1H9LB

Porcine pancreatic elastase complexed with acetyl-val-glu-pro-ile-cooh
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PEPTIDE INHIBITOR
publication title Kinetic and Crystallographic Analysis of Complexes Formed between Elastase and Peptides from Beta-Casein
pubmed doi rcsb
total genus 59
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2001-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1h9lB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1h9lB01
2TBSA 2JH0D 3KGPA 6CHAB 3MNXA 2F9NA 1S6FA 2CMYA 1SGCA 1TNHA 3ZVAA 2Z7FE 1SLVB 4B74A 1TNJA 1MTWA 4D7GA 1H9IE 2SNWA 1BJUA 3LJJA 4OS2A 3ZZ9A 1O30A 1NO9H 1QQUA 7GCHG 1W3CA 4AZ2B 2PWXA 2BDHA 5A0CA 1GI1A 4ZKSU 1ZTKA 3KHVA 5DO4H 4CHAC 3A7ZA 4E7NA 1F7ZA 1TGBA 4THNH 3V13A 3GCHB 1K1IA 3MH4A 1SGNE 3A7TA 1G37A 2GMTC 2CGAA 2Q6FA 1GJCB 3SZNA 3QTVH 3PWCA 2IN2A 1LQEA 1C1RA 1GDQA 2QAAA 1D6WA 4AGJA 3QLPH 1AVGH 1Z1IA 4R8TB 2HOBA 1SQOA 4FUJA 3AW1A 3NUMA 3QUMP 3JZ2B 2Q6GA 3FVFB 5F8XA 1ARCA 5E0JA 3A7YA 1S81A 3SV2H 3DT0H 1J14A 4ZUHA 4ZROA 1CA0C 1YM0A 2AGGX 3UIRA 1IQNA 3GCTF 1MZDA 1YBWA 1W12U 3MI4A 3HGNA 1BUIA 1YPMH 2WINI 4OS7A 2ODPA 1CGIE 5A8YA 1O5CB 4INKA 3SO3A 1JXPA 4YT6H 7KMEH 4YOIA 5E0GA 3E0NB 1AFQC 1C2MA 1ZGVA 2FEQH 5T6DA 2AIPA 5ESBA 4Y7AA 1GI4A 3LH1A 5DP5A 1AMHA 4JYTA 1UVOA 5I25A 5CE1A 4ISNA 4JZFH 2OTVA 1SGRE 1O2LA 1BTUA 2PKAB 2QN5T 1DVAH 3VGCC 1DSUA 1FXYA 3M7TA 1A5GH 1QR3E 1ELVA 7GCHF 1PPFE 1QY6A 3RU4E 4K3JA 1TX7A 1O5BB 4AB9A 2FMJA 2A1DB 1O36A 1L1GA 2UWPA 4CBNA 2G55A 1LKAA 3SUEA 1TGSZ 2ZTYA 1SPJA 3ZZ6A 1DWCH 3RU4D 3SNDA 5EQRA 3AASA 1NU7B 1TQ0B 4A5TS 1AQ7A 5HXFA 1TWXB 4IC6A 4BAOB 2WYJA 1GI8B 3V7TA 3URCA 1NY22 1C5SA 1PQAA 1QL8A 3D23A 4O97A 3UPEA 2ZECA 3ZVBA 5F8TA 1EJAA 3VPKA 3SHCH 1O2MA 1S6HA 1B5GH 1A3EH 4DOQA 2A7CA 1AIXH 2GGVB 3EE0B 4K1EA 2TGPZ 2VVCA 4GLYA 2DE8A 3TH3H 1BTZA 1Y5UT 4X8UH 2Z9JA 3AVZA 4OS6A 1WV7H 3SU2A 3E8LA 1A0LA 3KNXA 2BXTH 1BTHH 2ZCHP 1VR1H 3LGWA 1EOLA 1PPGE 4X6NA 4CRDA 2FLRH 2OC0A 2V3OH 2QYIA 4XFQA 2H5CA 1A7SA 3BEUA 1WOFA 1SGFA 1TNIA 1MCVA 5GDSH 1TPAE 4X1NU 1V2LT 1DANH 5AF9H 5EPYA 2FTMA 2HALA 5K0HA 5T6FA 3NKKA 3T28A 1UK3A 3RXOA 3ATLA 5HYOA 2FOBA 2UUJB 2OC7A 1TGNA 4A1XA 4BOHA 5T3HA 1A3BH 4MNWA 1O32A 4FUFA 5LH8A 1T8NA 5G4BA 5F03A 1SI5H 4DY7B 2FTLE 2V3HH 5FHTA 1KLJH 2OXSA 3A8CA 1MTNB 2FOMB 1C1UH 1O3LA 2ASUB 2SGEE 4TWWA 3BV9B 5EW2H 1M9UA 4X0WU 3PMBB 2LPRA 1ABIH 5CHAB 4CR9A 3HATH 1C5XB 1P02A 1NT1A 3BTQE 4ISHH 3BTGE 4MPXA 2O9QA 1AFEH 3RMNH 3S7HB 4B2CA 3VB5A 2B0FA 2G4TA 1OPHB 1YGCH 2BXUH 2J95A 4A7IB 1RD3B 2RG3A 1XVOA 4MPUA 3CS0A 3PB1E 1ETSH 1RJXB 1QHRB 2VH6A 4MPVA 1O31A 1EP6A 2FOCA 1A1RA 1RTKA 4I8KA 2P3FH 3TK5A 1D3DB 1VCWA 2BM2A 3OY6U 6GCHG 2NU1E 1FI8A 4TWYA 2DUCA 1QA7A 1HAVA 2ZQ2A 4ISLA 4MPWA 1ZRBA 2H6MA 4K5ZA 4FUIA 1JIMA 4X6PA 1SHYA 4QT8C 2ALPA 1CE5A 4FUHA 1TBZH 5FPYA 2OC1A 2FX4A 1GMHG 3QX5H 5DPAA 3BG8A 1LHGH 3SJKA 1PFXC 5DP6A 1B7XB 1HJ8A 4WH6A 1P2NA 3F9GA 1WTGH 1UTPA 2C8YB 3MU4A 4JZ1A 2XBYA 3Q00A 1UVUH 2Y7ZA 1V2VT 2BD7A 3LGVA 4B75A 1H4WA 2J92A 2P8OC 1ZHPA 1MKXH 1GBBA 4DIHH 1TYNA 2EA3A 1DWEH 1C5YB 2GV6A 5ABWA 4AB8A 3BEFB 4FUDA 1CHGA 3RXDA 1LHCH 3UQVA 1GDUA 4LZ4B 2QA9E 1BZXE 4NG9H 1DOJA 1MTVA 1IQKA 1CT4E 5F6MA 3DHKH 3GDSA 2ZDAH 1FLEE 3M7UA 2PUXB 3LT3A 1AKSA 1TRNA 3O8DA 1AWFH 3FP8E 2SGAA 1TMUH 1P03A 1FZZA 3MFJA 4OS5A 2O8UA 1N6XA 1LMWB 4BAMB 4ABAA 1NS3A 3EA7A 2KAIB 2I6QA 3HKIB 4K8YA 3SORA 4B2AA 1FV9A 2C4FH 1RIWC 5DP3A 4MLFB 1F5KU 1ACBE 2BY5X 1O3JA 2B9LA 5JBCS 4BXSA 1GBLA 2JETC 2ZHDA 2BHGA 1LVYA 5DK1A 3S9CA 3T25A 4SGBE 1V2TT 1EQ9A 1O2SA 1KY9A 2R0KA 1K28D 1QRWA 2HNTE 6GCHF 1T31A 3F9HA 1C5PA 7LPRA 3PYHA 3ZV8A 1QRXA 1GJDB 3SUGA 3SOSA 4ESTE 1KXEA 1K21H 2PR3A 4F4OC 4X1RU 2H5DA 1HNEE 5EXLA 2AS9A 1ANDA 3ZVGA 1P11E 2ANWA 1C2IA 1KXFA 5TJXA 1RGQA 1UMAH 1GMHF 5C5NA 1O5DH 2ZGBH 2ZDKA 3FFGA 1G32B 1YPKH 2J4IA 2PGBB 4JK5A 1ZSJA 5AFZH 1P2JA 3UOPA 1FUJA 4AFSA 1HAPH 4TY6A 1A0HB 1K2I1 4DJZB 1XKAC 1V2QT 2B5TB 4DT7B 1ELAA 4AYVB 4FUCA 4OS4A 1AB9C 3TVJB 4FU8A 1HJAC 1WSSH 4INHA 2W7SA 3LOXA 1O2VA 3RXEA 1YKTA 1A5IA 2FOHA 1GCDA 2C8WB 2XC4A 2OUAA 1VZQH 2GP9B 1TRMA 2BD3A 1K1MA 1QBVH 4BTUB 1PPHE 4I8LA 4WY3A 2QF0A 3AAUA 1C1TA 1T4UH 3GCOA 1O5AB 1EPTC 1P10A 4D7FA 1RTLA 1VGCB 2P95A 2R2MB 2VIPA 1Z7KA 3KQEA 2HRVA 4ISOA 3ENSB 1V2OT 1CBWC 1T32A 5EW1H 1LVOA 1C2JA 2V0BA 1BRAA 1B0FA 3SJ9A 1IQHA 2CN0H 3KQCA 3SU1A 5DKMA 1ANEA 1ZJKA 1O39A 1UTOA 3A8DA 2PKSB 1O2UA 1NC6A 4JZIA 5I46H 1KTSB 1GDNA 1OSSA 1MBMA 1F0SA 1C1VH 1GL0E 3LGUA 4YLQH 3A85A 2TGTA 3CENA 1HLTH 1NRNH 1YCPM 2BX4A 4TYDA 2ZU4A 1PYTD 3U8OH 2M5TA 2ZA5A 3MU8A 1CQQA 3LONA 1NRSH 4NWKA 3P6ZB 1LVMA 2BZ6H 1J9CH 1C4Y2 2PLXA 1XUJA 2BD8A 3RLWH 3CP7A 3MNSA 3BTEE 1BTWA 1AUTC 1OWHA 2ZHFH 1YPHC 3BTFE 1V2JT 1DLKB 1S85A 2R2WU 1LVBA 3HGPA 1GGDC 2D2DA 5A8ZA 2RCEA 2ZPSA 1DWBH 4HI3A 3ZYEA 2ZFQH 1AHTH 4X6MA 2HGTH 3T62A 1UTJA 4OGXA 2P16A 3LDXH 1O3IA 2GT8A 4K60A 4X1QU 3SV6A 3SGAE 4AN7A 1UTMA 4XSKU 3UWIA 1A4WH 3ELAH 2ZHWH 3UNSA 1K1PA 1O3OA 1AZ8A 2FI4E 1YPJH 2ZGCA 1C4U2 1GPZA 3K2UA 2HPPH 2GDDA 2HWLB 2UWLA 2XC5A 1FAKH 3IWMA 1YLDA 1G3EA 3V3MA 2HLCA 2QV1A 5ETXA 2BD5A 1XUIA 2UWOA 