1V2ST

Benzamidine in complex with bovine trypsin variant x(ssfi.glu)bt.d1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Understanding protein-ligand interactions: the price of protein flexibility
pubmed doi rcsb
molecule keywords Trypsin
source organism Bos taurus
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2sT01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2sT02
4WF8A 2THFB 1MQ5A 2PHBA 3R3GB 1FMGA 1FIWA 4J1YA 1HDTH 1P09A 1TNGA 1W0ZU 4GVUA 4ZKSU 2ZFFH 4KKDA 2ZCHP 1SSXA 3DUXH 2EI8A 1DWBH 2JETB 2QCYA 1OWDA 1O3NA 3E6PH 2A7JA 1VCWA 1V2MT 2IPHA 4U32A 2H5DA 4XSKU 3H7TA 3L3TA 1T4VH 1KTTB 4BNRA 2BDHA 4CH8B 1XUIA 2XWAA 3RXBA 1V2KT 2NWNA 1FDPA 2Y5HA 2ZFQH 4TWYA 1TX7A 1CGHA 1GCTC 1GJ4H 4ABFA 1LHFH 1GJ9B 1AO5A 2ZGXH 2F9PA 4NZLA 4U30A 1AUTC 3F9FA 3QGJA 3RXPA 2Z9JA 1HAXB 2OINA 1GI8B 1V2PT 3RXVA 1ELVA 4E7NA 2AGIX 1BMLA 3R0FA 3KHVA 4MNYA 1LPGB 2Q6FA 2UUJB 3RXJA 1OWJA 1GHAF 3FAOA 1JIRA 3IWMA 2BD5A 2B9LA 1F0TA 2BZAA 1PQ7A 4AZ2B 3LIWA 5L2ZH 1WTHD 2G81E 1DT2A 5JDUB 1VJAU 2CHAC 2SGQE 1SVPA 1MD8A 1HYLA 4Y76A 2HPQH 3SNDA 5DJ7A 1ACBE 3P8NA 3A89A 2BX3A 4U01A 3A86A 1JBUH 1G36A 3CS7A 3PMAB 1Y59T 1OYTH 1ZMJA 1W7XH 1UHBA 1W8BH 2C8XB 1YM0A 3MYWA 1GMCF 1O32A 1C5MD 2XC0A 1FI8A 1MTVA 1NFXA 1J16A 1ZHMA 3AW0A 1YLDA 1UTOA 2P93A 3F9GA 3RM0H 1DSUA 1TNIA 1GJBB 5C1XA 3MOCA 1ZTLA 1YF4A 3A7ZA 5GPIB 5L2YH 1FIZA 2ZDLA 2Q1JA 1GVZA 4X8UH 2AIPA 5FPYA 3BG4C 1O30A 1BBRK 3SU2A 2J38A 3TGIE 2ZHEH 2G8TA 2PWXA 1GHAG 1AMHA 1S0QA 3GY6A 3VB6A 2V0BA 3NPSA 1BOQA 4K5ZA 1A46H 5EODA 1RFNA 3T27A 4YOGA 1W10U 2W7SA 4Y6DA 1TAWA 2Y81A 1KXBA 2BY7X 3LGUA 4K60A 4ZXYH 6CHAB 1BTWA 1UVUH 3LGTA 1G2MA 3VGCB 1AFEH 1HV7A 4ISHH 3RMLH 4HGCA 2QV1A 1SGYE 4I31A 4ABIA 1KXEA 2FOHA 2GCHF 5L30H 4NIWA 1P12E 4AFQA 2H1UA 3RUOA 4KELA 2JETC 2FWWA 1ZGIA 2SGEE 3MH5A 2Z6BD 3A7XA 2A4QA 2QAAA 4VGCB 1TIOA 9LPRA 1NZQH 2SGFE 4IS5A 5BPEA 2TGDA 1GBAA 1SLVB 1SG8B 3VB3A 2UUYA 2XNIA 1MKXH 6ESTA 2FESH 3TLOA 1LTOA 4D9RA 2JH6D 2VINA 5FX6A 3NKKA 1D3TB 1ELDE 1ZPBA 4O03A 3TITA 2PSXA 1K1PA 1CHGA 3GY4A 1RIWC 3SU3A 4A6LA 3ZZ8A 4FU8A 1C1QA 2J4IA 1BT7A 4ABDA 3RC6A 1NU7B 1WUNH 5ESTE 2A32A 1OOKB 3FZZA 1GJ7B 3PROA 2CGAA 1P03A 2ZU3A 4JZEH 1A0HB 1WAYB 1C2JA 3B9FH 3OU0A 3S69A 1BMMH 2AGGX 1EB2A 4MNXA 1EZQA 1Y8TA 2QC2A 8KME2 4WMDA 3RP2A 1C5QA 2VVVA 1ZLRA 4KTUA 4F49A 1EPTB 5C5OA 2A1DB 3ODFA 3KEEA 3SU4A 1K1MA 1UTMA 1GJ5H 1ANEA 3D65E 4LK4A 3H7OA 2Y5FA 2PKSB 5JYIA 2OC7A 1QBVH 2WYJA 5PTPA 1BUIA 4BAKB 1QB9A 5FCKA 2BB4A 3NZIA 3V12A 4X0WU 2IOTA 1MU8B 2R9PA 2FI4E 3RXGA 5J4QA 1G3EA 4KTCA 1ELEE 2O8WA 1OWEA 1XMNB 3MO9A 1TPPA 3ATLA 1UK2A 1O2MA 5FXLA 1FV9A 4JYVH 1AB9B 1OP2A 3D23A 1OX1A 3QGNB 4RN6A 1HAIH 4B2AA 3O8DA 2RG3A 1H8IH 1TPOA 2ZFRH 3UTUH 3PTNA 2PR3A 2XBVA 1C1TA 1O2GH 1S6HA 4OGXA 4UONA 9ESTA 1G3BA 1TPAE 1S85A 3RXKA 5HYOA 3LGWA 3E91A 4LOYH 2WV4A 1C4U2 4IBLH 1EUFA 2F91A 3RXTA 3DFLA 2ANKH 1HCGA 1FXYA 3EA9A 1V2QT 4B73A 1BTXA 1ANBA 1TGSZ 2C8WB 4DW2U 6CHAC 5AVDA 2BQWB 1IHSH 3MO3A 1C2LA 1LVMA 5A8XA 5AFYH 5F8ZA 1FLEE 1FPCH 1YPHC 4AGJA 2WINI 3TU7H 4D8NA 4NIYA 4TY6A 1BHXB 1A5HA 1P02A 1RTLA 3MU8A 1W13U 3HGPA 1GMHF 4AYVB 3A82A 1QL7A 1O2QA 3KCGH 1TOMH 1P3EA 3SQHE 4OS5A 2FO9A 2SNWA 1ETRH 1HAGE 4I32A 2G5NA 3ZVGA 5LGOA 1O2OA 1EP5A 1B5GH 4AG1A 2HGTH 2FEQH 4UD9H 5GIBA 3A8DA 2ANMH 1BRAA 1NFWA 3BTEE 4UE7H 1ZPZA 1UO6A 1EAUA 2GD4B 1RJXB 2HNTE 4AORA 3PV4A 1DY8A 1HAZB 2XXLA 4AGKA 2F9UA 2BQ7B 1VITH 1NROH 3EYDA 1V2WT 1O2HA 1O3LA 1K1LA 3ELAH 3RM2H 1C5NH 3ITIA 4X2WA 3T2NA 2AGEX 2C93B 3LOXA 4GCHF 3UNQA 1TYNA 4E7RG 4ISIH 1L1NA 1FAKH 1TFXA 1GDQA 2XBYA 1LVOA 3STIA 1WTGH 5CHAC 1N6XA 3RC5A 1D6RA 2P3TB 2BD4A 2OC8A 5C3NA 1T8MA 3QWCH 1SI5H 1ZSLA 1XVMA 3B23B 3M3SA 3EQ0H 3RXHA 2I6QA 3M7TA 1GJCB 1U6QA 2TGAA 4Q7YA 1FN6A 1IQEA 2ZHWH 2BOKA 4NWKA 1Z71A 3OX7U 1TX8A 3U8RH 6GCHG 2BLWA 2YNAA 3MFJA 3RXMA 1O3JA 1C1NA 1TB6H 3UPEA 1SOTA 5EPYA 2PGBB 2FZZA 4RKOB 2GZ7A 3PM3A 1ZSKA 2Q6DA 2ZKSA 2B8OH 1LQDB 1SGRE 4FUHA 5C67A 3GCNA 3EE0B 1RXPA 4GCHG 1H1BA 2UWPA 4KTSA 5EW1H 4ABHA 2ZIQH 4Z6AH 3RXQA 4DCDA 3DA9B 1NRSH 2XCFA 1KYNA 1BRUP 1HJAB 1O2PA 1LMWB 1O3PB 4ABEA 3OTJE 3PMBB 5FBEA 4GLYA 1V2LT 4CHAC 3MU1A 3I29A 4M7GA 5LPRA 1O2TA 1QL9A 2A4RA 1AE8H 3ZVCA 4B71A 1EPTA 1ZHRA 2A5KA 1NPMA 1O2IA 3QTOH 1DOJA 1KTSB 3FFGA 3A83A 4BXWA 3GDVA 1UCYK 1P01A 4XBDA 1DICA 3LJJA 3UWIA 1SGFG 1NFYA 2OBQA 1ZJKA 4MG3A 1IHTH 2FIRH 2Z3CA 5JBBS 1VZQH 5EXLA 1T31A 2BTCE 2QYIA 1GVKB 2PTCE 4DIIH 2I6SA 2A7HA 1HJ9A 5EQRA 4UFFH 1AFQC 1H9IE 2ODQA 1EATA 2GDDA 3E0NB 4OS4A 2NU2E 4WXIA 1THPB 3VB7A 3KQBA 4FUBA 1E36B 3A87A 4OS7A 1P2MA 1NRRH 1EKBB 2AS9A 2OC1A 3A7YA 4JMYA 2VB0A 1ARBA 3URDA 2C3SA 2ZGHA 4KGAA 3HK3B 2QXJA 4DVAU 3U1JB 1C5XB 1VJ9U 3TVJB 4NFEA 5CE1A 1TMBH 1ORFA 1KLJH 4XDEA 1K1NA 1GCTB 4CRBA 3RXFA 2Y5GA 3A84A 1C5OH 1FPHH 4FVBA 3Q76A 4FXGH 1FQ3A 3EAJA 3KL6A 2H9EH 2ZHFH 2WPIS 4XBCA 3JZ1B 5IYTA 1QA7A 4BAHB 1ESBA 3ZVAA 1DDJA 1CSOE 4YT6H 3ZZDA 2GV6A 1RS0A 1EXFA 4Y7AA 1NESE 1ZOMA 1G2LA 2BXTH 4NCYA 5DPAA 1GDNA 3GCOA 1XUGA 3PWCA 3QTVH 1AVGH 3E8LA 1MBMA 2CHAB 8LPRA 1A4WH 3DHKH 2GZ9A 2W3IA 5C1YA 4B74A 1C5UA 4WH6A 3PO1C 2GMTB 