1V2ST

Benzamidine in complex with bovine trypsin variant x(ssfi.glu)bt.d1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Understanding protein-ligand interactions: the price of protein flexibility
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2sT01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2sT02
2AGIX 1AD8H 1H4WA 1GMDF 2VVVA 4IMQA 4ZH8A 1F2SE 3QGJA 4BTTB 3QN7A 1CGJE 1WSSH 2AMDA 2OP9A 3MU8A 3HGPA 3ZVEA 5A8XA 2Z3DA 2VNTA 2BY6X 4XBDA 1O3MA 3T27A 4AB9A 1TMBH 5H4IB 4AOQA 1F5LA 4IGDA 1P03A 3SJKA 4NFFA 2A5KA 5TJXA 4WXIA 6CHAB 1GI0A 3FANA 3LDXH 3DHKH 1HIAB 3DFJA 1ELCA 3RXIA 4Y7AA 4JCNA 3TIUA 3M3VA 4UFDH 1AFEH 3HGNA 2BY7X 1UTKA 1SGRE 4CREA 3VB7A 2ZNKH 2ZFQH 3GYMA 3EA9A 2H9HA 2ULLA 1FZZA 1O3AA 3Q77A 1HXFH 2GDDA 4NWKA 1C1SA 2RG3A 2ZC9H 1K9OE 2SGPE 3TVJB 2CN0H 1GMHF 1O3OA 3FFGA 5A8YA 1ZHRA 3ESTA 3M36A 4GHTA 2ZU2A 1EZUC 1E37B 1FQ3A 1Y8TA 1CQQA 3DA9B 2GT8A 1CHOF 1KLTA 1EAUA 4X6NA 2ZQ2A 2A7JA 1C2FA 4ZAEA 3BF6H 3BSQA 2EA3A 1Q3XA 5F8ZA 3A7XA 5TCAA 1T8LA 3FAOA 3M3SA 3PO1C 3LJOA 1MAXA 1NRNH 1O2WA 1ELTA 2A4QA 1LKBA 2QIQA 3RXAA 4MPXA 1VJAU 1F5KU 1V3XA 1SOZA 1C2KA 2BDAA 3K6YA 3S69A 5F03A 2ZU3A 1SQTA 2ODYB 1UO6A 1SGTA 4JZIA 4MG3A 1ELEE 1HB0B 3P8NA 3ZZ5A 1GDQA 2D8WA 1O2MA 2ZHEH 3GOVB 1TPSA 2Z94A 1IOEA 4ABIA 1TNHA 1GWAA 3SU0A 2XTTB 2F83A 3U98H 7LPRA 2P3TB 4ZHMU 3H5CB 2BD2A 2PLXA 1LDTT 3VGCB 1TE0A 1IQLA 1H1BA 3A8AA 2XC5A 1FIZA 3BG4B 1C4V2 4I32A 3T26A 4FUHA 3SBKA 5L2YH 2BLWA 1ELVA 2BLQA 3FP6E 2VB0A 1UTQA 1GBKA 4O03A 4AN7A 3R0FA 1V2RT 4THNH 1QL7A 2ZDMA 1P3EA 2GZ9A 2TBSA 1OWDA 2ODQA 2ZCKP 1FY1A 1TNGA 2OQ5A 4B76A 1J16A 3KN2A 1GJ8B 2THFB 4DY7B 2WPJS 2AFQB 3RMMH 2JH5D 1ZRBA 3MH7A 2ZGHA 5FX5A 1VZQH 1VCQA 1S83A 3UIRA 4CBNA 1DS2E 3RXOA 3DUXH 8LPRA 1GJ7B 1ZPCA 3QWCH 2QAAA 1G2LA 2Y6TA 3D23A 1DY9A 1QRXA 1EAXA 3I78A 2A2QH 1BJVA 4DJZB 2A7CA 2PUXB 1L4ZA 1GMDG 1NU9A 4AYYB 1C5WB 2FOGA 1Q31A 3T25A 4XBCA 1AN1E 1ZR0A 2G81E 3KGPA 5K7RA 2FOEA 1ZOMA 2VIDA 2QN5T 4U30A 2STBE 1UMAH 3ODFA 1ZRKA 3SGBE 3AASA 1CO7E 2QXIA 3VXFH 2ODPA 5AHGH 4VGCB 4ZXYH 4BTIB 1TABE 1P2MA 5E0GA 1WTHD 1HUTH 2FI3E 1TNIA 3M5LA 3RXBA 1GG6C 4TWYA 6ESTA 3QTVH 1XM1A 2RA3A 3SQHE 1BQYA 2I6QA 1BBRE 2V6NA 2OC1A 1SSXA 1HBTH 1P57B 2GX4A 2PGBB 2QA9E 3BIUH 2PV9B 1TNJA 4E06H 3SV6A 3BTME 2BQ6B 3P70B 3UNRA 2H2ZA 1AUTC 1MBMA 1MTVA 3SGQE 1PQ8A 2PW8H 5DPAA 1O2XA 3ZZ8A 1L2EA 4MNVA 1GJ4H 2WPLS 1W14U 6CHAC 1GMHG 4XE4A 3SNDA 4ISNA 1G36A 5IYTA 4O9VA 1FN8A 1CHOG 1WOFA 2EI8A 2JH6D 1J15A 1QJ7B 1GVZA 2BXUH 1UTJA 4NZQA 1NS3A 1QRWA 1XUHA 4CR5A 4X1RU 2ZP0H 2BD8A 4H6TA 5GJ4B 3WY8A 1EP6A 2GDEH 1WYKA 1QB1A 4SGBE 2G8TA 5EQQA 2OBQA 3M37A 3G01A 2BD7A 4FUCA 5C3NA 3RXFA 1HV7A 4XFQA 1NFYA 2AMQA 2A45B 1T32A 5GIBA 1E38B 1SGNE 1C5TA 4Y0YE 1HJ9A 2A5IA 3CS0A 2OINA 4Y10E 5JBBS 3OYPA 2D1JA 1FIWA 1YCPK 2FDAA 1DFPA 3PMJA 2ZHQH 1TALA 1CE5A 1XXFA 1Y5UT 2K1QA 3LT3A 1AU8A 3KCGH 1O5FH 3KQDA 1THPB 1AWHB 1ZMJA 1LHGH 3L33A 3PTNA 4LOYH 3MNXA 3UPEA 5JBCS 2JETB 1JXPA 1OWJA 1YPEH 5DK1A 1BMAA 2VWLA 4X1SU 4JK6A 2A1DB 1E35B 1K1LA 1O2YA 1C5LH 1MCTA 3HKIB 5HXFA 4H6SB 1E34B 4IMZA 3T28A 1K21H 5JB8S 1AWFH 2BDYA 2WV5A 2OC0A 1BTHH 3ZZBA 3VGCC 3OX7U 3LGYA 3ODDA 1G9IE 3LGVA 2Y81A 2CMYA 4KP0A 3UWIA 5E0HA 3BG4C 1RJXB 3BEUA 1LMWB 1LTOA 1L1JA 2XYAA 2NU0E 4GAWA 2LPRA 1G3CA 2Y5FA 5EQRA 4WJG2 1VITF 1YLCA 2EC9H 2W3IA 1LVBA 6LPRA 3KF2A 2B9LA 4FU9A 1C5RA 5F8TA 3A85A 5DP6A 1VITH 1BB0B 5FCRA 1JOUB 1C2DA 2PUQH 4NIXA 3F1SB 3QGNB 1BBRH 4NFEA 2JKHA 4D9RA 1YPGH 5EOKA 3UNQA 1O2UA 1ANDA 4X2VA 1O2QA 4CBOA 1WUNH 4K60A 2OQUA 1YC0A 1V2KT 2IN2A 2NWNA 3ZVGA 2RA0A 3QZQA 4HFPB 5T6DA 1CBWB 3Q3XA 1ANEA 1GBAA 5LPRA 3VXEH 2R2WU 2BDIA 2ANYA 1NFWA 4XDEA 1HAZB 1O3BA 8KME2 5L6NH 2P8OB 2XCFA 1GJ9B 1ZTJA 2H6MA 3RM0H 1SGIB 3MU0A 1HAGE 3ZZ6A 1S84A 2KAIB 4OS6A 4J2YB 4E7RG 1ARCA 2HPPH 1JRTA 1HNEE 4GCHF 1K22H 4FUDA 1O2HA 1DXWA 1OP2A 4UFGH 1SLXB 4VGCC 3MNBA 2Y80A 5DP7A 3BTKE 3EGKH 5TCCA 5FX6A 1ESBA 1XUIA 5EPYA 1DUEA 3MFJA 1C5ZB 1L4DA 4JYUH 2Z7FE 1OX1A 2ZGJA 2HNTC 1FAXA 4R8TB 1P2QA 4GSOA 3TH3H 2QYIA 3EAJA 1PPEE 2XWBI 1BRCE 2ZDAH 1GMCF 3KQCA 3LKWA 3JZ1B 2NU3E 2VWMA 2OXSA 1ZYOA 2A4RA 1P2JA 4K69A 1ZGVA 1CHGA 1VJ9U 4ZMAH 1IAUA 4DGJA 1NN6A 2VIVA 1OP8A 2W26A 4ZKRU 1O5GH 3D62A 1GI1A 1A5GH 3TJOA 2FS9A 2A0QB 2BY9X 1PYTC 1XUKA 4CRFA 5BRRE 1ORFA 1BTYA 1OXGA 2R2MB 3ZYDA 1NY22 3Q00A 2WPHS 4ABAA 5ESBA 1RRKA 1ZSLA 4MNXA 4OGXA 5EXMA 3D49H 1UVTH 4IW4E 2OD3B 4UDWH 3RMLH 1Y3XA 1GL1A 1O39A 1DWCH 3A7ZA 1BTUA 1WQSA 4Q7YA 4D9QA 1EKBB 2PKSB 1TA6A 3RLWH 1SOTA 1GI2A 3BV9B 1O37A 1TAWA 4ZKNU 1FNIA 5EODA 5FHTA 2WPIS 1W13U 1HAHH 3IITA 1ZTLA 2SGFE 1TBQH 2BX3A 3TJUA 1Z6JH 2FLBH 1GL0E 2QGRA 1S85A 1AE5A 1CT0E 1GBLA 1L1GA 3GDSA 3P17H 1TIOA 4TWWA 1ZJDA 3KIDU 5DP3A 1SI5H 1VITG 2JETC 4LXBH 1C4Y2 3SI4H 1LHCH 2B7DH 3RMNH 1EJMA 2SGQE 4MDSA 2NU2E 1G37A 4DW2U 4B2BA 2J95A 4YLUA 2CHAB 1GI7B 1O2LA 1GI8B 4O3TA 3EDXB 1A61H 1C9PA 3M7UA 1HLTH 2ZU1A 2BOHB 1ETSH 1GBMA 3S7HB 3A87A 2ZZUH 3SOSA 2TGTA 3Q3YA 1IQGA 1ZSKA 2Z9JA 1MTSA 1DE7H 1E36B 3P8FA 1GI5A 2VH0A 4MPWA 1A3EH 1MQ6A 5LPEA 1EOJA 3GCHB 4GCHG 1TPOA 5G4BA 1BMNH 7ESTE 1B0FA 