1W7XH 1TALA 3DFLA 3VB7A 4CHAB 3ZZCA 4XE4A 4RKOB 1C2GA 2A5IA 3EYDA 2ODYB 4AYYB 2BVXH 3EAJA 1MU8B 3UR9A 1DY8A 1IHSH 2EEKA 2GMTB 1QJ7B 3QN7A 4E05H 4BNRA 1Q31A 2GZ8A 2OINA 1C9TA 3T29A 1J15A 1O2RA 4RSPA 3ZZ4A 2A4RA 2CHAC 4CR5A 2TGAA 4HFPB 1PJPA 2KAIA 2P3UB 3A7WA 4JK6A 4CH2B 3QTOH 1EPTA 1EZXC 3TK9A 3U1IB 1O2XA 1PQ8A 4H6TA 3TU7H 4ZKNU 1FY5A 1GBEA 3OYPA 3QDZB 1CA0B 3ODDA 2AGEX 2V35A 1OP8A 2A0QB 4HZHA 2BVSH 3UREA 5JB8S 1EB1H 1C5VA 1GI7B 3F9FA 1O2ZA 2AYWA 5T6GA 4AG2A 1PPBH 4TPIZ 2VVUA 1J17T 1F92A 3PO1C 1HAOH 2P93A 2VGCC 4NWLA 4NSVA 1Y3UA 3U1JB 1EZQA 1AFQB 1O5EH 1O33A 2OQ5A 3GOVB 2F91A 1O0DH 3BTTE 4ABIA 3ZZ8A 2VIVA 3ODFA 4ABEA 2ZTZA 1AU8A 1KLIH 2WPIS 4FUBA 1GG6C 4KP0A 4CRBA 3L3TA 4YT7H 2BDCA 2ZU2A 4WMFA 2AEIH 3MU1A 1CA8B 3RXRA 2I6SA 3KIDU 4UFFH 1P0SH 1TOCB 1G30B 3VGCB 4R0IA 1VCQA 3FP7E 1ZJDA 3MYWA 3NPSA 1DSTA 5H4IB 1FY4A 4HGCA 1N8OC 3SNCA 1TMBH 5C67A 1Y3XA 1QURH 1KXDA 3A8BA 5FCKA 5EQQA 1NPMA 5A8XA 3M5MA 1W8BH 4OGYA 5JB9S 4I8GA 4RN6A 4WWYA 3U8TH 2WPKS 2BTCE 2FM2A 1AWHB 1V2PT 1QJ6B 1HAVB 1P01A 1SHHB 3O8CA 3PLPA 1SMFE 2BD9A 3ZVDA 1UO6A 1IQLA 2A5KA 2HPQH 5A0AE 4X1SU 1D9IA 5EXNA 5FPSA 4U01A 3O8BA 4Y79A 4BTTB 3PTBA 1JBUH 1NFXA 4CRAA 1DITH 1S0QA 3PWBA 4IMQA 2BLQA 2XRCA 1AD8H 2ZIQH 1EJMA 1L4ZA 1BMAA 2Y5GA 1HXEH 1RRKA 2HNTC 3LGTA 1ZLRA 3LU9B 4ZAEA 2THFB 2ZNKH 3MOCA 3IITA 2ZDVH 1DT2A 3GICB 3P17H 1IHTH 4H6SB 4AGKA 3BTME 1FQ3A 4X1PU 3D65E 1C2HA 2A4GA 1RTFB 1SG8B 1MAXA 1TA2A 5TCAA 1C5UA 2Z9GA 1Z8JB 4UEHH 1NFUA 3E3TA 1LPGB 3OSYA 2BD2A 4ZXYH 1H9HE 5LPEA 4BTIB 5CMXH 2A7JA 1XXDA 1AKSB 1Y5BT 2PTCE 2ALVA 3H5CB 2BDGA 2ILNA 1C1SA 1PQ5A 1UVTH 2FOEA 1E36B 4Z0KA 1QRZA 3ATWA 5AVDA 3S69A 3RM2H 3A7VA 2AMDA 1AE8H 2V6NA 2G52A 3PMJA 3GY8A 1IQFA 2BOKA 2A7HA 3M5NA 1C5ZB 2FDAA 1LHEH 3LPRA 3H7TA 1DWDH 1W10U 3SV7A 2CF8H 1CHOG 1YPLH 1CU1A 1WU1A 1S0RA 3TPIZ 2C93B 1D4PB 2FOFA 4NSYA 5EG4A 1NRRH 3NWUA 4B76A 4LK4A 2ZDLA 4BXWA 1C5TA 1YPEH 3GYLB 5HMAA 5A2MH 1HAXB 1S5SA 1ARBA 2W5EA 1SGQE 3B9FH 1O2PA 2C90B 4A92A 3F9EA 1KLTA 2BY8X 3MH5A 2VJ1A 1YP9A 1BJVA 3RC6A 1Z6JH 4MNYA 1P3CA 3UNRA 3RP2A 2J2UA 2Y5HA 2XCFA 1NRPH 4GUXA 4K69A 1EXFA 2CJIA 3SNAA 1SSXA 2A2XH 2SGFE 4ABHA 3TNSA 1GJ6A 4NIVA 1YPHE 4U30A 1OWJA 1LDTT 3A8AA 4NFEA 4YTAA 1PPEE 3QGJA 3GYMA 2PSXA 4O3UA 3RU4T 2C8ZB 1O3DA 1H8DH 2TRMA 1KYNA 1EAWA 3M3VA 2RA3A 5FPTA 1HB0B 2H9TH 3ZVEA 3ATMA 4O3TA 1HAZB 1XX9A 1F2SE 2P8OB 2P59A 1D3PB 1TNKA 1SGFG 4Y10E 2EI7A 2YOLA 1GCTC 1SGEE 1SGIB 3MH6A 3TNTA 1Y5AT 3ATKA 3TIUA 1FJSA 4BAQB 1QGFA 1BA8B 1V2MT 5GPIB 3ZZAA 1BHXF 1GWAA 3M36A 2BVRH 3MU5A 2VINA 4ABGA 3TLOA 4Q7YA 1CHOF 1OYQA 1GMCG 1BITA 3SQEE 4Q80A 5ESTE 1RFNA 4UE7H 2EC9H 1O3MA 1T8LA 1CGJE 1JRTA 2B7DH 3F68H 1FIWA 2G81E 4CBOA 4I8HA 2DE9A 3U69H 1SLWB 1CT2E 4Y0ZE 2W3IA 1SQAA 1RIWB 1GHYH 3P70B 4I31A 4JZEH 1WQSA 5LGOA 1MTUA 3SU0A 2B8OH 1L0ZA 4K2YA 2JETB 3URDA 1BMMH 2BQ7B 2ZZUH 4IS5A 1V2UT 1TPPA 1KDQA 3K9XB 3TJNA 1UTKA 1YYY1 1ZGIA 4NCYA 5C5OA 1MKXK 1WQVH 1TMTH 3KN2A 2IJOB 3MO3A 3R0FA 1WAYB 1PPCE 4WF8A 4IBLH 4X2YA 3VEQB 1BDAA 3TK6A 1C4V2 1QNJA 2Z9IA 3AW0A 2OD3B 1C5NH 5FAHA 4AG1A 2W26A 1PPZA 4JZDH 1TONA 4ZHLU 3SU3A 1O2KA 2F9PA 1GI9B 1NTPA 2WUBA 1AB9B 2ZP0H 1HJAB 5EODA 2Y81A 4KKDA 3VFEA 1EX3A 1C5OH 1DPOA 1V2ST 2VWLA 2ODQA 2D8WA 2Y80A 4BAHB 1TPSA 3SNBA 1HPGA 3LGYA 2FLBH 2R3UA 3BTWE 1AUJA 3MO9A 5HM2A 4D76A 1GBCA 1GBDA 1O2QA 5AFYH 1HYLA 1LQDB 1S83A 4YESB 4I8JA 2PGQB 2P3TB 1GMCF 1DUEA 2ZCKP 1EPTB 3C1KA 3K6YA 3MO6A 3ZYDA 1UK4A 3Q3YA 2XTTB 4Q7ZA 3V12A 3GCNA 3M3TA 5FCRA 1CBWB 3EGKH 1W13U 2ANYA 2WPJS 4U32A 2A31A 1LHDH 1G3DA 2H2ZA 1G9IE 4ABJA 5BRRE 2BDBA 1VCPA 1C2LA 2ZG0H 3BTKE 2PV9B 1BT7A 1SR5C 4E06H 3BTHE 1SOTA 1HAIH 1HFDA 1ZYOA 4NFFA 3OX7U 1EB2A 4Y76A 3QZRA 1ORFA 1NU9A 8ESTE 4D8NA 2D1JA 1GJ4H 3UQOA 1MKWH 1NESE 4WXVA 1UJ1A 1XUGA 2EI6A 1GHXH 3LGIA 4ABFA 3VXFH 4JYVH 2RA0A 1P2QA 1LCYA 3A84A 8LPRA 2W3KA 1OP0A 5FBEA 1UVPA 1GHAG 5E2OA 1FPCH 1ZSKA 1DS2E 1TQ7B 3DFJA 5GXPA 1AVXA 1GGDB 1GBJA 2GV7A 2FYRA 2JKHA 1TBRH 2VIDA 1FY1A 1HRTH 2A4QA 2ZWLH 4ZXXH 3SW2B 3R3GB 5JBAS 5L2ZH 2C8XB 3TGKE 3P92A 4XDEA 5A0BA 5C1YA 2GD4B 2VWNA 3RXQA 2STBE 3SV9A 2Z94A 3T2NA 3OU0A 2Y82A 2IOTA 3LIWA 1K1LA 3RM0H 3UNQA 4CH8B 4YLUA 2ZFTA 1K22H 3DA9B 4K8BA 3ZZ7A 2BY6X 3E90B 4CRFA 2G51A 1ESTA 2GDEH 3GY6A 3QWCH 1LKBA 2AERH 4NA8A 4YO9A 3NZIA 1O2IA 4Y6DA 1SL3A 1ETTH 2HVXA 1GJ9B 5EGMA 4X8VH 1TOMH 2QXGA 2BOHB 2ANMH 4YM9A 1MAYA 1QFKH 1ZOMA 4SGAE 2Y6TA 5DP9A 1L1NA 1CVWH 3UR6A 1SLXB 1GHWH 4PROA 1IAUA 4M7GA 1O5FH 3C27B 3FANA 5FX5A 5C1UA 3H7OA 1HIAB 1T4VH 2ZU3A 1DXPA 2FZZA 5BPEA 4BANB 3P8OA 4Q7XA 2VVVA 1OX1A 3B8JA 1GJBB 3Q76A 4IC5A 3PMAB 1V3XA 3QO6A 4MDSA 1GJAB 1BRUP 4LOYH 1AE5A 1C2KA 1ELGA 5J4SA 1THPB 1YLCA 2ESTE 2WPMS 2G4UA 1ELTA 3GDUA 1VITG 1IQMA 2GZ7A 1GMDG 2QIQA 2OQUA 1G3CA 1BIOA 1EKBB 3UWJH 1O35A 3E91A 5FXLA 5JBBS 1MCTA 5F8ZA 2O8LA 2VH0A 3MNCA 2GKVE 4ABBA 3VB6A 2FODA 1GI3A 1TE0A 1GHAF 3PO1B 2XCNA 2FXRA 2VGCB 3TH2H 3W95A 1ANBA 3FAOA 3SV8A 1MH0A 5DP8A 1S84A 1Y3YA 3N7OA 1E0FD 3EDXB 1QB1A 1DM4B 3VB3A 1V2NT 5JDUB 2GCTC 1VJAU 3MMGA 1HGTH 1EATA 4Y11E 2ZDMA 4H42U 4GHQA 3SN8A 4NIYA 3RLYH 1BCUH 4MNVA 5IYTA 1GG6B 