1V2ST

Benzamidine in complex with bovine trypsin variant x(ssfi.glu)bt.d1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Trypsin
publication title Understanding protein-ligand interactions: the price of protein flexibility
pubmed doi rcsb
source organism Bos taurus
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2sT01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2sT02
4X2YA 1S0RA 1OYTH 3M3VA 4ZKSU 1FQ3A 1P12E 1RXPA 1HV7A 1BT7A 2PKAB 2FOAA 1SOTA 1YBWA 2PGQB 4NFEA 1DS2E 1ESTA 1H8DH 3LGTA 5JB8S 2GZ7A 2ZFTA 2ASUB 1UVTH 3SORA 3DFLA 1AQ7A 1SHYA 1A7SA 1P9SA 1J14A 1IQGA 3S0NA 3Q3XA 3UFAA 1EATA 1LHDH 2H9EH 1AZZA 1SMFE 1B0EA 4R0IA 3UIRA 1BRBE 4X0WU 1S0QA 1EPTA 1DVAH 3ZZBA 1O5EH 3MU1A 2FYRA 2BD4A 1A61H 2F9OA 2YNAA 4Q7XA 2IN2A 2BB4A 1K28D 4AG1A 4X6OA 4X1NU 7LPRA 1UCYK 1RRKA 1VR1H 1C5ZB 3M3SA 5LPFA 3AASA 3BEIB 2OTVA 1Z8IB 4UFEH 2PFEA 1GMHF 1O3FA 4HZHA 4U01A 3O8BA 4FUHA 2VIQA 2ZHFH 1GI6A 5DP5A 4K8BA 2WYGA 1MZAA 1GGDB 1OYQA 2H9TH 4X8VH 1CHOG 2BOHB 4YOJA 2HPPH 4DOQA 3LOXA 2OC8A 4DT7B 1OWEA 1LVMA 1O3AA 1L1GA 3OTJE 2Z7FE 2FOFA 4XBBA 3A85A 1QRXA 1UVUH 2W7UA 4K1SA 4KTUA 1IHTH 3BTDE 3SNAA 1ELEE 1V2ST 2FLRH 1F2SE 2TGAA 1O34A 1RTLA 3V7TA 3ZVBA 1N1LA 1KDQA 1PQAA 2VIVA 3SV9A 2ANYA 3MHWU 3GYLB 5LPEA 3MU4A 1NY22 1XKBC 4J2YB 1J9CH 2FOMB 1FI8A 1Z8GA 2UUKB 3N7OA 3QTOH 4THNH 3MMGA 1KLJH 1W12U 5IYTA 3MU0A 4YO9A 1BMNH 1MD8A 1NZQH 1Z8RA 1GVLA 3C1KA 2KAIB 5T6DA 3RMMH 3V13A 1C4Y2 5HGGA 3FVFB 2A45B 2OCVB 1HAZB 5HM2A 1V2OT 3RXIA 3MNBA 1LDTT 1BJUA 2B5TB 4Z0KA 4YOGA 1NRSH 1TQ7B 2G00A 2ZFQH 5C5OA 2ZA5A 3RC5A 3GDSA 1WU1A 1V2VT 1Z6JH 3GDVA 2BXTH 3BIVH 1O3IA 2Z3CA 1T31A 2UWPA 3E90B 1PYTD 5PTPA 7GCHF 3F1SB 1QQ4A 2QAAA 1C2HA 1EJAA 1HB0B 2FI4E 2Y5HA 2BQ6B 5JYIA 4H4FA 3D49H 3BG8A 1E37B 3DT0H 1PPGE 4X2VA 4A92A 4J1YA 3MNXA 4CRAA 4CH8B 1M9UA 3L33A 1F7ZA 1LVBA 1MCTA 1AHTH 5EOKA 1HUTH 3TU7H 1NROH 1IQMA 2ZQ2A 4MPXA 4UFDH 1SSXA 1O31A 2A2XH 3MH7A 4XDEA 5T6FA 1O5FH 1LPZB 3HKIB 4WF8A 2EA3A 2V35A 2QY0B 1LTOA 1P8VC 1PPBH 2ZG0H 1K1JA 2R0KA 5EXMA 1S6HA 5DPAA 5DP3A 2ZGBH 3D23A 4ZKNU 4O9VA 2P93A 4YLQH 1BQYA 1YGCH 1TNLA 1CVWH 3QUMP 4FU9A 2FM2A 2JH0D 4CREA 5FXLA 4OS7A 1O37A 1BTZA 1G3DA 1YM0A 4UEHH 1GJ4H 4K1EA 3ZZ5A 3RXOA 4Y7AA 1SLWB 3V3MA 1UJ1A 5JBAS 2JH5D 7KMEH 1EJNA 1W14U 1LPGB 5DP4A 4B74A 3DUXH 2AH4X 3M5MA 2FOGA 2VH6A 3KCGH 1GMHG 1K2I1 2ZGXH 1AIXH 1NC6A 4K3JA 4AYYB 2P3TB 1BDAA 5EPNA 1ELGA 1K1OA 4IS5A 1UTLM 1QGFA 4BNRA 5A09A 4O3TA 1XXDA 1C2IA 3AVZA 1UHBB 1Z1IA 4I8GA 3MO9A 3FFGA 4FU7A 1ZLRA 1KY9A 1AE8H 2SFAA 3A7ZA 2BZ6H 3VPKA 1BMLA 1C5XB 3TJVA 2Y82A 4K1TA 2FLBH 4E7NA 4GSOA 3LDXH 4ABFA 2QXGA 1O3EA 1F5KU 4VGCB 3W94A 1YC0A 4FUIA 1G3CA 4AGJA 4X8SH 3BTGE 3ESTA 3LGVA 1QRZA 3JZ1B 1BHXB 1HNEE 2ZTXA 6CHAB 5C67A 2P8OB 3HGPA 1CT4E 1E34B 1BRCE 1MH0A 2FI5E 2JKHA 2F9PA 3EYDA 1UCYE 1FZZA 4WXVA 1GG6C 1DDJA 1F92A 4NA7A 1DY9A 1SLUB 4WMFA 1AD8H 1V2TT 2Y81A 5A0BA 1JRSA 5L2ZH 3A7TA 1NPMA 2Y7ZA 3AAUA 1MTVA 3SNCA 4Y7BA 4DIHH 3UNQA 4YZUA 4HI3A 2V3OH 2P16A 5C20A 1SGRE 2G5VA 3FP7E 3LH1A 3P8FA 2ZHWH 4AFUA 1TPAE 1V2JT 4MVNA 3RLWH 1FAKH 1AZ8A 1WV7H 1UTKA 4KTCA 3H7TA 4NIVA 4Y8YA 1GMCF 3VB7A 1SQOA 1H4WA 2FOBA 1EPTC 1LVYA 3BTHE 2GMTB 3GCOA 1P04A 1C1RA 1C5MD 1SQTA 3QLPH 2SGFE 2W5EA 1MBMA 4BXSA 1L4ZA 3RLYH 3MNSA 1UTPA 1ZPCA 4UD9H 1RIWB 2BQ7B 1F0UA 2EI6A 3TK9A 2C90B 4MLFB 2GCHG 1T7CA 2H1UA 1ZSKA 2Z9IA 1C5LH 2XBXA 3ATKA 1XUGA 5C1UA 4XOJA 3MH6A 3M61U 3EAJA 4INLA 3P92A 3F9EA 4K69A 3I77A 1ELTA 3OSYA 4WWYA 1OS8A 3ODDA 3GCTF 1T32A 4NZLA 5DO4H 4X6NA 3R0FA 3SGBE 3PMJA 3T29A 2BQWB 2OBQA 3LKWA 3SZNA 4NWKA 2XXLA 1ZRBA 1CA8B 4KKDA 1C5TA 2HNTE 1V2MT 1TGNA 1A5IA 3G01A 5E2OA 1GI5A 4FXGH 3DHKH 4LXBH 1IQIA 1YPHE 3PMAB 1TABE 4MNXA 2A7JA 1SC8U 2G51A 2AGIX 1TGTA 1ZMJA 1NN6A 2SNVA 2GP9B 2IJOB 3SHCH 2OXSA 1UTJA 2VVCA 4JZIA 1IQFA 1HBTH 5C2ZA 2BDIA 1BTPA 1DUEA 1A3BH 3O8DA 1FY5A 1OP2A 5F8TA 1KXAA 1MTWA 3GY4A 2F91A 1FY4A 8ESTE 2VU8E 2Z6BD 5EQSA 2VIOA 1L0ZA 1KXFA 3PLPA 1ZRKA 2QYIA 5GDSH 2ZPQA 2VVVA 1EZUC 5L6NH 2BX3A 1NS3A 1CGHA 3ATIA 3BTTE 3MH5A 2BXUH 5EG4A 1QBVH 1RJXB 2JH6D 4F49A 5F03A 2O8WA 1FPCH 3H7OA 1C2MA 1AMHA 2FTMA 2LNCA 1O2VA 3QWCH 3A8BA 2ZCKP 5C5NA 4HTCH 1TX8A 5FPTA 2XCFA 1UTOA 4ZKOU 4INHA 3RMNH 1WQVH 2BD5A 4B2BA 1DSTA 1SFQB 5DP6A 1GI4A 1C1UH 3RXKA 1YLDA 1YCPH 2Z9LA 4I8LA 4ABGA 4ZROA 2HOBA 2A4GA 1A0HB 4YLUA 2R0LA 2QA9E 1XUHA 5HM9A 2J92A 3RMOH 1C5QA 4ZMAH 4ZHMU 1O3PB 1L1JA 1D6WA 3LIWA 3OX7U 1BBRH 4BANB 2GGVB 5E2PA 3UR6A 1QJ1B 5AF9H 1GBLA 1BITA 1XMNB 4RSPA 4MNVA 4OS4A 1AUTC 2Z9KA 1YF4A 1GMCG 3PWBA 5EGMA 1UTMA 2QXIA 2WPMS 4Y0ZE 1RD3B 1TPPA 2ZDVH 3ODFA 1HJ8A 5ETXA 4CBOA 1D3DB 4R8TB 5K7RA 5CHAC 3OY6U 4Y10E 4DJZB 2NU4E 3PLBA 1CBWB 1ELAA 2ZHQH 4FUFA 3SI4H 5FHTA 1PQ7A 2CMYA 2D26C 2OP9A 4CRBA 3AAVA 2ZCLP 3ZVAA 2C8XB 3A7WA 1B7XB 1P3EA 2BD8A 3SNBA 4ABEA 1ESBA 1HAIH 3VGCB 1IQLA 1HRTH 1P10A 2WPJS 3S7KB 3TIUA 3MWIU 1BOQA 4ASHA 4AOQA 1WTGH 1D9IA 2QCYA 2VGCB 3A81A 5F6MA 3IITA 4DY7B 4Y76A 4YTAA 5C1XA 1O2TA 5AHGH 1EX3A 1D3PB 4AB9A 1MKWH 1VITG 3BN9A 2BY9X 2BD2A 1Y5AT 4AGKA 8LPRA 1X7AC 1P2KA 4SGAE 4XBCA 2ZKSA 4ZXYH 1GJBB 1NFXA 1Y5BT 