2ZTYA 4U2WA 2QC2A 4WVPE 2YOLA 1C1MA 3PV4A 3ZVBA 2OC8A 4NIVA 1AHTH 1UVUH 1KDQA 3HPTB 1FDPA 2XBXA 1CBWC 2H9TH 1TRNA 2FX6A 3MOCA 3ZZ7A 3RXHA 2ESTE 3SUFA 2P8OC 1MTUA 1V2NT 3RXKA 4MLFB 1AKSB 3UQVA 1OWIA 1GBTA 1GDNA 1JIMA 1GMCG 2PKAA 2ZA5A 2O8MA 1O3HA 3M35A 3RU4E 1FY4A 2ANWA 4IBLH 3A84A 4ISOA 3M61U 1UTMA 4YOJA 2P3FH 1GHAF 2OLGA 4ZROA 1BMLA 2ZG0H 4YOIA 5E0JA 2JH0D 3ZVCA 2PSXA 1AIXH 2NU4E 1Z6EA 3MO6A 1O33A 1C5SA 1F0RA 3K6ZA 2ILNA 1P0SH 5GCHF 1INCA 3KQEA 2A31A 3VB4A 1IQEA 2TIOA 4KELA 2ZHDA 3K2UA 1K1PA 1UK2A 2ALPA 2SGEE 2BM2A 1KXBA 3A88A 1ELDE 2J4IA 3ZV9A 2A2XH 2ZPSA 4JZFH 3SV7A 1V2WT 2VWOA 2O9QA 4ABJA 3B8JA 2Y82A 2W7SA 2BMGB 4GHQA 1W0YH 1MD7A 1O2OA 5A0AE 3MU4A 4X8VH 4Q2KA 1ELBA 4ASHA 4A1XA 3A82A 1K1JA 4ESTE 5C5OA 3PWBA 2FODA 2F9BH 1SGFA 3AAVA 4ISIH 1NTPA 3MNCA 3SNAA 1MBQA 2Q6FA 3E0PB 1V6DA 1HRTH 2H5CA 1MMJN 1TQ7B 2ANMH 1ZSJA 1AVXA 1J17T 2DUCA 1DSUA 2VVCA 4OS1A 1YKTA 1D3TB 1WQVH 1QHRB 1FLEE 4B71A 2PKSC 2B8OH 1THRH 1NC6A 3GY8A 5A8ZA 1OS8A 5FPSA 3LU9B 1AY6H 4Y0ZE 1ZZZA 4HGCA 1PFXC 2XW9A 2GCHF 4E7NA 2V3OH 1UHBA 2BHGA 3EYDA 5EGMA 5HGGA 2PTCE 1W8BH 3MMGA 4OGYA 3P8GA 5JB9S 1C5PA 2UWLA 3LGIA 2GV6A 3ZV8A 4ABEA 4AX9H 1TRMA 3U9AH 3SJOA 2FOMB 3R3GB 1FY5A 4JZEH 1VCPA 4TY6A 4MPUA 1G3EA 1K28D 2VINA 1ZGIA 2BDHA 2W5EA 3VB3A 1MU6B 2PWXA 1C5VA 5I46H 5ETXA 4FUFA 2CHAC 2J38A 1SGQE 1V2QT 1IQHA 1GI4A 1M9UA 5C67A 1SQOA 2R3YA 1ACBE 1PPCE 2FI5E 1SB1H 3ATLA 5GWZA 1DT2A 2AGEX 3EQ0H 4DCDA 1TBRH 3LPRA 3AVZA 2ZDLA 1O36A 3VB5A 4INLA 1O30A 2FTMA 3MWIU 1PPFE 3FP8E 1C2LA 4Q7XA 3M7TA 1LKAA 1SHHB 3TH4H 1X7AC 2TGAA 2WPMS 2FOBA 4K1TA 1RIWC 1TFXA 5K0HA 5SGAE 1GHVH 1S6FA 2GCTB 4B74A 1ANBA 1FPCH 1QQUA 3GCHC 3UR9A 5HMAA 1SLUB 3BTGE 3EA7A 2WPKS 1EXFA 1YCPH 1S0QA 1SGEE 2DE8A 1GHAG 3GISB 3RXJA 1TMTH 2XCNA 1GJ6A 5F8XA 1K1NA 4CRBA 2BD3A 3E90B 3U69H 3P92A 1MCVA 1BHXF 1KXEA 1O3FA 3UR6A 4YTAA 1FI8A 4U32A 3HATH 4YESB 3IWMA 1N6YA 3LONA 4MQAA 3SHCH 1EJAA 1F5RA 1FAKH 1QY6A 4FUBA 1LHFH 5GPIB 5B6OA 1TMUH 5ABWA 3TK6A 5C1YA 1Z7KA 3VB6A 3SU4A 1DY8A 1O2TA 3E6PH 5T6GA 2BOKA 1UTPA 2P93A 1KXCA 1NT1A 4A1TA 3TJVA 3TNSA 1O3PB 1YPHC 1HJ8A 2HGTH 1LCYA 3FP7E 2QV1A 5DP9A 3SV2H 3S7KB 4BAHB 1BZXE 1QA0A 4ZXXH 2BDCA 3SU2A 4INHA 1NM6A 3A8DA 1L0ZA 3I29A 3BTHE 4Z0KA 2QY0B 4K1EA 3MHWU 1MD8A 3LH1A 1BUIA 3MU1A 3SV9A 1BTWA 3TJNA 2OCVB 4K1SA 2ZU4A 2PGQB 3E3TA 1TNLA 2STAE 3GYLB 4FUEA 2C90B 3MU5A 1HIAA 1P2NA 1MAYA 1MTNB 2TRMA 3ENSB 1AVWA 1QIXB 3KQBA 1O5BB 2F9UA 3AW0A 4AFZA 1UVSH 2GTBA 1ZHPA 1TX6A 1YF4A 2G5NA 1GHZA 1PPBH 4XSKU 4Z6AH 2GCHG 3PWCA 4IN1A 1A7SA 1P9SA 3W95A 1DWBH 3V0XA 1C2JA 2SNWA 1QJ6B 1OP0A 1OSSA 2ZFFH 2OBOA 1G3DA 3RLYH 2CF8H 2O8TA 1ZJKA 2BD9A 5A2MH 3SI3H 1RFNA 2PFEA 2GZ7A 2XNIA 1J14A 1THSH 5PTPA 3Q76A 4QT8C 1TLDA 1PPGE 2P3UB 1T8MA 1GVLA 3BN9A 1NRQH 5BPEA 1Y3YA 3MTYA 1TGTA 3M5OA 2UWPA 1QGFA 1A5HA 2VVUA 2J92A 4UEHH 4X8SH 4WMDA 3ZZ4A 1G3BA 1ZMNA 2XXLA 1E0FD 1GJAB 3V12A 3STIA 1SC8U 1F92A 1TOCB 1IQIA 1O35A 1CA8B 3O8CA 3HK3B 2QXHA 3MH5A 2FS8A 4A92A 1H8IH 4ABFA 2DE9A 1D3DB 1D9IA 2IPHA 1C1NA 1BTXA 1Z8JB 3Q3KA 1EASA 1YPKH 1LHDH 2ZDKA 4BAKB 1C5QA 3A86A 1N1LA 2RDLA 4J1YA 1C1VH 1SMFE 3BIVH 3GY4A 4BANB 4Y8YA 3UREA 1TGSZ 3JZ2B 3TGKE 1GGDB 1MKXH 4DT7B 3AW1A 1V2ST 3W94A 1O3CA 4X1QU 3UOUA 3RU4D 3M3TA 1Z8RA 2FLRH 1O2SA 4K8BA 5IDKA 1HAPH 4Q7ZA 3CENA 2BTCE 3QUMP 5EXNA 5FPTA 3SJ9A 4AZ2B 2GCTC 1AVGH 1O32A 1Z1IA 2ZFTA 2SGDE 3TITA 1O34A 1ZTKA 1EPTB 2Y5HA 3TGJE 1ANCA 1BMMH 3SNBA 3A7WA 5A09A 2FYRA 3U8OH 1ZPZA 1W3CA 4B2CA 1HJAB 3MNSA 4FUIA 4KTUA 4ZHLU 1EAIA 1NRPH 1NFXA 3RC6A 1WAYB 2FIRH 5A0BA 1KDQB 1EATA 3T62A 4UFEH 1QL9A 2YNBA 3MO3A 1F0UA 3RXLA 2ZEBA 3ZZ9A 1CSOE 1O31A 1YPMH 5FXLA 1GBDA 2XWAA 1GJBB 2D26C 2CJIA 1BJUA 1N8OB 2FX4A 2G52A 3I77A 4JYTA 1K2I1 5CHAB 4X6PA 3B23B 2ZI2H 2PKAB 1PQ7A 2ZWLH 4I8GA 5DKMA 2CF9H 4OS5A 2GMTB 1GHXH 3ATKA 1G30B 2TPIZ 2BQ7B 4X6MA 3RXQA 5EQSA 1H8DH 2TGDA 3L3TA 3RP2A 1W2KH 1O3LA 1GCTB 3RXGA 5CE1A 1CA0B 4I8HA 4RKJB 4LK4A 3BTEE 4BOHA 1AZ8A 1B0EA 1P06A 4MPVA 4D7FA 1K1IA 3KL6A 1EX3A 1FXYA 2A4GA 1GI3A 3E8LA 4DIHH 4B75A 4X6OA 3TK9A 1Y59T 2BLOA 1NZQH 1DUAA 3F6UH 1DITH 5HYOA 2A4OA 2VIOA 5ESTE 3URDA 5EW2H 1MTNC 2F9PA 3URCA 4O97A 1TYNA 3KHVA 3SU6A 2GD4B 2UUKB 1KIGH 1VCWA 4WMEA 3U1IB 2BVXH 2C3SA 1P3CA 9LPRA 1DWEH 1EOLA 2HPQH 1C1UH 5GDSH 1G32B 4H4FA 1O2PA 4NIYA 2FI4E 3SUDA 3U1JB 1HAVA 2ZPQA 2QCYA 3NCLA 2WYJA 3PROA 1MKXK 4CHAB 1NPMA 2XBWA 4FUJA 5JPMH 2FOFA 3ELAH 4JMYA 1NU7B 3EE0B 1AUJA 1GI9B 1HPGA 3NWUA 4B2AA 1TGBA 3S0NA 1C1QA 2SNVA 1H9IE 1P09A 4Y8XA 5E2OA 1TNKA 3V7TA 4NSVA 2G00A 1MKWK 2G51A 3K65B 2HRVA 1C4U2 2Z9GA 4K5ZA 5LGOA 2CXVA 1F7ZA 2R0LA 1O3IA 3RXEA 4INKA 1CU1A 1C2EA 1C5NH 3EA8A 3SU5A 4ZKOU 2R0KA 1H9LB 1QTFA 2QF0A 3QK1A 1KXAA 3MO9A 3F9HA 1A3BH 1O2NA 1UK3A 1DSTA 2A5AA 5JBAS 4HI3A 2BD4A 1TPPA 2C8ZB 1GJDB 2XC0A 1RTLA 4K2YA 5I25A 1CGIE 3F9FA 1Q2WA 1BIOA 2C4FH 2ZGCA 3HK6B 5DP8A 5HM2A 2WYGA 1FY8E 3QDZB 1YM0A 3RDZA 1QQ4A 4Y11E 1IQFA 2LNCA 1XUJA 1SLVB 1LVOA 1TX8A 4WMFA 2ZO3H 1IQMA 3SV8A 1A0HB 1GGDC 1RTFB 1SR5C 1SGFG 1RIWB 3N7OA 1W7XH 4AYVB 1ZHMA 1QA7A 5E8EH 1OYTH 3CS7A 1TRYA 2VU8E 2ZTXA 1ETTH 4JZDH 