1V2ST

Benzamidine in complex with bovine trypsin variant x(ssfi.glu)bt.d1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Understanding protein-ligand interactions: the price of protein flexibility
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
molecule keywords Trypsin
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2sT01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2sT02
1QB1A 1QNJA 2EI7A 1PPZA 4Y76A 7LPRA 2O8WA 4LZ4B 1A7SA 1P3CA 1H1BA 5F8XA 1FXYA 5DO4H 1IQMA 2VWOA 3E16B 3H7TA 2Z9JA 1KXCA 4O3UA 1O5FH 1HAXB 4AFUA 5CE1A 4DG4A 1UVUH 3KCGH 3K65B 4AN7A 3EA7A 1GBAA 2FP7B 5CHAC 4BTTB 3D49H 1T4UH 3ZV8A 5GIBA 2IPHA 3QGNB 1C2JA 3HGPA 1P9SA 1VITG 1ARBA 1FY5A 4X6PA 2VGCB 1XUKA 5FHTA 3SW2B 1GDUA 3PMAB 1GHYH 1H4WA 3GY8A 3LGIA 1TALA 2NWNA 3SU5A 3SNEA 1E36B 1P03A 4BANB 1P2QA 2FWWA 3E91A 4K60A 3SQHE 4THNH 2PSYA 2UWPA 1JBUH 1Y59T 2AS9A 3RU4D 1AVGH 1G3EA 1YPMH 1Z7KA 2R2MB 1C2EA 2DE9A 5LPEA 1AIXH 1SI5H 2TRMA 2BXUH 1MBMA 4YESB 3SNDA 1FN6A 1S6FA 1SGTA 4CH8B 1GI7B 1LVYA 3GOVB 3GY4A 2V3OH 1TNLA 4KELA 4GSOA 3ZVAA 1MUEB 2XC0A 3MTYA 1NTPA 3ZZ7A 4NIXA 1V2MT 1AZ8A 4GHQA 2ZGHA 2NU3E 5GXPA 3SJ8A 1XXFA 3F9FA 3RXDA 1P02A 5C5NA 1EOJA 1EJMA 2ESTE 5A8YA 1OSSA 4WWYA 1O3IA 1NFUA 1ZMJA 4Z6AH 2VWMA 2VVVA 3BTQE 1HJAB 3M5LA 1DT2A 2Q1JA 3ZVFA 3ZVDA 3TK5A 1EQ9A 3QUMP 1MTVA 1GJ8B 5A0AE 2JETC 2HVXA 4X8UH 1V2NT 1GHAG 5T3HA 2K1QA 1K28D 4QT8C 2O9QA 4OS6A 4WVPE 3EYDA 3EQ0H 1EUFA 1CHGA 3MU8A 1GJ4H 2UUYA 4ZAEA 5I25A 4XBCA 3T5FH 1C5XB 1QB6A 2B0FA 1EOLA 1ZOMA 1AFQB 5EXLA 4M7GA 3ZZ8A 1ZTKA 4DW2U 1MTSA 1FIZA 3SNCA 1P9UA 2ZEBA 1O2RA 3DFLA 1UK4A 4RSPA 4CRCA 3A7VA 2G55A 3MU0A 1OS8A 2PUQH 2AH4X 1VJ9U 2PSXA 1FPHH 3ZVGA 3PTBA 1YLDA 1CO7E 2UUKB 4X0WU 1MTNC 1CT0E 1UHBA 1Z8GA 3M7UA 3U69H 2AGIX 2G4TA 3KF2A 3SNAA 1AO5A 3E0NB 1L4DA 4XSKU 2GMTC 1GBFA 3MH7A 4HTCH 1P01A 1B0EA 1FN8A 3BEUA 3GYMA 1PPGE 2J2UA 1T8MA 2TGPZ 4NWLA 1WTHD 1C1WH 5BRRE 4X1SU 5EPYA 1D9IA 3GY3A 3A8BA 1C2HA 2BDCA 4ZXYH 1BCUH 3GCHC 1C2KA 1UCYK 1AZZA 2ANWA 2Y6TA 3L33A 5TCCA 2G5VA 2HLCA 5J4SA 4B75A 2BOHB 1LQDB 1VCPA 5EQRA 2FTLE 4AX9H 5EPNA 3TH3H 2GD4B 2I6QA 5JDUB 3TGKE 2D26C 1B5GH 1FAKH 2BQ7B 2Y80A 2ZF0H 1IQKA 4H42U 5F6MA 1YM0A 1WYKA 1LVMA 2HGTH 1D6RA 1N8OC 1KSNA 5TCAA 3A7XA 2BY7X 1LPKB 2CV3A 2PHBA 1P06A 5TJXA 2ZGXH 1ELAA 5A0BA 2VNTA 1Y3VA 1HIAA 3ZZ4A 1C1PA 3RXJA 5E2PA 4I8GA 1SVPA 2PGBB 1FAXA 2GDDA 3LGWA 5JBAS 3ZZ3A 3HGNA 3RMMH 2A32A 2I6SA 1WQVH 4HGCA 2A7HA 3STJA 1ELTA 1O38A 1HDTH 4XBDA 2V6NA 1E0FD 3VB5A 1D3QB 3UNRA 4Q7ZA 4KP0A 2GZ7A 5A8XA 2OQUA 4U32A 4I7YH 1VCWA 2LNCA 1JRTA 3LONA 2FOGA 4JYTA 3GICB 1DWEH 5DP6A 2A4RA 1C1SA 1V2PT 1O3MA 1GBJA 1GHXH 3UNSA 1GMDF 2Q6GA 2OBOA 2VGCC 2AGEX 2VU8E 1P2JA 3QO6A 3SU1A 1CGHA 1AB9B 1MKXK 2CHAC 2R9PA 4R0IA 4JYVH 3F68H 1S6HA 3GCTG 1O2XA 5FCRA 1ESBA 1O2JA 1KDQA 1LMWB 3RMNH 2QXHA 1HAZB 1LO6A 2G81E 3LH1A 3UTUH 1NS3A 3UNQA 3SHAH 1VITF 4IS5A 1NROH 5HYOA 3SOSA 1SFIA 2ZGCA 4OS1A 1GVLA 1GCTB 4ZUHA 5C1XA 3U8RH 4YT7H 3E1XB 2F9NA 2HNTC 2WYGA 1SG8B 1LHCH 3BTEE 4ASHA 1MD8A 3GYLB 2HPPH 1QA0A 2A4OA 1TGBA 4E05H 3QZQA 1YCPM 1V2TT 5F03A 2XBWA 1G2LA 1H9IE 2Z6BD 3VB6A 2AMQA 1DX5M 1O0DH 1QL9A 4ZKNU 3ESTA 1C5QA 3TH4H 3T27A 2VINA 3PMBB 4NFFA 2XC5A 4IGDA 2R0KA 2JKHA 2WPMS 1G3BA 2ANKH 1TBQH 3F6UH 1AD8H 1P3EA 2QC2A 1C1TA 4ABJA 3UR9A 1C5LH 1YPGH 3LJJA 2P94A 4KTSA 3K6ZA 5L6NH 4DJZB 1SGYE 1W7XH 2W26A 1TRNA 2BLOA 2CGAA 2ZTYA 3BV9B 4X8SH 1D3PB 2FZZA 1QQ4A 1KLIH 4AG1A 1IHSH 2THFB 1PQ7A 4NIYA 1G2MA 1SSXA 2VB0A 1SHHB 2XC4A 1AI8H 1TNJA 2Q6FA 2STAE 2ZWLH 5DKMA 1HAYB 4A92A 2GMTB 3A7ZA 1C5YB 1FNIA 4TWWA 5GCHG 4AFQA 1ABJH 1LDTT 3ITIA 2P8OB 2ZFPH 1W8BH 4MNYA 3AAVA 2GP9B 2BDYA 1UK2A 1P10A 3MI4A 3MFJA 1TWXB 3UOUA 3D23A 2QYIA 1VITH 4FXGH 2PR3A 1HAOH 1F5LA 2FM2A 4YOGA 4IMZA 4O03A 3T62A 3W95A 3BTFE 1BBRK 2OCVB 1UVSH 4HZHA 1BBRH 1TGSZ 2XBVA 3S7HB 2A4GA 1TABE 3BEIB 4CRDA 1F0SA 1HUTH 1LQEA 1WQSA 2W7UA 2JH0D 4AYYB 3ZZDA 1SBWA 5DPAA 3SU6A 4JK5A 2OUAA 3SGQE 1QJ6B 3OY6U 1MTUA 6CHAB 4BTIB 4FU8A 4ISNA 3TK6A 1UCYH 1EKBB 2FODA 4K3JA 4JMYA 4GVUA 1GJ7B 1DANH 1TMUH 4KKDA 2ZFRH 1G36A 1T4VH 1TQ0B 4Q7YA 1DLEA 1IQJA 4LK4A 2FYQA 1Y8TA 1C5SA 1A0HB 2Z3CA 1NPMA 3STIA 5DP4A 4B2AA 4MPVA 2BLWA 5E0JA 1GJDB 1N6YA 5ESTE 4JZ1A 1OX1A 2J4IA 1AHTH 4GAWA 2ZQ1A 1NRPH 1SL3A 1O2GH 2PTNA 5PTPA 1A61H 2F9PA 5DP7A 1O2IA 1ZHRA 1O30A 1QURH 1K1LA 1ZRKA 2NU2E 3VXEH 4Z0KA 2J95A 1NRSH 2GCHF 1UTJA 1K1MA 1TE0A 4Y0YE 3Q76A 2BOKA 1DOJA 4FUBA 1BTPA 1QQUA 1Q3XA 4I31A 3BSQA 1O2QA 1RXPA 2AMDA 1F2SE 4AYVB 1CGIE 1L1GA 3A85A 4DVAU 1W13U 1AN1E 3A8CA 3CENA 4O9VA 4CR5A 1UMAH 1JMOH 2PW8H 1V2JT 2BD2A 4UFFH 3QWCH 3NCLA 1WU1A 2VIPA 1CBWB 3GDVA 1QRZA 1C5RA 4IN1A 4RN6A 2QCYA 2ZZUH 1EPTA 4WXIA 1ELBA 1HJAC 1A46H 1O5BB 3AAUA 2UWLA 4Q7XA 1GGDB 4GUXA 1O2TA 1RJXB 2VIDA 1JIMA 5E0HA 1ZHPA 2XBYA 1PPFE 1ID5H 5FXLA 1QRWA 4MPXA 1O35A 2NU1E 1PFXC 1UCYE 1V2LT 1P09A 1EASA 1RFNA 1Z1IA 4H6SB 4CRFA 2PLXA 1S0QA 5HM9A 1O3LA 1BJVA 1B7XB 1EAXA 2CXVA 2BD4A 1AKSB 1YCPK 1GJ9B 3F1SB 4A6LA 1CA0C 3VGCC 1ZZZA 4NWKA 2FDAA 1BBRE 1G3DA 1J14A 2WV4A 3SBKA 1BTXA 1P2MA 1TPSA 4WMFA 1GHAF 2BDHA 2F9UA 1YF4A 