3TJOA

Htra1 catalytic domain, mutationally inactivated
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
211
structure length
198
Chain Sequence
MDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTTQDYIQTDAIINYGNAGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFLTESHDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease HTRA1
publication title Structural and Functional Analysis of HtrA1 and Its Subdomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 47
structure length 198
sequence length 211
chains with identical sequence B, D
ec nomenclature ec 3.4.21.-:
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tjoA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tjoA02
4AYVB 1DLEA 3SNBA 2CGAA 1P2JA 1HCGA 1LQEA 1JIRA 1QNJA 1C9PA 5DP3A 8GCHF 1EATA 1F92A 1RIWB 1C1WH 3HATH 1GI6A 4A7IB 3JZ2B 4LZ1H 3LPRA 1C5QA 1TALA 5EG4A 4YLUA 1KLIH 1DX5M 2BZ6H 3TH2H 1GJAB 1O5EH 1IQIA 1SVPA 3E8LA 2UWOA 1ZSJA 2G4UA 4X6MA 2PSXA 2HRVA 3SQEE 1Y5AT 4HGCA 2C8ZB 1BMAA 2QF0A 2G81E 1WAYB 2TGTA 3PO1C 1KLTA 1TBRH 2ZP0H 4WH8A 2QXIA 1RRKA 4TWYA 3MU0A 1LPKB 1YGCH 3URCA 1WV7H 1E0FD 3FVFB 1FJSA 1GBDA 2A31A 4WF8A 1UCYH 4BTUB 1LVMA 2WPMS 1OKXA 3MMGA 3SJ8A 2FOAA 1AKSA 2AYWA 1GPZA 4KP0A 1CHOG 3V12A 1V2MT 2O8WA 3HK3B 2VJ1A 2P93A 5SGAE 1LVOA 1Z7KA 2W3KA 2FPZA 1G30B 1WUNH 1VR1H 5C1UA 1AIXH 4CBNA 2A4OA 1T8NA 4QT8C 2ZU1A 1C5PA 1EZQA 4JZDH 1AZZA 1QJ7B 1AE8H 2OD3B 4D7FA 1LVBA 1V2QT 1JOUB 2J9NA 3U9AH 3LT3A 3RXOA 3STIA 1QA7A 1ZTLA 3QUMP 3LGIA 4ESTE 1ABIH 2OBOA 5EQQA 2SGDE 2PW8H 2P8OB 1FXYA 1O3GA 1HB0B 4YM9A 4J2YB 3OU0A 2H9HA 2HPQH 2R9PA 3AAVA 1BITA 2QXJA 4X2YA 2FYRA 3UOPA 3EYDA 3TJVA 1YPMH 1HUTH 1ZJDA 1C1PA 2SGQE 2A45B 2BY6X 2G52A 4IGDA 3RXEA 