1H9LB

Porcine pancreatic elastase complexed with acetyl-val-glu-pro-ile-cooh
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDE INHIBITOR
publication title Kinetic and Crystallographic Analysis of Complexes Formed between Elastase and Peptides from Beta-Casein
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 59
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2001-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1h9lB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1h9lB01
1GJAB 1EPTB 5TCCA 1BTZA 2BY7X 1ELCA 4WH8A 3Q77A 1EZSC 4BTUB 3KEEA 4M7GA 4RN6A 2G55A 1FAKH 1U6QA 3SU2A 2W7UA 3ZZDA 2G5NA 1TRNA 3GY7A 1FIZA 2QY0B 3ZVEA 1S81A 2O8WA 4RKJB 2Y82A 1HDTH 3UFAA 5HGGA 1GG6B 1DXWA 5EQRA 2V35A 1NT1A 4IN1A 3SOSA 2PV9B 1YPEH 5DPAA 1GMDG 2VIPA 2ZGCA 4FUJA 4E06H 1BTUA 1O2LA 1AB9C 3SI3H 2AGIX 4NIYA 5GCHF 3NCLA 3ITIA 2TIOA 1NRPH 1SLUB 1YC0A 2XCNA 1UVUH 1XKAC 5C1YA 1HB0B 2BXTH 5A8ZA 1G3BA 1SGIB 1ELEE 4ZH8A 1T31A 1QB9A 3P8OA 2AS9A 3SI4H 1GL0E 1BRAA 4X2XA 1J15A 3S0NA 1ZMNA 2Q1JA 4ASHA 2A5IA 1ANBA 5C3NA 1BRBE 5F8ZA 3RXTA 1GHYH 5FPTA 3A7XA 1O5DH 3P8FA 5GJ4B 1LVYA 2CHAC 1EAXA 3B9FH 3SV2H 1BRUP 1V6DA 3GY3A 1DICA 4DVAU 1TQ0B 3ATMA 5TJXA 1IQJA 1QJ7B 1RTKA 1WAYB 3BN9A 1S5SA 2AYWA 1LHEH 1MAYA 1UCYH 4WH6A 1GHZA 2ANWA 1PQAA 3FP8E 4NFFA 1HYLA 2ZECA 1VCPA 1GBJA 1ZRBA 1OOKB 3CS0A 1FY8E 1V2JT 1EQ9A 1P03A 2FWWA 3SUEA 1UTOA 1LQEA 1GJ8B 3PMBB 3PYHA 1FZZA 1O36A 4UEHH 2OD3B 3ZZAA 1GCTB 2CGAA 2A4GA 3QWCH 2VGCC 3O8DA 4X1NU 3ZZCA 2QC2A 3RU4D 1GBKA 1CHOG 1HAOH 1QFKH 4DIIH 2GTBA 4E7RG 1TE0A 4OS7A 1L4DA 3TPIZ 1FDPA 5GDSH 2PSXA 4OS2A 4X6OA 1S85A 2ZCKP 3SGQE 3MO3A 2FXRA 6GCHF 1MU8B 1DY9A 5EG4A 2AH4X 3F9FA 2HLCA 4DCDA 5L2YH 1PPFE 1BB0B 1CGHA 3TNSA 1KLIH 1V2TT 1K22H 3QZQA 3ZVAA 3GCTG 2W5EA 4ZROA 1C5UA 1O5CB 5CE1A 5FHTA 1ZMJA 2AERH 4YLQH 2F3CE 1THPB 1TQ7B 1K1JA 1G3EA 3LT3A 4Y8XA 3FZZA 3H7TA 3FZDA 1BIOA 2ZPRA 3HK6B 3ZV8A 4K8BA 1FV9A 5JB8S 5E8EH 1IQNA 2BB4A 4ISLA 3MTYA 2ZPSA 3PLKA 2B5TB 1L4ZA 3PLPA 3RXPA 2ZCLP 2QA9E 1F5KU 2WINI 1Y3XA 1NU9A 1OWJA 1WQVH 4A1TA 1MTSA 5F8XA 3VB3A 2R2MB 3KGPA 4AG2A 3MO6A 4ZKRU 2O8UA 1O38A 1BUIA 2J2UA 2TPIZ 2QAAA 4I8GA 1OYTH 2PTCE 5T6FA 3RXRA 5I46H 3Q3XA 1DT2A 2FX4A 3KN2A 4GSOA 4KELA 4FXGH 1EKBB 1P01A 1GJ4H 2OBOA 3QN7A 1P2OA 1NZQH 1GMCG 2P8OC 4THNH 1HLTH 2BVRH 3C1KA 4Z6AH 3PROA 2BMGB 2GV6A 2Y7ZA 4F49A 4ESTE 1ZTLA 3F68H 1VJAU 4TYDA 4NSVA 4X6NA 4X8UH 3IG6B 2QGRA 1Y5UT 3PWBA 1VZQH 2HNTF 3U1JB 1VITH 2H5CA 2ZWLH 2BD2A 3CENA 4AYVB 2HGTH 4CREA 1JXPA 2AGEX 3GY8A 1O2UA 4Y0ZE 4NSYA 3STJA 3RC6A 1DM4B 1D4PB 2ILNA 3LGTA 1FY3A 4BTIB 1D6RA 1K1MA 1F5RA 1P2KA 1AB9B 2ZU4A 3M35A 1MQ6A 3DT0H 1BOQA 2H9TH 4I33A 2ASUB 1NFYA 3F9EA 3P8NA 4D76A 1RTLA 4WVPE 3RMMH 3LIWA 2IJOB 4DY7B 2XW9A 2VIOA 4DJZB 3UTUH 1O3GA 3A8AA 2VVCA 3FAOA 1TONA 1RTFB 1HAIH 4K3JA 2C4FH 3I29A 1ESTA 1KIGH 1GCDA 4CRDA 2VVVA 3ZZBA 4AFUA 4BAMB 4OS5A 1L1NA 3KQCA 2ANMH 3RLYH 2ZFFH 1MMJN 1T8OA 2ZKSA 3RMLH 3VB4A 2HPPH 1Q3XA 5E0JA 2ZTXA 2GT7A 4NZQA 2BDAA 1EZUC 2IN2A 1SR5C 1O3BA 1MKWH 1W12U 3GCHB 1XUJA 1D9IA 4I31A 1MKXH 1FQ3A 2NWNA 2Y5GA 2Z6BD 2WUCA 4X1SU 3A87A 3DUXH 3UOPA 1CA8B 3UNSA 3G01A 1SHHB 2BXUH 3CS7A 1KXDA 3EA9A 3FP7E 1IQFA 3AW1A 1UTKA 4OS6A 3SV8A 3VFEA 4CHAB 4JZFH 3E3TA 1HUTH 1MCTA 4MQAA 3RU4E 4AB8A 1NROH 1F0RA 3ZYEA 3LPRA 1O2KA 2O8TA 4MNVA 1O2MA 1P2QA 2Z3DA 3IWMA 3TGKE 2ESTE 2VGCB 3T28A 1SGYE 1BA8B 1S6HA 4QT8C 1AFQC 4NG9H 4FUDA 2Y81A 1GHAG 3HK3B 1CT4E 4ABIA 5FX5A 1SOTA 4K69A 1LQDB 1UTMA 1MQ5A 2Z7FE 5GCHG 1QQUA 1LPKB 4VGCC 3F9HA 3MU5A 3VPKA 3LJJA 1LHFH 1GI5A 1EASA 2P16A 5E0HA 1UCYE 1OWHA 1C9TA 2QIQA 1C1UH 2OBQA 1CE5A 1CSOE 1Y3UA 3S69A 1TB6H 1W8BH 1KXAA 1GL1A 3GCNA 1HCGA 4IS5A 5HM9A 3MU8A 1GWAA 1SHYA 4JYTA 2BDIA 1O2XA 1RIWC 1TFXA 1Y59T 5F8TA 2G52A 1MTNB 5DP4A 1LDTT 2Z9IA 2OP9A 1SL3A 3VXFH 5DGJA 1C2FA 2UWLA 3Q3KA 3A83A 1P57B 3E90B 1SLVB 5JB9S 1FJSA 1CHGA 3TGJE 2GZ8A 3PLBA 2GMTC 1HAXB 3R0FA 2H1UA 1TOMH 3RM0H 1ESBA 1C1PA 2CXVA 2Z94A 2RDLA 1H1BA 1GDUA 2W26A 1TRMA 2C3SA 2ZHQH 1IHSH 2DE9A 3QUMP 3MNCA 1SFIA 4PROA 1O31A 1GJ7B 4A1VA 5AF9H 2Z3CA 4X8SH 1EATA 2OC7A 4FUEA 3BSQA 2P8OB 4CH2B 3QTVH 4MPWA 1TWXB 1BBRK 5C5NA 3LH1A 1FY1A 3EDXB 3NPSA 2BM2A 3OTJE 4K2YA 1SGFG 1W3CA 5AFYH 3ESTA 4MLFB 5L30H 1BCUH 4B74A 4X2WA 2C8YB 1O5BB 1GHXH 4BXSA 1AUTC 1GVZA 3KQDA 3UPEA 2BDHA 2EEKA 5DP8A 4H42U 3GDSA 3N7OA 4GCHG 8KME2 1GG6C 2ZDMA 1C5TA 1CHOF 1QJ1B 4R8TB 4ABGA 4INKA 2QF3A 3ATWA 4IGDA 1V2RT 2WPIS 5FX6A 1TA6A 1BHXF 2ZGXH 4WWYA 2ZA5A 1TMTH 1YCPK 2F9OA 3A80A 3HKJB 4O97A 1NRQH 5AFZH 3SBKA 1CQQA 1GHVH 1UTQA 1AZZA 2Y6TA 4XBDA 3SU5A 5C20A 2F9BH 3B8JA 1XUGA 1GI4A 1ZLRA 1WTGH 1XUHA 2UUYA 3SNAA 1G30B 1JOUB 1A2CH 2BQWB 3NUMA 1CBWB 2UWPA 4MNYA 2ALVA 3BTTE 4AFSA 2CN0H 1GJ6A 4BAOB 2AMPA 3RLWH 1RD3B 3SW2B 1K28D 3BG4B 4KKDA 1H8DH 1ZSLA 4YTAA 2XBWA 1TMBH 1ZMLA 2EA3A 1JWTA 2BYAX 2V3HH 2Y7XA 3KL6A 3EAJA 1BTYA 1AN1E 2ZDAH 5JBBS 3QGNB 4MVNA 1SFQB 3ZVCA 2VU8E 2ZO3H 3A89A 3SJIA 3TK9A 1W0ZU 1PQ5A 1B7XB 4J1YA 1ZHRA 4A5TS 4A92A 1KSNA 3SZNA 2VIVA 2ZEBA 1C5QA 2FX6A 1A0HB 2Z9KA 4YO9A 1ELDE 1AFQB 4KTCA 2ODQA 3SN8A 1TALA 1TGTA 1IHTH 2R0LA 1LPZB 