1V2ST

Benzamidine in complex with bovine trypsin variant x(ssfi.glu)bt.d1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Understanding protein-ligand interactions: the price of protein flexibility
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2sT01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2sT02
2ASUB 1V2MT 2STAE 1V6DA 5E2PA 1UJ1A 3PLBA 1W11U 3DFLA 2GMTC 2D2DA 8LPRA 1SQTA 2YOLA 1LHGH 1QBNA 3KF2A 1QB1A 4DOQA 2VH6A 5A2MH 3NK8A 3T29A 4F49A 3VFEA 1Y3WA 2FTMA 1VGCB 4D8NA 4FUDA 1CA0C 1K22H 1LMWB 3GY3A 1O37A 1GJ5H 1INCA 1GGDC 1HAXB 3MH6A 3D49H 1O5DH 1UVTH 3GYLB 3A86A 5AF9H 2P3TB 4ABDA 1OXGA 2W26A 1EJNA 5EOKA 2AGIX 1QR3E 1QTFA 2OCVB 2XBXA 3TK6A 3O8RA 1TPSA 2Q6DA 2GX4A 4MPVA 3RC4A 1RIWC 1KXCA 1CU1A 3P70B 4I31A 4U30A 1A3BH 1ZTLA 2W3IA 3HGPA 4Y0YE 3ODFA 4NWKA 1NRRH 1GHZA 4YZUA 3DFJA 1GBIA 2DUCA 1KIGH 1F7ZA 1H1BA 1ELFA 3TK9A 1VZQH 4AFSA 2FLRH 2HRVA 3EYDA 1ZMJA 2ZPQA 1A2CH 2H1UA 4AORA 1O32A 1VGCC 1HAIH 1Z7KA 1JIRA 1O35A 4FVBA 4ZUHA 2ULLA 3A7ZA 3TNSA 4KTSA 3GY4A 1O2UA 4NZQA 1WUNH 3BTQE 5SGAE 1EZXC 1A61H 8GCHG 5A8ZA 3RXMA 3ZYDA 1CA8B 1SI5H 1ID5H 4YLUA 2AMDA 3HPTB 1C5OH 2RDLA 4NGAH 4MLFB 1FMGA 1TOCB 3UNSA 1DUAA 1C5SA 1C5NH 1T7CA 5L6NH 1Y5UT 1ZGVA 3A88A 1QRXA 2J4IA 9ESTA 1GMHG 2PTCE 3PMHB 1C5WB 5C2ZA 4K5ZA 3S0NA 3FFGA 4OS5A 2Y5FA 1FIZA 2XCNA 4WH8A 3AASA 2G5VA 4MTBA 5A8YA 5E8EH 2H6MA 4RN6A 4MDSA 2W5EA 3RDZA 1TBQH 3UWIA 1TRYA 5FCKA 1H8DH 1W0ZU 1P2IA 1MTSA 4Y0ZE 2R3UA 3M5OA 4AYYB 1FPHH 5HM2A 1AFEH 1IQKA 3DT0H 1AY6H 1C2MA 1LKAA 1EB2A 1K1JA 4X2VA 2K1QA 1Z6JH 3RXCA 2EI7A 1SGCA 1BMAA 5F8ZA 1UMAH 3MWIU 1LHFH 1O2TA 2Z3EA 1J17T 1C1TA 2FPZA 5A09A 1P2MA 5JBCS 4I8KA 3RXGA 3LGWA 5A0BA 1XM1A 4A5TS 4WMEA 2C90B 2ZCHP 3EGKH 4MPXA 3RM2H 1T4VH 1L4ZA 3UNRA 1UTPA 1EAUA 1NFUA 3CS0A 2AIPA 3SO3A 2Y5HA 2HNTE 1ANCA 5EGMA 1P0SH 2J92A 3PLPA 1JWTA 1L4DA 4JMYA 1PQAA 4M7GA 4ZXXH 1KXBA 1C5TA 2G52A 4ZXYH 1SGDE 4ABIA 1NZQH 3Q3KA 1QFKH 1W10U 1T31A 3RXPA 5GIBA 1ZLRA 2VWMA 2TGPZ 1F5LA 3ZV8A 5L2ZH 1XUJA 2ZFFH 2PSXA 1AO5A 2WPIS 3PO1B 1OYQA 3UTUH 1CE5A 2ESTE 1K1NA 2PKAB 2NWNA 3ZZ3A 5J4QA 1HJ9A 3MI4A 1W3CA 2GV7A 3F1SB 7ESTE 1GJBB 1SLVB 2F91A 1ANEA 2Z9GA 4D76A 3BTME 5JB8S 3SNAA 1NU9A 3EAJA 1AIXH 1AKSA 1O2MA 2VNTA 3VXFH 3MU5A 3ODDA 1GI6A 2YNBA 1LKBA 1P2QA 4TPIZ 4ZAEA 4IBLH 1EXFA 1O5GH 3B9FH 5F6MA 1C4Y2 3BTGE 1C1PA 5F8TA 1VJ9U 3MO9A 1LHDH 4Y7AA 2R0KA 5DP9A 3ATKA 2ALVA 3HK3B 1TNGA 1PQ5A 2ILNA 4Q7XA 3ZZBA 3S7KB 2GCTC 2GDDA 1D9IA 1XVOA 3RXVA 5DG6A 1OOKB 1BB0B 2UUJB 2BY8X 1KY9A 1O3EA 1QRWA 3HK6B 3PO1C 3QO6A 1S84A 2RG3A 4AB9A 1V2LT 5EQQA 1CHOG 4I8GA 5IYTA 4OS2A 3AVZA 5IDKA 4ZHMU 4AG2A 2H2ZA 3GY2A 1GL1A 4JCNA 4UDWH 1MAYA 4FUFA 2UWPA 5FPYA 1CGHA 1GCTB 3E3TA 3MFJA 1HXEH 5E0JA 3TNTA 1IQIA 3A8BA 4KP0A 2QXGA 4Q7ZA 4YTAA 3MMGA 5CE1A 1SLXB 4CRAA 1B7XB 2BHGA 3VPKA 1MZAA 2BM2A 1QBOA 2ZU5A 3BTHE 3M36A 3NKKA 1HB0B 3MNXA 4ZKOU 1GBHA 4OGYA 3QX5H 2XCFA 1OX1A 4X8TH 1TMUH 3A80A 1ZJKA 3LC5A 3OTJE 3BN9A 1TONA 1ELAA 1QY6A 4B74A 1EATA 1QIXB 4YLQH 1ZMLA 2QIQA 1MUEB 1TGNA 1FN6A 3EQ0H 4CH8B 1S6HA 1C5YB 1OYTH 2VVVA 3ZZ5A 4B2AA 4K69A 2GZ8A 4B71A 4IMZA 1B0FA 2GCHG 4LK4A 1GJCB 1QJ1B 2V3HH 4THNH 2P59A 3K6ZA 1AN1E 2SNWA 3U8OH 1FN8A 4O97A 2AS9A 3PYHA 1GJ6A 2GV6A 4JYTA 3FP8E 2D1JA 1WCZA 5C20A 3BF6H 1GI9B 3B23B 3RU4T 2CHAC 3SI4H 3RP2A 2ZHFH 1BHXB 3G01A 3ZV9A 1W7GH 5JBBS 2ZHEH 3NZIA 4Y6DA 1AU8A 4UFGH 4KGAA 2PSYA 4VGCB 1MBQA 3SU2A 1SGPE 2V0BA 1O2NA 2F9NA 1YPLH 5C1UA 2BXUH 3NWUA 5FBIA 3SGBE 1BRBE 2J94A 2XNIA 2ZHWH 1EZQA 1IQGA 1KXAA 2ZU1A 4KTCA 1O2VA 4X8UH 1S85A 1LO6A 4ASHA 1BTPA 1W12U 3FP6E 3QZRA 1L1GA 1P03A 2FO9A 2BTCE 1A0LA 2OQUA 2FS9A 1AFQC 1O5BB 2O9QA 1YCPH 2GVFA 4X1PU 1EX3A 2KAIB 2BDBA 2SFAA 3K2UA 2ZDVH 5DKMA 3LJOA 1DDJA 4JZIA 1E35B 1AWHB 1HAHH 1LVMA 1HIAA 1MTNC 3UR6A 1PYTD 5TCAA 4VGCC 2JH6D 4B2BA 4I8HA 3SU6A 1FY1A 1O2LA 3F9GA 1OWEA 2Z9KA 2UUYA 3S9CA 2TPIZ 1YPKH 1ABJH 2BX4A 4PROA 1XMNB 4IC5A 1DPOA 3SORA 2VWNA 4K1SA 1QHRB 4UD9H 1SC8U 4FUEA 4D7GA 1FUJA 3ZYEA 1XUKA 3M61U 2V3OH 3RLYH 3MNSA 1UK4A 1FLEE 2ZC9H 1DANH 1DXPA 2OC7A 3QK1A 3M5MA 2PFEA 2BY6X 3E1XB 3NCLA 1UHBA 2BXTH 4UFEH 2H9TH 1GBCA 4FU8A 1Z8RA 4ZHAA 2F9UA 1LVYA 3GDUA 4BANB 1MCTA 1EUFA 1DWCH 2PHBA 2F9VA 1E36B 4E06H 2C8YB 1A0HB 2PR3A 3U8TH 1XVMA 3RLWH 1N8OC 3KGPA 4H42U 3CENA 5AFYH 2ZU2A 2ZFRH 1BITA 5A0CA 3T5FH 3RXSA 4LOYH 2OQ5A 2QGRA 3TJNA 1GHAG 1MKWK 2FS8A 2TGTA 1OWDA 1A1RA 1EOLA 3MU4A 3V7TA 1HJAB 1C9PA 1EAIA 4HGCA 1C2FA 2A2QH 5DK1A 1QBVH 1DM4B 1T32A 1TYNA 4AB8A 1A0JA 6GCHF 4MPUA 1NRSH 4GAWA 4O03A 1ESBA 1QQUA 4QT8C 1YGCH 1GJ4H 3GISB 3SNDA 1QB6A 3TVJB 4NSVA 6CHAB 1EB1H 1HAYB 4ZKSU 2OC0A 5ETXA 1Z8GA 1GHBG 1O0DH 3M7QA 1D6WA 2OINA 3SJOA 3TJVA 4XBBA 2P8OC 1WU1A 4Y79A 3C1KA 4E7NA 2SGPE 1FNIA 1BBRE 3TITA 1DFPA 3T27A 3ZZ8A 1PYTC 1GG6C 1OKXA 2VWOA 1D3PB 1D3TB 4A92A 1D3DB 1FIWA 1SFQB 1IQFA 1DVAH 3ATWA 3BTTE 3UQVA 1JOUB 1HJAC 1AVXA 3RXOA 1K1MA 3A7XA 4INLA 2AIQA 1BMNH 4WXVA 1TNLA 1IQEA 1YPJH 3LH3A 3TGJE 1TE0A 2TIOA 1THRH 3TH3H 1TX8A 2G4UA 2EA3A 1Z71A 4TWWA 1CHGA 4GCHG 2BY7X 4TY6A 2PW8H 3UQOA 1TQ7B 3SU1A 3L33A 2XW9A 5HM9A 3A85A 1TB6H 4IGDA 