1A0JA 1T31A 3P8OA 2FOFA 1UO6A 2GP9B 1HAVB 3R0FA 4TPYA 2UUJB 1HNEE 1Z8JB 3TNSA 2A7HA 5DKMA 4MNYA 1SFIA 2RA3A 1EP5A 4K1TA 3BG4C 1YPEH 1C2FA 5IDKA 4MLFB 1O3NA 4MG3A 4ZUHA 4ZKRU 2F91A 4GCHF 1BMLA 3A7WA 4CRAA 2ZPRA 3Q3YA 4AYYB 3AVZA 4UD9H 2BDCA 1CT2E 1Y3UA 5K7RA 3MI4A 1AVXA 1KIGH 4MQAA 3HGNA 1GCDA 2QAAA 1IHTH 2ODPA 1DT2A 4NGAH 4YTAA 3E3TA 4DIHH 2PKAA 3SZNA 1GJ4H 3PWBA 3TITA 5HM9A 1P02A 3M36A 1QL9A 1V3XA 1O3OA 3SUGA 4AFSA 3UY9A 1T4UH 1AQ7A 1CBWB 1O3IA 1O2VA 1V2TT 3VGCC 3MU1A 1SLXB 2BD2A 1EKBB 4FUBA 3I78A 4WMDA 4RN6A 1TPAE 5DO4H 1DWCH 1C5SA 1S85A 1EJAA 2ZFTA 1EAUA 3LC5A 2XBWA 1KYNA 1G3BA 3AAUA 3ESTA 5FPSA 1E36B 1O33A 2GDDA 3KQEA 2NU2E 5EODA 3ATMA 2VIPA 1GL0E 1ZHMA 2AS9A 4TY6A 1KDQB 5BRRE 1TNIA 4BXWA 4Y10E 4KTCA 2QV1A 3SO3A 4AOQA 1L1GA 9ESTA 2HOBA 4UFEH 1W11U 4KTSA 1C5ZB 2Z9JA 5EW1H 3EA7A 2VU8E 1FY8E 1K1OA 1QJ1B 2BX3A 4YT6H 3U8RH 1P2IA 1UK2A 2Y82A 3P8NA 1ZOMA 3QZQA 1NN6A 5ESTE 1VGCC 2VWOA 1ZTJA 1HV7A 1GMCG 1Z71A 5A09A 6LPRA 1UVSH 4AFUA 4CRFA 2G00A 2V35A 1QCPA 5HXFA 2VGCC 2OQ5A 4O03A 1ZHRA 3QK1A 1O3MA 3TGJE 2FX4A 4BNRA 1HFDA 2G51A 1ELTA 1MBQA 1QY6A 3BTDE 4ZXYH 4AORA 5FAHA 2G4TA 4ZKSU 4MNWA 3SV7A 1X7AC 2R0KA 1PQ8A 1AU8A 4K3JA 3MO9A 1H1BA 1C2LA 2ANMH 1Z8IB 3VB7A 1AE5A 3FFGA 1XUFA 4I8JA 1D3TB 4K2YA 1TPOA 3F9FA 1ZPCA 1GI0A 4XSKU 2ZZUH 1H9LB 2THFB 4FU7A 2EI7A 4B71A 5L30H 3ZVBA 1LPZB 2FOGA 4KGAA 1QB9A 1NO9H 2SGAA 1YPKH 1BBRH 1MTWA 1THRH 5PTPA 3TPIZ 1N6YA 2ZDAH 3PO1B 1DFPA 4MPWA 5FCRA 2HGTH 1XVOA 1HYLA 4ABGA 1BHXF 1DXPA 1GMHG 4B73A 3ZZ9A 1GG6C 1C1OA 1CT0E 1AMHA 2A1DB 4YZUA 4Z0KA 1WCZA 1O2GH 2BDIA 3PM3A 5EQSA 1JIMA 1T4VH 1SGRE 2TRMA 3RXSA 2FESH 2SGPE 1O5DH 1QRXA 2G8TA 1DANH 4JZIA 1DSUA 4THNH 4IBLH 3ATWA 1GJCB 4OS6A 2BX4A 5FX5A 3OY5U 