1ARCA 1E38B 3P8OA 1YCPK 1QHRB 1C5VA 1BA8B 1L4ZA 1C9TA 1S6FA 3UUZA 4BTTB 3GISB 1O3KA 5G4BA 1SC8U 1XUFA 2BLQA 4K3JA 4OS2A 3W95A 3BTWE 3BSQA 1DXPA 1HAYB 2GX4A 2VH0A 3I77A 5E8EH 3PLBA 4DJZB 2ZHDA 3K6YA 3SN8A 2B0FA 3S7HB 1NY22 3RDZA 5A8YA 1NS3A 3K65B 2FOGA 4ZHAA 3OSYA 3T26A 1MKWH 3QZQA 2GCTB 1HFDA 3HATH 3OY5U 3GYMA 1AQ7A 4K2YA 2PV9B 2ZA5A 2O8MA 1W12U 1MQ6A 1QRWA 3NWUA 4OS6A 1TNLA 1O2NA 2BD2A 1TALA 1Y5BT 2FOBA 2JKHA 2BMGB 3KIDU 4X1QU 3GICB 2QXIA 3L33A 4I8KA 7KMEH 5ESBA 1Z6EA 5HGGA 1FN8A 4Q7XA 5AFZH 3VXEH 1MMJN 1EP6A 2AMPA 5GDSH 2AEIH 5EXMA 1P8VC 3O8BA 1P04A 2R2WU 3KQDA 1RD3B 2QY0B 2QXGA 3TH2H 1BDAA 2V35A 4JZIA 1O3CA 1O5CB 1EX3A 4I8LA 2ZU1A 4YM9A 3MU4A 1J17T 3QO6A 2GTBA 1SGTA 3LGVA 1E37B 1HAHH 1V2NT 5F8TA 1QA0A 1K1JA 3ESTA 4BANB 1QQ4A 2W5EA 1EQ9A 2Z9KA 1GBDA 2FOCA 3Q3KA 2BZ6H 1XVOA 1QBNA 4UDWH 1MBQA 4BAQB 1ETTH 3Q3YA 4NGAH 1RIWB 3GCHC 1GDUA 4BAOB 1V2OT 1SGPE 1T8OA 4HZHA 1K28D 1C1RA 1XKAC 1GMDF 1TOCB 2VU8E 2J94A 2O8LA 4NA7A 1QR3E 3UOPA 5C2ZA 1K22H 1HRTH 2ULLA 1C1SA 1BBRE 1UJ1A 2BDIA 3P70B 3T5FH 1GCDA 1ABIH 1P9UA 1AKSB 1ZMLA 2OP9A 1O2XA 4NG9H 3DT0H 3QK1A 5A0BA 2Y80A 3D49H 4SGAE 1DWEH 4HI3A 1P2JA 2AMDA 3FP6E 2GMTC 2FTMA 3F6UH 3M7UA 3RMNH 1N1LA 2KAIB 2CN0H 3BIUH 1B0EA 1MUEB 2OC0A 2FOMB 1IQFA 4FUGA 1LKAA 4RSPA 2J92A 2F9VA 3NCLA 4K1SA 3P8FA 3SUEA 5C5NA 1P2QA 1TE0A 3RXUA 1PQ5A 1GMDG 4NA8A 5EW2H 4AB8A 1UTKA 4TPIZ 3L6PA 1LHCH 2ZF0H 1EJMA 5C1UA 4JYUH 2FX6A 3CENA 1TABE 1ZPCA 2ZZUH 4BTIB 2J95A 2GCTC 2H9HA 1P2OA 1Y5AT 2VIWA 1O2KA 1TRMA 1JOUB 3NUMA 2LNCA 2QF3A 3VXFH 3GDSA 1BTPA 5DP5A 4ZKRU 2O8UA 3ATWA 1Z8RA 1SGIB 2FXRA 2R3YA 4MLFB 3SW2B 1E34B 1GL1A 1D9IA 4UFDH 1DLEA 2WPLS 1FY8E 1QB1A 2B5TB 3RLYH 1PPGE 4DIHH 1CA0C 2XBXA 3BF6H 5DK1A 2D2DA 1AZ8A 1TRYA 4ASHA 1GMCG 1UVSH 3RU4E 1UTNA 1QRZA 1MTSA 2JH5D 2AH4X 1O3GA 1PPCE 3V0XA 2F83A 5GXPA 1S84A 3SJOA 1C5RA 1XXDA 1SLWB 3ZV8A 1IQHA 2W26A 3RLWH 2ZFSA 1O3FA 1K1OA 3TJUA 1IOEA 1A5GH 1C2HA 1M9UA 3E3TA 3TJOA 1O2JA 2G55A 5CMXH 4H6SB 1QIXB 2XWBI 1S0RA 4XFQA 2TRMA 3LU9B 1CT0E 3BTFE 3T28A 2PGQB 2GT7A 1K21H 3A7TA 2EEKA 5DG6A 2TPIZ 2BDAA 1SBWA 2ZCKP 1GWAA 1F92A 2FOEA 1UVOA 2ZEBA 5A2MH 1GBCA 3BTQE 2ZWLH 1SGQE 4ISNA 2OTVA 1BBRH 2A4OA 1J14A 3ZZBA 2A45B 4HTCH 1OWHA 2GCHG 2OLGA 1EAXA 2WPMS 1FY4A 1PPFE 1BTUA 2BDYA 2VIOA 2VNTA 4PROA 1ELCA 2CMYA 3BEIB 5CHAB 1VR1H 2FI5E 1LQEA 4R8TB 1ZSJA 1FAXA 3ZZ4A 1KIGH 1P10A 1HUTH 1UTQA 3SU0A 2GP9B 1VITF 3AASA 1H8DH 2FLRH 1EASA 3SI3H 1HNEE 4K1EA 1YPKH 4FU7A 1P05A 5GCHF 4ZHLU 3VFEA 3FP8E 3M7QA 3LPRA 1Y3XA 1TQ7B 2Z3EA 1NRQH 4MQAA 4YOIA 1ABJH 3M3TA 5DP4A 4Y79A 2ZP0H 1GI7B 4Y0ZE 4DGJA 2WPJS 1AVWA 1O3AA 2XTTB 3MH6A 3SNCA 3SU1A 2Z7FE 2R0KA 3RC4A 2W7UA 7ESTE 2VGCB 3UR6A 2ZGCA 2R2MB 1P2KA 2WPKS 3M5NA 1ZYOA 4MNVA 3U8OH 4CRGA 1O5BB 2RA0A 3UNSA 1H4WA 3KGPA 5FBIA 3RXIA 4CREA 1CA8B 4A1VA 3D62A 1F5RA 1ESAA 3MHWU 2CXVA 4X8VH 1Y5UT 3A85A 4FU9A 5DP7A 2BOHB 4X1NU 2D1JA 4CHAB 1AKSA 3BTGE 4DT7B 1TGTA 2HLCA 3MNSA 4MDSA 3TGJE 1ZMNA 1GI9B 1VITG 7GCHF 3SU5A 1GJAB 2UWLA 5JB8S 5JBAS 3ZV9A 1OYQA 4YOJA 3JZ2B 4NSVA 4DURA 1RGQA 1A1RA 5GCHG 1HAOH 3E0PB 1SLUB 1ELBA 1NT1A 1SHHB 1LHGH 1RTFB 2C8ZB 4A7IB 2QN5T 4E05H 1NRPH 1MH0A 4YESB 4A1XA 2YOLA 4DG4A 1EJAA 3M5LA 3W94A 2KAIA 2BVXH 3SJKA 2BLOA 2A2QH 1GI6A 2PKAA 4LXBH 3TIUA 2NU1E 2PSYA 2DUCA 3BEUA 4NFFA 1AFQB 1AWFH 1O5DH 1SPJA 2ALPA 1DUAA 3P95A 3HK6B 2G51A 1MTWA 3SUDA 1P9SA 1BJVA 2Y7XA 3VEQB 1Z1IA 2ZQ1A 1T8LA 2ZC9H 3UWJH 1Z7KA 1V2VT 1O33A 1P2IA 4GUXA 3H5CB 1F0RA 1O2RA 4MPVA 4CR9A 1LO6A 2A5IA 1DVAH 2UWOA 3NK8A 3LONA 4TYDA 2ODYB 2Y6TA 5AF9H 3P17H 1G32B 1C1PA 1UMAH 4OS1A 3QLPH 7GCHG 1SGFA 4LZ1H 2F9BH 1Q2WA 4NIVA 5JBCS 3RMMH 4CRCA 4Q2KA 1O3OA 1WU1A 2RCEA 2OD3B 1SQAA 1BIOA 3EDXB 1IQIA 3MNCA 5T6GA 5LH8A 4BOHA 1GMHG 4X8TH 2HNTF 1HIAB 4B2CA 1CVWH 2BVRH 1HXFH 4I7YH 1XUKA 2A7CA 5L6NH 1DPOA 1O2SA 5EG4A 1V2UT 3SUFA 4JCNA 4X1PU 1P2NA 3SHCH 4Y8YA 2BD7A 4MNWA 3PO1B 4AX9H 1UCYE 3MWIU 2BY6X 3ZZAA 3MMGA 4INHA 1DXWA 2HALA 1HB0B 6LPRA 3SUGA 1QQUA 4FUJA 1VCPA 1FONA 4MPWA 2P16A 1EZSC 1F0SA 3BTTE 3RXOA 1GBIA 1YGCH 2VGCC 1YPHE 1AHTH 1HAPH 5JBTA 3SHAH 2XC5A 3M37A 2RDLA 1T7CA 1CT2E 1A3BH 1AU8A 5HXFA 1THRH 5EXNA 2STBE 1MTNB 3C27B 2OQ5A 1WOFA 3FANA 2AYWA 3SGBE 3KQEA 1VGCC 1WSSH 4AFUA 4WH8A 4I8JA 1Y3UA 5EOKA 1ZZZA 1C2KA 1F7ZA 1GI2A 1Z8JB 4TPYA 1P3CA 2VWOA 2XCNA 3F9HA 3Q77A 3AVZA 3UOUA 1D3QB 1SLXB 1TRNA 5EQQA 1V6DA 1QB6A 4MVNA 4AYYB 3MH4A 3WY8A 1O38A 4A1TA 2GZ8A 3DFJA 2J34A 1O31A 1QBOA 3UQVA 1J8AA 2VWNA 1O5FH 1YCPM 1TNJA 5HMAA 1IQMA 1C1MA 1BRCE 3SNAA 3K6ZA 3ZYEA 2BDBA 1JMOH 3TK6A 1ZRBA 2TGPZ 1SOZA 4ESTE 1C2DA 4FVDA 1PPHE 5DP9A 1SB1H 1GBTA 1YLCA 5C20A 4D7FA 1LCYA 1DSTA 2SNVA 1NO9H 2R0LA 3PTBA 1BB0B 1W2KH 1S82A 1TNHA 4LZ4B 2IN2A 2D26C 3RXDA 1CGJE 1SGCA 3TH4H 2GDEH 4CBOA 4WXVA 3GCHB 5ABWA 1A5IA 5HM9A 3RXLA 1UTLM 2F9OA 1KDQB 3TK5A 1C5YB 1V2JT 4R0IA 1O3HA 4XE4A 1C2MA 2WUBA 5T6FA 3TPIZ 3G01A 1C5SA 5AHGH 7LPRA 2VIVA 3MU0A 3ZVBA 1SQTA 3SORA 1MZDA 2ZDVH 1MZAA 1ZJDA 2ZFTA 3ZZ7A 2CV3A 2ZTYA 8ESTE 5FHTA 1DLKB 3ODDA 4GHQA 3FVFB 1O2ZA 1ZTKA 2RA3A 1K1IA 3GY5A 1DITH 1GG6C 1EJNA 2QA9E 3M3VA 2OCVB 2BY5X 1YYY1 