1ELFA 1GMCF 2ZTZA 4UD9H 4CRFA 2VIWA 3VEQB 1IQIA 5AVDA 1YKTA 1P10A 1YPLH 2GKVE 3BTHE 2GZ9A 4I8JA 3Q3YA 1ETSH 4D9RA 1E36B 1UVPA 3SQHE 2V6NA 3QZRA 4XBBA 5GIBA 4VGCB 4NZLA 1AO5A 1ZJKA 1IQLA 2OQ5A 3MU1A 1YPHC 3JZ2B 3VB5A 4RSPA 1BT7A 1EOJA 1GI7B 1K1PA 3M61U 1C1WH 1GVLA 2OC1A 3EGKH 1C2DA 4WMDA 5FXLA 1S83A 1BMMH 3L6PA 1O2NA 5T6GA 4K1SA 3M5OA 1F2SE 1RS0A 5F03A 1UK4A 4I7YH 4GUXA 1RIWB 1T8LA 3UOUA 5DP6A 4Y11E 4I8KA 3BEFB 1EZQA 3IITA 5A0AE 4CRAA 1NRRH 1FY5A 3SJ8A 1TAWA 4Z0KA 2GZ7A 4TWWA 2ZHEH 3BTQE 1AHTH 1HXEH 3T27A 1GBFA 1C5NH 1S84A 1T4UH 4WXIA 1QRZA 1WUNH 1NFXA 3SQEE 2GX4A 1SGNE 9LPRA 1D6WA 1KLJH 1CT2E 2PSYA 4AYYB 4ZKSU 1QRWA 5EOKA 1NRSH 1A5GH 1GI9B 3BIUH 3PO1B 2P59A 2Q6GA 1ZPZA 3CP7A 1NESE 2TRMA 1G32B 3RXBA 1ID5H 5E2OA 2DUCA 4NIVA 1G2LA 4A6LA 1Z6JH 1FPHH 4U32A 5EODA 3Q76A 3TIUA 1C1RA 1P2NA 1Z1JA 5DO4H 2P93A 2RA3A 2R3UA 1C1QA 1QL9A 5G4BA 2BLWA 5GPIB 1ZR0A 3EQ0H 4ABJA 1EB2A 2GDDA 4YT7H 2GCHG 1DX5M 1AE5A 1E0FD 2VJ1A 3K9XB 4X1PU 2VVUA 4DGJA 1A3BH 4X0WU 1GHAF 1QTFA 2ZU5A 3E0PB 1NC6A 1W7GH 1ABJH 1ELBA 3TJUA 1Z6EA 7ESTE 2EI6A 1LVMA 5T6DA 4AGKA 1GHWH 1N6YA 1SC8U 3MFJA 3E91A 1XUIA 2QXHA 4NWKA 3BG8A 1YP9A 4MG3A 5DK1A 4XBCA 2TGAA 4NA7A 1W7XH 2WV5A 2FDAA 5DP9A 1IOEA 1P9SA 4XOJA 1Q2WA 1RFNA 1EAUA 3MH4A 3T5FH 2FYQA 4BOHA 3BTGE 2A2XH 4JYUH 1C5PA 2O8MA 2A5AA 2F9NA 2IPHA 3L33A 1MBQA 1Y5AT 1QNJA 1SB1H 1TGNA 5H4IB 3M37A 1ZTJA 3GCHC 4D8NA 2V0BA 2GDEH 3U8TH 5AHGH 2A31A 1V2WT 3SO3A 1S6FA 1G36A 4B76A 4I8HA 1IQGA 1LHCH 1QA7A 4CBOA 1TABE 1KTTB 1QR3E 3LDXH 2TGTA 6CHAC 5C2ZA 1UTNA 2ZDLA 3U8OH 2Q6FA 2RA0A 4CHAC 3PMJA 1WTHD 4A1XA 5HYOA 5I25A 2SNWA 3MNSA 1DSUA 3T25A 8ESTE 1KXFA 3OY6U 1V2KT 8GCHG 1K1IA 1OX1A 3GY6A 1HAYB 1UVOA 3KF2A 2IOTA 1GJDB 1TYNA 1A3EH 1Q31A 3EA7A 4TWYA 1N8OB 1T8MA 2WV4A 4MPXA 3MOCA 5FCRA 3TJNA 2AIQA 5T3HA 1GDQA 1XUFA 5DJ7A 1GMHG 4OS4A 3ZZ8A 2A7HA 2VNTA 3RM2H 3KCGH 2SGEE 1UMAH 2GD4B 5EXLA 3UNQA 3ZVBA 2NU4E 4AORA 3S7HB 1NPMA 2LPRA 3LGWA 4GCHF 3GCOA 1YPHE 1C1NA 1O3JA 5L6NH 5CHAC 2OLGA 2AMDA 1SI5H 1W0YH 2EI7A 4U30A 1IAUA 3A7YA 2PGQB 5K7RA 3O8CA 2J38A 2OCVB 3UR6A 1NN6A 3F9GA 4YESB 4BNRA 1MD7A 1PPGE 1FIWA 1NRNH 1EJNA 2G81E 4UFEH 1MTNC 5FBEA 3URCA 3VXEH 4JZIA 2AMQA 1O3IA 3MI4A 1HJ8A 3MHWU 4AFZA 3M7QA 2SGPE 3RC4A 4UFDH 3AAVA 2J92A 1LPGB 4HGCA 1GVKB 1DVAH 4LK4A 2Z9JA 3BTWE 1QCPA 2Y80A 2ZU1A 1O3DA 1AMHA 1Z8JB 1GJ5H 1HGTH 4X1QU 3LGIA 4X2VA 3GDVA 1AY6H 3VGCC 1EJMA 1GDNA 2TGPZ 1HBTH 4OGXA 3NWUA 3ATKA 1C2HA 1CT0E 1AI8H 2CV3A 2R0KA 2BVXH 1BDAA 1V2MT 2A5KA 1PFXC 2XRCA 5DP5A 5GWZA 1K1LA 4DURA 5EXNA 2JH5D 3SU6A 3F1SB 1B0FA 1EAIA 2P3TB 2XC5A 4FUBA 1ELVA 1GBBA 1O2VA 1RRKA 2STAE 2JKHA 2SGFE 4UE7H 1AVXA 3UWJH 3LC3A 1YLDA 3LOXA 3A7ZA 1FMGA 4NIWA 2F9VA 5E0GA 2EI8A 4Y8ZA 1JRTA 2ULLA 4O9VA 1GI8B 3MNXA 1SOZA 5J4SA 1YPMH 2Q6DA 2WPMS 1YPGH 3W95A 3ZZ4A 1A5HA 5EXMA 4D9QA 1H9IE 2PFEA 1C5MD 2ZFQH 1K9OE 3DD2H 1O2GH 4O3TA 1KY9A 2W3KA 1F0SA 4LXBH 2HOBA 5LPRA 1OKXA 3PTNA 4ISHH 3UREA 3ZVFA 1G9IE 1AUJA 1UJ1A 1O35A 1GBMA 1SGQE 2J95A 2BVSH 1ABIH 3STIA 4B2BA 1QHRB 1W2KH 1CBWC 1MTVA 1C2MA 1GBTA 1O2SA 7GCHG 1MTUA 1C4Y2 4MNXA 1UTLM 1K2I1 1C2KA 1P04A 3SJKA 1J16A 5IDKA 1TLDA 4NA8A 6CHAB 3BG4C 1QBOA 4Y79A 2ZG0H 3B23B 2C93B 1PQ7A 2PKSC 4Q2KA 2ODPA 2HALA 4FUCA 4B2CA 2BY5X 3U8RH 1A1RA 2Z9LA 1O2WA 2ANKH 4LZ4B 2G5VA 2FI3E 2F9UA 2GCTB 4GHTA 4XSKU 2FOEA 2F83A 4KP0A 2B9LA 2RG3A 4F4OC 4Q7ZA 2ZI2H 2BD7A 4X8TH 1QIXB 3UWIA 1OWDA 2JH0D 3T62A 1O2JA 1VGCC 1HAPH 5EPYA 1O2YA 2BY9X 3TGIE 1PPHE 4ZXYH 1N1LA 3SNCA 3SNBA 1P3EA 1WCZA 3A7WA 4FVDA 1GI1A 1IQMA 1C5OH 1XUKA 5JYIA 1FXYA 2VH0A 2GCHF 3E6PH 3M36A 1FN6A 1GBEA 1Y3VA 1DWCH 2NU2E 3D49H 4CR5A 5CHAB 2WYGA 1ZGVA 1G3DA 1J17T 1AVGH 1F0TA 2THFB 1GJCB 3PB1E 2YOLA 3M5MA 5ESTE 1ELAA 1PQ8A 1ARCA 2UWOA 1UK2A 1VITG 1ZSKA 3EE0B 4UONA 3OYPA 2A32A 2FOGA 3RXGA 4H4FA 3ZVDA 1ELTA 1JIMA 5BPEA 2ZHFH 4UFGH 1V2QT 2OQUA 3V0XA 1SGEE 4GLYA 4ABDA 1DWEH 1V2OT 1AFEH 4IC5A 5ABWA 2O8LA 3DA9B 3UR9A 1G3CA 1TGCA 1QL8A 4UFFH 3VB7A 1BTPA 4BTTB 3A8DA 3URDA 1LTOA 2ZHDA 3FFGA 2ANYA 1XKBC 4IW4E 3PO1C 3E16B 3VGCB 3EA8A 1DUEA 1DE7H 2SNVA 2D26C 4OGYA 1PPEE 1NM6A 1XVOA 1UVSH 2A7CA 3RDZA 1PYTC 1INCA 1V2ST 3S9AA 1EXFA 4E7NA 1D3PB 1GBLA 1FLEE 1GBCA 1HFDA 2ZFRH 2ZGHA 3P6ZB 2HNTC 1O3HA 5FPSA 1V2LT 5EQSA 2PR3A 1X7AC 6LPRA 1ZHPA 1MAXA 3QO6A 4FU9A 4DIHH 3TK5A 3SU3A 1F0UA 1KXBA 1GBIA 8GCHF 4K5ZA 1KLTA 2J4IA 1NO9H 4YLUA 3RXOA 1SGTA 4MPUA 4ZHLU 1EOLA 1YPJH 2Z3EA 4ISOA 4CRBA 1P06A 3K6YA 1J8AA 4FU8A 1UVTH 2BTCE 3P95A 3V7TA 5ETXA 2XC4A 1PYTD 2BHGA 3RXUA 1GMHF 2FOFA 3GDUA 5JPMH 1TPOA 1ZPCA 4X6MA 2WPLS 5B6OA 3SJ9A 4INHA 3RC5A 1TMUH 1RGQA 1NTPA 4OS1A 1C5XB 1H4WA 3GY2A 1O3NA 1OYQA 1TX6A 3ZVGA 1L0ZA 2FLBH 1EP5A 1ETRH 2FOBA 1GBAA 4DW2U 5ESBA 1C5ZB 2I6SA 4Q7YA 3T2NA 3E0NB 2BY6X 1BTHH 2C90B 4LZ1H 4AFQA 1P02A 3T26A 1DS2E 1GI0A 1QA0A 2BQ6B 2CF8H 3I78A 4B71A 3UQOA 2ALPA 3BV9B 4Y6DA 2G51A 2OXSA 1LKAA 1MBMA 1L1GA 1O5FH 1DXPA 3L3TA 2PKSB 4IBLH 2QXIA 1T32A 2F9PA 3S9BA 8LPRA 1BTXA 1SPJA 3HATH 1AZ8A 3BTEE 1XMNB 2BLQA 2H5DA 2GT8A 4K60A 1C1TA 3UIRA 1H9HE 4E05H 1B0EA 1OXGA 5L2ZH 2H9HA 4ZKOU 4FUIA 5EW1H 1BZXE 1FNIA 4GVUA 1O5EH 2ZNKH 1AKSA 