1JWTA 1TQ0B 2BTCE 3U8RH 1FY1A 3ZZ8A 4AB8A 1MUEB 3NZIA 2FDAA 1EAUA 1S84A 3UY9A 2ZHEH 5DG6A 4WVPE 2TPIZ 1XVMA 1W3CA 1BMMH 1UMAH 2PSXA 2PW8H 1MTSA 3GY8A 2FODA 4H6SB 3KEEA 5HXFA 2QC2A 6GCHF 3U8OH 3LGYA 2B0FA 2FIRH 2XC4A 4DW2U 1SL3A 8GCHF 1Y3UA 1TNKA 2O8TA 3TK6A 1F5LA 4OGXA 3D62A 5A0CA 2A5IA 3RXTA 2ZTYA 3E16B 1ZPZA 4TY6A 1Q3XA 2GKVE 1OOKB 4D9QA 1IQHA 3SNDA 1XUIA 4CRDA 3RXCA 1WSSH 3STJA 2FPZA 3MU5A 4B76A 2SGQE 1DWCH 4UFGH 2FESH 1DANH 2HRVA 1GI7B 3SUFA 1CHGA 1SHHB 1GBHA 2OQUA 3MI4A 5GJ4B 3VB6A 2R3YA 4JMYA 1C2DA 1ANEA 1OXGA 1GHAF 2AGGX 1TPSA 1Y3YA 2XCNA 1LMWB 3SJIA 3RMLH 1EAXA 4O3UA 2H5CA 4YESB 2ANKH 1HAYB 1GI2A 3Q76A 1EXFA 1SGTA 1DY8A 1SFIA 1TA2A 2ANWA 3HATH 3ZZAA 3SU5A 3TGJE 2R2WU 1G36A 2GD4B 1OWKA 1Y8TA 4CHAC 1T8MA 1INCA 1ELVA 2Q6GA 1GG6B 1E35B 1C5YB 4UDWH 1Y3WA 1P2QA 4AFZA 3SGQE 3TH2H 5HMAA 1IQKA 1UCYH 1BRAA 2F9BH 3E1XB 1T8NA 4AN7A 5BPEA 4MNWA 5A8ZA 4I33A 1CGJE 2P3FH 4X8TH 1GI9B 2ZGJA 2SNWA 5EQRA 2H5DA 1YPLH 2FYQA 1C4U2 4B71A 1GCTB 1TE0A 1V3XA 3TJOA 1YPEH 1ZMLA 3FP6E 3MYWA 2OBOA 3LC5A 3SGAE 4IC6A 4JK6A 1GJCB 2PHBA 4X1SU 3RDZA 3S9CA 1MTNC 5B6OA 4A1TA 3QK1A 5TJXA 1MAYA 1CSOE 1P02A 5LPRA 4U32A 1TB6H 1FN6A 1HYLA 3NWUA 3Q00A 1JRTA 1O3NA 1PPEE 1BMAA 2ZU1A 2F9NA 5GPIB 2Y7XA 3QDZB 5JBCS 1PPHE 1QCPA 3RM0H 2ZDKA 3TLOA 1O5CB 2Q1JA 5F8ZA 3NXPA 1RTKA 1J8AA 2F9VA 2VINA 1FY3A 1C5SA 4AORA 1MQ5A 2BOKA 3LT3A 3UOPA 2STAE 1GHVH 3SOSA 4ESTE 1OPHB 3MNCA 1ZTKA 2GT8A 2QGRA 1K1MA 1H9LB 1AB9C 4NZQA 2TBSA 1TNGA 3T62A 4I8KA 2AYWA 4JYUH 2I6SA 2ZTZA 2BLQA 5L2YH 4BTTB 3FP8E 1WUNH 1BBRE 1GL0E 2FEQH 2UUFB 1H1BA 6GCHG 1TGSZ 2CHAC 2G55A 2ZU3A 3LU9B 1S5SA 2AIQA 5T3HA 1HIAA 3GCHC 3GYMA 3E91A 2W26A 4BAKB 3LJOA 3URCA 1ZSJA 1WCZA 3MFJA 2J34A 4ZHLU 2Q6FA 2GCTC 2IOTA 3F9GA 3U1JB 2BDYA 3UNRA 2BDAA 2J4IA 3PM3A 4BAQB 4FUDA 2GVFA 3BG4C 1GJ7B 1O3BA 1FDPA 4IBLH 3VFEA 2F83A 1GJDB 2D8WA 4JK5A 5FPSA 4RKJB 1T8LA 1GHAG 1ZOMA 2D1JA 3P70B 2WPHS 1TALA 1KTSB 3LGUA 3MU8A 4NSVA 2BM2A 3Q3YA 4CBNA 1OWIA 2HALA 3A7XA 2VB0A 2BDCA 1ID5H 3U98H 2B8OH 3HGNA 3TK5A 4D7FA 2FX4A 4ISLA 3TNTA 1AFQB 1Z1JA 2ZPSA 1O3KA 4YT7H 1G37A 1O2SA 1WBGB 1XKAC 1THPB 4B2AA 1LKBA 1AVGH 1DUAA 3KIDU 1N8OC 1W0ZU 1BB0B 1CA0C 1BTWA 1HJAC 1L4DA 1K21H 1CE5A 2J9NA 5ESTE 1P03A 6LPRA 1PPZA 1YCPM 5FX6A 2GV7A 5I46H 2JETB 3B9FH 3SV8A 1ELCA 4H42U 1WOFA 2ZCHP 1G2LA 1XUJA 1SGIB 3K6ZA 3S7HB 1O5AB 1P9UA 1WYKA 2RDLA 5E0HA 1B0FA 1GVKB 5CHAB 1GWAA 4NA8A 1Z8JB 3FANA 3V12A 1NM6A 3F9HA 3R3GB 2Q6DA 1QB1A 1NO9H 1VGCC 1LHGH 3BEUA 3TITA 2AMPA 1GJ8B 1KTTB 4IN1A 2FOEA 3BTKE 1O3OA 3S9BA 2Z9JA 1V2RT 1O33A 3ZZ4A 3EA9A 3M37A 1BHXF 1P0SH 1HXFH 4FVBA 3MH4A 1UVOA 4Y6DA 5BRRE 4BTUB 2AFQB 1GBTA 5LH8A 2CXVA 3FZDA 1C2JA 1GBCA 1A2CH 5EW2H 3SUGA 1NFYA 2GT7A 4ISIH 3QO6A 1C2EA 3VB5A 1EZQA 3RXUA 3F6UH 2Z3DA 3RU4T 1O2WA 1K1PA 1O39A 1SR5C 1G2MA 1P06A 3ZVDA 1D3QB 1V2WT 2PGBB 4H6TA 2ZFSA 1Y3VA 2AERH 1FXYA 5FBEA 4CH2B 2A5KA 1KLIH 1RS0A 5AFZH 2ZFPH 1EUFA 2NU3E 1ZYOA 1O2UA 1C2GA 2ZQ1A 3DFJA 3I29A 2ZDLA 2M5TA 2ZNKH 1K1LA 2EEKA 5F8XA 1O36A 1QJ7B 1HJ9A 1OWDA 4CR9A 1GMDF 1C5PA 1TONA 2PKSC 1O0DH 1O2QA 1O2JA 1O5GH 2BYAX 4OS5A 1FV9A 3NPSA 3TGKE 2PLXA 2QV1A 2PR3A 1KXDA 1P2JA 3PO1C 7GCHG 3CS0A 1BRUP 2OC1A 2TIOA 2O8UA 3LPRA 4WXIA 1K22H 1C1VH 1LHCH 3KNXA 3RXRA 3TVJB 3C27B 3ZZ9A 3SU0A 2GDDA 3RXBA 2VIWA 2ZPRA 1VITH 1QNJA 5EQQA 1O3CA 3K6YA 4GCHF 3TJUA 4UONA 4GHQA 1KIGH 2EI8A 3EDXB 2VWLA 3E3TA 1UTNA 4AYVB 2XWBI 1A3EH 2ZGCA 4X2XA 4K60A 5FCKA 1F0TA 1TIOA 2IPHA 4A1XA 1TNJA 9ESTA 4XFQA 1SLVB 3QGNB 1ZPBA 4NA9H 3TPIZ 2ZFRH 1P2OA 3QZRA 4Q2KA 3RXSA 1ABIH 2PTNA 1P2IA 1GGDC 4JZEH 1ZGVA 1O3LA 1W11U 1DITH 3S9AA 3ZYEA 4ZHAA 1C1QA 2A1DB 2WUCA 1OX1A 2GX4A 3W95A 5A8XA 4GVUA 2PWXA 1O2OA 4E06H 3SV7A 1FN8A 3I78A 3HK3B 2PUQH 5EW1H 2THFB 2BMGB 3NK8A 1HDTH 2ZECA 3M5NA 2Y5FA 5DP9A 4NGAH 4WJG2 5J4SA 1B5GH 2AIPA 3PLKA 2QIQA 3GY5A 1O2KA 2OINA 4IW4E 1BTHH 3EGKH 5GCHF 3M5LA 1TBZH 1TMTH 1NU9A 2GTBA 2HGTH 1ZGIA 3A7YA 9LPRA 2AS9A 4DVAU 4BAMB 1THRH 1VCPA 5GWZA 2Y5GA 3E8LA 1GBAA 3L3TA 1UK3A 1FNIA 3KL6A 2WYJA 3BEFB 4DG4A 2HWLB 1OP0A 3MO3A 1HAVA 2R3UA 1K9OE 1HAXB 1YP9A 3EQ0H 3RXFA 1JIRA 2VJ1A 1DLEA 3GY6A 2WPKS 1NRRH 4U2WA 1CO7E 2RA3A 2QF0A 2QXHA 3E6PH 3V0XA 2V6NA 1QL7A 5DP7A 1LPKB 5T6GA 2SGPE 4TWYA 1GMDG 3URDA 2H2ZA 1DFPA 3LONA 3RXQA 2CHAB 4I8JA 4U30A 1TPOA 1N6YA 4NWLA 1G9IE 4KELA 3GOVB 3SBKA 3SU2A 1GBFA 3A84A 3S69A 1AUJA 1ZSLA 1C9TA 5EPYA 4I32A 4WMDA 2XTTB 1RTFB 2A32A 1LHFH 1AY6H 2WPIS 1K1NA 1GHXH 3SU1A 1QY6A 1DICA 2J2UA 3RXAA 4D9RA 4Y0YE 4ABIA 2J38A 1QL9A 1GI8B 1GHBF 5AVDA 1SGEE 1SOZA 1MKXK 1GBMA 2ZEBA 5SGAE 3RU4D 1TBRH 1E38B 2GZ9A 4CR5A 4Y11E 5DK1A 1MMJN 2Z3EA 3ZYDA 2K1QA 5EODA 3BG4B 4GCHG 4I8HA 4K2YA 2G81E 1QL8A 1P01A 2ZGHA 1C2LA 1KXEA 4D8NA 1GHYH 4TPYA 3NCLA 1YPHC 4AX9H 1YCPK 1HAPH 1AGJA 1O3GA 2I6QA 2BZAA 1MU6B 1GBEA 3A8CA 1W7GH 2W7SA 5J4QA 1AWFH 1XXFA 1H9HE 2NU2E 2BVSH 1C1OA 1QHRB 1ZJDA 2VWNA 3GCTG 1QFKH 3GISB 2C3SA 1AFEH 1OWHA 2BY7X 1A46H 1WAYB 3RXEA 1ELFA 4MPVA 3P95A 1IOEA 3VEQB 1GBKA 1Z71A 2V0BA 2AMQA 2CN0H 3FZZA 1IQNA 2TGDA 1IQEA 4ISHH 1N8OB 1W13U 3SUEA 1CA0B 1T8OA 1EZSC 3PMBB 1THSH 1FJSA 1HJAB 