1ZMLA 3MNSA 1SHYA 1GI4A 2OINA 1T8MA 5TCAA 2LPRA 2EI6A 3RC4A 4AX9H 2Q6GA 1ZPBA 2RCEA 3SHAH 4FU8A 1G9IE 2XCFA 4Q7YA 4X2VA 2SNWA 1ZTKA 3M37A 2OC7A 3P6ZB 4ZKNU 1IAUA 1FUJA 2HNTE 2ULLA 3FZDA 5F8TA 1TGTA 4JK5A 2ZFQH 1TRMA 2BY5X 2VH6A 3BTEE 1BT7A 3Q77A 1DITH 5AFYH 4OGYA 5EXLA 3GY8A 1C5WB 3QTOH 1AVWA 2ZPSA 5GJ4B 3SV9A 3DHKH 3FZZA 3SJOA 1O2LA 1SQOA 1HAVA 1GMDG 5JB9S 5FCKA 3ZVFA 3M5NA 1MTVA 2Z94A 1O31A 1J15A 1TONA 1K1MA 1GBMA 4O3UA 1UK4A 3M5LA 3RU4T 3RXUA 3MWIU 3RMLH 1C1QA 3BG4B 5C1XA 2QIQA 1S84A 2XC5A 5C1YA 2FYQA 1EOJA 1WOFA 3R3GB 3HPTB 1TPPA 1DY9A 1UTMA 4CH8B 1V2KT 4FUCA 2HLCA 2GZ8A 2BVXH 2D26C 1YF4A 3IG6B 1MQ5A 2CN0H 1W7XH 3AW0A 3S9AA 1MKWH 1SGFA 4OS2A 3NXPA 4NWKA 1IQKA 2FX6A 4JYTA 1EPTC 1TFXA 3SU1A 1C5OH 1V2NT 3BN9A 4JYVH 3A7VA 3RM0H 4DIIH 4NZQA 2WUCA 5H4IB 2GZ9A 3SV6A 2W5EA 2QXHA 1OPHB 4KTUA 2ZHWH 3RXBA 2WPKS 1UTQA 1A7SA 1JBUH 1GBLA 1E35B 1DICA 1UVPA 1V2OT 2ZCLP 5G4BA 5A0AE 2WPLS 3MH7A 3K6YA 3VGCB 1V6DA 2GMTC 1G3EA 4D8NA 4TWWA 3LDXH 5DP6A 1YBWA 1YCPK 3MNCA 2EA3A 3SJIA 3BEUA 3T62A 1ELCA 1PQ5A 4WJG2 1ACBE 2FOHA 4K60A 1O38A 1LDTT 2ANWA 1K1IA 1T7CA 4MTBA 1OWDA 2NU3E 1GBAA 2P8OC 5TCCA 1XUJA 3F68H 4A1XA 1O35A 1KTTB 4IN1A 2H5CA 1CHGA 1DDJA 1TX8A 3MO3A 2C93B 3P92A 2J92A 1K2I1 2ZGJA 3DFJA 5FBEA 2SFAA 4BAOB 4D7GA 1K9OE 1FY1A 1GDUA 1G32B 3CS0A 2ZO3H 1LHDH 2Z7FE 2GVFA 2XC0A 2FEQH 1O2OA 1OWJA 1LHFH 4FUJA 1F5RA 1A46H 3V7TA 2F83A 2OQUA 2V3OH 3SBKA 1C5UA 2ALVA 1O2IA 1UHBB 3UQVA 3JZ1B 2F9BH 3F9HA 2F9UA 2PUQH 4Y6DA 1KXCA 4H6TA 3A89A 1GBCA 3NWUA 1A5GH 1FV9A 2A5IA 3FAOA 1G3DA 3Q00A 1C5MD 4OGXA 1GI3A 2B8OH 1QBOA 1XX9A 1BUIA 2EI8A 3NUMA 1HAOH 1DWBH 2YNBA 1Y59T 4NWLA 4ZAEA 1SGPE 1C1VH 4BAMB 2P3UB 3P95A 3QDZB 3SGBE 1YLDA 4WMFA 3PMBB 2P94A 1FZZA 