9LPRA 1O2OA 2GP9B 3BIVH 4JYUH 6CHAC 2O8TA 5EXMA 3A7YA 1FY5A 1GBBA 4MNWA 3GDSA 3RM0H 1P2JA 3UNQA 4AOQA 4NA9H 1ZJDA 2ALPA 1IQMA 3AW1A 1YPEH 1BCUH 2ZHDA 1HYLA 1FONA 1EP6A 1SG8B 1JBUH 3T25A 1HPGA 4K1TA 1ELBA 2XBYA 5FAHA 1UTMA 3FVFB 3RU4E 2C8WB 2OXSA 1UTJA 2FI3E 3O8CA 4ZROA 5JDUB 1NRQH 2WPHS 1OWHA 5HMAA 3TGIE 1SGTA 1GJ9B 1UCYH 1MTWA 3MH4A 3W95A 2UUFB 3BV9B 3DA9B 1KDQB 1SOZA 1Y3VA 1EJMA 2YNAA 2EEKA 1O5FH 5EQRA 3TU7H 2QN5T 1GI0A 3U9AH 1O3OA 2AMPA 1T8NA 1SQOA 1OP0A 2HNTC 2ZWLH 4X6NA 3TH4H 1BBRK 3HATH 1SB1H 4A1XA 4JK5A 3SNEA 1RTLA 1THSH 1A7SA 2QA9E 4NZLA 1O2JA 2FOGA 3W94A 2EI8A 1YPMH 1PQ7A 1C2IA 2QXIA 1C2DA 4FU7A 2ZZUH 1AE5A 3QGJA 4U32A 1ZPCA 1Y5AT 1NN6A 2PKSC 4XFQA 3WY8A 1GI7B 2BLWA 1H8IH 1SGNE 2A5IA 5I25A 2ANYA 1GDUA 4AGJA 1PPHE 1AMHA 2HOBA 2BY5X 2WV4A 1C5VA 1NFXA 1UTNA 5E0GA 1J9CH 1V2UT 1TRNA 4OS1A 1SL3A 1O38A 3PMBB 2XBWA 3PTBA 2ZFSA 1WQVH 2BLVA 3RXFA 1TMBH 1U6QA 2ZPRA 1GWAA 4WY3A 1V2RT 2P93A 1UVUH 1DSTA 3RXUA 4WH6A 1ZYOA 2ZGCA 3LGUA 1QJ6B 3Q00A 3RXTA 1O5CB 2VINA 3U8RH 1ARBA 2B0FA 1O3PB 3I77A 2UWLA 1KLTA 2CXVA 1EZSC 1AGJA 4XDEA 3F9FA 3FP7E 1G2MA 3KCGH 1QJ7B 2QXHA 1PPZA 3QUMP 1O3AA 2OBQA 4JZEH 2BD5A 2BQWB 3Q76A 3SI3H 5DP7A 2XBVA 2Q6FA 5LPRA 1GVZA 4HTCH 2AERH 1AE8H 3UR9A 4R8TB 4BAOB 3RXKA 1NO9H 1G3BA 1KLJH 1N6XA 5GCHF 2FI4E 2WUCA 2THFB 2XC4A 2XXLA 1PPBH 2WPMS 4A1VA 1F0RA 3S7HB 1WSSH 3UUZA 2F9BH 1OWJA 1F5KU 2AMQA 1THPB 2Y81A 4YOIA 2P16A 2R0LA 2FOMB 4CR9A 2XTTB 1CT4E 3BSQA 4CBNA 4Y11E 2Z6BD 5JBAS 1IQLA 1C5LH 3IITA 4NA7A 1NFWA 1SGFG 4GVUA 1GHVH 3LPRA 1VITF 2M5TA 2G8TA 4XBCA 4DT7B 4JYVH 2ZDAH 2ZP0H 1G9IE 1YBWA 3TK5A 3RMLH 3RC6A 1LHEH 1G3CA 1UTQA 4DCDA 1C1MA 2A4OA 1O2HA 4NCYA 3KQDA 1HAOH 2C93B 2ZTYA 3ZZ6A 1PFXC 3PLKA 1C1WH 2ZDKA 1VCPA 1ZOMA 5K7RA 2W7UA 1BOQA 1BA8B 1S6FA 4LXBH 1WQSA 2PKAA 2Y7ZA 3SNCA 3SOSA 2IN2A 4X2WA 4IW4E 1RXPA 4RSPA 2BZAA 1PJPA 1SGYE 2C8ZB 5LPEA 3SV6A 1ZPZA 3STIA 4OGXA 3SUGA 4DURA 5EPNA 2ZGBH 1TA6A 1E0FD 4Y10E 1GHWH 3URDA 1MU6B 3EA8A 4FUBA 5DO4H 1B0EA 1W8BH 3JZ2B 1SPJA 3F68H 1BRCE 3MNBA 1GBLA 1L0ZA 2Y6TA 4UE7H 1HAVB 1JMOH 3E16B 2B8OH 5L30H 2PGBB 1K1PA 4WVPE 7GCHF 4ZMAH 2VIOA 1TALA 4ABEA 1VITH 2A1DB 1C1VH 1DE7H 1EQ9A 4Y8XA 1MTUA 2ANWA 2FXRA 1BMLA 2BZ6H 2G00A 1ELEE 4FVDA 3EA9A 3QTVH 1KXFA 1DX5M 2QYIA 1O2ZA 1Y5BT 4D9QA 1DWDH 1KXDA 1GPZA 4SGBE 1HFDA 1TNIA 1C5QA 1VCWA 1RTFB 1JRTA 5GXPA 2H5DA 5DJ7A 1WV7H 4YOGA 4Q2KA 3MO6A 4ZKRU 2GT7A 1QQ4A 1Q3XA 3V13A 4ABJA 4B75A 4KELA 2HLCA 3O8DA 1LCYA 2VJ1A 4NIWA 3VB3A 3SW2B 3E8LA 4CRCA 5BPEA 3LH1A 1ZHMA 4INHA 1K9OE 3P8GA 2F3CE 2J9NA 3GDVA 2Y7XA 5GPIB 2BOKA 1V3XA 1F2SE 1C4U2 3GICB 1FZZA 5H4IB 1QGFA 4YOJA 2A5AA 4BAMB 3M3TA 3RU4D 1GMCF 4JZ1A 4DVAU 3MU8A 3SHCH 4BXWA 3BTEE 2I6SA 1C2JA 2QC2A 2ZFTA 1YM0A 4AG1A 1O31A 2LNCA 3M3SA 1HJ8A 2BD8A 4MVNA 5EW2H 3MH7A 3ZZAA 1ARCA 4YM9A 2GCHF 3RXEA 1GDQA 1ANBA 1ZHPA 4X8SH 3ZVBA 1ZRBA 1V2KT 4B73A 1DICA 1HCGA 2BDYA 2C3SA 4WF8A 1KSNA 1FAXA 5E0HA 1OWKA 1W7XH 2PWXA 1T4UH 1UVOA 1GMDF 4FUGA 2BY9X 1TPPA 2Z7FE 1CQQA 4K8YA 4MG3A 1GCTC 4DIHH 5FBEA 1GI1A 1HAZB 3SUEA 2BLOA 3A82A 3UWJH 1C5MD 4I33A 1K2I1 1GHYH 1K1OA 2VVCA 1EOJA 3E0NB 1HLTH 1C4V2 1ETSH 1YPGH 3M5NA 3Q3XA 1GI2A 3H7TA 3UOUA 1O34A 3OSYA 4BTIB 1SBWA 3LOXA 2FEQH 4J2YB 1G36A 1WYKA 2NU0E 1IQJA 3QTOH 3SJIA 1EAWA 4X1QU 2CGAA 1MQ6A 2KAIA 3LGIA 1GBDA 1EKBB 1UO6A 3M5LA 5HXFA 3LGYA 2WYJA 5HYOA 1GJDB 1GBEA 4AFQA 1C2KA 3LONA 5C3NA 5FX5A 5GDSH 1GVLA 3KIDU 3LJJA 3UY9A 4B76A 2ANMH 2TGAA 3FZDA 3E91A 3NXPA 1HXFH 4J1YA 1DOJA 1OS8A 4WMFA 1C1SA 3D23A 4I7YH 4CRGA 3T2NA 4FUHA 3AW0A 2JH5D 3K9XB 2VIDA 1QRZA 4AX9H 2SGQE 3PM3A 3VGCB 1D6RA 1Y3XA 1FY4A 3MU1A 1O2XA 1P06A 2WPLS 3AAUA 1GJ7B 2OC8A 1ZTJA 2O8UA 1RS0A 1MQ5A 1J16A 2UUKB 1SVPA 3UFAA 1OP8A 1Z6EA 4HI3A 1ANDA 4DW2U 1P11E 1NESE 3SGAE 2BDIA 2A31A 2ZU4A 1TFXA 3EDXB 2CF8H 3V0XA 1NU7B 2VB0A 2NU2E 4Y8ZA 1SOTA 1NT1A 3RXIA 3S9BA 1JRSA 4CRDA 4CR5A 3ZZCA 5GWZA 4DIIH 4MNXA 4AZ2B 4K2YA 1ELVA 3A8AA 2GT8A 3OY5U 8KME2 2J2UA 1J14A 1V2NT 4X6PA 1T8LA 3U98H 5F03A 2V6NA 1GI3A 1WTGH 2A45B 1FJSA 2QV1A 4X1NU 4DGJA 3KL6A 1C2LA 3VXEH 3VGCC 4HFPB 3DHKH 1ZR0A 1NRNH 4XBDA 4X6MA 1V2QT 3L6PA 1E34B 1ZTKA 3KN2A 5C5NA 3BTDE 1Y59T 1HDTH 3SBKA 1P09A 1V2OT 5B6OA 2TBSA 3M3VA 3ATLA 1P10A 1G2LA 1IHSH 3E0PB 5TCCA 1V2WT 1J8AA 4IC6A 4LZ1H 2J34A 1EASA 1AB9B 2ZG0H 3LIWA 5LPFA 3LKWA 3Q77A 4JZFH 1AWFH 1C2EA 3SN8A 1A5IA 2P3UB 5FHTA 2FOHA 5T6GA 4MNYA 2AGGX 1S81A 1KTSB 4X1SU 3I78A 4KKDA 1DT2A 1P9UA 3BG8A 1G3DA 3RMMH 2JH0D 1BJVA 2B5TB 1SGFA 1TABE 1OWIA 4CRBA 1YCPK 3NPSA 3ATIA 1GBAA 2BD9A 2F9PA 1MD7A 4FUJA 3RMNH 3RUOA 1EPTB 4BNRA 4ZKNU 3DUXH 3GCTF 2OTVA 2OP9A 1P12E 4BAQB 4K60A 3TJOA 1W0YH 3OU0A 2FOAA 1ELTA 2GD4B 2NU4E 1TA2A 4GCHF 4ISOA 4UFFH 3V12A 1QCPA 4BXSA 1VJAU 5T3HA 1AB9C 2O8WA 2R3YA 3KHVA 2G51A 1NFYA 1MKXH 1P3CA 3U1IB 1O5AB 1SHYA 3VEQB 4AN7A 4RKOB 2ZI2H 2NU1E 5EXLA 4YT6H 4ABGA 3BEFB 1O3CA 1GBMA 1C5RA 4ABFA 3KQBA 2HALA 1ZMNA 1O2GH 2FX4A 1WOFA 1V2JT 2ZCKP 1NS3A 3KQCA 1KDQA 7KMEH 1OP2A 3ZVAA 3NUMA 5GJ4B 2Y5GA 3BEUA 1N1LA 2JETB 1ELDE 3LGTA 6GCHG 2H9EH 3B8JA 1S0QA 5E2OA 1AVWA 1YLCA 1SLWB 1TGBA 1CT0E 1TIOA 1BTWA 