1ANEA 2FTLE 2C8XB 2GV7A 4SGAE 1VGCB 3SGBE 2JETC 1YPKH 4DT7B 1CGIE 2FO9A 1UK3A 1W14U 2ZQ2A 3QK1A 2ZU2A 4I8LA 5JBCS 2ZDNA 1B5GH 5SGAE 4D7FA 1A5IA 1BMAA 4YT6H 1N8OC 2SGDE 1TX7A 3M7UA 3BTME 1FAXA 2BDCA 7KMEH 1FI8A 1L2EA 2CMYA 1OWEA 3U1IB 2ZP0H 2H6MA 4TY7A 2FIRH 5LGOA 3SGAE 1WBGB 1THRH 1LVBA 4FVBA 2SFAA 3A7TA 1DUAA 1ZYOA 1A4WH 1P8VC 1UO6A 3NZIA 2FOCA 4Y76A 3RXHA 1BBRH 1DWBH 2P94A 2FMJA 1NFWA 1C1MA 1J9CH 1SGRE 1OP0A 1UCYK 3A88A 3BIVH 1O2HA 1OPHB 3PV4A 3ELAH 3M5NA 1O5GH 1ESAA 2YNAA 3UY9A 2D8WA 4JZ1A 3AASA 1QBVH 3D62A 1YYY1 2A7JA 1P2JA 1C2LA 4CBNA 3MO9A 4JZDH 2FTMA 3BEUA 2VWNA 1FPCH 3T29A 2PLXA 2ZFSA 4YOIA 3DHKH 2BD3A 4LOYH 1O2ZA 3ZZ3A 4DOQA 1MZDA 1TBQH 3C27B 1C5RA 2NU3E 4A7IB 3SV9A 2BD5A 1QB1A 1FY4A 1BRCE 2FS9A 5C1UA 2STBE 4HTCH 1EB1H 7GCHF 3TH2H 3TLOA 4JYVH 1YCPH 1OSSA 1C5WB 3MU4A 1OP2A 4YZUA 5A0CA 1HAZB 1V3XA 3RXMA 3KQBA 5JBTA 3F6UH 3RXDA 1IQHA 1ANCA 3P70B 3R3GB 4ZMAH 1AWFH 1TBRH 2G00A 5DG6A 2PUQH 1GHBG 4TY6A 4H6SB 2HRVA 3I77A 3TU7H 1A0LA 3WY8A 4FU7A 4TPYA 3AVZA 1BJUA 1TNIA 3P92A 1FUJA 3KNXA 2QXJA 5EGMA 1LMWB 3SORA 3GISB 4Y0YE 2HNTE 1LHDH 1TGBA 4JK5A 2ZZUH 3RXQA 4O03A 5J4QA 2FI5E 5C67A 1S82A 4KGAA 1J14A 1GBDA 1UHBA 1YBWA 1TOCB 3GICB 4AB9A 2ZGJA 1W10U 3ENSB 1C4V2 1O3LA 3QTOH 4YM9A 1KDQA 2UUFB 1ETTH 4JCNA 3RUOA 2FOMB 4ABAA 4XDEA 2WPHS 4AG1A 3M3SA 1P11E 4ZXXH 1VITF 4INLA 3UNRA 2VIQA 1Y3YA 4GHQA 3RXIA 4Y7BA 2ZDVH 1FN8A 1HPGA 4HZHA 2BZ6H 3A84A 3O8BA 1UHBB 1O37A 2GP9B 1GI3A 3U9AH 1TRYA 2XTTB 2KAIA 1O3MA 3S7KB 1BJVA 4JK6A 1KDQB 1Z8GA 4ABHA 4Y71A 2TGDA 2WYJA 1C1OA 3SUGA 1SVPA 4Y10E 1HJAB 3W94A 3RXVA 2OTVA 2GCTC 1O3KA 1A0JA 1MTWA 4B2AA 1YGCH 2A45B 1KXEA 4WY3A 1IQEA 2JETB 3E8LA 1H8IH 1T4VH 4TPIZ 1SQOA 5EW2H 1QURH 1HAGE 4WMEA 1YM0A 2F91A 1C5SA 2KAIB 1LKBA 4MNWA 1CO7E 2BX4A 4JMYA 1V2VT 4Q80A 1DLEA 1C5LH 2FEQH 2BOKA 3PMAB 1QJ6B 2BLVA 2BDYA 4BANB 2H2ZA 3BTDE 2BQ7B 4X6PA 2ZGBH 1MH0A 2AGGX 3KIDU 3SUFA 1MKWK 4WMFA 1EZXC 1TNKA 4NIXA 3PWCA 2G4TA 1MKXK 3VB6A 1O34A 1PPCE 1GI2A 3MNBA 2XBYA 1NY22 2VIDA 1O2IA 2JH6D 3DFLA 2CF9H 3TJOA 3U69H 2B7DH 4YOGA 3FANA 2PWXA 2YNBA 1V2UT 4X8VH 4U01A 4Q7XA 3QX5H 1L1JA 3LH3A 1ZPBA 3D65E 1O0DH 1Z71A 1WV7H 4FUFA 2Z9GA 3RXJA 1GGDC 3RXAA 4WXVA 2ZFPH 2BD9A 4RKOB 2XYAA 4B75A 4GAWA 3OY5U 1F92A 1K21H 1M9UA 2ZIQH 2O9QA 5IYTA 1HV7A 4BAQB 3OSYA 1HAVA 2J9NA 1FONA 1SQAA 2OC8A 1BBRE 1C2IA 5EQQA 3M7TA 1O3OA 1RJXB 2WPKS 4ZHAA 5JBAS 2C8WB 1QQ4A 2BY8X 1TGSZ 1ZTKA 5DP3A 1EUFA 3MU0A 1PPBH 4ZUHA 1ACBE 1BMLA 1SSXA 1EX3A 1O3EA 1P09A 3Q00A 3SNEA 4JZEH 5A8XA 4SGBE 1RXPA 1P05A 4WF8A 1O2TA 2A4OA 2PW8H 1OWKA 2D1JA 1AGJA 3NK8A 3RXFA 3ZV9A 1O32A 1ZZZA 3QGJA 1HAVB 4J2YB 5LPEA 1BHXB 1EP6A 1C5VA 2ZPQA 1P12E 2VWLA 3HKIB 2AIPA 1K1OA 1W13U 2OUAA 2OINA 1O2PA 2NU0E 5JDUB 3BEIB 5FBIA 3SU0A 1W11U 1A46H 5EU8A 1Y8TA 4AOQA 2DE8A 2OC0A 2ZCHP 1GJBB 2QYIA 2FI4E 1JIRA 2PUXB 3LU9B 1Y3WA 2QF0A 1F5LA 2B8OH 2QV1A 3OX7U 2C8ZB 1WQSA 3MH6A 1V2NT 3TK6A 2TBSA 2XBVA 3BTFE 4UDWH 3S9CA 1F7ZA 1SGDE 1TNGA 2SGQE 3GOVB 1C5YB 4MPVA 3RXLA 4NA9H 2W7SA 5BRRE 1IQKA 2GVFA 2Y5FA 1GBHA 3V3MA 2PKAA 1XX9A 1QGFA 1VCWA 1AU8A 2BLOA 4KTSA 2R9PA 2BOHB 2FOAA 1UTJA 4K1TA 1VJ9U 3M3TA 1P0SH 1T7CA 2A1DB 2CHAB 1GPZA 1WU1A 1VCQA 2XWAA 1C2JA 2PGBB 3SHCH 2HWLB 4AX9H 4BXWA 1XM1A 2BZAA 2Y5HA 3U98H 2HVXA 1JRSA 3TITA 1QB6A 3SNDA 3GY4A 1A61H 3A82A 3LJOA 3A7VA 2VB0A 2PKAB 1BTWA 3LGVA 4CRGA 1SMFE 1ZJDA 5A8YA 3LONA 4DG4A 4XFQA 1GHBF 1SQTA 2BDGA 1XVMA 1O3FA 4WJG2 1E34B 3MWIU 2FESH 4ABFA 1O3PB 3JZ1B 4HI3A 2VINA 1SLXB 1CGJE 1PJPA 2QXGA 5LPFA 3HGPA 1HJ9A 2XXLA 1JBUH 3ODFA 3RXKA 1MU6B 1TBZH 2ZDKA 4KTUA 5K0HA 2PHBA 2XC0A 1A7SA 2K1QA 3RP2A 9ESTA 1AVWA 1DFPA 1HXFH 2FLRH 4IN2A 2XCFA 3SU4A 1JMOH 4CH8B 2ZTYA 3TH3H 2WUBA 2UUKB 4U2WA 4AN7A 4CRCA 5DP7A 3SV7A 3K65B 3TNTA 1DITH 1TNHA 1Y5BT 1DY8A 3V12A 1GI6A 3UQVA 1YF4A 2ZU3A 2RCEA 5FCKA 1QRXA 4ZHMU 1GGDB 1ORFA 1TPPA 1OWIA 2QCYA 1HAHH 1GMDF 4ABBA 1S0RA 3LGYA 1OP8A 1O2RA 1TIOA 1LCYA 3TVJB 1N6XA 2VH6A 1HRTH 4BAHB 2ZFTA 3BF6H 1O39A 4K8YA 3SV6A 5HM2A 2BD8A 2J34A 3RU4T 2LNCA 3P8GA 1OS8A 3K6ZA 3NXPA 2PTNA 2A4RA 4ZAEA 3RXEA 5HXFA 4MTBA 3PMHB 3QLPH 3K2UA 3ODDA 3ZZ6A 4B73A 1WOFA 1AIXH 5A0BA 1C2EA 2H9EH 1KTSB 1PPZA 1SG8B 3D23A 3DFJA 5C1XA 1XXFA 2P95A 1CA0C 1KXCA 3SJOA 1O2OA 1EJAA 2UUJB 3A81A 1SGPE 3RXCA 3SU1A 3ZZ5A 1S0QA 3A8CA 1NS3A 1D3DB 4ISNA 1LHGH 1O30A 1AD8H 1HNEE 1EPTC 1O2QA 1DDJA 4XE4A 1G37A 1O3CA 1K1NA 5TCAA 2P3UB 2R3YA 1T8NA 1P9UA 2P3FH 4K1EA 3RXSA 3MH5A 2VWOA 3MMGA 5F6MA 2G4UA 4HFPB 3H5CB 2A2QH 1DOJA 6GCHG 1C2GA 3BTKE 1ARBA 2HPQH 4BAKB 1CU1A 1BMNH 1E38B 1UTPA 2XNIA 2SGAA 4NWLA 5FPYA 4MDSA 1TA2A 3KQEA 2XWBI 3HPTB 3V13A 2GGVB 3FP6E 1LVOA 2A4QA 3ZYDA 1ZSJA 4R0IA 1ZOMA 5PTPA 5LH8A 1P2MA 1ZHMA 1AWHB 3NKKA 1O33A 1MUEB 1SGFA 1CVWH 1MZAA 1XXDA 3UUZA 2FOHA 4B1TA 1WYKA 4X1RU 4NGAH 3TH4H 5A2MH 1O5AB 2ZC9H 3GCTF 1TX8A 2AEIH 2G8TA 3LKWA 3M5LA 1DWDH 1THSH 2A0QB 2XBXA 3O8RA 1O3AA 2ZF0H 1MD8A 3RMNH 1DLKB 1C4U2 1C1SA 2CJIA 3KHVA 1EAWA 4Y8YA 2B0FA 3PM3A 5C5OA 3M3VA 4NFEA 2V3OH 1P2IA 4Y7AA 3RMOH 1QBNA 1QL7A 2J94A 3LC5A 1VR1H 3AW0A 5E2PA 2R2WU 1AQ7A 2AFQB 1BITA 5HMAA 7LPRA 3A86A 1HJAC 2BD4A 5EPNA 2FS8A 2QN5T 4D7GA 3SHAH 4ABEA 3HGNA 2EC9H 1YCPM 1Z7KA 1TPAE 3LGUA 4I32A 2W3IA 3ATIA 4CR9A 4IMZA 1E35B 2WPJS 1E37B 3MYWA 5CMXH 4H6TA 4FUGA 3ZZ7A 3ATLA 1DSTA 3SUDA 1C9PA 5A09A 2FZZA 1GCTC 4NCYA 1ANDA 1BQYA 1HIAA 2FM2A 2VWMA 1ELGA 1AKSB 4FUHA 1KYNA 1LO6A 3P17H 1H9LB 3GY5A 3H7OA 1SLWB 2I6QA 3A85A 3OU0A 2FODA 3EYDA 1NFUA 1SGCA 1YLCA 3ZZ9A 1DPOA 1GJ9B 1MCVA 3AAUA 6ESTA 1ZGIA 3TJVA 3GYLB 4IMQA 1C1VH 1Z8IB 3FVFB 5DKMA 2FP7B 4AZ2B 1D3TB 3MH7A 4GPGA 3GYMA 1WSSH 1P3CA 1EPTA 2FPZA 3A8BA 4O3UA 1HIAB 1Z1IA 5GXPA 1D3QB 4X2YA 1NU7B 1Z8RA 4ISIH 2GMTB 1G2MA 2ZQ1A 2BDBA 2M5TA 4IC6A 1TNJA 1DANH 3PTBA 1AE8H 3QDZB 1CA0B 1TPSA 2FYRA 2ODYB 5FAHA 2ZHWH 1QY6A 1ZRKA 2D2DA 1V2PT 2NU1E 1TNLA 3E1XB 2BX3A 4YOJA 4AGJA 4ZKNU 1SBWA