5HYOA 3GY3A 5JB9S 1BCUH 3EE0B 1G3EA 4ABBA 1E36B 1C1MA 3ZZCA 1U6QA 1S83A 1FONA 4B1TA 2OC0A 3ZVCA 1NRPH 4RN6A 5DP8A 1QA0A 2G52A 5TCAA 3RXLA 1HCGA 2SGEE 1A5HA 2P8OC 1AWHB 1J15A 5C1YA 3B8JA 3NKKA 1MAXA 4TYDA 1DWBH 1E0FD 2VWOA 1N6XA 1G3BA 1LCYA 5FPYA 2AEIH 2ALPA 5JBBS 1AKSB 3UR9A 2B9LA 3RXJA 3RC6A 1O2YA 1MBQA 1ZTLA 2FMJA 3ZV8A 1HFDA 2BDBA 3P8OA 3T25A 4IMQA 2EI7A 4A6LA 1LHEH 1Z6EA 1P57B 1S85A 1UVSH 2PSYA 1ARCA 1TGBA 4IMZA 3L6PA 1T4VH 2YNBA 3ZV9A 1LQEA 1C1TA 4ABJA 4NCYA 1Q2WA 2Z9GA 1O5DH 1CQQA 4WH6A 1GBBA 3HKJB 1QURH 2GMTC 4O03A 1V2KT 4GPGA 3M5OA 1O2LA 3K2UA 1JXPA 1P11E 4KP0A 5TCCA 1GI1A 1OP8A 4MDSA 2UUYA 3A8DA 3T2NA 1GI0A 3ELAH 3BTME 1TMUH 2DE8A 1RIWC 4WH8A 2A4OA 1LKAA 2TGPZ 1IQJA 3CENA 2BVXH 1V2LT 2OC7A 1SQAA 1ZR0A 1O30A 3SW2B 2PKAA 3TJNA 1DWEH 1W7XH 4YT6H 3KF2A 1O2XA 3T27A 3M35A 4JZ1A 4OS6A 1FAXA 3F68H 1SGYE 3A7VA 1GHBG 3KHVA 2PKSB 1F0SA 1DT2A 1ZHPA 2ZDMA 4DURA 4E7RG 4OS2A 2FOHA 1GJAB 3T26A 2ZDAH 3LC3A 3PTNA 1HAGE 4ABHA 4DGJA 5IDKA 4D7GA 3PO1B 1O3JA 1O2PA 3O8CA 1HGTH 3RXVA 1H9IE 1QRWA 1ZMNA 2A4RA 3GY2A 4CRGA 3A8AA 1EPTB 2G8TA 1TX6A 1JMOH 2XW9A 3HK6B 3SI3H 4FVDA 1XM1A 1ORFA 3TH4H 3OU0A 4KTSA 3RC4A 1UO6A 4GHTA 1NTPA 1NESE 4AFSA 3PROA 3UQVA 3U9AH 2XBWA 4NG9H 1L2EA 1ABJH 5K0HA 2BD7A 2CF9H 2FZZA 5E0GA 1YLCA 1LVOA 2C8YB 3BTEE 3QN7A 3A86A 4OGYA 4NIXA 1DXPA 3RUOA 1DSUA 1F5RA 1NT1A 4NFFA 5E0JA 1A0LA 2VVUA 1GDUA 4QT8C 1ETSH 1ESAA 1IAUA 1O2GH 2TGTA 5JBTA 2PUXB 3A80A 2ESTE 1P2NA 2OLGA 4Q80A 3VXEH 2ZU5A 3LJJA 1C9PA 3T28A 2C8ZB 2V3HH 2BDHA 4GUXA 2UWOA 1O3HA 4ZAEA 2ZZUH 5EXLA 3ATMA 4ISOA 1KDQB 2NU0E 2FS8A 3PMHB 3LGWA 5FAHA 2UUJB 4Y8ZA 2VH0A 3EA7A 3ZVGA 1O2HA 4RKOB 4A7IB 2BVRH 1C5WB 3NUMA 8GCHG 2KAIA 3VXFH 2XC0A 2A31A 1ZJKA 1BTUA 1C5NH 1SGFA 4Y8XA 3SQEE 1WTHD 4Z6AH 1TNIA 6ESTA 4E05H 2ODPA 1D6RA 5DGJA 4FUGA 1VJ9U 2J95A 2G4UA 1C5OH 2WV5A 1HIAB 1SVPA 1QA7A 2BLVA 2C93B 4HFPB 4JCNA 2GZ8A 1OSSA 4ZH8A 1EAWA 3CS7A 1TRNA 3RP2A 1LQDB 1C1WH 3SJ8A 1A0JA 1W0YH 4Q7YA 4A5TS 3PYHA 4AG2A 2VIDA 3ATLA 1O2NA 4IGDA 2FP7B 2OD3B 1TBQH 5LGOA 3PTBA 1MD7A 2Z94A 1CBWC 1O2MA 3Q77A 3QZQA 4NIWA 3RXHA 5CE1A 5EXNA 1PQ5A 1SPJA 1BTYA 1V2NT 2WINI 1CT2E 1YPJH 3BIUH 3P17H 2HNTF 3KQCA 3D65E 4MPUA 3VGCC 1JBUH 1GBIA 3Q3KA 1MQ6A 1K1IA 3KQDA 1PYTC 2G5NA 2C4FH 1FIWA 2F9UA 1KSNA 5EU8A 1ELDE 2VGCC 1PPFE 3SN8A 1Y5UT 1J16A 1EKBB 1UK4A 5CMXH 2BHGA 1D4PB 2HPQH 2ULLA 4I31A 4LZ1H 4WMEA 2XYAA 2GCHF 3U1IB 4B73A 4IC5A 1NRNH 1HPGA 3B23B 3TNSA 5DKMA 1UTQA 3SNEA 4DCDA 3MO6A 1EP5A 1CT0E 3VB3A 3O8RA 2BY6X 3SHAH 2QF3A 1DPOA 1VJAU 1SG8B 1QR3E 2GDEH 1NU7B 5ABWA 3BSQA 1XUFA 2H9HA 4NIYA 1KYNA 3E0PB 3ZZ3A 2FS9A 2CV3A 1C1PA 4D76A 1UHBA 1D3TB 2BY5X 4HGCA 1O5BB 3ZVFA 3SUDA 2ZHDA 3M7TA 3DD2H 1BTXA 2YOLA 2PTCE 3RXPA 3ZVEA 1TLDA 5FCRA 1HAOH 5FBIA 1GHWH 2VNTA 3UREA 2A5AA 3K65B 1HXEH 1SGFG 4TWWA 3OYPA 3P8NA 3ZZDA 1OWJA 5AFYH 1CGIE 1GDNA 1EB1H 2A7HA 2XNIA 3A82A 3QX5H 5GXPA 4BXWA 2BDGA 3KQBA 4Y79A 1TOCB 2O9QA 2ALVA 5A0AE 1FUJA 1FLEE 2SGAA 1PQ8A 2VWMA 1V2UT 2ZF0H 3A83A 1EOJA 2EC9H 2TRMA 1YYY1 4B2CA 1TAWA 3UOUA 2FTLE 1YPGH 3UTUH 2FI3E 1QBOA 1J17T 2W3IA 3A89A 3P6ZB 1RGQA 1GCDA 1V6DA 4UE7H 2ODQA 4CRCA 1SGNE 3VB4A 5DJ7A 1C1SA 1PFXC 3ZZ6A 5H4IB 1P2MA 5E8EH 3U69H 7ESTE 2C8WB 3LGIA 1JOUB 1KXCA 3BTQE 2ANMH 1O3DA 4LOYH 3BF6H 1O2ZA 4ZUHA 2ZI2H 1AN1E 3M7QA 2AGEX 1EB2A 4Q7ZA 4XE4A 1DOJA 1DE7H 4XSKU 2CGAA 3TH3H 2XBVA 3AW0A 1ZHRA 3UWIA 4X6MA 1ZZZA 3K9XB 4FUJA 1UVPA 1SLXB 1GCTC 1G30B 2ODYB 1O38A 3E0NB 1EQ9A 2AMDA 3MOCA 3SU6A 2FXRA 1RFNA 2FOCA 1KXBA 1BIOA 1SGQE 1OKXA 3UPEA 1T4UH 2ILNA 2P94A 1H8IH 3A88A 1TRYA 5ESBA 3SU4A 3AW1A 2J94A 4CHAB 1ZHMA 5G4BA 4TY7A 1AI8H 2A4QA 2BLOA 2XWAA 4UFFH 2HLCA 2O8MA 2G4TA 3MTYA 1FY8E 4BAHB 1GBJA 1ACBE 3QGJA 3BV9B 2BD3A 1GHZA 3M7UA 3PWCA 1IHSH 4PROA 4M7GA 3CP7A 1SB1H 4O97A 1C5VA 1C2KA 2ZWLH 4Y71A 4YM9A 3SU3A 2P95A 2ZIQH 5FX5A 1QB9A 1GPZA 1A5GH 1VITF 3HPTB 5JDUB 1TNHA 1FMGA 1SGPE 4FUEA 3H5CB 3GDUA 1GJ9B 1GDQA 2W3KA 1MTNB 3RU4E 1V2PT 2CJIA 1DM4B 2OQ5A 4F4OC 1MZDA 4X2WA 1QQUA 1CU1A 3M3TA 3STIA 2B7DH 1XVOA 1AO5A 2QN5T 5I25A 1BUIA 8KME2 3IG6B 1AVWA 5JPMH 1YPKH 4JYVH 2O8LA 4X1QU 3SQHE 1TOMH 2ZU2A 2NU1E 1NFUA 1HAVB 3PB1E 2ZC9H 2FO9A 1AB9B 1LO6A 4MQAA 4JYTA 2WUBA 1ANBA 1BA8B 1BJVA 3GICB 1TGCA 1MKXH 1P05A 1C1NA 1EAIA 4INKA 2Y80A 3OY5U 1TMBH 1YPMH 1TYNA 1AVXA 2PV9B 4LZ4B 3ZZ7A 1AFQC 2ZU4A 1W2KH 4A1VA 1DX5M 4LK4A 1O2RA 1FPHH 3ATWA 3GCHB 1SGCA 4FU8A 1P3CA 2R2MB 1F0RA 1QTFA 1EZXC 3UWJH 3GCNA 3LH3A 4ABAA 4AZ2B 1TRMA 2A0QB 4MTBA 2GCTB 4JZDH 4BTIB 4IN2A 2BLWA 2GV6A 1EP6A 1QBNA 4X6PA 1XX9A 3IWMA 1EJMA 4FUBA 1NRQH 3ENSB 1YKTA 1BZXE 1S6FA 2JETC 3WY8A 1GI3A 1ETTH 1A1RA 2HNTC 2LPRA 1O2IA 2HVXA 3SJKA 2P59A 4WY3A 1EOLA 4K5ZA 2BY8X 2BX4A 1GVZA 1S82A 1QB6A 1QJ6B 1SGDE 4ZKRU 2Y6TA 1HAHH 4SGBE 4X1RU 2ZFFH 1PJPA 1W8BH 1SI5H 4YOIA 1BBRK 2FX6A 4AFQA 3UQOA 3SJOA 1DWDH 2RCEA 1TWXB 2ZO3H 4JZFH 3F9FA 2WPLS 2STBE 1VCQA 5L30H 1S81A 3PV4A 4I7YH 1MU8B 3UUZA 4ISNA 1GJ5H 1JIMA 1WQSA 1O32A 4FUCA 1ETRH 4VGCC 3SV2H 1XUKA 2ZP0H 4XBDA 4NSYA 1C2FA 1CHOF 3BTFE 1ARBA 5A2MH 1C5RA 3QTVH 3BTWE 4GAWA 2SGDE 3JZ2B 1ANDA 4MG3A 6CHAC 1DXWA 1L1NA 2XBYA 1V2QT 5GCHG 3SO3A 1C5UA 3KN2A 1TFXA 3A87A 1PPCE 1HLTH 2OUAA 1TA6A 4B75A 1AE5A 3RXDA 1O35A 2CF8H 3RXMA 3GY7A 1P09A 4OS1A 2A2QH 1NFWA 2H6MA 3FAOA 1A4WH 1C4V2 1ANCA 4ABDA 1AU8A 4KGAA 2R9PA 3RM2H 1MKWK 3KQEA 2A7CA 2QXJA 1AKSA 1Q31A 3DA9B 1KLTA 2RA0A 2BD9A 1GJ6A 4GLYA 5GIBA 1TX7A 3T5FH 1VZQH 1VGCB 2P3UB 1QIXB 2WV4A 1Y3XA 3EA8A 2RG3A 4X8UH 3KGPA 4X1PU 1GL1A 2XRCA 4TPIZ 1EASA 3TGIE 4MNYA 3ITIA 3UNSA 2D2DA 4BAOB 5C3NA 2F3CE 2FWWA 1W10U 2NWNA 2DUCA 1UK2A 4BOHA 1VCWA 3U8TH 3SV6A 4ZXXH 1DLKB 1SBWA 4CRFA 1FIZA 1G32B 2ZDNA 2XC5A 1MCVA 1ZTJA 3SJ9A 1Z7KA 3P8GA 5A8YA 1ELBA 3RXGA 4DIIH 1MTUA 3M36A 4K8YA 2VIPA 4MPWA 1O3MA 1GBDA 1Y59T 2DE9A 2UWLA