2ASUB 4X8VH 3SI4H 4KTUA 3SUFA 4D76A 3R3GB 1FJSA 2O8UA 5HMAA 4B1TA 3KL6A 1P57B 3UUZA 2SGFE 4FUDA 1A5GH 1KDQB 1X7AC 1HFDA 1ANDA 1DFPA 3K9XB 4MQAA 1MQ5A 3KEEA 5A2MH 1WCZA 3T29A 1O2WA 2FOMB 1WSSH 1IHTH 3RM2H 1PPCE 1AU8A 2F9VA 5FX6A 4H6TA 1L2EA 2ZHWH 3O8RA 4K2YA 2OD3B 1BJUA 1FMGA 3MHWU 4I33A 4WY3A 1YLCA 4ZXXH 1AMHA 1P2IA 4ZHLU 1BRCE 1HAHH 1QGFA 1UTLM 1ELVA 1LCYA 1WAYB 4B73A 3VXFH 2GX4A 3B23B 1BMLA 1BRAA 3M5MA 3ZYDA 1GBHA 3OY5U 3FVFB 1O2YA 1HBTH 1W2KH 2VIVA 1LTOA 2Y5HA 1XX9A 2DE8A 4IW4E 4LZ1H 1UTOA 5LPRA 3E3TA 5JBBS 2XNIA 1DSUA 4X2WA 2A5IA 1EZQA 1RD3B 4X2VA 1LHFH 4WF8A 5FAHA 4CHAC 2FTMA 3URDA 1DY8A 4K1TA 1HIAB 2ZDLA 1WBGB 2GCTB 1YPJH 3JZ2B 5CMXH 4DURA 3LKWA 1THSH 3O8DA 2BD5A 3QLPH 2XXLA 3BF6H 3RXGA 3TK9A 3RXMA 4FUGA 2A7JA 2VIOA 1MH0A 5EXMA 1O2NA 1CU1A 1Y5UT 2XW9A 2C8YB 5DP8A 1ZJKA 1EPTC 4VGCC 4AORA 1FIWA 1C5OH 3BTGE 1CT4E 1GMHG 2QF0A 5DG6A 3SNBA 1BOQA 3ATIA 4JZEH 1O2HA 2RA0A 3RUOA 1DWBH 2SGAA 2G5NA 1NN6A 1EJAA 4KTCA 2Z9GA 2ZHFH 2ZKSA 3BG8A 1EATA 2J34A 2Z7FE 4ISLA 4ABEA 1OWEA 2D1JA 4K5ZA 1SFQB 3GY5A 1C4Y2 4ZKRU 1OYQA 1GMDG 3M61U 5C1UA 4B71A 3MNBA 5AVDA 1C9PA 2EC9H 3KQBA 1TOMH 1GI5A 1SOZA 1UTNA 2ANMH 1Z8RA 2BMGB 1HCGA 4ABIA 4NG9H 2BX3A 1T8OA 2A7CA 3RXBA 2VJ1A 3SUDA 1MD7A 3UOPA 4I32A 3EDXB 1AGJA 2EI6A 1XXDA 5FX5A 3L6PA 3M37A 5JB9S 1W11U 2ILNA 2XRCA 3F9EA 3MH5A 2ZHEH 3PLKA 1VCQA 1O5GH 3NUMA 4FUCA 3H5CB 3S0NA 3SJKA 3K6YA 3SJIA 1QJ7B 1XM1A 4X1NU 5DP5A 1INCA 3MYWA 1CBWC 5FPSA 1KTSB 2WPKS 1TBZH 4ZKSU 3M7TA 5GJ4B 5EW2H 1IQIA 3MH4A 1G32B 1O3DA 2Y81A 1C5TA 1IQHA 1C5NH 3KHVA 3PLPA 1J15A 1O3KA 2KAIA 2OTVA 5AFZH 3C27B 4JK6A 2BB4A 2ZGBH 2AFQB 1NO9H 2R3YA 2YOLA 3BIVH 4FVDA 3UQOA 4YLQH 2H5CA 1EJNA 1QA7A 4I8HA 1DXPA 3HPTB 5AHGH 3RXPA 4Q80A 1DE7H 2BDAA 5FPYA 1DWDH 4AB8A 3K2UA 1A0JA 4GCHF 1KXBA 1OPHB 1CA0B 3VGCB 1K22H 2PGQB 1GI2A 3QTVH 2TGAA 1C2DA 4JZDH 3TGJE 3GDSA 2A5KA 2GTBA 3NKKA 1C4U2 3VB7A 1YCPH 1YPHC 1EZSC 1LHGH 3HK6B 3MU4A 3RM0H 1MQ6A 1SMFE 1ZPBA 2PKSC 2ZO3H 5GCHF 1DDJA 1GG6B 1BTUA 1S83A 1NU9A 3TJNA 1MMJN 3ODDA 3MWIU 1JXPA 3LC3A 3RXIA 2FESH 3F9GA 2F9BH 2QY0B 3PO1C 4D7GA 1KXDA 5HXFA 3R0FA 4DIHH 5K0HA 1SQOA 1ZMLA 3SQEE 1TAWA 3MOCA 1MKWH 4TYDA 5CHAB 1T8LA 1HPGA 1BITA 4NZQA 3GY7A 1S82A 2HRVA 1EZXC 1BTHH 3RU4T 3H7OA 1TNGA 1YPHE 1O3PB 3RXAA 2G00A 3BTHE 3VB3A 3ATLA 4OS5A 3RXTA 2Y5FA 1RTKA 5LPFA 4NCYA 3T26A 1SPJA 2HALA 3E90B 1O33A 7GCHG 1O2PA 5GPIB 3SUEA 2ZHDA 1VGCC 1C9TA 3FFGA 1WUNH 1LPGB 1KY9A 3RC6A 1ANEA 1F5RA 3M5NA 3RMLH 2EA3A 1GJAB 1Y5BT 1DSTA 1MCTA 1P2OA 1BMAA 2BY6X 4UFEH 1TX6A 2GZ8A 1BDAA 4UFGH 1SQTA 1NU7B 4BAHB 2O8MA 3HKJB 5AFYH 2IN2A 3A86A 3BTKE 3M5OA 4NA7A 1JWTA 5EQQA 4YM9A 1T7CA 3MNXA 2C4FH 1BA8B 1O5EH 1P11E 1TMTH 1ZTJA 1O2VA 2BXTH 5L2YH 4OS7A 1QR3E 1ZSJA 2XWAA 3CS0A 1OKXA 1A2CH 3RC5A 3D62A 1P04A 2AERH 4BXSA 2ALPA 1WOFA 1KIGH 3OTJE 1L4ZA 2OC1A 1DUAA 1XUGA 1K1NA 3A83A 1O5CB 4NSYA 3FP7E 1MZAA 1CGJE 1ORFA 1YPEH 3FP6E 1EP6A 5T6DA 3LPRA 1P05A 4WMEA 1NM6A 3V0XA 1CHOG 1P0SH 3AASA 1NFYA 1QCPA 1CVWH 1JRSA 1FDPA 1V2RT 2ZA5A 5A09A 3SZNA 3OYPA 1A1RA 1C2IA 5LH8A 3TGIE 1RS0A 1NESE 2SGPE 4AG2A 4NIWA 2G52A 1F7ZA 1B0FA 1P12E 3GY6A 9ESTA 4RKJB 3KGPA 1MU8B 4X1QU 4CRBA 1HAPH 4SGAE 4XBBA 1GHBG 5L30H 3LU9B 3Q3YA 5EODA 1BZXE 2G4UA 3MH6A 1SGPE 1U6QA 1A5IA 1KLTA 3TITA 3M35A 3BG4C 2ZCLP 2FMJA 1QRXA 2QAAA 1OP8A 1MTNB 1TNHA 2NU4E 3SU0A 1KXAA 4YT6H 1MBQA 1WV7H 2ZI2H 3TU7H 4U01A 4BOHA 1SB1H 3A80A 3NWUA 3V3MA 1V2QT 1SLXB 4Y7AA 1GMCG 4JCNA 2P95A 1EAUA 1C5UA 1T32A 5DP3A 3QX5H 3ZZCA 4MVNA 1C1QA 4GHTA 1SGEE 1HAVA 1QBOA 3A88A 2BY8X 1AVWA 3QGJA 3KQEA 3A87A 2H9HA 1D6WA 1A3EH 2ZDMA 4MNXA 5T6FA 5DK1A 4DIIH 9LPRA 1FUJA 1VR1H 4DGJA 1NFXA 3ZVCA 1Y5AT 3ATWA 1HAGE 1BUIA 5E2OA 1HLTH 1V3XA 4TPIZ 4Y6DA 4D7FA 1S84A 1BHXB 1XUJA 5E8EH 1OP2A 2J94A 2TPIZ 1G9IE 2H9TH 3HKIB 1C5PA 4GPGA 3RXEA 1MAXA 4YTAA 3TPIZ 2VH6A 3I78A 5A8ZA 1G37A 4X1PU 3SU4A 1FPCH 2W3IA 5JB8S 1IQEA 3PM3A 3RXQA 1C5ZB 2FLRH 3PB1E 1E37B 3PWBA 1PQ8A 4UONA 1GI4A 2AIPA 2SGQE 1BMNH 1HRTH 2BDIA 1O3BA 3KQCA 1V2UT 1SQAA 2UUFB 3QK1A 1Y3UA 1O36A 2Z9LA 3QTOH 1O32A 2STBE 4WJG2 2R2WU 1GJ6A 1GBKA 2ZFFH 1C4V2 2VH0A 2EEKA 2VIWA 1BQYA 1SLWB 1NY22 2GCHG 1V2ST 2Q6DA 1W10U 4CRGA 1YKTA 4X6NA 8LPRA 3IITA 5C20A 1JOUB 1GI9B 2GV7A 2A2XH 1Y3XA 2CJIA 1KXEA 1O34A 3EAJA 2YNBA 2FPZA 1CE5A 4X6OA 1FLEE 5C3NA 3V7TA 1ETSH 1UVTH 1TPAE 2H5DA 1V2VT 2EI8A 5EXNA 2PKAB 2JETB 2H2ZA 3QN7A 7KMEH 4GCHG 1GJ5H 3ZVBA 3AVZA 1V2KT 4CH2B 3PWCA 4IMQA 1ZJDA 1SGFA 3DFJA 1J17T 1DPOA 3P8FA 2TIOA 5GDSH 2WV5A 3JZ1B 1GDNA 1GMHF 2ZDAH 2P3UB 1GI6A 2RDLA 4ABHA 3SV9A 1W0ZU 1E35B 1UHBB 4E7NA 2ODYB 3EA9A 3M3SA 3P8GA 1ANCA 2GT7A 1C2FA 4ABGA 2BX4A 3A84A 1W7GH 4OGXA 5FPTA 1TA6A 3SHCH 1RGQA 1NT1A 1GPZA 4NA8A 4CBOA 3TLOA 2FI5E 2F9OA 4ESTE 5FBIA 1GBCA 1LPZB 3FAOA 2SNVA 4B2CA 1AWHB 2AEIH 1O3NA 2VIQA 4ZHAA 2BLVA 3A7YA 3TVJB 3GCHB 1QFKH 3DT0H 4LOYH 3ELAH 1SR5C 4NA9H 2GCTC 4A1TA 1P8VC 1YBWA 1ABIH 2ZHQH 4XFQA 1UTQA 2ZPSA 1AB9C 1LVOA 2CHAB 1C2MA 2B7DH 4JZIA 3Q77A 1UVOA 2AGGX 3ZVEA 1DLKB 2A1DB 2GKVE 1EP5A 1O3JA 2IOTA 3SO3A 3RXFA 1UVPA 2WPJS 4D8NA 2ZPRA 1TMBH 2LPRA 1RIWC 3OSYA 2BDBA 5C67A 1RTFB 