1V2ST

Benzamidine in complex with bovine trypsin variant x(ssfi.glu)bt.d1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Understanding protein-ligand interactions: the price of protein flexibility
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
molecule keywords Trypsin
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2sT01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2sT02
4AG1A 1O2OA 1YPHC 2PKSC 1A0LA 1QIXB 2ZGHA 3MYWA 4B2BA 1SGIB 3W94A 2ASUB 3MNBA 2Z3EA 1P05A 2O9QA 2PTNA 1SQAA 3I78A 1MTVA 1GMDG 3V0XA 4E06H 1CT2E 5EOKA 3GY2A 1P04A 2XTTB 3M61U 2QIQA 2ZWLH 2A7CA 1FQ3A 1QTFA 2VGCC 4JZDH 1GI3A 2BD3A 1OYQA 1W0ZU 1TX8A 2P59A 2VIPA 1W11U 1GJBB 3S9BA 1L1NA 2ZFQH 2ZGXH 1Y3UA 3RXEA 1TRMA 2BD7A 3QX5H 1C2EA 2PSYA 1ZTLA 1O2XA 2G81E 4HFPB 5EPYA 4DW2U 2VINA 4KKDA 1OS8A 4ZXYH 4IMZA 1P01A 5I25A 2YNAA 4I8JA 4DVAU 1K1NA 2FO9A 2FS9A 2EI7A 4INHA 1EKBB 1ELAA 4J2YB 2O8WA 4OS2A 4WJG2 3U9AH 1P2IA 1DE7H 2FM2A 2JETB 3ZZ8A 4X1PU 1YPKH 3S69A 2UUJB 3M7TA 1VITG 4NIWA 3MO9A 2A31A 1DDJA 2ZPRA 2G5VA 4YT7H 1TALA 2BDAA 3P8FA 4XFQA 1FZZA 2ZNKH 3A83A 1G2LA 3SORA 3ELAH 4MDSA 1OWEA 2RA3A 3GOVB 4SGBE 3D65E 1GBDA 2GTBA 3NUMA 2JH6D 1KXFA 3LC3A 4KTCA 3RXKA 4ABFA 1O38A 1Z8RA 1JBUH 1PYTD 2B0FA 1ELCA 1O5DH 1K21H 5GCHG 3SNCA 4GHQA 3BEFB 2ILNA 4E7NA 1DWBH 3U8OH 4K1TA 5LPFA 1N6XA 2OC7A 3U1JB 1E38B 3ZYDA 1P3CA 4YESB 2Z6BD 3SQEE 3FAOA 4B73A 1SBWA 1MQ5A 4MVNA 3RXDA 4ZHAA 1CA8B 4I8GA 4Y6DA 2Y5GA 1SOTA 3QGJA 4K69A 4Y71A 2KAIA 1O3NA 1TMBH 1Z71A 1LTOA 2C8YB 1B0EA 1GHBG 2QN5T 3SNBA 1S82A 1O2NA 2BLWA 2ZFTA 1BTYA 4X1RU 1WU1A 6LPRA 2NU0E 2VVUA 1RIWB 2FXRA 1SGQE 3NWUA 3Q3YA 1O5CB 3KCGH 4IW4E 4K8YA 1AI8H 1CU1A 1AZZA 2PUXB 1BQYA 5DP7A 3A8BA 3D62A 3RU4E 5GIBA 1WQSA 2FOGA 2ZGBH 3UFAA 1ZHPA 4D9RA 4FU9A 4MPVA 5JDUB 5IYTA 2Y81A 1HLTH 4MLFB 4GCHF 3TGKE 2FX4A 4OGXA 1KLJH 1AD8H 1BBRE 3P6ZB 1GDNA 1P2QA 1CGJE 4JK6A 1HB0B 1KYNA 4WXVA 3RXAA 3T5FH 1D3QB 1GJ8B 2D8WA 1BTHH 2BD9A 1TPAE 1DXWA 4FU7A 2Z9JA 4Y8ZA 1IQIA 1QB6A 3VB3A 1K1MA 2FOHA 1AB9B 1G3EA 3A88A 2JKHA 1CT4E 4X6MA 4VGCB 2C8ZB 2WPHS 2Q6FA 1GJ5H 2A45B 3A8DA 1KLTA 4U30A 3ZZ6A 1GMCG 3UNQA 3P8GA 5A0BA 3FZZA 7LPRA 3A7VA 2FI4E 1INCA 1EZSC 1HJ8A 3UTUH 1GBMA 1KTTB 1FJSA 1OOKB 1RTLA 3RXQA 1F92A 4NIXA 4I31A 1P03A 1SLWB 1THRH 3QK1A 1DUAA 1TABE 5HYOA 1RS0A 4B2CA 1K2I1 2G51A 2VIVA 1NT1A 1BA8B 1JIRA 1P8VC 1O31A 2OC1A 1ZSLA 2SNVA 3KF2A 1NM6A 1HAVB 1TGCA 4GVUA 4ISIH 3PLBA 2Z9IA 1AU8A 1GMDF 4TWYA 2R9PA 1LHCH 5AFZH 2BLOA 5EGMA 1N1LA 2OBQA 1G36A 1THSH 5K0HA 4CRBA 3PYHA 1QL7A 3ZZ4A 4YOJA 1AE5A 3PWBA 3SN8A 3RXGA 1C5XB 3TVJB 3LONA 3TH3H 1EJNA 2OCVB 3VPKA 1AHTH 2Z9GA 1IQJA 3NXPA 3TH2H 1O36A 1O5BB 3A8AA 3UQVA 1C5SA 1GMHF 3ZZCA 2FOBA 2IN2A 2JETC 3EYDA 5DKMA 4IMQA 1AZ8A 4Q7XA 1OXGA 1E34B 3H7TA 2WV4A 1HAIH 1T8OA 3E0NB 3MNXA 1BTPA 2GZ8A 1TFXA 1TAWA 3O8DA 2WUCA 5TCCA 4RSPA 1UVSH 2CHAC 2HALA 1O33A 2QXJA 2J2UA 1S0QA 4I33A 2BZ6H 2Z9KA 4ESTE 1DY8A 1EPTC 5EQSA 1O2IA 4DG4A 1YPGH 3ZV8A 4ZKOU 2B9LA 3MH7A 3RXLA 1TNHA 1F0RA 3STIA 3OU0A 1O2RA 2C3SA 3D23A 2G55A 1QBOA 2VIQA 3OY5U 1CHOG 1SGYE 4IS5A 4NFFA 1OKXA 3ATMA 1YPEH 3PM3A 5A2MH 1QR3E 2A5KA 2XBXA 5JYIA 2J4IA 5CMXH 1AMHA 2P95A 1O3EA 2KAIB 1H8IH 1OWIA 1UVOA 5A0CA 1BRBE 3E90B 2WPJS 1Z6EA 3QTVH 3T2NA 4U01A 1HAXB 3RXPA 1NU9A 1K1JA 1G32B 4INLA 1RIWC 1BTUA 4NIVA 1SG8B 1BOQA 3GDSA 1YM0A 3F9GA 3OX7U 1UTNA 3RXFA 1BMNH 4ZH8A 1UTPA 2HPQH 1ETSH 3ZVEA 5DP9A 3BG4B 4NWLA 3LH3A 1QL8A 3AVZA 2BX3A 4ABDA 2TIOA 1EB2A 3MNCA 3SV9A 3MHWU 3A81A 2SGQE 1ACBE 1GBAA 3BTEE 3TITA 3Q3XA 4AYYB 1SGDE 2PR3A 2CHAB 1S5SA 1T8LA 1O3KA 1EP6A 2TRMA 1SGEE 3T29A 3U1IB 1GBHA 2J92A 1G37A 1DWDH 1T32A 3ZZ7A 3H7OA 2Q6GA 4O9VA 2SGDE 2WYJA 2WV5A 4XOJA 5DK1A 4X2XA 1TBQH 2AIQA 1TGBA 1SVPA 3A7ZA 1UMAH 1IAUA 3PMJA 1SGNE 1EAIA 3PMHB 2ZHEH 2ZQ1A 1ABJH 1AFEH 2SGEE 2QGRA 1ANCA 4O3TA 3L33A 1T8MA 1UO6A 1JRTA 1JIMA 1LQDB 1L4ZA 2BLQA 2QYIA 1O3FA 4X1SU 1E36B 4MG3A 1ELTA 2BQ6B 1XUHA 4NFEA 1V2NT 1VITH 1CQQA 2AGEX 5A0AE 4WF8A 1P9UA 3RXTA 1LVYA 4CH2B 3QLPH 5C20A 4FUDA 3FZDA 1YP9A 1KTSB 1ABIH 4NCYA 1BDAA 6ESTA 2ALPA 1OP0A 4U2WA 1GL1A 2C90B 1GHYH 1XKBC 1Q31A 4YZUA 3RMOH 1TGSZ 3EAJA 5F8XA 1K1LA 1WTGH 3K6YA 1C2JA 3EGKH 3MU1A 1IQNA 2BYAX 3TPIZ 4D7GA 1GI7B 1YCPM 1TNJA 1J8AA 1GBEA 5ETXA 2PFEA 1P2KA 1DXPA 1W13U 2VWLA 1NRQH 1BMMH 1SGCA 2H9EH 1DSTA 1H1BA 4H6SB 2ZDMA 1HYLA 1C1RA 1GCDA 1MH0A 1HGTH 1TPSA 3A8CA 1SLXB 2BY5X 3K2UA 4ABEA 4I8KA 3GDUA 1PPBH 3PWCA 5H4IB 4X1QU 1MCTA 4MTBA 1GI8B 4FUBA 1CT0E 2UUFB 1TOMH 2ANMH 4DURA 4ZMAH 1F5RA 2C8XB 1LDTT 4ZXXH 1BHXB 1C1SA 1LKBA 3ESTA 4JZIA 2GCTB 2ZGJA 4CH8B 4DT7B 4IGDA 1O2SA 1XVMA 3GY7A 3V12A 2D2DA 2F9VA 4GPGA 2R0LA 1EAUA 1NRPH 1NRRH 1OWHA 4BXSA 3BEIB 4B75A 1TBRH 4NSYA 4BNRA 3BTHE 3E16B 1FNIA 5TJXA 2BD8A 2OXSA 1YKTA 1J16A 2BQ7B 3SW2B 3SJ9A 2D26C 4NZLA 2PGQB 1KXDA 2FPZA 4Y11E 3TK9A 1DLEA 3SNAA 1E0FD 2UUYA 2GZ9A 2B5TB 1O5AB 2RG3A 1S6HA 1AWFH 4OS4A 3VGCC 1A0HB 4O97A 1CO7E 1C5YB 2XWBI 1DOJA 3HGNA 4ZUHA 3BTME 4BAHB 4Y8XA 1UTQA 1K28D 5ABWA 2ZTXA 1D9IA 2ZPQA 2THFB 1WCZA 3SU0A 1PQ7A 2CXVA 1HFDA 2XNIA 3EA7A 4BANB 4X8UH 1YYY1 3QUMP 5L2YH 3MU4A 