3F6UH 1O2WA 1TOMH 3V3MA 1P2NA 1DITH 1FQ3A 2GDEH 1S83A 4ABAA 1C1NA 2WYGA 5AVDA 5EU8A 3GY5A 5FXLA 1H9HE 5EODA 1NRPH 2QF3A 2GKVE 2TGDA 1G3EA 1VCQA 2IPHA 3STJA 5EW1H 4GSOA 3M7TA 1LPGB 1ETRH 3MU0A 2SGEE 4H4FA 3KQEA 3RC5A 1LHCH 1NC6A 1H4WA 2ZDLA 1S0RA 2C8XB 3PWBA 2BD2A 4NG9H 4Y7BA 2ZA5A 3BIUH 4NIVA 1QL7A 4D9RA 3S69A 1UTKA 1SGRE 3A89A 3ENSB 4WJG2 1ZSKA 1WBGB 1UCYE 1ELGA 1ACBE 3F9HA 4LZ4B 2G4TA 1HAGE 3ZVGA 3BTKE 3HKIB 4BAKB 3M35A 4INKA 1BTZA 1FDPA 1XXFA 5C5OA 1AVGH 2PGQB 3T62A 5DP5A 3A84A 4AFZA 2H5CA 2FWWA 1DY8A 1O3FA 2Q6GA 3SZNA 3SU4A 2BD4A 1SGIB 4NIXA 4ZH8A 1MZDA 2BQ7B 1BIOA 3PV4A 1TPOA 1Q31A 2AYWA 1MH0A 1F0UA 1RIWB 3GY8A 1LTOA 1C5XB 1A5HA 3R0FA 1E37B 3P8FA 2FZZA 1F5RA 2ANKH 1G30B 1P9SA 1YPHE 1GBKA 1ORFA 1BDAA 2B9LA 2GZ7A 2CF9H 1AHTH 4UFDH 5JB9S 2AFQB 2FOFA 1TNKA 3QN7A 1TGCA 1TNHA 3LDXH 2F83A 4RKJB 2PUQH 3GYMA 4B1TA 3SV2H 1QB9A 4D7FA 1QNJA 2FM2A 2Z3DA 1BRAA 1N6YA 1VR1H 8GCHF 4X8VH 1LQDB 3MYWA 2G5NA 2A4GA 1P01A 4AFUA 4F4OC 1FV9A 1BUIA 1BQYA 2NU3E 1W2KH 4I8JA 1SHHB 4H6SB 3PWCA 3DD2H 1UK2A 1BTHH 1GVKB 1JXPA 2FOEA 1C1UH 2RA3A 1HRTH 1O3IA 1UCYK 2QAAA 3SU0A 1GMHF 2RCEA 1HV7A 1ZGIA 2FLBH 1XUGA 2GZ9A 1A5GH 2FOCA 5A8XA 4XE4A 1O3MA 5PTPA 3KNXA 3VB4A 3F9EA 1Y3YA 5DP3A 3ZVEA 1BT7A 4Q7YA 2WUBA 3SJKA 2ZCLP 1GHXH 2Y82A 1L1JA 1V2VT 1XUHA 2PTNA 3A8DA 2XC0A 2ZEBA 3U1JB 4GHQA 1AZZA 1XUIA 3LC3A 4FU9A 3RXBA 1O3JA 1C9TA 5G4BA 2HNTF 1W14U 2BX3A 5DP8A 1XKAC 3T28A 3TIUA 1C5UA 2F9OA 2J38A 4R0IA 4ZHLU 3ELAH 2ZGXH 2STBE 3EE0B 2BLQA 1KLIH 5K0HA 1F0SA 1MCVA 4MQAA 1FY8E 3SNBA 1Z1IA 2FI5E 4OS7A 2FODA 2VIWA 1FI8A 3D62A 3P8OA 2ODPA 1GBFA 2DE9A 3N7OA 4K8BA 3A81A 3CP7A 3L3TA 5L2YH 2CJIA 1FY3A 5AFZH 1AI8H 1C2HA 2A2XH 2VVUA 3M7UA 2A5KA 3A87A 2VH0A 2ZTXA 4TPYA 1HAVA 1AQ7A 1C5ZB 5GCHG 4FUCA 4IN1A 2CN0H 4BTTB 1UVPA 1DUEA 3SQHE 2Z3CA 1PQ8A 2SNVA 3A8CA 5AHGH 2JKHA 1TMTH 4ABBA 1A4WH 1LDTT 1O3KA 3MNCA 1P3EA 4K1EA 1ELCA 1QL8A 5C67A 4ISNA 1L2EA 1GL0E 1D4PB 2SGDE 1GJAB 1LPKB 2BVRH 2CV3A 2FYQA 2VU8E 4Z6AH 4OS4A 2BD7A 1BRUP 4Y71A 1O2QA 5J4SA 2GGVB 1QURH 2HPPH 2VWLA 1SQAA 1LVOA 5A0AE 1ZPBA 2EI6A 1NPMA 1P2OA 1QL9A 3FANA 3ZVFA 1VITG 2ZF0H 1TQ0B 3ZZ7A 2R2MB 3IWMA 2BDGA 3ZZDA 2Z9JA 2ZDNA 1T8MA 1YP9A 1S5SA 3E6PH 3TGKE 1SGEE 1SLUB 2UWOA 3P92A 4CREA 2ZKSA 2ZQ2A 3S9AA 1OSSA 1CVWH 2TRMA 1K28D 3RXLA 2ZFPH 1H9LB 5F8XA 3HKJB 3QWCH 3SQEE 2Y80A 1SGQE 1C2GA 3BTFE 1AZ8A 4NSYA 2ZGJA 2FIRH 2GCTB 3SV7A 1MTVA 1UK3A 3SUFA 2G55A 2ZFQH 1ESAA 1DWBH 1O3LA 1CHOF 2ZQ1A 3I29A 1RGQA 3SU5A 2ODYB 2SGFE 5EXNA 1CT2E 2Q1JA 6LPRA 3PMAB 3QGNB 1YLDA 1IHTH 2CMYA 3MOCA 1GBJA 3O8BA 1MBMA 4JZDH 4Y8YA 5EG4A 4ISLA 4YESB 3SV9A 1ZSJA 2BOHB 1O5EH 3HGNA 1GI8B 3ZVDA 3CS7A 1C1OA 2XYAA 4TWYA 1KXEA 2VIPA 4ISHH 5TJXA 3UIRA 2XWBI 5FX6A 5ESBA 1P2KA 3ATMA 7LPRA 1IOEA 1O3NA 1XKBC 1FXYA 7GCHG 1UTLM 1SR5C 1PPGE 5JBTA 3QDZB 1YYY1 2QF0A 3TJUA 2ZNKH 2FESH 3RXRA 1V2PT 2FX6A 1TPAE 2P94A 3VB6A 2VIVA 2FTLE 4A1TA 1QA0A 1K1IA 1BTXA 1O2IA 2HWLB 2VIQA 3PTNA 3SV8A 1MU8B 1AKSB 2Z9LA 1O36A 2P95A 4Q80A 1O3DA 1C5PA 3SU3A 1NTPA 2A4QA 2ZDMA 3RMOH 3LGVA 5T6DA 2WPKS 2P3FH 1GI5A 3E90B 3MH5A 4YT7H 1CO7E 1L1NA 1CGIE 4I8LA 3H7OA 1Q2WA 4ISIH 3P6ZB 2B7DH 5DP4A 2V35A 3PROA 3BG4B 1O3HA 1UTOA 3PMJA 3ZZ9A 4GPGA 1LQEA 2CHAB 1HUTH 1O2YA 4O9VA 2ZECA 1Z1JA 1KYNA 1GI4A 3VB7A 4SGAE 4NFEA 2HVXA 1EAXA 3H5CB 1O2PA 5JPMH 2BMGB 3T26A 5EPYA 1DLEA 4NA8A 3SJ8A 3U69H 1F92A 1GJ8B 1GMCG 5DP6A 3KEEA 2J95A 2HGTH 3URCA 1Y8TA 1C1RA 2BQ6B 4H6TA 3TH2H 1TX7A 4CRFA 1DXWA 4O3TA 4GUXA 2O8LA 5FCRA 3UREA 2PV9B 1TRMA 3M37A 4DG4A 2OD3B 1GDNA 1AFQB 1DY9A 2O8MA 3BG4C 2FOBA 1BJUA 1AUJA 1TGTA 4UEHH 3K65B 5CMXH 2D26C 5C1YA 4U01A 2ODQA 1ZZZA 1Z8IB 1MTNB 3MHWU 2IOTA 3AAVA 1GMDG 1P05A 2VGCB 3TPIZ 4BOHA 1CBWB 1GCDA 3IG6B 3ZZ4A 3QLPH 3A7VA 2H9HA 3FZZA 1ZHRA 3BTWE 2QXJA 2LPRA 4TY7A 2EC9H 2BB4A 2ZPSA 5LH8A 1MMJN 4XSKU 1YC0A 1LPZB 3GCOA 1MKWH 1Y3UA 5BRRE 2IJOB 2AH4X 4MNVA 4BTUB 2BVSH 4FUIA 3MO3A 1IQHA 3PB1E 4Y76A 1E38B 2ZIQH 2FDAA 3LU9B 1JIMA 1TGSZ 6ESTA 1XXDA 3ZVCA 1O2SA 1ABIH 1GBTA 3RXJA 1RJXB 3RXQA 4HZHA 1GHAF 1N8OB 1XUFA 2VGCC 4UONA 2I6QA 4E7RG 1H9IE 3GY7A 1O39A 1CBWC 1KTTB 1EPTA 1PPFE 2R2WU 2ZU3A 1DLKB 1EJAA 3P17H 3RXHA 3UPEA 1YPHC 1S82A 4NWLA 5T6FA 2OBOA 1O2RA 4NIYA 4A7IB 5JYIA 2DE8A 1ETTH 3JZ1B 3TLOA 2WV5A 2WINI 4CBOA 1XX9A 2RA0A 1P57B 2A32A 2FMJA 1MAXA 3OYPA 3A7WA 4X0WU 3VB5A 1LVBA 1P04A 3ESTA 2HPQH 2C4FH 2A4RA 4OS6A 1GHBF 1F0TA 2OC1A 1EZUC 2BVXH 1WAYB 1HIAB 2GTBA 4CH2B 1M9UA 2BDAA 4AGKA 1V2TT 3C27B 1MD8A 5C1XA 2Z9IA 3GCNA 1TX6A 2XRCA 1QA7A 2A7CA 4BAHB 2ZTZA 2W3KA 2P8OB 1G37A 4E05H 3RXAA 1DS2E 3SGQE 4IS5A 4WMDA 3SHAH 2WPJS 1GG6B 1RD3B 4Z0KA 3A83A 1YKTA 4B2CA 5FPTA 3GOVB 1V2ST 3D65E 1SMFE 3P95A 1NM6A 3SUDA 1X7AC 4U2WA 1PPEE 1IQNA 3FAOA 1TBRH 1A46H 5CHAB 2QY0B 1K21H 2W7SA 4A6LA 1UHBB 1TBZH 4WWYA 4YO9A 1BHXF 2XWAA 1ZRKA 1HGTH 2D8WA 4NFFA 1P8VC 2PLXA 2FYRA 3QZQA 1YF4A 1O3BA 4IN2A 5HGGA 4ABHA 3ITIA 1HNEE 1RTKA 1AD8H 3GY6A 1UVSH 4X2XA 4KTUA 5ABWA 1BBRH 1C1QA 1P02A 5LGOA 1ZSLA 4JK6A 2AGEX 5EQSA 2BYAX 1O30A 1EPTC 4ESTE 4CHAB 3OX7U 1TAWA 4O3UA 1DWEH 3OY6U 1CGJE 1NROH 1RFNA 1TNJA 1HAPH 2QCYA 3GCHB 5DGJA 3GCTG 4IMQA 2A0QB 2OUAA 3BEIB 4X2YA 1HBTH 2A7HA 2Z94A 1A3EH 1IAUA 4XOJA 3Q3YA 3RXDA 5CHAC 1DSUA 3P8NA 1BZXE 1YCPM 1K1LA 2PUXB 5FPSA 4X1RU 4TYDA 5DPAA 1O33A 1W13U 3MTYA 3R3GB 4DY7B 1AUTC 3EA7A 2ZHQH 1ESTA 1FPCH 3UOPA 1NY22 4MPWA 1BTUA 2G81E 4GHTA 1B5GH 2GMTB 4GLYA 1O2KA 1TLDA 3LT3A 1BMMH 1RRKA 1SFIA 1EP5A 2AEIH 2A7JA 1T8OA 2FP7B 2ZO3H 2PKSB 4CHAC 1CA0B 4K3JA 2XC5A 1D3QB 4X6OA 2R9PA 2JETC 1GGDB 4FXGH 1OPHB 3A7TA 3GCHC 4I32A 3SJ9A 5I46H 4AYVB 1MKXK 5ESTE 2OLGA 1FAKH 2SGAA 1J15A 2BDHA 4DJZB 1G32B 3K6YA 8ESTE 1BTYA 2BDCA 1TWXB 2ZGHA 2BD3A 1PPCE 4WXIA 1WTHD 1SSXA 1CSOE 1Z8JB 1O3GA