5SGAE 3F9HA 3SV7A 2BVSH 1PQ5A 1UO6A 1GCTC 1NRNH 1GBDA 2Y7ZA 3TNTA 1HV7A 5FBEA 2XWBI 4ABBA 1ESAA 5E0GA 3MU5A 4AZ2B 3I29A 4TY6A 1DXWA 1FONA 4INLA 3PMHB 2XTTB 2Y5GA 2V3HH 2Y82A 3U1JB 4YZUA 4OGYA 2XCNA 2PWXA 1OWDA 1TNKA 1Z8JB 2BD8A 4U30A 4MTBA 1O3FA 3U9AH 1ZSKA 3E0PB 2ZDVH 1M9UA 3VEQB 3GCOA 1TFXA 3ZZ9A 1RIWB 5FCKA 4Y10E 2HOBA 2C93B 1GHVH 1AE8H 3LGYA 2ZG0H 1ELDE 2F3CE 2WINI 2Y7XA 4H4FA 1F0TA 1HJ9A 1C1NA 4HI3A 3BTDE 4RKOB 2OQ5A 4YO9A 4WH6A 3URCA 1QJ1B 3U98H 3RLWH 2C3SA 1FV9A 7ESTE 3P17H 4NSVA 3B8JA 4ABDA 2ZU4A 1VGCB 2ZU1A 2P16A 1PPEE 2P93A 1C1VH 3KNXA 2BD3A 3LDXH 1DUEA 1XVMA 1E38B 2ANYA 4ISHH 4AB9A 2SNWA 4Y8XA 4K69A 2O8TA 6GCHF 2OC7A 5JBCS 1YGCH 2OP9A 1VZQH 2QGRA 1O2OA 2SFAA 4AFZA 2G8TA 1TRMA 3PMJA 3ZZ6A 4UDWH 4BAKB 2H1UA 3RU4E 2F83A 2FYRA 1W12U 4K1SA 4BAQB 5DP9A 1N8OB 3MO3A 2ZIQH 5HGGA 5EG4A 1J16A 2ZFSA 2CMYA 1RTLA 1OXGA 1C1UH 4FUHA 4Y79A 2QF3A 1XUFA 1GHWH 2OINA 1P2NA 1UTMA 3DHKH 4FUIA 2FS8A 3S9BA 3S9AA 1XVOA 2BY9X 1C2LA 3BTTE 1H8IH 1UJ1A 4D9RA 3V12A 5K7RA 2GZ9A 1OWJA 1MAYA 1C5VA 3FANA 1K2I1 5JYIA 3SGBE 1SGDE 4I8LA 3LC5A 1DICA 4F49A 1A5HA 2PTCE 2J9NA 3TNSA 1TGTA 2P8OC 3KN2A 1EB2A 1ELCA 2DUCA 2ZDKA 2BZ6H 2CF8H 2BM2A 3QDZB 1HAVB 3SU3A 1TPPA 1GBMA 4AGKA 1SGNE 5GWZA 3OX7U 1NZQH 4CRAA 2AIQA 1SGIB 1LHDH 1C1RA 3KIDU 3M7QA 4MG3A 1C5MD 1GBTA 1EAIA 2BD7A 1IOEA 3FP8E 2V35A 4I8KA 2A2QH 1HAIH 2Z3EA 1NC6A 2Z3DA 2ODPA 3B9FH 2VVUA 5F8TA 4NZLA 1YPLH 2IJOB 1SC8U 1T8NA 1Z1JA 1AWFH 1EAWA 5AF9H 1O3EA 1MKXH 4MNVA 1N6XA 1O2ZA 1V2WT 2FX6A 5G4BA 4A7IB 4IC5A 1AY6H 3PLBA 3OU0A 1UTKA 4UD9H 3TH2H 1BB0B 1O3GA 1O2MA 3M3VA 5A0CA 6GCHG 3CP7A 1CT2E 3RP2A 2QN5T 3ENSB 3BIUH 3HK3B 4WMDA 1SGQE 1RRKA 4E7RG 1QHRB 1J9CH 5H4IB 4K8BA 3PTNA 3LOXA 2W3KA 4A5TS 1ZHMA 2D2DA 1O3CA 1AUTC 1BT7A 2GVFA 5DJ7A 1GI0A 1IQNA 3GCNA 2OLGA 3WY8A 4BAMB 1OWKA 2P3TB 3LT3A 1S0RA 3RXHA 1THPB 3T25A 3LGVA 5I46H 4FUFA 2HPQH 4CBNA 1TB6H 1G3CA 1GBBA 1GHBF 2QV1A 3Q3KA 1TGCA 1PQAA 3ODFA 1O2UA 2FOBA 4Y8ZA 4DCDA 3UPEA 6CHAC 3U8TH 5C5OA 1QY6A 1OWHA 1GJCB 3LGTA 3S69A 2JH6D 3E8LA 4DT7B 1MTWA 2ULLA 1E34B 2FS9A 3Q3XA 4FU9A 4Y0ZE 2H9EH 1AKSA 2OXSA 3RXKA 1NRQH 2ZU3A 3EE0B 1GI8B 2A31A 3UIRA 4ZROA 5EW1H 4CR9A 1K1IA 1TYNA 1TRYA 1A0LA 2OC8A 2RCEA 1ZYOA 1Z6EA 2TBSA 3KQDA 1GI3A 2A4QA 2BY5X 2ZU2A 1FI8A 3RMOH 1JIRA 2QIQA 5JBTA 3UWJH 2B9LA 4O97A 1YYY1 1D3TB 1CQQA 1S81A 2ZCKP 4JYUH 1A4WH 3PROA 1H8DH 3ZZAA 4MPWA 3E6PH 1HYLA 1BIOA 3TIUA 1IAUA 2ZC9H 1GGDC 3RXOA 1W0YH 5J4QA 4ABFA 4MNWA 3P8OA 1QBNA 1GCDA 2B5TB 6ESTA 3EA8A 2ZDNA 3PO1B 2ZU5A 4BNRA 1S5SA 3RC4A 3RDZA 2FOAA 4UEHH 2PKSB 3PV4A 3TJVA 3M3TA 4IN2A 1D4PB 4K1EA 4MPUA 2CF9H 1GI1A 2ZECA 1TA2A 3P95A 3I77A 1C1OA 1BTZA 3MO9A 3T2NA 4Y7BA 8KME2 1EXFA 2Z94A 2WPIS 1TONA 4I8JA 1BHXF 1OOKB 2O8LA 1SGCA 2A0QB 1FQ3A 1Q31A 1Z8IB 4AOQA 3MNCA 1HB0B 1DY9A 4B74A 1DS2E 1IQFA 1TPOA 1MZDA 1O3AA 1K21H 2D8WA 3A8DA 4ZKOU 5JPMH 1C1MA 1WTGH 4MLFB 4U2WA 3A81A 2ZNKH 4AFSA 3BTWE 4B76A 3N7OA 1DM4B 2GDEH 1ZR0A 2BHGA 4ABAA 1THRH 1Z71A 1HJ8A 2YNAA 1AFEH 1ZPZA 2A5AA 2PKAA 3LJOA 3LIWA 2FOEA 1AUJA 1GVZA 1XKBC 1SGRE 1TIOA 4X2XA 3ATKA 2ZFQH 1K1JA 2BQWB 1FY4A 2ODQA 1V6DA 1O37A 2UUJB 1O2KA 1K1OA 1BTYA 3RXVA 1K9OE 4YLUA 2PFEA 2FI3E 2FLBH 5ETXA 3TJUA 1AQ7A 1FZZA 4LXBH 4FVBA 1XUIA 1V2OT 2BZAA 3HATH 4D9QA 1CA8B 2WPLS 4HFPB 3ATMA 1ZSLA 4BXWA 3RXLA 1W3CA 2GV6A 1LHEH 4WXVA 2M5TA 2FOHA 3MNSA 1AVXA 1QL7A 3SU2A 5IDKA 1SLVB 3A7WA 3P70B 1GWAA 2ZFTA 4Q2KA 1Y3WA 1ELGA 2R3UA 1Y3YA 3SV6A 2ZP0H 2ZCHP 4Y71A 1XMNB 3NK8A 1O5DH 2XCFA 2J38A 1O39A 3M36A 3DA9B 1O31A 1SHYA 2FEQH 3VFEA 2FIRH 1GMCF 1ZRBA 1ANBA 1OWIA 1MU6B 3SORA 4MDSA 2C8WB 3EGKH 1Z6JH 3SJOA 1FY8E 4SGBE 2P59A 1A3BH 1F0UA 1F5KU 1LKAA 1TX8A 3SV2H 3GY2A 6LPRA 2QXJA 4Y11E 1ZMNA 4IC6A 2H6MA 1PYTC 4INHA 2KAIB 1ELEE 1EZUC 2AMPA 3NXPA 8GCHG 3O8BA 2BVRH 3VB4A 4Y8YA 1L0ZA 3SGAE 2JH5D 1GBIA 3UQVA 1AFQC 1QB9A 1ELFA 2Z9IA 1OYTH 5C2ZA 5F8ZA 4X1RU 1GBLA 1C5WB 2ZTZA 2RG3A 3BEFB 4BAOB 2ZPQA 1OP0A 1ZTLA 5EQSA 2XYAA 1SOTA 1F92A 4R8TB 3D65E 4UFDH 4ZH8A 3FZZA 1EX3A 4X8TH 1CHOF 3GDUA 2VWLA 1PJPA 2FXRA 2HNTE 3BTME 2BDGA 1QBVH 5IYTA 1XKAC 3MO6A 1QL8A 1PPHE 4FUEA 1O3OA 1TBRH 3NZIA 5HM2A 1L1NA 1O5AB 1DITH 3RLYH 2WUCA 4DY7B 4WH8A 1BRBE 5C1YA 3NPSA 3BN9A 1TLDA 1TGNA 1G30B 3C1KA 5EU8A 2WYJA 4NGAH 1NFWA 4ZMAH 1FY3A 3A7TA 2FX4A 1O3HA 3RXRA 2GGVB 8ESTE 1GHZA 5ABWA 2HNTF 3AW0A 3GISB 4K8YA 1GBEA 3AW1A 3MMGA 2W7SA 1ARCA 1YP9A 2BQ6B 1C2GA 1IQGA 1S85A 1SLUB 2OC0A 1AE5A 1MCVA 1ZGVA 2VVCA 4ISOA 3SV8A 2RA3A 4XDEA 1QIXB 2FO9A 3ZZ5A 2VWNA 1F0RA 1GG6C 3MU1A 3RXSA 3GCTF 3ZV9A 2TGDA 1CSOE 1LKBA 1VJAU 2CN0H 1L1JA 1T31A 1TQ7B 3LH3A 1NRRH 2FOCA 2PV9B 2UWOA 1PPBH 2QXIA 2WUBA 2QXGA 1KYNA 2ZTXA 1ZGIA 3O8CA 5BPEA 1O2LA 5DGJA 2C8XB 5LGOA 4PROA 4TWYA 1ETTH 3IG6B 3RXCA 2A45B 1KTTB 2TGTA 1BTWA 2QA9E 3RXUA 1GL1A 2NU0E 4JZFH 2FI4E 3FZDA 3ZYEA 3BG4B 2BYAX 2HWLB 2GT8A 1KLJH 1IQLA 2AYWA 4FU7A 3V13A 3U1IB 1EPTB 1HGTH 4VGCB 5L2ZH 7GCHF 1GL0E 4XOJA 1ETRH 1TOCB 2R0LA 3IWMA 4GLYA 1HNEE 1TX7A 2BD9A 1P2KA 3SJ9A 1ZLRA 3UR6A 1D3DB 1BRUP 1H9HE 1TNIA 3SUGA 4YOIA 2ZQ2A 3A82A 1O2SA 3DUXH 4A1VA 1SGFG 2F91A 3VPKA 2J92A 2W5EA 1DVAH 2PUXB 3T28A 4OS2A 1UK3A 2SGEE 3TJOA 1ACBE 5ESBA 4J1YA 4TPYA 1GDQA 1KXFA 8GCHF 3L3TA 1ZPCA 3P92A 1W14U 2Z9KA 4J2YB 5EOKA 3UREA 3ZZBA 2ZGJA 3U8OH 4NIVA 5B6OA 5T6GA 4CREA 1YC0A 2B8OH 1ESTA 4UE7H 1HXEH 3CS7A 1MKWK 3SI3H 2V0BA 2BTCE 3P8NA 3UFAA 2XBXA 1LVBA 2WPHS 4NFEA 4AGJA 1QTFA 4OS4A 4ZHMU 4X6MA 3W94A 1DWCH 1H9LB 3LGUA 4ISIH 2G51A 3S7KB 1FY1A 1N1LA 1XUHA 3SN8A 3QZRA 4IBLH 2C8ZB 3UY9A 1Q2WA 2SGDE 4F4OC 1J8AA 1UTPA 4XE4A 3PYHA 2P3FH 4FUJA 1BMMH 1HXFH 3UWIA 4YOJA 2ALVA 1GVKB 3A89A 3P6ZB 2OBQA 1YPKH 1PYTD 3G01A 2FOFA 4BTUB 4E06H 3Q00A 4DOQA 4X2YA 3A8AA 1GJBB 2BVXH 4B2BA 4KGAA 4A1XA 4O3TA 3DD2H 4CHAB 1K1PA 1EB1H 3S9CA 2C90B 4TY7A 5EGMA 4INKA 2BLQA