chains in the Genus database with same CATH superfamily
1GJAB 1KMHB 1EPTB 5TCCA 1BTZA 2YMSB 2BY7X 1ELCA 4WH8A 3Q77A 1EZSC 4BTUB 3KEEA 4M7GA 4RN6A 2G55A 1FAKH 1U6QA 3SU2A 2W7UA 3ZZDA 2G5NA 1TRNA 3GY7A 1FIZA 2QY0B 3ZVEA 1K0HA 1S81A 2O8WA 4RKJB 2Y82A 1HDTH 3UFAA 5HGGA 1GG6B 1DXWA 5EQRA 2V35A 1NT1A 4IN1A 3SOSA 2KM0A 2PV9B 1YPEH 5DPAA 1GMDG 2VIPA 2ZGCA 4FUJA 4E06H 4F48B 1BTUA 1O2LA 1AB9C 3SI3H 2AGIX 4NIYA 5GCHF 3NCLA 5KEDA 3ITIA 2TIOA 1NRPH 1SLUB 1YC0A 2XCNA 1UVUH 1XKAC 5C1YA 1HB0B 2BXTH 3H09A 5A8ZA 1G3BA 1SGIB 1ELEE 4ZH8A 1T31A 1QB9A 3P8OA 2AS9A 3SI4H 3DSPA 1GL0E 4YXWD 1BRAA 4X2XA 1J15A 3S0NA 1ZMNA 2Q1JA 4ASHA 2A5IA 1ANBA 5C3NA 1BRBE 5F8ZA 3RXTA 1GHYH 5FPTA 3A7XA 1O5DH 3P8FA 5GJ4B 3F0PA 1LVYA 2CHAC 1EAXA 2J5UA 3B9FH 3SV2H 4Q63A 1BRUP 1V6DA 1W0KD 3GY3A 1DICA 4DVAU 1TQ0B 3ATMA 5TJXA 1IQJA 1QJ7B 1RTKA 1WAYB 3BN9A 2XNDD 2RFKC 1S5SA 2AYWA 1LHEH 1MAYA 1UCYH 4WH6A 2L74A 1GHZA 2ANWA 1PQAA 3FP8E 4NFFA 1HYLA 2ZECA 1VCPA 1GBJA 1ZRBA 1OOKB 3F2FA 3CS0A 1FY8E 1V2JT 1EQ9A 1P03A 2FWWA 5F53A 3VG8A 3SUEA 1UTOA 1LQEA 1GJ8B 3PMBB 3PYHA 1FZZA 1O36A 4UEHH 2OD3B 3ZZAA 1GCTB 2CGAA 2A4GA 3QWCH 2VGCC 3O8DA 4Z1MD 4X1NU 3ZZCA 2QC2A 3RU4D 1GBKA 1CHOG 1HAOH 1QFKH 4DIIH 2GTBA 4E7RG 1TE0A 2KFWA 4OS7A 1L4DA 3TPIZ 2WPDD 1FDPA 5GDSH 2PSXA 4OS2A 4X6OA 1S85A 2ZCKP 3SGQE 3MO3A 2FXRA 6GCHF 1MU8B 1DY9A 5EG4A 2AH4X 3F9FA 2HLCA 3OAAD 4DCDA 5L2YH 1PPFE 1BB0B 1CGHA 3FO8D 3TNSA 1KLIH 1V2TT 1K22H 3QZQA 3ZVAA 3GCTG 2W5EA 4ZROA 1C5UA 1O5CB 5CE1A 5FHTA 1ZMJA 2AERH 4YLQH 2F3CE 1THPB 1TQ7B 1K1JA 1G3EA 3LT3A 4Y8XA 3FZZA 3H7TA 3FZDA 1BIOA 2ZPRA 3HK6B 3ZV8A 4K8BA 1FV9A 5JB8S 5E8EH 1IQNA 2BB4A 4ISLA 3MTYA 2ZPSA 3PLKA 2B5TB 1L4ZA 3PLPA 3RXPA 2ZCLP 2QA9E 1F5KU 2WINI 1Y3XA 1NU9A 1OWJA 3PV2A 1WQVH 4A1TA 1MTSA 5F8XA 3VB3A 2QE7D 2R2MB 3KGPA 4AG2A 3MO6A 4ZKRU 2O8UA 1O38A 1BUIA 2J2UA 2TPIZ 2QAAA 4I8GA 1OYTH 2PTCE 5T6FA 3RXRA 5I46H 3Q3XA 1DT2A 2FX4A 3KN2A 4GSOA 1UW7A 4KELA 4FXGH 1EKBB 1P01A 1GJ4H 2OBOA 3QN7A 1P2OA 1NZQH 4P00A 1GMCG 2P8OC 4THNH 1HLTH 2BVRH 3C1KA 4Z6AH 3PROA 2BMGB 2GV6A 2Y7ZA 4F49A 4ACAA 4ESTE 1ZTLA 3F68H 1VJAU 4TYDA 4NSVA 4X6NA 4X8UH 3IG6B 2QGRA 1Y5UT 3PWBA 1VZQH 2HNTF 3U1JB 1VITH 2H5CA 2ZWLH 2BD2A 3CENA 4AYVB 2HGTH 4CREA 1JXPA 2AGEX 3GY8A 1O2UA 4Y0ZE 4NSYA 3STJA 3RC6A 1DM4B 1D4PB 2ILNA 3LGTA 3U28C 1FY3A 4BTIB 1D6RA 1K1MA 1F5RA 1P2KA 1AB9B 2ZU4A 3M35A 1MQ6A 3DT0H 1BOQA 2H9TH 4I33A 2ASUB 1NFYA 3F9EA 3P8NA 4D76A 1RTLA 4WVPE 3RMMH 3LIWA 2IJOB 4DY7B 2XW9A 2VIOA 4DJZB 3UTUH 1O3GA 3A8AA 2VVCA 3FAOA 1TONA 1RTFB 1HAIH 4K3JA 2C4FH 3I29A 5HKKD 1ESTA 1KIGH 1GCDA 4CRDA 2VVVA 3ZZBA 4AFUA 4BAMB 4OS5A 1L1NA 3KQCA 2ANMH 3RLYH 2ZFFH 1MMJN 1T8OA 2ZKSA 3RMLH 3VB4A 2HPPH 1Q3XA 5E0JA 2ZTXA 2GT7A 4NZQA 2BDAA 1EZUC 2IN2A 1SR5C 3DCLA 1O3BA 1MKWH 1W12U 3GCHB 1XUJA 1D9IA 4I31A 1MKXH 1FQ3A 2NWNA 2Y5GA 2Z6BD 2WUCA 4X1SU 3A87A 3DUXH 3UOPA 1CA8B 3UNSA 3G01A 1SHHB 2BXUH 3CS7A 1KXDA 3EA9A 3FP7E 1IQFA 3AW1A 1UTKA 4OS6A 3SV8A 3VFEA 4CHAB 4JZFH 3E3TA 1HUTH 2KZ4A 1MCTA 4MQAA 3RU4E 4AB8A 1NROH 1F0RA 3ZYEA 3LPRA 1O2KA 2O8TA 4MNVA 1O2MA 4M9FA 1P2QA 2Z3DA 3IWMA 4XD7D 3TGKE 5GNDA 2ESTE 2VGCB 3T28A 1SGYE 1BA8B 1S6HA 4QT8C 5CDFE 1AFQC 3MQKC 4NG9H 4FUDA 2Y81A 1GHAG 3HK3B 1CT4E 4ABIA 5FX5A 1SOTA 1WDIA 4K69A 1LQDB 1UTMA 1MQ5A 2Z7FE 5EJZA 5GCHG 1QQUA 5HIZA 1LPKB 4VGCC 3F9HA 3MU5A 3VPKA 3LJJA 1LHFH 2J98A 1GI5A 1EASA 2P16A 5E0HA 1UCYE 1OWHA 1C9TA 2QIQA 1C1UH 2OBQA 1CE5A 1CSOE 1Y3UA 3S69A 1TB6H 1W8BH 1KXAA 1GL1A 3GCNA 1HCGA 4IS5A 5HM9A 3MU8A 1GWAA 1SHYA 4JYTA 2BDIA 1O2XA 1RIWC 1TFXA 1Y59T 5F8TA 2G52A 1MTNB 5DP4A 1LDTT 2Z9IA 2OP9A 1SL3A 3VXFH 5DGJA 1C2FA 2UWLA 3Q3KA 3A83A 1P57B 2J98B 3E90B 1SLVB 5JB9S 1FJSA 1CHGA 3TGJE 2GZ8A 3PLBA 2GMTC 1HAXB 3R0FA 2H1UA 1TOMH 3RM0H 1ESBA 1C1PA 2CXVA 2Z94A 2KX4A 2RDLA 1H1BA 1GDUA 2W26A 1TRMA 2C3SA 2ZHQH 1IHSH 2DE9A 3QUMP 3MNCA 1SFIA 4PROA 1O31A 1GJ7B 4A1VA 5AF9H 2Z3CA 4X8SH 1EATA 2OC7A 4FUEA 3BSQA 2P8OB 4CH2B 3QTVH 1E1QD 1TWXB 4MPWA 1BBRK 5C5NA 3LH1A 1FY1A 3EDXB 3NPSA 2BM2A 3OTJE 4K2YA 1SGFG 1W3CA 5AFYH 3ESTA 2YMSC 4MLFB 3WWBA 4FETA 4TT3D 5L30H 1BCUH 4B74A 1SKYE 4X2WA 2C8YB 1O5BB 1GHXH 5EJLA 4BXSA 1AUTC 1GVZA 3KQDA 3UPEA 2BDHA 2EEKA 5DP8A 4H42U 3GDSA 3N7OA 4GCHG 8KME2 1GG6C 2ZDMA 1C5TA 1CHOF 1QJ1B 4R8TB 4ABGA 4INKA 2QF3A 3ATWA 4IGDA 1V2RT 3KYFA 2WPIS 5FX6A 1TA6A 1BHXF 2YMSD 2ZGXH 4WWYA 2ZA5A 1TMTH 1YCPK 