3LKWA 1FY5A 4GHTA 1WBGB 2FX4A 1UCYH 1TMUH 2H5CA 4E06H 2SFAA 5EPNA 1AWHB 2WV5A 1C5WB 1GGDC 1O3BA 3C1KA 3BIVH 3E90B 3K2UA 3F9EA 1O5AB 3LC5A 1ZR0A 3ATMA 2Z3DA 1Q3XA 4KP0A 2A2XH 1UK3A 5EQSA 1G37A 4WMEA 2VWLA 1YP9A 1Q31A 4J2YB 4X8SH 2FS8A 4K69A 3SNEA 4NSYA 5F8XA 1GL0E 2FM2A 4Y71A 4K1TA 3TNSA 4WWYA 1C5LH 3I78A 2PTNA 1GI4A 2DE8A 1O2VA 1MTNC 1EZUC 1NU9A 4YLUA 1KXFA 1UVPA 1MU6B 1ZTJA 2YNBA 2FYRA 2NU3E 2HWLB 1CT4E 3E1XB 3BTME 1VCQA 1G3CA 1SMFE 5T3HA 1HIAA 2ZFPH 1ZGVA 1TA6A 2Z9GA 4ZMAH 2PUXB 1W0YH 1E35B 4Z0KA 1AD8H 1T8NA 4TY7A 3P6ZB 1GHBF 1SL3A 1CA0B 1Z8IB 5B6OA 3U8TH 2FOFA 2FDAA 1J9CH 2P8OC 2P95A 3MTYA 2GKVE 4K8YA 5E2PA 5A09A 1KLIH 4Y0YE 1HJ8A 2W3KA 2ZPQA 1NM6A 5A0CA 3ENSB 4I8GA 1K9OE 1ELTA 1C1UH 2EI6A 1OWKA 5TJXA 3UIRA 1QJ7B 4Y11E 1YPGH 3TJNA 5BRRE 1OS8A 1C9PA 1CBWC 3MI4A 1C2FA 1YCPH 2BX4A 1O3MA 3BTHE 2ALVA 2PW8H 4B76A 1A61H 1F0UA 1S81A 4HFPB 5E0GA 1Z1JA 3CS0A 1L1GA 2QIQA 1BTZA 1GHXH 1A0LA 1IQLA 1KSNA 1Z8GA 2G00A 1IAUA 2P3UB 1JRSA 1T4UH 2BD9A 1GHBG 4CRDA 2UUKB 1OP0A 4Q80A 3ATKA 4OGYA 1XXFA 2LPRA 5H4IB 3TH3H 3A88A 4D7GA 4IMQA 5T6DA 2QGRA 2G4TA 1DX5M 1JXPA 1TGCA 4GSOA 4FUEA 1NFUA 3PLPA 1DWDH 1TGNA 1C1WH 4RKJB 1AIXH 3UNRA 3VB4A 3HKIB 2ZNKH 3RXAA 2OUAA 1P0SH 1HGTH 2Z9IA 5ETXA 3ZZ6A 2AFQB 1BTYA 1C4V2 3OYPA 2G4UA 4O9VA 1EOJA 1AI8H 3M5MA 1CGIE 1DM4B 1KXCA 2PKAB 2ZDNA 1O35A 1CQQA 4ABGA 1GBKA 1A0JA 1IQNA 3QUMP 1QJ6B 4ZHMU 1GJDB 2VH6A 2V3OH 2CF9H 1DY9A 3STJA 3T25A 3F68H 3BTKE 1BMAA 1THSH 2FMJA 1GBFA 4ZROA 1BCUH 1ESTA 1N6YA 4BXSA 2BD8A 1KDQA 3K9XB 4XOJA 3AW1A 5TCAA 4FUIA 4QT8C 1MKXK 2PUQH 1HAVB 3T29A 4I33A 2CF8H 5DP8A 1N8OB 3S9AA 4X6NA 5E0HA 2FODA 1PPEE 1TWXB 3SJ8A 2C90B 2H6MA 2AMQA 1W3CA 3SGQE 1A7SA 2A0QB 2HOBA 2SGDE 3LH3A 4X6MA 2F9NA 1TA2A 2VIQA 3UR9A 5F03A 2FI3E 3LT3A 4X2VA 3ZZ5A 2ZGBH 1QRXA 3Q3XA 2GGVB 2ZDMA 2ZTZA 3QDZB 2GVFA 3V13A 4IC5A 1D3DB 1V2TT 4GPGA 3S0NA 5K7RA 1CO7E 3SV6A 1O34A 1G9IE 2V3HH 1TMTH 1EAIA 4BTUB 2TBSA 3FZDA 2ZPRA 2HRVA 1GHZA 1O37A 2GT8A 1OWIA 2BYAX 3FP7E 1LVYA 3MU5A 2ZDAH 1LPZB 2ZI2H 2H9TH 1LPKB 4JK5A 1PJPA 2STAE 3BTDE 1BJUA 1L0ZA 3RU4T 3SV8A 1Y3WA 2BD3A 3F1SB 4JK6A 3VPKA 1LHDH 3BN9A 5A0AE 1S5SA 1RRKA 4CR5A 5FPSA 3ZZ9A 2ZU4A 4O3TA 1W7GH 2PFEA 4Q7ZA 1O2LA 1Z6JH 3LJOA 3M35A 1JWTA 1HXEH 4BAMB 4Y7BA 1FY1A 1P11E 3PMJA 1SHYA 2BLVA 5JPMH 1GHYH 3GCTF 4ABAA 2BDGA 1BTHH 2EA3A 5FAHA 1L2EA 1ZHPA 3SOSA 5DO4H 1GBBA 2SGPE 5JB9S 1XUHA 1GJ8B 3IITA 4WMFA 2QXHA 1FUJA 3DD2H 4Y8ZA 5GJ4B 3PB1E 2Z94A 1PFXC 2B7DH 2BDCA 5HM2A 1DWCH 1BQYA 5I25A 3B8JA 2BY9X 3SJ9A 1V2RT 3EA7A 2AIQA 5FCRA 5FPTA 1A3EH 1NN6A 2NU0E 5SGAE 3HGNA 1ELAA 1EB1H 2OXSA 2P3FH 3GDUA 4AB9A 3UQOA 5J4SA 1BITA 1OPHB 4X2XA 5DP3A 4INLA 3O8RA 2DE9A 1CHOF 2ILNA 1CU1A 2ODPA 2HNTC 1J15A 1GBLA 3RXEA 2TGTA 1FY3A 3A7WA 4ZXXH 3SI4H 1GVLA 4YTAA 5LPFA 2G52A 3GCTG 3SV2H 1DS2E 3P8GA 4WVPE 4A92A 3LH1A 1QGFA 3ZVEA 1C5TA 3GY7A 1G3DA 4Y10E 2C4FH 2VWMA 1N8OC 1QNJA 5I46H 1IQJA 1Y3VA 2XC4A 1WCZA 3LDXH 1VGCB 2WPHS 2ZU2A 4F4OC 1C2GA 4YO9A 1OP8A 1YPJH 5K0HA 1C2IA 3ZZ3A 1F5LA 4K8BA 1IQKA 3T62A 1F2SE 1OKXA 2QF0A 3MNXA 1ANDA 4NWLA 5DKMA 5TCCA 1YPEH 1GI1A 2O8TA 3U98H 2BY8X 2H2ZA 1PQ8A 2ZCLP 2XW9A 3PLKA 1QCPA 1CHOG 1MCVA 1PYTD 2SGAA 3HPTB 4UFGH 4AFZA 2C8YB 3AAVA 2A31A 3S9CA 2EC9H 3BV9B 3V3MA 1YKTA 2Q6GA 5DGJA 3A80A 4D9QA 1YPLH 3VGCC 3U9AH 3SU6A 3EA8A 2Z9LA 1SFIA 1MCTA 1PPBH 3RXCA 1GI5A 3A8BA 1AE5A 3A7VA 1SGNE 1WV7H 1UTPA 3SNBA 4I8HA 2VVUA 1TPSA 2BM2A 3TGKE 1KXDA 5A8ZA 2FLBH 3MH7A 1DE7H 1EOLA 1HAVA 4ABBA 3TJVA 3EGKH 1PPZA 1TGBA 2JH0D 2FPZA 5F6MA 4VGCC 4ZUHA 2ASUB 1YBWA 1O0DH 1SFQB 3M61U 1HPGA 1O3DA 1ZRKA 2VJ1A 2XBWA 1T32A 2ZU5A 2FP7B 1WYKA 3PYHA 1QJ1B 1L1JA 4FUFA 1O3IA 3GY2A 2ZDKA 6GCHF 3QZRA 1O2YA 4UEHH 4SGBE 1D4PB 1WQVH 2BXUH 1ELFA 1JRTA 3LGIA 2VVCA 2CJIA 1X7AC 2J9NA 3SQEE 1TBRH 4XBBA 3LGYA 2M5TA 3CP7A 1RTKA 1SGDE 4ZAEA 4D76A 1O5EH 3GYLB 1W11U 4IGDA 4MTBA 4B75A 2ZECA 1BRBE 1GG6B 2GV7A 1V2ST 1ANCA 1LKBA 1G30B 4AG2A 3GOVB 3U69H 1GGDB 4H6TA 3A8CA 3SBKA 2VIDA 1AN1E 3KF2A 1EPTC 4IMZA 2OQUA 1GBHA 4O97A 1QURH 1GI3A 1QTFA 2FTLE 3GY8A 1PQAA 1XUJA 2PKSC 1BMNH 1GBMA 1AVXA 4ISOA 3OY6U 3TK9A 5IDKA 3M36A 3RXSA 4MPUA 1FZZA 1KXAA 2D8WA 3Q00A 1PYTC 3PWBA 1QY6A 1INCA 1GHWH 3NXPA 1B0FA 1XKBC 2Y82A 4X6PA 2ZO3H 1AGJA 1FNIA 3S9BA 2ESTE 5E2OA 1NC6A 2UUFB 3SJIA 3P92A 5GWZA 2ZTXA 3UREA 3ATIA 1MTUA 4X1RU 2AERH 4Y8XA 3QX5H 1DUEA 3RXRA 3SGAE 1AB9C 4CRAA 2FOAA 1UK4A 3AAUA 1AZZA 4AN7A 1O5GH 4CH2B 1O2WA 3VB5A 1O39A 4DOQA 3KQCA 2EI7A 1FJSA 1E0FD 1MAXA 3UY9A 1TQ0B 4H42U 3ZVFA 4CRFA 5DP6A 2P94A 5EGMA 1TBQH 3SZNA 4JZFH 4UFEH 4YLQH 4H4FA 4WJG2 1F5KU 2P8OB 1HLTH 2G5VA 1H9HE 1YPMH 2PLXA 1XM1A 4ISLA 1D6WA 1LVBA 3PMHB 1AUJA 3MO6A 4FUCA 4ABJA 1B7XB 3M5OA 4YZUA 2VIPA 1O36A 1TLDA 1IQGA 3ZVDA 4JZ1A 1C1VH 1CBWB 3A81A 1TNKA 4YT7H 1C4Y2 1O3EA 3BEFB 2XRCA 3URCA 2BHGA 4B1TA 1C5ZB 4IW4E 1P57B 3ZZCA 3N7OA 2A4GA 2BQ6B 2A5AA 1UHBB 1MAYA 4MPXA 1EZXC 2K1QA 8GCHF 1KLTA 1W14U 1P06A 1MKWK 1DANH 2ZQ2A 3HKJB 2ANWA 1MD7A 3QN7A 5FX5A 3UFAA 1WQSA 3BG8A 1XX9A 1QL8A 4O3UA 1CE5A 1GJ6A 2ZPSA 3RMOH 4X1SU 2O9QA 3SV9A 1UTJA 2BVSH 2HVXA 3GY3A 3KN2A 5EU8A 4IN1A 1D3PB 4WY3A 1ETSH 1SQOA 2WYGA 1EAWA 4ZH8A 1TONA 1A2CH 2R3UA 1C5PA 1GBJA 1GI0A 1LDTT 4FUDA 2ZHQH 4CBNA 2J2UA 4X2YA 4A5TS 1TX6A 4U2WA 3S7KB 4TWWA 4GAWA 4X6OA 2XYAA 2V6NA 3IG6B 3V7TA 1K2I1 1TBZH 5E0JA 4ZKNU 1JIMA 1GHVH 3O8CA 1AY6H 4JZDH 3SO3A 3MNBA 1C1OA 1HBTH 1S83A 4JYTA 4NIXA 2ZGJA 2IJOB 3A8AA 2F3CE 3TNTA 8GCHG 4AFSA 1GPZA 4B2BA 3RU4D 1ID5H 4NA9H 3LC3A 4DY7B 1ELGA 2OBOA 1YC0A 4IC6A 3SV7A 1GBEA 1H9LB 1SR5C 1OXGA 1KY9A 4IN2A 1L4DA 2FYQA 3ZYDA 2Y7ZA 2WUCA 1C2EA 1QFKH 1BZXE 5LPEA 1NRNH 1DFPA 1Y3YA 2P59A 3BG4B 3E16B 1HJAC 4NZQA 1BHXF 2ANYA 1O2UA 4THNH 1OSSA 1SGEE 1UVTH 4INKA 3U1IB 1NTPA 2ZG0H 1LHEH 4ZKOU 2TIOA 2HPPH 1V3XA 4AOQA 3KNXA 2FS9A 2NU4E