chains in the Genus database with same CATH superfamily
1QB1A 1QNJA 2EI7A 1PPZA 4Y76A 7LPRA 2O8WA 4LZ4B 1A7SA 1P3CA 1H1BA 4Z1MD 5F8XA 1FXYA 5DO4H 1IQMA 2VWOA 3E16B 3H7TA 2Z9JA 1KXCA 4O3UA 1O5FH 1HAXB 4AFUA 5CE1A 4DG4A 1UVUH 3KCGH 3K65B 4AN7A 3EA7A 3OAAD 1GBAA 2FP7B 5CHAC 4BTTB 3D49H 1T4UH 3ZV8A 5GIBA 2IPHA 3QGNB 2YMSD 1C2JA 3HGPA 1P9SA 1VITG 1ARBA 1FY5A 4X6PA 2VGCB 1XUKA 5FHTA 3SW2B 1GDUA 3PMAB 1GHYH 1H4WA 3GY8A 3LGIA 1TALA 2NWNA 3SU5A 3SNEA 1E36B 1P03A 4BANB 1P2QA 2KCPA 2FWWA 3E91A 3N7DA 4K60A 3SQHE 4THNH 2PSYA 2UWPA 3H09A 1JBUH 1Y59T 2AS9A 3RU4D 1AVGH 1G3EA 1YPMH 1Z7KA 2R2MB 1C2EA 2DE9A 5EJLA 5LPEA 1AIXH 1SI5H 2TRMA 2BXUH 1MBMA 4YESB 3SNDA 1FN6A 1S6FA 1SGTA 4CH8B 1GI7B 3DCLA 3AK5A 1LVYA 3GOVB 3GY4A 2V3OH 1TNLA 4KELA 3N7EA 4GSOA 3ZVAA 1MUEB 2XC0A 3MTYA 1NTPA 3ZZ7A 4NIXA 1V2MT 1AZ8A 4GHQA 2ZGHA 3F2HA 2NU3E 5GXPA 3SJ8A 1XXFA 3F9FA 3OE7D 3RXDA 1P02A 5C5NA 1EOJA 1EJMA 1COWD 2ESTE 5A8YA 1OSSA 4WWYA 1O3IA 1NFUA 1ZMJA 4Z6AH 2VWMA 2VVVA 3BTQE 1HJAB 3M5LA 1DT2A 2Q1JA 3ZVFA 3ZVDA 3TK5A 1EQ9A 3F2FA 3QUMP 1MTVA 1GJ8B 5A0AE 2JETC 2HVXA 4X8UH 1V2NT 1GHAG 5T3HA 2K1QA 1K28D 4QT8C 2O9QA 4OS6A 4WVPE 3EYDA 3EQ0H 1EUFA 1CHGA 3MU8A 1GJ4H 2UUYA 4ZAEA 5I25A 4XBCA 3T5FH 1C5XB 1QB6A 2B0FA 1EOLA 1ZOMA 1AFQB 5EXLA 4M7GA 2KCOA 3ZZ8A 1ZTKA 4DW2U 1MTSA 1FIZA 3SNCA 1P9UA 2ZEBA 1O2RA 3DFLA 1UK4A 4RSPA 4CRCA 3A7VA 2G55A 3MU0A 1OS8A 2PUQH 2AH4X 1VJ9U 2PSXA 1FPHH 3ZVGA 3PTBA 1YLDA 1CO7E 2UUKB 4X0WU 1MTNC 1CT0E 1UHBA 1Z8GA 3M7UA 3KYFA 3U69H 2AGIX 2G4TA 3KF2A 3SNAA 1AO5A 3E0NB 1L4DA 4XSKU 2GMTC 1GBFA 3MH7A 2JDID 4HTCH 3GS9A 1P01A 1B0EA 2YMSB 1FN8A 3BEUA 2JJ1D 3GYMA 1PPGE 2J2UA 1T8MA 2F4LA 2TGPZ 4NWLA 1WTHD 1C1WH 4B6EA 5BRRE 4X1SU 5EPYA 1D9IA 3GY3A 4AC9A 3A8BA 1C2HA 2BDCA 4ZXYH 1BCUH 3GCHC 1C2KA 1UCYK 1AZZA 2ANWA 2Y6TA 3L33A 5TCCA 2G5VA 2HLCA 5J4SA 4B75A 2BOHB 4P02A 1LQDB 1VCPA 5EQRA 2FTLE 4AX9H 5EPNA 3TH3H 3F0PA 2GD4B 2I6QA 5JDUB 3TGKE 2D26C 1B5GH 1FAKH 2YMSC 2BQ7B 2Y80A 2ZF0H 1IQKA 4H42U 5F6MA 4P00A 1YM0A 1WYKA 1LVMA 2HGTH 1D6RA 1N8OC 1KSNA 2JJ2D 5TCAA 3A7XA 2BY7X 1LPKB 2CV3A 2PHBA 1P06A 5C0UA 5TJXA 2ZGXH 1ELAA 4RT0A 5A0BA 2VNTA 1Y3VA 1HIAA 2IJD1 3ZZ4A 1C1PA 3RXJA 4YXWD 5E2PA 5C0TA 4I8GA 1SVPA 2PGBB 1FAXA 2GDDA 3LGWA 5JBAS 3ZZ3A 3HGNA 3RMMH 2A32A 2I6SA 3U28C 1WQVH 1W0KD 4HGCA 1OHHD 2A7HA 3STJA 1ELTA 1O38A 1HDTH 4XBDA 2V6NA 1E0FD 3VB5A 1D3QB 3UNRA 4Q7ZA 4KP0A 2GZ7A 5A8XA 2OQUA 4U32A 4I7YH 1VCWA 2LNCA 1JRTA 3LONA 3VG8A 2FOGA 4ZCNA 4JYTA 3GICB 1DWEH 5DP6A 1H8ED 2A4RA 1C1SA 1V2PT 1O3MA 1GBJA 1GHXH 3UNSA 1GMDF 2Q6GA 2OBOA 2VGCC 2AGEX 1P2JA 2VU8E 3QO6A 3SU1A 1CGHA 1AB9B 1MKXK 2CHAC 2LELA 2R9PA 4R0IA 1W0JD 4JYVH 3F68H 1S6HA 3GCTG 1O2XA 5FCRA 1ESBA 1O2JA 1KDQA 1LMWB 3RMNH 2QXHA 1HAZB 1LO6A 2G81E 3LH1A 3UTUH 5HIYA 1NS3A 3UNQA 3SHAH 1VITF 4IS5A 1NROH 5HYOA 3SOSA 1SFIA 2ZGCA 4OS1A 1GVLA 1GCTB 4ZUHA 5C1XA 3U8RH 1WXRA 4YT7H 3E1XB 2F9NA 2HNTC 2WYGA 1SG8B 1LHCH 3BTEE 4ASHA 1MD8A 3GYLB 2HPPH 1QA0A 2A4OA 1TGBA 4E05H 3QZQA 1YCPM 1V2TT 5F03A 2XBWA 1G2LA 1H9IE 2Z6BD 3VB6A 2AMQA 1DX5M 1O0DH 1QL9A 4ZKNU 3ESTA 1C5QA 3TH4H 3T27A 2VINA 3PMBB 4NFFA 2XC5A 4IGDA 2R0KA 2JKHA 2WPMS 1G3BA 2ANKH 1TBQH 3F6UH 1AD8H 1P3EA 2QC2A 4FETA 1C1TA 4ABJA 3UR9A 1C5LH 1YPGH 3LJJA 2P94A 4KTSA 3K6ZA 5L6NH 4DJZB 1SGYE 1W7XH 4F55A 2W26A 1TRNA 2BLOA 2CGAA 2ZTYA 3BV9B 4X8SH 1D3PB 2FZZA 1QQ4A 1KLIH 4AG1A 1IHSH 2THFB 1PQ7A 4NIYA 1G2MA 1SSXA 2VB0A 1SHHB 2XC4A 1AI8H 1TNJA 2Q6FA 2STAE 2ZWLH 5DKMA 1HAYB 4A92A 2GMTB 3A7ZA 1C5YB 1FNIA 4TWWA 5GCHG 4AFQA 1ABJH 1LDTT 3ITIA 2P8OB 2ZFPH 3PV2A 1W8BH 4MNYA 3AAVA 2GP9B 2BDYA 5IK2D 1UK2A 1P10A 3MI4A 3MFJA 1TWXB 3UOUA 3D23A 2QYIA 1VITH 4FXGH 2F43B 2PR3A 4FOUC 1HAOH 1F5LA 2FM2A 4YOGA 4IMZA 3DSOA 4O03A 3T62A 3W95A 3BTFE 1BBRK 2OCVB 1UVSH 4HZHA 1BBRH 1TGSZ 2XBVA 3S7HB 2A4GA 1TABE 3BEIB 4CRDA 1F0SA 1HUTH 1LQEA 1WQSA 2W7UA 2JH0D 4AYYB 2GJGA 5KGOA 1SBWA 3ZZDA 5DPAA 3SU6A 4JK5A 2OUAA 3SGQE 1QJ6B 3OY6U 1MTUA 6CHAB 4BTIB 4FU8A 4ISNA 3TK6A 1UCYH 1EKBB 2FODA 4K3JA 4JMYA 4GVUA 1GJ7B 1DANH 1TMUH 4KKDA 2ZFRH 1G36A 1T4VH 1TQ0B 4Q7YA 1DLEA 1IQJA 4LK4A 2FYQA 2JIZD 1Y8TA 1C5SA 1A0HB 2Z3CA 1NPMA 3STIA 5DP4A 4B2AA 4MPVA 2BLWA 5E0JA 1GJDB 1N6YA 2M2AA 5ESTE 4JZ1A 1OX1A 2J4IA 1AHTH 4GAWA 2ZQ1A 1NRPH 1SL3A 1O2GH 2XOKD 2PTNA 5PTPA 1A61H 2F9PA 5DP7A 1O2IA 1ZHRA 1O30A 1QURH 1K1LA 1ZRKA 2NU2E 3VXEH 4Z0KA 2J95A 1NRSH 2GCHF 1UTJA 1K1MA 1TE0A 4Y0YE 3Q76A 2BOKA 1DOJA 