chains in the Genus database with same CATH superfamily
4X2YA 1S0RA 1OYTH 3M3VA 4ZKSU 1FQ3A 1P12E 1RXPA 2YMSD 1HV7A 1BT7A 2PKAB 2FOAA 1SOTA 1YBWA 2PGQB 5F53A 4NFEA 1DS2E 1ESTA 1H8DH 3LGTA 5JB8S 2GZ7A 2ZFTA 2ASUB 1UVTH 3SORA 3DFLA 1AQ7A 1SHYA 1A7SA 1P9SA 2YMSC 1J14A 1IQGA 3S0NA 3Q3XA 3UFAA 1EATA 1LHDH 2H9EH 1AZZA 1SMFE 1B0EA 4R0IA 3UIRA 1BRBE 4X0WU 1S0QA 1EPTA 1DVAH 3ZZBA 1O5EH 3MU1A 2FYRA 2BD4A 1A61H 2F9OA 2YNAA 4Q7XA 2IN2A 2BB4A 1K28D 4AG1A 4X6OA 4X1NU 7LPRA 1UCYK 1RRKA 1VR1H 1C5ZB 3M3SA 5LPFA 3AASA 3BEIB 2OTVA 1Z8IB 4UFEH 2PFEA 1GMHF 1O3FA 4HZHA 4U01A 3O8BA 3FO8D 5C94A 4FUHA 2VIQA 2ZHFH 1GI6A 3N99A 4K8BA 5DP5A 2WYGA 1MZAA 1GGDB 1OYQA 2H9TH 4X8VH 1CHOG 2BOHB 4YOJA 2HPPH 4DOQA 2V7QD 2OC8A 3LOXA 4DT7B 1OWEA 1LVMA 1O3AA 1L1GA 3OTJE 2Z7FE 2FOFA 4XBBA 3A85A 1QRXA 2QE7D 1UVUH 2W7UA 4K1SA 4KTUA 1IHTH 3BTDE 3SNAA 1ELEE 1V2ST 2W6ID 2FLRH 1F2SE 2TGAA 1O34A 2JJ1D 1RTLA 3V7TA 3ZVBA 1N1LA 1KDQA 1PQAA 2VIVA 3SV9A 2ANYA 3MHWU 3GYLB 5LPEA 3MU4A 1NY22 1XKBC 4J2YB 1J9CH 2FOMB 1FI8A 1Z8GA 2UUKB 3N7OA 3QTOH 4F55A 4THNH 3MMGA 1KLJH 1W12U 5IYTA 3MU0A 4YO9A 1BMNH 1MD8A 1NZQH 1Z8RA 1GVLA 3C1KA 2KAIB 5T6DA 3RMMH 3V13A 1C4Y2 5HGGA 3FVFB 2A45B 2OCVB 1HAZB 5HM2A 1V2OT 3RXIA 3MNBA 1LDTT 1BJUA 2B5TB 4Z0KA 4YOGA 1NRSH 2WHXA 1OHHD 1TQ7B 2G00A 2ZFQH 5C5OA 2ZA5A 3RC5A 3GDSA 1WU1A 1V2VT 1Z6JH 3GDVA 2BXTH 3BIVH 2HLDD 1O3IA 2Z3CA 1T31A 2UWPA 3E90B 1PYTD 5PTPA 7GCHF 3F1SB 1QQ4A 2QAAA 1C2HA 1EJAA 1HB0B 2FI4E 2Y5HA 2BQ6B 5JYIA 4H4FA 3D49H 3BG8A 1E37B 3DT0H 3FN8A 1PPGE 4X2VA 4A92A 4J1YA 3MNXA 4CRAA 4CH8B 1M9UA 3L33A 1F7ZA 1LVBA 1MCTA 1AHTH 5EOKA 1HUTH 3TU7H 1NROH 1IQMA 2ZQ2A 4MPXA 4UFDH 1SSXA 1O31A 2A2XH 3MH7A 4XDEA 5T6FA 1O5FH 1LPZB 3HKIB 4WF8A 2EA3A 2V35A 2QY0B 1LTOA 1P8VC 1PPBH 2ZG0H 1K1JA 2R0KA 5EXMA 2HVYB 1S6HA 5DPAA 3MQKC 5DP3A 2ZGBH 3D23A 4ZKNU 4O9VA 2P93A 4YLQH 1BQYA 1YGCH 1TNLA 1CVWH 3QUMP 4FU9A 2FM2A 2JH0D 4CREA 5FXLA 4OS7A 1O37A 1BTZA 1G3DA 1YM0A 4UEHH 1GJ4H 4K1EA 3ZZ5A 1NBMD 3RXOA 3H09A 2RFKC 4Y7AA 1SLWB 3V3MA 1UJ1A 5JBAS 2JH5D 7KMEH 1EJNA 1W14U 1LPGB 5DP4A 4B74A 3DUXH 2AH4X 3M5MA 2FOGA 2VH6A 3KCGH 1GMHG 1K2I1 2ZGXH 1AIXH 1NC6A 4K3JA 4AYYB 2P3TB 1BDAA 5EPNA 1ELGA 1K1OA 4IS5A 1UTLM 1QGFA 4BNRA 5A09A 4O3TA 1XXDA 1C2IA 3AVZA 1UHBB 1Z1IA 4I8GA 3MO9A 1E1RD 3FFGA 4FU7A 1ZLRA 1KY9A 1AE8H 2SFAA 3A7ZA 2BZ6H 3VPKA 1BMLA 1C5XB 3TJVA 2Y82A 4K1TA 2FLBH 4E7NA 4GSOA 3LDXH 4ABFA 2QXGA 1O3EA 1F5KU 4VGCB 3W94A 1YC0A 4FUIA 1G3CA 4AGJA 4X8SH 3BTGE 3ESTA 3LGVA 4FOUC 1QRZA 3WW7A 3JZ1B 1BHXB 1HNEE 2ZTXA 6CHAB 5C67A 2P8OB 3HGPA 1CT4E 1E34B 1BRCE 1MH0A 2FI5E 2JKHA 2F9PA 3EYDA 1UCYE 1FZZA 4WXVA 1GG6C 1DDJA 1F92A 4NA7A 1DY9A 1SLUB 4WMFA 1AD8H 5EIYA 1V2TT 2Y81A 5A0BA 1JRSA 5L2ZH 3A7TA 1NPMA 2Y7ZA 3AAUA 1MTVA 3SNCA 4Y7BA 4DIHH 3UNQA 4YZUA 4HI3A 2V3OH 2P16A 5C20A 1SGRE 2G5VA 3FP7E 3LH1A 3P8FA 2ZHWH 4AFUA 1TPAE 1V2JT 4MVNA 3RLWH 1FAKH 1AZ8A 1WV7H 1UTKA 4KTCA 3H7TA 4NIVA 4Y8YA 1GMCF 3VB7A 1SQOA 1H4WA 2FOBA 1EPTC 1LVYA 3BTHE 2GMTB 3GCOA 1P04A 1C1RA 1C5MD 1SQTA 3QLPH 2SGFE 2W5EA 1MBMA 4BXSA 4HG6A 1L4ZA 3RLYH 2EQNA 3MNSA 1UTPA 1ZPCA 4UD9H 1RIWB 2BQ7B 1F0UA 2EI6A 3TK9A 2C90B 4MLFB 2GCHG 1T7CA 2H1UA 1ZSKA 2Z9IA 3F2GA 1C5LH 2XBXA 3ATKA 1XUGA 5C1UA 4XOJA 3MH6A 3M61U 3EAJA 4INLA 4Q63A 3P92A 3F9EA 4K69A 3I77A 1ELTA 3OSYA 4WWYA 1OS8A 3ODDA 3SZEA 3GCTF 1T32A 4NZLA 5DO4H 4X6NA 3R0FA 3SGBE 1WDIA 2J98A 3PMJA 3T29A 2BQWB 2OBQA 3LKWA 3SZNA 4NWKA 2XXLA 1ZRBA 1CA8B 4KKDA 1C5TA 2HNTE 2YMSB 1V2MT 1TGNA 1A5IA 3G01A 1MABB 2V3MA 5E2OA 1GI5A 4FXGH 3DHKH 4LXBH 1IQIA 1YPHE 3PMAB 1TABE 4MNXA 2A7JA 1SC8U 2G51A 2AGIX 1TGTA 1ZMJA 1NN6A 2SNVA 2GP9B 2IJOB 3SHCH 2OXSA 1UTJA 2VVCA 4JZIA 1IQFA 1HBTH 5C2ZA 2BDIA 4YXWD 1BTPA 1DUEA 1A3BH 1KMHB 3O8DA 1FY5A 1OP2A 5F8TA 1KXAA 2KCOA 1MTWA 3GY4A 5EJLA 2F91A 1FY4A 8ESTE 2VU8E 2Z6BD 5EQSA 2VIOA 1L0ZA 1KXFA 3PLPA 1ZRKA 2QYIA 5GDSH 2ZPQA 2VVVA 1EZUC 5L6NH 2BX3A 1NS3A 1CGHA 3ATIA 3BTTE 3MH5A 2BXUH 5EG4A 1QBVH 1RJXB 2JH6D 4F49A 5F03A 5B6LA 2O8WA 1FPCH 3DSGA 3H7OA 1C2MA 1AMHA 2FTMA 2LNCA 1O2VA 3QWCH 3A8BA 4TT3D 2ZCKP 5C5NA 4HTCH 1TX8A 5FPTA 2XCFA 1UTOA 4ZKOU 4INHA 1K0HA 3RMNH 1WQVH 2BD5A 4B2BA 1DSTA 1SFQB 5DP6A 1GI4A 1C1UH 3RXKA 1YLDA 1YCPH 2Z9LA 2KR7A 4I8LA 4ABGA 4ZROA 2HOBA 2A4GA 1A0HB 4YLUA 2R0LA 2QA9E 1XUHA 5HM9A 2J92A 3RMOH 1C5QA 4ZMAH 4ZHMU 1O3PB 1L1JA 1D6WA 3LIWA 3OX7U 1BBRH 5GNDA 4BANB 2GGVB 5E2PA 3UR6A 1QJ1B 1VKYA 5AF9H 1GBLA 1BITA 1XMNB 