chains in the Genus database with same CATH superfamily
4WF8A 2THFB 1MQ5A 2PHBA 3R3GB 1FMGA 1FIWA 4J1YA 1HDTH 2QE7D 1P09A 1TNGA 1W0ZU 1YWUA 4GVUA 1WXRA 4ZKSU 2ZFFH 4KKDA 2ZCHP 1SSXA 3DUXH 2EI8A 1DWBH 2JETB 2QCYA 1OWDA 1O3NA 3E6PH 2A7JA 1VCWA 1V2MT 2IPHA 4U32A 2H5DA 4XSKU 3H7TA 3L3TA 1T4VH 1KTTB 4BNRA 2BDHA 4CH8B 1XUIA 2XWAA 3RXBA 1V2KT 2NWNA 1FDPA 2Y5HA 2ZFQH 4TWYA 1TX7A 1CGHA 1GCTC 1GJ4H 4ABFA 1LHFH 1GJ9B 1AO5A 2IJD1 2F9PA 2ZGXH 4NZLA 4U30A 1AUTC 3F9FA 3QGJA 3RXPA 2Z9JA 1HAXB 2OINA 1GI8B 1V2PT 4DT4A 3RXVA 1ELVA 4E7NA 2AGIX 1BMLA 3R0FA 3KHVA 5CDFE 4MNYA 1LPGB 2Q6FA 2VBCA 2UUJB 3RXJA 1OWJA 1GHAF 3FAOA 1JIRA 3IWMA 2BD5A 2B9LA 1F0TA 2BZAA 1PQ7A 4AZ2B 3LIWA 5L2ZH 1WTHD 2G81E 1DT2A 1MABB 5JDUB 1VJAU 2CHAC 2SGQE 1SVPA 1MD8A 1HYLA 4Y76A 2HPQH 3SNDA 5DJ7A 1ACBE 2J97A 3P8NA 3A89A 2YMSB 2BX3A 2K8IA 3A86A 4U01A 1JBUH 1G36A 3CS7A 3PMAB 1Y59T 1OYTH 1ZMJA 1W7XH 4M9FA 1UHBA 1W8BH 2C8XB 1YM0A 3MYWA 1GMCF 1O32A 1C5MD 2XC0A 1FI8A 1MTVA 1NFXA 1J16A 1ZHMA 3AW0A 1YLDA 1UTOA 2P93A 3F9GA 3U28C 3RM0H 1DSUA 3PV5A 1TNIA 1GJBB 5C1XA 3MOCA 1ZTLA 1YF4A 3A7ZA 5GPIB 5L2YH 1FIZA 2ZDLA 2Q1JA 1GVZA 4X8UH 2AIPA 5FPYA 2QF5A 3BG4C 1O30A 1BBRK 3SU2A 2J38A 3TGIE 2ZHEH 2G8TA 2PWXA 1GHAG 1AMHA 1S0QA 3GY6A 3VB6A 2V0BA 3NPSA 1BOQA 2V3MA 4K5ZA 1A46H 5EODA 1RFNA 3T27A 4YOGA 1W10U 2W7SA 4Y6DA 1TAWA 2Y81A 1KXBA 2BY7X 3LGUA 4K60A 4ZXYH 6CHAB 1BTWA 1UVUH 3LGTA 2JIZD 1G2MA 3VGCB 1AFEH 1HV7A 4ISHH 3RMLH 4HGCA 2QV1A 1SGYE 4I31A 4ABIA 1KXEA 2FOHA 2GCHF 5L30H 4NIWA 1P12E 4AFQA 4Z1MD 2H1UA 3RUOA 4KELA 3H09A 2JETC 2FWWA 1ZGIA 2SGEE 3MH5A 2Z6BD 3A7XA 2A4QA 2QAAA 4VGCB 1TIOA 9LPRA 1NZQH 3AK5A 2SGFE 4IS5A 5FL7D 5BPEA 2TGDA 1GBAA 1SLVB 1SG8B 3VB3A 2UUYA 2XNIA 1MKXH 6ESTA 2FESH 3TLOA 1LTOA 4D9RA 2JH6D 2VINA 5FX6A 3NKKA 1D3TB 1ELDE 1ZPBA 4O03A 3TITA 2PSXA 1K1PA 1CHGA 3GY4A 1RIWC 3SU3A 4A6LA 3ZZ8A 4FU8A 1C1QA 2J4IA 1BT7A 4ABDA 3RC6A 1NU7B 1WUNH 5ESTE 2A32A 1OOKB 3FZZA 1GJ7B 3PROA 2CGAA 1P03A 2ZU3A 4JZEH 1A0HB 1WAYB 1C2JA 3B9FH 3OU0A 3S69A 1BMMH 2AGGX 1EB2A 4MNXA 1EZQA 1Y8TA 2QC2A 8KME2 4WMDA 3RP2A 1C5QA 2VVVA 1ZLRA 4KTUA 4F49A 1EPTB 5C5OA 2A1DB 3ODFA 3KEEA 3SU4A 1K1MA 1UTMA 1GJ5H 1ANEA 3D65E 4LK4A 3H7OA 2Y5FA 2PKSB 5JYIA 2OC7A 1QBVH 2WYJA 5PTPA 1BUIA 4BAKB 1QB9A 5FCKA 2BB4A 3NZIA 3V12A 4X0WU 2IOTA 1MU8B 2R9PA 2FI4E 3RXGA 5J4QA 1G3EA 4KTCA 1ELEE 2O8WA 1WDIA 1OWEA 1XMNB 3MO9A 1TPPA 3ATLA 1UK2A 1O2MA 5FXLA 1FV9A 4JYVH 1AB9B 1OP2A 3D23A 1OX1A 3QGNB 3OFND 4RN6A 1HAIH 4B2AA 3O8DA 2RG3A 1H8IH 1TPOA 2ZFRH 3UTUH 1E1RD 3PTNA 2PR3A 2XBVA 1C1TA 1O2GH 1S6HA 2XOKD 4OGXA 4UONA 9ESTA 1G3BA 1TPAE 1S85A 3RXKA 5HYOA 1NBME 3LGWA 3E91A 4LOYH 2WV4A 1C4U2 4IBLH 1EUFA 2F91A 3RXTA 3DFLA 2ANKH 1HCGA 1FXYA 3EA9A 1V2QT 4B73A 1BTXA 1ANBA 1TGSZ 2C8WB 4DW2U 6CHAC 5AVDA 2BQWB 1IHSH 3MO3A 1C2LA 1LVMA 5A8XA 5AFYH 5F8ZA 1FLEE 1FPCH 1YPHC 4AGJA 2WINI 1EFRD 3TU7H 4D8NA 4NIYA 3N99A 4TY6A 1BHXB 1A5HA 1P02A 1RTLA 3FN8A 3MU8A 1W13U 3HGPA 1GMHF 4AYVB 3A82A 1QL7A 1O2QA 3KCGH 1TOMH 1P3EA 3SQHE 4OS5A 2FO9A 2SNWA 1ETRH 1HAGE 4I32A 4I86A 2G5NA 3ZVGA 5LGOA 1O2OA 3DSOA 1EP5A 1B5GH 4AG1A 2HGTH 2FEQH 4UD9H 5GIBA 3A8DA 2ANMH 4FOUC 1BRAA 1NFWA 3BTEE 4UE7H 1ZPZA 1UO6A 1EAUA 2GD4B 1RJXB 2HNTE 3UAIC 4AORA 3PV4A 1DY8A 1HAZB 2XXLA 4AGKA 2F9UA 2BQ7B 1VITH 2PP6A 1NROH 3EYDA 1V2WT 1O2HA 1O3LA 1K1LA 3ELAH 3RM2H 1C5NH 3ITIA 4X2WA 3T2NA 2AGEX 3PRBA 2C93B 3LOXA 4GCHF 3UNQA 1TYNA 4E7RG 4ISIH 1L1NA 1FAKH 1TFXA 1GDQA 4ACAA 2XBYA 1LVOA 3STIA 1WTGH 1E79D 5CHAC 1N6XA 3RC5A 1D6RA 2P3TB 2BD4A 2OC8A 5C3NA 1T8MA 2W6ID 3QWCH 1SI5H 1ZSLA 2CK3D 1XVMA 3B23B 3M3SA 3EQ0H 3RXHA 2I6QA 3M7TA 1GJCB 1U6QA 2TGAA 4Q7YA 1FN6A 1IQEA 2ZHWH 2BOKA 4NWKA 1Z71A 2RFKC 3OX7U 1TX8A 3U8RH 6GCHG 2BLWA 2YNAA 3MFJA 3RXMA 1O3JA 2GJGA 1C1NA 1TB6H 3UPEA 1SOTA 5EPYA 2PGBB 2FZZA 4RKOB 2GZ7A 3PM3A 1ZSKA 3KQ5A 3F2HA 2KCAA 2Q6DA 2ZKSA 2B8OH 1LQDB 1SGRE 4FUHA 5C67A 3GCNA 3EE0B 1RXPA 4GCHG 1H1BA 2UWPA 4KTSA 5EW1H 4ABHA 2ZIQH 4Z6AH 3RXQA 4DCDA 3DA9B 1NRSH 2XCFA 1KYNA 1BRUP 1HJAB 1O2PA 1LMWB 1O3PB 5KECA 4ABEA 3OTJE 3PMBB 5FBEA 4GLYA 1V2LT 4CHAC 3MU1A 3I29A 4M7GA 5HKKD 5LPRA 3OEHD 1O2TA 1QL9A 2A4RA 1AE8H 3ZVCA 4B71A 1EPTA 2M2AA 1ZHRA 2A5KA 1NPMA 1QZ8A 1O2IA 3QTOH 1DOJA 1KTSB 3FFGA 3A83A 4BXWA 3GDVA 1UCYK 1P01A 4XBDA 1DICA 3LJJA 3UWIA 1SGFG 1NFYA 2OBQA 1ZJKA 4MG3A 1IHTH 2FIRH 2Z3CA 5JBBS 1VZQH 5EXLA 1T31A 2BTCE 2QYIA 1GVKB 2PTCE 4DIIH 2I6SA 2A7HA 1HJ9A 5EQRA 4UFFH 