chains in the Genus database with same CATH superfamily
2ASUB 2M2AA 1V2MT 2STAE 1V6DA 5E2PA 1UJ1A 3PLBA 1W11U 3DFLA 2GMTC 2D2DA 8LPRA 1SQTA 2YOLA 1LHGH 1QBNA 3KF2A 1QB1A 4DOQA 2VH6A 5A2MH 3NK8A 3T29A 4F49A 3VFEA 1Y3WA 2FTMA 1VGCB 5CDFE 4D8NA 4FUDA 1E79D 1CA0C 1K22H 1LMWB 3GY3A 1O37A 1GJ5H 1INCA 1GGDC 4RT0A 1HAXB 3MH6A 3D49H 1O5DH 1UVTH 3GYLB 3A86A 5AF9H 2P3TB 4ABDA 1OXGA 2W26A 1EJNA 5EOKA 2AGIX 1QR3E 1QTFA 2OCVB 2XBXA 3TK6A 3O8RA 1TPSA 2Q6DA 2GX4A 4MPVA 3RC4A 1RIWC 1KXCA 1CU1A 2F43B 3P70B 4I31A 1A3BH 1ZTLA 4U30A 2W3IA 3HGPA 4Y0YE 3ODFA 4NWKA 2OK5A 1NRRH 1GHZA 4YZUA 3DFJA 1GBIA 2DUCA 1KIGH 1F7ZA 1H1BA 1ELFA 3TK9A 1VZQH 4AFSA 2FLRH 2HRVA 3EYDA 3SZEA 1ZMJA 2ZPQA 1A2CH 2H1UA 4AORA 1O32A 1VGCC 1HAIH 1Z7KA 1JIRA 1O35A 4FVBA 4ZUHA 3OFND 2ULLA 3A7ZA 3TNSA 4KTSA 3GY4A 1O2UA 4NZQA 1WUNH 3BTQE 5SGAE 1EZXC 1A61H 8GCHG 5A8ZA 3RXMA 3ZYDA 1CA8B 1SI5H 1ID5H 4YLUA 2AMDA 3HPTB 1C5OH 2RDLA 2K0QA 1E1QD 4MLFB 4NGAH 1FMGA 1TOCB 1MABB 3UNSA 1DUAA 1C5SA 5F53A 1E1RD 1C5NH 1T7CA 2W6JD 5L6NH 1Y5UT 1ZGVA 3A88A 1QRXA 2J4IA 9ESTA 1GMHG 2PTCE 3PMHB 1C5WB 5C2ZA 4K5ZA 3S0NA 3FFGA 4OS5A 2Y5FA 1FIZA 2XCNA 4WH8A 3AASA 2HVYB 2VBCA 2G5VA 4MTBA 5A8YA 5E8EH 2H6MA 2V3MA 4RN6A 4MDSA 2W5EA 3RDZA 1TBQH 3UWIA 1TRYA 5FCKA 1H8DH 3F2HA 1W0ZU 1P2IA 1MTSA 4Y0ZE 2R3UA 3M5OA 4AYYB 1FPHH 5HM2A 1AFEH 1IQKA 3DT0H 1AY6H 1C2MA 1LKAA 1EB2A 1K1JA 4X2VA 2K1QA 1Z6JH 1YY3A 3RXCA 2EI7A 1SGCA 1BMAA 5F8ZA 1UMAH 3MWIU 1LHFH 1O2TA 2Z3EA 1J17T 1C1TA 2FPZA 5A09A 1P2MA 5JBCS 5GNDA 4I8KA 3RXGA 3LGWA 5A0BA 1XM1A 4A5TS 4WMEA 2C90B 2ZCHP 3EGKH 4MPXA 3RM2H 1T4VH 1L4ZA 4P00A 3UNRA 1UTPA 1EAUA 1NFUA 3CS0A 2AIPA 3SO3A 2Y5HA 2HNTE 1ANCA 5EGMA 1P0SH 2J92A 3PLPA 1JWTA 1L4DA 4JMYA 2J98B 1PQAA 4M7GA 4ZXXH 1KXBA 1C5TA 3PRDA 2G52A 4ZXYH 1SGDE 4ABIA 1NZQH 3Q3KA 1QFKH 1W10U 1T31A 3RXPA 2V7QD 5GIBA 1ZLRA 2VWMA 2TGPZ 5B6LA 1F5LA 3ZV8A 5L2ZH 1XUJA 2ZFFH 2PSXA 5EJZA 1AO5A 2WPIS 3PO1B 1OYQA 3UTUH 1CE5A 2ESTE 1K1NA 2PKAB 2NWNA 3ZZ3A 5J4QA 1HJ9A 3MI4A 1W3CA 2GV7A 3F1SB 7ESTE 1GJBB 1SLVB 2F91A 1ANEA 2Z9GA 2JJ1D 4D76A 3BTME 5EJLA 5JB8S 3SNAA 1NU9A 3EAJA 1AIXH 1AKSA 1O2MA 2VNTA 3VXFH 3MU5A 3ODDA 1GI6A 2YNBA 1LKBA 1P2QA 2QF5A 4TPIZ 4ZAEA 4IBLH 1EXFA 1O5GH 3B9FH 5F6MA 1C4Y2 3BTGE 1C1PA 5F8TA 1VJ9U 3MO9A 1LHDH 4Y7AA 2R0KA 5DP9A 3ATKA 2ALVA 3HK3B 3KQ5A 1TNGA 1PQ5A 2ILNA 4Q7XA 3ZZBA 3S7KB 2GCTC 2GDDA 1D9IA 1XVOA 3RXVA 5DG6A 1OOKB 1BB0B 2UUJB 2BY8X 1KY9A 1O3EA 1QRWA 3HK6B 3PO1C 3QO6A 1S84A 2RG3A 4AB9A 1V2LT 5EQQA 1CHOG 4I8GA 5IYTA 4OS2A 3AVZA 5IDKA 4ZHMU 4AG2A 2H2ZA 3GY2A 1GL1A 4JCNA 4UDWH 1MAYA 4FUFA 2UWPA 5FPYA 1CGHA 1GCTB 3E3TA 3MFJA 1HXEH 5E0JA 3TNTA 1IQIA 3A8BA 4KP0A 2QXGA 4Q7ZA 4YTAA 3MMGA 5CE1A 1SLXB 4CRAA 1B7XB 2BHGA 3VPKA 1MZAA 2BM2A 1QBOA 2ZU5A 3BTHE 3M36A 3NKKA 1HB0B 3MNXA 4ZKOU 1GBHA 4OGYA 3QX5H 2XCFA 1OX1A 4X8TH 1TMUH 1FX0B 3A80A 1ZJKA 3LC5A 3OTJE 4OM9A 3BN9A 1TONA 1ELAA 1QY6A 4B74A 1EATA 1QIXB 4YLQH 1ZMLA 2QIQA 3MQKC 1MUEB 1TGNA 1FN6A 3EQ0H 4CH8B 1S6HA 1C5YB 1OYTH 2VVVA 4Z1MD 3ZZ5A 4B2AA 4K69A 4YXWD 2GZ8A 4B71A 4IMZA 1B0FA 2GCHG 4LK4A 5CHBA 1GJCB 1QJ1B 2V3HH 4THNH 2P59A 3K6ZA 1AN1E 2SNWA 3U8OH 1FN8A 4O97A 5C0TA 2AS9A 3PYHA 1GJ6A 2GV6A 4JYTA 3FP8E 2D1JA 1WDIA 1WCZA 5C20A 3BF6H 1GI9B 3B23B 3RU4T 2CHAC 3SI4H 3RP2A 2ZHFH 1BHXB 3G01A 3ZV9A 5C0UA 1W7GH 5JBBS 2ZHEH 3AK5A 3NZIA 4Y6DA 1AU8A 4UFGH 4KGAA 2PSYA 4VGCB 1MBQA 3SU2A 1SGPE 2V0BA 1O2NA 2F9NA 1YPLH 5C1UA 2BXUH 3NWUA 5FBIA 3SGBE 1BRBE 2J94A 2XNIA 2ZHWH 1EZQA 1IQGA 1KXAA 2ZU1A 4KTCA 1O2VA 4X8UH 1S85A 1LO6A 2IPQX 1BTPA 1W12U 4ASHA 3FP6E 3QZRA 1L1GA 3WWFA 1P03A 2FO9A 2BTCE 1A0LA 2OQUA 2FS9A 1AFQC 1O5BB 2O9QA 1YCPH 2GVFA 4X1PU 1EX3A 2KAIB 2BDBA 2SFAA 3K2UA 2ZDVH 5DKMA 3LJOA 1DDJA 4JZIA 1E35B 3F2FA 1AWHB 1HAHH 1LVMA 1HIAA 1MTNC 3UR6A 1PYTD 3CNRA 5TCAA 4VGCC 2JH6D 4B2BA 4I8HA 3SU6A 1FY1A 1O2LA 3F9GA 1OWEA 2Z9KA 2UUYA 1YWUA 3S9CA 2TPIZ 1YPKH 3U28C 1ABJH 2BX4A 4PROA 1XMNB 4IC5A 1DPOA 2YMSB 3SORA 2VWNA 4K1SA 1QHRB 4UD9H 1SC8U 4FUEA 4D7GA 1FUJA 3ZYEA 1XUKA 3M61U 2V3OH 3RLYH 3MNSA 1UK4A 1FLEE 2ZC9H 1DANH 1DXPA 2OC7A 3QK1A 3M5MA 2PFEA 2BY6X 3E1XB 3NCLA 1UHBA 2BXTH 4UFEH 2EY4C 2H9TH 1GBCA 4FU8A 1Z8RA 4ZHAA 2F9UA 1LVYA 3GDUA 3UB0A 4BANB 1MCTA 1EUFA 1DWCH 2PHBA 2F9VA 1E36B 4E06H 2C8YB 1A0HB 2PR3A 3U8TH 1XVMA 3RLWH 1N8OC 3KGPA 4H42U 5DSFA 3CENA 5AFYH 2ZU2A 2ZFRH 1BITA 5A0CA 3T5FH 4FOUC 3RXSA 4LOYH 2OQ5A 2QGRA 3TJNA 1GHAG 1MKWK 2FS8A 2TGTA 1OWDA 1A1RA 1EOLA 3MU4A 3V7TA 1HJAB 