4RSPA 4MNVA 4OS4A 1AUTC 2Z9KA 1YF4A 1GMCG 3PWBA 5EGMA 1UTMA 2QXIA 2M2AA 2WPMS 4Y0ZE 1RD3B 1TPPA 2ZDVH 3ODFA 1HJ8A 5ETXA 4CBOA 1D3DB 4R8TB 5K7RA 5CHAC 3OY6U 4Y10E 4DJZB 2NU4E 3PLBA 1CBWB 1ELAA 2ZHQH 4FUFA 3SI4H 5FHTA 2KM0A 1PQ7A 2CMYA 2D26C 2OP9A 3AK5A 4CRBA 3AAVA 2ZCLP 3ZVAA 2C8XB 3A7WA 1B7XB 1P3EA 2BD8A 3SNBA 4ABEA 5C0TA 1ESBA 1HAIH 3VGCB 1IQLA 1HRTH 1P10A 2WPJS 3S7KB 3TIUA 3MWIU 1BOQA 4ASHA 4AOQA 1WTGH 1D9IA 2QCYA 2VGCB 3A81A 5F6MA 3IITA 4DY7B 4Y76A 4YTAA 5C1XA 1O2TA 5AHGH 1EX3A 1D3PB 4AB9A 1MKWH 1VITG 3BN9A 2BY9X 2BD2A 1Y5AT 4AGKA 8LPRA 1X7AC 3OEHD 1P2KA 4SGAE 4XBCA 2ZKSA 4ZXYH 1GJBB 1NFXA 1Y5BT 1JWTA 1TQ0B 2BTCE 3U8RH 1FY1A 2AHME 3ZZ8A 4AB8A 1MUEB 3NZIA 2FDAA 1EAUA 1S84A 3UY9A 2ZHEH 3ZIAD 1UW7A 5DG6A 4WVPE 2TPIZ 1XVMA 1W3CA 1BMMH 1UMAH 2PSXA 2PW8H 1MTSA 3GY8A 2FODA 4H6SB 3KEEA 5HXFA 2QC2A 6GCHF 3U8OH 3LGYA 1S6LA 2B0FA 2WPDD 2J5UA 2FIRH 2XC4A 4DW2U 1SL3A 8GCHF 1Y3UA 1TNKA 2O8TA 3TK6A 1F5LA 4OGXA 3D62A 5A0CA 2A5IA 3RXTA 2ZTYA 1COWD 1EFRD 3E16B 5DN6D 1ZPZA 4TY6A 1Q3XA 2GKVE 1OOKB 5EJ1A 4D9QA 1IQHA 3PV5A 3SNDA 1XUIA 4CRDA 3RXCA 1WSSH 3STJA 2FPZA 3MU5A 4B76A 2LELA 2SGQE 1W0JD 1DWCH 4UFGH 2FESH 5KECA 1DANH 2HRVA 1GI7B 3WWFA 3SUFA 1CHGA 1SHHB 1GBHA 2OQUA 3MI4A 5GJ4B 3VB6A 2R3YA 4JMYA 1C2DA 1ANEA 1OXGA 1GHAF 2AGGX 1TPSA 1Y3YA 2XCNA 1LMWB 3SJIA 3RMLH 1EAXA 2XNDD 2H5CA 4O3UA 4YESB 2ANKH 1HAYB 1GI2A 3Q76A 1EXFA 1SGTA 1DY8A 1SFIA 1TA2A 2ANWA 3HATH 4OM9A 3SU5A 3ZZAA 2R2WU 3TGJE 1G36A 2GD4B 1OWKA 1Y8TA 4CHAC 1T8MA 1INCA 1ELVA 2Q6GA 1GG6B 1E35B 2F43B 1C5YB 4UDWH 1Y3WA 1P2QA 4AFZA 3SGQE 3TH2H 5HMAA 1IQKA 1UCYH 1BRAA 2KCAA 2F9BH 3E1XB 1T8NA 3F2FA 4AN7A 5BPEA 4MNWA 5A8ZA 4I33A 1CGJE 2P3FH 4X8TH 4FETA 1GI9B 2ZGJA 2SNWA 5EQRA 2H5DA 1YPLH 2FYQA 1C4U2 4B71A 1GCTB 1TE0A 1V3XA 3TJOA 1YPEH 1ZMLA 3FP6E 3MYWA 2OBOA 3LC5A 3SGAE 4IC6A 4JK6A 1GJCB 2PHBA 4X1SU 3RDZA 3S9CA 1MTNC 5B6OA 4A1TA 3QK1A 5TJXA 1MAYA 1CSOE 1P02A 5LPRA 4U32A 1TB6H 1FN6A 1HYLA 3NWUA 5HKKD 3Q00A 1JRTA 1O3NA 1PPEE 1BMAA 2ZU1A 2F9NA 5GPIB 2Y7XA 3QDZB 5JBCS 3N7DA 1PPHE 1QCPA 3RM0H 2ZDKA 3TLOA 1O5CB 2Q1JA 5F8ZA 3NXPA 1RTKA 1J8AA 2F9VA 2VINA 1FY3A 1C5SA 4AORA 1MQ5A 2BOKA 3LT3A 3UOPA 2STAE 1GHVH 3SOSA 4ESTE 1OPHB 3MNCA 1ZTKA 2GT8A 2QGRA 1K1MA 1H9LB 1AB9C 4NZQA 2TBSA 1TNGA 3T62A 4I8KA 2AYWA 4JYUH 2I6SA 2ZTZA 2BLQA 5L2YH 4BTTB 3FP8E 1WUNH 1BBRE 1GL0E 2L6OA 2FEQH 2UUFB 1H1BA 6GCHG 1TGSZ 4ZCNA 2CHAC 1H8ED 3FKSD 2G55A 2ZU3A 3LU9B 1S5SA 2AIQA 5T3HA 1HIAA 3GCHC 3GYMA 3E91A 2W26A 4BAKB 2CK3D 3LJOA 3URCA 1ZSJA 1WCZA 3WWBA 3MFJA 2J34A 4ZHLU 2Q6FA 1NBME 2GCTC 2IOTA 3F9GA 3U1JB 2BDYA 4B6EA 3UNRA 2BDAA 2J4IA 3FOAA 3PM3A 4BAQB 4FUDA 2GVFA 3BG4C 1GJ7B 1O3BA 1FDPA 4IBLH 3VFEA 2F83A 1GJDB 2D8WA 5CDFE 4JK5A 3KYFA 5FPSA 4RKJB 1T8LA 1GHAG 1ZOMA 2D1JA 3P70B 2WPHS 1TALA 5DSFA 1KTSB 3LGUA 3MU8A 4NSVA 2BM2A 3Q3YA 4CBNA 1OWIA 2HALA 3A7XA 2VB0A 2BDCA 1ID5H 3U98H 2B8OH 3HGNA 3TK5A 4D7FA 2FX4A 4ISLA 3TNTA 1AFQB 1Z1JA 2ZPSA 1O3KA 4YT7H 1G37A 1O2SA 1WBGB 1XKAC 1THPB 4B2AA 1LKBA 1AVGH 1DUAA 3KIDU 1N8OC 1W0ZU 1BB0B 1CA0C 1BTWA 1H8HD 1HJAC 1L4DA 3OE7D 1K21H 1CE5A 2J9NA 3DSPA 1P03A 5ESTE 6LPRA 3W1EA 1PPZA 1YCPM 5FX6A 2GV7A 5I46H 2JETB 3B9FH 1BMFD 3SV8A 1ELCA 4H42U 1WOFA 2ZCHP 1G2LA 1XUJA 1SGIB 3K6ZA 3S7HB 1O5AB 1P9UA 1WYKA 4P00A 2RDLA 5E0HA 1B0FA 1GVKB 5CHAB 1GWAA 4NA8A 1Z8JB 3FANA 3V12A 1NM6A 3F9HA 3R3GB 2Q6DA 1WXRA 1QB1A 1NO9H 1VGCC 1LHGH 3BEUA 3TITA 2AMPA 1GJ8B 1KTTB 4IN1A 2FOEA 3BTKE 1O3OA 3S9BA 2Z9JA 1V2RT 1O33A 3ZZ4A 3EA9A 3M37A 1BHXF 1P0SH 1HXFH 4FVBA 3MH4A 4AC9A 1UVOA 4Y6DA 5BRRE 4BTUB 2AFQB 1GBTA 5LH8A 2CXVA 2K8IA 3FZDA 1C2JA 1GBCA 1A2CH 5EW2H 3SUGA 1NFYA 2GT7A 4ISIH 3QO6A 1C2EA 3VB5A 1EZQA 3RXUA 3F6UH 2Z3DA 3RU4T 1O2WA 1K1PA 1O39A 1SR5C 1G2MA 1P06A 3ZVDA 1D3QB 1V2WT 2PGBB 4H6TA 2ZFSA 1Y3VA 2AERH 1FXYA 5FBEA 4CH2B 2A5KA 1KLIH 1RS0A 5AFZH 2ZFPH 1EUFA 2GJGA 2NU3E 5HIYA 1ZYOA 1O2UA 2WZQA 1C2GA 2ZQ1A 3DFJA 3I29A 2ZDLA 2M5TA 2ZNKH 1K1LA 2EEKA 5F8XA 1O36A 1QJ7B 1HJ9A 1OWDA 4CR9A 1GMDF 3OAAD 3UB0A 3PV2A 1C5PA 1TONA 3DSOA 2PKSC 1O0DH 1O2QA 1O2JA 1O5GH 2BYAX 3F0OA 2W6JD 4OS5A 1FV9A 3NPSA 3TGKE 2PLXA 2QV1A 2PR3A 1KXDA 1P2JA 3SYJA 3PO1C 7GCHG 3CS0A 1BRUP 2OC1A 2TIOA 2O8UA 4DT4A 3LPRA 4WXIA 4TSFD 1K22H 1C1VH 1LHCH 3KNXA 3RXRA 3TVJB 3C27B 3ZZ9A 3SU0A 2GDDA 3RXBA 2VIWA 2ZPRA 1VITH 2J97A 1QNJA 5EQQA 1O3CA 3K6YA 4GCHF 4RT0A 3TJUA 4UONA 1E79D 4GHQA 1KIGH 2EI8A 3EDXB 2VWLA 3E3TA 1UTNA 4AYVB 2XWBI 1A3EH 2ZGCA 4X2XA 4K60A 2PP6A 5FCKA 1F0TA 1TIOA 2IPHA 4A1XA 1TNJA 9ESTA 4XFQA 1SLVB 3QGNB 2L74A 1ZPBA 4NA9H 3TPIZ 2ZFRH 1P2OA 3QZRA 4Q2KA 2IJD1 3RXSA 1ABIH 2PTNA 1P2IA 1GGDC 4JZEH 1ZGVA 1O3LA 4ASUD 1W11U 1DITH 3S9AA 3ZYEA 4ZHAA 1C1QA 2A1DB 2WUCA 1OX1A 2GX4A 3W95A 5A8XA 4GVUA 2PWXA 1O2OA 4E06H 2KCYA 3SV7A 1FN8A 3I78A 3HK3B 2PUQH 5EW1H 1SKYE 2THFB 4Q4LA 2BMGB 3NK8A 1HDTH 2ZECA 3M5NA 2Y5FA 5DP9A 2QF4A 4NGAH 4WJG2 5J4SA 1B5GH 2AIPA 3PLKA 2QIQA 3GY5A 1O2KA 2OINA 4IW4E 1BTHH 3EGKH 5GCHF 3M5LA 1TBZH 1TMTH 1NU9A 2GTBA 2HGTH 1ZGIA 3A7YA 9LPRA 2AS9A 4DVAU 4BAMB 3VG8A 4ACAA 1THRH 1VCPA 5GWZA 2Y5GA 3E8LA 1GBAA 3L3TA 1UK3A 1FNIA 3KL6A 