1NFUA 3SV2H 1IQGA 1O30A 3P70B 1D3PB 1QNJA 1A0JA 1G3CA 4Q2KA 1IQEA 1AQ7A 1DVAH 4JYUH 2GP9B 3RC5A 1BCUH 1DX5M 1EZQA 1UCYK 8GCHG 8KME2 4Y0ZE 5JB9S 3S9AA 1SR5C 1FLEE 1GCTB 4H42U 2OTVA 7ESTE 1UCYE 4BAKB 3B9FH 1ELVA 3RXIA 1YC0A 4A1VA 3RM2H 3SOSA 5C5OA 1EXFA 2ZDLA 2GT7A 5FPTA 3E1XB 1NTPA 4NGAH 2QCYA 3UWJH 2UUKB 4NA9H 5FAHA 1BITA 4AFUA 8GCHF 2WPKS 3TNSA 2XBVA 1O34A 1V6DA 3RXJA 3TJVA 1C4Y2 4WXIA 1EASA 1MD7A 2PKSB 3T26A 1HAVA 2GVFA 1ZPCA 2VIOA 4X2VA 1FY4A 4KELA 2G8TA 3MWIU 1GJ4H 2ZP0H 3GCTG 1P2MA 1OPHB 2VWNA 5C67A 3TNTA 2LNCA 1QRZA 1UTKA 5CHAB 3LGIA 7GCHG 4IN1A 5LGOA 3SJKA 1DWEH 1TGNA 4YOIA 1P10A 2AGGX 1NRNH 5FPSA 1ETRH 1UHBB 2BD2A 1SHYA 2BTCE 3LKWA 2EI6A 3LGUA 5EXLA 3U69H 1BIOA 5FCKA 1J14A 1D3DB 1TONA 4ZAEA 5FHTA 1SGFA 2PTCE 2XWAA 4BXWA 4AB9A 5HM2A 1DPOA 1V2QT 1EAWA 3QDZB 1GHAG 3SU2A 1ZTKA 4HGCA 1GL0E 1XX9A 5C3NA 2GKVE 2V3OH 5JPMH 2Y80A 1SMFE 1QA0A 1JXPA 2TGDA 5GPIB 5J4QA 1IQHA 1XVOA 4Q80A 4KTUA 3SU4A 1TA2A 1CBWB 1Y3XA 2O8TA 2ZA5A 3NPSA 3BTWE 1ELGA 1FI8A 2FTLE 4OS1A 2BVRH 4K1EA 3V13A 2PGBB 3SBKA 3GY4A 4D9QA 1EPTB 2VH6A 1EX3A 3CP7A 1M9UA 5ESTE 5HM9A 1Z7KA 1A7SA 3M5LA 2BVSH 1YCPH 1GHWH 3T62A 2ZECA 2G4TA 1TX7A 5DP8A 5DJ7A 3BF6H 3ENSB 2UWOA 5T6FA 1PPGE 4ISNA 4FXGH 3QWCH 1GCTC 3RLWH 1C1WH 1C4U2 2BMGB 4D8NA 4E05H 3GDVA 1DY9A 1NY22 4NG9H 1LHFH 3K9XB 3SU3A 1HIAA 1W0YH 1BJUA 3A7TA 1LVMA 3BIVH 2OP9A 1XUJA 1OWDA 1BB0B 1GHVH 3B8JA 3LH1A 3HKIB 3UR9A 1EAXA 3BTFE 3MO6A 4MPXA 2BLVA 1QURH 1O0DH 1WUNH 1BHXF 1QRXA 5EW1H 4DJZB 1V2KT 3UNRA 1S84A 1NFWA 1HAZB 2P94A 5A8XA 1UK3A 2FLBH 3GCTF 1BRCE 1C2DA 3Q00A 1C2HA 4NWKA 2R2WU 4Z0KA 1S83A 4YOGA 5T6DA 1E37B 2C93B 1A3BH 1W7GH 2ZKSA 1WV7H 1RGQA 1IOEA 1ZPZA 1G9IE 4ISHH 1TNLA 5HMAA 1GBCA 1FY5A 1MUEB 2BY7X 1CBWC 1SGRE 1UHBA 1O2YA 5EW2H 1YPJH 2FIRH 5CE1A 2H2ZA 3SHAH 3V3MA 1NPMA 1O3JA 4GAWA 3Q3KA 2FI5E 1ELBA 3DT0H 5GDSH 2WINI 3M7QA 3ODFA 3LGVA 3HPTB 1YPLH 1FMGA 1TQ0B 1N8OB 2QXIA 5L2ZH 1VGCC 1LPGB 1Z8GA 2ALVA 3HATH 5IDKA 1AIXH 1P3EA 2Y5HA 1SLUB 2GDEH 1HUTH 2ANKH 2O8LA 2OUAA 1UVPA 2Z3CA 1VCWA 2XW9A 3SI4H 1SGTA 1ZSKA 4XE4A 3BTDE 3SQHE 3P17H 3SU5A 3SU6A 4CRAA 2GMTB 4ABGA 2XCNA 3RXOA 2RDLA 1G3BA 4X1NU 5F03A 1TWXB 1V2JT 3EDXB 1HV7A 2IPHA 4ABIA 1NROH 1EP5A 1P2NA 3F9EA 5AVDA 3QZQA 1FUJA 1V2TT 3LC5A 5E0GA 2ULLA 1V2WT 1Q2WA 2STAE 5J4SA 2GCTC 1HDTH 1KY9A 3MU0A 3GISB 4X2WA 1ESBA 1V2MT 3M5MA 3M3VA 4MPUA 3S7HB 5EPNA 4Y79A 1KIGH 2UWPA 1O3BA 2BZAA 2Y7ZA 4Q7YA 1TYNA 1YGCH 3JZ2B 3L3TA 1NC6A 2ZIQH 3HK3B 1F7ZA 3FP7E 4XBBA 1MKWH 1XUIA 2CN0H 3W95A 5JBCS 2VNTA 1EATA 2BY6X 5DP4A 1MTSA 1LKAA 1F0TA 2NU3E 3KQEA 5FX6A 3IITA 2W3KA 5BRRE 3MH5A 1HXEH 1S85A 1GMCF 2PSXA 4UEHH 2AERH 2HNTC 1BRAA 3MFJA 2C8WB 1NFXA 4XBCA 2BD4A 1W14U 3BSQA 2Y5FA 1BMLA 2W5EA 3ZV9A 1HBTH 1MAYA 1QJ7B 3SGAE 2PUQH 2QY0B 3OY6U 3KQDA 1C1VH 1O3PB 2GD4B 1QGFA 3SV6A 2PW8H 3TJOA 2H5DA 3HKJB 1W2KH 1JMOH 2NU4E 1UTLM 1MU6B 3LGYA 2P8OC 3SJIA 1SC8U 4YLUA 2QF0A 4BAQB 1C2LA 1NU7B 1O2GH 3M3SA 3BTTE 2ZPSA 1C5PA 4RN6A 3O8RA 4BAOB 1HNEE 2FOEA 2XBYA 1T7CA 1K22H 2P8OB 2R3YA 4PROA 3ZVCA 1O3AA 5GXPA 1AO5A 3IWMA 3K6ZA 1V2OT 3RM0H 1C5QA 3Q77A 4TY7A 2A4OA 3VB7A 1PQAA 2FYRA 1Z6JH 2W7UA 3ZVAA 3S7KB 3A82A 4I8HA 1O2UA 4D76A 3TH4H 1L2EA 3C27B 1PQ5A 2FI3E 2VIWA 2QC2A 3LU9B 1E35B 2PWXA 1TX6A 4OGYA 2XC5A 1D6RA 4H6TA 1W10U 2A2QH 2FOFA 4I7YH 3GY6A 1JRSA 2GZ7A 3PLKA 3URCA 2AYWA 1HIAB 2GDDA 5LPEA 1C1TA 3GICB 5E2PA 2ZI2H 3ZZ3A 3EA9A 2EA3A 1N6YA 5JBAS 2G52A 1AKSB 2Q6DA 1ELDE 1D4PB 1O2PA 2CJIA 1UJ1A 1C5MD 9ESTA 1ANBA 1C1NA 4O3UA 1GPZA 3F68H 3GY3A 3P92A 1GDQA 1D3TB 3ZVGA 1Y3YA 2ODPA 4NZQA 3PO1C 5GCHF 1BTZA 2BOHB 3SUFA 4JMYA 5C1UA 4AX9H 3SO3A 3U98H 2BDCA 4MPWA 1HAYB 4CRGA 2ZCHP 4ZKSU 1RRKA 5FXLA 1IQKA 2GX4A 4K2YA 1MTWA 2F9UA 1L1JA 2ZFRH 3E91A 2EEKA 1OWKA 1MZDA 4JK5A 1B0FA 1BTXA 1QJ6B 4BTIB 4CRFA 1V2RT 2ANYA 1FPCH 1ARBA 1HAGE 3ZZ5A 5FPYA 1A1RA 1AFQC 3Q76A 1O5EH 1C5VA 1G30B 2HPPH 1CSOE 2FDAA 2QAAA 1WQVH 2A4GA 2VJ1A 5EXMA 1EJAA 1KXBA 1BUIA 1GJCB 1IQFA 1C5OH 4TPIZ 2STBE 1Z1IA 5FX5A 1GI4A 1PPCE 4IC5A 2W7SA 1O2JA 1H9LB 4NSVA 1QCPA 3LPRA 2HOBA 3UREA 1BBRH 1TIOA 3VGCB 1W7XH 2QA9E 3MNSA 5T3HA 2UWLA 1L1GA 1O2KA 2FMJA 1AUJA 2OBOA 1XKAC 4NA8A 5GWZA 5DG6A 1O3GA 1C9TA 1MD8A 4WMFA 2AMQA 1BRUP 1C2MA 4X8VH 1HPGA 1ZR0A 1ZOMA 3WY8A 3OTJE 4INKA 2AMDA 3SGQE 3LDXH 3BTQE 3GCOA 1VZQH 1ELEE 3DUXH 3RP2A 4QT8C 4DGJA 4TPYA 1YLCA 3IG6B 1XXFA 4Y10E 2M5TA 5DO4H 5L6NH 3CENA 1YBWA 1V2ST 2P3FH 2XC0A 4MNWA 1FV9A 1C4V2 2B8OH 4KTSA 3RMMH 1EQ9A 1Z8IB 2R2MB 4M7GA 1GBTA 1AVGH 1K1PA 4VGCC 2A32A 1C2GA 3MU5A 4BTUB 4AOQA 1RD3B 3HGPA 2SGAA 2OQ5A 1O2ZA 2FLRH 1O32A 4ZKRU 1GVLA 1WSSH 2PLXA 1P12E 1GGDB 3LIWA 4RKOB 2ZU3A 4CBNA 5C5NA 4F49A 3GYMA 5HGGA 1UCYH 3SJ8A 1AVWA 2SGFE 1QHRB 1O5GH 2OC0A 3VB4A 4JZ1A 1MKXH 1O2MA 1L0ZA 3RDZA 1C2IA 2BVXH 3TU7H 5PTPA 4MNXA 4U32A 2Z7FE 4FUEA 2AS9A 3SJOA 1ZHRA 2ZU5A 5FBIA 3NKKA 4DIHH 5FCRA 2P3TB 4K5ZA 1QFKH 1LVBA 1FAKH 2BHGA 4ABAA 1AVXA 1GJ9B 3AW0A 3RXMA 1ZSJA 4WMDA 1UTJA 2A5IA 1K9OE 2RA0A 2VIDA 5T6GA 1EJMA 4ZHMU 4B1TA 6GCHF 1LHGH 3VFEA 1O3DA 2ZTZA 2WPLS 3RXSA 3UUZA 1LPKB 2VU8E 4X8TH 2F9PA 1QQUA 1GBBA 1GBLA 3TGIE 3BIUH 4A1XA 