3SGBE 3LC5A 2NU3E 1GJ7B 1BMNH 4MQAA 2BDYA 2VIWA 5HGGA 3RXMA 1YCPH 2FI3E 1G36A 2QCYA 1Y3VA 1IQIA 1ELEE 1LHFH 1N8OB 4INLA 4OS1A 1W0YH 4X2VA 3RXBA 1A46H 1BTYA 3EA8A 4J2YB 3RXLA 1DFPA 3TGJE 1DXWA 3I77A 1D6RA 5E8EH 3GY7A 1BTXA 4TY7A 1C1PA 5EOKA 4A1TA 2BX3A 1TNLA 3CS7A 1XUKA 1O2YA 1O3AA 1BBRH 3PLKA 1CSOE 1P9UA 2C3SA 5GWZA 1SOZA 2A5AA 3HKJB 1ZZZA 2FOAA 2FPZA 1GL1A 2OLGA 1F0UA 3O8RA 2ZO3H 4IN1A 1C2DA 4KTCA 3EA9A 3PM3A 1SQTA 2AGIX 1SGYE 3SI3H 3NXPA 1KTTB 3BG4C 4NIXA 2ANKH 3I78A 1G3BA 2UUFB 1BTPA 1O38A 3BIUH 1QB6A 4ZMAH 1ELCA 1O3KA 4WMDA 1K9OE 2PUQH 1SFIA 1VITF 3PTNA 3E6PH 3ESTA 2IPHA 1GMDF 2WPLS 1QL7A 1L2EA 1GBKA 1T7CA 3U9AH 2ZFFH 3RXSA 3ZV9A 3U8RH 3QZQA 3SJ8A 1Y8TA 5FBIA 1ETRH 3EQ0H 3GY5A 1GBAA 3S0NA 2H9EH 4BAKB 2PHBA 1NROH 3MH7A 1KXCA 5DP4A 2F9UA 4J1YA 1K1JA 1C1NA 2TGDA 4FVBA 1V2RT 1MQ5A 1NZQH 3ZVCA 2GT7A 3WY8A 3UY9A 1J16A 3AAVA 2SNVA 3SUDA 1K1NA 3P8GA 1WTHD 1AI8H 4UFGH 1G2LA 4VGCC 4Y8XA 1AGJA 1T8OA 2FX6A 1ZMNA 1WCZA 1ZR0A 3KQDA 1T8MA 1MZAA 1UCYH 4IMZA 3RMOH 3Q3XA 2XYAA 3BTDE 2VWOA 1F0RA 2OBOA 3A88A 1ZTLA 2FI5E 1QQ4A 1QL9A 2YNAA 2W7UA 2O8WA 2ZHEH 1UTQA 2FS8A 2SGQE 1ELFA 3E1XB 3MHWU 4DURA 1LPKB 3LC3A 1KXBA 1P57B 1KDQB 1EAIA 1EUFA 3KF2A 2ZF0H 2BDIA 4Y0YE 4NZLA 1EZSC 4K1TA 1OKXA 4Y7BA 1DDJA 2AMQA 1QB9A 3SI4H 2XC0A 3LJOA 1XUHA 2F9OA 1UTNA 3DUXH 3KL6A 1SVPA 1TPOA 1EP5A 1GBIA 2ZPRA 1FN8A 3BSQA 4ZHMU 4I32A 1EZUC 2ZGHA 4FUGA 1FIZA 3OY5U 1SC8U 1HIAA 1TX8A 2FS9A 1O5GH 2TIOA 3E0PB 3SQHE 5HM9A 5B6OA 3PROA 4U2WA 1A0JA 3RXPA 2JH6D 2J94A 4KTSA 1BRCE 2AIQA 4YOGA 2WUCA 3SU6A 2VIOA 5E2PA 5EPNA 3A87A 1ZPBA 2ZFSA 3PLBA 2NU4E 6CHAC 1EOJA 1HXFH 2BZAA 3RXGA 4A6LA 5J4QA 3A83A 1TFXA 2XNIA 4RKJB 1Q3XA 3P8NA 1BB0B 2PSYA 2WPHS 2FWWA 3ZZ3A 1V2KT 1V2WT 3STIA 1P09A 2O8MA 5C20A 4YZUA 5DJ7A 2NU0E 4X2WA 5GJ4B 1Y3WA 2UUYA 4NA7A 1C5LH 4UFDH 5JBTA 1GCTB 3T26A 1C1OA 3D49H 1MBQA 2VNTA 2Z3DA 2SGDE 3GCHC 4D9RA 3K65B 2BY7X 2Q1JA 1KIGH 1KSNA 4X6OA 2ZU5A 4GVUA 2PTNA 4I7YH 2RDLA 5EQSA 3RXAA 1HBTH 1GVLA 4Z6AH 3MTYA 2BY9X 3RXUA 1C5QA 1JOUB 1NFWA 1SBWA 3A86A 1JMOH 5TCCA 3ITIA 1HCGA 5IDKA 1P2MA 3LH3A 2G00A 3ZVFA 2F83A 1E37B 1GBMA 4UFEH 3RXKA 4UONA 5C1XA 1A61H 2CF9H 3BEIB 2R9PA 2ZTXA 2PW8H 4ABDA 1BOQA 3G01A 2F9VA 3MWIU 1O3CA 3JZ1B 4X8SH 2ZFPH 8KME2 5SGAE 3SBKA 1MQ6A 1Q2WA 2H9HA 4CRCA 1VITH 2OBQA 4IN2A 1QBNA 1SGDE 2BQ6B 4K1SA 1HAGE 1PYTC 2A32A 1GHBG 1GHVH 1GI6A 4AOQA 5A09A 1H8IH 1H1BA 2WV4A 1SGPE 3M7QA 1MU6B 1QCPA 4MNXA 3M5LA 3RXVA 1AY6H 1HAHH 1SGTA 4WVPE 4UDWH 1O3EA 1F5LA 3RUOA 3SGQE 2UUKB 1FDPA 1W14U 1O2WA 3M5OA 4GHTA 4GPGA 1UHBB 1ZTJA 2G5VA 2YNBA 3ZZBA 1FN6A 4WJG2 1Z8GA 3BIVH 1OWKA 2XBWA 4D9QA 4DW2U 2Z3EA 1QTFA 1HDTH 3KCGH 2Z9KA 2FOGA 1C9PA 3GY2A 2Y7XA 3S9AA 1ESBA 1K1OA 1Y59T 4B73A 9LPRA 4IGDA 3NK8A 3KQBA 4B2BA 1ANCA 4KGAA 1DX5M 1LPZB 4ASHA 4JCNA 2Z3CA 2OC8A 1ZHRA 2ZU1A 1EAXA 1C1WH 1ZSLA 1ZMLA 2VIQA 4NZQA 1BMLA 1FY3A 6LPRA 3L33A 3GISB 3RMLH 1Z71A 1Z8RA 1F5RA 2AFQB 3LKWA 1E38B 4AX9H 1ELDE 3TJOA 2QF3A 1WBGB 2SFAA 2ULLA 1OOKB 2R0LA 7ESTE 1TNGA 4JMYA 1KXAA 2VB0A 3B23B 2G5NA 1E34B 3UFAA 1O2OA 5GCHG 5L6NH 3S9BA 1CT0E 1O3HA 1X7AC 1HJ9A 3GY3A 3ZZ5A 5EU8A 1OYTH 2FP7B 3S7KB 4DVAU 1GHBF 3PMHB 4NA9H 3RMMH 4KTUA 1FAXA 1TIOA 1W2KH 1GVZA 1IQGA 1IQEA 3STJA 2BQWB 1AVWA 5DP7A 2Y5FA 2Z6BD 1FNIA 1OWIA 1C1MA 1SFQB 1XUFA 1P3EA 2A45B 5C3NA 3SNEA 3UUZA 2GTBA 4LZ1H 4KELA 1ZPZA 2ZPQA 1EJNA 1MTNC 1THSH 2ZGXH 3FP6E 3T5FH 3OTJE 2OCVB 1TB6H 2EI8A 2XWAA 3HK3B 5JPMH 1AZZA 2BLOA 3M61U 4TPYA 5CHAC 1GBHA 9ESTA 2BMGB 1YF4A 1MUEB 3QK1A 1JRSA 5E0HA 1G2MA 2QXHA 2PKAA 1NFYA 2VU8E 1MKWK 1YPGH 2ZCLP 2Z9LA 1O37A 4CREA 3A80A 1FONA 3L6PA 1QIXB 1RS0A 2HNTF 1TABE 3VXEH 4I33A 3A81A 1C2EA 3F1SB 2Q6DA 1O3NA 1O2TA 1DLEA 2QXJA 1B0EA 3RDZA 1N1LA 5LPRA 2WYGA 4DIIH 2TPIZ 1MD8A 1TA6A 1OP2A 1O3FA 1BBRE 5L2YH 3D62A 4WMEA 3IG6B 4FVDA 4HTCH 3QGNB 3A89A 1GI5A 4MG3A 2BLWA 3SU5A 4XOJA 1O3PB 4B71A 4FUEA 1V6DA 4Y8ZA 1DICA 5GCHF 3RC4A 4MTBA 1QBOA 2R3YA 3TITA 1A5HA 1C1QA 4ZHAA 5JYIA 4DG4A 1OWDA 3P95A 1DUAA 2BYAX 3RC5A 2F9BH 1TAWA 2ZI2H 2XBXA 3Q77A 1EAUA 1GHZA 2GX4A 1XXFA 3NCLA 4AFUA 1C2FA 1OWEA 3GY4A 3V0XA 1CO7E 1LO6A 2FYQA 2K1QA 1JWTA 1P12E 1O3BA 1OS8A 5DG6A 1L1JA 2GCTB 4H4FA 1D3TB 1ELBA 1NRQH 1FPHH 3SJOA 5K7RA 1TGTA 3ATIA 4GAWA 1ABJH 4O9VA 1SB1H 2A2QH 1MMJN 2SGPE 1N6YA 3I29A 3TH4H 4X2XA 1WYKA 2AMPA 2GZ9A 1NN6A 2ZQ1A 4E7RG 1Z8IB 2NWNA 4JYUH 1A2CH 2A4OA 3M35A 2XBVA 4MVNA 4O03A 1UHBA 1ZRKA 1P04A 1CGHA 1TRYA 1P2KA 2D26C 1ZHMA 2QXIA 1Z6EA 2LNCA 1MD7A 1O2GH 1HAYB 2J9NA 1RXPA 2STAE 1UCYE 1W11U 1UTLM 8GCHG 2VWMA 4GCHG 1QA0A 3RXFA 1Z1JA 1DE7H 3ZZDA 1C5RA 1ZMJA 3SU4A 2ZKSA 4Y71A 1D3QB 2CHAB 6ESTA 1AN1E 1GI2A 3E16B 3SUFA 3VB4A 4X8TH 4Y8YA 2O8TA 3FZZA 3UTUH 5FX6A 1IOEA 3BG4B 1BHXB 1INCA 3U98H 1GI0A 1LTOA 1O3GA 2FIRH 2FO9A 2GCHG 3RXCA 3RXIA 4UD9H 4ZKRU 5PTPA 4DCDA 5L30H 1NM6A 3A82A 2BLVA 1BRBE 1E35B 2F3CE 1O34A 2ZDNA 3BF6H 4WH8A 3SJIA 1AO5A 4B1TA 3TJVA 2WV5A 1YCPK 5DGJA 2ZGJA 1P2OA 1P8VC 1O2NA 2P94A 5EXMA 2BDAA 3RXHA 1WUNH 2J38A 4LXBH 3GDVA 3Q3KA 2H1UA 2XWBI 1OXGA 1F0TA 1DY9A 1JIRA 1QJ1B 4ISIH 1BBRK 2QGRA 4FXGH 3TGIE 1O2HA 3MNBA 4XBDA 1XM1A 2ZHQH 4A1VA 4GSOA 4VGCB 4AFQA 2ZFRH 1W0ZU 2NU2E 4YOJA 3M3SA 1FMGA 2BD4A 1TLDA 5GIBA 2G8TA 3T27A 1VGCC 4XBCA 2QC2A 1GVKB 4XBBA 1XVMA 1XKBC 5C2ZA 4CRGA 2CV3A 1MTSA 4AORA 1GBTA 3FZDA 3RXTA 8GCHF 4GCHF 1ESAA 2BB4A 4FU7A 2GVFA 2PKSC 3RXJA 2ZC9H 5LPFA 3A7XA 1HUTH 4WXIA 3HK6B 1P05A 3TJUA 1TX6A 3UOUA 4F49A 2AH4X 1TBQH 1GJ8B 4IW4E 1BQYA 1IQJA 1C5WB 1ID5H 3DD2H 4DGJA 1PQ7A 1THRH 1W7GH 1YC0A 5AHGH 1FY8E 2JH5D 1GJ5H 1TGCA 1ZPCA 1L4DA 1P9SA 1EASA 4NIWA 3MU0A 3GCTG 1HV7A 3BN9A 1SLUB 3P8FA 3K6ZA 2PFEA 1C5MD 4NGAH 1U6QA 3KEEA 4ZH8A 2J34A 2GCHF 3M37A 2XXLA 2CXVA 2XW9A 1H9LB 1UK2A 3HPTB 1O2JA 3PV4A 4AFZA 2OP9A 1UCYK 4Q2KA 1VJ9U 2FESH 1J8AA 1XMNB 3F6UH 4ZKOU 1UVSH 3W94A 1P06A 3SHAH 4FU9A 1P2IA 1S82A 2QY0B 2ZEBA 1GBFA