4FUBA 1BTPA 1QQUA 1Q3XA 4I31A 3BSQA 1O2QA 1RXPA 2AMDA 1F2SE 4AYVB 1CGIE 1L1GA 3A85A 4DVAU 1W13U 1AN1E 3A8CA 3CENA 4O9VA 4CR5A 1UMAH 1JMOH 2PW8H 1V2JT 2BD2A 4UFFH 3QWCH 3NCLA 1WU1A 2VIPA 1CBWB 3GDVA 1QRZA 1C5RA 4IN1A 4RN6A 2QCYA 2ZZUH 1EPTA 4WXIA 1ELBA 1HJAC 1A46H 1O5BB 3AAUA 2UWLA 4Q7XA 1GGDB 4GUXA 1O2TA 1RJXB 2VIDA 1JIMA 5E0HA 1ZHPA 2XBYA 1PPFE 1ID5H 5FXLA 1QRWA 4MPXA 1O35A 2NU1E 2KCYA 1PFXC 1UCYE 1V2LT 1P09A 1EASA 1RFNA 1Z1IA 4H6SB 4CRFA 2PLXA 1S0QA 5HM9A 1O3LA 1BJVA 1B7XB 1EAXA 2CXVA 5EIYA 2BD4A 3UAIC 1AKSB 1YCPK 1GJ9B 3F1SB 1E79D 4A6LA 1CA0C 3VGCC 1ZZZA 4NWKA 2FDAA 1BBRE 3OEHD 3KQ5A 1G3DA 1J14A 2WV4A 3SBKA 1BTXA 1P2MA 1TPSA 4WMFA 1E1RD 1GHAF 2BDHA 2F9UA 1YF4A 2ASUB 4X8VH 3SI4H 4KTUA 3SUFA 4D76A 3R3GB 1FJSA 2O8UA 5HMAA 4B1TA 3KL6A 1P57B 3UUZA 2SGFE 4FUDA 1A5GH 1KDQB 1X7AC 1HFDA 1ANDA 1DFPA 3K9XB 4MQAA 1MQ5A 3KEEA 5A2MH 1WCZA 3T29A 1O2WA 2FOMB 1WSSH 1IHTH 3RM2H 1PPCE 1AU8A 2F9VA 5FX6A 4H6TA 1L2EA 4RT1A 2ZHWH 3O8RA 4K2YA 2OD3B 1BJUA 1FMGA 2J98B 3MHWU 4I33A 4WY3A 1YLCA 4ZXXH 1AMHA 1P2IA 4ZHLU 1BRCE 1HAHH 1QGFA 1UTLM 1ELVA 1LCYA 1WAYB 4B73A 3VXFH 2GX4A 3B23B 1BMLA 1BRAA 3M5MA 3ZYDA 1GBHA 3OY5U 3FVFB 1O2YA 1HBTH 1W2KH 2VIVA 1LTOA 2Y5HA 1XX9A 2DE8A 4IW4E 4LZ1H 3DSPA 1UTOA 3FKSD 5LPRA 3E3TA 5JBBS 2XNIA 1DSUA 4X2WA 2A5IA 2HVYB 1EZQA 1RD3B 4X2VA 1LHFH 4WF8A 5B6LA 5FAHA 4CHAC 2FTMA 3URDA 1DY8A 4K1TA 1HIAB 2ZDLA 1WBGB 2GCTB 1YPJH 3JZ2B 5CMXH 4DURA 3LKWA 1THSH 3O8DA 2BD5A 3QLPH 2XXLA 3BF6H 3RXGA 3TK9A 3RXMA 4FUGA 2A7JA 2VIOA 1MH0A 5EXMA 1O2NA 1CU1A 1Y5UT 2XW9A 2C8YB 5DP8A 1ZJKA 3PRBA 1EPTC 2V3MA 4VGCC 4AORA 1FIWA 1C5OH 3BTGE 1CT4E 1GMHG 2QF0A 5DG6A 3SNBA 1BOQA 3ATIA 4JZEH 1O2HA 2RA0A 3RUOA 1DWBH 2SGAA 2G5NA 1NN6A 1EJAA 2L74A 4KTCA 2Z9GA 2ZHFH 2ZKSA 3BG8A 1EATA 2J34A 2Z7FE 4ISLA 4ABEA 1OWEA 2D1JA 4K5ZA 1SFQB 3GY5A 1C4Y2 4ZKRU 1OYQA 1GMDG 3M61U 5C1UA 4B71A 3MNBA 5AVDA 1C9PA 2EC9H 3KQBA 1TOMH 1GI5A 1SOZA 1UTNA 2ANMH 3MQKC 1Z8RA 2BMGB 2W6ID 1HCGA 4ABIA 4NG9H 2BX3A 1T8OA 2A7CA 3RXBA 2VJ1A 3SUDA 1MD7A 3UOPA 4I32A 3EDXB 1AGJA 2EI6A 1XXDA 5FX5A 3L6PA 3M37A 5JB9S 1W11U 2ILNA 2XRCA 3F9EA 3MH5A 2ZHEH 3PLKA 1VCQA 1O5GH 3NUMA 4FUCA 3H5CB 3S0NA 3SJKA 3K6YA 3SJIA 1QJ7B 1XM1A 4X1NU 5DP5A 1INCA 5KECA 3MYWA 1CBWC 5FPSA 4ACBA 1KTSB 2WPKS 1TBZH 4ZKSU 3M7TA 5GJ4B 5EW2H 1IQIA 3MH4A 1G32B 3OEED 1O3DA 2Y81A 1C5TA 1IQHA 1C5NH 3KHVA 3PLPA 1J15A 2OTVA 1O3KA 2KAIA 5AFZH 3C27B 4JK6A 2BB4A 2ZGBH 2AFQB 1NO9H 2R3YA 2YOLA 3BIVH 4FVDA 3UQOA 3OFND 4YLQH 2H5CA 1EJNA 1QA7A 4I8HA 1DXPA 3HPTB 5AHGH 4I86A 3RXPA 4Q80A 1DE7H 2BDAA 5FPYA 1DWDH 4AB8A 3K2UA 4Q4LA 1A0JA 4GCHF 1KXBA 1OPHB 1CA0B 3VGCB 1K22H 2PGQB 1GI2A 3QTVH 1K0HA 3FO8D 2TGAA 1C2DA 4JZDH 3TGJE 3GDSA 2A5KA 2GTBA 3NKKA 1C4U2 3VB7A 1YCPH 1YPHC 1EZSC 1LHGH 3HK6B 3MU4A 3RM0H 3FOAA 1MQ6A 1SMFE 1ZPBA 2PKSC 2ZO3H 5GCHF 1DDJA 1GG6B 1UW7A 1BTUA 1S83A 1NU9A 3TJNA 1MMJN 3ODDA 3MWIU 1JXPA 3LC3A 3RXIA 2FESH 3F9GA 2F9BH 1BMFD 2QY0B 3PO1C 4D7GA 1KXDA 5HXFA 3R0FA 4DIHH 5K0HA 1SQOA 1ZMLA 3SQEE 1TAWA 3MOCA 1MKWH 4TYDA 5CHAB 1T8LA 1HPGA 1BITA 4NZQA 3GY7A 1S82A 2HRVA 3FN8A 1EZXC 1BTHH 3RU4T 3H7OA 1TNGA 1YPHE 2J98A 1O3PB 3RXAA 2G00A 3BTHE 3VB3A 3ATLA 4OS5A 3RXTA 2WV9A 2Y5FA 1RTKA 5LPFA 4NCYA 3T26A 1SPJA 2IPQX 2HALA 3E90B 1O33A 7GCHG 1O2PA 5GPIB 3SUEA 2ZHDA 1VGCC 1C9TA 3FFGA 1WUNH 1LPGB 1KY9A 3RC6A 1ANEA 1F5RA 3M5NA 3RMLH 2KM0A 2EA3A 1GJAB 1Y5BT 2OK5A 1DSTA 1MCTA 1P2OA 1BMAA 2BY6X 4UFEH 1TX6A 2GZ8A 1BDAA 4UFGH 1SQTA 1NU7B 4BAHB 2O8MA 3HKJB 5AFYH 2IN2A 3A86A 3BTKE 3M5OA 4NA7A 1JWTA 5EQQA 4YM9A 1T7CA 3MNXA 2C4FH 1BA8B 1O5EH 1P11E 1TMTH 1ZTJA 1O2VA 2BXTH 5L2YH 4OS7A 1QR3E 1ZSJA 2XWAA 3CS0A 1OKXA 1A2CH 3RC5A 3D62A 1P04A 2AERH 4BXSA 2ALPA 1WOFA 1KIGH 3OTJE 1L4ZA 2OC1A 1DUAA 1XUGA 1K1NA 3A83A 1O5CB 4NSYA 3FP7E 1MZAA 1CGJE 1ORFA 1YPEH 3FP6E 1EP6A 5T6DA 3LPRA 1P05A 4WMEA 1NM6A 3N99A 2K8IA 5CHBA 3V0XA 1CHOG 1P0SH 3AASA 1NFYA 1QCPA 1CVWH 1JRSA 1FDPA 1V2RT 2ZA5A 5A09A 3SZNA 3OYPA 1A1RA 1C2IA 5LH8A 3TGIE 1RS0A 1NESE 2SGPE 4AG2A 4NIWA 4DT4A 2G52A 1F7ZA 1B0FA 1P12E 3GY6A 9ESTA 4RKJB 3KGPA 1MU8B 1YWUA 4X1QU 5HIZA 4CRBA 1HAPH 4SGAE 2CK3D 4XBBA 1GHBG 5L30H 3LU9B 2KR7A 3Q3YA 5EODA 1BZXE 2G4UA 3MH6A 1SGPE 1U6QA 1A5IA 1KLTA 3TITA 3M35A 3BG4C 2ZCLP 2FMJA 1QRXA 2QAAA 1OP8A 1MTNB 1TNHA 2NU4E 3SU0A 1KXAA 4YT6H 1MBQA 1WV7H 2ZI2H 3TU7H 4U01A 4BOHA 1SB1H 3A80A 3NWUA 3V3MA 1V2QT 1SLXB 4Y7AA 1GMCG 4JCNA 2P95A 1EAUA 1C5UA 1T32A 2KZ4A 5DP3A 3QX5H 3UB0A 3ZZCA 4MVNA 1C1QA 4GHTA 1SGEE 1HAVA 1QBOA 3A88A 2BY8X 1AVWA 3QGJA 3KQEA 3PRDA 3A87A 2H9HA 1D6WA 1A3EH 2ZDMA 4MNXA 5T6FA 5DK1A 4DIIH 9LPRA 1FUJA 1VR1H 4DGJA 1NFXA 1S6LA 3ZVCA 1Y5AT 3ATWA 1HAGE 1BUIA 5E2OA 1HLTH 1V3XA 4TPIZ 4Y6DA 3WWFA 4D7FA 1S84A 1BHXB 1XUJA 5E8EH 1OP2A 2J94A 2TPIZ 1G9IE 2H9TH 3HKIB 1C5PA 4GPGA 3RXEA 1MAXA 4YTAA 3TPIZ 2VH6A 3I78A 5A8ZA 1G37A 1QZ8A 4X1PU 3SU4A 1FPCH 2W3IA 5JB8S 1IQEA 1FX0B 2KFWA 3PM3A 3RXQA 1C5ZB 2FLRH 3PB1E 1E37B 3PWBA 1PQ8A 4UONA 3ZIAD 1GI4A 2AIPA 2SGQE 1BMNH 1HRTH 2BDIA 1O3BA 3SZEA 3KQCA 1V2UT 1SQAA 2UUFB 3QK1A 1Y3UA 1O36A 2Z9LA 3QTOH 1O32A 2STBE 4WJG2 2R2WU 1GJ6A 1GBKA 2ZFFH 