1J15A 4A6LA 2XYAA 2Q1JA 3ATIA 2V0BA 1WYKA 3E0PB 1YCPK 1FONA 1A61H 1TQ7B 4A7IB 1C1OA 1EOJA 2EC9H 3F9HA 3ZYEA 5E2OA 2AIPA 4FUHA 4X6OA 2G5NA 4AFZA 1RJXB 4H4FA 1ID5H 1C5ZB 2ZHFH 2RCEA 3E3TA 4O03A 1GHAF 2P3UB 5ESBA 1VGCB 2ZDKA 4DCDA 1LCYA 4AN7A 1XUKA 5E0HA 5LH8A 3ZVFA 1MTNB 1LHEH 4CHAB 2F9NA 5EXNA 1GBKA 2GGVB 3ZVDA 1EZXC 1CVWH 1KLIH 3ZZDA 3LJOA 3QO6A 2VVCA 4LZ4B 1O3CA 3O8CA 2D1JA 2BY9X 5CHAC 1RXPA 4XDEA 1JWTA 1G2MA 4FUIA 1ZMJA 3SI3H 1Y8TA 4K1SA 1C1UH 2A0QB 4WMEA 3E6PH 3A87A 2SFAA 3BG8A 5DP6A 4AYVB 4DIIH 4K8BA 2CF9H 3FP8E 1O3OA 2O8UA 4GLYA 4R0IA 1IHTH 1ZJDA 1GG6B 2W26A 6CHAC 1LHDH 4UONA 1K1OA 1O37A 4WH8A 2FEQH 2OINA 2ZCKP 4BTTB 1LMWB 4FUFA 2W3IA 1P2OA 2ZC9H 5E8EH 1EPTA 3T27A 4X6PA 4WH6A 1ZMLA 2FP7B 1FIZA 2BDBA 1DUEA 3TIUA 3UOUA 1H8DH 2OQUA 1GI6A 1O3HA 5F8TA 1O39A 2PV9B 3QN7A 3M3TA 4CBOA 3KQBA 3CS0A 1DM4B 5F6MA 3SHCH 4AGKA 3GYLB 3N7OA 1VJ9U 1DLKB 1LPZB 1GJ6A 2EI8A 1P9SA 2CGAA 2CF8H 4UFGH 4I32A 1MCVA 3MMGA 2XXLA 1FN8A 2R0KA 1DS2E 4JYTA 1KXCA 4TYDA 1GVKB 2BDIA 2DUCA 4B2AA 2BOKA 4ABHA 4F4OC 4B71A 1P2JA 2J95A 2ZDNA 1SB1H 1O3LA 1X7AC 4NIYA 1OP2A 1Y3VA 3ATWA 1H4WA 3FFGA 3UY9A 2GMTC 4Y0YE 5I46H 1Z1JA 4AORA 1SL3A 4K60A 2BXTH 4A1TA 3DD2H 1TB6H 3DFLA 3LGWA 1MU8B 2NWNA 1V2VT 2LPRA 2O8MA 2ANWA 1A4WH 1T4UH 3BV9B 3VXFH 3UR6A 4TY6A 4YTAA 1OP8A 2A7JA 4IC6A 1A5GH 1ARCA 3RC6A 1FIWA 1P06A 1GMHG 2H1UA 4MNYA 3DHKH 1ZPBA 1C1QA 4X8SH 4BAMB 1T4VH 2XBWA 2R3UA 5FBEA 5JBBS 1O3IA 1HJAB 3A80A 2HWLB 5K7RA 5AF9H 1UK4A 1TRYA 2VB0A 2I6QA 4ABJA 3L6PA 1AKSA 3AW1A 1GI2A 2PHBA 3SV8A 2VH0A 1AY6H 3KGPA 3MO3A 3BTKE 2PKAA 1MZAA 1WTHD 4YT6H 2YOLA 1O35A 2WPMS 1N8OC 1GI1A 4ZHLU 5C2ZA 4OS6A 5L30H 2BY8X 1AE8H 1WOFA 3JZ1B 4WY3A 1DFPA 5BPEA 3RXBA 1AN1E 1H9HE 3DFJA 2F9BH 4FVDA 1B5GH 1C5NH 3KHVA 5B6OA 7GCHF 1A3EH 3A86A 3RC4A 3FANA 1J9CH 1CHGA 5EU8A 2Y7XA 4AZ2B 3PROA 5EODA 1XUGA 3UIRA 1BZXE 1ORFA 1Y5UT 1UVUH 3MI4A 3TGJE 1MTNC 2A5AA 3BTGE 1C5UA 1NZQH 1ESTA 1NRSH 1GWAA 2G4UA 4OS5A 2ZF0H 2ZHDA 3NZIA 1ZLRA 3T25A 6GCHG 3SU1A 2QV1A 3ODDA 1QJ1B 2FTMA 1KDQB 3C1KA 3EA8A 2ZZUH 4CREA 1FPHH 3ITIA 3VB5A 3A89A 3EE0B 3R0FA 2FZZA 1C5WB 4TWWA 1LQEA 3KIDU 5DPAA 1HCGA 1QBVH 1ZMNA 5A8YA 5A8ZA 3F6UH 3RU4T 1BMAA 4B74A 1C5RA 4SGAE 2XC4A 1IQLA 2ZO3H 3SV7A 1YF4A 4E7RG 4DOQA 1FAXA 5DGJA 2GCHG 3RU4D 4J1YA 1ANEA 2J38A 1DANH 4A5TS 4NA7A 2WUBA 3PTBA 1TGTA 4GHTA 3PB1E 4UD9H 3MOCA 1HAOH 1G3DA 1FXYA 1GJDB 2AGIX 1F0UA 3KN2A 4Y7BA 2FODA 1T31A 4MNVA 1KXEA 4JYVH 4X2YA 3NCLA 1F5KU 1S0RA 2FYQA 3M36A 1MBMA 4HTCH 4XBDA 3GCHB 2FS8A 3ZZBA 1UVTH 1VR1H 3PTNA 4ISOA 1RFNA 1RTFB 2BXUH 1O2HA 2FOMB 2ZU2A 2ZG0H 1QB9A 2QXGA 1TBZH 1GHBF 3GCNA 3UOPA 2HNTE 4YM9A 1CE5A 4LXBH 1CA0B 1AUTC 3SUDA 3F9FA 5EQRA 4BOHA 1XUFA 1PPEE 5C1YA 5G4BA 3VB6A 4HZHA 2I6SA 2K1QA 1PQ8A 1O2WA 1S81A 1SSXA 5HXFA 1AFQB 1SFQB 1O2VA 4JCNA 2P93A 3UWIA 4GUXA 3B23B 2VWMA 4KGAA 1EOLA 4ASHA 1ANDA 1C2FA 1Y5AT 3GY5A 3ATKA 1TMTH 1H9IE 1F5LA 3LOXA 9LPRA 2TGTA 1NS3A 1TLDA 4ABBA 1OX1A 4CR5A 2XCFA 4Y76A 3LT3A 3U8RH 1DICA 2TBSA 2ZU4A 1RTKA 3KNXA 1Z8JB 1CA0C 2V35A 1TNKA 2ESTE 5C1XA 4WVPE 1THPB 2Y6TA 3TJUA 1SLVB 2FESH 3LJJA 3U8TH 1F0SA 2HNTF 1SI5H 2DE9A 2ZEBA 1Y3WA 1UK2A 3SUGA 1CGHA 1ELFA 4ZROA 2ZGCA 2SNWA 3RXUA 3P8OA 1EB1H 3MTYA 3R3GB 2H9TH 3KEEA 1DT2A 3EQ0H 1WBGB 1BT7A 4UFFH 4CR9A 3OSYA 4IN2A 1F2SE 4X0WU 1XXDA 1O3MA 3PMBB 1TNGA 5AFYH 1LVOA 2J9NA 3ATLA 5AHGH 2PKAB 1MKWK 4RKJB 3QZRA 1P02A 2A7HA 1TA6A 3S9CA 1GHXH 4YLQH 3UQOA 4UFEH 4FUCA 1Y5BT 2XRCA 2ZFPH 1ZRKA 4HI3A 4KP0A 3M35A 5GJ4B 4R8TB 4A92A 1PPFE 1GGDC 1ETTH 4B76A 1W12U 4FUGA 4FUJA 3TJNA 3M5OA 4K3JA 2HVXA 1QA7A 2V6NA 1TOCB 1VCQA 3O8BA 2GCHF 1AWHB 1Y59T 5F8ZA 2ZFFH 3BN9A 1C1MA 2ZQ2A 3SNEA 3E8LA 3PMAB 2GV7A 1ZTJA 1YLDA 4LZ1H 1SQTA 5JB8S 1SFIA 2FOCA 2OD3B 2ZDAH 2GT8A 1FY1A 4YO9A 3I29A 1MBQA 1HRTH 1C1PA 1FY8E 1J17T 2HRVA 3RXVA 3AAUA 3PV4A 2B7DH 2DE8A 4AFSA 1U6QA 1NO9H 5DP5A 2P16A 3FP6E 2AH4X 1A2CH 1KXAA 4GSOA 1GDUA 2J34A 2ZDVH 3UPEA 2VVVA 3PLPA 3G01A 2WYGA 5EG4A 3AASA 1SPJA 2AMPA 1TPPA 1ZJKA 4AB8A 2ODQA 4IBLH 2H9HA 3MH4A 2OLGA 2CMYA 3GCHC 2BDGA 8LPRA 2NU2E 2TGPZ 1QL9A 1VITF 2H6MA 2ZHWH 5TCAA 1DWCH 1GBFA 3QTOH 1GI0A 3K65B 1YPMH 3QGNB 4Y7AA 2IOTA 2AEIH 3TLOA 1GI9B 3MH6A 1QRWA 3RXRA 2AFQB 1QBNA 1HJ9A 1TRNA 2GV6A 1PFXC 3SGBE 3ZZ9A 3RLYH 1DITH 1LO6A 1SHHB 4UFDH 4FVBA 2BB4A 1VJAU 3BEUA 2J94A 2ZU1A 3HK6B 1QY6A 3KL6A 8ESTE 3RUOA 1KSNA 4MQAA 1PPHE 1MAXA 1WAYB 1FDPA 2ZHQH 1MMJN 3TK5A 3A84A 4X6NA 4CRDA 4DY7B 1C5TA 2SGPE 2A2XH 2BQWB 2JH5D 1MTUA 1SOZA 1B7XB 1SQOA 1T8NA 1TE0A 3RMNH 3UNSA 1C9PA 1IHSH 4GCHG 1V2UT 3ZZAA 1FY3A 3DA9B 3D49H 1P57B 2BD5A 3M7UA 3PO1B 7KMEH 1EZUC 1GHZA 5A09A 4CRCA 2VWOA 4WWYA 2C4FH 2ODYB 2OC8A 3AAVA 5E0JA 1V2PT 1YPHE 2FX6A 4JZFH 1TNIA 3SUEA 2HGTH 2BDHA 2IJOB 3ZVBA 1C2KA 2Z9LA 2A1DB 1PJPA 1L4DA 1ZYOA 1IQMA 1ZGIA 1O2LA 4FU8A 4LK4A 2YNBA 1Q3XA 3M37A 1PPZA 2QXHA 2H5CA 2F3CE 1QQ4A 2WPIS 3STJA 3V7TA 5LPRA 1OWJA 4I8LA 3CS7A 4D7FA 1K1IA 2Z3DA 4THNH 1HAPH 1ZHMA 1S6FA 1GVZA 3A7WA 3MU8A 1NN6A 2Y82A 1ZRBA 1BJVA 2HLCA 2FOAA 2A4QA 3A7XA 3S0NA 1P09A 1XM1A 1FN6A 4CHAC 1GG6C 6CHAB 3KQCA 1XMNB 5DP3A 1C5LH 1P0SH 2BDYA 3P8NA 1GI5A 2ZCLP 1O2QA 1HJAC 1A46H 3T28A 1NESE 2F9OA 5JBTA 1GBIA 1BTWA 3A7YA 1A5IA 1AGJA 1TPOA 3RXCA 2JH0D 3GY8A 1CHOF 5SGAE 1A5HA 4UE7H 1VCPA 2VGCB 1SGFG 3I77A 1O5FH 1HAHH 2F91A 2ZTYA 1QB1A 1O2TA 2FWWA 3SZNA 4UDWH 2F83A 1ESAA 4Z6AH 1DSUA 4OS7A 3RMLH 1V3XA 2ZFSA 4Y8YA 3TK6A 1W8BH 1UTOA 4LOYH 2BM2A 1D6WA 3F1SB 1KDQA 2BX4A 2QF3A 1GJAB 2NU1E 2Z94A 2A4RA 3VXEH 2G00A 3NK8A 4JZEH 1W3CA 5EQQA 4Q7ZA 2TGAA 1ZZZA 1MQ6A 3BG4C 3A85A 4AFQA 4AGJA 4ISLA 3URDA 1GJ7B 1P11E 1UTMA 1AB9C 3LGTA 1MKXK 3M5NA 1GBJA 3RXHA 1OYTH 3FVFB 1BBRK 1NFYA 2CV3A 3H5CB 1TMUH 4AG2A 1OSSA 1V2LT 1PYTC 1HXFH 2V3HH 3VEQB 1EUFA 1SGPE 1CGIE 3OYPA 4ZKNU 1JOUB 3P95A 2TPIZ 4XSKU 1ZGVA 3SNDA