chains in the Genus database with same CATH superfamily
2TBSA 2JH0D 3KGPA 6CHAB 3MNXA 2F9NA 1S6FA 2CMYA 1SGCA 1TNHA 3ZVAA 2Z7FE 1SLVB 4B74A 1TNJA 1MTWA 4D7GA 1H9IE 2SNWA 1BJUA 3LJJA 4OS2A 3ZZ9A 1O30A 1NO9H 1QQUA 7GCHG 1W3CA 4AZ2B 2PWXA 2BDHA 5A0CA 1GI1A 4ZKSU 1ZTKA 2KCPA 3KHVA 5DO4H 4CHAC 3A7ZA 4E7NA 1F7ZA 1TGBA 4THNH 3V13A 3GCHB 1K1IA 3MH4A 1SGNE 3A7TA 1G37A 2GMTC 2CGAA 2Q6FA 1GJCB 3SZNA 3QTVH 3PWCA 2IN2A 1LQEA 1C1RA 1GDQA 2QAAA 1D6WA 4AGJA 3QLPH 2JJ1D 1AVGH 1Z1IA 4R8TB 2HOBA 1SQOA 4FUJA 3AW1A 3NUMA 3QUMP 3UAIC 3JZ2B 2Q6GA 3FVFB 5F8XA 1ARCA 5E0JA 3A7YA 1S81A 3SV2H 3DT0H 1J14A 4ZUHA 4ZROA 1CA0C 1YM0A 2AGGX 3UIRA 4ASUD 1IQNA 3GCTF 1MZDA 3N7DA 1YBWA 1W12U 3MI4A 3HGNA 1BUIA 1YPMH 2WINI 4OS7A 2ODPA 1CGIE 5A8YA 1O5CB 4INKA 3SO3A 1JXPA 4YT6H 7KMEH 4YOIA 5E0GA 3E0NB 1AFQC 1C2MA 1ZGVA 2FEQH 2PP6A 4RT0A 5T6DA 2AIPA 5ESBA 4Y7AA 1GI4A 3LH1A 5DP5A 1AMHA 4JYTA 1UVOA 5I25A 5CE1A 4ISNA 4JZFH 2OTVA 4Z1MD 1SGRE 2JIZD 1O2LA 1BTUA 2PKAB 2QN5T 1DVAH 3VGCC 1DSUA 1FXYA 3M7TA 1A5GH 1QR3E 1ELVA 7GCHF 2GJGA 1PPFE 1QY6A 3RU4E 4K3JA 1TX7A 1O5BB 5HKKD 4AB9A 2FMJA 2A1DB 1O36A 1L1GA 2UWPA 4CBNA 2G55A 1LKAA 3SUEA 1TGSZ 2ZTYA 1SPJA 3ZZ6A 1DWCH 3RU4D 3SNDA 5EQRA 3AASA 1NU7B 1TQ0B 4A5TS 1AQ7A 5HXFA 1TWXB 4IC6A 4BAOB 2WYJA 1GI8B 3V7TA 3URCA 1NY22 1C5SA 1PQAA 1QL8A 3D23A 4O97A 3UPEA 2ZECA 3ZVBA 5F8TA 1EJAA 3VPKA 3SHCH 1O2MA 1S6HA 1B5GH 1A3EH 4DOQA 2A7CA 1WXRA 1AIXH 2GGVB 3EE0B 4K1EA 2TGPZ 2VVCA 4GLYA 2DE8A 3TH3H 1BTZA 1Y5UT 4X8UH 2Z9JA 3AVZA 4OS6A 1WV7H 3SU2A 3E8LA 1A0LA 3KNXA 2BXTH 1BTHH 2ZCHP 1VR1H 3LGWA 1EOLA 1PPGE 4X6NA 4CRDA 2FLRH 2OC0A 2V3OH 2QYIA 4XFQA 2H5CA 1A7SA 3BEUA 1WOFA 1SGFA 1TNIA 5CHBA 1MCVA 5GDSH 1TPAE 4X1NU 1V2LT 1DANH 5AF9H 5EPYA 3OEED 2FTMA 2HALA 5K0HA 5T6FA 3NKKA 3T28A 1UK3A 3RXOA 3ATLA 5HYOA 2FOBA 2UUJB 2OC7A 1TGNA 4A1XA 1QZ8A 4BOHA 5T3HA 1A3BH 4MNWA 1O32A 4FUFA 5LH8A 1T8NA 5G4BA 5F03A 1SI5H 4DY7B 2FTLE 2V3HH 5FHTA 1KLJH 3KYFA 2OXSA 3A8CA 1MTNB 2FOMB 1UW7A 1C1UH 1O3LA 2ASUB 2SGEE 4TWWA 3VG8A 2L6OA 3BV9B 5EW2H 1M9UA 4X0WU 3PMBB 2LPRA 1ABIH 5CHAB 5KGOA 4CR9A 3HATH 1C5XB 2XOKD 1P02A 1NT1A 3BTQE 4ISHH 3BTGE 4MPXA 2O9QA 1AFEH 3RMNH 3S7HB 4B2CA 3VB5A 2B0FA 2G4TA 1OPHB 1YGCH 2BXUH 2J95A 4A7IB 1H8ED 1RD3B 2W6JD 2RG3A 1XVOA 4MPUA 3CS0A 3PB1E 1ETSH 1RJXB 1QHRB 2VH6A 4MPVA 1O31A 1EP6A 2FOCA 1A1RA 1RTKA 4I8KA 2P3FH 3TK5A 1D3DB 1VCWA 2BM2A 3OY6U 6GCHG 2NU1E 1FI8A 4TWYA 2DUCA 1QA7A 1YWUA 1HAVA 2ZQ2A 4ISLA 4MPWA 1ZRBA 2H6MA 4K5ZA 4FUIA 1JIMA 4P02A 1SHYA 4X6PA 4QT8C 2ALPA 1CE5A 4FUHA 1TBZH 5FPYA 1E79D 2OC1A 2FX4A 1GMHG 3QX5H 5DPAA 3BG8A 1LHGH 3SJKA 1PFXC 5DP6A 3NRLA 3KQ5A 1B7XB 1HJ8A 4WH6A 1P2NA 3F9GA 1WTGH 1UTPA 2C8YB 3MU4A 4JZ1A 2XBYA 3Q00A 1UVUH 2Y7ZA 1V2VT 2BD7A 3LGVA 4B75A 1H4WA 2J92A 2P8OC 1ZHPA 1MKXH 1GBBA 4DIHH 1TYNA 2EA3A 1DWEH 1C5YB 2GV6A 5ABWA 4AB8A 3BEFB 4FUDA 1CHGA 3RXDA 2CK3D 1LHCH 3UQVA 1GDUA 4LZ4B 2QA9E 1BZXE 4NG9H 1DOJA 1MTVA 1IQKA 3F2GA 1BMFD 1CT4E 5F6MA 3DHKH 3GDSA 2ZDAH 1FLEE 3M7UA 5CDFE 2PUXB 3LT3A 1AKSA 1TRNA 3O8DA 1AWFH 2WSSD 3FP8E 2SGAA 1TMUH 1P03A 1FZZA 3MFJA 4OS5A 2O8UA 1N6XA 1LMWB 4BAMB 4ABAA 1NS3A 3EA7A 2KAIB 2I6QA 3HKIB 4K8YA 3SORA 4B2AA 1FV9A 2C4FH 1RIWC 5DP3A 4MLFB 1F5KU 1ACBE 2BY5X 1FX0B 1O3JA 2B9LA 1NBMD 4BXSA 1GBLA 2JETC 2ZHDA 2BHGA 3F0OA 5JBCS 3PRBA 1LVYA 3OE7D 5DK1A 5EIYA 3S9CA 3T25A 4SGBE 1V2TT 1EQ9A 1O2SA 1KY9A 2R0KA 1K28D 1QRWA 2HNTE 6GCHF 1T31A 3F9HA 1C5PA 7LPRA 3PYHA 3ZV8A 1QRXA 1GJDB 3SUGA 3SOSA 4ESTE 1KXEA 1K21H 2PR3A 4F4OC 2QE7D 4X1RU 2H5DA 1HNEE 5EXLA 2AS9A 1ANDA 3ZVGA 1P11E 2ANWA 1OHHD 1C2IA 1KXFA 5TJXA 1RGQA 2EY4C 1UMAH 1GMHF 5C5NA 1O5DH 2ZGBH 2ZDKA 3FFGA 1G32B 1YPKH 2J4IA 2PGBB 4JK5A 1ZSJA 5AFZH 1P2JA 5EJLA 1FUJA 3UOPA 4AFSA 1HAPH 4TY6A 1A0HB 1K2I1 4DJZB 1XKAC 1V2QT 2B5TB 4DT7B 1ELAA 4AYVB 4FUCA 4OS4A 1AB9C 3TVJB 4FU8A 1HJAC 1WSSH 4INHA 2W7SA 3LOXA 1O2VA 3RXEA 1YKTA 1A5IA 2FOHA 1GCDA 2C8WB 2XC4A 2OUAA 1VZQH 2GP9B 1TRMA 2BD3A 1K1MA 1QBVH 4BTUB 1PPHE 4I8LA 4WY3A 2QF0A 3AAUA 1C1TA 1T4UH 3GCOA 1O5AB 1EPTC 1P10A 4D7FA 1RTLA 1VGCB 2P95A 2R2MB 2VIPA 1Z7KA 3KQEA 2HRVA 4ISOA 3ENSB 1V2OT 1CBWC 1T32A 5EW1H 1LVOA 1C2JA 2V0BA 1BRAA 1B0FA 3SJ9A 1IQHA 2CN0H 3KQCA 3SU1A 5DKMA 1ANEA 2OK5A 1ZJKA 1O39A 1UTOA 3A8DA 2PKSB 1O2UA 1NC6A 4JZIA 5I46H 1KTSB 1GDNA 1OSSA 1MBMA 1F0SA 1C1VH 1GL0E 3LGUA 4YLQH 2VBCA 3A85A 2TGTA 3CENA 1HLTH 1NRNH 1YCPM 2BX4A 4TYDA 