1C9PA 1EAIA 4HGCA 1C2FA 4RT1A 2A2QH 5DK1A 1QBVH 1DM4B 1T32A 1TYNA 4AB8A 1A0JA 6GCHF 4MPUA 1NRSH 4GAWA 4O03A 1ESBA 1QQUA 4QT8C 1YGCH 1GJ4H 3GISB 3SNDA 1QB6A 1W0JD 3TVJB 4NSVA 3F2GA 6CHAB 1EB1H 1HAYB 4ZKSU 2JIZD 2XNDD 2OC0A 5ETXA 1Z8GA 1GHBG 1O0DH 3M7QA 1D6WA 2QF4A 2OINA 3SJOA 3TJVA 4XBBA 2P8OC 1WU1A 4Y79A 3C1KA 4E7NA 2SGPE 1FNIA 1BBRE 3TITA 1DFPA 3T27A 3ZZ8A 1PYTC 1GG6C 1OKXA 2VWOA 1D3PB 1D3TB 4A92A 1D3DB 1FIWA 4XD7D 1SFQB 1IQFA 1DVAH 3ATWA 3BTTE 3UQVA 1JOUB 1HJAC 1AVXA 3RXOA 1K1MA 3A7XA 4INLA 2AIQA 1BMNH 4WXVA 1TNLA 1IQEA 1YPJH 3LH3A 3TGJE 1TE0A 2TIOA 1THRH 3TH3H 1TX8A 2G4UA 2EA3A 1Z71A 4TWWA 5FL7D 1CHGA 4GCHG 2BY7X 4TY6A 2PW8H 3UQOA 1TQ7B 3SU1A 3L33A 2XW9A 5HM9A 3A85A 1TB6H 4IGDA 9LPRA 1O2OA 2GP9B 3BIVH 4JYUH 6CHAC 2O8TA 5EXMA 3A7YA 1FY5A 2LELA 1GBBA 4MNWA 3GDSA 3RM0H 1P2JA 3UNQA 4AOQA 4NA9H 1ZJDA 2XOKD 2ALPA 1IQMA 3AW1A 1YPEH 1BCUH 2ZHDA 1HYLA 1FONA 1EP6A 1SG8B 1JBUH 2KCPA 4P02A 3T25A 1HPGA 4K1TA 5HIYA 1ELBA 2XBYA 5FAHA 1UTMA 3FVFB 3RU4E 2C8WB 2OXSA 1UTJA 2FI3E 3O8CA 4ZROA 5JDUB 1NRQH 2WPHS 1OWHA 5HMAA 3TGIE 1SGTA 1GJ9B 1UCYH 1MTWA 3MH4A 3W95A 2UUFB 3BV9B 3DA9B 1KDQB 1SOZA 1Y3VA 1EJMA 2YNAA 2EEKA 1O5FH 5EQRA 3TU7H 2QN5T 1GI0A 3U9AH 1O3OA 2AMPA 1T8NA 1SQOA 1YLNA 1OP0A 2HNTC 2ZWLH 4X6NA 3TH4H 1BBRK 3HATH 1SB1H 4A1XA 4JK5A 3SNEA 5HKKD 1RTLA 1THSH 1A7SA 2QA9E 4NZLA 1O2JA 2FOGA 3W94A 2EI8A 1YPMH 1PQ7A 1C2IA 2QXIA 1C2DA 2WZQA 4FU7A 2ZZUH 1AE5A 3QGJA 4U32A 1ZPCA 1Y5AT 1NN6A 2PKSC 4XFQA 3WY8A 1GI7B 2BLWA 1H8IH 1SGNE 2A5IA 5I25A 2ANYA 1GDUA 2KCYA 4AGJA 1PPHE 1AMHA 2HOBA 2BY5X 2WV4A 1C5VA 1NFXA 1UTNA 5E0GA 1J9CH 1V2UT 1TRNA 4OS1A 1SL3A 1O38A 3PMBB 2XBWA 3PTBA 3OTPA 2ZFSA 1WQVH 2BLVA 3RXFA 1TMBH 1U6QA 2ZPRA 1GWAA 4WY3A 1V2RT 2P93A 3FKSD 1UVUH 1W0KD 1DSTA 3RXUA 4WH6A 1ZYOA 2ZGCA 3LGUA 1QJ6B 3Q00A 3RXTA 1O5CB 2VINA 3U8RH 1ARBA 2B0FA 1O3PB 3I77A 2UWLA 1KLTA 2CXVA 1EZSC 1AGJA 4XDEA 3F9FA 3FP7E 1G2MA 3KCGH 1EFRD 1QJ7B 2QXHA 1PPZA 2EQNA 3QUMP 1O3AA 2OBQA 4JZEH 2BD5A 2BQWB 3Q76A 3SI3H 5DP7A 2XBVA 3VG8A 2Q6FA 5LPRA 1GVZA 4HTCH 2AERH 3EE7A 1AE8H 3UR9A 4R8TB 4BAOB 3RXKA 1NO9H 3W1EA 1G3BA 1KLJH 1N6XA 5GCHF 2FI4E 2WUCA 2THFB 2XC4A 2XXLA 1PPBH 2WPMS 4A1VA 1F0RA 3S7HB 1WSSH 3UUZA 2F9BH 1OWJA 1F5KU 2AMQA 1THPB 2Y81A 4YOIA 2P16A 2R0LA 2FOMB 4CR9A 2XTTB 1CT4E 3BSQA 4CBNA 4Y11E 4XRNA 2Z6BD 5JBAS 1IQLA 1C5LH 3IITA 4NA7A 1NFWA 1SGFG 4GVUA 1GHVH 3LPRA 1VITF 2M5TA 2G8TA 4XBCA 4DT7B 1H8HD 4JYVH 2ZDAH 2ZP0H 1G9IE 1YBWA 2J98A 3TK5A 3KYFA 3RMLH 3RC6A 1LHEH 1G3CA 1UTQA 4DCDA 5T1VA 1C1MA 2A4OA 1OHHD 1O2HA 4NCYA 3KQDA 1HAOH 2C93B 2ZTYA 3ZZ6A 1PFXC 3PLKA 1C1WH 2ZDKA 1VCPA 1ZOMA 5K7RA 2W7UA 1BOQA 1BA8B 1S6FA 4LXBH 1WQSA 2PKAA 2Y7ZA 3SNCA 3SOSA 2IN2A 4X2WA 4IW4E 1RXPA 4ASUD 4RSPA 2BZAA 1PJPA 1SGYE 2C8ZB 5LPEA 3SV6A 1ZPZA 3STIA 4OGXA 3SUGA 4DURA 5EPNA 2ZGBH 1TA6A 1E0FD 4Y10E 1GHWH 3URDA 1MU6B 3EA8A 4FUBA 5DO4H 1B0EA 1W8BH 3JZ2B 1SPJA 3F68H 1BRCE 3MNBA 1GBLA 1L0ZA 2Y6TA 4UE7H 1HAVB 1JMOH 3E16B 2B8OH 5L30H 2PGBB 1K1PA 4WVPE 7GCHF 4ZMAH 3PV2A 2VIOA 2JDID 1TALA 4ABEA 1VITH 2A1DB 1C1VH 1DE7H 1EQ9A 4Y8XA 1MTUA 2ANWA 2FXRA 1BMLA 2RFKC 2BZ6H 2G00A 1ELEE 4FVDA 3EA9A 3QTVH 1KXFA 1DX5M 2QYIA 1O2ZA 2WPDD 1Y5BT 4D9QA 1DWDH 1KXDA 1GPZA 4SGBE 1HFDA 1TNIA 1C5QA 1VCWA 1RTFB 1JRTA 5GXPA 2H5DA 5DJ7A 1WV7H 4YOGA 4Q2KA 3MO6A 4ZKRU 2GT7A 1QQ4A 1Q3XA 3V13A 4ABJA 4B75A 4KELA 2HLCA 3O8DA 1LCYA 3DSPA 2VJ1A 4NIWA 3VB3A 3SW2B 3E8LA 4CRCA 5BPEA 3LH1A 1ZHMA 4INHA 1K9OE 3P8GA 2F3CE 2J9NA 3GDVA 2Y7XA 5GPIB 1COWD 2BOKA 1V3XA 1F2SE 1C4U2 5KECA 3GICB 1FZZA 4ZCNA 5H4IB 1QGFA 4YOJA 2A5AA 4BAMB 3M3TA 3RU4D 1GMCF 4JZ1A 4DVAU 3MU8A 3SHCH 4BXWA 3BTEE 2I6SA 1C2JA 2QC2A 2ZFTA 1YM0A 4AG1A 1O31A 2LNCA 3M3SA 1HJ8A 2BD8A 4MVNA 5EW2H 3MH7A 3ZZAA 1ARCA 4YM9A 2GCHF 4RI0A 3RXEA 3WW7A 1GDQA 1ANBA 1ZHPA 4X8SH 3ZVBA 1ZRBA 1V2KT 4B73A 1DICA 2HLDD 2F4LA 1HCGA 2BDYA 2C3SA 4WF8A 4TT3D 1KSNA 1FAXA 5E0HA 1OWKA 1W7XH 2PWXA 1T4UH 1UVOA 1GMDF 4FUGA 2BY9X 1TPPA 2Z7FE 1CQQA 4K8YA 4MG3A 1GCTC 4DIHH 5FBEA 1GI1A 1HAZB 3SUEA 2BLOA 1QZ8A 3A82A 1C5MD 4I33A 3UWJH 1K2I1 1GHYH 1K1OA 2VVCA 1EOJA 3E0NB 1HLTH 1C4V2 1ETSH 1YPGH 3M5NA 3Q3XA 1GI2A 3H7TA 3UOUA 1O34A 3OSYA 4BTIB 1SBWA 3LOXA 2FEQH 4J2YB 1G36A 1WYKA 2NU0E 1IQJA 3QTOH 3SJIA 1EAWA 4X1QU 2CGAA 1MQ6A 2KAIA 3LGIA 1GBDA 1EKBB 1UO6A 3M5LA 5HXFA 3LGYA 2WYJA 2AHME 5HYOA 1GJDB 1GBEA 4AFQA 1C2KA 3OE7D 3LONA 5C3NA 5FX5A 5GDSH 1GVLA 1S6LA 3KIDU 3LJJA 3UY9A 4B76A 2ANMH 2TGAA 3FZDA 3E91A 3NXPA 1HXFH 4J1YA 1DOJA 1OS8A 2YMSD 4WMFA 1C1SA 3D23A 4I7YH 4CRGA 3T2NA 4FUHA 3AW0A 2JH5D 3K9XB 2VIDA 1QRZA 4AX9H 2SGQE 3PM3A 3VGCB 1D6RA 1Y3XA 1FY4A 1K0HA 3MU1A 3OEED 1O2XA 1P06A 2WPLS 3AAUA 1GJ7B 2OC8A 1ZTJA 2O8UA 1RS0A 1MQ5A 1J16A 2UUKB 1SVPA 3UFAA 1OP8A 1Z6EA 4HI3A 1ANDA 4DW2U 1P11E 1NESE 3SGAE 2BDIA 2A31A 2ZU4A 1TFXA 3EDXB 2CF8H 5HIZA 3V0XA 1NU7B 2VB0A 2NU2E 4Y8ZA 1SOTA 1NT1A 3RXIA 3S9BA 1JRSA 4CRDA 4CR5A 3ZZCA 5GWZA 4DIIH 4MNXA 4AZ2B 4K2YA 2WHXA 1ELVA 3A8AA 2GT8A 3OY5U 8KME2 2J2UA 1J14A 1V2NT 4X6PA 1T8LA 3SYJA 5F03A 3U98H 2V6NA 1GI3A 1WTGH 2A45B 1FJSA 2QV1A 4X1NU 4DGJA 3KL6A 1C2LA 3VXEH 3VGCC 