chains in the Genus database with same CATH superfamily
4AG1A 1O2OA 1YPHC 2PKSC 2VBCA 1A0LA 1QIXB 2ZGHA 3MYWA 4B2BA 1SGIB 3W94A 2ASUB 3MNBA 2Z3EA 1P05A 2O9QA 4RI0A 2PTNA 1SQAA 3I78A 1MTVA 1GMDG 3V0XA 4E06H 1CT2E 5EOKA 3GY2A 1P04A 2XTTB 3M61U 2QIQA 2ZWLH 2A7CA 1FQ3A 1QTFA 2VGCC 2YMSC 4JZDH 1GI3A 2BD3A 1OYQA 1W0ZU 1TX8A 2P59A 2VIPA 1W11U 1GJBB 3S9BA 1L1NA 2ZFQH 2ZGXH 1Y3UA 3RXEA 1TRMA 2BD7A 3QX5H 1C2EA 2PSYA 1ZTLA 1O2XA 2G81E 4HFPB 5EPYA 4DW2U 2VINA 4KKDA 1OS8A 4ZXYH 4IMZA 1P01A 5I25A 2JIZD 2YNAA 4I8JA 4DVAU 1K1NA 2FO9A 2FS9A 2EI7A 4I86A 3PV2A 4INHA 1EKBB 2EY4C 1ELAA 4J2YB 2O8WA 4OS2A 4WJG2 5HIYA 5KGOA 1P2IA 1DE7H 2FM2A 2JETB 2QF4A 1VKYA 3ZZ8A 4X1PU 1YPKH 3S69A 2UUJB 3M7TA 1VITG 4NIWA 3MO9A 2A31A 1DDJA 2ZPRA 2G5VA 4YT7H 1TALA 2BDAA 3P8FA 4XFQA 1FZZA 2ZNKH 3A83A 1G2LA 3SORA 4XRNA 3ELAH 4MDSA 2V7QD 1OWEA 2RA3A 3GOVB 4SGBE 3D65E 3OEHD 1GBDA 2GTBA 3NUMA 2JH6D 1KXFA 3LC3A 4KTCA 3RXKA 4ABFA 1O38A 1Z8RA 1JBUH 1PYTD 2B0FA 1ELCA 1O5DH 1K21H 5GCHG 3SNCA 4GHQA 3BEFB 2ILNA 4E7NA 1DWBH 3U8OH 4K1TA 5LPFA 1N6XA 2OC7A 3U1JB 1E38B 3ZYDA 1P3CA 4YESB 2Z6BD 3SQEE 3FAOA 4B73A 1SBWA 3KYGA 1MQ5A 4MVNA 3RXDA 4ZHAA 1CA8B 4I8GA 4Y6DA 2Y5GA 1SOTA 3QGJA 4K69A 4Y71A 2KAIA 1O3NA 1TMBH 1Z71A 1LTOA 2C8YB 1B0EA 1GHBG 2QN5T 3SNBA 1S82A 1O2NA 2BLWA 2ZFTA 1BTYA 4X1RU 1WU1A 6LPRA 2NU0E 2VVUA 1RIWB 2FXRA 1SGQE 3NWUA 3Q3YA 1O5CB 5GNDA 3KCGH 4IW4E 4K8YA 1AI8H 1CU1A 1AZZA 2PUXB 1BQYA 5DP7A 3A8BA 3D62A 3RU4E 5GIBA 1WQSA 2FOGA 2ZGBH 3UFAA 1ZHPA 4D9RA 4FU9A 4MPVA 5JDUB 5IYTA 2Y81A 1HLTH 4MLFB 4GCHF 3TGKE 2FX4A 4OGXA 1KLJH 1AD8H 1BBRE 3N7EA 3P6ZB 1GDNA 1P2QA 2RDEA 2L74A 1CGJE 4JK6A 1HB0B 1KYNA 4WXVA 3RXAA 3T5FH 1D3QB 1GJ8B 2D8WA 1BTHH 2BD9A 1TPAE 1DXWA 4FU7A 2Z9JA 4Y8ZA 1IQIA 1QB6A 1WDIA 1K1MA 2YMSD 2FOHA 1AB9B 1G3EA 3A88A 3VB3A 2JKHA 1CT4E 4X6MA 3OAAD 4VGCB 2C8ZB 2WPHS 2Q6FA 1GJ5H 2A45B 3A8DA 1KLTA 4U30A 3ZZ6A 1GMCG 3UNQA 3P8GA 5A0BA 3FZZA 7LPRA 3A7VA 2FI4E 1INCA 1EZSC 1HJ8A 2J5UA 3UTUH 1GBMA 1KTTB 1FJSA 1OOKB 1RTLA 3RXQA 1F92A 4NIXA 4I31A 1P03A 1SLWB 1THRH 3QK1A 1DUAA 1TABE 5HYOA 1RS0A 4B2CA 1K2I1 2G51A 2VIVA 1NT1A 1BA8B 1JIRA 1P8VC 1O31A 2OC1A 1ZSLA 2SNVA 3KF2A 1NM6A 1HAVB 1TGCA 4GVUA 4ISIH 3PLBA 2Z9IA 1AU8A 1GMDF 4TWYA 2R9PA 1LHCH 5AFZH 2BLOA 5EGMA 2QE7D 1N1LA 2OBQA 1G36A 1THSH 5K0HA 4CRBA 3PYHA 1QL7A 3ZZ4A 4YOJA 1AE5A 3PWBA 3SN8A 3RXGA 1C5XB 3TVJB 3LONA 3TH3H 1EJNA 2OCVB 3VPKA 1AHTH 2Z9GA 1IQJA 3NXPA 3TH2H 4Q4LA 1O36A 1O5BB 3A8AA 3UQVA 1C5SA 1GMHF 1MABB 2KR7A 3ZZCA 2FOBA 2KFWA 2IN2A 2JETC 3EYDA 5DKMA 3F2HA 4IMQA 1AZ8A 1H8HD 4Q7XA 1OXGA 1E34B 3H7TA 2WV4A 2HLDD 1HAIH 1T8OA 3E0NB 3MNXA 1BTPA 2GZ8A 1TFXA 1TAWA 3O8DA 2WUCA 5TCCA 4RSPA 1UVSH 2CHAC 2HALA 1O33A 3F0OA 2QXJA 2J2UA 1S0QA 4I33A 2BZ6H 2Z9KA 4ESTE 1DY8A 1EPTC 5EQSA 1O2IA 4DG4A 1YPGH 3ZV8A 4ZKOU 2B9LA 3MH7A 3RXLA 1TNHA 1F0RA 4XD7D 1NBMD 3OU0A 3STIA 1O2RA 2C3SA 3D23A 2G55A 1QBOA 2VIQA 3OY5U 1CHOG 1SGYE 4IS5A 4NFFA 1OKXA 3ATMA 5C0UA 1YPEH 4TSFD 3PM3A 5A2MH 1QR3E 2A5KA 2XBXA 5JYIA 2J4IA 5CMXH 1AMHA 2P95A 1O3EA 2KAIB 1H8IH 4Z1MD 1OWIA 1UVOA 5A0CA 1BRBE 3E90B 2WPJS 1Z6EA 3QTVH 3T2NA 4U01A 1HAXB 1SQRA 3RXPA 1NU9A 1K1JA 1G32B 4INLA 1RIWC 1BTUA 4NIVA 1SG8B 1BOQA 3GDSA 3DSOA 1YM0A 2F43B 3F9GA 3OX7U 1UTNA 3RXFA 1BMNH 4ZH8A 1UTPA 2HPQH 1ETSH 3ZVEA 5DP9A 3BG4B 4Q63A 4NWLA 3LH3A 1QL8A 3AVZA 2BX3A 4ABDA 2TIOA 1EB2A 3MNCA 3SV9A 5HIZA 3MHWU 2XOKD 3A81A 2SGQE 1ACBE 1GBAA 3BTEE 3TITA 3Q3XA 4AYYB 1SGDE 2PR3A 2CHAB 1S5SA 1T8LA 1O3KA 1EP6A 2TRMA 1SGEE 3T29A 3U1IB 1GBHA 2J92A 1G37A 1DWDH 3F2GA 1T32A 3ZZ7A 3H7OA 2Q6GA 4O9VA 2SGDE 2WYJA 2RFKC 2WV5A 4XOJA 5DK1A 4X2XA 1TBQH 2AIQA 1TGBA 1SVPA 3A7ZA 1UMAH 1IAUA 3PMJA 1SGNE 1EAIA 3PMHB 2ZHEH 2ZQ1A 1ABJH 1AFEH 2SGEE 2QGRA 1E79D 1ANCA 2KX4A 4O3TA 3L33A 1T8MA 1UO6A 1JRTA 1JIMA 1LQDB 1L4ZA 2BLQA 2LP6A 1O3FA 2QYIA 4X1SU 1E36B 4MG3A 1ELTA 2BQ6B 1XUHA 4NFEA 1V2NT 1VITH 1CQQA 2AGEX 5A0AE 3NRLA 4WF8A 1P9UA 3RXTA 4ASUD 1LVYA 4CH2B 3QLPH 5C20A 4FUDA 3FZDA 1YP9A 1KTSB 1ABIH 4NCYA 1BDAA 6ESTA 2ALPA 1OP0A 4U2WA 1GL1A 2C90B 1GHYH 1XKBC 1Q31A 4YZUA 3RMOH 1TGSZ 3EAJA 5F8XA 1K1LA 1WTGH 3K6YA 1C2JA 3EGKH 3MU1A 1IQNA 2BYAX 3TPIZ 4D7GA 5EIYA 1GI7B 1YCPM 1TNJA 1BMFD 1J8AA 1GBEA 5ETXA 2PFEA 1P2KA 1DXPA 1W13U 2VWLA 3U28C 1NRQH 1BMMH 1SGCA 2H9EH 1DSTA 4FETA 1H1BA 4H6SB 2ZDMA 1HYLA 1C1RA 1GCDA 1EFRD 1MH0A 1HGTH 1TPSA 3A8CA 4ACBA 1SLXB 2BY5X 3K2UA 4ABEA 4I8KA 3GDUA 1PPBH 3PWCA 