2ZU4A 1PYTD 3U8OH 2M5TA 2ZA5A 3MU8A 1CQQA 3LONA 1NRSH 4NWKA 3P6ZB 1LVMA 2BZ6H 1J9CH 1C4Y2 2PLXA 1XUJA 2BD8A 3RLWH 3CP7A 3MNSA 3BTEE 1BTWA 1AUTC 1OWHA 2ZHFH 1YPHC 3BTFE 1V2JT 1DLKB 1S85A 2R2WU 1LVBA 3HGPA 1GGDC 2D2DA 5A8ZA 2RCEA 2ZPSA 1DWBH 4HI3A 3ZYEA 2ZFQH 1AHTH 4X6MA 2HGTH 3T62A 1UTJA 4OGXA 2P16A 3LDXH 1O3IA 2GT8A 4K60A 4X1QU 3SV6A 3SGAE 4AN7A 1UTMA 4XSKU 3UWIA 1A4WH 3ELAH 2ZHWH 3UNSA 1K1PA 1O3OA 1AZ8A 2FI4E 1YPJH 2ZGCA 1C4U2 1GPZA 3UB0A 3K2UA 2HPPH 2GDDA 2HWLB 2UWLA 2XC5A 1FAKH 2J97A 3IWMA 1YLDA 1G3EA 3V3MA 2HLCA 2QV1A 5ETXA 3WW7A 2BD5A 1XUIA 2UWOA 1W7XH 1TALA 3DFLA 3VB7A 4CHAB 3ZZCA 4XE4A 4RKOB 1C2GA 2J98A 2A5IA 3EYDA 2ODYB 4AYYB 3OTPA 2BVXH 3EAJA 1MU8B 3UR9A 1DY8A 1IHSH 2EEKA 2GMTB 1QJ7B 3QN7A 4E05H 5KEDA 4BNRA 1Q31A 2GZ8A 2OINA 1C9TA 3T29A 1J15A 1O2RA 4RSPA 3ZZ4A 2A4RA 2CHAC 4CR5A 2TGAA 4HFPB 1PJPA 2KAIA 2P3UB 3A7WA 4JK6A 4CH2B 4ZCNA 3QTOH 5F53A 1EPTA 1EZXC 3TK9A 3U1IB 1O2XA 1PQ8A 4H6TA 3TU7H 4ZKNU 1FY5A 1GBEA 3OYPA 1YY3A 3QDZB 1CA0B 3ODDA 2AGEX 2V35A 1OP8A 2A0QB 4HZHA 2BVSH 3UREA 5JB8S 1EB1H 1C5VA 1GI7B 3F9FA 1O2ZA 2AYWA 4P00A 5T6GA 4AG2A 1PPBH 1W0KD 4TPIZ 2VVUA 3F3BA 1J17T 1F92A 3PO1C 1HAOH 2P93A 2EQNA 2VGCC 4NWLA 4NSVA 1Y3UA 3U1JB 1EZQA 1AFQB 1O5EH 1O33A 2OQ5A 3GOVB 2F91A 1O0DH 3BTTE 4ABIA 3ZZ8A 2VIVA 3ODFA 4ABEA 2ZTZA 1AU8A 1KLIH 2WPIS 4FUBA 1GG6C 4KP0A 4CRBA 3L3TA 4YT7H 2BDCA 2ZU2A 4WMFA 2AEIH 3MU1A 1CA8B 3RXRA 2I6SA 3KIDU 4UFFH 2WPDD 1P0SH 1TOCB 1G30B 3VGCB 4R0IA 1VCQA 3FP7E 2W6ID 1ZJDA 3MYWA 3NPSA 1DSTA 5H4IB 1FY4A 4HGCA 1N8OC 3SNCA 1TMBH 5C67A 1Y3XA 1QURH 1KXDA 3A8BA 5FCKA 5EQQA 1NPMA 5A8XA 3M5MA 1W8BH 4OGYA 5JB9S 4I8GA 4RN6A 4WWYA 3U8TH 2WPKS 2BTCE 2FM2A 1AWHB 2YMSC 1V2PT 1QJ6B 1HAVB 1P01A 5FL7D 1SHHB 3O8CA 3PLPA 1SMFE 2BD9A 3ZVDA 1UO6A 1IQLA 2A5KA 2HPQH 5A0AE 3MQKC 4X1SU 1D9IA 5EXNA 5FPSA 4U01A 3O8BA 4Y79A 4BTTB 3PTBA 1JBUH 1NFXA 4CRAA 1DITH 1S0QA 3PWBA 4IMQA 2BLQA 2XRCA 1AD8H 2ZIQH 1EJMA 1L4ZA 1BMAA 2Y5GA 1HXEH 1RRKA 2HNTC 3LGTA 1ZLRA 3LU9B 5C0UA 4ZAEA 2THFB 2ZNKH 3MOCA 2K0QA 3IITA 2ZDVH 1DT2A 3GICB 3P17H 1IHTH 4H6SB 4AGKA 3BTME 1FQ3A 4X1PU 3D65E 1C2HA 2A4GA 1RTFB 1SG8B 1MAXA 1TA2A 5TCAA 1C5UA 2KCAA 2Z9GA 1Z8JB 4UEHH 1NFUA 3E3TA 1LPGB 3F2HA 3OSYA 2BD2A 4ZXYH 1H9HE 5LPEA 4BTIB 5CMXH 2A7JA 1XXDA 1AKSB 1Y5BT 2PTCE 5DSFA 2ALVA 3H5CB 2BDGA 2ILNA 1C1SA 1PQ5A 1UVTH 2FOEA 1E36B 4Z0KA 4FETA 1QRZA 3ATWA 5AVDA 3S69A 3N7EA 3RM2H 3A7VA 2AMDA 1AE8H 2V6NA 2G52A 3PMJA 3GY8A 1IQFA 2BOKA 2A7HA 3M5NA 1C5ZB 2FDAA 1LHEH 3LPRA 3H7TA 4B6EA 1DWDH 1W10U 5IK2D 3SV7A 2CF8H 3SZEA 1CHOG 1YPLH 1CU1A 1WU1A 1S0RA 3TPIZ 2C93B 2KFWA 1D4PB 2FOFA 4NSYA 5EG4A 1NRRH 3NWUA 4B76A 4LK4A 2ZDLA 4BXWA 1C5TA 1YPEH 3GYLB 5HMAA 5A2MH 1HAXB 1S5SA 1ARBA 2W5EA 1SGQE 3B9FH 1O2PA 2C90B 4A92A 3F9EA 1KLTA 2BY8X 3MH5A 2VJ1A 1YP9A 1BJVA 3RC6A 1Z6JH 4MNYA 1P3CA 3UNRA 3RP2A 2J2UA 2Y5HA 2XCFA 1NRPH 4GUXA 4K69A 1EXFA 2CJIA 3SNAA 1SSXA 2A2XH 2SGFE 4ABHA 2QF5A 3TNSA 1GJ6A 4NIVA 1YPHE 4U30A 1OWJA 2IPQX 1LDTT 3A8AA 2KR7A 4NFEA 4YTAA 1PPEE 3QGJA 1EFRD 4ACAA 3GYMA 2PSXA 4O3UA 3RU4T 2C8ZB 1O3DA 1H8DH 2JJ2D 2TRMA 1KYNA 1EAWA 3M3VA 2RA3A 5FPTA 1HB0B 2H9TH 3ZVEA 3ATMA 4O3TA 1HAZB 1XX9A 1F2SE 2AHME 2P8OB 2P59A 1D3PB 1TNKA 1SGFG 4Y10E 2EI7A 2YOLA 1GCTC 1SGEE 1SGIB 3MH6A 3TNTA 1Y5AT 3ATKA 3TIUA 1FJSA 4BAQB 1QGFA 1BA8B 1V2MT 2F43B 5GPIB 3ZZAA 1BHXF 1GWAA 3M36A 2BVRH 3MU5A 2VINA 4ABGA 3TLOA 4Q7YA 1CHOF 1OYQA 1GMCG 1BITA 3SQEE 4Q80A 5ESTE 1RFNA 4UE7H 2EC9H 1O3MA 1T8LA 1CGJE 1JRTA 2B7DH 3F68H 1FIWA 2G81E 4CBOA 4I8HA 2DE9A 3U69H 1SLWB 3PRDA 1CT2E 4Y0ZE 2W3IA 1SQAA 1RIWB 1GHYH 3P70B 4I31A 5GNDA 4JZEH 1WQSA 5LGOA 1MTUA 3SU0A 2B8OH 1L0ZA 4K2YA 2JETB 3URDA 1BMMH 2BQ7B 2ZZUH 4IS5A 1V2UT 1TPPA 1KDQA 2KX4A 3K9XB 1UTKA 1YYY1 3TJNA 1ZGIA 4NCYA 5C5OA 1MKXK 1WQVH 4M9FA 1TMTH 3KN2A 2IJOB 3MO3A 3R0FA 1WAYB 1PPCE 2K8IA 4WF8A 4IBLH 4X2YA 3VEQB 1BDAA 3TK6A 1C4V2 1QNJA 2Z9IA 3AW0A 2OD3B 1C5NH 5FAHA 4AG1A 2LELA 2W26A 1PPZA 4JZDH 1TONA 4ZHLU 3SU3A 1O2KA 2F9PA 1GI9B 1NTPA 2WUBA 1AB9B 2ZP0H 1HJAB 5EODA 2Y81A 4KKDA 3VFEA 1EX3A 2J98B 1C5OH 1DPOA 1V2ST 2VWLA 2ODQA 1KMHB 2D8WA 2Y80A 4BAHB 1TPSA 3SNBA 1HPGA 3LGYA 2FLBH 2R3UA 3BTWE 1AUJA 3MO9A 5HM2A 4D76A 1GBCA 1GBDA 1O2QA 5AFYH 1HYLA 3GS9A 1LQDB 1S83A 4YESB 4I8JA 2PGQB 2P3TB 4HG6A 1GMCF 1DUEA 2ZCKP 1EPTB 2YMSD 3C1KA 3K6YA 3MO6A 3F0PA 1UK4A 3ZYDA 3Q3YA 2XTTB 4Q7ZA 3V12A 3GCNA 3M3TA 5FCRA 1CBWB 3EGKH 1W13U 2ANYA 2WPJS 4U32A 2A31A 1LHDH 1G3DA 2H2ZA 1G9IE 4ABJA 5BRRE 2BDBA 1VCPA 1C2LA 2ZG0H 3BTKE 2PV9B 1BT7A 1SR5C 4E06H 3BTHE 1SOTA 1HAIH 1HFDA 1ZYOA 4NFFA 4F48B 3OX7U 1EB2A 1H8HD 4Y76A 3QZRA 1ORFA 1NU9A 8ESTE 4D8NA 2D1JA 1GJ4H 3UQOA 1MKWH 1NESE 2V3MA 4WXVA 1UJ1A 2F4LA 1XUGA 2EI6A 3WWBA 1GHXH 5EJ1A 3LGIA 2JDID 4ABFA 3VXFH 4JYVH 2RA0A 1P2QA 1LCYA 3A84A 8LPRA 2W3KA 1OP0A 5FBEA 1UVPA 3DCLA 1GHAG 5E2OA 1FPCH 1ZSKA 1DS2E 1TQ7B 3DFJA 5GXPA 1AVXA 1GGDB 1GBJA 2GV7A 2FYRA 2JKHA 1TBRH 2VIDA 1FY1A 1HRTH 2A4QA 2ZWLH 4ZXXH 3SW2B 3R3GB 5JBAS 5L2ZH 2C8XB 3TGKE 3P92A 4XDEA 5A0BA 5C1YA 2GD4B 2VWNA 3RXQA 2STBE 3SV9A 2Z94A 3T2NA 3OU0A 2Y82A 2IOTA 3LIWA 1K1LA 3RM0H 3UNQA 4CH8B 4YLUA 2ZFTA 