4HFPB 3DHKH 1ZR0A 1NRNH 4XBDA 4X6MA 1V2QT 3L6PA 1E34B 1ZTKA 3KN2A 3OAAD 5C5NA 3BTDE 1Y59T 1HDTH 3SBKA 1P09A 1V2OT 5B6OA 2TBSA 3M3VA 3ATLA 1P10A 3DSGA 1G2LA 1IHSH 3E0PB 5TCCA 1V2WT 1J8AA 4IC6A 4LZ1H 2J34A 1EASA 1AB9B 2ZG0H 3LIWA 5LPFA 3LKWA 3Q77A 4JZFH 1AWFH 1C2EA 3SN8A 1A5IA 2P3UB 5FHTA 2FOHA 5T6GA 4MNYA 2AGGX 1S81A 1KTSB 4X1SU 3I78A 4KKDA 1DT2A 1P9UA 3BG8A 1G3DA 3RMMH 2JH0D 1BJVA 2B5TB 1SGFA 1TABE 1OWIA 4CRBA 1YCPK 3NPSA 3ATIA 1GBAA 2YMSC 2BD9A 2F9PA 1MD7A 4FUJA 3RMNH 3RUOA 1EPTB 4BNRA 4ZKNU 3DUXH 3GCTF 2OTVA 2OP9A 1P12E 4BAQB 4K60A 3TJOA 1W0YH 3OU0A 2FOAA 1ELTA 2GD4B 2NU4E 1TA2A 4GCHF 4ISOA 4UFFH 3V12A 1QCPA 4BXSA 1VJAU 5T3HA 1AB9C 2K8IA 2O8WA 2R3YA 3KHVA 2G51A 1NFYA 1MKXH 1P3CA 3U1IB 1O5AB 1SHYA 3VEQB 4AN7A 4RKOB 2ZI2H 2NU1E 5EXLA 4YT6H 4ABGA 3BEFB 1O3CA 1GBMA 1C5RA 4ABFA 3KQBA 2HALA 1ZMNA 4ACAA 1O2GH 2FX4A 1WOFA 3KYGA 1V2JT 2ZCKP 1NS3A 3KQCA 1KDQA 7KMEH 1OP2A 3ZVAA 3NUMA 5GJ4B 1NBME 2Y5GA 3BEUA 1N1LA 2JETB 1ELDE 3LGTA 6GCHG 2H9EH 1BMFD 3B8JA 1S0QA 5E2OA 1AVWA 1YLCA 1SLWB 1TGBA 1CT0E 1TIOA 1BTWA 3F6UH 1O2WA 1TOMH 3V3MA 1P2NA 1DITH 1FQ3A 2GDEH 1S83A 4ABAA 1C1NA 2WYGA 5AVDA 5EU8A 3GY5A 5FXLA 1H9HE 2KR7A 1NRPH 2QF3A 5EODA 2GKVE 2TGDA 1G3EA 1VCQA 2IPHA 3STJA 5EW1H 4GSOA 3M7TA 1LPGB 1ETRH 3MU0A 2SGEE 4H4FA 3KQEA 3RC5A 1LHCH 1NC6A 1H4WA 2ZDLA 1S0RA 2C8XB 3NRLA 3F0PA 3PWBA 2BD2A 4NG9H 4Y7BA 2ZA5A 3BIUH 4NIVA 1QL7A 4D9RA 3S69A 1UTKA 1SGRE 3A89A 3ENSB 4WJG2 1ZSKA 1WBGB 3UAIC 1UCYE 1ELGA 1ACBE 3F9HA 4LZ4B 2G4TA 1HAGE 3ZVGA 3BTKE 3HKIB 4BAKB 3M35A 4INKA 1BTZA 1FDPA 1XXFA 5C5OA 1AVGH 2PGQB 3T62A 5DP5A 3A84A 4AFZA 2H5CA 2J97A 2FWWA 1DY8A 1O3FA 2Q6GA 3SZNA 3SU4A 2BD4A 1SGIB 4NIXA 4ZH8A 1MZDA 2BQ7B 1BIOA 3PV4A 1TPOA 3FO8D 1Q31A 2AYWA 1MH0A 1F0UA 1RIWB 3GY8A 1LTOA 1C5XB 1A5HA 3R0FA 1E37B 3P8FA 2FZZA 1F5RA 2ANKH 1G30B 1P9SA 1YPHE 1GBKA 4B6FA 1ORFA 1SKYE 1BDAA 2B9LA 2GZ7A 2CF9H 1AHTH 4UFDH 5JB9S 2AFQB 2FOFA 1TNKA 3QN7A 1TGCA 1TNHA 3LDXH 2F83A 4RKJB 4I86A 2PUQH 3GYMA 4B1TA 3SV2H 1UW7A 1QB9A 4D7FA 1QNJA 2FM2A 2Z3DA 1BRAA 1N6YA 1VR1H 8GCHF 4X8VH 1LQDB 3MYWA 2G5NA 2A4GA 1P01A 4AFUA 4F4OC 1FV9A 1BUIA 1BQYA 2NU3E 1W2KH 4I8JA 1SHHB 2KCAA 4H6SB 3PWCA 3DD2H 1UK2A 1BTHH 1GVKB 1JXPA 2FOEA 1C1UH 2RA3A 1HRTH 1O3IA 1UCYK 2QAAA 3SU0A 1GMHF 2RCEA 1HV7A 1ZGIA 2FLBH 1XUGA 2GZ9A 1A5GH 2FOCA 5A8XA 4XE4A 1O3MA 5PTPA 3KNXA 3VB4A 3F9EA 1Y3YA 5DP3A 3ZVEA 1BT7A 5KGOA 4Q7YA 2WUBA 5IK2D 3SJKA 2ZCLP 1GHXH 2Y82A 1L1JA 1V2VT 1XUHA 2PTNA 3A8DA 2XC0A 2ZEBA 3U1JB 4GHQA 1AZZA 1XUIA 3LC3A 4FU9A 3PRBA 3RXBA 1O3JA 1C9TA 5G4BA 2HNTF 1W14U 2BX3A 5DP8A 1XKAC 3T28A 3TIUA 1C5UA 2F9OA 2J38A 4R0IA 4ZHLU 3ELAH 2ZGXH 2STBE 3EE0B 2BLQA 1KLIH 5K0HA 1F0SA 1MCVA 4MQAA 1FY8E 3SNBA 1Z1IA 3F3BA 2FI5E 4OS7A 2FODA 2VIWA 1FI8A 3D62A 3P8OA 2ODPA 1GBFA 2DE9A 3N7OA 2RDEA 4K8BA 3A81A 3CP7A 3L3TA 5L2YH 2CJIA 1FY3A 5AFZH 1AI8H 1C2HA 2A2XH 2VVUA 3M7UA 2A5KA 3A87A 2VH0A 2ZTXA 2KZ4A 2PP6A 1HAVA 1AQ7A 4TPYA 1H8ED 1C5ZB 5KEDA 2WSSD 5GCHG 4FUCA 4IN1A 2CN0H 4BTTB 2J5UA 1UVPA 1DUEA 3SQHE 2Z3CA 1PQ8A 2SNVA 3A8CA 5AHGH 2JKHA 1TMTH 4ABBA 1A4WH 1LDTT 1WXRA 1O3KA 3MNCA 1P3EA 4K1EA 3WWBA 1ELCA 1QL8A 5C67A 4ISNA 1L2EA 1GL0E 1D4PB 2SGDE 1GJAB 1LPKB 2BVRH 2CV3A 2FYQA 2VU8E 4Z6AH 4OS4A 2BD7A 1BRUP 4Y71A 1O2QA 5J4SA 2GGVB 1QURH 2HPPH 2VWLA 1SQAA 2KCOA 1LVOA 3N7EA 5A0AE 1ZPBA 2EI6A 1NPMA 1P2OA 1QL9A 3FANA 3ZVFA 1VITG 2ZF0H 2L74A 1TQ0B 4TSFD 3ZZ7A 2R2MB 3IWMA 2BDGA 3ZZDA 2Z9JA 2ZDNA 1T8MA 2GJGA 1YP9A 1S5SA 3E6PH 3TGKE 1SGEE 1SLUB 2UWOA 3P92A 4CREA 2ZKSA 2ZQ2A 3S9AA 1OSSA 1CVWH 1KMHB 2TRMA 1K28D 3RXLA 2ZFPH 1H9LB 5F8XA 3HKJB 3QWCH 3SQEE 2Y80A 1SGQE 3H09A 1C2GA 3BTFE 1AZ8A 3N99A 4NSYA 2ZGJA 2FIRH 2GCTB 3SV7A 1MTVA 1UK3A 3SUFA 2G55A 2ZFQH 1ESAA 1DWBH 2WV9A 5EIYA 1O3LA 1CHOF 2ZQ1A 5C17A 3I29A 1RGQA 2KFWA 2ODYB 2SGFE 5EXNA 3SU5A 1CT2E 2Q1JA 6LPRA 3PMAB 3QGNB 1YLDA 1IHTH 2CMYA 3MOCA 1GBJA 3O8BA 3PV5A 1MBMA 4JZDH 4Y8YA 5EG4A 4ISLA 4YESB 3SV9A 2KM0A 1ZSJA 2BOHB 1O5EH 3HGNA 1GI8B 1NBMD 3ZVDA 3CS7A 1C1OA 2XYAA 4TWYA 1KXEA 2VIPA 4ISHH 4F48B 5TJXA 3UIRA 2XWBI 5FX6A 5ESBA 1P2KA 3ATMA 7LPRA 1IOEA 1O3NA 1XKBC 1FXYA 7GCHG 1UTLM 1SR5C 1PPGE 5JBTA 3QDZB 1YYY1 2QF0A 3TJUA 2ZNKH 2FESH 3RXRA 1V2PT 2FX6A 1VKYA 1TPAE 2P94A 4HG6A 3VB6A 3F0OA 4ACBA 2VIVA 2FTLE 4A1TA 1QA0A 1K1IA 1BTXA 1O2IA 2HWLB 2VIQA 3PTNA 3SV8A 1MU8B 1AKSB 2Z9LA 1O36A 2P95A 4Q80A 1O3DA 1C5PA 3SU3A 1NTPA 2A4QA 2ZDMA 3RMOH 3LGVA 5T6DA 2WPKS 2P3FH 3ZIAD 1GI5A 3E90B 3MH5A 4YT7H 1CO7E 1L1NA 1CGIE 4I8LA 3H7OA 1Q2WA 4ISIH 3P6ZB 2B7DH 5DP4A 2V35A 4M9FA 3PROA 3BG4B 1O3HA 1UTOA 3PMJA 3ZZ9A 4GPGA 1LQEA 2CHAB 1HUTH 1O2YA 4O9VA 2ZECA 1Z1JA 1KYNA 1GI4A 3VB7A 4SGAE 4NFEA 2HVXA 1EAXA 3H5CB 1O2PA 5JPMH 2BMGB 3T26A 5EPYA 1DLEA 3FOAA 4NA8A 3SJ8A 3U69H 1F92A 1GJ8B 1GMCG 5DP6A 3KEEA 4DT4A 2J95A 2HGTH 3URCA 1Y8TA 1C1RA 2BQ6B 4H6TA 3DSOA 3TH2H 1TX7A 3N7DA 4CRFA 1DXWA 4O3TA 4GUXA 2O8LA 5FCRA 2QE7D 3UREA 2PV9B 1TRMA 3M37A 4DG4A 2OD3B 1GDNA 1AFQB 1DY9A 2O8MA 3BG4C 2FOBA 1BJUA 1AUJA 1TGTA 4UEHH 3K65B 5CMXH 2D26C 5C1YA 4U01A 2ODQA 1ZZZA 1Z8IB 1MTNB 3MHWU 2IOTA 3AAVA 1GMDG 3DCLA 1P05A 