2P94A 1JMOH 1GBBA 3LC5A 1P2IA 2QXGA 4UD9H 1UVPA 3SNEA 3SHAH 1CVWH 1K1OA 1BA8B 1QL8A 3SGAE 1TQ0B 1EPTC 1A0LA 3BEFB 1DLKB 2BB4A 4Y7BA 8GCHF 2WUBA 3RXPA 1ABIH 4CH2B 3RUOA 2HOBA 1HJAC 1N6XA 4MNYA 1JWTA 5L2ZH 4OS4A 4FUGA 4AGKA 4Y6DA 3PMHB 2Q6DA 5EG4A 2ANKH 1AQ7A 4DG4A 1V2VT 3PLBA 1ELFA 1MZAA 2KAIA 4K8YA 4LZ4B 4ABBA 1P8VC 2PTNA 1PQ5A 2OC7A 1TB6H 2HNTE 3BTWE 2V0BA 3FVFB 3K9XB 1SVPA 2FO9A 5C1UA 2F9VA 4CRGA 1FPHH 3ATWA 1N8OC 3P8OA 4A6LA 4B73A 2FXRA 1O5DH 4F49A 5CHAC 1GBFA 3LGWA 5L30H 4PROA 3RXDA 3MYWA 2A7HA 3RU4T 1Y5BT 3A7YA 2GMTC 1TONA 4B1TA 1WTGH 4R0IA 4D76A 1TPAE 4A1VA 2ZHWH 1T31A 3A83A 1QCPA 1A2CH 1UCYK 1GCTC 1KY9A 2BVRH 1W12U 1L1NA 1CA0C 3PMAB 3PB1E 5AVDA 1O3NA 1XUGA 5JBTA 5A0CA 2AIPA 1EZQA 4WWYA 1VR1H 1W10U 1C2HA 1DX5M 2WINI 2HLCA 1D3QB 2ZTZA 1TX7A 1GBEA 3E91A 2Z9LA 2AIQA 1XVOA 3LH3A 1C2GA 1XVMA 3GY2A 1IHSH 1BRAA 1GDUA 5LPFA 1ARBA 1UJ1A 2F9NA 3VFEA 2F91A 2HVXA 1V2UT 4BAQB 1MQ5A 3TLOA 2PSYA 2FMJA 2P59A 5DO4H 4BAMB 5DG6A 4AG1A 2BDGA 4NA9H 1D6WA 1A5IA 1FUJA 5F6MA 1K1MA 4CHAC 3TPIZ 4AGJA 1SQAA 1T4VH 3O8RA 1V2TT 1P2KA 1FJSA 2CGAA 1SBWA 3FZZA 3UY9A 3A80A 2GZ8A 3ZVAA 4WH8A 3ATMA 3UWJH 2YNAA 1ZLRA 1LVMA 1BT7A 2CV3A 1SFQB 1EZSC 1HCGA 1KXDA 1QFKH 4NSYA 1O3DA 4X2XA 4IC6A 3RXMA 4NZLA 4Y71A 2VJ1A 1UTNA 2XC4A 1TGCA 2PR3A 1MH0A 2AEIH 2J9NA 2QXJA 3ZZCA 1MU8B 3O8DA 4JK5A 4NCYA 4YZUA 1C1RA 4ISLA 5J4SA 1O5CB 4F4OC 1B5GH 3LGUA 2R3UA 1O2GH 3NK8A 1DVAH 1YCPM 2EEKA 1AGJA 1DANH 1O2IA 3C1KA 4RN6A 2H9EH 2HNTF 2O8WA 3GCOA 3A7VA 2BLVA 5DP5A 4MTBA 3GY5A 1YGCH 4KTCA 3P6ZB 4YO9A 4UONA 4KKDA 5FAHA 4HZHA 4M7GA 2BX4A 4Q80A 8GCHG 1AI8H 2WV4A 1P02A 2AH4X 4X8TH 1BRBE 4FXGH 2Q6GA 4NWLA 2UUJB 4XBBA 1GJ5H 1T7CA 1O0DH 1RD3B 3DFLA 1VGCB 2FOAA 3GDUA 5FCKA 5T6FA 1AMHA 4YLQH 1JBUH 2AYWA 4JZ1A 1LVYA 3PLKA 1G2MA 1SGPE 2UUYA 1YBWA 1O2JA 1BITA 1SHYA 3NKKA 3LIWA 1WU1A 4GLYA 1EJNA 3OU0A 1Z1JA 2ZECA 1PPHE 4TY7A 2O8LA 1O2VA 5FBIA 3BG8A 3SZNA 2VIWA 5DGJA 4NGAH 1CT4E 2Y7XA 3A81A 5GCHG 3GICB 1ZPBA 4A7IB 5C1XA 1MTWA 1J9CH 1DWDH 1O5EH 1AKSA 4ZHAA 2C93B 1UTLM 3E1XB 1FONA 5DP4A 2F3CE 1KLJH 2F9OA 1O5AB 3OY5U 3SU1A 1P12E 1Z8GA 1GBHA 3ZVDA 4DVAU 1C2IA 3M5MA 2J94A 1KSNA 2G55A 3U8TH 7KMEH 1KLIH 2ZCHP 1LPZB 1YPJH 1ZMLA 3IG6B 1YPLH 4X1NU 3A89A 5JYIA 3A8CA 2BVSH 2EI6A 2XBYA 2Z9IA 3RXSA 2M5TA 4BAOB 2FTLE 4ABDA 2VWNA 2XRCA 2Z6BD 3E16B 1PJPA 4AG2A 2ZFSA 1IQNA 1OYQA 3T5FH 4GVUA 1OPHB 1GBIA 2UWOA 1AE8H 5T3HA 1EP5A 3T29A 1SL3A 3PLPA 1U6QA 3OSYA 1ESTA 1QNJA 2ZGXH 3U8RH 3A8BA 5AFZH 3SW2B 1HDTH 3OY6U 2ZIQH 1XX9A 4WY3A 4D8NA 2NU1E 3PTBA 1C9TA 3MI4A 1AZZA 1PQAA 2V35A 1DXPA 3QTOH 2P95A 1GJCB 2B5TB 3UQOA 1V2PT 2I6SA 2BZAA 2P16A 1Z8IB 2GT7A 2ZU5A 3O8BA 7GCHF 1V2OT 2V3HH 4BTUB 2FESH 3F9GA 1S82A 2UUFB 1BHXB 4IN2A 4ISHH 4GUXA 3NXPA 3RC5A 3GY6A 2ZQ1A 1HXEH 4IS5A 1TWXB 2VGCB 2G4TA 1T4UH 2BD5A 2BYAX 1S81A 2Q1JA 1HAVB 1EB1H 2FOHA 2ZFRH 3OTJE 5C20A 1QJ1B 2ASUB 3S9AA 1OOKB 3F9EA 1JIRA 3RXVA 1BTZA 2SGAA 1HAXB 3BTQE 4AB8A 1W0ZU 2FZZA 4RSPA 4E05H 1FMGA 2GV7A 2IOTA 4YT6H 4WH6A 4CRAA 2TGPZ 1SGYE 1KYNA 1F0SA 1UVOA 3F68H 2ZDNA 3KNXA 4OS7A 1W7GH 5GXPA 1BRUP 1LO6A 2W7UA 1QBVH 1SGDE 4AFSA 2O8UA 1XKAC 2SFAA 1HAOH 1O2ZA 2AERH 3BTFE 1IHTH 3KEEA 3SUGA 1D3PB 3T2NA 3NUMA 1NFUA 1S6HA 1NESE 3GY3A 1J8AA 4UE7H 4GPGA 4X0WU 4A5TS 5J4QA 4H42U 1P11E 1AB9B 1C2MA 1C5XB 1GCDA 2QF3A 1CGHA 2BXTH 3TGIE 1KXFA 1P10A 1FV9A 2G4UA 3GY7A 4ZUHA 1UCYE 2BY5X 2IJOB 1VGCC 2Z3EA 1S0RA 1UK4A 1C1TA 3PYHA 1YYY1 2AMPA 5DJ7A 1HAYB 1DDJA 4LZ1H 4FVDA 5HM9A 1EQ9A 2C8WB 4D7GA 2FYQA 1HAIH 4FU7A 3SU3A 3SN8A 3BEIB 2Y7ZA 3LC3A 1RGQA 4KGAA 2HWLB 4WXVA 2ZFPH 1A46H 2FPZA 3MH4A 1NO9H 1MKWH 4CR9A 1P05A 1Y5AT 6GCHF 3NPSA 1RS0A 4I7YH 2OUAA 2BQWB 1LPKB 4TPIZ 3CP7A 3E0NB 4MNWA 1RTKA 1IQJA 2VIPA 1V2JT 3UTUH 3VEQB 3RXCA 2Y5GA 4BNRA 1A0JA 1LQEA 3RXRA 1AFQB 1H9HE 2W3KA 2FOCA 3MH6A 1PYTD 1C1OA 4RKOB 1GHWH 4SGAE 3QLPH 1YPHE 2WUCA 3H7TA 1BCUH 4X2YA 4DOQA 3SJ8A 1T8OA 2OTVA 1MZDA 4FU8A 1BTPA 1QRZA 1UTOA 1Y3WA 2BZ6H 3V13A 3GCTF 4DIIH 3SUEA 1TBZH 2FEQH 1BOQA 3GCNA 1GHYH 5CMXH 1C5UA 1EAWA 1YLDA 2G5VA 2C8YB 1GVKB 3M7QA 3BTTE 4YT7H 5EW1H 1A4WH 1CT2E 1FN6A 1HGTH 4JYVH 1QB6A 2BDBA 7GCHG 1GI6A 4FVBA 3C27B 1W11U 2ALVA 3GDVA 1SGCA 1GHBF 3SQEE 1ESAA 1D6RA 1SLWB 3BTDE 3FZDA 1OWKA 5FBEA 2AGGX 4I33A 4BXWA 4Y76A 4KTSA 2ZGBH 5JDUB 3TK5A 4AFUA 4CH8B 3DT0H 4I31A 1NROH 4AFQA 1Y3VA 1C5OH 3NZIA 4ABGA 1V2LT 2FP7B 3SNCA 1TA2A 1QBNA 3ZVFA 3P95A 3TH2H 1GBCA 1XKBC 1Z71A 3UFAA 5EXLA 3UOPA 2XBVA 2D2DA 1EZXC 2ZF0H 1O3EA 4CRDA 4DURA 1ABJH 3QO6A 2VGCC 1OKXA 1SFIA 2ZCLP 3ZZAA 4K3JA 5C5NA 4NA7A 1C5MD 4BXSA 2HALA 2PHBA 1EUFA 1XMNB 5AFYH 1UCYH 3PO1B 2GGVB 3AAUA 3QZRA 1P9UA 1BBRK 1QB9A 1EB2A 3LJJA 2GVFA 2GP9B 3S9CA 3PMBB 3M5NA 3LGTA 1UHBB 3ZZDA 5EPNA 4X1PU 1O3KA 4NG9H 4TYDA 3ZZ3A 1DOJA 4NIWA 1C1WH 3HKJB 2VIQA 1YP9A 4UFFH 1SG8B 2EI7A 2AS9A 1HYLA 4OS2A 5E2PA 4I8LA 3TU7H 1KTTB 2ZPRA 4XOJA 1P2OA 2R9PA 1MUEB 1O3GA 2A32A 5LH8A 4IC5A 2GKVE 1RXPA 2H5DA 3ATIA 3ITIA 1C5YB 1LPGB 1ID5H 1XUFA 4YM9A 4I8KA 1AB9C 1F0TA 4I8JA 3QX5H 1B7XB 6GCHG 1WCZA 5EU8A 3ZYEA 1S5SA 1DICA 2VH6A 1QURH 3STJA 2ZDVH 1WBGB 1XXDA 1P01A 3A7TA 4MVNA 4AORA 1V2MT 2ZKSA 1ELGA 1Y3UA 2FM2A 3VPKA 3UNSA 2B0FA 1QBOA 8ESTE 1SPJA 3L6PA 1GBJA 1OWEA 1DM4B 3RXTA 3RMOH 3RC4A 1O38A 2Z9KA 4U01A 1EPTA 1TOMH 3RM2H 1A1RA 3SO3A 4WF8A 1D4PB 3DD2H 1DPOA 1PPZA 9ESTA 1DLEA 1IQKA 1O3JA 3TNTA 2RCEA 3GCTG 1WV7H 1T8NA 4ABHA 4TPYA 2FWWA 4HTCH 3V3MA 1NRRH 1LHEH 3PM3A 1HFDA 1O2RA 4YOGA 1AFQC 1NRSH 3H7OA 1ELAA 1C1PA 3RXUA 3S9BA 1BDAA 3D65E 1O2KA 1FY3A 1GPZA 2ZHFH 5FPYA 4NA8A 3B9FH 1GHBG 1KTSB 4O3UA 4X2WA 1OWHA 3SORA 2J2UA 4ZKSU 1JRSA 1P04A 3LOXA 1TGNA 2C8XB 4X8UH 3SJIA 1QR3E 4CRCA 2BY8X 4Y8ZA 1ETRH 2Z3CA 4Y79A 5AF9H 1LQDB 3UUZA 1GG6B 2J34A 1AO5A 5C2ZA 2H1UA