1K22H 3DA9B 4K8BA 3ZZ7A 2BY6X 3E90B 4CRFA 2G51A 1ESTA 2GDEH 3GY6A 3QWCH 1LKBA 2AERH 4NA8A 3EE7A 4YO9A 3NZIA 1O2IA 4Y6DA 1SL3A 1ETTH 2HVXA 2J5UA 1GJ9B 5EGMA 4X8VH 1TOMH 2QXGA 2BOHB 2ANMH 4YM9A 1MAYA 1QFKH 1ZOMA 4SGAE 2Y6TA 4TSFD 5DP9A 1L1NA 1CVWH 3UR6A 1SLXB 1GHWH 4PROA 1IAUA 4M7GA 1O5FH 3C27B 3FANA 5FX5A 5C1UA 3H7OA 1HIAB 1T4VH 2ZU3A 1DXPA 2FZZA 5BPEA 4BANB 3P8OA 4Q7XA 2VVVA 1OX1A 3B8JA 1GJBB 3Q76A 4IC5A 3ZIAD 3PMAB 1V3XA 3QO6A 2WHXA 4MDSA 1GJAB 1BRUP 4LOYH 1AE5A 1C2KA 1ELGA 5J4SA 1THPB 1YLCA 2ESTE 2WPMS 2G4UA 1ELTA 3GDUA 1VITG 1IQMA 2GZ7A 1GMDG 2QIQA 2OQUA 1G3CA 1BIOA 1EKBB 3UWJH 1O35A 3E91A 4B6FA 5FXLA 5JBBS 1MCTA 5F8ZA 2O8LA 2VH0A 3MNCA 2GKVE 4ABBA 3VB6A 2FODA 1GI3A 1TE0A 1GHAF 3PO1B 2XCNA 2FXRA 2VGCB 3TH2H 3W95A 1ANBA 3FAOA 3SV8A 1MH0A 1W0JD 5DP8A 1S84A 1Y3YA 4RI0A 3N7OA 1E0FD 3EDXB 1QB1A 1DM4B 3VB3A 1V2NT 5JDUB 2GCTC 1VJAU 3MMGA 1HGTH 1EATA 4Y11E 2ZDMA 4H42U 4GHQA 3SN8A 3CNRA 3AK5A 4NIYA 3RLYH 1BCUH 4MNVA 5IYTA 1GG6B 3SGBE 1K0HA 3LC5A 2NU3E 1GJ7B 1BMNH 4MQAA 2BDYA 2VIWA 5HGGA 3RXMA 1YCPH 2FI3E 1G36A 2QCYA 1Y3VA 2WZQA 1IQIA 1ELEE 1LHFH 1N8OB 4INLA 4OS1A 1W0YH 4X2VA 3RXBA 1A46H 1BTYA 3EA8A 4J2YB 3RXLA 1DFPA 3TGJE 1DXWA 3I77A 1D6RA 5E8EH 3GY7A 2KM0A 1BTXA 4TY7A 1C1PA 5EOKA 4A1TA 2BX3A 1TNLA 2V7QD 3CS7A 1XUKA 1O2YA 1O3AA 1BBRH 3PLKA 1CSOE 1P9UA 2C3SA 5GWZA 1SOZA 2A5AA 3HKJB 4DT4A 1ZZZA 2YMSB 2FOAA 2FPZA 1GL1A 2OLGA 1F0UA 3O8RA 2ZO3H 4IN1A 1C2DA 4KTCA 3EA9A 3PM3A 1SQTA 2AGIX 1SGYE 3SI3H 3NXPA 1KTTB 3BG4C 4NIXA 2ANKH 3I78A 1G3BA 2UUFB 1BTPA 1O38A 3BIUH 1QB6A 4ZMAH 1ELCA 1O3KA 4WMDA 1K9OE 2PUQH 1SFIA 1VITF 3PTNA 3E6PH 3ESTA 2IPHA 1GMDF 2WPLS 1QL7A 1L2EA 1GBKA 1T7CA 3U9AH 2ZFFH 3RXSA 3ZV9A 3U8RH 3QZQA 3SJ8A 1Y8TA 5FBIA 1ETRH 3EQ0H 3GY5A 1GBAA 3S0NA 2H9EH 4BAKB 2PHBA 1NROH 3MH7A 1KXCA 5DP4A 2F9UA 4J1YA 1K1JA 1C1NA 2TGDA 4FVBA 1V2RT 1MQ5A 1NZQH 3ZVCA 2GT7A 3DSOA 3WY8A 3UY9A 1J16A 4ACBA 3AAVA 2SNVA 3SUDA 1K1NA 3P8GA 1WTHD 1AI8H 4UFGH 1G2LA 2QF4A 4VGCC 1AGJA 4Y8XA 1T8OA 2FX6A 1ZMNA 1WCZA 1ZR0A 3KQDA 4XRNA 1T8MA 1MZAA 1UCYH 4IMZA 3RMOH 3Q3XA 2XYAA 3BTDE 2VWOA 1F0RA 2OBOA 3A88A 1ZTLA 2FI5E 1QQ4A 1QL9A 2YNAA 4I86A 2W7UA 2O8WA 2ZHEH 1UTQA 2FS8A 2SGQE 1ELFA 2HLDD 3E1XB 3MHWU 4DURA 1LPKB 3LC3A 1KXBA 1P57B 1KDQB 1EAIA 1EUFA 3KF2A 2ZF0H 2BDIA 3FKSD 4Y0YE 4NZLA 1EZSC 4K1TA 1OKXA 4Y7BA 1DDJA 2AMQA 1QB9A 3SI4H 2XC0A 3LJOA 1XUHA 2F9OA 5EJZA 1UTNA 3DUXH 3KL6A 1SVPA 1TPOA 4Q4LA 1EP5A 1GBIA 2ZPRA 1FN8A 3BSQA 3DSGA 4ZHMU 4I32A 1EZUC 2ZGHA 4FUGA 1FIZA 3OY5U 1SC8U 1HIAA 1TX8A 2FS9A 1O5GH 2TIOA 3E0PB 3SQHE 5HM9A 5B6OA 3PROA 4U2WA 1A0JA 3RXPA 2JH6D 2J94A 4KTSA 1BRCE 2AIQA 4YOGA 2WUCA 3SU6A 2VIOA 5E2PA 5EPNA 3A87A 1ZPBA 2ZFSA 3PLBA 2NU4E 6CHAC 1EOJA 1HXFH 2BZAA 3RXGA 3DSPA 4A6LA 5J4QA 3A83A 1TFXA 2XNIA 3OFND 4RKJB 3N99A 4AC9A 1Q3XA 3P8NA 1BB0B 2PSYA 2WPHS 2FWWA 3ZZ3A 1V2KT 1V2WT 3STIA 1VKYA 1P09A 2O8MA 5C20A 4YZUA 5DJ7A 2NU0E 4X2WA 5GJ4B 1Y3WA 2UUYA 4NA7A 1C5LH 4UFDH 5JBTA 1GCTB 3T26A 1C1OA 3D49H 1MBQA 2VNTA 2Z3DA 2SGDE 3GCHC 4D9RA 3K65B 2BY7X 2Q1JA 1KIGH 1KSNA 4F55A 4X6OA 2ZU5A 4GVUA 2PTNA 4I7YH 2RDLA 5EQSA 3RXAA 1HBTH 1GVLA 4Z6AH 3MTYA 2BY9X 3RXUA 1C5QA 1JOUB 1NFWA 1SBWA 3A86A 1JMOH 5TCCA 3ITIA 3PV2A 1HCGA 4YXWD 5IDKA 1P2MA 3LH3A 2G00A 3ZVFA 2F83A 1E37B 1GBMA 4TT3D 4UFEH 3RXKA 4UONA 5C1XA 1A61H 2CF9H 3BEIB 2R9PA 2ZTXA 2PW8H 4ABDA 1BOQA 3G01A 2F9VA 3MWIU 1O3CA 3JZ1B 4X8SH 2ZFPH 8KME2 5SGAE 3SBKA 1MQ6A 1Q2WA 2H9HA 4CRCA 1VITH 2OBQA 4IN2A 1QBNA 1SGDE 2BQ6B 4K1SA 1HAGE 1PYTC 2A32A 1GHBG 1GHVH 1GI6A 4AOQA 3FN8A 5A09A 3F2FA 1H8IH 2RDEA 1H1BA 2WV4A 4FOUC 1SGPE 3M7QA 1MU6B 1QCPA 4MNXA 3M5LA 3RXVA 1AY6H 1HAHH 1SGTA 4WVPE 4UDWH 1O3EA 1F5LA 1E1RD 3RUOA 3SGQE 3SYJA 2UUKB 3W1EA 1FDPA 1W14U 1O2WA 3M5OA 4GHTA 4GPGA 1UHBB 1ZTJA 2G5VA 2YNBA 3ZZBA 1FN6A 4WJG2 1Z8GA 3BIVH 1OWKA 2XBWA 4D9QA 4DW2U 2Z3EA 1QTFA 2IJD1 1HDTH 3KCGH 3WWFA 2Z9KA 3U28C 2FOGA 1C9PA 3GY2A 2Y7XA 3S9AA 1ESBA 1K1OA 1Y59T 4B73A 9LPRA 4IGDA 3NK8A 2HVYB 3KQBA 4B2BA 1ANCA 4KGAA 1DX5M 1LPZB 4ASHA 4JCNA 1WDIA 2Z3CA 2OC8A 5T1VA 1ZHRA 2ZU1A 5B6LA 1EAXA 1C1WH 1ZSLA 1ZMLA 2VIQA 4NZQA 1BMLA 1FY3A 6LPRA 3L33A 3GISB 3RMLH 1Z71A 1Z8RA 1F5RA 2AFQB 3LKWA 1E38B 4AX9H 1ELDE 3TJOA 2QF3A 1WBGB 2SFAA 2ULLA 1OOKB 2R0LA 7ESTE 1TNGA 4JMYA 1KXAA 2VB0A 3B23B 2G5NA 1E34B 3UFAA 1O2OA 5GCHG 5L6NH 3S9BA 1CT0E 1O3HA 1X7AC 1HJ9A 3GY3A 4OM9A 3ZZ5A 5EU8A 1OYTH 2FP7B 3S7KB 4DVAU 1GHBF 3PMHB 4NA9H 3RMMH 4KTUA 1FAXA 1TIOA 1W2KH 1GVZA 1IQGA 1IQEA 3STJA 2BQWB 1AVWA 5DP7A 2Y5FA 2Z6BD 1FNIA 1OWIA 1C1MA 1SFQB 1XUFA 1P3EA 2A45B 5C3NA 3SNEA 3UUZA 5C0TA 2GTBA 4LZ1H 4KELA 3KYGA 1ZPZA 2ZPQA 1EJNA 1MTNC 1THSH 2ZGXH 3FP6E 3T5FH 3OTJE 2OCVB 1TB6H 2EI8A 2XWAA 3HK3B 5JPMH 1AZZA 2BLOA 3M61U 4TPYA 5CHAC 1GBHA 9ESTA 2BMGB 1YF4A 5C17A 1MUEB 3QK1A 1JRSA 5E0HA 1G2MA 2QXHA 2PKAA 1NFYA 2VU8E 1MKWK 1YPGH 2ZCLP 2Z9LA 1O37A 4CREA 3A80A 1FONA 3L6PA 2M2AA 1QIXB 1RS0A 2HNTF 1TABE 3VXEH 1NBME 1SKYE 4I33A 3A81A 1C2EA 3F1SB 2Q6DA 1O3NA 1O2TA 1DLEA 2QXJA 1B0EA 3RDZA 1N1LA 5LPRA 2WYGA 4DIIH 2TPIZ 1MD8A 1TA6A 1OP2A 1O3FA 1BBRE 5L2YH 3D62A 4WMEA 3IG6B 4FVDA 4HTCH 3QGNB 3A89A 