5H4IB 4X1QU 2J97A 1MCTA 4MTBA 1GI8B 4FUBA 1CT0E 2UUFB 1TOMH 2ANMH 4DURA 4ZMAH 1F5RA 2C8XB 1LDTT 4ZXXH 1BHXB 1C1SA 1LKBA 3ESTA 4JZIA 2GCTB 2ZGJA 4CH8B 4DT7B 4IGDA 1O2SA 1XVMA 3GY7A 3V12A 2D2DA 2F9VA 4GPGA 2R0LA 1EAUA 1NRPH 1NRRH 1OWHA 4BXSA 3BEIB 4B75A 1TBRH 4NSYA 1SKYE 5FL7D 4BNRA 2IPQX 3BTHE 3E16B 1FNIA 5TJXA 2BD8A 2OXSA 1YKTA 1J16A 2BQ7B 3SW2B 3SJ9A 2D26C 4NZLA 2PGQB 1KXDA 3F0PA 2FPZA 3CNRA 4Y11E 3TK9A 1DLEA 3SNAA 1E0FD 2UUYA 2GZ9A 2B5TB 1O5AB 2RG3A 1S6HA 1AWFH 4OS4A 3VGCC 1A0HB 4TT3D 3N99A 4O97A 1CO7E 5CHBA 1C5YB 2XWBI 1DOJA 3HGNA 4ZUHA 2XNDD 3BTME 4BAHB 4Y8XA 1UTQA 1K28D 5ABWA 2ZTXA 1D9IA 2ZPQA 2THFB 1WCZA 3SU0A 1PQ7A 2CXVA 1HFDA 2XNIA 3EA7A 4BANB 4X8UH 1YYY1 3QUMP 5L2YH 1YY3A 3MU4A 1NFUA 3SV2H 1IQGA 1O30A 3P70B 1D3PB 1QNJA 1A0JA 1G3CA 4Q2KA 1IQEA 1AQ7A 1DVAH 2GJGA 4JYUH 2GP9B 3RC5A 1BCUH 1DX5M 1EZQA 1UCYK 8GCHG 8KME2 4Y0ZE 5JB9S 3S9AA 1SR5C 1FLEE 1GCTB 4H42U 2OTVA 7ESTE 1UCYE 4BAKB 3B9FH 1ELVA 3RXIA 4OM9A 1YC0A 4A1VA 3RM2H 3SOSA 1E1RD 5C5OA 1EXFA 2ZDLA 5HKKD 2GT7A 5FPTA 3E1XB 1NTPA 2KCAA 2QCYA 4NGAH 3UWJH 2UUKB 4NA9H 5FAHA 1BITA 4AFUA 8GCHF 2WPKS 3TNSA 2XBVA 1O34A 1V6DA 3RXJA 3TJVA 1C4Y2 4WXIA 1EASA 1MD7A 2PKSB 3T26A 1HAVA 2GVFA 1ZPCA 2VIOA 2J98A 4X2VA 1FY4A 4KELA 2G8TA 3MWIU 1GJ4H 2ZP0H 4M9FA 3GCTG 1P2MA 1OPHB 2VWNA 5C67A 3TNTA 2LNCA 1QRZA 1UTKA 5CHAB 3LGIA 7GCHG 4IN1A 5LGOA 3SJKA 1DWEH 1TGNA 4YOIA 1P10A 2AGGX 1NRNH 5FPSA 1ETRH 1UHBB 2BD2A 1SHYA 2BTCE 3LKWA 2EI6A 3LGUA 5EXLA 3U69H 1BIOA 5FCKA 1J14A 1D3DB 1TONA 4ZAEA 5FHTA 1SGFA 2PTCE 2XWAA 4BXWA 2CK3D 4AB9A 5HM2A 1DPOA 1V2QT 1EAWA 3QDZB 2WHXA 1GHAG 4DT4A 3SU2A 1ZTKA 4HGCA 1GL0E 1XX9A 5C3NA 2GKVE 2V3OH 5JPMH 2Y80A 1SMFE 1QA0A 1JXPA 2TGDA 5GPIB 5J4QA 1IQHA 1XVOA 3GS9A 4Q80A 4KTUA 3SU4A 1TA2A 1CBWB 1Y3XA 2O8TA 2ZA5A 3NPSA 3BTWE 1ELGA 1FI8A 2FTLE 4OS1A 2BVRH 4K1EA 3V13A 2PGBB 3SBKA 3GY4A 4D9QA 1EPTB 2VH6A 1EX3A 3CP7A 1M9UA 5ESTE 5HM9A 1Z7KA 1A7SA 3M5LA 2BVSH 1YCPH 1GHWH 3T62A 2ZECA 2G4TA 1TX7A 5DP8A 5DJ7A 3BF6H 3ENSB 2UWOA 5T6FA 1PPGE 4ISNA 4FXGH 3QWCH 1GCTC 3RLWH 1C1WH 1C4U2 2BMGB 4D8NA 4E05H 3GDVA 1DY9A 1NY22 4NG9H 1LHFH 3K9XB 3SU3A 1HIAA 1W0YH 1BJUA 3A7TA 2OK5A 1LVMA 3BIVH 2OP9A 1XUJA 1OWDA 3KYFA 1BB0B 1GHVH 3B8JA 3LH1A 3HKIB 5EJ1A 3UR9A 1EAXA 3BTFE 3MO6A 4MPXA 2BLVA 1QURH 1O0DH 1WUNH 1BHXF 1QRXA 5EW1H 4DJZB 4YXWD 1V2KT 3UNRA 1S84A 1NFWA 1HAZB 2P94A 3PRBA 5A8XA 1UK3A 2FLBH 3OE7D 3GCTF 1BRCE 1C2DA 3Q00A 1C2HA 4NWKA 2R2WU 4Z0KA 1S83A 1H8ED 4YOGA 5T6DA 1E37B 2C93B 1A3BH 1W7GH 2ZKSA 1WV7H 1RGQA 4RT0A 1IOEA 1ZPZA 1G9IE 4ISHH 1TNLA 5HMAA 1GBCA 1FY5A 1MUEB 2BY7X 1CBWC 1SGRE 1UHBA 1O2YA 5EW2H 1YPJH 2FIRH 5CE1A 4AC9A 2H2ZA 3SHAH 3V3MA 1NPMA 1O3JA 4GAWA 3Q3KA 2FI5E 1ELBA 3DT0H 5GDSH 2WINI 3M7QA 3ODFA 3LGVA 3HPTB 1YPLH 1FMGA 1TQ0B 1N8OB 2QXIA 5L2ZH 1VGCC 1LPGB 1Z8GA 2L6OA 2ALVA 3HATH 5IDKA 1AIXH 1P3EA 2Y5HA 1SLUB 2GDEH 2HVYB 1HUTH 2ANKH 2O8LA 4RT1A 2OUAA 1UVPA 2Z3CA 1VCWA 2XW9A 3SI4H 1SGTA 1ZSKA 4XE4A 3BTDE 3SQHE 3P17H 3SU5A 3SU6A 4CRAA 2GMTB 4ABGA 2XCNA 3RXOA 2RDLA 1G3BA 4X1NU 5F03A 1TWXB 1V2JT 3EDXB 1HV7A 2IPHA 4ABIA 1NROH 1EP5A 1P2NA 3F9EA 5AVDA 3QZQA 1FUJA 1V2TT 3LC5A 5E0GA 2ULLA 1V2WT 3W1EA 1Q2WA 2STAE 5J4SA 2GCTC 1HDTH 1KY9A 3MU0A 3GISB 4X2WA 1ESBA 1V2MT 3M5MA 3M3VA 4MPUA 3S7HB 5EPNA 4Y79A 1KIGH 2UWPA 1O3BA 2BZAA 2Y7ZA 4Q7YA 1TYNA 1YGCH 3JZ2B 3L3TA 1NC6A 2ZIQH 3HK3B 1F7ZA 3FP7E 4XBBA 1MKWH 1XUIA 3WWFA 2CN0H 3W95A 5JBCS 2VNTA 1EATA 2BY6X 5DP4A 1MTSA 1LKAA 1F0TA 2NU3E 3KQEA 5FX6A 3FOAA 3IITA 2W3KA 5BRRE 3MH5A 1HXEH 1S85A 1GMCF 2PSXA 2KCOA 4UEHH 2AERH 2HNTC 1BRAA 3MFJA 2C8WB 1NFXA 4XBCA 2BD4A 1W14U 3BSQA 2Y5FA 1BMLA 2W5EA 3ZV9A 1HBTH 1MAYA 1QJ7B 3SGAE 2PUQH 2QY0B 3OY6U 3KQDA 2J98B 1C1VH 1O3PB 2GD4B 1QGFA 3SV6A 2PW8H 3TJOA 2H5DA 3HKJB 1W2KH 1JMOH 2NU4E 1UTLM 1MU6B 1QZ8A 3LGYA 3DSPA 2P8OC 3SJIA 1SC8U 4YLUA 2QF0A 4BAQB 1C2LA 1NU7B 1O2GH 1YWUA 3M3SA 2JJ2D 3BTTE 2ZPSA 1C5PA 4RN6A 3O8RA 4BAOB 1HNEE 2FOEA 2XBYA 1T7CA 1K22H 2P8OB 2R3YA 4PROA 3ZVCA 1O3AA 5GXPA 3UAIC 1AO5A 3IWMA 3K6ZA 1V2OT 3RM0H 1C5QA 3Q77A 4TY7A 3U9AH 2A4OA 3VB7A 1PQAA 2FYRA 1Z6JH 2W7UA 3ZVAA 3S7KB 3A82A 4I8HA 1O2UA 4D76A 3TH4H 1L2EA 3C27B 1PQ5A 2FI3E 2VIWA 2QC2A 3LU9B 1OHHD 1E35B 2PWXA 1TX6A 4OGYA 2XC5A 1D6RA 4H6TA 1W10U 2A2QH 2FOFA 4I7YH 3GY6A 1JRSA 2GZ7A 5CDFE 3PLKA 3URCA 2AYWA 2WPDD 1HIAB 2GDDA 5LPEA 1C1TA 3GICB 5E2PA 2ZI2H 3ZZ3A 3EA9A 2EA3A 1N6YA 5JBAS 2G52A 1AKSB 2Q6DA 1ELDE 1D4PB 1O2PA 2CJIA 3PV5A 1UJ1A 1C5MD 9ESTA 1ANBA 1C1NA 4O3UA 1GPZA 3F68H 3GY3A 3P92A 1GDQA 1D3TB 3ZVGA 1Y3YA 2ODPA 4FOUC 4NZQA 3PO1C 5GCHF 1BTZA 2BOHB 3SUFA 4JMYA 5C1UA 4AX9H 3SO3A 3U98H 2BDCA 4MPWA 1HAYB 4CRGA 2ZCHP 4ZKSU 1RRKA 5FXLA 1IQKA 2GX4A 4K2YA 1MTWA 2F9UA 1L1JA 2ZFRH 3E91A 3SZEA 2EEKA 1OWKA 1MZDA 3AK5A 4JK5A 1B0FA 1BTXA 1QJ6B 4BTIB 4CRFA 3KQ5A 1V2RT 2ANYA 1FPCH 1ARBA 1HAGE 3ZZ5A 5FPYA 1A1RA 1AFQC 3VG8A 3Q76A 1O5EH 1C5VA 1G30B 2HPPH 1CSOE 2FDAA 2QAAA 1WQVH 2A4GA 2KM0A 2VJ1A 5EXMA 1EJAA 1KXBA 1BUIA 1GJCB 1IQFA 1C5OH 4TPIZ 2STBE 1Z1IA 5FX5A 1GI4A 3SYJA 1PPCE 4IC5A 2W7SA 1O2JA 1H9LB 4NSVA 1QCPA 3LPRA 2HOBA 3UREA 1BBRH 1TIOA 3VGCB 