chains in the Genus database with same CATH superfamily
2AGIX 1AD8H 1H4WA 1GMDF 2VVVA 4IMQA 4ZH8A 1F2SE 3QGJA 2WSSD 4BTTB 3QN7A 5HIYA 1CGJE 1WSSH 2AMDA 2OP9A 3MU8A 3HGPA 3OEHD 3ZVEA 5A8XA 2Z3DA 2VNTA 3DSGA 2BY6X 4XBDA 1O3MA 3T27A 4AB9A 1TMBH 5H4IB 4AOQA 1F5LA 4IGDA 1P03A 3SJKA 4NFFA 2A5KA 5TJXA 3CNRA 4WXIA 6CHAB 1GI0A 3FANA 1H8HD 3LDXH 3DHKH 1HIAB 3DFJA 1ELCA 3RXIA 4Y7AA 4JCNA 3TIUA 3M3VA 4UFDH 1AFEH 3HGNA 2BY7X 1UTKA 1SGRE 2IJD1 4CREA 3VB7A 2ZNKH 2ZFQH 3GYMA 3EA9A 2H9HA 2ULLA 1FZZA 1O3AA 3Q77A 1HXFH 2GDDA 4NWKA 1C1SA 2RG3A 2ZC9H 2F4LA 1K9OE 2SGPE 3TVJB 2CN0H 1GMHF 1O3OA 3FFGA 5A8YA 1ZHRA 3ESTA 3M36A 4GHTA 2ZU2A 1EZUC 2KCPA 1E37B 1FQ3A 1Y8TA 1CQQA 3DA9B 2GT8A 1CHOF 1KLTA 1EAUA 4X6NA 2ZQ2A 2A7JA 1C2FA 4ZAEA 3BF6H 3BSQA 2EA3A 1Q3XA 5F8ZA 3A7XA 5TCAA 1T8LA 3FAOA 3M3SA 3PO1C 3LJOA 1MAXA 1NRNH 1O2WA 1ELTA 2A4QA 3WWFA 1LKBA 2QIQA 3RXAA 4MPXA 1VJAU 1F5KU 1V3XA 1SOZA 1C2KA 2BDAA 3K6YA 3PRDA 3S69A 5F03A 2ZU3A 1SQTA 2ODYB 1UO6A 1SGTA 4JZIA 4MG3A 1ELEE 1HB0B 3P8NA 3ZZ5A 1GDQA 2D8WA 1O2MA 2ZHEH 3GOVB 1TPSA 2Z94A 1IOEA 4ABIA 1TNHA 2QE7D 4ACBA 1GWAA 3SU0A 2XTTB 2F83A 3U98H 7LPRA 2P3TB 4ZHMU 3H5CB 2BD2A 2GJGA 2PLXA 1LDTT 3VGCB 1TE0A 1IQLA 1H1BA 3A8AA 2XC5A 1FIZA 3BG4B 1C4V2 4I32A 2YMSD 3T26A 4FUHA 3SBKA 5L2YH 2BLWA 1BMFD 3N7DA 1ELVA 2BLQA 3FP6E 5EIYA 2VB0A 1UTQA 1GBKA 4O03A 4AN7A 3R0FA 1V2RT 4THNH 1QL7A 2ZDMA 1P3EA 2GZ9A 2TBSA 1OWDA 2ODQA 2ZCKP 1FY1A 1TNGA 2OQ5A 4B76A 1J16A 3KN2A 1GJ8B 2THFB 4DY7B 2WPJS 2AFQB 3RMMH 2JH5D 1ZRBA 3MH7A 2ZGHA 5FX5A 1VZQH 1VCQA 1S83A 3UIRA 3OTPA 4CBNA 1DS2E 3RXOA 1E1RD 3DUXH 8LPRA 1GJ7B 1ZPCA 2XNDD 2QAAA 1G2LA 2Y6TA 3QWCH 3D23A 1DY9A 1QRXA 1EAXA 3I78A 2A2QH 1BJVA 4DJZB 2A7CA 2PUXB 1L4ZA 1GMDG 1NU9A 2KCOA 4AYYB 1C5WB 2FOGA 1Q31A 3T25A 4XBCA 1AN1E 1ZR0A 2G81E 3KGPA 5K7RA 2FOEA 1ZOMA 2VIDA 2QN5T 4U30A 2STBE 1UMAH 3ODFA 1ZRKA 3SGBE 3AASA 1CO7E 2QXIA 3F0PA 3VXFH 2ODPA 5AHGH 4VGCB 4ZXYH 4BTIB 1TABE 1P2MA 5E0GA 1WTHD 1HUTH 2FI3E 1TNIA 3M5LA 2YMSC 3RXBA 1GG6C 4TWYA 6ESTA 3QTVH 1XM1A 2RA3A 3SQHE 1BQYA 2I6QA 1BBRE 2V6NA 2OC1A 1SSXA 1HBTH 1P57B 2GX4A 2PGBB 2QA9E 3BIUH 2PV9B 1TNJA 4E06H 3SV6A 4RT0A 3BTME 2BQ6B 3P70B 3UNRA 2H2ZA 1AUTC 1MBMA 1MTVA 3SGQE 1PQ8A 2PW8H 5DPAA 1O2XA 3ZZ8A 1L2EA 4MNVA 1GJ4H 2WPLS 1W14U 6CHAC 1GMHG 4XE4A 3OFND 3SNDA 4ISNA 1G36A 5IYTA 5B6LA 4O9VA 1FN8A 1CHOG 1WOFA 2EI8A 2JH6D 1J15A 1QJ7B 1GVZA 2BXUH 1UTJA 4NZQA 5C17A 1NS3A 1QRWA 1XUHA 4CR5A 4X1RU 2ZP0H 2BD8A 4H6TA 3ZIAD 5GJ4B 3WY8A 1EP6A 2GDEH 1WYKA 1QB1A 4SGBE 2G8TA 5EQQA 2OBQA 3M37A 3G01A 2BD7A 4FUCA 5C3NA 3RXFA 1HV7A 4XFQA 1NFYA 2AMQA 2A45B 1T32A 5GIBA 1E38B 1SGNE 1C5TA 4Y0YE 1HJ9A 2A5IA 3CS0A 2OINA 4Y10E 5JBBS 3OYPA 2D1JA 1FIWA 1YCPK 2FDAA 1DFPA 3PMJA 2ZHQH 1TALA 1CE5A 1XXFA 1Y5UT 2K1QA 3LT3A 1AU8A 3KCGH 1O5FH 3KQDA 1THPB 1AWHB 1ZMJA 1LHGH 3L33A 3PTNA 4LOYH 3MNXA 3UPEA 5JBCS 2JETB 1JXPA 1OWJA 1YPEH 5DK1A 1BMAA 2W6JD 2VWLA 4X1SU 4JK6A 2A1DB 5CHBA 1E35B 1K1LA 1O2YA 1C5LH 1MCTA 3HKIB 5HXFA 4H6SB 1E34B 4IMZA 2V7QD 3T28A 1K21H 5JB8S 1AWFH 2BDYA 2WV5A 2OC0A 1BTHH 3ZZBA 3VGCC 3OX7U 3LGYA 3ODDA 1G9IE 3LGVA 2Y81A 2CMYA 4KP0A 3UWIA 5E0HA 3BG4C 1RJXB 3BEUA 1LMWB 1LTOA 1L1JA 2XYAA 2NU0E 4GAWA 2LPRA 1G3CA 3N7EA 2Y5FA 5EQRA 4WJG2 1VITF 1YLCA 2EC9H 2W3IA 1LVBA 6LPRA 3KF2A 2B9LA 4FU9A 1C5RA 5F8TA 3A85A 5DP6A 3F0OA 1VITH 1BB0B 5FCRA 1JOUB 2RDEA 1C2DA 2PUQH 4NIXA 3F1SB 3QGNB 1BBRH 4NFEA 2JKHA 4D9RA 1YPGH 5EOKA 3UNQA 1O2UA 1ANDA 4X2VA 1O2QA 4CBOA 1WUNH 4K60A 2OQUA 1YC0A 1V2KT 2IN2A 2NWNA 3ZVGA 2RA0A 3QZQA 4HFPB 4M9FA 5T6DA 1CBWB 3Q3XA 1ANEA 1GBAA 5LPRA 3VXEH 2R2WU 2BDIA 2ANYA 1NFWA 4XDEA 1HAZB 5C0UA 1O3BA 8KME2 5L6NH 2P8OB 2XCFA 1GJ9B 1ZTJA 2H6MA 3RM0H 1YY3A 1SGIB 2KZ4A 1HAGE 3MU0A 3ZZ6A 1S84A 2KAIB 4OS6A 4J2YB 3F3BA 4E7RG 1ARCA 2HPPH 1JRTA 1HNEE 4GCHF 1K22H 4FUDA 1O2HA 1DXWA 1OP2A 4UFGH 1SLXB 4VGCC 3MNBA 2Y80A 5DP7A 3BTKE 3EGKH 5TCCA 5FX6A 1ESBA 1XUIA 5EPYA 1DUEA 3MFJA 1C5ZB 1L4DA 4JYUH 2Z7FE 1OX1A 4ACAA 2ZGJA 2HNTC 1FAXA 4R8TB 1P2QA 4GSOA 3TH3H 2QYIA 3EAJA 4TT3D 1PPEE 2XWBI 1BRCE 5EJZA 2ZDAH 1GMCF 3KQCA 3LKWA 3JZ1B 2NU3E 2VWMA 2OXSA 1ZYOA 2A4RA 1P2JA 4K69A 1ZGVA 1CHGA 1VJ9U 4ZMAH 1IAUA 4DGJA 1NN6A 2VIVA 1OP8A 2W26A 4ZKRU 1O5GH 3D62A 1GI1A 1A5GH 2M2AA 3TJOA 2FS9A 2A0QB 2BY9X 1PYTC 1XUKA 4CRFA 5BRRE 1ORFA 1BTYA 1OXGA 2R2MB 3ZYDA 1NY22 3Q00A 2WPHS 4ABAA 5ESBA 1RRKA 1ZSLA 4MNXA 4OGXA 5EXMA 3DSOA 3D49H 1UVTH 4IW4E 2OD3B 4UDWH 3PV2A 3RMLH 1Y3XA 1GL1A 1O39A 1DWCH 