1GI5A 4MG3A 5HIYA 2BLWA 3SU5A 4XOJA 1O3PB 4B71A 4FUEA 1V6DA 4Y8ZA 1DICA 5GCHF 3RC4A 4MTBA 5KECA 3FO8D 2KCYA 1QBOA 2R3YA 3TITA 1A5HA 1C1QA 4ZHAA 5JYIA 4DG4A 1OWDA 3P95A 1DUAA 2BYAX 3RC5A 2F9BH 1TAWA 2ZI2H 2XBXA 3Q77A 1EAUA 1GHZA 2GX4A 1XXFA 3NCLA 3OAAD 4AFUA 1C2FA 1OWEA 3GY4A 3V0XA 1CO7E 1LO6A 2FYQA 2K1QA 1JWTA 1P12E 1O3BA 1OS8A 2KZ4A 5DG6A 1L1JA 2GCTB 4H4FA 1D3TB 1ELBA 1NRQH 1FPHH 3SJOA 5K7RA 1TGTA 3ATIA 4GAWA 1ABJH 4O9VA 1SB1H 2A2QH 1MMJN 2SGPE 1N6YA 3I29A 3TH4H 4X2XA 1WYKA 2AMPA 2GZ9A 1NN6A 2ZQ1A 4Q63A 4E7RG 1Z8IB 2NWNA 4JYUH 1A2CH 2A4OA 3M35A 2XBVA 4MVNA 4O03A 1UHBA 2L74A 1ZRKA 1P04A 1CGHA 1TRYA 1P2KA 2D26C 1ZHMA 2QXIA 1Z6EA 2LNCA 1MD7A 1O2GH 1HAYB 2J9NA 1RXPA 2STAE 1UCYE 1W11U 1UTLM 8GCHG 2VWMA 4GCHG 1QA0A 3RXFA 1Z1JA 1DE7H 1SQRA 3ZZDA 1C5RA 1ZMJA 3SU4A 2ZKSA 2RFKC 4Y71A 1D3QB 2CHAB 6ESTA 1AN1E 1GI2A 3E16B 3SUFA 3VB4A 4RT1A 4X8TH 4Y8YA 2O8TA 1COWD 3FZZA 3UTUH 5FX6A 1IOEA 3BG4B 1BHXB 1INCA 3U98H 1GI0A 1LTOA 1O3GA 2FIRH 2FO9A 2GCHG 3RXCA 3RXIA 4UD9H 4ZKRU 5PTPA 4DCDA 5L30H 1NM6A 3A82A 2BLVA 1BRBE 5HIZA 1E35B 2F3CE 1O34A 2ZDNA 3BF6H 4WH8A 3SJIA 1AO5A 4B1TA 3TJVA 2WV5A 1YCPK 5DGJA 2ZGJA 1P2OA 1P8VC 1MABB 1O2NA 2P94A 5EXMA 2BDAA 3RXHA 1WUNH 2J38A 4LXBH 3GDVA 3Q3KA 2H1UA 2XWBI 5DN6D 3OEHD 1OXGA 1F0TA 1DY9A 1JIRA 1QJ1B 4ISIH 1BBRK 2QGRA 4FXGH 3TGIE 1O2HA 3MNBA 2LP6A 4XBDA 1XM1A 2ZHQH 4A1VA 4GSOA 4VGCB 4AFQA 2ZFRH 1W0ZU 2NU2E 4YOJA 1E1QD 3M3SA 1FMGA 2BD4A 1TLDA 2XNDD 5GIBA 2G8TA 1YLNA 1VGCC 4XBCA 3T27A 2QC2A 1GVKB 4XBBA 1XVMA 1XKBC 5C2ZA 4CRGA 2CV3A 1MTSA 3H09A 4AORA 1GBTA 3FZDA 3RXTA 8GCHF 4GCHF 1ESAA 2BB4A 4FU7A 2GVFA 2PKSC 3RXJA 2ZC9H 5LPFA 3A7XA 1HUTH 4WXIA 3HK6B 1P05A 3TJUA 1TX6A 3UOUA 4F49A 2AH4X 1TBQH 3PV5A 1GJ8B 4IW4E 1BQYA 1IQJA 1C5WB 1ID5H 3DD2H 4DGJA 1PQ7A 1THRH 1W7GH 1YC0A 5AHGH 1FY8E 2JH5D 1GJ5H 1TGCA 1ZPCA 1L4DA 1P9SA 1EASA 4NIWA 3MU0A 3GCTG 1HV7A 3BN9A 1SLUB 3P8FA 3K6ZA 2PFEA 1C5MD 4NGAH 1S6LA 1U6QA 3KEEA 4ZH8A 2J34A 2GCHF 3M37A 2XXLA 2CXVA 2XW9A 1H9LB 1UK2A 5C94A 3HPTB 4XD7D 1O2JA 3PV4A 4AFZA 2OP9A 1UCYK 4Q2KA 1VJ9U 2FESH 1J8AA 1XMNB 3F6UH 4ZKOU 1UVSH 2WV9A 3W94A 1P06A 3SHAH 3FOAA 4FU9A 1P2IA 1S82A 2KCOA 2QY0B 2ZEBA 1GBFA
chains in the Genus database with same CATH topology
2TBSA 2JH0D 3KGPA 6CHAB 3MNXA 2F9NA 1S6FA 2CMYA 1SGCA 1TNHA 3ZVAA 2Z7FE 1SLVB 4B74A 1TNJA 1MTWA 4D7GA 1H9IE 2SNWA 1BJUA 3LJJA 4OS2A 3ZZ9A 1O30A 1NO9H 1QQUA 7GCHG 1W3CA 4AZ2B 2PWXA 2BDHA 5A0CA 1GI1A 4ZKSU 1ZTKA 3KHVA 5DO4H 4CHAC 3A7ZA 4E7NA 1F7ZA 1TGBA 4THNH 3V13A 3GCHB 1K1IA 3MH4A 1SGNE 3A7TA 1G37A 2GMTC 2CGAA 2Q6FA 1GJCB 3SZNA 3QTVH 3PWCA 2IN2A 1LQEA 1C1RA 1GDQA 2QAAA 1D6WA 4AGJA 3QLPH 1AVGH 1Z1IA 4R8TB 2HOBA 1SQOA 4FUJA 3AW1A 3NUMA 3QUMP 3JZ2B 2Q6GA 3FVFB 5F8XA 1ARCA 5E0JA 3A7YA 1S81A 3SV2H 3DT0H 1J14A 4ZUHA 4ZROA 1CA0C 1YM0A 2AGGX 3UIRA 1IQNA 3GCTF 1MZDA 1YBWA 1W12U 3MI4A 3HGNA 1BUIA 1YPMH 2WINI 4OS7A 2ODPA 1CGIE 5A8YA 1O5CB 4INKA 3SO3A 1JXPA 4YT6H 7KMEH 4YOIA 5E0GA 3E0NB 1AFQC 1C2MA 1ZGVA 2FEQH 5T6DA 2AIPA 5ESBA 4Y7AA 1GI4A 3LH1A 5DP5A 1AMHA 4JYTA 1UVOA 5I25A 5CE1A 4ISNA 4JZFH 2OTVA 1SGRE 1O2LA 1BTUA 2PKAB 2QN5T 1DVAH 3VGCC 1DSUA 1FXYA 3M7TA 1A5GH 1QR3E 1ELVA 7GCHF 1PPFE 1QY6A 3RU4E 4K3JA 1TX7A 1O5BB 4AB9A 2FMJA 2A1DB 1O36A 1L1GA 2UWPA 4CBNA 2G55A 1LKAA 3SUEA 1TGSZ 2ZTYA 1SPJA 3ZZ6A 1DWCH 3RU4D 3SNDA 5EQRA 3AASA 1NU7B 1TQ0B 4A5TS 1AQ7A 5HXFA 1TWXB 4IC6A 4BAOB 2WYJA 1GI8B 3V7TA 3URCA 1NY22 1C5SA 1PQAA 1QL8A 3D23A 4O97A 3UPEA 2ZECA 3ZVBA 5F8TA 1EJAA 3VPKA 3SHCH 1O2MA 1S6HA 1B5GH 1A3EH 4DOQA 2A7CA 1AIXH 2GGVB 3EE0B 4K1EA 2TGPZ 2VVCA 4GLYA 2DE8A 3TH3H 1BTZA 1Y5UT 4X8UH 2Z9JA 3AVZA 4OS6A 1WV7H 3SU2A 3E8LA 1A0LA 3KNXA 2BXTH 1BTHH 2ZCHP 1VR1H 3LGWA 1EOLA 1PPGE 4X6NA 4CRDA 2FLRH 2OC0A 2V3OH 2QYIA 4XFQA 2H5CA 1A7SA 3BEUA 1WOFA 1SGFA 1TNIA 1MCVA 5GDSH 1TPAE 4X1NU 1V2LT 1DANH 5AF9H 5EPYA 2FTMA 2HALA 5K0HA 5T6FA 3NKKA 3T28A 1UK3A 3RXOA 3ATLA 5HYOA 2FOBA 2UUJB 2OC7A 1TGNA 4A1XA 4BOHA 5T3HA 1A3BH 4MNWA 1O32A 4FUFA 5LH8A 1T8NA 5G4BA 5F03A 1SI5H 4DY7B 2FTLE 2V3HH 5FHTA 1KLJH 2OXSA 3A8CA 1MTNB 2FOMB 1C1UH 1O3LA 2ASUB 2SGEE 4TWWA 3BV9B 5EW2H 1M9UA 4X0WU 3PMBB 2LPRA 1ABIH 5CHAB 4CR9A 3HATH 1C5XB 1P02A 1NT1A 3BTQE 4ISHH 3BTGE 4MPXA 2O9QA 1AFEH 3RMNH 3S7HB 4B2CA 3VB5A 2B0FA 2G4TA 1OPHB 1YGCH 2BXUH 2J95A 4A7IB 1RD3B 2RG3A 1XVOA 4MPUA 3CS0A 3PB1E 1ETSH 1RJXB 1QHRB 2VH6A 4MPVA 1O31A 1EP6A 2FOCA 1A1RA 1RTKA 4I8KA 2P3FH 3TK5A 1D3DB 1VCWA 2BM2A 3OY6U 6GCHG 2NU1E 1FI8A 4TWYA 2DUCA 1QA7A 1HAVA 2ZQ2A 4ISLA 4MPWA 1ZRBA 2H6MA 4K5ZA 4FUIA 1JIMA 4X6PA 1SHYA 4QT8C 2ALPA 1CE5A 4FUHA 1TBZH 5FPYA 2OC1A 2FX4A 1GMHG 3QX5H 5DPAA 3BG8A 1LHGH 3SJKA 1PFXC 5DP6A 1B7XB 1HJ8A 4WH6A 1P2NA 3F9GA 1WTGH 1UTPA 2C8YB 3MU4A 4JZ1A 2XBYA 3Q00A 1UVUH 2Y7ZA 1V2VT 2BD7A 3LGVA 4B75A 1H4WA 2J92A 2P8OC 1ZHPA 1MKXH 1GBBA 4DIHH 1TYNA 2EA3A 1DWEH 1C5YB 2GV6A 5ABWA 4AB8A 3BEFB 4FUDA 1CHGA 3RXDA 1LHCH 3UQVA 1GDUA 4LZ4B 2QA9E 1BZXE 4NG9H 1DOJA 1MTVA 1IQKA 1CT4E 5F6MA 3DHKH 3GDSA 2ZDAH 1FLEE 3M7UA 2PUXB 3LT3A 1AKSA 1TRNA 3O8DA 1AWFH 3FP8E 2SGAA 1TMUH 1P03A 1FZZA 3MFJA 4OS5A 2O8UA 1N6XA 1LMWB 4BAMB 4ABAA 