2F9OA 5B6LA 3A80A 3HKJB 4O97A 1NRQH 5AFZH 3SBKA 1CQQA 1GHVH 1UTQA 1AZZA 2KCPA 2Y6TA 4XBDA 3SU5A 1YLNA 5C20A 2F9BH 3B8JA 1XUGA 1GI4A 1ZLRA 1WTGH 1XUHA 2PP6A 2UUYA 3SNAA 1G30B 1JOUB 1A2CH 2BQWB 3NUMA 1CBWB 2UWPA 4MNYA 2ALVA 3BTTE 4AFSA 2CN0H 1GJ6A 4BAOB 2AMPA 3RLWH 1RD3B 3SW2B 1K28D 3BG4B 4KKDA 1H8DH 1ZSLA 4YTAA 2XBWA 1TMBH 1ZMLA 2EA3A 1JWTA 2BYAX 2V3HH 2Y7XA 3KL6A 3EAJA 2OK5A 1BTYA 1AN1E 2ZDAH 5JBBS 2IJD1 3QGNB 4MVNA 1SFQB 3ZVCA 2VU8E 2ZO3H 3A89A 3SJIA 3TK9A 2WSSD 1W0ZU 1PQ5A 1B7XB 4J1YA 1ZHRA 4A5TS 4A92A 3OEED 1KSNA 3SZNA 2VIVA 2ZEBA 1C5QA 2FX6A 1A0HB 2Z9KA 4YO9A 1ELDE 1AFQB 4KTCA 2ODQA 4FOUC 3SN8A 1TALA 1TGTA 1IHTH 2R0LA 1LPZB 1ELFA 1GMCF 2ZTZA 4UD9H 4CRFA 2VIWA 3VEQB 1IQIA 5AVDA 1YKTA 1P10A 1YPLH 2GKVE 3BTHE 2XOKD 2GZ9A 2AHME 4I8JA 3Q3YA 1ETSH 4D9RA 1E36B 1UVPA 2KCYA 3SQHE 2V6NA 3QZRA 4XBBA 5GIBA 4VGCB 4NZLA 1AO5A 1ZJKA 1IQLA 2OQ5A 3MU1A 1YPHC 3JZ2B 3VB5A 4RSPA 1BT7A 1EOJA 1GI7B 1K1PA 2W6JD 3M61U 1C1WH 1GVLA 2OC1A 3EGKH 5T1VA 1C2DA 4WMDA 5FXLA 1S83A 1BMMH 3L6PA 1O2NA 5T6GA 4K1SA 3M5OA 1F2SE 1RS0A 5F03A 1UK4A 4I7YH 4GUXA 1RIWB 1T8LA 3UOUA 5DP6A 4Y11E 4I8KA 3BEFB 1EZQA 3IITA 5A0AE 4CRAA 1NRRH 1FY5A 3SJ8A 1TAWA 4Z0KA 2GZ7A 4TWWA 2ZHEH 3BTQE 1AHTH 1HXEH 3T27A 1GBFA 1C5NH 1S84A 1T4UH 4WXIA 1QRZA 1WUNH 1NFXA 3SQEE 2GX4A 1SGNE 9LPRA 1D6WA 1KLJH 1CT2E 2PSYA 4AYYB 4ZKSU 1QRWA 5EOKA 1NRSH 1A5GH 1GI9B 3BIUH 3PO1B 2P59A 2Q6GA 1ZPZA 3CP7A 1NESE 2TRMA 1G32B 3RXBA 1ID5H 5E2OA 2DUCA 4NIVA 1G2LA 4A6LA 1Z6JH 1FPHH 4U32A 5EODA 3Q76A 3TIUA 1C1RA 1P2NA 1Z1JA 5DO4H 2P93A 2RA3A 2R3UA 1C1QA 1QL9A 5G4BA 2BLWA 5GPIB 1ZR0A 3EQ0H 4ABJA 1EB2A 5FL7D 2GDDA 4YT7H 2GCHG 1DX5M 1AE5A 1E0FD 2VJ1A 3K9XB 4TSFD 4X1PU 2VVUA 4DGJA 1A3BH 4X0WU 1GHAF 1QTFA 2ZU5A 3E0PB 3UB0A 1NC6A 1W7GH 1ABJH 1ELBA 3TJUA 1Z6EA 7ESTE 2EI6A 1LVMA 5T6DA 4AGKA 1GHWH 1N6YA 1SC8U 3MFJA 3E91A 1XUIA 2QXHA 4NWKA 3BG8A 1YP9A 4MG3A 5DK1A 4XBCA 2TGAA 4NA7A 1W7XH 2WV5A 2FDAA 5DP9A 1IOEA 1P9SA 4XOJA 1Q2WA 1RFNA 2VBCA 1EAUA 3MH4A 3T5FH 2FYQA 4BOHA 3BTGE 2A2XH 4JYUH 1C5PA 1E1RD 2O8MA 2A5AA 2F9NA 2IPHA 3L33A 1MBQA 1Y5AT 1QNJA 1SB1H 1TGNA 5H4IB 3M37A 1ZTJA 3GCHC 4D8NA 2V0BA 2GDEH 3U8TH 5AHGH 2A31A 2V7QD 1V2WT 3SO3A 1S6FA 1G36A 4B76A 4I8HA 1IQGA 1LHCH 1QA7A 4CBOA 1TABE 1KTTB 3N7DA 1QR3E 3LDXH 2TGTA 6CHAC 5C2ZA 1UTNA 2ZDLA 3U8OH 2Q6FA 1YWUA 2RA0A 4CHAC 3PMJA 1WTHD 4A1XA 1E79D 5HYOA 5I25A 2SNWA 3MNSA 3KQ5A 1DSUA 3T25A 8ESTE 1KXFA 3OY6U 1V2KT 8GCHG 5EJ1A 1K1IA 1OX1A 2LELA 3GY6A 1HAYB 1UVOA 3KF2A 2IOTA 1GJDB 1TYNA 1A3EH 1Q31A 3EA7A 4TWYA 1N8OB 1T8MA 2WV4A 4MPXA 3MOCA 5FCRA 3TJNA 2AIQA 5T3HA 1GDQA 1XUFA 5DJ7A 1GMHG 4OS4A 3ZZ8A 2A7HA 2VNTA 3RM2H 3KCGH 2SGEE 1OHHD 1UMAH 2GD4B 5EXLA 3UNQA 3ZVBA 2NU4E 4AORA 3S7HB 1NPMA 2LPRA 3LGWA 4GCHF 3GCOA 1YPHE 1C1NA 1O3JA 5L6NH 5CHAC 2OLGA 2AMDA 1SI5H 1W0YH 2EI7A 4U30A 5C94A 1IAUA 3A7YA 2PGQB 5K7RA 3O8CA 2J38A 2OCVB 3UR6A 1NN6A 3F9GA 4YESB 4BNRA 1MD7A 1PPGE 1FIWA 1NRNH 1EJNA 2G81E 4UFEH 1MTNC 5FBEA 3URCA 2F43B 3VXEH 3UAIC 4JZIA 1COWD 1YY3A 2AMQA 1O3IA 3F2GA 3MI4A 1HJ8A 3MHWU 4AFZA 3M7QA 2SGPE 3RC4A 4UFDH 3AAVA 2J92A 1LPGB 4HGCA 1GVKB 1DVAH 4LK4A 2Z9JA 3BTWE 1QCPA 2Y80A 2ZU1A 1O3DA 1AMHA 1Z8JB 2K8IA 1GJ5H 1HGTH 4X1QU 2M2AA 3LGIA 4X2VA 3GDVA 1AY6H 3VGCC 1EJMA 1GDNA 2TGPZ 1HBTH 4OGXA 3NWUA 3ATKA 1C2HA 1CT0E 1AI8H 2CV3A 2R0KA 2J97A 2BVXH 1BDAA 1V2MT 2A5KA 1PFXC 3FOAA 2XRCA 5DP5A 5GWZA 1K1LA 4DURA 5EXNA 2JH5D 3SU6A 3F1SB 1B0FA 1EAIA 2P3TB 2XC5A 4FUBA 1ELVA 1GBBA 1O2VA 1RRKA 2STAE 2JKHA 2SGFE 4UE7H 1AVXA 3UWJH 3LC3A 1YLDA 1BMFD 3A7ZA 3LOXA 1FMGA 4NIWA 2F9VA 1SQRA 5E0GA 2EI8A 4Y8ZA 1JRTA 2ULLA 4O9VA 1GI8B 3MNXA 1SOZA 5J4SA 1YPMH 1NBMD 2Q6DA 2WPMS 1YPGH 3W95A 3ZZ4A 1A5HA 5EXMA 3WW7A 4D9QA 1H9IE 2PFEA 1C5MD 2ZFQH 1K9OE 3DD2H 1O2GH 4O3TA 1KY9A 2W3KA 1F0SA 4LXBH 2HOBA 5LPRA 1OKXA 3PTNA 4ISHH 3UREA 2V3MA 3ZVFA 1G9IE 1AUJA 1UJ1A 1O35A 1GBMA 1SGQE 2J95A 2BVSH 1ABIH 3STIA 4B2BA 1QHRB 1W2KH 1CBWC 1H8ED 1MTVA 1C2MA 1GBTA 1O2SA 7GCHG 1MTUA 1C4Y2 4MNXA 1UTLM 1K2I1 1C2KA 1P04A 3SJKA 1J16A 5IDKA 1TLDA 4NA8A 6CHAB 3BG4C 1QBOA 4Y79A 2ZG0H 3B23B 2C93B 1FX0B 1PQ7A 2PKSC 4Q2KA 2ODPA 2HALA 4FUCA 4B2CA 2BY5X 3U8RH 1A1RA 2Z9LA 1O2WA 2ANKH 4LZ4B 2G5VA 2FI3E 2F9UA 2GCTB 4GHTA 4XSKU 2FOEA 5IK2D 2F83A 4KP0A 2B9LA 2RG3A 4F4OC 4Q7ZA 3W1EA 2ZI2H 2BD7A 3N99A 4X8TH 1QIXB 3UWIA 1OWDA 2HVYB 2JH0D 3T62A 1O2JA 1VGCC 1HAPH 5EPYA 1O2YA 2BY9X 4AC9A 1PPHE 3TGIE 4ZXYH 1N1LA 3SNCA 3SNBA 1P3EA 1WCZA 3A7WA 4FVDA 5CHBA 1GI1A 1IQMA 1C5OH 1XUKA 5JYIA 1FXYA 2VH0A 2GCHF 3E6PH 5HIYA 3M36A 1FN6A 1GBEA 5KECA 1Y3VA 1DWCH 2NU2E 3D49H 4CR5A 5CHAB 2WYGA 1ZGVA 1G3DA 1J17T 1AVGH 1F0TA 2THFB 1GJCB 3PB1E 2YOLA 3M5MA 5ESTE 1ELAA 1PQ8A 1ARCA 2UWOA 1UK2A 1VITG 1ZSKA 3EE0B 4UONA 3OYPA 2A32A 2FOGA 3RXGA 4H4FA 3ZVDA 1ELTA 1JIMA 5BPEA 2ZHFH 4UFGH 1V2QT 2OQUA 3V0XA 1SGEE 4GLYA 4ABDA 1DWEH 1V2OT 1AFEH 4IC5A 3ZIAD 5ABWA 2O8LA 3DA9B 3UR9A 1G3CA 1TGCA 4HG6A 1QL8A 4UFFH 3VB7A 1BTPA 4BTTB 3A8DA 3URDA 1LTOA 2ZHDA 3FFGA 2ANYA 1XKBC 4IW4E 3PO1C 3E16B 3VGCB 3EA8A 1DUEA 1DE7H 2SNVA 2D26C 4OGYA 1PPEE 1NM6A 1XVOA 1UVSH 2A7CA 3RDZA 1PYTC 1INCA 1V2ST 3S9AA 1EXFA 