3A7ZA 1BTUA 1WQSA 4Q7YA 4D9QA 1EKBB 2PKSB 1TA6A 4F55A 3RLWH 1K0HA 1SOTA 3SYJA 1GI2A 3BV9B 1O37A 1TAWA 4ZKNU 1FNIA 5EODA 5FHTA 2WPIS 1W13U 1HAHH 3IITA 1ZTLA 2SGFE 1TBQH 2BX3A 3TJUA 1Z6JH 2FLBH 1GL0E 2QGRA 1S85A 1AE5A 1CT0E 1GBLA 1L1GA 3GDSA 3P17H 1TIOA 2AHME 4TWWA 1ZJDA 3KIDU 5DP3A 1SI5H 1VITG 2JETC 4LXBH 1C4Y2 3SI4H 1LHCH 2B7DH 3RMNH 1EJMA 2SGQE 3F2GA 4MDSA 2NU2E 1G37A 3OAAD 4DW2U 4B2BA 2J95A 4YLUA 2CHAB 1GI7B 1O2LA 3MQKC 1GI8B 4O3TA 3EDXB 1A61H 1C9PA 3M7UA 1HLTH 2ZU1A 2WV9A 2BOHB 1ETSH 1GBMA 3S7HB 3A87A 2ZZUH 3SOSA 2TGTA 3Q3YA 1IQGA 1ZSKA 2Z9JA 1MTSA 1DE7H 2IPQX 1E36B 3P8FA 1GI5A 2VH0A 4MPWA 1A3EH 1MQ6A 5LPEA 1EOJA 3GCHB 4GCHG 1TPOA 5G4BA 1BMNH 7ESTE 1B0FA 2ZTYA 4U2WA 2QC2A 4WVPE 2YOLA 1C1MA 3PV4A 3ZVBA 2OC8A 4NIVA 1AHTH 1UVUH 1KDQA 3HPTB 1FDPA 2XBXA 1CBWC 2H9TH 1TRNA 2FX6A 3MOCA 3ZZ7A 3RXHA 2ESTE 3SUFA 2P8OC 1MTUA 1V2NT 3RXKA 4MLFB 1AKSB 3UQVA 1OWIA 1GBTA 1GDNA 1JIMA 1GMCG 2PKAA 2ZA5A 2O8MA 1O3HA 3M35A 3RU4E 1FY4A 2ANWA 4IBLH 3A84A 4ISOA 3M61U 1UTMA 2OK5A 4YOJA 2P3FH 1GHAF 2OLGA 4ZROA 1BMLA 2ZG0H 4YOIA 5E0JA 2JH0D 3ZVCA 2PSXA 1AIXH 1W0JD 2HVYB 2NU4E 1Z6EA 3MO6A 1O33A 1C5SA 1F0RA 3K6ZA 2ILNA 1P0SH 5GCHF 1INCA 3KQEA 1FX0B 2A31A 3VB4A 1IQEA 2TIOA 4KELA 2ZHDA 3K2UA 1K1PA 1UK2A 2ALPA 2SGEE 2BM2A 1KXBA 3A88A 1ELDE 2J4IA 3ZV9A 2A2XH 2ZPSA 4JZFH 3SV7A 1V2WT 2VWOA 2O9QA 4ABJA 3B8JA 2Y82A 2W7SA 2BMGB 4GHQA 1W0YH 1MD7A 1O2OA 5A0AE 3MU4A 4X8VH 4Q2KA 1ELBA 4ASHA 4A1XA 3A82A 1K1JA 4ESTE 5C5OA 3PWBA 2FODA 2F9BH 1SGFA 3AAVA 4ISIH 1NTPA 3MNCA 3SNAA 1MBQA 2Q6FA 3E0PB 1V6DA 1HRTH 2H5CA 5KGOA 1MMJN 1TQ7B 2ANMH 1ZSJA 1AVXA 1J17T 2DUCA 1DSUA 2VVCA 4OS1A 5DN6D 1YKTA 1D3TB 1WQVH 1QHRB 3SZEA 1FLEE 3DSPA 4B71A 2PKSC 2B8OH 3FOAA 1THRH 1NC6A 3GY8A 5A8ZA 1OS8A 5FPSA 3LU9B 1AY6H 4Y0ZE 1ZZZA 4HGCA 1PFXC 2XW9A 2GCHF 4E7NA 2V3OH 1UHBA 2BHGA 3EYDA 5EGMA 5HGGA 2PTCE 1W8BH 3MMGA 4OGYA 3P8GA 5JB9S 1C5PA 2UWLA 3LGIA 2GV6A 3ZV8A 4ABEA 4AX9H 1TRMA 3U9AH 3SJOA 2FOMB 3R3GB 1FY5A 4JZEH 1VCPA 4TY6A 4MPUA 1G3EA 1K28D 2VINA 1ZGIA 2BDHA 2W5EA 3VB3A 1MU6B 1E79D 2PWXA 1C5VA 5I46H 2XOKD 5ETXA 4FUFA 2CHAC 2J38A 1SGQE 1V2QT 1IQHA 1GI4A 1M9UA 5C67A 1SQOA 2R3YA 1ACBE 1PPCE 2FI5E 1SB1H 3ATLA 5GWZA 1DT2A 2AGEX 3EQ0H 4DCDA 1TBRH 3LPRA 3AVZA 2ZDLA 1O36A 3VB5A 4INLA 1O30A 2FTMA 3MWIU 1PPFE 3FP8E 1C2LA 4Q7XA 3M7TA 1LKAA 1SHHB 3TH4H 1X7AC 2TGAA 2WPMS 2FOBA 4K1TA 1RIWC 1TFXA 5K0HA 5SGAE 1GHVH 1S6FA 2GCTB 4B74A 1ANBA 1FPCH 1QQUA 3GCHC 3UR9A 5HMAA 1SLUB 3BTGE 3EA7A 2WPKS 1EXFA 1YCPH 1S0QA 1SGEE 2DE8A 1GHAG 3GISB 3RXJA 1TMTH 2XCNA 1GJ6A 5F8XA 1K1NA 4CRBA 2BD3A 3E90B 1W0KD 3U69H 3P92A 1MCVA 1BHXF 1KXEA 1O3FA 3UR6A 4YTAA 1FI8A 4U32A 1VKYA 3HATH 4YESB 3IWMA 1N6YA 3LONA 4MQAA 3SHCH 1EJAA 1F5RA 1FAKH 1QY6A 4FUBA 1LHFH 5GPIB 5B6OA 3KYFA 1TMUH 5ABWA 3TK6A 3W1EA 5C1YA 1Z7KA 3VB6A 3SU4A 1DY8A 2J98B 1O2TA 3E6PH 4OM9A 5T6GA 2BOKA 1UTPA 2P93A 1KXCA 2KR7A 1NT1A 4A1TA 3TJVA 3TNSA 1O3PB 1YPHC 1HJ8A 2HGTH 1LCYA 3FP7E 2QV1A 4TSFD 5DP9A 3SV2H 3S7KB 4BAHB 1BZXE 1QA0A 4ZXXH 2BDCA 3SU2A 4INHA 1NM6A 3A8DA 1L0ZA 3I29A 3BTHE 4Z0KA 2QY0B 4K1EA 3MHWU 1MD8A 3LH1A 1BUIA 3PRBA 3MU1A 3SV9A 1BTWA 3TJNA 2OCVB 4K1SA 2ZU4A 2PGQB 3E3TA 1TNLA 2STAE 3GYLB 4FUEA 2C90B 3MU5A 1HIAA 1P2NA 1MAYA 1MTNB 2TRMA 3ENSB 1AVWA 1QIXB 3KQBA 4Z1MD 1O5BB 2F9UA 3AW0A 4AFZA 1UVSH 2GTBA 1SQRA 1TX6A 1ZHPA 1YF4A 2G5NA 1GHZA 5C94A 1PPBH 4XSKU 4Z6AH 2GCHG 3PWCA 4IN1A 1A7SA 1P9SA 3W95A 1DWBH 3V0XA 1C2JA 2SNWA 1QJ6B 1OP0A 1OSSA 2ZFFH 2OBOA 1G3DA 4XRNA 3RLYH 2CF8H 2O8TA 1ZJKA 2BD9A 5A2MH 3SI3H 1RFNA 2PFEA 5T1VA 2GZ7A 2XNIA 1J14A 1THSH 5PTPA 3Q76A 4QT8C 1TLDA 1PPGE 2P3UB 1T8MA 1GVLA 2J5UA 3BN9A 1NRQH 5BPEA 1Y3YA 3MTYA 1TGTA 3M5OA 2UWPA 1QGFA 1A5HA 2VVUA 2J92A 4UEHH 4X8SH 2CK3D 2EQNA 4WMDA 1G3BA 3ZZ4A 1ZMNA 2JIZD 2XXLA 1E0FD 1GJAB 3V12A 3STIA 1SC8U 1F92A 1TOCB 1IQIA 1O35A 1CA8B 3O8CA 3HK3B 2QXHA 3MH5A 2FS8A 4A92A 1H8IH 4ABFA 2DE9A 5IK2D 2EY4C 1D3DB 1D9IA 2IPHA 1C1NA 1BTXA 1EFRD 1Z8JB 3Q3KA 1EASA 1YPKH 2JJ2D 1LHDH 2ZDKA 4BAKB 1C5QA 3A86A 1N1LA 2RDLA 4J1YA 1C1VH 1SMFE 3BIVH 2LP6A 3GY4A 2K8IA 4BANB 4Y8YA 3UREA 1TGSZ 3JZ2B 3TGKE 1GGDB 1MKXH 4DT7B 3AW1A 1V2ST 3W94A 3PV5A 1O3CA 4X1QU 3UOUA 3RU4D 3M3TA 1Z8RA 2FLRH 1O2SA 4K8BA 5IDKA 1HAPH 4Q7ZA 3CENA 2BTCE 3QUMP 5EXNA 5FPTA 3SJ9A 4AZ2B 2GCTC 2WPDD 1AVGH 1O32A 1Z1IA 2ZFTA 2SGDE 3TITA 1O34A 1ZTKA 1EPTB 2Y5HA 3TGJE 1ANCA 1BMMH 3SNBA 3A7WA 5A09A 2FYRA 3U8OH 1ZPZA 1W3CA 4B2CA 1HJAB 3MNSA 4FUIA 4KTUA 4ZHLU 1EAIA 1NRPH 1NFXA 3RC6A 1WAYB 2FIRH 5A0BA 1KDQB 1EATA 3T62A 4UFEH 1QL9A 3WWBA 4FOUC 2YNBA 3MO3A 1F0UA 3RXLA 2ZEBA 3ZZ9A 1CSOE 1O31A 1YPMH 5FXLA 1GBDA 2XWAA 1GJBB 2D26C 2CJIA 1BJUA 1N8OB 2FX4A 2KM0A 2G52A 3I77A 4JYTA 1K2I1 5CHAB 4X6PA 3B23B 4XD7D 2ZI2H 2PKAB 1PQ7A 2ZWLH 4I8GA 5DKMA 2CF9H 4OS5A 2GMTB 1GHXH 3ATKA 1G30B 2TPIZ 2BQ7B 4X6MA 3RXQA 5EQSA 1H8DH 2TGDA 3L3TA 3RP2A 1W2KH 1O3LA 1GCTB 3RXGA 5CE1A 1CA0B 4I8HA 4RKJB 4LK4A 3BTEE 4BOHA 1AZ8A 1B0EA 1P06A 4MPVA 4D7FA 1K1IA 3KL6A 1EX3A 1FXYA 2A4GA 1GI3A 3E8LA 4DIHH 4B75A 4X6OA 3TK9A 1Y59T 2BLOA 1NZQH 1DUAA 3F6UH 1DITH 5HYOA 2A4OA 2VIOA 5ESTE 3URDA 5EW2H 