1C4V2 2VH0A 2EEKA 2VIWA 1BQYA 1SLWB 1NY22 2GCHG 1V2ST 2Q6DA 1W10U 4CRGA 1YKTA 4X6NA 8LPRA 3IITA 5C20A 1JOUB 1GI9B 2GV7A 2A2XH 1Y3XA 2CJIA 1KXEA 1O34A 3EAJA 2YNBA 3F2GA 1NBME 2FPZA 1CE5A 4X6OA 1FLEE 5C3NA 3V7TA 1ETSH 1UVTH 1TPAE 2L6OA 2H5DA 1V2VT 2EI8A 5EXNA 2PKAB 2JETB 2H2ZA 3QN7A 7KMEH 4GCHG 1GJ5H 3ZVBA 3AVZA 1V2KT 4CH2B 3PWCA 4IMQA 1ZJDA 1SGFA 3DFJA 1J17T 1DPOA 2KCAA 3P8FA 2TIOA 5GDSH 2WV5A 3JZ1B 1GDNA 1GMHF 2ZDAH 2P3UB 1GI6A 2RDLA 4ABHA 3SV9A 1W0ZU 1E35B 1UHBB 4E7NA 5C94A 2ODYB 3EA9A 3M3SA 3P8GA 1ANCA 2GT7A 1C2FA 4ABGA 2BX4A 3A84A 1W7GH 4OGXA 5FPTA 1TA6A 3SHCH 1RGQA 1NT1A 1GPZA 4NA8A 4CBOA 3TLOA 2FI5E 1YLNA 2F9OA 4ESTE 5FBIA 1GBCA 1LPZB 1WDIA 3FAOA 2SNVA 4B2CA 1AWHB 2AEIH 1O3NA 2VIQA 4ZHAA 2BLVA 3A7YA 3TVJB 3GCHB 1QFKH 3DT0H 4LOYH 3ELAH 1SR5C 4NA9H 2GCTC 4A1TA 1P8VC 1YBWA 1ABIH 2ZHQH 4XFQA 1UTQA 2WHXA 2ZPSA 1AB9C 1LVOA 2CHAB 1C2MA 2B7DH 4JZIA 3Q77A 2AHME 1UVOA 2AGGX 3ZVEA 1DLKB 2A1DB 2GKVE 4XRNA 1EP5A 1O3JA 2IOTA 3SO3A 3RXFA 1UVPA 2WPJS 4D8NA 2KX4A 2ZPRA 1TMBH 2LPRA 1RIWC 3OSYA 2BDBA 5C67A 1RTFB 5SGAE 3F9HA 3SV7A 2BVSH 1PQ5A 5KEDA 1UO6A 1GCTC 1NRNH 1GBDA 1SQRA 2Y7ZA 3TNTA 1HV7A 5FBEA 2XWBI 4ABBA 1ESAA 5E0GA 3MU5A 4AZ2B 3I29A 4TY6A 1DXWA 2QE7D 1FONA 4INLA 3PMHB 4M9FA 2XTTB 2Y5GA 2V3HH 2Y82A 3U1JB 2VBCA 4YZUA 4OGYA 2XCNA 2PWXA 1OWDA 1TNKA 1Z8JB 2BD8A 2LP6A 2RFKC 4U30A 4MTBA 1O3FA 3U9AH 1ZSKA 3E0PB 2ZDVH 1M9UA 3CNRA 3VEQB 1EFRD 3GCOA 3DSGA 1TFXA 3ZZ9A 1RIWB 5FCKA 4Y10E 2HOBA 2C93B 2WZQA 1GHVH 1AE8H 3LGYA 2ZG0H 1ELDE 2F3CE 2WINI 2Y7XA 4H4FA 1F0TA 1HJ9A 5DSFA 1C1NA 4HI3A 3BTDE 4RKOB 2OQ5A 4YO9A 4WH6A 3URCA 1QJ1B 3U98H 3RLWH 2C3SA 1FV9A 7ESTE 3P17H 4NSVA 3B8JA 4ABDA 2ZU4A 1VGCB 2ZU1A 2P16A 1PPEE 2P93A 1C1VH 3KNXA 2BD3A 3LDXH 1DUEA 1XVMA 1E38B 2ANYA 2K0QA 4ISHH 4AB9A 2SNWA 4Y8XA 4K69A 2O8TA 6GCHF 2OC7A 5JBCS 4B6FA 1YGCH 2OP9A 1VZQH 2QGRA 2RDEA 3OTPA 1O2OA 2SFAA 4AFZA 2G8TA 1TRMA 3PMJA 3ZZ6A 4UDWH 4BAKB 2H1UA 3RU4E 2F83A 2FYRA 1W12U 4K1SA 4BAQB 5DP9A 1N8OB 3MO3A 2ZIQH 5HGGA 5EG4A 3W1EA 1J16A 2ZFSA 2CMYA 1RTLA 1OXGA 1C1UH 4FUHA 4Y79A 2QF3A 1XUFA 1GHWH 2OINA 1P2NA 3NRLA 1UTMA 3DHKH 4FUIA 2FS8A 3S9BA 5F53A 3S9AA 1XVOA 2BY9X 1C2LA 3BTTE 1H8IH 1UJ1A 4D9RA 3V12A 5K7RA 2GZ9A 1OWJA 1MAYA 1C5VA 3FANA 1K2I1 5JYIA 3SGBE 5EJZA 1SGDE 4ASUD 4I8LA 3LC5A 1DICA 4F49A 1A5HA 2PTCE 2J9NA 3TNSA 1TGTA 2P8OC 3KN2A 1EB2A 1ELCA 2DUCA 2ZDKA 2BZ6H 2CF8H 2BM2A 3QDZB 1HAVB 4XD7D 1TPPA 3SU3A 2J97A 1GBMA 4AGKA 1SGNE 5GWZA 3OX7U 1NZQH 4CRAA 2AIQA 1SGIB 1LHDH 1C1RA 3KIDU 3M7QA 4MG3A 1C5MD 1GBTA 1EAIA 2BD7A 1IOEA 3FP8E 2V35A 4I8KA 2A2QH 1HAIH 2Z3EA 1NC6A 2Z3DA 2ODPA 3B9FH 2VVUA 5F8TA 4NZLA 1YPLH 2IJOB 1SC8U 1T8NA 1Z1JA 1AWFH 1EAWA 5AF9H 1O3EA 1MKXH 3KYGA 4MNVA 1N6XA 1O2ZA 1V2WT 2FX6A 5G4BA 4A7IB 4IC5A 1AY6H 3PLBA 3OU0A 1UTKA 4UD9H 3TH2H 1BB0B 1O3GA 1O2MA 3M3VA 5A0CA 6GCHG 3CP7A 1CT2E 3RP2A 2QN5T 3ENSB 3BIUH 3HK3B 4WMDA 1SGQE 1RRKA 5C17A 4E7RG 1QHRB 1J9CH 5H4IB 4K8BA 3PTNA 3LOXA 2W3KA 4A5TS 1ZHMA 2D2DA 1O3CA 1AUTC 1BT7A 2GVFA 5DJ7A 1GI0A 1IQNA 3GCNA 2OLGA 3WY8A 4BAMB 1OWKA 2P3TB 3LT3A 1S0RA 3RXHA 1THPB 3T25A 2V7QD 3LGVA 5I46H 4FUFA 2HPQH 4CBNA 1TB6H 1G3CA 1GBBA 1GHBF 2QV1A 1VKYA 3Q3KA 1TGCA 1PQAA 3ODFA 1O2UA 2FOBA 4Y8ZA 4DCDA 3UPEA 6CHAC 3U8TH 5C5OA 1QY6A 1OWHA 1GJCB 3LGTA 4TT3D 3S69A 2JH6D 3E8LA 4DT7B 1MTWA 2ULLA 1E34B 2FS9A 3Q3XA 4FU9A 4Y0ZE 2H9EH 1E1QD 1AKSA 2OXSA 3RXKA 1NRQH 2ZU3A 3EE0B 1GI8B 2A31A 3UIRA 4ZROA 5EW1H 4CR9A 1K1IA 1TYNA 1TRYA 1A0LA 2OC8A 2RCEA 1ZYOA 1Z6EA 2TBSA 3KQDA 2PP6A 1GI3A 2A4QA 2BY5X 2ZU2A 1FI8A 3RMOH 1JIRA 2QIQA 5JBTA 3UWJH 2B9LA 4O97A 1YYY1 1D3TB 4ACAA 1CQQA 1S81A 2ZCKP 4JYUH 1A4WH 3PROA 1H8DH 3ZZAA 4MPWA 3E6PH 1HYLA 1BIOA 3TIUA 1IAUA 2ZC9H 3PV5A 1GGDC 3RXOA 1W0YH 5J4QA 4ABFA 4MNWA 3P8OA 1QBNA 1GCDA 2B5TB 6ESTA 3EA8A 2ZDNA 3PO1B 2ZU5A 4BNRA 1S5SA 3RC4A 3RDZA 2FOAA 4UEHH 2PKSB 3PV4A 3TJVA 3M3TA 4IN2A 1D4PB 4K1EA 4MPUA 2CF9H 1GI1A 2ZECA 1TA2A 3P95A 3I77A 1C1OA 1BTZA 3MO9A 3T2NA 4Y7BA 8KME2 1EXFA 2Z94A 2WPIS 1TONA 4I8JA 1BHXF 1OOKB 2O8LA 1SGCA 2A0QB 1FQ3A 1Q31A 1Z8IB 4AOQA 3MNCA 1HB0B 4HG6A 1DY9A 4B74A 1DS2E 1IQFA 1TPOA 1MZDA 1O3AA 1K21H 2D8WA 3A8DA 4ZKOU 5JPMH 1C1MA 1WTGH 4MLFB 4U2WA 3A81A 2ZNKH 4AFSA 3BTWE 4B76A 3N7OA 1DM4B 2GDEH 1ZR0A 2BHGA 4ABAA 1THRH 1Z71A 1HJ8A 2YNAA 1AFEH 1ZPZA 2A5AA 2PKAA 3LJOA 3LIWA 2FOEA 1AUJA 1GVZA 1XKBC 1SGRE 4OM9A 1TIOA 4X2XA 3ATKA 2ZFQH 1K1JA 2BQWB 1FY4A 2ODQA 1V6DA 1O37A 2UUJB 1O2KA 1K1OA 1BTYA 3RXVA 1K9OE 4YLUA 2PFEA 2FI3E 2FLBH 5ETXA 3TJUA 1AQ7A 1FZZA 4LXBH 4FVBA 1XUIA 3F3BA 4TSFD 1V2OT 2BZAA 3HATH 4D9QA 1CA8B 1YY3A 2WPLS 4HFPB 3ATMA 1ZSLA 4BXWA 3RXLA 1W3CA 2GV6A 1LHEH 1H8HD 4WXVA 2M5TA 2FOHA 3MNSA 1AVXA 1QL7A 3SU2A 5IDKA 1SLVB 3A7WA 3P70B 1GWAA 2ZFTA 4Q2KA 1Y3WA 1ELGA 2R3UA 1Y3YA 3SV6A 2ZP0H 2ZCHP 4Y71A 1XMNB 3NK8A 1O5DH 2XCFA 2J38A 1O39A 3M36A 3DA9B 1O31A 1SHYA 2FEQH 3VFEA 2FIRH 1GMCF 1ZRBA 1ANBA 1OWIA 1MU6B 3WWBA 3SORA 4MDSA 2C8WB 3EGKH 1Z6JH 3SJOA 1FY8E 4SGBE 2P59A 1A3BH 1F0UA 1F5KU 1LKAA 1TX8A 3SV2H 3GY2A 6LPRA 2QXJA 2XNDD 5EJ1A 4Y11E 1ZMNA 4IC6A 2H6MA 1PYTC 4INHA 2KAIB 1ELEE 1EZUC 2AMPA 