4E7NA 1D3PB 1GBLA 1FLEE 1GBCA 1HFDA 2ZFRH 2ZGHA 3P6ZB 2HNTC 1O3HA 5FPSA 1V2LT 5EQSA 2PR3A 1X7AC 6LPRA 1NBME 1ZHPA 1MAXA 3QO6A 4FU9A 4DIHH 3TK5A 3SU3A 1F0UA 1KXBA 1GBIA 8GCHF 4K5ZA 1KLTA 2J4IA 1NO9H 4YLUA 3RXOA 1SGTA 4MPUA 4ZHLU 1EOLA 1YPJH 2Z3EA 4ISOA 4CRBA 1P06A 3K6YA 1J8AA 4FU8A 1UVTH 2BTCE 3P95A 3V7TA 5ETXA 2XC4A 1PYTD 2BHGA 3RXUA 1GMHF 2FOFA 3GDUA 5JPMH 1TPOA 1ZPCA 4X6MA 2WPLS 5B6OA 3SJ9A 4INHA 3RC5A 1TMUH 1RGQA 1NTPA 4OS1A 1C5XB 4RT0A 2EY4C 1H4WA 3GY2A 1O3NA 1OYQA 2F4LA 1TX6A 3ZVGA 1L0ZA 2FLBH 1EP5A 1ETRH 2FOBA 1GBAA 4DW2U 5ESBA 1C5ZB 2I6SA 4Q7YA 3T2NA 3E0NB 2BY6X 1BTHH 4RT1A 2C90B 4LZ1H 4AFQA 1P02A 3T26A 1DS2E 1GI0A 1QA0A 2BQ6B 2CF8H 3F0OA 3I78A 4B71A 3UQOA 2ALPA 3BV9B 4Y6DA 2G51A 2OXSA 1LKAA 1MBMA 1L1GA 1O5FH 3OFND 1DXPA 3L3TA 2PKSB 4IBLH 2QXIA 1T32A 2F9PA 3S9BA 3OEHD 8LPRA 1BTXA 1SPJA 3HATH 1AZ8A 3BTEE 5C17A 1XMNB 2BLQA 2H5DA 2GT8A 4K60A 1C1TA 3UIRA 1H9HE 4E05H 1B0EA 1OXGA 5L2ZH 5C0TA 2H9HA 4ZKOU 4FUIA 5EW1H 1BZXE 1FNIA 4GVUA 1O5EH 2ZNKH 1AKSA 1ANEA 2FTLE 2C8XB 2GV7A 4SGAE 1VGCB 3SGBE 2JETC 1YPKH 4DT7B 1CGIE 2FO9A 1UK3A 1W14U 2ZQ2A 3QK1A 2ZU2A 4I8LA 5JBCS 2ZDNA 1B5GH 5SGAE 4D7FA 1A5IA 3DSGA 1BMAA 4YT6H 1N8OC 2SGDE 1TX7A 3M7UA 3BTME 1FAXA 2BDCA 7KMEH 1FI8A 1L2EA 2CMYA 1OWEA 3U1IB 2ZP0H 2H6MA 4TY7A 2FIRH 5LGOA 3SGAE 1WBGB 1THRH 1LVBA 4FVBA 2SFAA 3A7TA 1DUAA 1VKYA 1ZYOA 1A4WH 1P8VC 1UO6A 3NZIA 4P02A 2FOCA 4Y76A 3RXHA 1BBRH 1DWBH 1W0JD 2P94A 2FMJA 1NFWA 1C1MA 1J9CH 1SGRE 1OP0A 1UCYK 3A88A 3BIVH 1O2HA 1OPHB 3PV4A 3ELAH 3M5NA 1O5GH 1ESAA 2YNAA 3UY9A 2D8WA 4JZ1A 3AASA 1QBVH 3D62A 3DSOA 1YYY1 2A7JA 1P2JA 1C2LA 4CBNA 3MO9A 4JZDH 2FTMA 3BEUA 2VWNA 1FPCH 3T29A 2PLXA 2ZFSA 4YOIA 3DHKH 2BD3A 4LOYH 1O2ZA 3ZZ3A 4DOQA 1S6LA 1MZDA 3PV5A 1TBQH 3WWFA 3C27B 1C5RA 2NU3E 4A7IB 3SV9A 2BD5A 1QB1A 1FY4A 1BRCE 2FS9A 5C1UA 2STBE 4HTCH 1EB1H 7GCHF 3TH2H 3TLOA 3SZEA 4JYVH 1YCPH 4DT4A 1OSSA 1C5WB 3MU4A 1OP2A 4YZUA 5A0CA 1HAZB 1V3XA 2RDEA 3RXMA 3KQBA 5JBTA 3F6UH 3RXDA 1IQHA 1ANCA 3P70B 3R3GB 4ZMAH 1AWFH 1TBRH 2G00A 5DG6A 2PUQH 1GHBG 4TY6A 4H6SB 2HRVA 3I77A 3TU7H 1A0LA 3WY8A 4FU7A 4TPYA 3AVZA 1BJUA 1TNIA 3P92A 1FUJA 3KNXA 2QXJA 5EGMA 1LMWB 3SORA 3GISB 4Y0YE 2HNTE 1LHDH 1TGBA 4JK5A 2ZZUH 3RXQA 4O03A 5J4QA 2FI5E 5C67A 1S82A 4KGAA 1J14A 1GBDA 1UHBA 1YBWA 1TOCB 3GICB 4AB9A 2ZGJA 1W10U 3ENSB 1C4V2 1O3LA 3QTOH 4YM9A 1KDQA 2UUFB 3KYGA 1ETTH 4JCNA 3RUOA 2FOMB 4ABAA 4XDEA 2WPHS 4AG1A 2KCAA 3M3SA 1P11E 4ZXXH 1VITF 4INLA 3UNRA 2VIQA 1Y3YA 4GHQA 3RXIA 4Y7BA 2ZDVH 1FN8A 1HPGA 4HZHA 5KGOA 2BZ6H 3A84A 3O8BA 1UHBB 1O37A 2GP9B 4F55A 1GI3A 4ASUD 3U9AH 1TRYA 2XTTB 2KAIA 1O3MA 3S7KB 1BJVA 4JK6A 1KDQB 1Z8GA 4ABHA 4Y71A 2WHXA 2TGDA 2WYJA 3PRDA 1C1OA 3SUGA 1H8HD 1SVPA 4Y10E 2KCOA 1HJAB 4B6FA 3W94A 3RXVA 2OTVA 2GCTC 1O3KA 1A0JA 1MTWA 4B2AA 1YGCH 2A45B 1KXEA 4I86A 4WY3A 1IQEA 2JETB 3E8LA 1H8IH 1T4VH 4TPIZ 1SQOA 5EW2H 1QURH 1HAGE 4WMEA 1YM0A 2F91A 1C5SA 2KAIB 1LKBA 4MNWA 1CO7E 2BX4A 4JMYA 1V2VT 4Q80A 1DLEA 1C5LH 2FEQH 2BOKA 3PMAB 1QJ6B 4Q4LA 2BLVA 2BDYA 4BANB 2H2ZA 3BTDE 2BQ7B 4X6PA 2ZGBH 1MH0A 2AGGX 3KIDU 3SUFA 1MKWK 4WMFA 1EZXC 1TNKA 4NIXA 3PWCA 2G4TA 1MKXK 3VB6A 1O34A 1PPCE 1GI2A 3MNBA 2XBYA 1NY22 2VIDA 1O2IA 2JH6D 3DFLA 2CF9H 3TJOA 3U69H 2B7DH 4YOGA 3FANA 2PWXA 2YNBA 1V2UT 4X8VH 4ACBA 4U01A 4Q7XA 2JJ2D 3OTPA 3QX5H 1L1JA 3LH3A 1ZPBA 3D65E 1O0DH 1Z71A 1WV7H 3F3BA 4OM9A 4FUFA 2Z9GA 3RXJA 1GGDC 3RXAA 4WXVA 2ZFPH 2CK3D 2BD9A 4RKOB 2XYAA 4B75A 4GAWA 3OY5U 3OE7D 1F92A 1K21H 1M9UA 2ZIQH 2O9QA 2KR7A 5IYTA 1HV7A 4BAQB 3OSYA 1HAVA 2J9NA 3FKSD 1FONA 1SQAA 2OC8A 1BBRE 1C2IA 4RI0A 3M7TA 1O3OA 1RJXB 2K0QA 2WPKS 5EQQA 4ZHAA 1EFRD 5JBAS 2C8WB 1QQ4A 2BY8X 1TGSZ 1ZTKA 5DP3A 1EUFA 3MU0A 1PPBH 4ZUHA 1ACBE 1BMLA 1SSXA 1EX3A 1O3EA 1P09A 3Q00A 3SNEA 4JZEH 5A8XA 4SGBE 1RXPA 1P05A 5DN6D 4WF8A 1O2TA 1QZ8A 2A4OA 2PW8H 1OWKA 2D1JA 1AGJA 3NK8A 3RXFA 3ZV9A 1O32A 1ZZZA 3QGJA 1HAVB 4J2YB 5LPEA 1BHXB 1EP6A 1C5VA 2ZPQA 1P12E 2VWLA 3HKIB 2AIPA 3EE7A 1K1OA 1W13U 2JDID 2OUAA 2OINA 1O2PA 2NU0E 5JDUB 3BEIB 5FBIA 3SU0A 1W11U 1A46H 5EU8A 1Y8TA 4AOQA 2DE8A 2OC0A 2ZCHP 1GJBB 2QYIA 2FI4E 2GJGA 1JIRA 2PUXB 3LU9B 1Y3WA 2QF0A 1F5LA 2B8OH 2QV1A 3OX7U 2C8ZB 1WQSA 3MH6A 1V2NT 3TK6A 2TBSA 2XBVA 3BTFE 4UDWH 3S9CA 1F7ZA 1SGDE 1TNGA 2SGQE 3GOVB 1C5YB 4MPVA 3RXLA 4NA9H 2W7SA 4B6EA 5BRRE 1IQKA 2GVFA 2Y5FA 1GBHA 2IPQX 3V3MA 2PKAA 1XX9A 1QGFA 1VCWA 1AU8A 2BLOA 4KTSA 2R9PA 2BOHB 2FOAA 1UTJA 4K1TA 1VJ9U 3M3TA 1P0SH 1T7CA 2A1DB 3SYJA 2CHAB 1GPZA 1WU1A 1VCQA 2XWAA 1C2JA 2PGBB 3SHCH 2HWLB 5DSFA 4AX9H 4BXWA 1XM1A 2BZAA 2Y5HA 3U98H 2HVXA 4ZCNA 1JRSA 3TITA 1QB6A 3SNDA 3GY4A 1A61H 3A82A 3LJOA 3A7VA 2VB0A 2PKAB 1BTWA 3LGVA 4CRGA 1SMFE 1ZJDA 5A8YA 2W6ID 3LONA 5EIYA 4DG4A 4XFQA 1GHBF 1SQTA 2BDGA 1XVMA 1O3FA 4WJG2 1E34B 3MWIU 2FESH 4ABFA 1O3PB 3JZ1B 4HI3A 2VINA 1SLXB 1CGJE 1PJPA 2QXGA 5LPFA 3HGPA 1HJ9A 2XXLA 1JBUH 3PRBA 3ODFA 3RXKA 1MU6B 1TBZH 2ZDKA 2QF4A 4KTUA 5K0HA 2PHBA 2XC0A 1A7SA 2K1QA 3RP2A 4XRNA 9ESTA 1AVWA 1DFPA 1HXFH 2FLRH 4IN2A 2XCFA 3SU4A 1JMOH 4CH8B 2ZTYA 3TH3H 2WUBA 2UUKB 4U2WA 4AN7A 4CRCA 5DP7A 3SV7A 3K65B 3TNTA 1DITH 1TNHA 1Y5BT 1DY8A 