1MTNC 2F9PA 3URCA 5HKKD 4O97A 1TYNA 3KHVA 3SU6A 2GD4B 2UUKB 1KIGH 1VCWA 4WMEA 3U1IB 2BVXH 2C3SA 1P3CA 9LPRA 1DWEH 1EOLA 2HPQH 1C1UH 5GDSH 1G32B 4H4FA 1O2PA 4NIYA 2FI4E 3SUDA 3U1JB 1HAVA 2ZPQA 2QCYA 3NCLA 2WYJA 3PROA 1MKXK 4CHAB 1NPMA 2XBWA 4FUJA 5JPMH 4AC9A 2FOFA 3ELAH 4JMYA 1NU7B 3EE0B 4HG6A 1AUJA 1GI9B 1HPGA 3NWUA 4B2AA 1TGBA 3S0NA 1C1QA 2SNVA 1H9IE 1P09A 4Y8XA 5E2OA 1TNKA 3V7TA 4NSVA 2G00A 1MKWK 2G51A 3K65B 2HRVA 1C4U2 2Z9GA 4K5ZA 5LGOA 2CXVA 1F7ZA 2R0LA 3WW7A 1O3IA 3RXEA 4INKA 1CU1A 1C2EA 1C5NH 3EA8A 3SU5A 4ZKOU 2R0KA 1H9LB 1QTFA 2QF0A 3QK1A 1KXAA 3MO9A 3FKSD 3F9HA 1A3BH 1O2NA 1UK3A 1DSTA 2A5AA 5JBAS 4HI3A 2BD4A 3H09A 1TPPA 2C8ZB 1GJDB 2XC0A 1RTLA 4K2YA 5I25A 1CGIE 3F9FA 1Q2WA 4B6EA 1BIOA 2C4FH 2ZGCA 3HK6B 5DP8A 5HM2A 2WYGA 1FY8E 3QDZB 1YM0A 3RDZA 2JJ1D 1QQ4A 4Y11E 1IQFA 2LNCA 5KECA 1XUJA 1SLVB 3U28C 5F53A 1LVOA 1TX8A 4WMFA 2ZO3H 1IQMA 3SV8A 1A0HB 1GGDC 1RTFB 1SR5C 1SGFG 1RIWB 3N7OA 1W7XH 4AYVB 1ZHMA 1QA7A 4Q4LA 5E8EH 1OYTH 3CS7A 1TRYA 2VU8E 2ZTXA 1ETTH 4JZDH 2P94A 1JMOH 1GBBA 3LC5A 1P2IA 2QXGA 4UD9H 1UVPA 3SNEA 3SHAH 1CVWH 1K1OA 1BA8B 1QL8A 3KYGA 3SGAE 1TQ0B 3NRLA 1EPTC 1A0LA 3BEFB 1DLKB 2BB4A 4Y7BA 8GCHF 3GS9A 2WUBA 3RXPA 3N99A 1ABIH 4CH2B 3RUOA 2HOBA 1HJAC 1N6XA 4MNYA 5CDFE 1JWTA 5L2ZH 4OS4A 4FUGA 4AGKA 4Y6DA 3PMHB 2Q6DA 5EG4A 2ANKH 1AQ7A 4DG4A 1V2VT 3PLBA 5FL7D 1ELFA 1MZAA 2KAIA 4K8YA 4LZ4B 4ABBA 1P8VC 2PTNA 1PQ5A 3UB0A 2OC7A 1TB6H 2HNTE 3BTWE 2V0BA 3FVFB 3K9XB 1SVPA 2FO9A 5C1UA 5EJ1A 3FO8D 2F9VA 4CRGA 1FPHH 3ATWA 1N8OC 3P8OA 4A6LA 4B73A 2FXRA 1O5DH 4F49A 5CHAC 1GBFA 3LGWA 5L30H 4PROA 3RXDA 3MYWA 2A7HA 3RU4T 1Y5BT 3A7YA 2GMTC 1TONA 4B1TA 1WTGH 4R0IA 4D76A 1TPAE 4A1VA 2ZHWH 1T31A 3A83A 5KEDA 1QCPA 1A2CH 1UCYK 1GCTC 1KY9A 2BVRH 1W12U 1L1NA 1CA0C 3PMAB 3PB1E 5AVDA 1O3NA 1XUGA 5JBTA 5A0CA 2LELA 2AIPA 1EZQA 4WWYA 1VR1H 1W10U 1C2HA 1DX5M 2WINI 2HLCA 1D3QB 2ZTZA 1TX7A 1S6LA 1GBEA 3E91A 2Z9LA 2AIQA 1XVOA 3LH3A 1C2GA 1XVMA 3GY2A 1IHSH 1BRAA 1GDUA 5LPFA 1ARBA 1UJ1A 2F9NA 3VFEA 2F91A 2HVXA 3EE7A 1V2UT 4BAQB 1MQ5A 3TLOA 2PSYA 2FMJA 2P59A 5DO4H 1KMHB 4BAMB 5DG6A 4AG1A 2BDGA 4NA9H 1D6WA 1A5IA 1FUJA 5F6MA 1K1MA 4CHAC 3TPIZ 4AGJA 1SQAA 1T4VH 3O8RA 1V2TT 1P2KA 1FJSA 1COWD 2CGAA 1SBWA 3FZZA 3UY9A 3A80A 2GZ8A 2W6ID 3ZVAA 4WH8A 3ATMA 3UWJH 2YNAA 1ZLRA 1LVMA 1BT7A 2CV3A 1SFQB 1EZSC 1HCGA 1KXDA 1QFKH 4NSYA 1O3DA 4X2XA 4IC6A 3RXMA 4NZLA 4Y71A 2VJ1A 1UTNA 2XC4A 1TGCA 2PR3A 1MH0A 2AEIH 2J9NA 2QXJA 3ZZCA 1MU8B 3O8DA 4JK5A 4YXWD 3VG8A 4NCYA 4YZUA 1C1RA 4ISLA 5J4SA 1O5CB 4F4OC 1WXRA 1B5GH 3LGUA 5EJLA 2R3UA 1O2GH 3NK8A 1DVAH 1YCPM 2EEKA 1AGJA 1DANH 1O2IA 3C1KA 4RN6A 2H9EH 2HNTF 2O8WA 3GCOA 3A7VA 2BLVA 5DP5A 4MTBA 3GY5A 1YGCH 4KTCA 3P6ZB 4YO9A 4UONA 4KKDA 5C0TA 4HZHA 5FAHA 4M7GA 2BX4A 4Q80A 8GCHG 1AI8H 2WV4A 1P02A 1YLNA 2AH4X 4X8TH 1BRBE 4FXGH 2Q6GA 4NWLA 2UUJB 4XBBA 1GJ5H 1T7CA 1O0DH 1RD3B 3DFLA 1VGCB 2FOAA 3GDUA 5FCKA 5T6FA 1AMHA 1WDIA 4YLQH 1JBUH 2AYWA 4JZ1A 1LVYA 3PLKA 1G2MA 1SGPE 2UUYA 1YBWA 1O2JA 1BITA 1SHYA 2KCYA 3NKKA 3LIWA 1WU1A 4GLYA 1EJNA 3F2FA 3OU0A 1NBME 1Z1JA 2ZECA 1PPHE 4TY7A 2O8LA 1O2VA 5FBIA 3BG8A 4RT1A 3SZNA 2K0QA 2VIWA 5DGJA 4NGAH 5DSFA 1CT4E 2Y7XA 3A81A 5GCHG 3GICB 1ZPBA 4A7IB 5C1XA 1MTWA 1J9CH 1DWDH 4F48B 1O5EH 1AKSA 4ZHAA 2C93B 2JDID 1UTLM 3E1XB 2QF4A 1FONA 5DP4A 2F3CE 2WHXA 1KLJH 2F9OA 1O5AB 3OY5U 3SU1A 1P12E 1Z8GA 1GBHA 3ZVDA 4DVAU 1C2IA 3M5MA 2J94A 1KSNA 2G55A 3U8TH 7KMEH 1KLIH 2ZCHP 1LPZB 1YPJH 1ZMLA 3IG6B 1YPLH 4X1NU 3A89A 5JYIA 3A8CA 2BVSH 2EI6A 2XBYA 2Z9IA 3RXSA 2HLDD 2M5TA 4BAOB 2FTLE 4ABDA 2VWNA 2XRCA 2Z6BD 3F2HA 3E16B 1PJPA 4AG2A 2ZFSA 1IQNA 1OYQA 3T5FH 4GVUA 1OPHB 1GBIA 2UWOA 1AE8H 5T3HA 1EP5A 3T29A 1SL3A 3PLPA 1U6QA 3OSYA 1ESTA 1MABB 1QNJA 2ZGXH 3U8RH 3A8BA 5AFZH 3SW2B 1HDTH 3OY6U 2ZIQH 1XX9A 4WY3A 4D8NA 2NU1E 3PTBA 1C9TA 3MI4A 1AZZA 1PQAA 2V35A 1DXPA 3QTOH 2P95A 1GJCB 2B5TB 3UQOA 1V2PT 2I6SA 2BZAA 2P16A 3OEED 1Z8IB 2GT7A 2ZU5A 3O8BA 7GCHF 1V2OT 2V3HH 4BTUB 2FESH 3F9GA 1S82A 2UUFB 2F43B 1BHXB 4IN2A 4ISHH 4GUXA 3NXPA 3RC5A 3GY6A 2ZQ1A 1HXEH 4IS5A 4I86A 1TWXB 2VGCB 2G4TA 1T4UH 2BD5A 2BYAX 1S81A 4RI0A 2Q1JA 1HAVB 1EB1H 2FOHA 2ZFRH 3OTJE 5C20A 1QJ1B 2ASUB 3S9AA 1OOKB 3F9EA 1JIRA 3RXVA 1BTZA 4Q63A 2SGAA 1HAXB 3BTQE 4AB8A 1W0ZU 2FZZA 4P00A 2KFWA 1QZ8A 4RSPA 4E05H 1FMGA 2GV7A 2IOTA 4YT6H 4WH6A 4CRAA 2TGPZ 1SGYE 1KYNA 1F0SA 1UVOA 3F68H 2ZDNA 5HIZA 3KNXA 4OS7A 1W7GH 5GXPA 1BRUP 1LO6A 2W7UA 1QBVH 1SGDE 4AFSA 2O8UA 1XKAC 2SFAA 1YWUA 1HAOH 1O2ZA 2AERH 3BTFE 1IHTH 3KEEA 3SUGA 1D3PB 3T2NA 3NUMA 1NFUA 1S6HA 1NESE 3GY3A 1J8AA 4UE7H 3DCLA 4GPGA 4X0WU 3UAIC 4A5TS 5J4QA 4H42U 1P11E 1AB9B 1C2MA 1C5XB 1GCDA 2J97A 2QF3A 1CGHA 2BXTH 3TGIE 1KXFA 1P10A 1OHHD 1FV9A 2G4UA 3GY7A 4ZUHA 1UCYE 2BY5X 2IJOB 1VGCC 2Z3EA 1S0RA 1UK4A 1C1TA 3PYHA 1YYY1 2AMPA 5DJ7A 1HAYB 1DDJA 4LZ1H 4FVDA 5HM9A 1EQ9A 2C8WB 4D7GA 2FYQA 1HAIH 4FU7A 3SU3A 3SN8A 3BEIB 2Y7ZA 3LC3A 1RGQA 4KGAA 2HWLB 4WXVA 2ZFPH 5GNDA 1A46H 2FPZA 3MH4A 1NO9H 1MKWH 4CR9A 1P05A 1Y5AT 6GCHF 3NPSA 1RS0A 4I7YH 2OUAA 2BQWB 1LPKB 4TPIZ 3CP7A 3E0NB 4MNWA 1RTKA 1IQJA 2VIPA 1V2JT 