1AFQC 1H9IE 2ODQA 1EATA 2GDDA 3E0NB 4OS4A 2NU2E 4WXIA 1THPB 3VB7A 3KQBA 4FUBA 1E36B 3A87A 4OS7A 1P2MA 1NRRH 1EKBB 2AS9A 2OC1A 3A7YA 4JMYA 2VB0A 1ARBA 3URDA 2C3SA 2ZGHA 4KGAA 3HK3B 2QXJA 4DVAU 3U1JB 3OTPA 1C5XB 1VJ9U 3TVJB 4NFEA 5CE1A 1TMBH 1ORFA 1KLJH 4XDEA 1K1NA 1GCTB 4CRBA 3RXFA 2Y5GA 3A84A 1C5OH 1FPHH 4FVBA 3Q76A 4FXGH 1FQ3A 3EAJA 3OEED 3KL6A 2H9EH 2ZHFH 2WPIS 4XBCA 3JZ1B 5IYTA 1QA7A 4BAHB 1ESBA 3ZVAA 1DDJA 1CSOE 4YT6H 3ZZDA 2GV6A 1RS0A 1EXFA 4Y7AA 5C17A 1NESE 1ZOMA 3F3BA 1G2LA 2BXTH 4NCYA 5DPAA 1GDNA 3GCOA 1XUGA 3PWCA 3QTVH 1AVGH 3E8LA 1MBMA 2CHAB 8LPRA 1A4WH 3DHKH 2GZ9A 2W3IA 5C1YA 4B74A 1C5UA 4WH6A 3PO1C 2GMTB 1ARCA 4ZCNA 1E38B 3P8OA 1YCPK 1QHRB 1C5VA 4F48B 1BA8B 1L4ZA 1C9TA 1S6FA 3UUZA 4BTTB 3GISB 1O3KA 5G4BA 1SC8U 1XUFA 2BLQA 4K3JA 4OS2A 3W95A 3BTWE 3BSQA 1DXPA 1HAYB 2GX4A 2VH0A 3I77A 5E8EH 3PLBA 4DJZB 2ZHDA 3K6YA 3N7DA 3SN8A 2B0FA 3S7HB 1NY22 3RDZA 5A8YA 1NS3A 3K65B 2FOGA 3N7EA 4ZHAA 3OSYA 3T26A 1MKWH 3QZQA 2GCTB 1HFDA 3HATH 3OY5U 3GYMA 1AQ7A 4K2YA 2PV9B 2WZQA 2ZA5A 2O8MA 1W12U 1MQ6A 1QRWA 3NWUA 4OS6A 1TNLA 1O2NA 2BD2A 1TALA 1Y5BT 2KFWA 2FOBA 2JKHA 2BMGB 3KIDU 4X1QU 3GICB 2QXIA 3L33A 4I8KA 7KMEH 5ESBA 1Z6EA 5HGGA 1FN8A 4Q7XA 5AFZH 3VXEH 1MMJN 1EP6A 2AMPA 5GDSH 2AEIH 5EXMA 1P8VC 3O8BA 1P04A 2R2WU 3KQDA 1RD3B 2QY0B 2QXGA 3TH2H 1BDAA 2V35A 4JZIA 1O3CA 1O5CB 1EX3A 4I8LA 2ZU1A 4YM9A 3MU4A 4XD7D 1J17T 1BMFD 3QO6A 2GTBA 1SGTA 3LGVA 1E37B 1HAHH 1V2NT 5F8TA 1QA0A 1K1JA 3ESTA 4BANB 1QQ4A 3PV2A 2W5EA 1EQ9A 4ASUD 2Z9KA 1GBDA 2FOCA 3Q3KA 2BZ6H 1XVOA 1QBNA 4UDWH 1MBQA 4BAQB 1ETTH 3Q3YA 4NGAH 1RIWB 3GCHC 1GDUA 4BAOB 1V2OT 1SGPE 1T8OA 4HZHA 1K28D 1C1RA 1XKAC 1GMDF 1TOCB 2VU8E 2J94A 2O8LA 4NA7A 1QR3E 3UOPA 5C2ZA 1K22H 1HRTH 2ULLA 1C1SA 1BBRE 1UJ1A 2BDIA 3P70B 3T5FH 2RDEA 1GCDA 1ABIH 1P9UA 4RT1A 1AKSB 1ZMLA 2OP9A 1O2XA 4NG9H 3DT0H 3QK1A 5A0BA 2Y80A 3D49H 4SGAE 1DWEH 4HI3A 1H8HD 1P2JA 2AMDA 3FP6E 2GMTC 3OAAD 2FTMA 3F6UH 1NBMD 3M7UA 3RMNH 1N1LA 2KAIB 2CN0H 3BIUH 1B0EA 1MUEB 3DCLA 2OC0A 2FOMB 1IQFA 4FUGA 1LKAA 2J98A 4Q63A 4RSPA 2J92A 2F9VA 3NCLA 4K1SA 3P8FA 3SUEA 5C5NA 3SYJA 1P2QA 1TE0A 3RXUA 1PQ5A 1GMDG 4NA8A 5EW2H 4AB8A 1UTKA 4TPIZ 3L6PA 1LHCH 2ZF0H 1EJMA 5C1UA 4JYUH 2FX6A 3CENA 1TABE 1ZPCA 2ZZUH 4BTIB 2J95A 2GCTC 2H9HA 1P2OA 1Y5AT 5GNDA 2VIWA 1O2KA 1TRMA 1JOUB 2L6OA 3NUMA 2LNCA 2QF3A 4AC9A 3VXFH 3GDSA 1BTPA 5DP5A 4ZKRU 2O8UA 3ATWA 1Z8RA 1SGIB 2FXRA 2R3YA 4MLFB 3SW2B 1E34B 1GL1A 1D9IA 4UFDH 2OK5A 1DLEA 2WPLS 1FY8E 1QB1A 2B5TB 3RLYH 1PPGE 4DIHH 1CA0C 2XBXA 3BF6H 5DK1A 2D2DA 1AZ8A 1TRYA 4ASHA 1GMCG 1UVSH 3RU4E 1UTNA 1QRZA 1MTSA 2JH5D 2AH4X 1O3GA 1PPCE 3V0XA 2F83A 5GXPA 1S84A 3SJOA 1C5RA 1XXDA 1YLNA 1SLWB 3ZV8A 1IQHA 2W26A 3RLWH 2ZFSA 1O3FA 1K1OA 3TJUA 1IOEA 1A5GH 1C2HA 1M9UA 2V7QD 3W1EA 3E3TA 3TJOA 1O2JA 2G55A 5CMXH 4H6SB 1QIXB 2XWBI 1S0RA 4XFQA 2F43B 2TRMA 3LU9B 1CT0E 3BTFE 3T28A 2PGQB 2GT7A 1K21H 3A7TA 2EEKA 5DG6A 3CNRA 2TPIZ 2BDAA 1SBWA 2ZCKP 1GWAA 1F92A 2FOEA 1UVOA 2ZEBA 5A2MH 1GBCA 3BTQE 2ZWLH 1SGQE 4ISNA 2OTVA 1BBRH 2A4OA 1J14A 3ZZBA 3DSGA 2A45B 4HTCH 1OWHA 2GCHG 2OLGA 1OHHD 1EAXA 2WPMS 1FY4A 1PPFE 1BTUA 2BDYA 2VIOA 2VNTA 4PROA 1ELCA 2CMYA 3BEIB 5CHAB 1VR1H 2FI5E 1LQEA 4R8TB 1ZSJA 1FAXA 3ZZ4A 1KIGH 1P10A 1HUTH 1UTQA 2KX4A 3SU0A 2GP9B 1VITF 3AASA 1H8DH 2FLRH 1EASA 3SI3H 1HNEE 4K1EA 1YPKH 4FU7A 1P05A 5GCHF 4ZHLU 3VFEA 3FP8E 3M7QA 3LPRA 1Y3XA 1TQ7B 2Z3EA 1NRQH 4MQAA 4YOIA 1ABJH 3M3TA 5DP4A 4Y79A 2ZP0H 1GI7B 4Y0ZE 4DGJA 2WPJS 1AVWA 1O3AA 2XTTB 3MH6A 3SNCA 3SU1A 2Z7FE 2R0KA 3RC4A 2W7UA 7ESTE 2VGCB 3UR6A 2ZGCA 2R2MB 1P2KA 2WPKS 3M5NA 1ZYOA 4MNVA 3U8OH 4CRGA 1O5BB 2RA0A 3UNSA 1H4WA 3KGPA 5FBIA 3RXIA 4CREA 1CA8B 4A1VA 3VG8A 3D62A 1F5RA 1ESAA 3MHWU 2CXVA 4X8VH 1Y5UT 3A85A 4FU9A 5DP7A 2BOHB 4X1NU 2D1JA 4CHAB 1AKSA 3BTGE 4DT7B 4Q4LA 1TGTA 2HLCA 3MNSA 4MDSA 3TGJE 1ZMNA 1GI9B 1VITG 7GCHF 3SU5A 1GJAB 2UWLA 5JB8S 5JBAS 3ZV9A 1OYQA 4YOJA 3JZ2B 4NSVA 4DURA 1RGQA 1A1RA 5GCHG 1HAOH 3E0PB 1SLUB 1ELBA 1NT1A 1SHHB 1LHGH 1RTFB 2C8ZB 4A7IB 2QN5T 1SQRA 4E05H 1NRPH 1MH0A 4YESB 3WWBA 4A1XA 2YOLA 4DG4A 1EJAA 3M5LA 3W94A 2KAIA 2BVXH 3SJKA 2BLOA 2A2QH 1GI6A 2PKAA 4LXBH 3TIUA 2NU1E 2PSYA 2DUCA 3BEUA 4NFFA 1AFQB 1AWFH 1O5DH 3OE7D 1SPJA 2ALPA 1DUAA 3P95A 3HK6B 2G51A 1MTWA 3SUDA 1P9SA 1BJVA 2Y7XA 3SZEA 3VEQB 1Z1IA 2ZQ1A 4YXWD 1T8LA 2ZC9H 3UWJH 1Z7KA 1V2VT 3WW7A 1O33A 1P2IA 4GUXA 3H5CB 1F0RA 1O2RA 4MPVA 4CR9A 4P02A 1LO6A 2A5IA 1DVAH 2UWOA 3NK8A 3LONA 4TYDA 2ODYB 2Y6TA 5AF9H 3P17H 1G32B 1C1PA 1UMAH 4OS1A 3QLPH 7GCHG 1SGFA 4LZ1H 2F9BH 1Q2WA 2WSSD 4NIVA 2EY4C 5JBCS 3RMMH 4CRCA 4Q2KA 1O3OA 1WU1A 2RCEA 2OD3B 1SQAA 1BIOA 3EDXB 1IQIA 3MNCA 5T6GA 5LH8A 4BOHA 1GMHG 4X8TH 2HNTF 4RT0A 1HIAB 4B2CA 1CVWH 2BVRH 1HXFH 4I7YH 1XUKA 2A7CA 5L6NH 1DPOA 1O2SA 5EG4A 1V2UT 3SUFA 4JCNA 4X1PU 1P2NA 3SHCH 4Y8YA 5IK2D 4B6FA 2BD7A 4MNWA 3PO1B 4AX9H 1UCYE 3MWIU 2BY6X 2J5UA 3ZZAA 3MMGA 4INHA 4ACBA 1DXWA 2HALA 1HB0B 2KM0A 6LPRA 3SUGA 1QQUA 4FUJA 1UW7A 1VCPA 1FONA 4MPWA 2P16A 1EZSC 1F0SA 3BTTE 3RXOA 1GBIA 1YGCH 2VGCC 1YPHE 1AHTH 1HAPH 5JBTA 3SHAH 2XC5A 3M37A 2RDLA 1T7CA 1CT2E 1A3BH 