1W7XH 2QA9E 3MNSA 5T3HA 3F3BA 2UWLA 1L1GA 1O2KA 2FMJA 1AUJA 2OBOA 1XKAC 4NA8A 5GWZA 5DG6A 1O3GA 1C9TA 1MD8A 4WMFA 2AMQA 1BRUP 1C2MA 4X8VH 1HPGA 1ZR0A 1ZOMA 3WY8A 3OTJE 4INKA 2AMDA 3FN8A 3SGQE 3LDXH 3BTQE 3GCOA 1VZQH 1ELEE 3DUXH 3RP2A 4QT8C 4DGJA 4TPYA 1UW7A 1YLCA 3IG6B 1XXFA 4Y10E 2M5TA 5DO4H 5L6NH 3CENA 1YBWA 1V2ST 2P3FH 2XC0A 4MNWA 1FV9A 1C4V2 2B8OH 4KTSA 3RMMH 1EQ9A 1Z8IB 2R2MB 4M7GA 1GBTA 1AVGH 1K1PA 4VGCC 2A32A 1C2GA 3MU5A 2KZ4A 4BTUB 4AOQA 1RD3B 3HGPA 2SGAA 2OQ5A 2W6JD 1O2ZA 2FLRH 1O32A 4ZKRU 1GVLA 1WSSH 2PLXA 1P12E 1GGDB 3LIWA 4RKOB 2ZU3A 4CBNA 5C5NA 4F49A 3GYMA 5HGGA 1UCYH 3DCLA 3SJ8A 5C94A 1AVWA 2SGFE 1QHRB 1O5GH 2OC0A 3VB4A 4JZ1A 1MKXH 1O2MA 1L0ZA 3RDZA 1C2IA 2BVXH 2WSSD 3TU7H 5PTPA 4MNXA 4U32A 2Z7FE 4FUEA 2AS9A 3SJOA 1ZHRA 2ZU5A 5FBIA 3NKKA 4DIHH 5FCRA 2P3TB 4K5ZA 1QFKH 1LVBA 1FAKH 2BHGA 4ABAA 1AVXA 1GJ9B 3AW0A 5B6LA 3RXMA 1ZSJA 4WMDA 1UTJA 2A5IA 1K9OE 2RA0A 2VIDA 5T6GA 1EJMA 4ZHMU 4B1TA 6GCHF 1LHGH 3VFEA 1O3DA 2ZTZA 2WPLS 3RXSA 3UUZA 1LPKB 2VU8E 4X8TH 2F9PA 1QQUA 1GBBA 1GBLA 3TGIE 3BIUH 3OEED 4A1XA 1J15A 4A6LA 2XYAA 2Q1JA 3ATIA 2V0BA 1WYKA 3E0PB 1YCPK 1FONA 1A61H 1TQ7B 4A7IB 1C1OA 1EOJA 2EC9H 3F9HA 1NBME 3ZYEA 5E2OA 2AIPA 4FUHA 4X6OA 2G5NA 4AFZA 1RJXB 4H4FA 1ID5H 1C5ZB 2ZHFH 2RCEA 3E3TA 4O03A 3EE7A 1GHAF 2P3UB 5ESBA 1VGCB 2ZDKA 4DCDA 5KECA 1LCYA 4AN7A 1XUKA 5E0HA 5LH8A 3ZVFA 1MTNB 1LHEH 3DSGA 4CHAB 2F9NA 5EXNA 1GBKA 2GGVB 3ZVDA 1EZXC 1CVWH 1KLIH 3ZZDA 3LJOA 3QO6A 2VVCA 4LZ4B 1O3CA 3O8CA 2D1JA 2BY9X 5CHAC 1RXPA 4XDEA 1JWTA 1G2MA 4FUIA 1ZMJA 3WW7A 3SI3H 1Y8TA 4K1SA 1C1UH 2A0QB 4WMEA 3E6PH 3A87A 2SFAA 3BG8A 5DP6A 4AYVB 4DIIH 4K8BA 2CF9H 3FP8E 1O3OA 2O8UA 4GLYA 4R0IA 1IHTH 1ZJDA 1GG6B 2W26A 6CHAC 1LHDH 1W0JD 4UONA 1K1OA 1O37A 4WH8A 2FEQH 2OINA 2ZCKP 1KMHB 4BTTB 1LMWB 4FUFA 2W3IA 1P2OA 2ZC9H 5E8EH 1EPTA 3T27A 4X6PA 4WH6A 1ZMLA 2AHME 2FP7B 1FIZA 2BDBA 1DUEA 1YLNA 3TIUA 3UOUA 1H8DH 2OQUA 1GI6A 1O3HA 5F8TA 3H09A 1O39A 2PV9B 3QN7A 3M3TA 4CBOA 3KQBA 2JDID 3CS0A 1DM4B 5F6MA 3SHCH 4AGKA 3GYLB 3N7OA 1VJ9U 1DLKB 1LPZB 1GJ6A 2EI8A 1P9SA 2CGAA 2CF8H 4UFGH 4I32A 1MCVA 3MMGA 2XXLA 1FN8A 2R0KA 1DS2E 4JYTA 1KXCA 4TYDA 1GVKB 2BDIA 2DUCA 4B2AA 4HG6A 2BOKA 4ABHA 4F4OC 4B71A 1P2JA 2J95A 2ZDNA 1SB1H 1O3LA 1X7AC 4NIYA 1OP2A 1Y3VA 3ATWA 3WWBA 1W0KD 1H4WA 3FFGA 2PP6A 3UY9A 2GMTC 4Y0YE 5I46H 1Z1JA 4AORA 1SL3A 4K60A 2BXTH 4A1TA 3DD2H 1TB6H 3DFLA 3LGWA 1MU8B 2NWNA 1V2VT 2LPRA 4ZCNA 2O8MA 2ANWA 1A4WH 3F2FA 1T4UH 2W6ID 3BV9B 3VXFH 3UR6A 4TY6A 4YTAA 1OP8A 2A7JA 4IC6A 1A5GH 1ARCA 3RC6A 1FIWA 2EQNA 1P06A 1GMHG 2H1UA 4MNYA 3DHKH 1ZPBA 3MQKC 1C1QA 4X8SH 4BAMB 1T4VH 2XBWA 2R3UA 5FBEA 5JBBS 1O3IA 1HJAB 3A80A 3FKSD 2HWLB 5K7RA 5AF9H 1UK4A 3FO8D 1TRYA 2VB0A 2I6QA 4ABJA 3L6PA 4F55A 1AKSA 3AW1A 1GI2A 2PHBA 3SV8A 2VH0A 1AY6H 3KGPA 3MO3A 3BTKE 2PKAA 1MZAA 1WTHD 4YT6H 2YOLA 1O35A 2WPMS 1N8OC 1GI1A 4P02A 4ZHLU 5C2ZA 4OS6A 5L30H 2BY8X 1AE8H 1WOFA 3JZ1B 4WY3A 1DFPA 5BPEA 3RXBA 1AN1E 1H9HE 3DFJA 2F9BH 4FVDA 1B5GH 1FX0B 5T1VA 1C5NH 3KHVA 5B6OA 7GCHF 1A3EH 3A86A 2K8IA 2JJ1D 3RC4A 3FANA 1J9CH 1CHGA 5EU8A 2Y7XA 4AZ2B 3PROA 5EODA 1XUGA 3UIRA 1BZXE 1ORFA 1Y5UT 1UVUH 3MI4A 3TGJE 1MTNC 2A5AA 3BTGE 1C5UA 1NZQH 1ESTA 1NRSH 1GWAA 2G4UA 4OS5A 2ZF0H 2ZHDA 3NZIA 1ZLRA 3T25A 6GCHG 3SU1A 2QV1A 3ODDA 1QJ1B 2FTMA 1KDQB 3C1KA 3EA8A 2ZZUH 4CREA 1FPHH 2QF5A 3ITIA 3VB5A 3A89A 3EE0B 3R0FA 2FZZA 1C5WB 5C17A 4TWWA 1LQEA 3KIDU 5DPAA 1HCGA 1QBVH 1ZMNA 5A8YA 5A8ZA 3F6UH 3RU4T 1BMAA 4B74A 1S6LA 1C5RA 4SGAE 2XC4A 1IQLA 2IJD1 2ZO3H 3SV7A 1COWD 1YF4A 4E7RG 4DOQA 1FAXA 5DGJA 2GCHG 3RU4D 4J1YA 1ANEA 2J38A 3OTPA 1DANH 4A5TS 4NA7A 2WUBA 3PTBA 1TGTA 4GHTA 3PB1E 4UD9H 3MOCA 1HAOH 4ACAA 1G3DA 1FXYA 1GJDB 2AGIX 1F0UA 3KN2A 4Y7BA 2FODA 4F48B 1T31A 4MNVA 1KXEA 4JYVH 4X2YA 3NCLA 1F5KU 1S0RA 2FYQA 3M36A 2LELA 1MBMA 4HTCH 4XBDA 3GCHB 2FS8A 3ZZBA 1UVTH 1VR1H 3PTNA 4ISOA 1RFNA 1RTFB 2BXUH 1O2HA 2FOMB 2ZU2A 2ZG0H 1QB9A 2QXGA 1TBZH 1GHBF 2F4LA 3GCNA 3UOPA 2HNTE 4YM9A 1CE5A 4LXBH 1CA0B 1AUTC 3SUDA 3F9FA 5EQRA 4BOHA 1XUFA 1PPEE 5C1YA 5G4BA 1K0HA 2M2AA 3VB6A 4HZHA 2I6SA 2K1QA 1PQ8A 1O2WA 1S81A 1SSXA 5HXFA 1AFQB 1SFQB 1O2VA 3N7DA 4JCNA 2P93A 3UWIA 4GUXA 3B23B 2VWMA 4KGAA 1EOLA 4ASHA 1ANDA 5IK2D 1C2FA 1Y5AT 3GY5A 3ATKA 1TMTH 1H9IE 1F5LA 3LOXA 9LPRA 2TGTA 1NS3A 1TLDA 4ABBA 1OX1A 4CR5A 2XCFA 4Y76A 3LT3A 3U8RH 1DICA 2TBSA 2ZU4A 5KEDA 4P00A 1RTKA 3KNXA 1Z8JB 1CA0C 2V35A 1TNKA 2ESTE 5C1XA 4WVPE 1THPB 2Y6TA 3TJUA 1SLVB 2FESH 3LJJA 3U8TH 1F0SA 2HNTF 1SI5H 5C0TA 2DE9A 2ZEBA 1Y3WA 1UK2A 3SUGA 1CGHA 1ELFA 4ZROA 2ZGCA 2SNWA 3RXUA 3P8OA 1EB1H 3MTYA 3R3GB 2H9TH 3KEEA 1DT2A 3EQ0H 1WBGB 1BT7A 4UFFH 4CR9A 3OSYA 4IN2A 1F2SE 4X0WU 1XXDA 1O3MA 3PMBB 1TNGA 5AFYH 1LVOA 2J9NA 3ATLA 5AHGH 2PKAB 1MKWK 4RKJB 3QZRA 1P02A 5DN6D 2A7HA 1TA6A 3S9CA 1GHXH 4YLQH 3UQOA 4UFEH 4FUCA 3UB0A 1Y5BT 2XRCA 2ZFPH 1ZRKA 4HI3A 5EJLA 4KP0A 3M35A 5GJ4B 4R8TB 4A92A 1PPFE 1GGDC 1ETTH 3ZIAD 4B76A 1W12U 4FUGA 4FUJA 4B6EA 3TJNA 3M5OA 4K3JA 2HVXA 1QA7A 2V6NA 1TOCB 1VCQA 3O8BA 2GCHF 1AWHB 1Y59T 5F8ZA 2ZFFH 3BN9A 1C1MA 2ZQ2A 3SNEA 3E8LA 3PMAB 2GV7A 1ZTJA 