1O5GH 1RTLA 4ABDA 1XUHA 1ZYOA 5C3NA 2BDBA 3RXAA 1O5AB 1QRZA 3MTYA 1W10U 3WY8A 1BRCE 1HIAB 1O2TA 1OP8A 1QBNA 1DS2E 1BTHH 1GMCF 4UFDH 3OY6U 3ATKA 3SJ9A 3TJNA 2GT8A 3BG8A 4E05H 1LHCH 1BQYA 5BPEA 5I46H 1TIOA 1V2ST 1SQAA 1B7XB 3RXKA 1O3AA 3A85A 1T8LA 1SLVB 4YOIA 1CA0B 1DXWA 3UR9A 5DG6A 2VVUA 3BF6H 1FAKH 3DT0H 3TK9A 5ABWA 3BEIB 4X8UH 5I25A 1YKTA 1C4Y2 1VITF 1P01A 3RXCA 2R3UA 1GG6B 2FS8A 4DG4A 4A6LA 1O2RA 5A8XA 3ZZ4A 1ZR0A 5EPYA 1V2WT 2HVXA 3T27A 1F0SA 4X8VH 3FP6E 3QZRA 2YOLA 1Z8GA 1M9UA 1EOLA 1UVOA 1HXEH 1W14U 3PLBA 3N7OA 5TJXA 1YPLH 3O8BA 4A1VA 1BBRE 1FNIA 2AIPA 1NM6A 1SSXA 2ZPQA 3SHCH 1UVTH 1MKXH 4MVNA 4ISOA 1AGJA 3RXGA 2UUYA 1C5YB 1EASA 1P3EA 1HAHH 1GMHF 2G5NA 1GL1A 4AGKA 1TNKA 1F0RA 2ODYB 1TX6A 3E6PH 2JKHA 4DCDA 1TOCB 1FLEE 2QCYA 1TGCA 1F2SE 2P95A 1HXFH 2ZTZA 5DJ7A 3T28A 3RU4E 3GYLB 1IQJA 3SQHE 1SFQB 1GBEA 4CR5A 5FPYA 2D2DA 1JRSA 1P12E 3RMNH 3LGUA 1HPGA 1SB1H 2BLQA 2ZC9H 1S6HA 1O2XA 2GKVE 1MU6B 3OX7U 4CBOA 1MTNC 3LH3A 2A7CA 2Q6DA 3RXHA 1C5LH 2Z3DA 1MU8B 1ZMJA 1FDPA 4K69A 4CR9A 1W8BH 3SU6A 4H42U 1S0QA 1AO5A 1YPJH 1P10A 3A84A 4XBCA 5F8XA 2SNVA 1QURH 1SLUB 2FS9A 4XBBA 3NCLA 6GCHG 1GJ7B 2VB0A 1FY4A 3TJOA 3PLPA 3CP7A 3SU0A 1C4V2 4DGJA 3QTVH 1T8OA 4INKA 2FWWA 4FVBA 5E8EH 1CE5A 2V3HH 2AGEX 4Q2KA 2ZHDA 1SBWA 2GT7A 3KIDU 1EAXA 1W13U 2C8XB 4GSOA 1SPJA 1AZ8A 2AMQA 1Z1JA 3UTUH 1GMDF 1EPTB 3NPSA 4IN2A 2AEIH 2FP7B 1DVAH 1O3JA 1CQQA 2Z9LA 3RC5A 3KNXA 1C1NA 4U2WA 2VH0A 4IS5A 3VB6A 2A4GA 4X6OA 1O2NA 2ZGCA 4DY7B 2XW9A 2GMTB 1DPOA 2BQ7B 1GVLA 4H6SB 1EAIA 1S5SA 3BIVH 3M5OA 2FI3E 1E37B 1NFXA 5AVDA 4ABHA 3DD2H 1TPSA 1MAXA 3KF2A 2G55A 4WXIA 1S82A 2GZ7A 3KEEA 1ABJH 1O2ZA 2ZTYA 1GJDB 1YM0A 5EOKA 1INCA 1O2WA 1HJAC 1U6QA 3RXFA 2WV4A 2OC0A 4ZH8A 