2VGCB 5C94A 3TPIZ 4BOHA 1CBWB 1GCDA 3IG6B 3ZZ4A 3QLPH 3A7VA 2H9HA 3FZZA 1ZHRA 3BTWE 2QXJA 2LPRA 4TY7A 2EC9H 4AC9A 2BB4A 2ZPSA 5LH8A 1MMJN 4XSKU 1YC0A 1LPZB 3GCOA 1MKWH 1Y3UA 5BRRE 2IJOB 2AH4X 4MNVA 4BTUB 2BVSH 4FUIA 3MO3A 1IQHA 3PB1E 4Y76A 1E38B 2ZIQH 2FDAA 3LU9B 1JIMA 1TGSZ 6ESTA 1XXDA 3ZVCA 1O2SA 1ABIH 1GBTA 3RXJA 1RJXB 2L6OA 3RXQA 4HZHA 1GHAF 1N8OB 1XUFA 2VGCC 4UONA 2I6QA 2IJD1 4E7RG 1H9IE 3GY7A 1O39A 1CBWC 1KTTB 1EPTA 1PPFE 2R2WU 2ZU3A 1DLKB 1EJAA 3P17H 3RXHA 3UPEA 1YPHC 1S82A 4NWLA 5T6FA 2OBOA 1O2RA 4NIYA 4A7IB 5EJ1A 5JYIA 2DE8A 1ETTH 3JZ1B 3TLOA 2WV5A 2WINI 4CBOA 1XX9A 2RA0A 1P57B 2A32A 2FMJA 1MAXA 3OYPA 3A7WA 4X0WU 3VB5A 1LVBA 1P04A 3ESTA 2HPQH 2C4FH 2A4RA 4OS6A 1GHBF 1F0TA 2OC1A 1EZUC 2BVXH 1WAYB 1HIAB 2GTBA 4CH2B 1M9UA 2BDAA 4AGKA 1V2TT 3C27B 1MD8A 5C1XA 2Z9IA 3GCNA 1TX6A 2XRCA 1QA7A 2KX4A 2A7CA 4BAHB 2ZTZA 2W3KA 2W6ID 2P8OB 1G37A 4E05H 3RXAA 1DS2E 3SGQE 4IS5A 4WMDA 3SHAH 2WPJS 1GG6B 1RD3B 4Z0KA 3A83A 1YKTA 4B2CA 5FPTA 3GOVB 1V2ST 3D65E 1SMFE 3P95A 5DN6D 2LP6A 1NM6A 3SUDA 1X7AC 4U2WA 1PPEE 1IQNA 3FAOA 1TBRH 1A46H 5CHAB 2QY0B 1K21H 2W7SA 4A6LA 1UHBB 1TBZH 4WWYA 4YO9A 1BHXF 2XWAA 1ZRKA 1HGTH 2D8WA 4NFFA 1P8VC 2PLXA 2FYRA 3QZQA 1YF4A 1O3BA 4IN2A 5HGGA 4ABHA 3ITIA 1HNEE 1RTKA 1AD8H 4F55A 3GY6A 1UVSH 4X2XA 4KTUA 5ABWA 1BBRH 1C1QA 1P02A 5LGOA 2JJ2D 1ZSLA 4JK6A 2AGEX 5EQSA 2BYAX 1O30A 1EPTC 4ESTE 4CHAB 3OX7U 1TAWA 4O3UA 1DWEH 3OY6U 1CGJE 1NROH 1RFNA 1TNJA 1HAPH 2QCYA 3GCHB 5DGJA 3GCTG 4IMQA 2A0QB 2OUAA 3BEIB 4Q63A 4X2YA 1HBTH 2A7HA 2Z94A 1A3EH 1IAUA 4XOJA 3Q3YA 3RXDA 5CHAC 1DSUA 3P8NA 1BZXE 1YCPM 1K1LA 2PUXB 5FPSA 4X1RU 4TYDA 5DPAA 1O33A 1W13U 3MTYA 3R3GB 4DY7B 1AUTC 2CK3D 3EA7A 2ZHQH 1ESTA 1FPCH 3OEHD 3UOPA 1NY22 4MPWA 1BTUA 2G81E 4GHTA 1B5GH 2GMTB 4GLYA 1O2KA 1TLDA 3LT3A 1BMMH 1RRKA 1SFIA 1EP5A 2AEIH 2A7JA 1T8OA 2FP7B 2ZO3H 2PKSB 4CHAC 1CA0B 4K3JA 2XC5A 1D3QB 4X6OA 2R9PA 2JETC 1GGDB 4FXGH 1OPHB 3A7TA 3GCHC 4I32A 3SJ9A 5I46H 4AYVB 1MKXK 5ESTE 2OLGA 3GS9A 1FAKH 2SGAA 1J15A 4FETA 4B6EA 1SQRA 2BDHA 4DJZB 1G32B 3K6YA 8ESTE 1BTYA 2BDCA 1TWXB 2ZGHA 2BD3A 1PPCE 3FN8A 1WTHD 1SSXA 4WXIA 1CSOE 1Z8JB 4Q4LA 1O3GA
chains in the Genus database with same CATH topology
2ASUB 1V2MT 2STAE 1V6DA 5E2PA 1UJ1A 3PLBA 1W11U 3DFLA 2GMTC 2D2DA 8LPRA 1SQTA 2YOLA 1LHGH 1QBNA 3KF2A 1QB1A 4DOQA 2VH6A 5A2MH 3NK8A 3T29A 4F49A 3VFEA 1Y3WA 2FTMA 1VGCB 4D8NA 4FUDA 1CA0C 1K22H 1LMWB 3GY3A 1O37A 1GJ5H 1INCA 1GGDC 1HAXB 3MH6A 3D49H 1O5DH 1UVTH 3GYLB 3A86A 5AF9H 2P3TB 4ABDA 1OXGA 2W26A 1EJNA 5EOKA 2AGIX 1QR3E 1QTFA 2OCVB 2XBXA 3TK6A 3O8RA 1TPSA 2Q6DA 2GX4A 4MPVA 3RC4A 1RIWC 1KXCA 1CU1A 3P70B 4I31A 4U30A 1A3BH 1ZTLA 2W3IA 3HGPA 4Y0YE 3ODFA 4NWKA 1NRRH 1GHZA 4YZUA 3DFJA 1GBIA 2DUCA 1KIGH 1F7ZA 1H1BA 1ELFA 3TK9A 1VZQH 4AFSA 2FLRH 2HRVA 3EYDA 1ZMJA 2ZPQA 1A2CH 2H1UA 4AORA 1O32A 1VGCC 1HAIH 1Z7KA 1JIRA 1O35A 4FVBA 4ZUHA 2ULLA 3A7ZA 3TNSA 4KTSA 3GY4A 1O2UA 4NZQA 1WUNH 3BTQE 5SGAE 1EZXC 1A61H 8GCHG 5A8ZA 3RXMA 3ZYDA 1CA8B 1SI5H 1ID5H 4YLUA 2AMDA 3HPTB 1C5OH 2RDLA 4NGAH 4MLFB 1FMGA 1TOCB 3UNSA 1DUAA 1C5SA 1C5NH 1T7CA 5L6NH 1Y5UT 1ZGVA 3A88A 1QRXA 2J4IA 9ESTA 1GMHG 2PTCE 3PMHB 1C5WB 5C2ZA 4K5ZA 3S0NA 3FFGA 4OS5A 2Y5FA 1FIZA 2XCNA 4WH8A 3AASA 2G5VA 4MTBA 5A8YA 5E8EH 2H6MA 4RN6A 4MDSA 2W5EA 3RDZA 1TBQH 3UWIA 1TRYA 5FCKA 1H8DH 1W0ZU 1P2IA 1MTSA 4Y0ZE 2R3UA 3M5OA 4AYYB 1FPHH 5HM2A 1AFEH 1IQKA 3DT0H 1AY6H 1C2MA 1LKAA 1EB2A 1K1JA 4X2VA 2K1QA 1Z6JH 3RXCA 2EI7A 1SGCA 1BMAA 5F8ZA 1UMAH 3MWIU 1LHFH 1O2TA 2Z3EA 1J17T 1C1TA 2FPZA 5A09A 1P2MA 5JBCS 4I8KA 3RXGA 3LGWA 5A0BA 1XM1A 4A5TS 4WMEA 2C90B 2ZCHP 3EGKH 4MPXA 3RM2H 1T4VH 1L4ZA 3UNRA 1UTPA 1EAUA 1NFUA 3CS0A 2AIPA 3SO3A 2Y5HA 2HNTE 1ANCA 5EGMA 1P0SH 2J92A 3PLPA 1JWTA 1L4DA 4JMYA 1PQAA 4M7GA 4ZXXH 1KXBA 1C5TA 2G52A 4ZXYH 1SGDE 4ABIA 1NZQH 3Q3KA 1QFKH 1W10U 1T31A 3RXPA 5GIBA 1ZLRA 2VWMA 2TGPZ 1F5LA 3ZV8A 5L2ZH 1XUJA 2ZFFH 2PSXA 1AO5A 2WPIS 3PO1B 1OYQA 3UTUH 1CE5A 2ESTE 1K1NA 2PKAB 2NWNA 3ZZ3A 5J4QA 1HJ9A 3MI4A 1W3CA 2GV7A 3F1SB 7ESTE 1GJBB 1SLVB 2F91A 1ANEA 2Z9GA 4D76A 3BTME 5JB8S 3SNAA 1NU9A 3EAJA 1AIXH 1AKSA 1O2MA 2VNTA 3VXFH 3MU5A 3ODDA 1GI6A 2YNBA 1LKBA 1P2QA 4TPIZ 4ZAEA 4IBLH 1EXFA 1O5GH 3B9FH 5F6MA 1C4Y2 3BTGE 1C1PA 5F8TA 1VJ9U 3MO9A 1LHDH 4Y7AA 2R0KA 5DP9A 3ATKA 2ALVA 3HK3B 1TNGA 1PQ5A 2ILNA 4Q7XA 3ZZBA 3S7KB 2GCTC 2GDDA 1D9IA 1XVOA 3RXVA 5DG6A 1OOKB 1BB0B 2UUJB 2BY8X 1KY9A 1O3EA 1QRWA 3HK6B 3PO1C 3QO6A 1S84A 2RG3A 4AB9A 1V2LT 5EQQA 1CHOG 4I8GA 5IYTA 4OS2A 3AVZA 5IDKA 4ZHMU 4AG2A 2H2ZA 3GY2A 1GL1A 4JCNA 4UDWH 1MAYA 4FUFA 2UWPA 5FPYA 1CGHA 1GCTB 3E3TA 3MFJA 1HXEH 5E0JA 3TNTA 1IQIA 3A8BA 4KP0A 2QXGA 4Q7ZA 4YTAA 3MMGA 5CE1A 1SLXB 4CRAA 1B7XB 2BHGA 3VPKA 1MZAA 2BM2A 1QBOA 2ZU5A 3BTHE 3M36A 3NKKA 1HB0B 3MNXA 4ZKOU 1GBHA 4OGYA 3QX5H 2XCFA 1OX1A 4X8TH 1TMUH 3A80A 1ZJKA 3LC5A 3OTJE 3BN9A 1TONA 1ELAA 1QY6A 4B74A 1EATA 1QIXB 4YLQH 1ZMLA 2QIQA 1MUEB 1TGNA 1FN6A 3EQ0H 4CH8B 1S6HA 1C5YB 1OYTH 2VVVA 3ZZ5A 4B2AA 4K69A 2GZ8A 4B71A 4IMZA 1B0FA 2GCHG 4LK4A 1GJCB 1QJ1B 2V3HH 4THNH 2P59A 3K6ZA 1AN1E 2SNWA 3U8OH 1FN8A 4O97A 