3UTUH 3VEQB 3RXCA 2Y5GA 4BNRA 1A0JA 1LQEA 3RXRA 1AFQB 1H9HE 2W3KA 2FOCA 3MH6A 1PYTD 4ASUD 2QF5A 1C1OA 4RKOB 1GHWH 4SGAE 3QLPH 1YPHE 2WUCA 3H7TA 1BCUH 4X2YA 4DOQA 3SJ8A 2J98A 1T8OA 2OTVA 1MZDA 4FU8A 1BTPA 1QRZA 1UTOA 1Y3WA 2BZ6H 2VBCA 3V13A 3GCTF 4DIIH 3SUEA 1TBZH 1H8ED 1BOQA 2FEQH 3GCNA 4P02A 1GHYH 5CMXH 1C5UA 1EAWA 1YLDA 2G5VA 1E1QD 2C8YB 1GVKB 3M7QA 3BTTE 4YT7H 5EW1H 1A4WH 1CT2E 1FN6A 1HGTH 4JYVH 1QB6A 2BDBA 7GCHG 1GI6A 4FVBA 3C27B 1W11U 2ALVA 3GDVA 1SGCA 1GHBF 3SQEE 1ESAA 1D6RA 1SLWB 3BTDE 3FZDA 1OWKA 2L6OA 5FBEA 2AGGX 4I33A 4BXWA 4Y76A 4KTSA 2ZGBH 5JDUB 3TK5A 4AFUA 4CH8B 3DT0H 4I31A 1NROH 2KX4A 4AFQA 1Y3VA 1C5OH 3NZIA 4ABGA 1V2LT 2FP7B 3SNCA 1TA2A 1QBNA 3ZVFA 2PP6A 3P95A 3TH2H 1GBCA 1XKBC 1Z71A 3UFAA 5EXLA 3UOPA 2XBVA 2D2DA 1EZXC 2ZF0H 2RFKC 1O3EA 4CRDA 4DURA 1ABJH 3QO6A 2VGCC 1OKXA 1SFIA 2ZCLP 3ZZAA 4K3JA 5C5NA 4NA7A 1C5MD 4BXSA 2HALA 2PHBA 1EUFA 1XMNB 5AFYH 1UCYH 3PO1B 2GGVB 3AAUA 2WZQA 3QZRA 1P9UA 1BBRK 1QB9A 1EB2A 3LJJA 2GVFA 2GP9B 3S9CA 3PMBB 4B6FA 3M5NA 3LGTA 1UHBB 3ZZDA 5EPNA 4X1PU 1O3KA 4NG9H 4ZCNA 4TYDA 3ZZ3A 1DOJA 4NIWA 1C1WH 3HKJB 2VIQA 1YP9A 4UFFH 1SG8B 2EI7A 2AS9A 1HYLA 4OS2A 5E2PA 4I8LA 3TU7H 1KTTB 2ZPRA 4XOJA 1P2OA 2R9PA 1MUEB 1O3GA 2A32A 5LH8A 4IC5A 2GKVE 1NBMD 1RXPA 2H5DA 3ATIA 3ITIA 1C5YB 1LPGB 1ID5H 1XUFA 4YM9A 4I8KA 1AB9C 1F0TA 4I8JA 3AK5A 3FN8A 3QX5H 1B7XB 2L74A 6GCHG 1WCZA 5EU8A 3ZYEA 1S5SA 1DICA 2VH6A 1QURH 3STJA 2ZDVH 1WBGB 1XXDA 1P01A 3A7TA 4MVNA 4AORA 1V2MT 2ZKSA 1ELGA 1Y3UA 2FM2A 4FETA 3VPKA 3UNSA 2B0FA 1QBOA 8ESTE 1SPJA 2KCAA 3L6PA 1GBJA 1OWEA 1DM4B 3RXTA 3RMOH 3RC4A 1O38A 2Z9KA 4U01A 1EPTA 1TOMH 3RM2H 1A1RA 2V3MA 3SO3A 1SKYE 3KQ5A 4WF8A 1D4PB 3DD2H 1DPOA 1PPZA 9ESTA 1DLEA 1IQKA 1O3JA 3TNTA 2RCEA 3GCTG 1WV7H 1T8NA 4ABHA 4TPYA 2FWWA 4HTCH 3V3MA 1NRRH 1LHEH 3PM3A 1HFDA 1O2RA 4YOGA 4DT4A 1AFQC 1NRSH 3H7OA 1ELAA 1C1PA 3RXUA 3S9BA 1BDAA 3D65E 1O2KA 1FY3A 1GPZA 2ZHFH 5FPYA 4NA8A 3B9FH 1GHBG 1KTSB 4O3UA 4X2WA 1OWHA 3SORA 2J2UA 4ZKSU 1JRSA 1P04A 3LOXA 1TGNA 2C8XB 4X8UH 3SJIA 1QR3E 4CRCA 2BY8X 4Y8ZA 1ETRH 2Z3CA 4Y79A 1UW7A 2YMSB 5AF9H 1LQDB 3UUZA 1GG6B 2J34A 1AO5A 3OE7D 5C2ZA 2H1UA
chains in the Genus database with same CATH topology
2AGIX 1AD8H 1H4WA 1GMDF 2VVVA 4IMQA 4ZH8A 1F2SE 3QGJA 4BTTB 3QN7A 1CGJE 1WSSH 2AMDA 2OP9A 3MU8A 3HGPA 3ZVEA 5A8XA 2Z3DA 2VNTA 2BY6X 4XBDA 1O3MA 3T27A 4AB9A 1TMBH 5H4IB 4AOQA 1F5LA 4IGDA 1P03A 3SJKA 4NFFA 2A5KA 5TJXA 4WXIA 6CHAB 1GI0A 3FANA 3LDXH 3DHKH 1HIAB 3DFJA 1ELCA 3RXIA 4Y7AA 4JCNA 3TIUA 3M3VA 4UFDH 1AFEH 3HGNA 2BY7X 1UTKA 1SGRE 4CREA 3VB7A 2ZNKH 2ZFQH 3GYMA 3EA9A 2H9HA 2ULLA 1FZZA 1O3AA 3Q77A 1HXFH 2GDDA 4NWKA 1C1SA 2RG3A 2ZC9H 1K9OE 2SGPE 3TVJB 2CN0H 1GMHF 1O3OA 3FFGA 5A8YA 1ZHRA 3ESTA 3M36A 4GHTA 2ZU2A 1EZUC 1E37B 1FQ3A 1Y8TA 1CQQA 3DA9B 2GT8A 1CHOF 1KLTA 1EAUA 4X6NA 2ZQ2A 2A7JA 1C2FA 4ZAEA 3BF6H 3BSQA 2EA3A 1Q3XA 5F8ZA 3A7XA 5TCAA 1T8LA 3FAOA 3M3SA 3PO1C 3LJOA 1MAXA 1NRNH 1O2WA 1ELTA 2A4QA 1LKBA 2QIQA 3RXAA 4MPXA 1VJAU 1F5KU 1V3XA 1SOZA 1C2KA 2BDAA 3K6YA 3S69A 5F03A 2ZU3A 1SQTA 2ODYB 1UO6A 1SGTA 4JZIA 4MG3A 1ELEE 1HB0B 3P8NA 3ZZ5A 1GDQA 2D8WA 1O2MA 2ZHEH 3GOVB 1TPSA 2Z94A 1IOEA 4ABIA 1TNHA 1GWAA 3SU0A 2XTTB 2F83A 3U98H 7LPRA 2P3TB 4ZHMU 3H5CB 2BD2A 2PLXA 1LDTT 3VGCB 1TE0A 1IQLA 1H1BA 3A8AA 2XC5A 1FIZA 3BG4B 1C4V2 4I32A 3T26A 4FUHA 3SBKA 5L2YH 2BLWA 1ELVA 2BLQA 3FP6E 2VB0A 1UTQA 1GBKA 4O03A 4AN7A 3R0FA 1V2RT 4THNH 1QL7A 2ZDMA 1P3EA 2GZ9A 2TBSA 1OWDA 2ODQA 2ZCKP 1FY1A 1TNGA 2OQ5A 4B76A 1J16A 3KN2A 1GJ8B 2THFB 4DY7B 2WPJS 2AFQB 3RMMH 2JH5D 1ZRBA 3MH7A 2ZGHA 5FX5A 1VZQH 1VCQA 1S83A 3UIRA 4CBNA 1DS2E 3RXOA 3DUXH 8LPRA 1GJ7B 1ZPCA 3QWCH 2QAAA 1G2LA 2Y6TA 3D23A 1DY9A 1QRXA 1EAXA 3I78A 2A2QH 1BJVA 4DJZB 2A7CA 2PUXB 1L4ZA 1GMDG 1NU9A 4AYYB 1C5WB 2FOGA 1Q31A 3T25A 4XBCA 1AN1E 1ZR0A 2G81E 3KGPA 5K7RA 2FOEA 1ZOMA 2VIDA 2QN5T 4U30A 2STBE 1UMAH 3ODFA 1ZRKA 3SGBE 3AASA 1CO7E 2QXIA 3VXFH 2ODPA 5AHGH 4VGCB 4ZXYH 4BTIB 1TABE 1P2MA 5E0GA 1WTHD 1HUTH 2FI3E 1TNIA 3M5LA 3RXBA 1GG6C 4TWYA 6ESTA 3QTVH 1XM1A 2RA3A 3SQHE 1BQYA 2I6QA 1BBRE 2V6NA 2OC1A 1SSXA 1HBTH 1P57B 2GX4A 2PGBB 2QA9E 3BIUH 2PV9B 1TNJA 4E06H 3SV6A 3BTME 2BQ6B 3P70B 3UNRA 2H2ZA 1AUTC 1MBMA 1MTVA 3SGQE 1PQ8A 2PW8H 5DPAA 1O2XA 3ZZ8A 1L2EA 4MNVA 1GJ4H 2WPLS 1W14U 6CHAC 1GMHG 4XE4A 3SNDA 4ISNA 1G36A 5IYTA 4O9VA 1FN8A 1CHOG 1WOFA 2EI8A 2JH6D 1J15A 1QJ7B 1GVZA 2BXUH 1UTJA 4NZQA 1NS3A 1QRWA 1XUHA 4CR5A 4X1RU 2ZP0H 2BD8A 4H6TA 5GJ4B 3WY8A 1EP6A 2GDEH 1WYKA 1QB1A 4SGBE 2G8TA 5EQQA 2OBQA 3M37A 3G01A 2BD7A 4FUCA 5C3NA 3RXFA 1HV7A 4XFQA 1NFYA 2AMQA 2A45B 1T32A 5GIBA 1E38B 1SGNE 1C5TA 4Y0YE 1HJ9A 2A5IA 3CS0A 2OINA 4Y10E 5JBBS 3OYPA 2D1JA 1FIWA 1YCPK 2FDAA 1DFPA 3PMJA 2ZHQH 1TALA 1CE5A 1XXFA 1Y5UT 2K1QA 3LT3A 1AU8A 3KCGH 1O5FH 3KQDA 1THPB 1AWHB 1ZMJA 1LHGH 3L33A 3PTNA 4LOYH 3MNXA 3UPEA 5JBCS 2JETB 1JXPA 1OWJA 1YPEH 5DK1A 1BMAA 2VWLA 4X1SU 4JK6A 2A1DB 1E35B 1K1LA 1O2YA 1C5LH 1MCTA 3HKIB 5HXFA 4H6SB 1E34B 4IMZA 3T28A 1K21H 5JB8S 1AWFH 2BDYA 2WV5A 2OC0A 1BTHH 3ZZBA 3VGCC 3OX7U 3LGYA 3ODDA 1G9IE 3LGVA 2Y81A 2CMYA 4KP0A 