2WYJA 3BEFB 4DG4A 3OTPA 2HWLB 1OP0A 4P02A 3MO3A 1HAVA 2R3UA 1K9OE 1HAXB 1YP9A 3EQ0H 3RXFA 1JIRA 2VJ1A 1DLEA 3GY6A 2WPKS 1NRRH 4U2WA 1CO7E 2RA3A 2QF0A 2QXHA 3E6PH 3V0XA 3OFND 2V6NA 1QL7A 5DP7A 1LPKB 5T6GA 2XOKD 2SGPE 4TWYA 1GMDG 3URDA 2H2ZA 1DFPA 3LONA 3RXQA 2CHAB 4I8JA 4U30A 1TPOA 1N6YA 4NWLA 1G9IE 4KELA 3GOVB 3SBKA 3SU2A 1GBFA 3A84A 3S69A 1AUJA 1ZSLA 1C9TA 5EPYA 4I32A 4WMDA 2XTTB 1RTFB 2A32A 1LHFH 1AY6H 2WPIS 1K1NA 1GHXH 3SU1A 1QY6A 1DICA 2J2UA 3RXAA 4D9RA 4Y0YE 4ABIA 2J38A 1QL9A 1GI8B 1GHBF 5AVDA 1SGEE 1SOZA 1MKXK 1GBMA 2ZEBA 5SGAE 3RU4D 1TBRH 1E38B 2GZ9A 4CR5A 4Y11E 5DK1A 1MMJN 2Z3EA 3ZYDA 2K1QA 5EODA 3BG4B 4GCHG 4I8HA 4K2YA 2G81E 2JJ2D 1QL8A 1P01A 2ZGHA 1C2LA 1KXEA 4D8NA 1GHYH 4TPYA 3NCLA 1YPHC 4AX9H 1YCPK 1HAPH 1AGJA 1O3GA 2I6QA 2BZAA 1E1QD 3OEED 1MU6B 1GBEA 3A8CA 1W7GH 2W7SA 5J4QA 1AWFH 1XXFA 5C0UA 1H9HE 2NU2E 2BVSH 1C1OA 1QHRB 1ZJDA 2VWNA 5CHBA 3F2HA 3GCTG 1QFKH 3GISB 2C3SA 1AFEH 1OWHA 2BY7X 2JDID 1A46H 1WAYB 3RXEA 1ELFA 1YWUA 4MPVA 3P95A 1IOEA 3VEQB 1GBKA 1Z71A 2V0BA 2AMQA 2CN0H 3FZZA 1IQNA 2TGDA 1IQEA 4ISHH 1N8OB 1W13U 3SUEA 1CA0B 1T8OA 1EZSC 3PMBB 1THSH 1FJSA 1HJAB 5HYOA 3GY3A 5JB9S 1BCUH 3EE0B 1G3EA 4ABBA 1E36B 1C1MA 3ZZCA 1U6QA 4Z1MD 1S83A 1FONA 4B1TA 2OC0A 3ZVCA 1NRPH 4RN6A 5DP8A 1QA0A 2G52A 5TCAA 3RXLA 1HCGA 2SGEE 1A5HA 2P8OC 5FL7D 1AWHB 1J15A 5C1YA 3B8JA 3NKKA 1MAXA 4TYDA 1DWBH 1E0FD 2VWOA 1N6XA 1G3BA 1LCYA 5FPYA 2AEIH 2ALPA 5JBBS 1AKSB 3UR9A 2B9LA 3RXJA 3RC6A 1O2YA 1MBQA 1ZTLA 2FMJA 3ZV8A 1HFDA 2BDBA 3P8OA 3T25A 4IMQA 2EI7A 4A6LA 1LHEH 1Z6EA 1P57B 1S85A 1UVSH 2PSYA 1ARCA 1TGBA 4IMZA 3L6PA 1T4VH 2YNBA 3ZV9A 1LQEA 1C1TA 4ABJA 4NCYA 1Q2WA 2Z9GA 1O5DH 1CQQA 4WH6A 1GBBA 3HKJB 1QURH 2GMTC 4O03A 1V2KT 4GPGA 3M5OA 5T1VA 1O2LA 3K2UA 1JXPA 1P11E 4KP0A 5TCCA 1GI1A 1OP8A 4MDSA 2UUYA 3A8DA 3T2NA 1GI0A 3ELAH 3BTME 1TMUH 2DE8A 1RIWC 4WH8A 2A4OA 1LKAA 2TGPZ 1IQJA 3CENA 2BVXH 2IPQX 1V2LT 2OC7A 1SQAA 1ZR0A 1O30A 3SW2B 2PKAA 3TJNA 1DWEH 1W7XH 4YT6H 2VBCA 3KF2A 1O2XA 3T27A 3M35A 4JZ1A 4OS6A 1FAXA 3F68H 1SGYE 3A7VA 1GHBG 3KHVA 2PKSB 1F0SA 1DT2A 1ZHPA 2ZDMA 4DURA 4E7RG 4OS2A 2FOHA 1GJAB 3T26A 2ZDAH 3LC3A 3PTNA 1HAGE 4ABHA 4DGJA 5IDKA 4D7GA 3PO1B 1O3JA 1O2PA 3O8CA 1HGTH 3RXVA 1H9IE 1QRWA 1ZMNA 2A4RA 3GY2A 4CRGA 3A8AA 1EPTB 2G8TA 1TX6A 1JMOH 2XW9A 3PRBA 3HK6B 3SI3H 4FVDA 1XM1A 1ORFA 3TH4H 3OU0A 4KTSA 3RC4A 1UO6A 4GHTA 1NTPA 1NESE 4AFSA 3PROA 3UQVA 3U9AH 2XBWA 4NG9H 1L2EA 1ABJH 5K0HA 2BD7A 2CF9H 2FZZA 5E0GA 1YLCA 1LVOA 2C8YB 3BTEE 4F48B 2KZ4A 3QN7A 3A86A 4OGYA 4NIXA 1DXPA 3RUOA 1DSUA 1F5RA 1NT1A 4NFFA 5E0JA 2RDEA 1A0LA 2VVUA 1GDUA 4QT8C 1ETSH 1ESAA 1IAUA 1O2GH 2TGTA 5JBTA 2PUXB 3A80A 2ESTE 1P2NA 2OLGA 4Q80A 3VXEH 2ZU5A 3LJJA 1C9PA 3T28A 2C8ZB 2V3HH 2BDHA 3PRDA 4GUXA 1QZ8A 1O3HA 2UWOA 4ZAEA 2ZZUH 5EXLA 3ATMA 4ISOA 1KDQB 2NU0E 2FS8A 3PMHB 3LGWA 5KGOA 5FAHA 2UUJB 4Y8ZA 2VH0A 3EA7A 3ZVGA 1O2HA 4RKOB 4A7IB 2BVRH 1C5WB 3NUMA 4I86A 8GCHG 2KAIA 3VXFH 1SQRA 2WSSD 2A31A 2XC0A 1ZJKA 1BTUA 1C5NH 1SGFA 4Y8XA 3SQEE 1WTHD 4Z6AH 1TNIA 6ESTA 4E05H 2ODPA 1D6RA 5DGJA 4FUGA 1VJ9U 2J95A 2G4UA 1C5OH 2QF5A 2WV5A 1HIAB 1SVPA 1QA7A 2BLVA 2C93B 4HFPB 4JCNA 2GZ8A 1OSSA 4ZH8A 4ACBA 1EAWA 3CS7A 1TRNA 3RP2A 1LQDB 1C1WH 3SJ8A 1A0JA 1W0YH 4Q7YA 4A5TS 3PYHA 4AG2A 5C17A 2VIDA 3ATLA 1O2NA 4IGDA 2FP7B 2OD3B 1TBQH 5LGOA 3PTBA 1MD7A 2Z94A 1CBWC 1O2MA 3Q77A 3QZQA 4NIWA 3RXHA 5CE1A 5EXNA 1PQ5A 1SPJA 1BTYA 4M9FA 1V2NT 2WINI 1CT2E 1YPJH 3BIUH 3P17H 2HNTF 3KQCA 3D65E 4MPUA 3VGCC 1JBUH 1GBIA 3Q3KA 1MQ6A 1K1IA 3KQDA 1PYTC 2G5NA 2C4FH 1FIWA 2F9UA 1KSNA 5EU8A 1ELDE 1YY3A 2VGCC 1PPFE 3SN8A 1Y5UT 1J16A 1EKBB 1UK4A 5CMXH 2BHGA 1D4PB 2HPQH 2ULLA 4I31A 4LZ1H 4WMEA 2XYAA 2GCHF 3U1IB 4B73A 4IC5A 1NRNH 1HPGA 3B23B 3TNSA 5DKMA 1UTQA 3SNEA 4DCDA 3MO6A 1EP5A 1CT0E 3N7EA 3VB3A 3O8RA 2BY6X 3SHAH 2QF3A 1DPOA 1VJAU 1SG8B 1QR3E 2GDEH 4XRNA 1NU7B 5ABWA 3BSQA 1XUFA 2H9HA 4NIYA 1KYNA 3E0PB 3ZZ3A 2FS9A 2CV3A 1C1PA 4B6FA 4D76A 1UHBA 1D3TB 2BY5X 4HGCA 1O5BB 3ZVFA 3SUDA 2ZHDA 3M7TA 3DD2H 1BTXA 2YOLA 2PTCE 3RXPA 3ZVEA 1TLDA 5FCRA 1HAOH 5FBIA 1GHWH 2VNTA 3UREA 2A5AA 3K65B 1HXEH 2KFWA 5HIZA 1SGFG 4TWWA 3OYPA 3P8NA 3ZZDA 1OWJA 5AFYH 1CGIE 1GDNA 1EB1H 2A7HA 2XNIA 3A82A 3QX5H 5GXPA 4BXWA 2BDGA 3KQBA 4Y79A 1TOCB 2O9QA 2ALVA 5A0AE 3GS9A 1FUJA 4XD7D 1FLEE 2SGAA 1YLNA 1PQ8A 2VWMA 1V2UT 2ZF0H 3A83A 1EOJA 2EC9H 2TRMA 1YYY1 4B2CA 1TAWA 3UOUA 2FTLE 1YPGH 3UTUH 2FI3E 1QBOA 1J17T 2W3IA 3A89A 3P6ZB 1RGQA 1GCDA 1V6DA 4UE7H 2ODQA 4CRCA 3CNRA 1SGNE 3VB4A 5DJ7A 1C1SA 1PFXC 3ZZ6A 5H4IB 1P2MA 5E8EH 3U69H 7ESTE 2C8WB 3LGIA 1JOUB 1KXCA 3BTQE 2ANMH 1O3DA 4LOYH 3BF6H 1O2ZA 4ZUHA 2ZI2H 1AN1E 3M7QA 2AGEX 1EB2A 4Q7ZA 4XE4A 1DOJA 1DE7H 4XSKU 2CGAA 3TH3H 2XBVA 3AW0A 1ZHRA 3UWIA 2F4LA 4X6MA 1ZZZA 3K9XB 4FUJA 1UVPA 1SLXB 1GCTC 1G30B 4RI0A 2ODYB 1O38A 3E0NB 1EQ9A 2AMDA 3MOCA 3SU6A 2FXRA 1RFNA 2FOCA 1KXBA 1BIOA 1SGQE 1OKXA 3UPEA 1T4UH 2ILNA 2P94A 2WV9A 1H8IH 3A88A 1TRYA 5ESBA 3SU4A 3AW1A 2J94A 4CHAB 1ZHMA 5G4BA 4TY7A 1AI8H 2A4QA 2BLOA 2XWAA 4UFFH 2HLCA 2O8MA 2G4TA 3MTYA 1FY8E 4BAHB 1GBJA 1ACBE 3QGJA 5KEDA 3BV9B 2BD3A 1GHZA 3M7UA 