1AU8A 5HXFA 1THRH 5EXNA 2STBE 1MTNB 3C27B 2OQ5A 1WOFA 3FANA 2AYWA 3SGBE 3KQEA 1VGCC 1WSSH 4AFUA 2K0QA 4WH8A 4I8JA 1Y3UA 5EOKA 1SKYE 2W6JD 1ZZZA 1C2KA 1E1QD 1F7ZA 1GI2A 3FKSD 1Z8JB 4TPYA 1P3CA 2VWOA 2XCNA 3F9HA 3Q77A 3AVZA 3UOUA 1D3QB 1SLXB 1TRNA 5EQQA 1V6DA 1QB6A 4MVNA 4AYYB 3MH4A 3WY8A 1O38A 4A1TA 2GZ8A 3DFJA 2J34A 1O31A 1QBOA 3UQVA 1J8AA 2VWNA 1O5FH 1YCPM 1TNJA 5HMAA 1IQMA 1C1MA 1BRCE 3SNAA 3K6ZA 3ZYEA 5F53A 2BDBA 1JMOH 3TK6A 4TT3D 1ZRBA 2TGPZ 1SOZA 4ESTE 1C2DA 4FVDA 1PPHE 5DP9A 1SB1H 1GBTA 1YLCA 5C20A 4D7FA 2KZ4A 1LCYA 1DSTA 2SNVA 1NO9H 2R0LA 3PTBA 1BB0B 1W2KH 1S82A 1K0HA 2J98B 1TNHA 4LZ4B 2IN2A 2D26C 3RXDA 1CGJE 1SGCA 3TH4H 2GDEH 4CBOA 4WXVA 3GCHB 5ABWA 1A5IA 5HM9A 3RXLA 1UTLM 2F9OA 1KDQB 3TK5A 1C5YB 1V2JT 4R0IA 1O3HA 4XE4A 1C2MA 2WUBA 5T6FA 3TPIZ 3G01A 1C5SA 5AHGH 1S6LA 7LPRA 2VIVA 3MU0A 3ZVBA 2JJ2D 1SQTA 2KCYA 3SORA 1MZDA 2ZDVH 1MZAA 1ZJDA 2ZFTA 3ZZ7A 2CV3A 2ZTYA 8ESTE 5FHTA 1DLKB 3ODDA 4GHQA 3FVFB 1O2ZA 1ZTKA 2RA3A 1K1IA 3GY5A 1DITH 1GG6C 1EJNA 2QA9E 3M3VA 2OCVB 2BY5X 1YYY1 3LKWA 1FY5A 4GHTA 1WBGB 1W0JD 2FX4A 1UCYH 1TMUH 2H5CA 4E06H 2SFAA 5EPNA 1AWHB 2WV5A 1C5WB 1GGDC 1O3BA 3C1KA 3BIVH 3E90B 3K2UA 3F9EA 1O5AB 3LC5A 1ZR0A 3ATMA 2Z3DA 1Q3XA 4KP0A 2A2XH 1UK3A 5EQSA 1G37A 4WMEA 2VWLA 1YP9A 1Q31A 4J2YB 4X8SH 2FS8A 4K69A 3SNEA 4NSYA 5F8XA 1GL0E 2FM2A 4Y71A 5HIYA 4K1TA 3TNSA 4WWYA 1C5LH 3I78A 2PTNA 1GI4A 2DE8A 1O2VA 1MTNC 1EZUC 2WHXA 3KYGA 1NU9A 4YLUA 1KXFA 1UVPA 1MU6B 1ZTJA 2YNBA 2FYRA 2WV9A 2NU3E 2HWLB 1CT4E 3E1XB 3BTME 1VCQA 1G3CA 1SMFE 5T3HA 1HIAA 2ZFPH 1ZGVA 1TA6A 2Z9GA 4ZMAH 2PUXB 1W0YH 1E35B 2F4LA 4Z0KA 1AD8H 1T8NA 4TY7A 3P6ZB 1GHBF 1SL3A 1CA0B 1Z8IB 5B6OA 3U8TH 2FOFA 2FDAA 1J9CH 2P8OC 2P95A 3MTYA 2GKVE 4K8YA 5E2PA 5A09A 1KLIH 4Y0YE 1HJ8A 2KR7A 2W3KA 2ZPQA 1NM6A 5A0CA 3ENSB 4I8GA 1K9OE 1ELTA 1C1UH 2EI6A 1OWKA 5TJXA 3UIRA 1QJ7B 4Y11E 1YPGH 3TJNA 5BRRE 1OS8A 1C9PA 1CBWC 3MI4A 1C2FA 1YCPH 2BX4A 1O3MA 3BTHE 2ALVA 2PW8H 4FETA 4B76A 1A61H 1F0UA 1S81A 4HFPB 5E0GA 1Z1JA 3CS0A 5T1VA 1L1GA 2QIQA 1BTZA 1GHXH 1A0LA 1IQLA 1KSNA 1Z8GA 2G00A 1COWD 1IAUA 2P3UB 1JRSA 1T4UH 2BD9A 3FO8D 1GHBG 4CRDA 2UUKB 1OP0A 4Q80A 3ATKA 4OGYA 1XXFA 2LPRA 5H4IB 3TH3H 3A88A 4D7GA 4IMQA 5T6DA 2QGRA 3ZIAD 2G4TA 1DX5M 1JXPA 1TGCA 4GSOA 4FUEA 1NFUA 3PLPA 1DWDH 1TGNA 1C1WH 4RKJB 1AIXH 3UNRA 3VB4A 3HKIB 2ZNKH 3RXAA 2OUAA 1P0SH 1HGTH 2Z9IA 5ETXA 3ZZ6A 2AFQB 1BTYA 1C4V2 3OYPA 2G4UA 4O9VA 1EOJA 1AI8H 3M5MA 1CGIE 5EJ1A 1DM4B 1KXCA 2PKAB 2ZDNA 1O35A 2EQNA 2XNDD 1CQQA 3KYFA 1GBKA 4ABGA 1A0JA 1IQNA 3QUMP 1QJ6B 4ZHMU 1GJDB 2VH6A 2V3OH 2CF9H 1DY9A 3STJA 3T25A 3F68H 3BTKE 1BMAA 1THSH 2FMJA 1GBFA 4ZROA 1BCUH 1ESTA 1N6YA 4BXSA 2BD8A 1KDQA 3K9XB 4XOJA 3AW1A 5TCAA 4FUIA 4QT8C 1MKXK 2PUQH 1HAVB 3T29A 4I33A 2CF8H 5DP8A 1N8OB 3S9AA 4X6NA 5E0HA 1VKYA 2JJ1D 2LELA 2FODA 1PPEE 1TWXB 3SJ8A 2C90B 4F55A 2H6MA 2AMQA 1W3CA 3SGQE 1A7SA 2A0QB 2HOBA 2SGDE 3WWFA 3LH3A 4X6MA 2F9NA 2L74A 1TA2A 2VIQA 3UR9A 5F03A 2FI3E 2YMSD 3LT3A 4X2VA 3ZZ5A 2ZGBH 1QRXA 3Q3XA 2GGVB 2ZDMA 2ZTZA 3QDZB 2GVFA 3V13A 4IC5A 1D3DB 1V2TT 4GPGA 3S0NA 5K7RA 1CO7E 3SV6A 1O34A 1G9IE 2V3HH 1TMTH 1EAIA 4BTUB 2TBSA 3FZDA 2ZPRA 2HRVA 5KGOA 1GHZA 1O37A 5B6LA 2GT8A 1OWIA 2BYAX 3F2GA 3FP7E 1LVYA 3MU5A 2ZDAH 1LPZB 2ZI2H 2H9TH 1LPKB 4JK5A 1PJPA 2STAE 3BTDE 1BJUA 1L0ZA 3RU4T 3SV8A 1Y3WA 2BD3A 3F1SB 4JK6A 3VPKA 1LHDH 3BN9A 5A0AE 1S5SA 1RRKA 4CR5A 5FPSA 3ZZ9A 2ZU4A 4O3TA 1W7GH 2PFEA 4Q7ZA 1O2LA 1Z6JH 3LJOA 3M35A 1JWTA 1HXEH 4P00A 4BAMB 4Y7BA 1FY1A 1P11E 3PMJA 1SHYA 2BLVA 5JPMH 3F0OA 1GHYH 3GS9A 3GCTF 4ABAA 2BDGA 1BTHH 2EA3A 5FAHA 1L2EA 1ZHPA 3SOSA 5DO4H 1GBBA 2SGPE 5JB9S 1XUHA 1GJ8B 3IITA 4WMFA 2QXHA 1FUJA 3DD2H 4Y8ZA 5GJ4B 3PB1E 2Z94A 1PFXC 2B7DH 2BDCA 4OM9A 5HM2A 1DWCH 1BQYA 5I25A 3B8JA 2BY9X 3SJ9A 1V2RT 3EA7A 2AIQA 5FCRA 5FPTA 1A3EH 1NN6A 2NU0E 5SGAE 3HGNA 1ELAA 1EB1H 2OXSA 2P3FH 3GDUA 4AB9A 3UQOA 5J4SA 1BITA 1OPHB 4X2XA 5DP3A 4INLA 3O8RA 2DE9A 1CHOF 2ILNA 1CU1A 1W0KD 2ODPA 2HNTC 1J15A 2YMSC 1GBLA 3RXEA 2TGTA 1FX0B 1FY3A 3A7WA 4ZXXH 3SI4H 1GVLA 4YTAA 5LPFA 3UB0A 2G52A 3GCTG 3SV2H 1DS2E 3P8GA 4WVPE 4A92A 3LH1A 1QGFA 3ZVEA 1C5TA 3GY7A 2AHME 1G3DA 3DSPA 4Y10E 2C4FH 2VWMA 1N8OC 1QNJA 5I46H 1IQJA 1Y3VA 2XC4A 1WCZA 3LDXH 1VGCB 5DN6D 2WPHS 2ZU2A 4F4OC 1C2GA 4YO9A 2JDID 1OP8A 1YPJH 5K0HA 1C2IA 3ZZ3A 1F5LA 3NRLA 4K8BA 2HLDD 1IQKA 3T62A 1F2SE 1OKXA 2QF0A 3MNXA 1ANDA 4NWLA 5DKMA 5TCCA 1YPEH 1GI1A 2O8TA 3U98H 2BY8X 2H2ZA 1PQ8A 2ZCLP 2XW9A 3PLKA 1QCPA 1CHOG 1MCVA 1PYTD 2SGAA 5C0TA 5EIYA 3HPTB 4UFGH 4AFZA 2C8YB 3AAVA 2A31A 3S9CA 2EC9H 3BV9B 3V3MA 1YKTA 2Q6GA 5DGJA 3A80A 4D9QA 1YPLH 3VGCC 3U9AH 3SU6A 3EA8A 2Z9LA 1SFIA 1MCTA 1PPBH 3RXCA 1GI5A 3A8BA 1AE5A 3A7VA 1SGNE 1WV7H 1UTPA 3SNBA 5KEDA 4I8HA 2VVUA 1TPSA 2BM2A 3TGKE 1KXDA 5A8ZA 2FLBH 3MH7A 1DE7H 1EOLA 1HAVA 3EE7A 4ABBA 3TJVA 3EGKH 1PPZA 1TGBA 2JH0D 2FPZA 5F6MA 2KCPA 4VGCC 4ZUHA 2ASUB 1YBWA 1O0DH 1SFQB 3M61U 1HPGA 1O3DA 1ZRKA 2VJ1A 2XBWA 1T32A 2ZU5A 2FP7B 1WYKA 3PYHA 1QJ1B 1L1JA 4FUFA 1O3IA 3GY2A 2ZDKA 6GCHF 3QZRA 1O2YA 4UEHH 4SGBE 1D4PB 1WQVH 2BXUH 1ELFA 1JRTA 3LGIA 2VVCA 2CJIA 1X7AC 