1VJAU 1KSNA 4K8YA 1S0RA 2BY9X 4ABAA 4A92A 3DFLA 1XUGA 2HNTC 1ESBA 3ZZAA 1E38B 1MUEB 4I31A 1T32A 3P8GA 3VB4A 1ZHPA 4X2XA 5EPNA 5T6DA 3A8AA 1W0YH 1P11E 1EZSC 3OSYA 3QX5H 2AGGX 1XXDA 2IN2A 4Y8YA 1WBGB 4TYDA 1N8OC 4FXGH 1GDQA 2A7JA 1Y3VA 5GXPA 1P09A 1SGTA 3MH6A 3DUXH 2VIVA 3RXPA 5F8ZA 2BLOA 3GCTF 3UREA 8LPRA 2BMGB 1QB1A 3RXLA 1BTYA 1NPMA 1QQUA 2LNCA 3H5CB 1RGQA 3I77A 3TLOA 1C2HA 1D6RA 3SUDA 1G37A 2WYGA 4BAQB 3GY3A 5JBTA 2ZQ1A 1NS3A 1MQ6A 1C1RA 2BQ6B 2VIWA 1FMGA 5T6FA 1EX3A 2BB4A 1TGSZ 1NT1A 1Z8RA 4X1NU 8ESTE 1KXFA 1ZJKA 1SOTA 1EJNA 3RM2H 2ALPA 3SU5A 1C2DA 2PSYA 1FN6A 3Q76A 3RXMA 3ZYEA 3UOUA 3TGKE 2XYAA 2Y5FA 1AWFH 2JH5D 1E34B 2STAE 5GPIB 5DP4A 3PROA 1H8DH 1A3EH 1J8AA 3RXTA 4GUXA 1ZZZA 3BTME 1W3CA 2ASUB 4BAKB 1SGDE 1Z6JH 2Y7ZA 4I8KA 2M5TA 2C8YB 2OCVB 2F3CE 3MO6A 5DK1A 1SGNE 2BHGA 1DLKB 4OS1A 3TIUA 2ZDMA 2IOTA 3MHWU 1P3CA 2XRCA 3ZZ8A 2ZEBA 4Y7AA 3O8RA 1SGQE 3EQ0H 3BTKE 1MMJN 5HYOA 2XWBI 2A2XH 2AMDA 1P2KA 1THSH 3MYWA 3ZV8A 1CGJE 3F6UH 1BTUA 1SG8B 3T25A 4HTCH 1GBKA 1PQAA 1EB2A 2BLWA 1OYTH 1GDNA 2FLBH 5HGGA 1SGIB 1SR5C 4DT7B 5E0HA 1VCPA 4GLYA 4XBDA 2V0BA 3S0NA 1THPB 2F9NA 2WYJA 3TU7H 4AG2A 1AHTH 4X6NA 1NFYA 1AUTC 3LH1A 2BQWB 3ZVEA 1WTHD 2WINI 4NIVA 3GCNA 4H4FA 3M3TA 2BOHB 4ZHMU 5JBAS 3ZZBA 4BANB 1SGCA 4BOHA 1GI5A 1QJ6B 1A3BH 1MTUA 1C1UH 2H9TH 4B2AA 1C4U2 2V6NA 4UFFH 2UUKB 3OYPA 3ZVAA 4UEHH 4E7RG 3GISB 3KCGH 3V0XA 1C2EA 1DWDH 1JXPA 1L0ZA 1VITG 2TPIZ 3AW1A 3SOSA 1MTNB 2HALA 3P8FA 2BLVA 1UVUH 2QY0B 4NCYA 1GHBG 2A4RA 2FOCA 4ABBA 1BZXE 1NESE 1NC6A 1Y3YA 1QIXB 2O8MA 1YP9A 2W26A 4ABEA 1GJ9B 1OX1A 1D6WA 4Z6AH 3FP7E 1OWHA 1TLDA 3MOCA 1CA0C 4ISHH 2VINA 2VWLA 2JETC 1ANBA 1TAWA 4ABFA 2Y6TA 2ZIQH 5A8YA 5EQRA 4K1SA 1TE0A 4BTIB 3NKKA 4OS7A 