3PWCA 1IHSH 4PROA 2J98B 4M7GA 3CP7A 1SB1H 4O97A 1C5VA 1C2KA 2ZWLH 4Y71A 4YM9A 3SU3A 2P95A 2ZIQH 5FX5A 3F0PA 1QB9A 1GPZA 1A5GH 1VITF 3HPTB 5JDUB 1TNHA 1FMGA 1SGPE 4FUEA 3H5CB 3GDUA 1GJ9B 1GDQA 2W3KA 1MTNB 4RT1A 3RU4E 3UAIC 1V2PT 2CJIA 1DM4B 2OQ5A 4F4OC 3F3BA 1MZDA 4X2WA 1QQUA 1CU1A 3M3TA 3DCLA 3STIA 2KX4A 2B7DH 1XVOA 1AO5A 2QN5T 5I25A 1BUIA 8KME2 3IG6B 1AVWA 5JPMH 1YPKH 4JYVH 2O8LA 2JIZD 4X1QU 3SQHE 1TOMH 2ZU2A 2NU1E 1NFUA 3KYGA 1HAVB 3PB1E 2ZC9H 2FO9A 1AB9B 1LO6A 4MQAA 4JYTA 2WUBA 1ANBA 1BA8B 1BJVA 3GICB 1TGCA 1MKXH 1P05A 1C1NA 1EAIA 3NRLA 2Y80A 3OY5U 1TMBH 4INKA 1YPMH 1TYNA 1AVXA 2PV9B 4LZ4B 3ZZ7A 1AFQC 2ZU4A 1W2KH 4A1VA 1DX5M 4LK4A 1O2RA 1FPHH 3ATWA 3GCHB 1SGCA 4FU8A 1P3CA 2R2MB 1F0RA 1QTFA 1EZXC 3UWJH 3GCNA 3LH3A 4ABAA 4AZ2B 1TRMA 2A0QB 4MTBA 2GCTB 4JZDH 4BTIB 4IN2A 2BLWA 1W0KD 2GV6A 1EP6A 1QBNA 4X6PA 1XX9A 3IWMA 1EJMA 4FUBA 1NRQH 3ENSB 1YKTA 1BZXE 1S6FA 2K0QA 2JETC 3WY8A 1FX0B 1GI3A 1ETTH 1A1RA 2HNTC 2LPRA 1O2IA 2HVXA 3SJKA 2P59A 4WY3A 1EOLA 4K5ZA 2BY8X 5EJZA 2BX4A 1GVZA 1S82A 1QB6A 1QJ6B 1SGDE 2KCPA 2Y6TA 4ZKRU 1HAHH 4SGBE 4X1RU 2ZFFH 1PJPA 1W8BH 1SI5H 4YOIA 1BBRK 2FX6A 4AFQA 3UQOA 3SJOA 1DWDH 2RCEA 1TWXB 2ZO3H 4JZFH 3F9FA 2WPLS 2STBE 1VCQA 5L30H 1S81A 3PV4A 4I7YH 3EE7A 1MU8B 3UUZA 4ISNA 1GJ5H 1JIMA 1WQSA 2OK5A 1O32A 4FUCA 1ETRH 4VGCC 3SV2H 1XUKA 2ZP0H 4XBDA 4NSYA 1C2FA 1CHOF 3BTFE 1ARBA 5A2MH 1C5RA 3QTVH 3BTWE 4GAWA 2SGDE 3JZ2B 1ANDA 4MG3A 6CHAC 2EY4C 1DXWA 1L1NA 2XBYA 1V2QT 5GCHG 3SO3A 1C5UA 3KN2A 1TFXA 3A87A 1PPCE 1HLTH 2OUAA 1TA6A 4B75A 1AE5A 3RXDA 1O35A 2CF8H 3U28C 3RXMA 3GY7A 1P09A 4OS1A 2A2QH 1NFWA 2H6MA 3FAOA 1A4WH 1C4V2 1ANCA 4ABDA 1AU8A 4KGAA 2R9PA 3RM2H 1MKWK 3KQEA 2A7CA 2QXJA 1AKSA 1Q31A 3DA9B 1KLTA 2RA0A 2BD9A 1GJ6A 4GLYA 5GIBA 1TX7A 3T5FH 5IK2D 1VZQH 1VGCB 2P3UB 1QIXB 2WV4A 1Y3XA 3EA8A 2RG3A 4X8UH 3KGPA 4X1PU 1GL1A 2XRCA 4TPIZ 1EASA 3TGIE 4MNYA 3ITIA 3UNSA 2D2DA 4BAOB 5C3NA 2F3CE 2FWWA 2LP6A 1W10U 2NWNA 2DUCA 1UK2A 3KQ5A 1VCWA 4BOHA 3U8TH 3SV6A 4ZXXH 1DLKB 1SBWA 4CRFA 1FIZA 1G32B 2ZDNA 2XC5A 1MCVA 1ZTJA 3SJ9A 1Z7KA 3P8GA 5A8YA 1ELBA 3RXGA 4DIIH 1MTUA 3M36A 4K8YA 2VIPA 4MPWA 1O3MA 1GBDA 1Y59T 2DE9A 2UWLA
chains in the Genus database with same CATH topology
4X2YA 1S0RA 1OYTH 3M3VA 4ZKSU 1FQ3A 1P12E 1RXPA 1HV7A 1BT7A 2PKAB 2FOAA 1SOTA 1YBWA 2PGQB 4NFEA 1DS2E 1ESTA 1H8DH 3LGTA 5JB8S 2GZ7A 2ZFTA 2ASUB 1UVTH 3SORA 3DFLA 1AQ7A 1SHYA 1A7SA 1P9SA 1J14A 1IQGA 3S0NA 3Q3XA 3UFAA 1EATA 1LHDH 2H9EH 1AZZA 1SMFE 1B0EA 4R0IA 3UIRA 1BRBE 4X0WU 1S0QA 1EPTA 1DVAH 3ZZBA 1O5EH 3MU1A 2FYRA 2BD4A 1A61H 2F9OA 2YNAA 4Q7XA 2IN2A 2BB4A 1K28D 4AG1A 4X6OA 4X1NU 7LPRA 1UCYK 1RRKA 1VR1H 1C5ZB 3M3SA 5LPFA 3AASA 3BEIB 2OTVA 1Z8IB 4UFEH 2PFEA 1GMHF 1O3FA 4HZHA 4U01A 3O8BA 4FUHA 2VIQA 2ZHFH 1GI6A 5DP5A 4K8BA 2WYGA 1MZAA 1GGDB 1OYQA 2H9TH 4X8VH 1CHOG 2BOHB 4YOJA 2HPPH 4DOQA 3LOXA 2OC8A 4DT7B 1OWEA 1LVMA 1O3AA 1L1GA 3OTJE 2Z7FE 2FOFA 4XBBA 3A85A 1QRXA 1UVUH 2W7UA 4K1SA 4KTUA 1IHTH 3BTDE 3SNAA 1ELEE 1V2ST 2FLRH 1F2SE 2TGAA 1O34A 1RTLA 3V7TA 3ZVBA 1N1LA 1KDQA 1PQAA 2VIVA 3SV9A 2ANYA 3MHWU 3GYLB 5LPEA 3MU4A 1NY22 1XKBC 4J2YB 1J9CH 2FOMB 1FI8A 1Z8GA 2UUKB 3N7OA 3QTOH 4THNH 3MMGA 1KLJH 1W12U 5IYTA 3MU0A 4YO9A 1BMNH 1MD8A 1NZQH 1Z8RA 1GVLA 3C1KA 2KAIB 5T6DA 3RMMH 3V13A 1C4Y2 5HGGA 3FVFB 2A45B 2OCVB 1HAZB 5HM2A 1V2OT 3RXIA 3MNBA 1LDTT 1BJUA 2B5TB 4Z0KA 4YOGA 1NRSH 1TQ7B 2G00A 2ZFQH 5C5OA 2ZA5A 3RC5A 3GDSA 1WU1A 1V2VT 1Z6JH 3GDVA 2BXTH 3BIVH 1O3IA 2Z3CA 1T31A 2UWPA 3E90B 1PYTD 5PTPA 7GCHF 3F1SB 1QQ4A 2QAAA 1C2HA 1EJAA 1HB0B 2FI4E 2Y5HA 2BQ6B 5JYIA 4H4FA 3D49H 3BG8A 1E37B 3DT0H 1PPGE 4X2VA 4A92A 4J1YA 3MNXA 4CRAA 4CH8B 1M9UA 3L33A 1F7ZA 1LVBA 1MCTA 1AHTH 5EOKA 1HUTH 3TU7H 1NROH 1IQMA 2ZQ2A 4MPXA 4UFDH 1SSXA 1O31A 2A2XH 3MH7A 4XDEA 5T6FA 1O5FH 1LPZB 3HKIB 4WF8A 2EA3A 2V35A 2QY0B 1LTOA 1P8VC 1PPBH 2ZG0H 1K1JA 2R0KA 5EXMA 1S6HA 5DPAA 5DP3A 2ZGBH 3D23A 4ZKNU 4O9VA 2P93A 4YLQH 1BQYA 1YGCH 1TNLA 1CVWH 3QUMP 4FU9A 2FM2A 2JH0D 4CREA 5FXLA 4OS7A 1O37A 1BTZA 1G3DA 1YM0A 4UEHH 1GJ4H 4K1EA 3ZZ5A 3RXOA 4Y7AA 1SLWB 3V3MA 1UJ1A 5JBAS 2JH5D 7KMEH 1EJNA 1W14U 1LPGB 5DP4A 4B74A 3DUXH 2AH4X 3M5MA 2FOGA 2VH6A 3KCGH 1GMHG 1K2I1 2ZGXH 1AIXH 1NC6A 4K3JA 4AYYB 2P3TB 1BDAA 5EPNA 1ELGA 1K1OA 4IS5A 1UTLM 1QGFA 4BNRA 5A09A 4O3TA 1XXDA 1C2IA 3AVZA 1UHBB 1Z1IA 4I8GA 3MO9A 3FFGA 4FU7A 1ZLRA 1KY9A 1AE8H 2SFAA 3A7ZA 2BZ6H 3VPKA 1BMLA 1C5XB 3TJVA 2Y82A 4K1TA 2FLBH 4E7NA 4GSOA 3LDXH 4ABFA 2QXGA 1O3EA 1F5KU 4VGCB 3W94A 1YC0A 4FUIA 1G3CA 4AGJA 4X8SH 3BTGE 3ESTA 3LGVA 1QRZA 3JZ1B 1BHXB 1HNEE 2ZTXA 6CHAB 5C67A 2P8OB 3HGPA 1CT4E 1E34B 1BRCE 1MH0A 2FI5E 2JKHA 2F9PA 3EYDA 1UCYE 1FZZA 4WXVA 1GG6C 1DDJA 1F92A 4NA7A 1DY9A 1SLUB 4WMFA 1AD8H 1V2TT 2Y81A 5A0BA 1JRSA 5L2ZH 3A7TA 1NPMA 2Y7ZA 3AAUA 1MTVA 3SNCA 4Y7BA 4DIHH 3UNQA 4YZUA 4HI3A 2V3OH 2P16A 5C20A 1SGRE 2G5VA 3FP7E 3LH1A 3P8FA 2ZHWH 4AFUA 1TPAE 1V2JT 4MVNA 3RLWH 1FAKH 1AZ8A 1WV7H 1UTKA 4KTCA 3H7TA 4NIVA 4Y8YA 1GMCF 3VB7A 1SQOA 1H4WA 2FOBA 1EPTC 1LVYA 3BTHE 2GMTB 3GCOA 1P04A 1C1RA 1C5MD 1SQTA 3QLPH 2SGFE 2W5EA 1MBMA 4BXSA 1L4ZA 