2J9NA 3FOAA 3SQEE 1TBRH 4XBBA 3LGYA 2M5TA 3CP7A 1RTKA 1SGDE 4ZAEA 4D76A 1O5EH 2HVYB 3GYLB 5HIZA 1W11U 4IGDA 4MTBA 4B75A 2ZECA 1BRBE 1GG6B 2GV7A 1V2ST 4TSFD 1ANCA 1LKBA 1G30B 3MQKC 4AG2A 3GOVB 4HG6A 3U69H 1GGDB 4H6TA 3A8CA 3SBKA 2VIDA 1AN1E 3KF2A 1EPTC 4IMZA 2OQUA 1GBHA 4O97A 1QURH 1GI3A 1QTFA 2FTLE 3GY8A 1PQAA 1XUJA 2PKSC 1BMNH 1GBMA 1AVXA 4ISOA 3OY6U 3TK9A 5IDKA 3M36A 3RXSA 4MPUA 1FZZA 1KXAA 2D8WA 3Q00A 1PYTC 3PWBA 1QY6A 1INCA 1GHWH 3NXPA 1B0FA 1XKBC 2Y82A 4X6PA 2ZO3H 1AGJA 1FNIA 3S9BA 2ESTE 5E2OA 1NC6A 2UUFB 3SJIA 3P92A 5GWZA 2ZTXA 3UREA 3ATIA 1MTUA 4X1RU 2AERH 4Y8XA 3QX5H 1DUEA 3RXRA 3SGAE 1AB9C 4CRAA 2FOAA 1UK4A 3AAUA 1AZZA 4AN7A 1O5GH 4CH2B 1KMHB 1O2WA 3VB5A 1O39A 4DOQA 3KQCA 2EI7A 1FJSA 1E0FD 1MAXA 3UY9A 1TQ0B 4H42U 3ZVFA 4CRFA 5DP6A 2P94A 3F0PA 1TBQH 5EGMA 3SZNA 4JZFH 4UFEH 5C0UA 4B6EA 4YLQH 4H4FA 4WJG2 1F5KU 2P8OB 1HLTH 2G5VA 1H9HE 1YPMH 2PLXA 1XM1A 4ISLA 1D6WA 1LVBA 3PMHB 1AUJA 3MO6A 4FUCA 4ABJA 1B7XB 3M5OA 4YZUA 2VIPA 1O36A 1TLDA 1IQGA 3ZVDA 4JZ1A 2WPDD 1C1VH 1CBWB 3A81A 1TNKA 4YT7H 1C4Y2 1O3EA 3BEFB 4RI0A 2XRCA 3URCA 2BHGA 4B1TA 1C5ZB 4IW4E 1P57B 3ZZCA 3N7OA 2A4GA 2BQ6B 2A5AA 1UHBB 5DSFA 1MAYA 4MPXA 1EZXC 2K1QA 8GCHF 1KLTA 1W14U 1P06A 1MKWK 1DANH 2ZQ2A 3HKJB 2ANWA 1MD7A 3QN7A 5FX5A 3UFAA 1WQSA 3BG8A 1XX9A 1QL8A 4O3UA 1CE5A 1GJ6A 4XRNA 2IPQX 2ZPSA 4X1SU 2O9QA 3RMOH 3SV9A 1UTJA 2BVSH 2HVXA 3GY3A 3KN2A 5EU8A 4IN1A 1D3PB 4WY3A 1ETSH 1SQOA 2WYGA 1EAWA 4ZH8A 1TONA 1A2CH 2R3UA 1C5PA 1GBJA 1GI0A 1YY3A 1LDTT 4FUDA 2ZHQH 4CBNA 2J2UA 4X2YA 4A5TS 1TX6A 4U2WA 3S7KB 4TWWA 4GAWA 4X6OA 2XYAA 2V6NA 3IG6B 3V7TA 1K2I1 1TBZH 5E0JA 4ZKNU 1JIMA 5CHBA 1GHVH 3O8CA 2KCOA 1AY6H 4JZDH 3SO3A 3MNBA 1H8ED 1C1OA 1HBTH 1S83A 4JYTA 4NIXA 2ZGJA 2IJOB 3A8AA 2F3CE 3TNTA 8GCHG 4AFSA 1GPZA 4B2BA 3RU4D 1ID5H 4NA9H 3LC3A 4DY7B 1ELGA 2OBOA 1YC0A 3PRDA 2QF4A 4IC6A 3SV7A 1GBEA 1H9LB 1SR5C 1OXGA 1KY9A 4IN2A 5EJLA 1L4DA 2FYQA 3ZYDA 2Y7ZA 2WUCA 1C2EA 1QFKH 1BZXE 5LPEA 1NRNH 1DFPA 1Y3YA 2LP6A 2P59A 3BG4B 3E16B 1HJAC 4NZQA 1BHXF 2ANYA 1O2UA 4THNH 1OSSA 1SGEE 1UVTH 4INKA 3U1IB 5EJZA 1NTPA 5C94A 2ZG0H 1LHEH 4ZKOU 2TIOA 3F2FA 2HPPH 1V3XA 4AOQA 3KNXA 2FS9A 2NU4E
chains in the Genus database with same CATH topology
4WF8A 2THFB 1MQ5A 2PHBA 3R3GB 1FMGA 1FIWA 4J1YA 1HDTH 1P09A 1TNGA 1W0ZU 4GVUA 4ZKSU 2ZFFH 4KKDA 2ZCHP 1SSXA 3DUXH 2EI8A 1DWBH 2JETB 2QCYA 1OWDA 1O3NA 3E6PH 2A7JA 1VCWA 1V2MT 2IPHA 4U32A 2H5DA 4XSKU 3H7TA 3L3TA 1T4VH 1KTTB 4BNRA 2BDHA 4CH8B 1XUIA 2XWAA 3RXBA 1V2KT 2NWNA 1FDPA 2Y5HA 2ZFQH 4TWYA 1TX7A 1CGHA 1GCTC 1GJ4H 4ABFA 1LHFH 1GJ9B 1AO5A 2ZGXH 2F9PA 4NZLA 4U30A 1AUTC 3F9FA 3QGJA 3RXPA 2Z9JA 1HAXB 2OINA 1GI8B 1V2PT 3RXVA 1ELVA 4E7NA 2AGIX 1BMLA 3R0FA 3KHVA 4MNYA 1LPGB 2Q6FA 2UUJB 3RXJA 1OWJA 1GHAF 3FAOA 1JIRA 3IWMA 2BD5A 2B9LA 1F0TA 2BZAA 1PQ7A 4AZ2B 3LIWA 5L2ZH 1WTHD 2G81E 1DT2A 5JDUB 1VJAU 2CHAC 2SGQE 1SVPA 1MD8A 1HYLA 4Y76A 2HPQH 3SNDA 5DJ7A 1ACBE 3P8NA 3A89A 2BX3A 4U01A 3A86A 1JBUH 1G36A 3CS7A 3PMAB 1Y59T 1OYTH 1ZMJA 1W7XH 1UHBA 1W8BH 2C8XB 1YM0A 3MYWA 1GMCF 1O32A 1C5MD 2XC0A 1FI8A 1MTVA 1NFXA 1J16A 1ZHMA 3AW0A 1YLDA 1UTOA 2P93A 3F9GA 3RM0H 1DSUA 1TNIA 1GJBB 5C1XA 3MOCA 1ZTLA 1YF4A 3A7ZA 5GPIB 5L2YH 1FIZA 2ZDLA 2Q1JA 1GVZA 4X8UH 2AIPA 5FPYA 3BG4C 1O30A 1BBRK 3SU2A 2J38A 3TGIE 2ZHEH 2G8TA 2PWXA 1GHAG 1AMHA 1S0QA 3GY6A 3VB6A 2V0BA 3NPSA 1BOQA 4K5ZA 1A46H 5EODA 1RFNA 3T27A 4YOGA 1W10U 2W7SA 4Y6DA 1TAWA 2Y81A 1KXBA 2BY7X 3LGUA 4K60A 4ZXYH 6CHAB 1BTWA 1UVUH 3LGTA 1G2MA 3VGCB 1AFEH 1HV7A 4ISHH 3RMLH 4HGCA 2QV1A 1SGYE 4I31A 4ABIA 1KXEA 2FOHA 2GCHF 5L30H 4NIWA 1P12E 4AFQA 2H1UA 3RUOA 4KELA 2JETC 2FWWA 1ZGIA 2SGEE 3MH5A 2Z6BD 3A7XA 2A4QA 2QAAA 4VGCB 1TIOA 9LPRA 1NZQH 2SGFE 4IS5A 5BPEA 2TGDA 1GBAA 1SLVB 1SG8B 3VB3A 2UUYA 2XNIA 1MKXH 6ESTA 2FESH 3TLOA 1LTOA 4D9RA 2JH6D 2VINA 5FX6A 3NKKA 1D3TB 1ELDE 1ZPBA 4O03A 3TITA 2PSXA 1K1PA 1CHGA 3GY4A 1RIWC 3SU3A 4A6LA 3ZZ8A 4FU8A 1C1QA 2J4IA 1BT7A 4ABDA 3RC6A 1NU7B 1WUNH 5ESTE 2A32A 1OOKB 3FZZA 1GJ7B 3PROA 2CGAA 1P03A 2ZU3A 4JZEH 1A0HB 1WAYB 1C2JA 3B9FH 3OU0A 3S69A 1BMMH 2AGGX 1EB2A 4MNXA 1EZQA 1Y8TA 2QC2A 8KME2 4WMDA 3RP2A 1C5QA 2VVVA 1ZLRA 4KTUA 4F49A 1EPTB 5C5OA 2A1DB 3ODFA 3KEEA 3SU4A 1K1MA 1UTMA 1GJ5H 1ANEA 3D65E 4LK4A 3H7OA 2Y5FA 2PKSB 5JYIA 2OC7A 1QBVH 2WYJA 5PTPA 1BUIA 4BAKB 1QB9A 5FCKA 2BB4A 3NZIA 3V12A 4X0WU 2IOTA 1MU8B 2R9PA 2FI4E 3RXGA 5J4QA 1G3EA 4KTCA 1ELEE 2O8WA 1OWEA 1XMNB 3MO9A 1TPPA 3ATLA 1UK2A 1O2MA 5FXLA 1FV9A 4JYVH 1AB9B 1OP2A 3D23A 1OX1A 3QGNB 4RN6A 1HAIH 4B2AA 3O8DA 2RG3A 1H8IH 1TPOA 2ZFRH 3UTUH 3PTNA 2PR3A 2XBVA 1C1TA 1O2GH 1S6HA 4OGXA 4UONA 9ESTA 1G3BA 1TPAE 1S85A 3RXKA 5HYOA 3LGWA 3E91A 4LOYH 2WV4A 1C4U2 4IBLH 1EUFA 2F91A 3RXTA 3DFLA 2ANKH 1HCGA 1FXYA 3EA9A 1V2QT 4B73A 1BTXA 1ANBA 1TGSZ 2C8WB 4DW2U 6CHAC 5AVDA 2BQWB 1IHSH 3MO3A 1C2LA 1LVMA 5A8XA 5AFYH 5F8ZA 1FLEE 1FPCH 1YPHC 4AGJA 2WINI 3TU7H 4D8NA 4NIYA 4TY6A 1BHXB 1A5HA 1P02A 1RTLA 3MU8A 1W13U 3HGPA 1GMHF 4AYVB 3A82A 1QL7A 1O2QA 3KCGH 1TOMH 1P3EA 3SQHE 4OS5A 2FO9A 2SNWA 1ETRH 1HAGE 4I32A 2G5NA 3ZVGA 5LGOA 1O2OA 1EP5A 1B5GH 4AG1A 