3V12A 1GI6A 1WXRA 3UQVA 1YF4A 2ZU3A 2RCEA 5FCKA 1QRXA 2JJ1D 4ZHMU 1GGDB 1ORFA 1TPPA 1OWIA 2QCYA 1HAHH 1GMDF 4ABBA 1S0RA 3LGYA 1OP8A 1O2RA 1TIOA 1LCYA 3TVJB 1N6XA 2VH6A 1HRTH 4BAHB 2WV9A 2ZFTA 3BF6H 1O39A 4K8YA 3SV6A 5HM2A 2BD8A 2J34A 3RU4T 2LNCA 3P8GA 1OS8A 3K6ZA 3NXPA 2PTNA 2A4RA 4ZAEA 3RXEA 5HXFA 4MTBA 3PMHB 3QLPH 3K2UA 3ODDA 3ZZ6A 4B73A 1WOFA 1AIXH 5A0BA 1C2EA 2H9EH 1KTSB 1PPZA 1SG8B 3D23A 3DFJA 5C1XA 1XXFA 2P95A 1CA0C 2LP6A 1KXCA 3SJOA 1O2OA 1EJAA 2UUJB 3A81A 1SGPE 3RXCA 3SU1A 3ZZ5A 1S0QA 3A8CA 1NS3A 1D3DB 4ISNA 1LHGH 1O30A 1AD8H 1HNEE 1EPTC 1O2QA 1DDJA 4XE4A 1G37A 1O3CA 2WZQA 1K1NA 5TCAA 2P3UB 2R3YA 1T8NA 1P9UA 2P3FH 4K1EA 3RXSA 3MH5A 2VWOA 3MMGA 5F6MA 2G4UA 4HFPB 3H5CB 2A2QH 1DOJA 6GCHG 1C2GA 5C0UA 2L6OA 3BTKE 2EQNA 1ARBA 2HPQH 4BAKB 3GS9A 1CU1A 1BMNH 1E38B 1UTPA 2XNIA 2SGAA 4NWLA 2HLDD 5FPYA 4MDSA 1TA2A 3KQEA 2XWBI 3HPTB 3V13A 2GGVB 3FP6E 1LVOA 2A4QA 3ZYDA 1ZSJA 4R0IA 1ZOMA 5PTPA 2QF5A 5LH8A 1P2MA 1ZHMA 1AWHB 3NKKA 1O33A 1MUEB 1SGFA 1CVWH 1MZAA 1XXDA 3UUZA 2FOHA 4B1TA 1WYKA 4X1RU 4NGAH 3TH4H 5A2MH 1O5AB 2ZC9H 3GCTF 1TX8A 2AEIH 2G8TA 3LKWA 3M5LA 1DWDH 1THSH 2A0QB 2XBXA 3O8RA 1O3AA 2ZF0H 1MD8A 3RMNH 3FN8A 1DLKB 1C4U2 1C1SA 2CJIA 3KHVA 1EAWA 4Y8YA 2B0FA 3PM3A 5C5OA 3M3VA 4NFEA 2V3OH 1P2IA 1MABB 4Y7AA 3RMOH 1QBNA 1QL7A 2J94A 3N7EA 3LC5A 1VR1H 3AW0A 5E2PA 2R2WU 1AQ7A 2AFQB 1BITA 5HMAA 7LPRA 3A86A 3F2HA 1HJAC 2BD4A 5EPNA 2FS8A 2QN5T 4D7GA 3SHAH 4ABEA 3HGNA 2EC9H 1YCPM 1Z7KA 1TPAE 3LGUA 4I32A 2W3IA 3ATIA 4CR9A 4IMZA 1E35B 2WPJS 1E37B 3MYWA 5CMXH 4H6TA 4FUGA 3NRLA 3ZZ7A 3ATLA 1DSTA 3SUDA 1C9PA 5A09A 2FZZA 1GCTC 4NCYA 1ANDA 1BQYA 1HIAA 2FM2A 2VWMA 1ELGA 1AKSB 4FUHA 1KYNA 1LO6A 3P17H 1H9LB 3GY5A 3H7OA 1SLWB 2I6QA 3A85A 3OU0A 2FODA 3EYDA 1NFUA 1SGCA 1YLCA 3ZZ9A 1DPOA 1GJ9B 1MCVA 3AAUA 6ESTA 1ZGIA 3TJVA 3GYLB 4IMQA 1C1VH 1Z8IB 3FVFB 5DKMA 2FP7B 4AZ2B 1D3TB 3MH7A 4GPGA 3GYMA 1WSSH 1P3CA 1EPTA 2FPZA 3A8BA 4O3UA 1HIAB 1Z1IA 5GXPA 3CNRA 1D3QB 4X2YA 1NU7B 1Z8RA 4ISIH 2GMTB 1G2MA 2ZQ1A 2BDBA 2M5TA 4IC6A 2JIZD 1TNJA 3AK5A 1DANH 3PTBA 1AE8H 3QDZB 1CA0B 1TPSA 2FYRA 2ODYB 5FAHA 2ZHWH 1QY6A 1ZRKA 2D2DA 1V2PT 2NU1E 1TNLA 3E1XB 2BX3A 4YOJA 4AGJA 4ZKNU 1SBWA
chains in the Genus database with same CATH topology
1GJAB 1EPTB 5TCCA 1BTZA 2BY7X 1ELCA 4WH8A 3Q77A 1EZSC 4BTUB 3KEEA 4M7GA 4RN6A 2G55A 1FAKH 1U6QA 3SU2A 2W7UA 3ZZDA 2G5NA 1TRNA 3GY7A 1FIZA 2QY0B 3ZVEA 1S81A 2O8WA 4RKJB 2Y82A 1HDTH 3UFAA 5HGGA 1GG6B 1DXWA 5EQRA 2V35A 1NT1A 4IN1A 3SOSA 2PV9B 1YPEH 5DPAA 1GMDG 2VIPA 2ZGCA 4FUJA 4E06H 1BTUA 1O2LA 1AB9C 3SI3H 2AGIX 4NIYA 5GCHF 3NCLA 3ITIA 2TIOA 1NRPH 1SLUB 1YC0A 2XCNA 1UVUH 1XKAC 5C1YA 1HB0B 2BXTH 5A8ZA 1G3BA 1SGIB 1ELEE 4ZH8A 1T31A 1QB9A 3P8OA 2AS9A 3SI4H 1GL0E 1BRAA 4X2XA 1J15A 3S0NA 1ZMNA 2Q1JA 4ASHA 2A5IA 1ANBA 5C3NA 1BRBE 5F8ZA 3RXTA 1GHYH 5FPTA 3A7XA 1O5DH 3P8FA 5GJ4B 1LVYA 2CHAC 1EAXA 3B9FH 3SV2H 1BRUP 1V6DA 3GY3A 1DICA 4DVAU 1TQ0B 3ATMA 5TJXA 1IQJA 1QJ7B 1RTKA 1WAYB 3BN9A 1S5SA 2AYWA 1LHEH 1MAYA 1UCYH 4WH6A 1GHZA 2ANWA 1PQAA 3FP8E 4NFFA 1HYLA 2ZECA 1VCPA 1GBJA 1ZRBA 1OOKB 3CS0A 1FY8E 1V2JT 1EQ9A 1P03A 2FWWA 3SUEA 1UTOA 1LQEA 1GJ8B 3PMBB 3PYHA 1FZZA 1O36A 4UEHH 2OD3B 3ZZAA 1GCTB 2CGAA 2A4GA 3QWCH 2VGCC 3O8DA 4X1NU 3ZZCA 2QC2A 3RU4D 1GBKA 1CHOG 1HAOH 1QFKH 4DIIH 2GTBA 4E7RG 1TE0A 4OS7A 1L4DA 3TPIZ 1FDPA 5GDSH 2PSXA 4OS2A 4X6OA 1S85A 2ZCKP 3SGQE 3MO3A 2FXRA 6GCHF 1MU8B 1DY9A 5EG4A 2AH4X 3F9FA 2HLCA 4DCDA 5L2YH 1PPFE 1BB0B 1CGHA 3TNSA 1KLIH 1V2TT 1K22H 3QZQA 3ZVAA 3GCTG 2W5EA 4ZROA 1C5UA 1O5CB 5CE1A 5FHTA 1ZMJA 2AERH 4YLQH 2F3CE 1THPB 1TQ7B 1K1JA 1G3EA 3LT3A 4Y8XA 3FZZA 3H7TA 3FZDA 1BIOA 2ZPRA 3HK6B 3ZV8A 4K8BA 1FV9A 5JB8S 5E8EH 1IQNA 2BB4A 4ISLA 3MTYA 2ZPSA 3PLKA 2B5TB 1L4ZA 3PLPA 3RXPA 2ZCLP 2QA9E 1F5KU 2WINI 1Y3XA 1NU9A 1OWJA 1WQVH 4A1TA 1MTSA 5F8XA 3VB3A 2R2MB 3KGPA 4AG2A 3MO6A 4ZKRU 2O8UA 1O38A 1BUIA 2J2UA 2TPIZ 2QAAA 4I8GA 1OYTH 2PTCE 5T6FA 3RXRA 5I46H 3Q3XA 1DT2A 2FX4A 3KN2A 4GSOA 4KELA 4FXGH 1EKBB 1P01A 1GJ4H 2OBOA 3QN7A 1P2OA 1NZQH 1GMCG 2P8OC 4THNH 1HLTH 2BVRH 3C1KA 4Z6AH 3PROA 2BMGB 2GV6A 2Y7ZA 4F49A 4ESTE 1ZTLA 3F68H 1VJAU 4TYDA 4NSVA 4X6NA 4X8UH 3IG6B 2QGRA 1Y5UT 3PWBA 1VZQH 2HNTF 3U1JB 1VITH 2H5CA 2ZWLH 2BD2A 3CENA 4AYVB 2HGTH 4CREA 1JXPA 2AGEX 3GY8A 1O2UA 4Y0ZE 4NSYA 3STJA 3RC6A 1DM4B 1D4PB 2ILNA 3LGTA 1FY3A 4BTIB 1D6RA 1K1MA 1F5RA 1P2KA 1AB9B 2ZU4A 3M35A 1MQ6A 3DT0H 1BOQA 2H9TH 4I33A 2ASUB 1NFYA 3F9EA 3P8NA 4D76A 1RTLA 4WVPE 3RMMH 3LIWA 2IJOB 4DY7B 2XW9A 2VIOA 4DJZB 3UTUH 1O3GA 3A8AA 2VVCA 3FAOA 1TONA 1RTFB 1HAIH 4K3JA 2C4FH 3I29A 1ESTA 1KIGH 1GCDA 4CRDA 2VVVA 3ZZBA 4AFUA 4BAMB 4OS5A 1L1NA 3KQCA 2ANMH 3RLYH 2ZFFH 1MMJN 1T8OA 2ZKSA 3RMLH 3VB4A 2HPPH 1Q3XA 5E0JA 2ZTXA 2GT7A 4NZQA 2BDAA 1EZUC 2IN2A 1SR5C 1O3BA 1MKWH 1W12U 3GCHB 1XUJA 1D9IA 4I31A 1MKXH 1FQ3A 2NWNA 2Y5GA 2Z6BD 2WUCA 4X1SU 3A87A 3DUXH 3UOPA 1CA8B 3UNSA 3G01A 1SHHB 2BXUH 3CS7A 1KXDA 3EA9A 3FP7E 1IQFA 3AW1A 1UTKA 4OS6A 3SV8A 3VFEA 4CHAB 4JZFH 3E3TA 1HUTH 1MCTA 4MQAA 3RU4E 4AB8A 1NROH 1F0RA 3ZYEA 3LPRA 1O2KA 2O8TA 4MNVA 1O2MA 1P2QA 2Z3DA 3IWMA 3TGKE 2ESTE 2VGCB 3T28A 