3RLYH 3MNSA 1UTPA 1ZPCA 4UD9H 1RIWB 2BQ7B 1F0UA 2EI6A 3TK9A 2C90B 4MLFB 2GCHG 1T7CA 2H1UA 1ZSKA 2Z9IA 1C5LH 2XBXA 3ATKA 1XUGA 5C1UA 4XOJA 3MH6A 3M61U 3EAJA 4INLA 3P92A 3F9EA 4K69A 3I77A 1ELTA 3OSYA 4WWYA 1OS8A 3ODDA 3GCTF 1T32A 4NZLA 5DO4H 4X6NA 3R0FA 3SGBE 3PMJA 3T29A 2BQWB 2OBQA 3LKWA 3SZNA 4NWKA 2XXLA 1ZRBA 1CA8B 4KKDA 1C5TA 2HNTE 1V2MT 1TGNA 1A5IA 3G01A 5E2OA 1GI5A 4FXGH 3DHKH 4LXBH 1IQIA 1YPHE 3PMAB 1TABE 4MNXA 2A7JA 1SC8U 2G51A 2AGIX 1TGTA 1ZMJA 1NN6A 2SNVA 2GP9B 2IJOB 3SHCH 2OXSA 1UTJA 2VVCA 4JZIA 1IQFA 1HBTH 5C2ZA 2BDIA 1BTPA 1DUEA 1A3BH 3O8DA 1FY5A 1OP2A 5F8TA 1KXAA 1MTWA 3GY4A 2F91A 1FY4A 8ESTE 2VU8E 2Z6BD 5EQSA 2VIOA 1L0ZA 1KXFA 3PLPA 1ZRKA 2QYIA 5GDSH 2ZPQA 2VVVA 1EZUC 5L6NH 2BX3A 1NS3A 1CGHA 3ATIA 3BTTE 3MH5A 2BXUH 5EG4A 1QBVH 1RJXB 2JH6D 4F49A 5F03A 2O8WA 1FPCH 3H7OA 1C2MA 1AMHA 2FTMA 2LNCA 1O2VA 3QWCH 3A8BA 2ZCKP 5C5NA 4HTCH 1TX8A 5FPTA 2XCFA 1UTOA 4ZKOU 4INHA 3RMNH 1WQVH 2BD5A 4B2BA 1DSTA 1SFQB 5DP6A 1GI4A 1C1UH 3RXKA 1YLDA 1YCPH 2Z9LA 4I8LA 4ABGA 4ZROA 2HOBA 2A4GA 1A0HB 4YLUA 2R0LA 2QA9E 1XUHA 5HM9A 2J92A 3RMOH 1C5QA 4ZMAH 4ZHMU 1O3PB 1L1JA 1D6WA 3LIWA 3OX7U 1BBRH 4BANB 2GGVB 5E2PA 3UR6A 1QJ1B 5AF9H 1GBLA 1BITA 1XMNB 4RSPA 4MNVA 4OS4A 1AUTC 2Z9KA 1YF4A 1GMCG 3PWBA 5EGMA 1UTMA 2QXIA 2WPMS 4Y0ZE 1RD3B 1TPPA 2ZDVH 3ODFA 1HJ8A 5ETXA 4CBOA 1D3DB 4R8TB 5K7RA 5CHAC 3OY6U 4Y10E 4DJZB 2NU4E 3PLBA 1CBWB 1ELAA 2ZHQH 4FUFA 3SI4H 5FHTA 1PQ7A 2CMYA 2D26C 2OP9A 4CRBA 3AAVA 2ZCLP 3ZVAA 2C8XB 3A7WA 1B7XB 1P3EA 2BD8A 3SNBA 4ABEA 1ESBA 1HAIH 3VGCB 1IQLA 1HRTH 1P10A 2WPJS 3S7KB 3TIUA 3MWIU 1BOQA 4ASHA 4AOQA 1WTGH 1D9IA 2QCYA 2VGCB 3A81A 5F6MA 3IITA 4DY7B 4Y76A 4YTAA 5C1XA 1O2TA 5AHGH 1EX3A 1D3PB 4AB9A 1MKWH 1VITG 3BN9A 2BY9X 2BD2A 1Y5AT 4AGKA 8LPRA 1X7AC 1P2KA 4SGAE 4XBCA 2ZKSA 4ZXYH 1GJBB 1NFXA 1Y5BT 1JWTA 1TQ0B 2BTCE 3U8RH 1FY1A 3ZZ8A 4AB8A 1MUEB 3NZIA 2FDAA 1EAUA 1S84A 3UY9A 2ZHEH 5DG6A 4WVPE 2TPIZ 1XVMA 1W3CA 1BMMH 1UMAH 2PSXA 2PW8H 1MTSA 3GY8A 2FODA 4H6SB 3KEEA 5HXFA 2QC2A 6GCHF 3U8OH 3LGYA 2B0FA 2FIRH 2XC4A 4DW2U 1SL3A 8GCHF 1Y3UA 1TNKA 2O8TA 3TK6A 1F5LA 4OGXA 3D62A 5A0CA 2A5IA 3RXTA 2ZTYA 3E16B 1ZPZA 4TY6A 1Q3XA 2GKVE 1OOKB 4D9QA 1IQHA 3SNDA 1XUIA 4CRDA 3RXCA 1WSSH 3STJA 2FPZA 3MU5A 4B76A 2SGQE 1DWCH 4UFGH 2FESH 1DANH 2HRVA 1GI7B 3SUFA 1CHGA 1SHHB 1GBHA 2OQUA 3MI4A 5GJ4B 3VB6A 2R3YA 4JMYA 1C2DA 1ANEA 1OXGA 1GHAF 2AGGX 1TPSA 1Y3YA 2XCNA 1LMWB 3SJIA 3RMLH 1EAXA 4O3UA 2H5CA 4YESB 2ANKH 1HAYB 1GI2A 3Q76A 1EXFA 1SGTA 1DY8A 1SFIA 1TA2A 2ANWA 3HATH 3ZZAA 3SU5A 3TGJE 2R2WU 1G36A 2GD4B 1OWKA 1Y8TA 4CHAC 1T8MA 1INCA 1ELVA 2Q6GA 1GG6B 1E35B 1C5YB 4UDWH 1Y3WA 1P2QA 4AFZA 3SGQE 3TH2H 5HMAA 1IQKA 1UCYH 1BRAA 2F9BH 3E1XB 1T8NA 4AN7A 5BPEA 4MNWA 5A8ZA 4I33A 1CGJE 2P3FH 4X8TH 1GI9B 2ZGJA 2SNWA 5EQRA 2H5DA 1YPLH 2FYQA 1C4U2 4B71A 1GCTB 1TE0A 1V3XA 3TJOA 1YPEH 1ZMLA 3FP6E 3MYWA 2OBOA 3LC5A 3SGAE 4IC6A 4JK6A 1GJCB 2PHBA 4X1SU 3RDZA 3S9CA 1MTNC 5B6OA 4A1TA 3QK1A 5TJXA 1MAYA 1CSOE 1P02A 5LPRA 4U32A 1TB6H 1FN6A 1HYLA 3NWUA 3Q00A 1JRTA 1O3NA 1PPEE 1BMAA 2ZU1A 2F9NA 5GPIB 2Y7XA 3QDZB 5JBCS 1PPHE 1QCPA 3RM0H 2ZDKA 3TLOA 1O5CB 2Q1JA 5F8ZA 3NXPA 1RTKA 1J8AA 2F9VA 2VINA 1FY3A 1C5SA 4AORA 1MQ5A 2BOKA 3LT3A 3UOPA 2STAE 1GHVH 3SOSA 4ESTE 1OPHB 3MNCA 1ZTKA 2GT8A 2QGRA 1K1MA 1H9LB 1AB9C 4NZQA 2TBSA 1TNGA 3T62A 4I8KA 2AYWA 4JYUH 2I6SA 2ZTZA 2BLQA 5L2YH 4BTTB 3FP8E 1WUNH 1BBRE 1GL0E 2FEQH 2UUFB 1H1BA 6GCHG 1TGSZ 2CHAC 2G55A 2ZU3A 3LU9B 1S5SA 2AIQA 5T3HA 1HIAA 3GCHC 3GYMA 3E91A 2W26A 4BAKB 3LJOA 3URCA 1ZSJA 1WCZA 3MFJA 2J34A 4ZHLU 2Q6FA 2GCTC 2IOTA 3F9GA 3U1JB 2BDYA 3UNRA 2BDAA 2J4IA 3PM3A 4BAQB 4FUDA 2GVFA 3BG4C 1GJ7B 1O3BA 1FDPA 4IBLH 3VFEA 2F83A 1GJDB 2D8WA 4JK5A 5FPSA 4RKJB 1T8LA 1GHAG 1ZOMA 2D1JA 3P70B 2WPHS 1TALA 1KTSB 3LGUA 3MU8A 4NSVA 2BM2A 3Q3YA 4CBNA 1OWIA 2HALA 3A7XA 2VB0A 2BDCA 1ID5H 3U98H 2B8OH 3HGNA 3TK5A 4D7FA 2FX4A 4ISLA 3TNTA 1AFQB 1Z1JA 2ZPSA 1O3KA 4YT7H 1G37A 1O2SA 1WBGB 1XKAC 1THPB 4B2AA 1LKBA 1AVGH 1DUAA 3KIDU 1N8OC 1W0ZU 1BB0B 1CA0C 1BTWA 1HJAC 1L4DA 1K21H 1CE5A 2J9NA 5ESTE 1P03A 6LPRA 1PPZA 1YCPM 5FX6A 2GV7A 5I46H 2JETB 3B9FH 3SV8A 1ELCA 4H42U 1WOFA 2ZCHP 1G2LA 1XUJA 1SGIB 3K6ZA 3S7HB 1O5AB 1P9UA 1WYKA 2RDLA 5E0HA 1B0FA 1GVKB 5CHAB 1GWAA 4NA8A 1Z8JB 3FANA 3V12A 1NM6A 3F9HA 3R3GB 2Q6DA 1QB1A 1NO9H 1VGCC 1LHGH 3BEUA 3TITA 2AMPA 1GJ8B 1KTTB 4IN1A 2FOEA 3BTKE 1O3OA 3S9BA 2Z9JA 1V2RT 1O33A 3ZZ4A 3EA9A 3M37A 1BHXF 1P0SH 1HXFH 4FVBA 3MH4A 1UVOA 4Y6DA 5BRRE 4BTUB 2AFQB 1GBTA 5LH8A 2CXVA 3FZDA 1C2JA 1GBCA 1A2CH 5EW2H 3SUGA 1NFYA 2GT7A 4ISIH 3QO6A 1C2EA 3VB5A 1EZQA 3RXUA 3F6UH 2Z3DA 3RU4T 1O2WA 1K1PA 1O39A 1SR5C 1G2MA 1P06A 3ZVDA 1D3QB 1V2WT 2PGBB 4H6TA 2ZFSA 1Y3VA 2AERH 1FXYA 5FBEA 4CH2B 2A5KA 1KLIH 1RS0A 5AFZH 2ZFPH 1EUFA 2NU3E 1ZYOA 1O2UA 1C2GA 2ZQ1A 3DFJA 3I29A 2ZDLA 2M5TA 2ZNKH 1K1LA 2EEKA 5F8XA 1O36A 1QJ7B 1HJ9A 1OWDA 4CR9A 1GMDF 1C5PA 1TONA 2PKSC 1O0DH 1O2QA 1O2JA 1O5GH 2BYAX 4OS5A 1FV9A 3NPSA 3TGKE 2PLXA 2QV1A 2PR3A 1KXDA 1P2JA 3PO1C 7GCHG 3CS0A 1BRUP 2OC1A 2TIOA 2O8UA 3LPRA 4WXIA 1K22H 1C1VH 1LHCH 3KNXA 3RXRA 3TVJB 3C27B 3ZZ9A