2AS9A 3PYHA 1GJ6A 2GV6A 4JYTA 3FP8E 2D1JA 1WCZA 5C20A 3BF6H 1GI9B 3B23B 3RU4T 2CHAC 3SI4H 3RP2A 2ZHFH 1BHXB 3G01A 3ZV9A 1W7GH 5JBBS 2ZHEH 3NZIA 4Y6DA 1AU8A 4UFGH 4KGAA 2PSYA 4VGCB 1MBQA 3SU2A 1SGPE 2V0BA 1O2NA 2F9NA 1YPLH 5C1UA 2BXUH 3NWUA 5FBIA 3SGBE 1BRBE 2J94A 2XNIA 2ZHWH 1EZQA 1IQGA 1KXAA 2ZU1A 4KTCA 1O2VA 4X8UH 1S85A 1LO6A 4ASHA 1BTPA 1W12U 3FP6E 3QZRA 1L1GA 1P03A 2FO9A 2BTCE 1A0LA 2OQUA 2FS9A 1AFQC 1O5BB 2O9QA 1YCPH 2GVFA 4X1PU 1EX3A 2KAIB 2BDBA 2SFAA 3K2UA 2ZDVH 5DKMA 3LJOA 1DDJA 4JZIA 1E35B 1AWHB 1HAHH 1LVMA 1HIAA 1MTNC 3UR6A 1PYTD 5TCAA 4VGCC 2JH6D 4B2BA 4I8HA 3SU6A 1FY1A 1O2LA 3F9GA 1OWEA 2Z9KA 2UUYA 3S9CA 2TPIZ 1YPKH 1ABJH 2BX4A 4PROA 1XMNB 4IC5A 1DPOA 3SORA 2VWNA 4K1SA 1QHRB 4UD9H 1SC8U 4FUEA 4D7GA 1FUJA 3ZYEA 1XUKA 3M61U 2V3OH 3RLYH 3MNSA 1UK4A 1FLEE 2ZC9H 1DANH 1DXPA 2OC7A 3QK1A 3M5MA 2PFEA 2BY6X 3E1XB 3NCLA 1UHBA 2BXTH 4UFEH 2H9TH 1GBCA 4FU8A 1Z8RA 4ZHAA 2F9UA 1LVYA 3GDUA 4BANB 1MCTA 1EUFA 1DWCH 2PHBA 2F9VA 1E36B 4E06H 2C8YB 1A0HB 2PR3A 3U8TH 1XVMA 3RLWH 1N8OC 3KGPA 4H42U 3CENA 5AFYH 2ZU2A 2ZFRH 1BITA 5A0CA 3T5FH 3RXSA 4LOYH 2OQ5A 2QGRA 3TJNA 1GHAG 1MKWK 2FS8A 2TGTA 1OWDA 1A1RA 1EOLA 3MU4A 3V7TA 1HJAB 1C9PA 1EAIA 4HGCA 1C2FA 2A2QH 5DK1A 1QBVH 1DM4B 1T32A 1TYNA 4AB8A 1A0JA 6GCHF 4MPUA 1NRSH 4GAWA 4O03A 1ESBA 1QQUA 4QT8C 1YGCH 1GJ4H 3GISB 3SNDA 1QB6A 3TVJB 4NSVA 6CHAB 1EB1H 1HAYB 4ZKSU 2OC0A 5ETXA 1Z8GA 1GHBG 1O0DH 3M7QA 1D6WA 2OINA 3SJOA 3TJVA 4XBBA 2P8OC 1WU1A 4Y79A 3C1KA 4E7NA 2SGPE 1FNIA 1BBRE 3TITA 1DFPA 3T27A 3ZZ8A 1PYTC 1GG6C 1OKXA 2VWOA 1D3PB 1D3TB 4A92A 1D3DB 1FIWA 1SFQB 1IQFA 1DVAH 3ATWA 3BTTE 3UQVA 1JOUB 1HJAC 1AVXA 3RXOA 1K1MA 3A7XA 4INLA 2AIQA 1BMNH 4WXVA 1TNLA 1IQEA 1YPJH 3LH3A 3TGJE 1TE0A 2TIOA 1THRH 3TH3H 1TX8A 2G4UA 2EA3A 1Z71A 4TWWA 1CHGA 4GCHG 2BY7X 4TY6A 2PW8H 3UQOA 1TQ7B 3SU1A 3L33A 2XW9A 5HM9A 3A85A 1TB6H 4IGDA 9LPRA 1O2OA 2GP9B 3BIVH 4JYUH 6CHAC 2O8TA 5EXMA 3A7YA 1FY5A 1GBBA 4MNWA 3GDSA 3RM0H 1P2JA 3UNQA 4AOQA 4NA9H 1ZJDA 2ALPA 1IQMA 3AW1A 1YPEH 1BCUH 2ZHDA 1HYLA 1FONA 1EP6A 1SG8B 1JBUH 3T25A 1HPGA 4K1TA 1ELBA 2XBYA 5FAHA 1UTMA 3FVFB 3RU4E 2C8WB 2OXSA 1UTJA 2FI3E 3O8CA 4ZROA 5JDUB 1NRQH 2WPHS 1OWHA 5HMAA 3TGIE 1SGTA 1GJ9B 1UCYH 1MTWA 3MH4A 3W95A 2UUFB 3BV9B 3DA9B 1KDQB 1SOZA 1Y3VA 1EJMA 2YNAA 2EEKA 1O5FH 5EQRA 3TU7H 2QN5T 1GI0A 3U9AH 1O3OA 2AMPA 1T8NA 1SQOA 1OP0A 2HNTC 2ZWLH 4X6NA 3TH4H 1BBRK 3HATH 1SB1H 4A1XA 4JK5A 3SNEA 1RTLA 1THSH 1A7SA 2QA9E 4NZLA 1O2JA 2FOGA 3W94A 2EI8A 1YPMH 1PQ7A 1C2IA 2QXIA 1C2DA 4FU7A 2ZZUH 1AE5A 3QGJA 4U32A 1ZPCA 1Y5AT 1NN6A 2PKSC 4XFQA 3WY8A 1GI7B 2BLWA 1H8IH 1SGNE 2A5IA 5I25A 2ANYA 1GDUA 4AGJA 1PPHE 1AMHA 2HOBA 2BY5X 2WV4A 1C5VA 1NFXA 1UTNA 5E0GA 1J9CH 1V2UT 1TRNA 4OS1A 1SL3A 1O38A 3PMBB 2XBWA 3PTBA 2ZFSA 1WQVH 2BLVA 3RXFA 1TMBH 1U6QA 2ZPRA 1GWAA 4WY3A 1V2RT 2P93A 1UVUH 1DSTA 3RXUA 4WH6A 1ZYOA 2ZGCA 3LGUA 1QJ6B 3Q00A 3RXTA 1O5CB 2VINA 3U8RH 1ARBA 2B0FA 1O3PB 3I77A 2UWLA 1KLTA 2CXVA 1EZSC 1AGJA 4XDEA 3F9FA 3FP7E 1G2MA 3KCGH 1QJ7B 2QXHA 1PPZA 3QUMP 1O3AA 2OBQA 4JZEH 2BD5A 2BQWB 3Q76A 3SI3H 5DP7A 2XBVA 2Q6FA 5LPRA 1GVZA 4HTCH 2AERH 1AE8H 3UR9A 4R8TB 4BAOB 3RXKA 1NO9H 1G3BA 1KLJH 1N6XA 5GCHF 2FI4E 2WUCA 2THFB 2XC4A 2XXLA 1PPBH 2WPMS 4A1VA 1F0RA 3S7HB 1WSSH 3UUZA 2F9BH 1OWJA 1F5KU 2AMQA 1THPB 2Y81A 4YOIA 2P16A 2R0LA 2FOMB 4CR9A 2XTTB 1CT4E 3BSQA 4CBNA 4Y11E 2Z6BD 5JBAS 1IQLA 1C5LH 3IITA 4NA7A 1NFWA 1SGFG 4GVUA 1GHVH 3LPRA 1VITF 2M5TA 2G8TA 4XBCA 4DT7B 4JYVH 2ZDAH 2ZP0H 1G9IE 1YBWA 3TK5A 3RMLH 3RC6A 1LHEH 1G3CA 1UTQA 4DCDA 1C1MA 2A4OA 1O2HA 4NCYA 3KQDA 1HAOH 2C93B 2ZTYA 3ZZ6A 1PFXC 3PLKA 1C1WH 2ZDKA 1VCPA 1ZOMA 5K7RA 2W7UA 1BOQA 1BA8B 1S6FA 4LXBH 1WQSA 2PKAA 2Y7ZA 3SNCA 3SOSA 2IN2A 4X2WA 4IW4E 1RXPA 4RSPA 2BZAA 1PJPA 1SGYE 2C8ZB 5LPEA 3SV6A 1ZPZA 3STIA 4OGXA 3SUGA 4DURA 5EPNA 2ZGBH 1TA6A 1E0FD 4Y10E 1GHWH 3URDA 1MU6B 3EA8A 4FUBA 5DO4H 1B0EA 1W8BH 3JZ2B 1SPJA 3F68H 1BRCE 3MNBA 1GBLA 1L0ZA 2Y6TA 4UE7H 1HAVB 1JMOH 3E16B 2B8OH 5L30H 2PGBB 1K1PA 4WVPE 7GCHF 4ZMAH 2VIOA 1TALA 4ABEA 1VITH 2A1DB 1C1VH 1DE7H 1EQ9A 4Y8XA 1MTUA 2ANWA 2FXRA 1BMLA 2BZ6H 2G00A 1ELEE 4FVDA 3EA9A 3QTVH 1KXFA 1DX5M 2QYIA 1O2ZA 1Y5BT 4D9QA 1DWDH 1KXDA 1GPZA 4SGBE 1HFDA 1TNIA 1C5QA 1VCWA 1RTFB 1JRTA 5GXPA 2H5DA 5DJ7A 1WV7H 4YOGA 4Q2KA 3MO6A 4ZKRU 2GT7A 1QQ4A 1Q3XA 3V13A 4ABJA 4B75A 4KELA 2HLCA 3O8DA 1LCYA 2VJ1A 4NIWA 3VB3A 3SW2B 3E8LA 4CRCA 5BPEA 3LH1A 1ZHMA 4INHA 1K9OE 3P8GA 2F3CE 2J9NA 3GDVA 2Y7XA 5GPIB 2BOKA 1V3XA 1F2SE 1C4U2 3GICB 1FZZA 5H4IB 1QGFA 4YOJA 2A5AA 4BAMB 3M3TA 3RU4D 1GMCF 4JZ1A 4DVAU 3MU8A 3SHCH 4BXWA 3BTEE 2I6SA 1C2JA 2QC2A 2ZFTA 1YM0A 4AG1A 1O31A 2LNCA 3M3SA 1HJ8A 2BD8A 4MVNA 5EW2H 3MH7A 3ZZAA 1ARCA 4YM9A 2GCHF 3RXEA 1GDQA 1ANBA 1ZHPA 4X8SH 3ZVBA 1ZRBA 1V2KT 4B73A 1DICA 1HCGA 2BDYA 2C3SA 4WF8A 1KSNA 1FAXA 5E0HA 1OWKA 1W7XH 2PWXA 1T4UH 1UVOA 1GMDF 4FUGA 2BY9X 1TPPA 2Z7FE 1CQQA 4K8YA 4MG3A 1GCTC 4DIHH 5FBEA 1GI1A 1HAZB 3SUEA 2BLOA 3A82A 3UWJH 1C5MD 4I33A 1K2I1 1GHYH 1K1OA 2VVCA 1EOJA 3E0NB 1HLTH 1C4V2 1ETSH 1YPGH 3M5NA 3Q3XA 1GI2A 3H7TA 3UOUA 1O34A 3OSYA 4BTIB 1SBWA