1YLDA 4LZ1H 1SQTA 5F53A 5JB8S 1SFIA 2FOCA 2OD3B 2ZDAH 2GT8A 1FY1A 4YO9A 3I29A 1MBQA 1HRTH 1C1PA 1FY8E 1J17T 2HRVA 3RXVA 3AAUA 3PV4A 2B7DH 2DE8A 4AFSA 1U6QA 1NO9H 5DP5A 2P16A 3FP6E 2AH4X 2WZQA 1A2CH 1KXAA 4GSOA 1GDUA 2J34A 1WXRA 2ZDVH 3UPEA 2VVVA 3PLPA 3G01A 2WYGA 5EG4A 2KCPA 3AASA 1SPJA 2AMPA 1TPPA 1ZJKA 4AB8A 2ODQA 4IBLH 2H9HA 3MH4A 2OLGA 2CMYA 3GCHC 2BDGA 8LPRA 2NU2E 2TGPZ 1QL9A 1VITF 2H6MA 2ZHWH 5TCAA 1DWCH 1GBFA 3QTOH 2KCYA 1GI0A 3K65B 1YPMH 3QGNB 4Y7AA 2IOTA 2YMSB 2AEIH 3TLOA 1GI9B 3MH6A 1QRWA 3RXRA 5DSFA 2AFQB 1QBNA 1HJ9A 1TRNA 2GV6A 1PFXC 3SGBE 3ZZ9A 3RLYH 1DITH 1LO6A 1SHHB 4UFDH 4FVBA 2BB4A 1VJAU 3BEUA 2J94A 2ZU1A 3HK6B 1QY6A 3KL6A 8ESTE 3RUOA 1KSNA 4MQAA 1PPHE 1MAXA 1WAYB 1FDPA 2ZHQH 1MMJN 3TK5A 3A84A 4X6NA 4CRDA 4DY7B 1C5TA 2SGPE 2A2XH 2BQWB 2JH5D 1MTUA 1SOZA 1B7XB 1SQOA 1T8NA 1TE0A 3RMNH 3UNSA 1C9PA 1IHSH 4GCHG 1V2UT 3ZZAA 1FY3A 3DA9B 3D49H 1P57B 2BD5A 3M7UA 3PO1B 7KMEH 1EZUC 1GHZA 5A09A 4CRCA 2VWOA 4WWYA 2C4FH 2ODYB 2OC8A 3AAVA 5E0JA 1V2PT 1YPHE 2FX6A 4JZFH 1TNIA 3SUEA 2HGTH 2BDHA 2IJOB 3ZVBA 1C2KA 2Z9LA 2A1DB 1PJPA 1L4DA 1ZYOA 3OFND 1IQMA 1ZGIA 1O2LA 4FU8A 4LK4A 2YNBA 2K0QA 1Q3XA 3M37A 1PPZA 2QXHA 2H5CA 2F3CE 1QQ4A 2WPIS 3STJA 3V7TA 5LPRA 1OWJA 4I8LA 3CS7A 4D7FA 1K1IA 2Z3DA 4THNH 1HAPH 1ZHMA 5EJZA 1S6FA 1E1QD 1GVZA 3A7WA 3MU8A 1NN6A 2Y82A 1ZRBA 1BJVA 3PRDA 2HLCA 2FOAA 2A4QA 2V3MA 3A7XA 3S0NA 1P09A 1XM1A 1FN6A 4CHAC 1GG6C 6CHAB 3KQCA 1XMNB 5DP3A 2WV9A 1C5LH 1P0SH 2BDYA 3P8NA 1GI5A 2ZCLP 1O2QA 1HJAC 1A46H 3T28A 1NESE 2F9OA 5JBTA 1GBIA 1BTWA 3A7YA 1A5IA 1AGJA 1TPOA 3RXCA 2JH0D 3GY8A 1CHOF 5SGAE 1A5HA 4UE7H 1VCPA 2VGCB 1SGFG 3I77A 1O5FH 1HAHH 2F91A 2ZTYA 1QB1A 1O2TA 2FWWA 3SZNA 4UDWH 2F83A 1ESAA 4Z6AH 1DSUA 4OS7A 3RMLH 1V3XA 2ZFSA 4Y8YA 3TK6A 1W8BH 1UTOA 4LOYH 2BM2A 1D6WA 3F1SB 1KDQA 2BX4A 2QF3A 1GJAB 4B6FA 2NU1E 2Z94A 2A4RA 3VXEH 2G00A 3NK8A 4JZEH 1W3CA 5EQQA 4Q7ZA 2TGAA 1ZZZA 1MQ6A 3BG4C 3A85A 4AFQA 4AGJA 4ISLA 3URDA 1GJ7B 1P11E 1UTMA 1AB9C 3LGTA 1MKXK 3M5NA 1GBJA 3RXHA 1OYTH 3FVFB 1BBRK 1NFYA 2CV3A 3H5CB 1TMUH 4AG2A 1OSSA 1V2LT 1PYTC 1HXFH 2V3HH 3VEQB 1EUFA 1SGPE 1CGIE 3OYPA 4ZKNU 1JOUB 3P95A 2TPIZ 4XSKU 1ZGVA 3SNDA
chains in the Genus database with same CATH topology
4AG1A 1O2OA 1YPHC 2PKSC 1A0LA 1QIXB 2ZGHA 3MYWA 4B2BA 1SGIB 3W94A 2ASUB 3MNBA 2Z3EA 1P05A 2O9QA 2PTNA 1SQAA 3I78A 1MTVA 1GMDG 3V0XA 4E06H 1CT2E 5EOKA 3GY2A 1P04A 2XTTB 3M61U 2QIQA 2ZWLH 2A7CA 1FQ3A 1QTFA 2VGCC 4JZDH 1GI3A 2BD3A 1OYQA 1W0ZU 1TX8A 2P59A 2VIPA 1W11U 1GJBB 3S9BA 1L1NA 2ZFQH 2ZGXH 1Y3UA 3RXEA 1TRMA 2BD7A 3QX5H 1C2EA 2PSYA 1ZTLA 1O2XA 2G81E 4HFPB 5EPYA 4DW2U 2VINA 4KKDA 1OS8A 4ZXYH 4IMZA 1P01A 5I25A 2YNAA 4I8JA 4DVAU 1K1NA 2FO9A 2FS9A 2EI7A 4INHA 1EKBB 1ELAA 4J2YB 2O8WA 4OS2A 4WJG2 3U9AH 1P2IA 1DE7H 2FM2A 2JETB 3ZZ8A 4X1PU 1YPKH 3S69A 2UUJB 3M7TA 1VITG 4NIWA 3MO9A 2A31A 1DDJA 2ZPRA 2G5VA 4YT7H 1TALA 2BDAA 3P8FA 4XFQA 1FZZA 2ZNKH 3A83A 1G2LA 3SORA 3ELAH 4MDSA 1OWEA 2RA3A 3GOVB 4SGBE 3D65E 1GBDA 2GTBA 3NUMA 2JH6D 1KXFA 3LC3A 4KTCA 3RXKA 4ABFA 1O38A 1Z8RA 1JBUH 1PYTD 2B0FA 1ELCA 1O5DH 1K21H 5GCHG 3SNCA 4GHQA 3BEFB 2ILNA 4E7NA 1DWBH 3U8OH 4K1TA 5LPFA 1N6XA 2OC7A 3U1JB 1E38B 3ZYDA 1P3CA 4YESB 2Z6BD 3SQEE 3FAOA 4B73A 1SBWA 1MQ5A 4MVNA 3RXDA 4ZHAA 1CA8B 4I8GA 4Y6DA 2Y5GA 1SOTA 3QGJA 4K69A 4Y71A 2KAIA 1O3NA 1TMBH 1Z71A 1LTOA 2C8YB 1B0EA 1GHBG 2QN5T 3SNBA 1S82A 1O2NA 2BLWA 2ZFTA 1BTYA 4X1RU 1WU1A 6LPRA 2NU0E 2VVUA 1RIWB 2FXRA 1SGQE 3NWUA 3Q3YA 1O5CB 3KCGH 4IW4E 4K8YA 1AI8H 1CU1A 1AZZA 2PUXB 1BQYA 5DP7A 3A8BA 3D62A 3RU4E 5GIBA 1WQSA 2FOGA 2ZGBH 3UFAA 1ZHPA 4D9RA 4FU9A 4MPVA 5JDUB 5IYTA 2Y81A 1HLTH 4MLFB 4GCHF 3TGKE 2FX4A 4OGXA 1KLJH 1AD8H 1BBRE 3P6ZB 1GDNA 1P2QA 1CGJE 4JK6A 1HB0B 1KYNA 4WXVA 3RXAA 3T5FH 1D3QB 1GJ8B 2D8WA 1BTHH 2BD9A 1TPAE 1DXWA 4FU7A 2Z9JA 4Y8ZA 1IQIA 1QB6A 3VB3A 1K1MA 2FOHA 1AB9B 1G3EA 3A88A 2JKHA 1CT4E 4X6MA 4VGCB 2C8ZB 2WPHS 2Q6FA 1GJ5H 2A45B 3A8DA 1KLTA 4U30A 3ZZ6A 1GMCG 3UNQA 3P8GA 5A0BA 3FZZA 7LPRA 3A7VA 2FI4E 1INCA 1EZSC 1HJ8A 3UTUH 1GBMA 1KTTB 1FJSA 1OOKB 1RTLA 3RXQA 1F92A 4NIXA 4I31A 1P03A 1SLWB 1THRH 3QK1A 1DUAA 1TABE 5HYOA 1RS0A 4B2CA 1K2I1 2G51A 2VIVA 1NT1A 1BA8B 1JIRA 1P8VC 1O31A 2OC1A 1ZSLA 2SNVA 3KF2A 1NM6A 1HAVB 1TGCA 4GVUA 4ISIH 3PLBA 2Z9IA 1AU8A 1GMDF 4TWYA 2R9PA 1LHCH 5AFZH 2BLOA 5EGMA 1N1LA 2OBQA 1G36A 1THSH 5K0HA 4CRBA 3PYHA 1QL7A 3ZZ4A 4YOJA 1AE5A 3PWBA 3SN8A 3RXGA 1C5XB 3TVJB 3LONA 3TH3H 1EJNA 2OCVB 3VPKA 1AHTH 2Z9GA 1IQJA 3NXPA 3TH2H 1O36A 1O5BB 3A8AA 3UQVA 1C5SA 1GMHF 3ZZCA 2FOBA 2IN2A 2JETC 3EYDA 5DKMA 4IMQA 1AZ8A 4Q7XA 1OXGA 1E34B 3H7TA 2WV4A 1HAIH 1T8OA 3E0NB 3MNXA 1BTPA 2GZ8A 1TFXA 1TAWA 3O8DA 2WUCA 5TCCA 4RSPA 1UVSH 2CHAC 2HALA 1O33A 2QXJA 2J2UA 1S0QA 4I33A 2BZ6H 2Z9KA 4ESTE 1DY8A 1EPTC 5EQSA 1O2IA 4DG4A 1YPGH 3ZV8A 4ZKOU 2B9LA 3MH7A 3RXLA 1TNHA 1F0RA 3STIA 3OU0A 1O2RA 2C3SA 3D23A 2G55A 1QBOA 2VIQA 3OY5U 1CHOG 1SGYE 4IS5A 4NFFA 1OKXA 3ATMA 1YPEH 3PM3A 5A2MH 1QR3E 2A5KA 2XBXA 5JYIA 2J4IA 5CMXH 1AMHA 2P95A 1O3EA 2KAIB 1H8IH 1OWIA 1UVOA 5A0CA 1BRBE 3E90B 2WPJS 1Z6EA 3QTVH 3T2NA 4U01A 1HAXB 3RXPA 