3NXPA 8GCHG 3O8BA 2BVRH 3VB4A 5HKKD 4Y8YA 1L0ZA 3SGAE 2JH5D 1GBIA 3UQVA 2QF5A 1AFQC 1QB9A 1ELFA 1SKYE 2Z9IA 1OYTH 5C2ZA 5F8ZA 4X1RU 1GBLA 1C5WB 2ZTZA 2RG3A 3BEFB 4BAOB 3F0OA 2ZPQA 1OP0A 1ZTLA 5EQSA 2XYAA 1SOTA 1F92A 2WSSD 4R8TB 3D65E 4UFDH 4ZH8A 3FZZA 2EQNA 1EX3A 5FL7D 4X8TH 1CHOF 3GDUA 1PJPA 2FXRA 2VWLA 2HNTE 3BTME 2WPDD 2BDGA 1QBVH 5IYTA 1XKAC 3MO6A 1QL8A 1PPHE 4FUEA 1O3OA 1TBRH 3NZIA 5HM2A 5CDFE 1L1NA 1O5AB 1DITH 3RLYH 2WUCA 4DY7B 4WH8A 1BRBE 5C1YA 3NPSA 3BN9A 1TLDA 1TGNA 1G30B 3C1KA 5EU8A 2WYJA 4NGAH 1NFWA 4ZMAH 1FY3A 3A7TA 2FX4A 1O3HA 3RXRA 2GGVB 8ESTE 1GHZA 5ABWA 2HNTF 3AW0A 2EY4C 3GISB 4K8YA 1GBEA 3AW1A 2W6JD 3MMGA 2W7SA 1ARCA 1YP9A 2BQ6B 1C2GA 1IQGA 1S85A 1SLUB 2OC0A 1AE5A 1MCVA 1ZGVA 2VVCA 4ISOA 3SV8A 2RA3A 4XDEA 5GNDA 1QIXB 2FO9A 3ZZ5A 2VWNA 1F0RA 1GG6C 3MU1A 3RXSA 4F48B 3GCTF 3ZV9A 2TGDA 1CSOE 1LKBA 1VJAU 2CN0H 5DN6D 1L1JA 1T31A 1TQ7B 3LH3A 1NRRH 2FOCA 2PV9B 2UWOA 1PPBH 2QXIA 2WUBA 2QXGA 1KYNA 2ZTXA 3SYJA 1ZGIA 3O8CA 5BPEA 1O2LA 5DGJA 2C8XB 5LGOA 4PROA 4TWYA 1ETTH 3IG6B 3RXCA 2A45B 1KTTB 2TGTA 1BTWA 2QA9E 3RXUA 1GL1A 1NBMD 2NU0E 4JZFH 2FI4E 3FZDA 3ZYEA 3BG4B 2BYAX 2HWLB 2GT8A 1KLJH 1IQLA 2AYWA 4FU7A 3V13A 3U1IB 1EPTB 1HGTH 4VGCB 5L2ZH 7GCHF 1GL0E 4XOJA 1ETRH 1TOCB 2R0LA 3IWMA 4GLYA 1HNEE 1TX7A 2BD9A 1P2KA 3SJ9A 1ZLRA 3UR6A 1D3DB 1BRUP 1H9HE 1TNIA 1MABB 3SUGA 4YOIA 2ZQ2A 3A82A 1O2SA 3DUXH 4A1VA 1SGFG 2F91A 3VPKA 2J92A 2W5EA 1DVAH 2PUXB 3T28A 4OS2A 1UK3A 2SGEE 3TJOA 1ACBE 5ESBA 4J1YA 4TPYA 1GDQA 1KXFA 8GCHF 3L3TA 1ZPCA 3P92A 1W14U 2Z9KA 4J2YB 5EOKA 3UREA 3ZZBA 1KMHB 2ZGJA 3U8OH 4NIVA 5T1VA 5T6GA 3WW7A 5B6OA 4CREA 1YC0A 2B8OH 1ESTA 4UE7H 4RI0A 1HXEH 3CS7A 1MKWK 3EE7A 3SI3H 2V0BA 2BTCE 3P8NA 3UFAA 2XBXA 1LVBA 2J5UA 2WPHS 4NFEA 4AGJA 1QTFA 4OS4A 4ZHMU 4X6MA 3W94A 1DWCH 1H9LB 3LGUA 2QF4A 4ISIH 2G51A 3S7KB 1FY1A 1N1LA 1XUHA 3SN8A 3QZRA 4IBLH 2C8ZB 3UY9A 1Q2WA 2SGDE 4F4OC 1J8AA 1UTPA 4XE4A 3PYHA 2P3FH 4FUJA 1BMMH 1HXFH 3UWIA 4YOJA 2ALVA 1GVKB 3A89A 3P6ZB 4Q63A 2OBQA 1YPKH 2HLDD 1PYTD 3G01A 2FOFA 4BTUB 4E06H 3Q00A 4DOQA 4X2YA 3A8AA 1GJBB 2BVXH 4B2BA 4KGAA 4A1XA 4O3TA 3DD2H 4CHAB 1K1PA 1EB1H 3S9CA 2C90B 4TY7A 5EGMA 4INKA 2BLQA
chains in the Genus database with same CATH topology
1QB1A 1QNJA 2EI7A 1PPZA 4Y76A 7LPRA 2O8WA 4LZ4B 1A7SA 1P3CA 1H1BA 5F8XA 1FXYA 5DO4H 1IQMA 2VWOA 3E16B 3H7TA 2Z9JA 1KXCA 4O3UA 1O5FH 1HAXB 4AFUA 5CE1A 4DG4A 1UVUH 3KCGH 3K65B 4AN7A 3EA7A 1GBAA 2FP7B 5CHAC 4BTTB 3D49H 1T4UH 3ZV8A 5GIBA 2IPHA 3QGNB 1C2JA 3HGPA 1P9SA 1VITG 1ARBA 1FY5A 4X6PA 2VGCB 1XUKA 5FHTA 3SW2B 1GDUA 3PMAB 1GHYH 1H4WA 3GY8A 3LGIA 1TALA 2NWNA 3SU5A 3SNEA 1E36B 1P03A 4BANB 1P2QA 2FWWA 3E91A 4K60A 3SQHE 4THNH 2PSYA 2UWPA 1JBUH 1Y59T 2AS9A 3RU4D 1AVGH 1G3EA 1YPMH 1Z7KA 2R2MB 1C2EA 2DE9A 5LPEA 1AIXH 1SI5H 2TRMA 2BXUH 1MBMA 4YESB 3SNDA 1FN6A 1S6FA 1SGTA 4CH8B 1GI7B 1LVYA 3GOVB 3GY4A 2V3OH 1TNLA 4KELA 4GSOA 3ZVAA 1MUEB 2XC0A 3MTYA 1NTPA 3ZZ7A 4NIXA 1V2MT 1AZ8A 4GHQA 2ZGHA 2NU3E 5GXPA 3SJ8A 1XXFA 3F9FA 3RXDA 1P02A 5C5NA 1EOJA 1EJMA 2ESTE 5A8YA 1OSSA 4WWYA 1O3IA 1NFUA 1ZMJA 4Z6AH 2VWMA 2VVVA 3BTQE 1HJAB 3M5LA 1DT2A 2Q1JA 3ZVFA 3ZVDA 3TK5A 1EQ9A 3QUMP 1MTVA 1GJ8B 5A0AE 2JETC 2HVXA 4X8UH 1V2NT 1GHAG 5T3HA 2K1QA 1K28D 4QT8C 2O9QA 4OS6A 4WVPE 3EYDA 3EQ0H 1EUFA 1CHGA 3MU8A 1GJ4H 2UUYA 4ZAEA 5I25A 4XBCA 3T5FH 1C5XB 1QB6A 2B0FA 1EOLA 1ZOMA 1AFQB 5EXLA 4M7GA 3ZZ8A 1ZTKA 4DW2U 1MTSA 1FIZA 3SNCA 1P9UA 2ZEBA 1O2RA 3DFLA 1UK4A 4RSPA 4CRCA 3A7VA 2G55A 3MU0A 1OS8A 2PUQH 2AH4X 1VJ9U 2PSXA 1FPHH 3ZVGA 3PTBA 1YLDA 1CO7E 2UUKB 4X0WU 1MTNC 1CT0E 1UHBA 1Z8GA 3M7UA 3U69H 2AGIX 2G4TA 3KF2A 3SNAA 1AO5A 3E0NB 1L4DA 4XSKU 2GMTC 1GBFA 3MH7A 4HTCH 1P01A 1B0EA 1FN8A 3BEUA 3GYMA 1PPGE 2J2UA 1T8MA 2TGPZ 4NWLA 1WTHD 1C1WH 5BRRE 4X1SU 5EPYA 1D9IA 3GY3A 3A8BA 1C2HA 2BDCA 4ZXYH 1BCUH 3GCHC 1C2KA 1UCYK 1AZZA 2ANWA 2Y6TA 3L33A 5TCCA 2G5VA 2HLCA 5J4SA 4B75A 2BOHB 1LQDB 1VCPA 5EQRA 2FTLE 4AX9H 5EPNA 3TH3H 2GD4B 2I6QA 5JDUB 3TGKE 2D26C 1B5GH 1FAKH 2BQ7B 2Y80A 2ZF0H 1IQKA 4H42U 5F6MA 1YM0A 1WYKA 1LVMA 2HGTH 1D6RA 1N8OC 1KSNA 5TCAA 3A7XA 2BY7X 1LPKB 2CV3A 2PHBA 1P06A 5TJXA 2ZGXH 1ELAA 5A0BA 2VNTA 1Y3VA 1HIAA 3ZZ4A 1C1PA 3RXJA 5E2PA 4I8GA 1SVPA 2PGBB 1FAXA 2GDDA 3LGWA 5JBAS 3ZZ3A 3HGNA 3RMMH 2A32A 2I6SA 1WQVH 4HGCA 2A7HA 3STJA 1ELTA 1O38A 1HDTH 4XBDA 2V6NA 1E0FD 3VB5A 1D3QB 3UNRA 4Q7ZA 4KP0A 2GZ7A 5A8XA 2OQUA 4U32A 4I7YH 1VCWA 2LNCA 1JRTA 3LONA 2FOGA 4JYTA 3GICB 1DWEH 5DP6A 2A4RA 1C1SA 1V2PT 1O3MA 1GBJA 1GHXH 3UNSA 1GMDF 2Q6GA 2OBOA 2VGCC 2AGEX 2VU8E 1P2JA 3QO6A 3SU1A 1CGHA 1AB9B 1MKXK 2CHAC 2R9PA 4R0IA 4JYVH 3F68H 1S6HA 3GCTG 1O2XA 5FCRA 1ESBA 1O2JA 1KDQA 1LMWB 3RMNH 2QXHA 1HAZB 1LO6A 2G81E 3LH1A 3UTUH 1NS3A 3UNQA 3SHAH 1VITF 4IS5A 1NROH 5HYOA 3SOSA 1SFIA 2ZGCA 4OS1A 1GVLA 1GCTB 4ZUHA 5C1XA 3U8RH 4YT7H 3E1XB 2F9NA 2HNTC 2WYGA 1SG8B 1LHCH 3BTEE 4ASHA 1MD8A 3GYLB 2HPPH 1QA0A 2A4OA 1TGBA 4E05H 3QZQA 1YCPM 1V2TT 5F03A 2XBWA 1G2LA 1H9IE 2Z6BD 3VB6A 2AMQA 1DX5M 1O0DH 1QL9A 4ZKNU 3ESTA 1C5QA 3TH4H 3T27A 2VINA 3PMBB 4NFFA 2XC5A 4IGDA 2R0KA 2JKHA 2WPMS 1G3BA 2ANKH 1TBQH 3F6UH 1AD8H 