2HGTH 2FEQH 4UD9H 5GIBA 3A8DA 2ANMH 1BRAA 1NFWA 3BTEE 4UE7H 1ZPZA 1UO6A 1EAUA 2GD4B 1RJXB 2HNTE 4AORA 3PV4A 1DY8A 1HAZB 2XXLA 4AGKA 2F9UA 2BQ7B 1VITH 1NROH 3EYDA 1V2WT 1O2HA 1O3LA 1K1LA 3ELAH 3RM2H 1C5NH 3ITIA 4X2WA 3T2NA 2AGEX 2C93B 3LOXA 4GCHF 3UNQA 1TYNA 4E7RG 4ISIH 1L1NA 1FAKH 1TFXA 1GDQA 2XBYA 1LVOA 3STIA 1WTGH 5CHAC 1N6XA 3RC5A 1D6RA 2P3TB 2BD4A 2OC8A 5C3NA 1T8MA 3QWCH 1SI5H 1ZSLA 1XVMA 3B23B 3M3SA 3EQ0H 3RXHA 2I6QA 3M7TA 1GJCB 1U6QA 2TGAA 4Q7YA 1FN6A 1IQEA 2ZHWH 2BOKA 4NWKA 1Z71A 3OX7U 1TX8A 3U8RH 6GCHG 2BLWA 2YNAA 3MFJA 3RXMA 1O3JA 1C1NA 1TB6H 3UPEA 1SOTA 5EPYA 2PGBB 2FZZA 4RKOB 2GZ7A 3PM3A 1ZSKA 2Q6DA 2ZKSA 2B8OH 1LQDB 1SGRE 4FUHA 5C67A 3GCNA 3EE0B 1RXPA 4GCHG 1H1BA 2UWPA 4KTSA 5EW1H 4ABHA 2ZIQH 4Z6AH 3RXQA 4DCDA 3DA9B 1NRSH 2XCFA 1KYNA 1BRUP 1HJAB 1O2PA 1LMWB 1O3PB 4ABEA 3OTJE 3PMBB 5FBEA 4GLYA 1V2LT 4CHAC 3MU1A 3I29A 4M7GA 5LPRA 1O2TA 1QL9A 2A4RA 1AE8H 3ZVCA 4B71A 1EPTA 1ZHRA 2A5KA 1NPMA 1O2IA 3QTOH 1DOJA 1KTSB 3FFGA 3A83A 4BXWA 3GDVA 1UCYK 1P01A 4XBDA 1DICA 3LJJA 3UWIA 1SGFG 1NFYA 2OBQA 1ZJKA 4MG3A 1IHTH 2FIRH 2Z3CA 5JBBS 1VZQH 5EXLA 1T31A 2BTCE 2QYIA 1GVKB 2PTCE 4DIIH 2I6SA 2A7HA 1HJ9A 5EQRA 4UFFH 1AFQC 1H9IE 2ODQA 1EATA 2GDDA 3E0NB 4OS4A 2NU2E 4WXIA 1THPB 3VB7A 3KQBA 4FUBA 1E36B 3A87A 4OS7A 1P2MA 1NRRH 1EKBB 2AS9A 2OC1A 3A7YA 4JMYA 2VB0A 1ARBA 3URDA 2C3SA 2ZGHA 4KGAA 3HK3B 2QXJA 4DVAU 3U1JB 1C5XB 1VJ9U 3TVJB 4NFEA 5CE1A 1TMBH 1ORFA 1KLJH 4XDEA 1K1NA 1GCTB 4CRBA 3RXFA 2Y5GA 3A84A 1C5OH 1FPHH 4FVBA 3Q76A 4FXGH 1FQ3A 3EAJA 3KL6A 2H9EH 2ZHFH 2WPIS 4XBCA 3JZ1B 5IYTA 1QA7A 4BAHB 1ESBA 3ZVAA 1DDJA 1CSOE 4YT6H 3ZZDA 2GV6A 1RS0A 1EXFA 4Y7AA 1NESE 1ZOMA 1G2LA 2BXTH 4NCYA 5DPAA 1GDNA 3GCOA 1XUGA 3PWCA 3QTVH 1AVGH 3E8LA 1MBMA 2CHAB 8LPRA 1A4WH 3DHKH 2GZ9A 2W3IA 5C1YA 4B74A 1C5UA 4WH6A 3PO1C 2GMTB 1ARCA 1E38B 3P8OA 1YCPK 1QHRB 1C5VA 1BA8B 1L4ZA 1C9TA 1S6FA 3UUZA 4BTTB 3GISB 1O3KA 5G4BA 1SC8U 1XUFA 2BLQA 4K3JA 4OS2A 3W95A 3BTWE 3BSQA 1DXPA 1HAYB 2GX4A 2VH0A 3I77A 5E8EH 3PLBA 4DJZB 2ZHDA 3K6YA 3SN8A 2B0FA 3S7HB 1NY22 3RDZA 5A8YA 1NS3A 3K65B 2FOGA 4ZHAA 3OSYA 3T26A 1MKWH 3QZQA 2GCTB 1HFDA 3HATH 3OY5U 3GYMA 1AQ7A 4K2YA 2PV9B 2ZA5A 2O8MA 1W12U 1MQ6A 1QRWA 3NWUA 4OS6A 1TNLA 1O2NA 2BD2A 1TALA 1Y5BT 2FOBA 2JKHA 2BMGB 3KIDU 4X1QU 3GICB 2QXIA 3L33A 4I8KA 7KMEH 5ESBA 1Z6EA 5HGGA 1FN8A 4Q7XA 5AFZH 3VXEH 1MMJN 1EP6A 2AMPA 5GDSH 2AEIH 5EXMA 1P8VC 3O8BA 1P04A 2R2WU 3KQDA 1RD3B 2QY0B 2QXGA 3TH2H 1BDAA 2V35A 4JZIA 1O3CA 1O5CB 1EX3A 4I8LA 2ZU1A 4YM9A 3MU4A 1J17T 3QO6A 2GTBA 1SGTA 3LGVA 1E37B 1HAHH 1V2NT 5F8TA 1QA0A 1K1JA 3ESTA 4BANB 1QQ4A 2W5EA 1EQ9A 2Z9KA 1GBDA 2FOCA 3Q3KA 2BZ6H 1XVOA 1QBNA 4UDWH 1MBQA 4BAQB 1ETTH 3Q3YA 4NGAH 1RIWB 3GCHC 1GDUA 4BAOB 1V2OT 1SGPE 1T8OA 4HZHA 1K28D 1C1RA 1XKAC 1GMDF 1TOCB 2VU8E 2J94A 2O8LA 4NA7A 1QR3E 3UOPA 5C2ZA 1K22H 1HRTH 2ULLA 1C1SA 1BBRE 1UJ1A 2BDIA 3P70B 3T5FH 1GCDA 1ABIH 1P9UA 1AKSB 1ZMLA 2OP9A 1O2XA 4NG9H 3DT0H 3QK1A 5A0BA 2Y80A 3D49H 4SGAE 1DWEH 4HI3A 1P2JA 2AMDA 3FP6E 2GMTC 2FTMA 3F6UH 3M7UA 3RMNH 1N1LA 2KAIB 2CN0H 3BIUH 1B0EA 1MUEB 2OC0A 2FOMB 1IQFA 4FUGA 1LKAA 4RSPA 2J92A 2F9VA 3NCLA 4K1SA 3P8FA 3SUEA 5C5NA 1P2QA 1TE0A 3RXUA 1PQ5A 1GMDG 4NA8A 5EW2H 4AB8A 1UTKA 4TPIZ 3L6PA 1LHCH 2ZF0H 1EJMA 5C1UA 4JYUH 2FX6A 3CENA 1TABE 1ZPCA 2ZZUH 4BTIB 2J95A 2GCTC 2H9HA 1P2OA 1Y5AT 2VIWA 1O2KA 1TRMA 1JOUB 3NUMA 2LNCA 2QF3A 3VXFH 3GDSA 1BTPA 5DP5A 4ZKRU 2O8UA 3ATWA 1Z8RA 1SGIB 2FXRA 2R3YA 4MLFB 3SW2B 1E34B 1GL1A 1D9IA 4UFDH 1DLEA 2WPLS 1FY8E 1QB1A 2B5TB 3RLYH 1PPGE 4DIHH 1CA0C 2XBXA 3BF6H 5DK1A 2D2DA 1AZ8A 1TRYA 4ASHA 1GMCG 1UVSH 3RU4E 1UTNA 1QRZA 1MTSA 2JH5D 2AH4X 1O3GA 1PPCE 3V0XA 2F83A 5GXPA 1S84A 3SJOA 1C5RA 1XXDA 1SLWB 3ZV8A 1IQHA 2W26A 3RLWH 2ZFSA 1O3FA 1K1OA 3TJUA 1IOEA 1A5GH 1C2HA 1M9UA 3E3TA 3TJOA 1O2JA 2G55A 5CMXH 4H6SB 1QIXB 2XWBI 1S0RA 4XFQA 2TRMA 3LU9B 1CT0E 3BTFE 3T28A 2PGQB 2GT7A 1K21H 3A7TA 2EEKA 5DG6A 2TPIZ 2BDAA 1SBWA 2ZCKP 1GWAA 1F92A 2FOEA 1UVOA 2ZEBA 5A2MH 1GBCA 3BTQE 2ZWLH 1SGQE 4ISNA 2OTVA 1BBRH 2A4OA 1J14A 3ZZBA 2A45B 4HTCH 1OWHA 2GCHG 2OLGA 1EAXA 2WPMS 1FY4A 1PPFE 1BTUA 2BDYA 2VIOA 2VNTA 4PROA 1ELCA 2CMYA 3BEIB 5CHAB 1VR1H 2FI5E 1LQEA 4R8TB 1ZSJA 1FAXA 3ZZ4A 1KIGH 1P10A 1HUTH 1UTQA 3SU0A 2GP9B 1VITF 3AASA 1H8DH 2FLRH 1EASA 3SI3H 1HNEE 4K1EA 1YPKH 4FU7A 1P05A 5GCHF 4ZHLU 3VFEA 3FP8E 3M7QA 3LPRA 1Y3XA 1TQ7B 2Z3EA 1NRQH 4MQAA 4YOIA 1ABJH 3M3TA 5DP4A 4Y79A 2ZP0H 1GI7B 4Y0ZE 4DGJA 2WPJS 1AVWA 1O3AA 2XTTB 3MH6A 3SNCA 3SU1A 2Z7FE 2R0KA 3RC4A 2W7UA 7ESTE 2VGCB 3UR6A 2ZGCA 2R2MB 1P2KA 2WPKS 3M5NA 1ZYOA 4MNVA 3U8OH 4CRGA 1O5BB 2RA0A 3UNSA 1H4WA 3KGPA 5FBIA 3RXIA 4CREA 1CA8B 4A1VA 3D62A 1F5RA 1ESAA 3MHWU 2CXVA 4X8VH 1Y5UT 3A85A 4FU9A 5DP7A 2BOHB 4X1NU 2D1JA 4CHAB 1AKSA 3BTGE 4DT7B 1TGTA 2HLCA 3MNSA 4MDSA 3TGJE 1ZMNA 1GI9B 1VITG 7GCHF 3SU5A 1GJAB 2UWLA 5JB8S 5JBAS 3ZV9A 1OYQA 4YOJA 3JZ2B 4NSVA 4DURA 1RGQA 1A1RA 5GCHG 1HAOH 3E0PB 1SLUB 1ELBA 1NT1A 1SHHB 1LHGH 1RTFB 2C8ZB 4A7IB 2QN5T 4E05H 1NRPH 1MH0A 4YESB 4A1XA 2YOLA 4DG4A 1EJAA 3M5LA 3W94A 2KAIA 2BVXH 3SJKA 2BLOA 2A2QH 1GI6A 2PKAA 4LXBH 3TIUA