1NU9A 1K1JA 1G32B 4INLA 1RIWC 1BTUA 4NIVA 1SG8B 1BOQA 3GDSA 1YM0A 3F9GA 3OX7U 1UTNA 3RXFA 1BMNH 4ZH8A 1UTPA 2HPQH 1ETSH 3ZVEA 5DP9A 3BG4B 4NWLA 3LH3A 1QL8A 3AVZA 2BX3A 4ABDA 2TIOA 1EB2A 3MNCA 3SV9A 3MHWU 3A81A 2SGQE 1ACBE 1GBAA 3BTEE 3TITA 3Q3XA 4AYYB 1SGDE 2PR3A 2CHAB 1S5SA 1T8LA 1O3KA 1EP6A 2TRMA 1SGEE 3T29A 3U1IB 1GBHA 2J92A 1G37A 1DWDH 1T32A 3ZZ7A 3H7OA 2Q6GA 4O9VA 2SGDE 2WYJA 2WV5A 4XOJA 5DK1A 4X2XA 1TBQH 2AIQA 1TGBA 1SVPA 3A7ZA 1UMAH 1IAUA 3PMJA 1SGNE 1EAIA 3PMHB 2ZHEH 2ZQ1A 1ABJH 1AFEH 2SGEE 2QGRA 1ANCA 4O3TA 3L33A 1T8MA 1UO6A 1JRTA 1JIMA 1LQDB 1L4ZA 2BLQA 2QYIA 1O3FA 4X1SU 1E36B 4MG3A 1ELTA 2BQ6B 1XUHA 4NFEA 1V2NT 1VITH 1CQQA 2AGEX 5A0AE 4WF8A 1P9UA 3RXTA 1LVYA 4CH2B 3QLPH 5C20A 4FUDA 3FZDA 1YP9A 1KTSB 1ABIH 4NCYA 1BDAA 6ESTA 2ALPA 1OP0A 4U2WA 1GL1A 2C90B 1GHYH 1XKBC 1Q31A 4YZUA 3RMOH 1TGSZ 3EAJA 5F8XA 1K1LA 1WTGH 3K6YA 1C2JA 3EGKH 3MU1A 1IQNA 2BYAX 3TPIZ 4D7GA 1GI7B 1YCPM 1TNJA 1J8AA 1GBEA 5ETXA 2PFEA 1P2KA 1DXPA 1W13U 2VWLA 1NRQH 1BMMH 1SGCA 2H9EH 1DSTA 1H1BA 4H6SB 2ZDMA 1HYLA 1C1RA 1GCDA 1MH0A 1HGTH 1TPSA 3A8CA 1SLXB 2BY5X 3K2UA 4ABEA 4I8KA 3GDUA 1PPBH 3PWCA 5H4IB 4X1QU 1MCTA 4MTBA 1GI8B 4FUBA 1CT0E 2UUFB 1TOMH 2ANMH 4DURA 4ZMAH 1F5RA 2C8XB 1LDTT 4ZXXH 1BHXB 1C1SA 1LKBA 3ESTA 4JZIA 2GCTB 2ZGJA 4CH8B 4DT7B 4IGDA 1O2SA 1XVMA 3GY7A 3V12A 2D2DA 2F9VA 4GPGA 2R0LA 1EAUA 1NRPH 1NRRH 1OWHA 4BXSA 3BEIB 4B75A 1TBRH 4NSYA 4BNRA 3BTHE 3E16B 1FNIA 5TJXA 2BD8A 2OXSA 1YKTA 1J16A 2BQ7B 3SW2B 3SJ9A 2D26C 4NZLA 2PGQB 1KXDA 2FPZA 4Y11E 3TK9A 1DLEA 3SNAA 1E0FD 2UUYA 2GZ9A 2B5TB 1O5AB 2RG3A 1S6HA 1AWFH 4OS4A 3VGCC 1A0HB 4O97A 1CO7E 1C5YB 2XWBI 1DOJA 3HGNA 4ZUHA 3BTME 4BAHB 4Y8XA 1UTQA 1K28D 5ABWA 2ZTXA 1D9IA 2ZPQA 2THFB 1WCZA 3SU0A 1PQ7A 2CXVA 1HFDA 2XNIA 3EA7A 4BANB 4X8UH 1YYY1 3QUMP 5L2YH 3MU4A 1NFUA 3SV2H 1IQGA 1O30A 3P70B 1D3PB 1QNJA 1A0JA 1G3CA 4Q2KA 1IQEA 1AQ7A 1DVAH 4JYUH 2GP9B 3RC5A 1BCUH 1DX5M 1EZQA 1UCYK 8GCHG 8KME2 4Y0ZE 5JB9S 3S9AA 1SR5C 1FLEE 1GCTB 4H42U 2OTVA 7ESTE 1UCYE 4BAKB 3B9FH 1ELVA 3RXIA 1YC0A 4A1VA 3RM2H 3SOSA 5C5OA 1EXFA 2ZDLA 2GT7A 5FPTA 3E1XB 1NTPA 4NGAH 2QCYA 3UWJH 2UUKB 4NA9H 5FAHA 1BITA 4AFUA 8GCHF 2WPKS 3TNSA 2XBVA 1O34A 1V6DA 3RXJA 3TJVA 1C4Y2 4WXIA 1EASA 1MD7A 2PKSB 3T26A 1HAVA 2GVFA 1ZPCA 2VIOA 4X2VA 1FY4A 4KELA 2G8TA 3MWIU 1GJ4H 2ZP0H 3GCTG 1P2MA 1OPHB 2VWNA 5C67A 3TNTA 2LNCA 1QRZA 1UTKA 5CHAB 3LGIA 7GCHG 4IN1A 5LGOA 3SJKA 1DWEH 1TGNA 4YOIA 1P10A 2AGGX 1NRNH 5FPSA 1ETRH 1UHBB 2BD2A 1SHYA 2BTCE 3LKWA 2EI6A 3LGUA 5EXLA 3U69H 1BIOA 5FCKA 1J14A 1D3DB 1TONA 4ZAEA 5FHTA 1SGFA 2PTCE 2XWAA 4BXWA 4AB9A 5HM2A 1DPOA 1V2QT 1EAWA 3QDZB 1GHAG 3SU2A 1ZTKA 4HGCA 1GL0E 1XX9A 5C3NA 2GKVE 2V3OH 5JPMH 2Y80A 1SMFE 1QA0A 1JXPA 2TGDA 5GPIB 5J4QA 1IQHA 1XVOA 4Q80A 4KTUA 3SU4A 1TA2A 1CBWB 1Y3XA 2O8TA 2ZA5A 3NPSA 3BTWE 1ELGA 1FI8A 2FTLE 4OS1A 2BVRH 4K1EA 3V13A 2PGBB 3SBKA 3GY4A 4D9QA 1EPTB 2VH6A 1EX3A 3CP7A 1M9UA 5ESTE 5HM9A 1Z7KA 1A7SA 3M5LA 2BVSH 1YCPH 1GHWH 3T62A 2ZECA 2G4TA 1TX7A 5DP8A 5DJ7A 3BF6H 3ENSB 2UWOA 5T6FA 1PPGE 4ISNA 4FXGH 3QWCH 1GCTC 3RLWH 1C1WH 1C4U2 2BMGB 4D8NA 4E05H 3GDVA 1DY9A 1NY22 4NG9H 1LHFH 3K9XB 3SU3A 1HIAA 1W0YH 1BJUA 3A7TA 1LVMA 3BIVH 2OP9A 1XUJA 1OWDA 1BB0B 1GHVH 3B8JA 3LH1A 3HKIB 3UR9A 1EAXA 3BTFE 3MO6A 4MPXA 2BLVA 1QURH 1O0DH 1WUNH 1BHXF 1QRXA 5EW1H 4DJZB 1V2KT 3UNRA 1S84A 1NFWA 1HAZB 2P94A 5A8XA 1UK3A 2FLBH 3GCTF 1BRCE 1C2DA 3Q00A 1C2HA 4NWKA 2R2WU 4Z0KA 1S83A 4YOGA 5T6DA 1E37B 2C93B 1A3BH 1W7GH 2ZKSA 1WV7H 1RGQA 1IOEA 1ZPZA 1G9IE 4ISHH 1TNLA 5HMAA 1GBCA 1FY5A 1MUEB 2BY7X 1CBWC 1SGRE 1UHBA 1O2YA 5EW2H 1YPJH 2FIRH 5CE1A 2H2ZA 3SHAH 3V3MA 1NPMA 1O3JA 4GAWA 3Q3KA 2FI5E 1ELBA 3DT0H 5GDSH 2WINI 3M7QA 3ODFA 3LGVA 3HPTB 1YPLH 1FMGA 1TQ0B 1N8OB 2QXIA 5L2ZH 1VGCC 1LPGB 1Z8GA 2ALVA 3HATH 5IDKA 1AIXH 1P3EA 2Y5HA 1SLUB 2GDEH 1HUTH 2ANKH 2O8LA 2OUAA 1UVPA 2Z3CA 1VCWA 2XW9A 3SI4H 1SGTA 1ZSKA 4XE4A 3BTDE 3SQHE 3P17H 3SU5A 3SU6A 4CRAA 2GMTB 4ABGA 2XCNA 3RXOA 2RDLA 1G3BA 4X1NU 5F03A 1TWXB 1V2JT 3EDXB 1HV7A 2IPHA 4ABIA 1NROH 1EP5A 1P2NA 3F9EA 5AVDA 3QZQA 1FUJA 1V2TT 3LC5A 5E0GA 2ULLA 1V2WT 1Q2WA 2STAE 5J4SA 2GCTC 1HDTH 1KY9A 3MU0A 3GISB 4X2WA 1ESBA 1V2MT 3M5MA 3M3VA 4MPUA 3S7HB 5EPNA 4Y79A 1KIGH 2UWPA 1O3BA 2BZAA 2Y7ZA 4Q7YA 1TYNA 1YGCH 3JZ2B 3L3TA 1NC6A 2ZIQH 3HK3B 1F7ZA 3FP7E 4XBBA 1MKWH 1XUIA 2CN0H 3W95A 5JBCS 2VNTA 1EATA 2BY6X 5DP4A 1MTSA 1LKAA 1F0TA 2NU3E 3KQEA 5FX6A 3IITA 2W3KA 5BRRE 3MH5A 1HXEH 1S85A 1GMCF 2PSXA 4UEHH 2AERH 2HNTC 1BRAA 3MFJA 2C8WB 1NFXA 4XBCA 2BD4A 1W14U 3BSQA 2Y5FA 1BMLA 2W5EA 3ZV9A 1HBTH 1MAYA 1QJ7B 3SGAE 2PUQH 2QY0B 3OY6U 3KQDA 1C1VH 1O3PB 2GD4B 1QGFA 3SV6A 2PW8H 3TJOA 2H5DA 3HKJB 1W2KH 1JMOH 2NU4E 1UTLM 1MU6B 3LGYA 2P8OC 3SJIA 1SC8U 4YLUA 2QF0A 4BAQB 1C2LA 1NU7B 1O2GH 3M3SA 3BTTE 2ZPSA 1C5PA 4RN6A 3O8RA 4BAOB 1HNEE 2FOEA 2XBYA 1T7CA 1K22H 2P8OB 2R3YA 4PROA 3ZVCA 1O3AA 5GXPA 1AO5A 3IWMA 3K6ZA 1V2OT 3RM0H 1C5QA 3Q77A 4TY7A 2A4OA 3VB7A 1PQAA 2FYRA 1Z6JH 2W7UA 3ZVAA 3S7KB 3A82A 4I8HA 1O2UA 4D76A 3TH4H 1L2EA 3C27B 1PQ5A 2FI3E 2VIWA 2QC2A 3LU9B 1E35B 2PWXA 1TX6A 4OGYA 2XC5A 1D6RA 4H6TA