3UWIA 5E0HA 3BG4C 1RJXB 3BEUA 1LMWB 1LTOA 1L1JA 2XYAA 2NU0E 4GAWA 2LPRA 1G3CA 2Y5FA 5EQRA 4WJG2 1VITF 1YLCA 2EC9H 2W3IA 1LVBA 6LPRA 3KF2A 2B9LA 4FU9A 1C5RA 5F8TA 3A85A 5DP6A 1VITH 1BB0B 5FCRA 1JOUB 1C2DA 2PUQH 4NIXA 3F1SB 3QGNB 1BBRH 4NFEA 2JKHA 4D9RA 1YPGH 5EOKA 3UNQA 1O2UA 1ANDA 4X2VA 1O2QA 4CBOA 1WUNH 4K60A 2OQUA 1YC0A 1V2KT 2IN2A 2NWNA 3ZVGA 2RA0A 3QZQA 4HFPB 5T6DA 1CBWB 3Q3XA 1ANEA 1GBAA 5LPRA 3VXEH 2R2WU 2BDIA 2ANYA 1NFWA 4XDEA 1HAZB 1O3BA 8KME2 5L6NH 2P8OB 2XCFA 1GJ9B 1ZTJA 2H6MA 3RM0H 1SGIB 3MU0A 1HAGE 3ZZ6A 1S84A 2KAIB 4OS6A 4J2YB 4E7RG 1ARCA 2HPPH 1JRTA 1HNEE 4GCHF 1K22H 4FUDA 1O2HA 1DXWA 1OP2A 4UFGH 1SLXB 4VGCC 3MNBA 2Y80A 5DP7A 3BTKE 3EGKH 5TCCA 5FX6A 1ESBA 1XUIA 5EPYA 1DUEA 3MFJA 1C5ZB 1L4DA 4JYUH 2Z7FE 1OX1A 2ZGJA 2HNTC 1FAXA 4R8TB 1P2QA 4GSOA 3TH3H 2QYIA 3EAJA 1PPEE 2XWBI 1BRCE 2ZDAH 1GMCF 3KQCA 3LKWA 3JZ1B 2NU3E 2VWMA 2OXSA 1ZYOA 2A4RA 1P2JA 4K69A 1ZGVA 1CHGA 1VJ9U 4ZMAH 1IAUA 4DGJA 1NN6A 2VIVA 1OP8A 2W26A 4ZKRU 1O5GH 3D62A 1GI1A 1A5GH 3TJOA 2FS9A 2A0QB 2BY9X 1PYTC 1XUKA 4CRFA 5BRRE 1ORFA 1BTYA 1OXGA 2R2MB 3ZYDA 1NY22 3Q00A 2WPHS 4ABAA 5ESBA 1RRKA 1ZSLA 4MNXA 4OGXA 5EXMA 3D49H 1UVTH 4IW4E 2OD3B 4UDWH 3RMLH 1Y3XA 1GL1A 1O39A 1DWCH 3A7ZA 1BTUA 1WQSA 4Q7YA 4D9QA 1EKBB 2PKSB 1TA6A 3RLWH 1SOTA 1GI2A 3BV9B 1O37A 1TAWA 4ZKNU 1FNIA 5EODA 5FHTA 2WPIS 1W13U 1HAHH 3IITA 1ZTLA 2SGFE 1TBQH 2BX3A 3TJUA 1Z6JH 2FLBH 1GL0E 2QGRA 1S85A 1AE5A 1CT0E 1GBLA 1L1GA 3GDSA 3P17H 1TIOA 4TWWA 1ZJDA 3KIDU 5DP3A 1SI5H 1VITG 2JETC 4LXBH 1C4Y2 3SI4H 1LHCH 2B7DH 3RMNH 1EJMA 2SGQE 4MDSA 2NU2E 1G37A 4DW2U 4B2BA 2J95A 4YLUA 2CHAB 1GI7B 1O2LA 1GI8B 4O3TA 3EDXB 1A61H 1C9PA 3M7UA 1HLTH 2ZU1A 2BOHB 1ETSH 1GBMA 3S7HB 3A87A 2ZZUH 3SOSA 2TGTA 3Q3YA 1IQGA 1ZSKA 2Z9JA 1MTSA 1DE7H 1E36B 3P8FA 1GI5A 2VH0A 4MPWA 1A3EH 1MQ6A 5LPEA 1EOJA 3GCHB 4GCHG 1TPOA 5G4BA 1BMNH 7ESTE 1B0FA 2ZTYA 4U2WA 2QC2A 4WVPE 2YOLA 1C1MA 3PV4A 3ZVBA 2OC8A 4NIVA 1AHTH 1UVUH 1KDQA 3HPTB 1FDPA 2XBXA 1CBWC 2H9TH 1TRNA 2FX6A 3MOCA 3ZZ7A 3RXHA 2ESTE 3SUFA 2P8OC 1MTUA 1V2NT 3RXKA 4MLFB 1AKSB 3UQVA 1OWIA 1GBTA 1GDNA 1JIMA 1GMCG 2PKAA 2ZA5A 2O8MA 1O3HA 3M35A 3RU4E 1FY4A 2ANWA 4IBLH 3A84A 4ISOA 3M61U 1UTMA 4YOJA 2P3FH 1GHAF 2OLGA 4ZROA 1BMLA 2ZG0H 4YOIA 5E0JA 2JH0D 3ZVCA 2PSXA 1AIXH 2NU4E 1Z6EA 3MO6A 1O33A 1C5SA 1F0RA 3K6ZA 2ILNA 1P0SH 5GCHF 1INCA 3KQEA 2A31A 3VB4A 1IQEA 2TIOA 4KELA 2ZHDA 3K2UA 1K1PA 1UK2A 2ALPA 2SGEE 2BM2A 1KXBA 3A88A 1ELDE 2J4IA 3ZV9A 2A2XH 2ZPSA 4JZFH 3SV7A 1V2WT 2VWOA 2O9QA 4ABJA 3B8JA 2Y82A 2W7SA 2BMGB 4GHQA 1W0YH 1MD7A 1O2OA 5A0AE 3MU4A 4X8VH 4Q2KA 1ELBA 4ASHA 4A1XA 3A82A 1K1JA 4ESTE 5C5OA 3PWBA 2FODA 2F9BH 1SGFA 3AAVA 4ISIH 1NTPA 3MNCA 3SNAA 1MBQA 2Q6FA 3E0PB 1V6DA 1HRTH 2H5CA 1MMJN 1TQ7B 2ANMH 1ZSJA 1AVXA 1J17T 2DUCA 1DSUA 2VVCA 4OS1A 1YKTA 1D3TB 1WQVH 1QHRB 1FLEE 4B71A 2PKSC 2B8OH 1THRH 1NC6A 3GY8A 5A8ZA 1OS8A 5FPSA 3LU9B 1AY6H 4Y0ZE 1ZZZA 4HGCA 1PFXC 2XW9A 2GCHF 4E7NA 2V3OH 1UHBA 2BHGA 3EYDA 5EGMA 5HGGA 2PTCE 1W8BH 3MMGA 4OGYA 3P8GA 5JB9S 1C5PA 2UWLA 3LGIA 2GV6A 3ZV8A 4ABEA 4AX9H 1TRMA 3U9AH 3SJOA 2FOMB 3R3GB 1FY5A 4JZEH 1VCPA 4TY6A 4MPUA 1G3EA 1K28D 2VINA 1ZGIA 2BDHA 2W5EA 3VB3A 1MU6B 2PWXA 1C5VA 5I46H 5ETXA 4FUFA 2CHAC 2J38A 1SGQE 1V2QT 1IQHA 1GI4A 1M9UA 5C67A 1SQOA 2R3YA 1ACBE 1PPCE 2FI5E 1SB1H 3ATLA 5GWZA 1DT2A 2AGEX 3EQ0H 4DCDA 1TBRH 3LPRA 3AVZA 2ZDLA 1O36A 3VB5A 4INLA 1O30A 2FTMA 3MWIU 1PPFE 3FP8E 1C2LA 4Q7XA 3M7TA 1LKAA 1SHHB 3TH4H 1X7AC 2TGAA 2WPMS 2FOBA 4K1TA 1RIWC 1TFXA 5K0HA 5SGAE 1GHVH 1S6FA 2GCTB 4B74A 1ANBA 1FPCH 1QQUA 3GCHC 3UR9A 5HMAA 1SLUB 3BTGE 3EA7A 2WPKS 1EXFA 1YCPH 1S0QA 1SGEE 2DE8A 1GHAG 3GISB 3RXJA 1TMTH 2XCNA 1GJ6A 5F8XA 1K1NA 4CRBA 2BD3A 3E90B 3U69H 3P92A 1MCVA 1BHXF 1KXEA 1O3FA 3UR6A 4YTAA 1FI8A 4U32A 3HATH 4YESB 3IWMA 1N6YA 3LONA 4MQAA 3SHCH 1EJAA 1F5RA 1FAKH 1QY6A 4FUBA 1LHFH 5GPIB 5B6OA 1TMUH 5ABWA 3TK6A 5C1YA 1Z7KA 3VB6A 3SU4A 1DY8A 1O2TA 3E6PH 5T6GA 2BOKA 1UTPA 2P93A 1KXCA 1NT1A 4A1TA 3TJVA 3TNSA 1O3PB 1YPHC 1HJ8A 2HGTH 1LCYA 3FP7E 2QV1A 5DP9A 3SV2H 3S7KB 4BAHB 1BZXE 1QA0A 4ZXXH 2BDCA 3SU2A 4INHA 1NM6A 3A8DA 1L0ZA 3I29A 3BTHE 4Z0KA 2QY0B 4K1EA 3MHWU 1MD8A 3LH1A 1BUIA 3MU1A 3SV9A 1BTWA 3TJNA 2OCVB 4K1SA 2ZU4A 2PGQB 3E3TA 1TNLA 2STAE 3GYLB 4FUEA 2C90B 3MU5A 1HIAA 1P2NA 1MAYA 1MTNB 2TRMA 3ENSB 1AVWA 1QIXB 3KQBA 1O5BB 2F9UA 3AW0A 4AFZA 1UVSH 2GTBA 1ZHPA 1TX6A 1YF4A 2G5NA 1GHZA 1PPBH 4XSKU 4Z6AH 2GCHG 3PWCA 4IN1A 1A7SA 1P9SA 3W95A 1DWBH 3V0XA 1C2JA 2SNWA 1QJ6B 1OP0A 1OSSA 2ZFFH 2OBOA 1G3DA 3RLYH 2CF8H 2O8TA 1ZJKA 2BD9A 5A2MH 3SI3H 1RFNA 2PFEA 2GZ7A 2XNIA 1J14A 1THSH 5PTPA 3Q76A 4QT8C 1TLDA 1PPGE 2P3UB 1T8MA 1GVLA 3BN9A 1NRQH 5BPEA 1Y3YA 3MTYA 1TGTA 3M5OA 2UWPA 1QGFA 1A5HA 2VVUA 2J92A 4UEHH 4X8SH 4WMDA 3ZZ4A 1G3BA 1ZMNA 2XXLA 1E0FD 1GJAB 3V12A 3STIA 1SC8U 1F92A 1TOCB 1IQIA 1O35A 1CA8B 3O8CA 3HK3B 2QXHA 3MH5A 2FS8A 4A92A 1H8IH 4ABFA 2DE9A 1D3DB 1D9IA 2IPHA 1C1NA 1BTXA 1Z8JB 3Q3KA 1EASA 1YPKH 1LHDH 2ZDKA 4BAKB 1C5QA 3A86A 1N1LA 2RDLA 4J1YA 1C1VH 1SMFE 3BIVH 3GY4A 4BANB 4Y8YA 3UREA 1TGSZ 3JZ2B 3TGKE 1GGDB 1MKXH 4DT7B 3AW1A