1NS3A 3EA7A 2KAIB 2I6QA 3HKIB 4K8YA 3SORA 4B2AA 1FV9A 2C4FH 1RIWC 5DP3A 4MLFB 1F5KU 1ACBE 2BY5X 1O3JA 2B9LA 5JBCS 4BXSA 1GBLA 2JETC 2ZHDA 2BHGA 1LVYA 5DK1A 3S9CA 3T25A 4SGBE 1V2TT 1EQ9A 1O2SA 1KY9A 2R0KA 1K28D 1QRWA 2HNTE 6GCHF 1T31A 3F9HA 1C5PA 7LPRA 3PYHA 3ZV8A 1QRXA 1GJDB 3SUGA 3SOSA 4ESTE 1KXEA 1K21H 2PR3A 4F4OC 4X1RU 2H5DA 1HNEE 5EXLA 2AS9A 1ANDA 3ZVGA 1P11E 2ANWA 1C2IA 1KXFA 5TJXA 1RGQA 1UMAH 1GMHF 5C5NA 1O5DH 2ZGBH 2ZDKA 3FFGA 1G32B 1YPKH 2J4IA 2PGBB 4JK5A 1ZSJA 5AFZH 1P2JA 3UOPA 1FUJA 4AFSA 1HAPH 4TY6A 1A0HB 1K2I1 4DJZB 1XKAC 1V2QT 2B5TB 4DT7B 1ELAA 4AYVB 4FUCA 4OS4A 1AB9C 3TVJB 4FU8A 1HJAC 1WSSH 4INHA 2W7SA 3LOXA 1O2VA 3RXEA 1YKTA 1A5IA 2FOHA 1GCDA 2C8WB 2XC4A 2OUAA 1VZQH 2GP9B 1TRMA 2BD3A 1K1MA 1QBVH 4BTUB 1PPHE 4I8LA 4WY3A 2QF0A 3AAUA 1C1TA 1T4UH 3GCOA 1O5AB 1EPTC 1P10A 4D7FA 1RTLA 1VGCB 2P95A 2R2MB 2VIPA 1Z7KA 3KQEA 2HRVA 4ISOA 3ENSB 1V2OT 1CBWC 1T32A 5EW1H 1LVOA 1C2JA 2V0BA 1BRAA 1B0FA 3SJ9A 1IQHA 2CN0H 3KQCA 3SU1A 5DKMA 1ANEA 1ZJKA 1O39A 1UTOA 3A8DA 2PKSB 1O2UA 1NC6A 4JZIA 5I46H 1KTSB 1GDNA 1OSSA 1MBMA 1F0SA 1C1VH 1GL0E 3LGUA 4YLQH 3A85A 2TGTA 3CENA 1HLTH 1NRNH 1YCPM 2BX4A 4TYDA 2ZU4A 1PYTD 3U8OH 2M5TA 2ZA5A 3MU8A 1CQQA 3LONA 1NRSH 4NWKA 3P6ZB 1LVMA 2BZ6H 1J9CH 1C4Y2 2PLXA 1XUJA 2BD8A 3RLWH 3CP7A 3MNSA 3BTEE 1BTWA 1AUTC 1OWHA 2ZHFH 1YPHC 3BTFE 1V2JT 1DLKB 1S85A 2R2WU 1LVBA 3HGPA 1GGDC 2D2DA 5A8ZA 2RCEA 2ZPSA 1DWBH 4HI3A 3ZYEA 2ZFQH 1AHTH 4X6MA 2HGTH 3T62A 1UTJA 4OGXA 2P16A 3LDXH 1O3IA 2GT8A 4K60A 4X1QU 3SV6A 3SGAE 4AN7A 1UTMA 4XSKU 3UWIA 1A4WH 3ELAH 2ZHWH 3UNSA 1K1PA 1O3OA 1AZ8A 2FI4E 1YPJH 2ZGCA 1C4U2 1GPZA 3K2UA 2HPPH 2GDDA 2HWLB 2UWLA 2XC5A 1FAKH 3IWMA 1YLDA 1G3EA 3V3MA 2HLCA 2QV1A 5ETXA 2BD5A 1XUIA 2UWOA 1W7XH 1TALA 3DFLA 3VB7A 4CHAB 3ZZCA 4XE4A 4RKOB 1C2GA 2A5IA 3EYDA 2ODYB 4AYYB 2BVXH 3EAJA 1MU8B 3UR9A 1DY8A 1IHSH 2EEKA 2GMTB 1QJ7B 3QN7A 4E05H 4BNRA 1Q31A 2GZ8A 2OINA 1C9TA 3T29A 1J15A 1O2RA 4RSPA 3ZZ4A 2A4RA 2CHAC 4CR5A 2TGAA 4HFPB 1PJPA 2KAIA 2P3UB 3A7WA 4JK6A 4CH2B 3QTOH 1EPTA 1EZXC 3TK9A 3U1IB 1O2XA 1PQ8A 4H6TA 3TU7H 4ZKNU 1FY5A 1GBEA 3OYPA 3QDZB 1CA0B 3ODDA 2AGEX 2V35A 1OP8A 2A0QB 4HZHA 2BVSH 3UREA 5JB8S 1EB1H 1C5VA 1GI7B 3F9FA 1O2ZA 2AYWA 5T6GA 4AG2A 1PPBH 4TPIZ 2VVUA 1J17T 1F92A 3PO1C 1HAOH 2P93A 2VGCC 4NWLA 4NSVA 1Y3UA 3U1JB 1EZQA 1AFQB 1O5EH 1O33A 2OQ5A 3GOVB 2F91A 1O0DH 3BTTE 4ABIA 3ZZ8A 2VIVA 3ODFA 4ABEA 2ZTZA 1AU8A 1KLIH 2WPIS 4FUBA 1GG6C 4KP0A 4CRBA 3L3TA 4YT7H 2BDCA 2ZU2A 4WMFA 2AEIH 3MU1A 1CA8B 3RXRA 2I6SA 3KIDU 4UFFH 1P0SH 1TOCB 1G30B 3VGCB 4R0IA 1VCQA 3FP7E 1ZJDA 3MYWA 3NPSA 1DSTA 5H4IB 1FY4A 4HGCA 1N8OC 3SNCA 1TMBH 5C67A 1Y3XA 1QURH 1KXDA 3A8BA 5FCKA 5EQQA 1NPMA 5A8XA 3M5MA 1W8BH 4OGYA 5JB9S 4I8GA 4RN6A 4WWYA 3U8TH 2WPKS 2BTCE 2FM2A 1AWHB 1V2PT 1QJ6B 1HAVB 1P01A 1SHHB 3O8CA 3PLPA 1SMFE 2BD9A 3ZVDA 1UO6A 1IQLA 2A5KA 2HPQH 5A0AE 4X1SU 1D9IA 5EXNA 5FPSA 4U01A 3O8BA 4Y79A 4BTTB 3PTBA 1JBUH 1NFXA 4CRAA 1DITH 1S0QA 3PWBA 4IMQA 2BLQA 2XRCA 1AD8H 2ZIQH 1EJMA 1L4ZA 1BMAA 2Y5GA 1HXEH 1RRKA 2HNTC 3LGTA 1ZLRA 3LU9B 4ZAEA 2THFB 2ZNKH 3MOCA 3IITA 2ZDVH 1DT2A 3GICB 3P17H 1IHTH 4H6SB 4AGKA 3BTME 1FQ3A 4X1PU 3D65E 1C2HA 2A4GA 1RTFB 1SG8B 1MAXA 1TA2A 5TCAA 1C5UA 2Z9GA 1Z8JB 4UEHH 1NFUA 3E3TA 1LPGB 3OSYA 2BD2A 4ZXYH 1H9HE 5LPEA 4BTIB 5CMXH 2A7JA 1XXDA 1AKSB 1Y5BT 2PTCE 2ALVA 3H5CB 2BDGA 2ILNA 1C1SA 1PQ5A 1UVTH 2FOEA 1E36B 4Z0KA 1QRZA 3ATWA 5AVDA 3S69A 3RM2H 3A7VA 2AMDA 1AE8H 2V6NA 2G52A 3PMJA 3GY8A 1IQFA 2BOKA 2A7HA 3M5NA 1C5ZB 2FDAA 1LHEH 3LPRA 3H7TA 1DWDH 1W10U 3SV7A 2CF8H 1CHOG 1YPLH 1CU1A 1WU1A 1S0RA 3TPIZ 2C93B 1D4PB 2FOFA 4NSYA 5EG4A 1NRRH 3NWUA 4B76A 4LK4A 2ZDLA 4BXWA 1C5TA 1YPEH 3GYLB 5HMAA 5A2MH 1HAXB 1S5SA 1ARBA 2W5EA 1SGQE 3B9FH 1O2PA 2C90B 4A92A 3F9EA 1KLTA 2BY8X 3MH5A 2VJ1A 1YP9A 1BJVA 3RC6A 1Z6JH 4MNYA 1P3CA 3UNRA 3RP2A 2J2UA 2Y5HA 2XCFA 1NRPH 4GUXA 4K69A 1EXFA 2CJIA 3SNAA 1SSXA 2A2XH 2SGFE 4ABHA 3TNSA 1GJ6A 4NIVA 1YPHE 4U30A 1OWJA 1LDTT 3A8AA 4NFEA 4YTAA 1PPEE 3QGJA 3GYMA 2PSXA 4O3UA 3RU4T 2C8ZB 1O3DA 1H8DH 2TRMA 1KYNA 1EAWA 3M3VA 2RA3A 5FPTA 1HB0B 2H9TH 3ZVEA 3ATMA 4O3TA 1HAZB 1XX9A 1F2SE 2P8OB 2P59A 1D3PB 1TNKA 1SGFG 4Y10E 2EI7A 2YOLA 1GCTC 1SGEE 1SGIB 3MH6A 3TNTA 1Y5AT 3ATKA 3TIUA 1FJSA 4BAQB 1QGFA 1BA8B 1V2MT 5GPIB 3ZZAA 1BHXF 1GWAA 3M36A 2BVRH 3MU5A 2VINA 4ABGA 3TLOA 4Q7YA 1CHOF 1OYQA 1GMCG 1BITA 3SQEE 4Q80A 5ESTE 1RFNA 4UE7H 2EC9H 1O3MA 1T8LA 1CGJE 1JRTA 2B7DH 3F68H 1FIWA 2G81E 4CBOA 4I8HA 2DE9A 3U69H 1SLWB 1CT2E 4Y0ZE 2W3IA 1SQAA 1RIWB 1GHYH 3P70B 4I31A 4JZEH 1WQSA 5LGOA 1MTUA 3SU0A 2B8OH 1L0ZA 4K2YA 2JETB 3URDA 1BMMH 2BQ7B 2ZZUH 4IS5A 1V2UT 1TPPA 1KDQA 3K9XB 3TJNA 1UTKA 1YYY1 1ZGIA 4NCYA 5C5OA 1MKXK 1WQVH 1TMTH 3KN2A 2IJOB 3MO3A 3R0FA 1WAYB 1PPCE 4WF8A 4IBLH 4X2YA 3VEQB 1BDAA 3TK6A 1C4V2 1QNJA 2Z9IA 3AW0A 2OD3B 1C5NH 5FAHA 4AG1A 2W26A 1PPZA 4JZDH 1TONA 4ZHLU 3SU3A 1O2KA 2F9PA 1GI9B 1NTPA 2WUBA 1AB9B 2ZP0H 1HJAB 5EODA 2Y81A 4KKDA 3VFEA 1EX3A 1C5OH 1DPOA 1V2ST 2VWLA 2ODQA 2D8WA 2Y80A 4BAHB 1TPSA 3SNBA 1HPGA 3LGYA 2FLBH 2R3UA 3BTWE 1AUJA 3MO9A 5HM2A 4D76A 1GBCA 1GBDA 1O2QA 5AFYH 1HYLA 1LQDB<