1SGYE 1BA8B 1S6HA 4QT8C 1AFQC 4NG9H 4FUDA 2Y81A 1GHAG 3HK3B 1CT4E 4ABIA 5FX5A 1SOTA 4K69A 1LQDB 1UTMA 1MQ5A 2Z7FE 5GCHG 1QQUA 1LPKB 4VGCC 3F9HA 3MU5A 3VPKA 3LJJA 1LHFH 1GI5A 1EASA 2P16A 5E0HA 1UCYE 1OWHA 1C9TA 2QIQA 1C1UH 2OBQA 1CE5A 1CSOE 1Y3UA 3S69A 1TB6H 1W8BH 1KXAA 1GL1A 3GCNA 1HCGA 4IS5A 5HM9A 3MU8A 1GWAA 1SHYA 4JYTA 2BDIA 1O2XA 1RIWC 1TFXA 1Y59T 5F8TA 2G52A 1MTNB 5DP4A 1LDTT 2Z9IA 2OP9A 1SL3A 3VXFH 5DGJA 1C2FA 2UWLA 3Q3KA 3A83A 1P57B 3E90B 1SLVB 5JB9S 1FJSA 1CHGA 3TGJE 2GZ8A 3PLBA 2GMTC 1HAXB 3R0FA 2H1UA 1TOMH 3RM0H 1ESBA 1C1PA 2CXVA 2Z94A 2RDLA 1H1BA 1GDUA 2W26A 1TRMA 2C3SA 2ZHQH 1IHSH 2DE9A 3QUMP 3MNCA 1SFIA 4PROA 1O31A 1GJ7B 4A1VA 5AF9H 2Z3CA 4X8SH 1EATA 2OC7A 4FUEA 3BSQA 2P8OB 4CH2B 3QTVH 4MPWA 1TWXB 1BBRK 5C5NA 3LH1A 1FY1A 3EDXB 3NPSA 2BM2A 3OTJE 4K2YA 1SGFG 1W3CA 5AFYH 3ESTA 4MLFB 5L30H 1BCUH 4B74A 4X2WA 2C8YB 1O5BB 1GHXH 4BXSA 1AUTC 1GVZA 3KQDA 3UPEA 2BDHA 2EEKA 5DP8A 4H42U 3GDSA 3N7OA 4GCHG 8KME2 1GG6C 2ZDMA 1C5TA 1CHOF 1QJ1B 4R8TB 4ABGA 4INKA 2QF3A 3ATWA 4IGDA 1V2RT 2WPIS 5FX6A 1TA6A 1BHXF 2ZGXH 4WWYA 2ZA5A 1TMTH 1YCPK 2F9OA 3A80A 3HKJB 4O97A 1NRQH 5AFZH 3SBKA 1CQQA 1GHVH 1UTQA 1AZZA 2Y6TA 4XBDA 3SU5A 5C20A 2F9BH 3B8JA 1XUGA 1GI4A 1ZLRA 1WTGH 1XUHA 2UUYA 3SNAA 1G30B 1JOUB 1A2CH 2BQWB 3NUMA 1CBWB 2UWPA 4MNYA 2ALVA 3BTTE 4AFSA 2CN0H 1GJ6A 4BAOB 2AMPA 3RLWH 1RD3B 3SW2B 1K28D 3BG4B 4KKDA 1H8DH 1ZSLA 4YTAA 2XBWA 1TMBH 1ZMLA 2EA3A 1JWTA 2BYAX 2V3HH 2Y7XA 3KL6A 3EAJA 1BTYA 1AN1E 2ZDAH 5JBBS 3QGNB 4MVNA 1SFQB 3ZVCA 2VU8E 2ZO3H 3A89A 3SJIA 3TK9A 1W0ZU 1PQ5A 1B7XB 4J1YA 1ZHRA 4A5TS 4A92A 1KSNA 3SZNA 2VIVA 2ZEBA 1C5QA 2FX6A 1A0HB 2Z9KA 4YO9A 1ELDE 1AFQB 4KTCA 2ODQA 3SN8A 1TALA 1TGTA 1IHTH 2R0LA 1LPZB 1ELFA 1GMCF 2ZTZA 4UD9H 4CRFA 2VIWA 3VEQB 1IQIA 5AVDA 1YKTA 1P10A 1YPLH 2GKVE 3BTHE 2GZ9A 4I8JA 3Q3YA 1ETSH 4D9RA 1E36B 1UVPA 3SQHE 2V6NA 3QZRA 4XBBA 5GIBA 4VGCB 4NZLA 1AO5A 1ZJKA 1IQLA 2OQ5A 3MU1A 1YPHC 3JZ2B 3VB5A 4RSPA 1BT7A 1EOJA 1GI7B 1K1PA 3M61U 1C1WH 1GVLA 2OC1A 3EGKH 1C2DA 4WMDA 5FXLA 1S83A 1BMMH 3L6PA 1O2NA 5T6GA 4K1SA 3M5OA 1F2SE 1RS0A 5F03A 1UK4A 4I7YH 4GUXA 1RIWB 1T8LA 3UOUA 5DP6A 4Y11E 4I8KA 3BEFB 1EZQA 3IITA 5A0AE 4CRAA 1NRRH 1FY5A 3SJ8A 1TAWA 4Z0KA 2GZ7A 4TWWA 2ZHEH 3BTQE 1AHTH 1HXEH 3T27A 1GBFA 1C5NH 1S84A 1T4UH 4WXIA 1QRZA 1WUNH 1NFXA 3SQEE 2GX4A 1SGNE 9LPRA 1D6WA 1KLJH 1CT2E 2PSYA 4AYYB 4ZKSU 1QRWA 5EOKA 1NRSH 1A5GH 1GI9B 3BIUH 3PO1B 2P59A 2Q6GA 1ZPZA 3CP7A 1NESE 2TRMA 1G32B 3RXBA 1ID5H 5E2OA 2DUCA 4NIVA 1G2LA 4A6LA 1Z6JH 1FPHH 4U32A 5EODA 3Q76A 3TIUA 1C1RA 1P2NA 1Z1JA 5DO4H 2P93A 2RA3A 2R3UA 1C1QA 1QL9A 5G4BA 2BLWA 5GPIB 1ZR0A 3EQ0H 4ABJA 1EB2A 2GDDA 4YT7H 2GCHG 1DX5M 1AE5A 1E0FD 2VJ1A 3K9XB 4X1PU 2VVUA 4DGJA 1A3BH 4X0WU 1GHAF 1QTFA 2ZU5A 3E0PB 1NC6A 1W7GH 1ABJH 1ELBA 3TJUA 1Z6EA 7ESTE 2EI6A 1LVMA 5T6DA 4AGKA 1GHWH 1N6YA 1SC8U 3MFJA 3E91A 1XUIA 2QXHA 4NWKA 3BG8A 1YP9A 4MG3A 5DK1A 4XBCA 2TGAA 4NA7A 1W7XH 2WV5A 2FDAA 5DP9A 1IOEA 1P9SA 4XOJA 1Q2WA 1RFNA 1EAUA 3MH4A 3T5FH 2FYQA 4BOHA 3BTGE 2A2XH 4JYUH 1C5PA 2O8MA 2A5AA 2F9NA 2IPHA 3L33A 1MBQA 1Y5AT 1QNJA 1SB1H 1TGNA 5H4IB 3M37A 1ZTJA 3GCHC 4D8NA 2V0BA 2GDEH 3U8TH 5AHGH 2A31A 1V2WT 3SO3A 1S6FA 1G36A 4B76A 4I8HA 1IQGA 1LHCH 1QA7A 4CBOA 1TABE 1KTTB 1QR3E 3LDXH 2TGTA 6CHAC 5C2ZA 1UTNA 2ZDLA 3U8OH 2Q6FA 2RA0A 4CHAC 3PMJA 1WTHD 4A1XA 5HYOA 5I25A 2SNWA 3MNSA 1DSUA 3T25A 8ESTE 1KXFA 3OY6U 1V2KT 8GCHG 1K1IA 1OX1A 3GY6A 1HAYB 1UVOA 3KF2A 2IOTA 1GJDB 1TYNA 1A3EH 1Q31A 3EA7A 4TWYA 1N8OB 1T8MA 2WV4A 4MPXA 3MOCA 5FCRA 3TJNA 2AIQA 5T3HA 1GDQA 1XUFA 5DJ7A 1GMHG 4OS4A 3ZZ8A 2A7HA 2VNTA 3RM2H 3KCGH 2SGEE 1UMAH 2GD4B 5EXLA 3UNQA 3ZVBA 2NU4E 4AORA 3S7HB 1NPMA 2LPRA 3LGWA 4GCHF 3GCOA 1YPHE 1C1NA 1O3JA 5L6NH 5CHAC 2OLGA 2AMDA 1SI5H 1W0YH 2EI7A 4U30A 1IAUA 3A7YA 2PGQB 5K7RA 3O8CA 2J38A 2OCVB 3UR6A 1NN6A 3F9GA 4YESB 4BNRA 1MD7A 1PPGE 1FIWA 1NRNH 1EJNA 2G81E 4UFEH 1MTNC 5FBEA 3URCA 3VXEH 4JZIA 2AMQA 1O3IA 3MI4A 1HJ8A 3MHWU 4AFZA 3M7QA 2SGPE 3RC4A 4UFDH 3AAVA 2J92A 1LPGB 4HGCA 1GVKB 1DVAH 4LK4A 2Z9JA 3BTWE 1QCPA 2Y80A 2ZU1A 1O3DA 1AMHA 1Z8JB 1GJ5H 1HGTH 4X1QU 3LGIA 4X2VA 3GDVA 1AY6H 3VGCC 1EJMA 1GDNA 2TGPZ 1HBTH 4OGXA 3NWUA 3ATKA 1C2HA 1CT0E 1AI8H 2CV3A 2R0KA 2BVXH 1BDAA 1V2MT 2A5KA 1PFXC 2XRCA 5DP5A 5GWZA 1K1LA 4DURA 5EXNA 2JH5D 3SU6A 3F1SB 1B0FA 1EAIA 2P3TB 2XC5A 4FUBA 1ELVA 1GBBA 1O2VA 1RRKA 2STAE 2JKHA 2SGFE 4UE7H 1AVXA 3UWJH 3LC3A 1YLDA 3LOXA 3A7ZA 1FMGA 4NIWA 2F9VA 5E0GA 2EI8A 4Y8ZA 1JRTA 2ULLA 4O9VA 1GI8B 3MNXA 1SOZA 5J4SA 1YPMH 2Q6DA 2WPMS 1YPGH 3W95A 3ZZ4A 1A5HA 5EXMA 4D9QA 1H9IE 2PFEA 1C5MD 2ZFQH 1K9OE 3DD2H 1O2GH 4O3TA 1KY9A 2W3KA 1F0SA 4LXBH 2HOBA 5LPRA 1OKXA 3PTNA 4ISHH 3UREA 3ZVFA 1G9IE 1AUJA 1UJ1A 1O35A 1GBMA 1SGQE 2J95A 2BVSH 1ABIH 3STIA 4B2BA 1QHRB 1W2KH 1CBWC 1MTVA 1C2MA 1GBTA 1O2SA 7GCHG 1MTUA 1C4Y2 4MNXA 1UTLM 1K2I1 1C2KA 1P04A 3SJKA 1J16A 5IDKA 1TLDA 4NA8A 6CHAB 3BG4C 1QBOA 4Y79A 2ZG0H 3B23B 2C93B 1PQ7A 2PKSC 4Q2KA 2ODPA 2HALA 4FUCA 4B2CA 2BY5X 3U8RH 1A1RA 2Z9LA 1O2WA 2ANKH 4LZ4B 2G5VA 2FI3E 2F9UA 2GCTB 4GHTA 4XSKU 2FOEA 2F83A 4KP0A 2B9LA 2RG3A 4F4OC 4Q7ZA 2ZI2H 2BD7A