1P3EA 2QC2A 1C1TA 4ABJA 3UR9A 1C5LH 1YPGH 3LJJA 2P94A 4KTSA 3K6ZA 5L6NH 4DJZB 1SGYE 1W7XH 2W26A 1TRNA 2BLOA 2CGAA 2ZTYA 3BV9B 4X8SH 1D3PB 2FZZA 1QQ4A 1KLIH 4AG1A 1IHSH 2THFB 1PQ7A 4NIYA 1G2MA 1SSXA 2VB0A 1SHHB 2XC4A 1AI8H 1TNJA 2Q6FA 2STAE 2ZWLH 5DKMA 1HAYB 4A92A 2GMTB 3A7ZA 1C5YB 1FNIA 4TWWA 5GCHG 4AFQA 1ABJH 1LDTT 3ITIA 2P8OB 2ZFPH 1W8BH 4MNYA 3AAVA 2GP9B 2BDYA 1UK2A 1P10A 3MI4A 3MFJA 1TWXB 3UOUA 3D23A 2QYIA 1VITH 4FXGH 2PR3A 1HAOH 1F5LA 2FM2A 4YOGA 4IMZA 4O03A 3T62A 3W95A 3BTFE 1BBRK 2OCVB 1UVSH 4HZHA 1BBRH 1TGSZ 2XBVA 3S7HB 2A4GA 1TABE 3BEIB 4CRDA 1F0SA 1HUTH 1LQEA 1WQSA 2W7UA 2JH0D 4AYYB 3ZZDA 1SBWA 5DPAA 3SU6A 4JK5A 2OUAA 3SGQE 1QJ6B 3OY6U 1MTUA 6CHAB 4BTIB 4FU8A 4ISNA 3TK6A 1UCYH 1EKBB 2FODA 4K3JA 4JMYA 4GVUA 1GJ7B 1DANH 1TMUH 4KKDA 2ZFRH 1G36A 1T4VH 1TQ0B 4Q7YA 1DLEA 1IQJA 4LK4A 2FYQA 1Y8TA 1C5SA 1A0HB 2Z3CA 1NPMA 3STIA 5DP4A 4B2AA 4MPVA 2BLWA 5E0JA 1GJDB 1N6YA 5ESTE 4JZ1A 1OX1A 2J4IA 1AHTH 4GAWA 2ZQ1A 1NRPH 1SL3A 1O2GH 2PTNA 5PTPA 1A61H 2F9PA 5DP7A 1O2IA 1ZHRA 1O30A 1QURH 1K1LA 1ZRKA 2NU2E 3VXEH 4Z0KA 2J95A 1NRSH 2GCHF 1UTJA 1K1MA 1TE0A 4Y0YE 3Q76A 2BOKA 1DOJA 4FUBA 1BTPA 1QQUA 1Q3XA 4I31A 3BSQA 1O2QA 1RXPA 2AMDA 1F2SE 4AYVB 1CGIE 1L1GA 3A85A 4DVAU 1W13U 1AN1E 3A8CA 3CENA 4O9VA 4CR5A 1UMAH 1JMOH 2PW8H 1V2JT 2BD2A 4UFFH 3QWCH 3NCLA 1WU1A 2VIPA 1CBWB 3GDVA 1QRZA 1C5RA 4IN1A 4RN6A 2QCYA 2ZZUH 1EPTA 4WXIA 1ELBA 1HJAC 1A46H 1O5BB 3AAUA 2UWLA 4Q7XA 1GGDB 4GUXA 1O2TA 1RJXB 2VIDA 1JIMA 5E0HA 1ZHPA 2XBYA 1PPFE 1ID5H 5FXLA 1QRWA 4MPXA 1O35A 2NU1E 1PFXC 1UCYE 1V2LT 1P09A 1EASA 1RFNA 1Z1IA 4H6SB 4CRFA 2PLXA 1S0QA 5HM9A 1O3LA 1BJVA 1B7XB 1EAXA 2CXVA 2BD4A 1AKSB 1YCPK 1GJ9B 3F1SB 4A6LA 1CA0C 3VGCC 1ZZZA 4NWKA 2FDAA 1BBRE 1G3DA 1J14A 2WV4A 3SBKA 1BTXA 1P2MA 1TPSA 4WMFA 1GHAF 2BDHA 2F9UA 1YF4A 2ASUB 4X8VH 3SI4H 4KTUA 3SUFA 4D76A 3R3GB 1FJSA 2O8UA 5HMAA 4B1TA 3KL6A 1P57B 3UUZA 2SGFE 4FUDA 1A5GH 1KDQB 1X7AC 1HFDA 1ANDA 1DFPA 3K9XB 4MQAA 1MQ5A 3KEEA 5A2MH 1WCZA 3T29A 1O2WA 2FOMB 1WSSH 1IHTH 3RM2H 1PPCE 1AU8A 2F9VA 5FX6A 4H6TA 1L2EA 2ZHWH 3O8RA 4K2YA 2OD3B 1BJUA 1FMGA 3MHWU 4I33A 4WY3A 1YLCA 4ZXXH 1AMHA 1P2IA 4ZHLU 1BRCE 1HAHH 1QGFA 1UTLM 1ELVA 1LCYA 1WAYB 4B73A 3VXFH 2GX4A 3B23B 1BMLA 1BRAA 3M5MA 3ZYDA 1GBHA 3OY5U 3FVFB 1O2YA 1HBTH 1W2KH 2VIVA 1LTOA 2Y5HA 1XX9A 2DE8A 4IW4E 4LZ1H 1UTOA 5LPRA 3E3TA 5JBBS 2XNIA 1DSUA 4X2WA 2A5IA 1EZQA 1RD3B 4X2VA 1LHFH 4WF8A 5FAHA 4CHAC 2FTMA 3URDA 1DY8A 4K1TA 1HIAB 2ZDLA 1WBGB 2GCTB 1YPJH 3JZ2B 5CMXH 4DURA 3LKWA 1THSH 3O8DA 2BD5A 3QLPH 2XXLA 3BF6H 3RXGA 3TK9A 3RXMA 4FUGA 2A7JA 2VIOA 1MH0A 5EXMA 1O2NA 1CU1A 1Y5UT 2XW9A 2C8YB 5DP8A 1ZJKA 1EPTC 4VGCC 4AORA 1FIWA 1C5OH 3BTGE 1CT4E 1GMHG 2QF0A 5DG6A 3SNBA 1BOQA 3ATIA 4JZEH 1O2HA 2RA0A 3RUOA 1DWBH 2SGAA 2G5NA 1NN6A 1EJAA 4KTCA 2Z9GA 2ZHFH 2ZKSA 3BG8A 1EATA 2J34A 2Z7FE 4ISLA 4ABEA 1OWEA 2D1JA 4K5ZA 1SFQB 3GY5A 1C4Y2 4ZKRU 1OYQA 1GMDG 3M61U 5C1UA 4B71A 3MNBA 5AVDA 1C9PA 2EC9H 3KQBA 1TOMH 1GI5A 1SOZA 1UTNA 2ANMH 1Z8RA 2BMGB 1HCGA 4ABIA 4NG9H 2BX3A 1T8OA 2A7CA 3RXBA 2VJ1A 3SUDA 1MD7A 3UOPA 4I32A 3EDXB 1AGJA 2EI6A 1XXDA 5FX5A 3L6PA 3M37A 5JB9S 1W11U 2ILNA 2XRCA 3F9EA 3MH5A 2ZHEH 3PLKA 1VCQA 1O5GH 3NUMA 4FUCA 3H5CB 3S0NA 3SJKA 3K6YA 3SJIA 1QJ7B 1XM1A 4X1NU 5DP5A 1INCA 3MYWA 1CBWC 5FPSA 1KTSB 2WPKS 1TBZH 4ZKSU 3M7TA 5GJ4B 5EW2H 1IQIA 3MH4A 1G32B 1O3DA 2Y81A 1C5TA 1IQHA 1C5NH 3KHVA 3PLPA 1J15A 1O3KA 2KAIA 2OTVA 5AFZH 3C27B 4JK6A 2BB4A 2ZGBH 2AFQB 1NO9H 2R3YA 2YOLA 3BIVH 4FVDA 3UQOA 4YLQH 2H5CA 1EJNA 1QA7A 4I8HA 1DXPA 3HPTB 5AHGH 3RXPA 4Q80A 1DE7H 2BDAA 5FPYA 1DWDH 4AB8A 3K2UA 1A0JA 4GCHF 1KXBA 1OPHB 1CA0B 3VGCB 1K22H 2PGQB 1GI2A 3QTVH 2TGAA 1C2DA 4JZDH 3TGJE 3GDSA 2A5KA 2GTBA 3NKKA 1C4U2 3VB7A 1YCPH 1YPHC 1EZSC 1LHGH 3HK6B 3MU4A 3RM0H 1MQ6A 1SMFE 1ZPBA 2PKSC 2ZO3H 5GCHF 1DDJA 1GG6B 1BTUA 1S83A 1NU9A 3TJNA 1MMJN 3ODDA 3MWIU 1JXPA 3LC3A 3RXIA 2FESH 3F9GA 2F9BH 2QY0B 3PO1C 4D7GA 1KXDA 5HXFA 3R0FA 4DIHH 5K0HA 1SQOA 1ZMLA 3SQEE 1TAWA 3MOCA 1MKWH 4TYDA 5CHAB 1T8LA 1HPGA 1BITA 4NZQA 3GY7A 1S82A 2HRVA 1EZXC 1BTHH 3RU4T 3H7OA 1TNGA 1YPHE 1O3PB 3RXAA 2G00A 3BTHE 3VB3A 3ATLA 4OS5A 3RXTA 2Y5FA 1RTKA 5LPFA 4NCYA 3T26A 1SPJA 2HALA 3E90B 1O33A 7GCHG 1O2PA 5GPIB 3SUEA 2ZHDA 1VGCC 1C9TA 3FFGA 1WUNH 1LPGB 1KY9A 3RC6A 1ANEA 1F5RA 3M5NA 3RMLH 2EA3A 1GJAB 1Y5BT 1DSTA 1MCTA 1P2OA 1BMAA 2BY6X 4UFEH 1TX6A 2GZ8A 1BDAA 4UFGH 1SQTA 1NU7B 4BAHB 2O8MA 3HKJB 5AFYH 2IN2A 3A86A 3BTKE 3M5OA 4NA7A 1JWTA 5EQQA 4YM9A 1T7CA 3MNXA 2C4FH 1BA8B 1O5EH 1P11E 1TMTH 1ZTJA 1O2VA 2BXTH 5L2YH 4OS7A 1QR3E 1ZSJA 2XWAA 3CS0A 1OKXA 1A2CH 3RC5A 3D62A 1P04A 2AERH 4BXSA 2ALPA 1WOFA 1KIGH 3OTJE 1L4ZA 2OC1A 1DUAA 1XUGA 1K1NA 3A83A 1O5CB 4NSYA 3FP7E 1MZAA 1CGJE 1ORFA 1YPEH 3FP6E 1EP6A 5T6DA 3LPRA 1P05A 4WMEA 1NM6A 3V0XA 1CHOG 1P0SH 3AASA 1NFYA 1QCPA 1CVWH 1JRSA 1FDPA 1V2RT 2ZA5A 5A09A 3SZNA 3OYPA 1A1RA 1C2IA 5LH8A 3TGIE 1RS0A 1NESE 2SGPE 4AG2A 4NIWA 2G52A 1F7ZA 1B0FA 1P12E 3GY6A 9ESTA 4RKJB 3KGPA 1MU8B 4X1QU 4CRBA 1HAPH 4SGAE 4XBBA 1GHBG 5L30H 3LU9B 3Q3YA 5EODA 1BZXE 2G4UA 3MH6A 1SGPE 1U6QA 1A5IA 1KLTA 3TITA 3M35A