3V13A 5E2PA 1V2RT 3EGKH 1TA6A 1O3EA 3VB3A 4VGCB 1MCTA 1GHVH 1RJXB 1WQVH 3LKWA 3D23A 1ZGVA 3E90B 4DOQA 3M35A 1DM4B 2EC9H 3ODDA 4OS5A 4RKOB 1GHAF 3SJKA 1CSOE 4TY7A 2KAIB 4NFEA 1O0DH 3E0PB 5HMAA 2NWNA 2PFEA 4ZROA 3MU4A 2H1UA 6GCHF 1A0HB 4YESB 1S6FA 5DP9A 2A5KA 1O39A 2ZG0H 1GBIA 5JDUB 4Y8XA 3BTFE 1KXEA 2W7SA 2ZGBH 3M7QA 1ANEA 4Y0ZE 1VITH 1V2VT 3MU8A 4JZFH 3PTBA 3RLYH 1N1LA 5FPTA 1AB9B 3LU9B 5IYTA 3RLWH 1UCYE 4YOGA 1KXBA 3B8JA 2A32A 3EA9A 3D62A 4B2CA 2GD4B 1JMOH 1HJAB 1L4DA 4XDEA 5F6MA 3PWCA 2PV9B 2JH6D 1C5TA 1Q2WA 4O9VA 2Y5GA 3H7OA 5C20A 2VWNA 3HKIB 4X8SH 4PROA 1TX7A 2PGQB 3SV8A 1W7GH 1LPGB 1RFNA 5FXLA 4UONA 2CXVA 2P3TB 2Z3CA 1XXFA 2RG3A 3E0NB 3OTJE 1ETSH 1YCPM 1N8OB 1GCTB 4Y0YE 2GX4A 2ZU5A 1SMFE 2Z3EA 1P05A 4K1EA 5FHTA 5LH8A 3BIUH 1SGEE 1FIZA 3SORA 4FUGA 1MAYA 4FVDA 4WMEA 1F7ZA 2CJIA 4JCNA 1P2QA 2BYAX 3KL6A 4WH6A 2J94A 4X1RU 1Z6EA 1D9IA 1GBHA 1AUJA 1V2JT 2TGAA 4AN7A 2ZWLH 3M3VA 4X6PA 2I6QA 4Q7XA 3UNSA 3Q3XA 1HRTH 1P8VC 2BVSH 2CV3A 1KXDA 4JYUH 1SOZA 1HAPH 3L3TA 3V3MA 5CMXH 3GY7A 3LGTA 5L6NH 2VIQA 4B74A 3LOXA 4Y76A 1BDAA 2RDLA 2DE8A 3KHVA 3UFAA 3SNEA 1TNHA 1GI1A 1C2IA 2OUAA 3U98H 2GTBA 5L2YH 4TPIZ 4WY3A 3A8BA 4HZHA 2GV7A 2IJOB 2R2MB 4DVAU 2Z9IA 3SN8A 4CH2B 3M5MA 2VVCA 4GAWA 3ATLA 4I7YH 1Y5UT 1GI2A 1O2PA 1A0LA 3T26A 4INHA 3BSQA 4JK6A 1O5BB 3LGVA 3RU4D 3EAJA 1H4WA 3GCTG 1H9HE 2VWMA 1YYY1 1GHZA 1KDQA 1NROH 3RXDA 1C5VA 2QA9E 1DOJA 1ANCA 4AG1A 3W95A 5T3HA 4AZ2B 2AFQB 1SC8U 2ZTXA 3QLPH 1RD3B 2P3FH 3HKJB 3RMOH 4SGAE 2VNTA 2XC4A 4NA8A 5JYIA 3GCOA 3I29A 1EB1H 1C1SA 1PPEE 3SV2H 1HGTH 1PPZA 1DUAA 6ESTA 3S7HB 1FY3A 3SGAE 3NZIA 4F4OC 2XBXA 4YLQH 1EXFA 4Y11E 4AFZA 3ZZ3A 1J16A 4B1TA 3K6ZA 1VCWA 3EE0B 4ASHA 2ZA5A 2K1QA 1IQHA 1NRRH 5ESBA 1K1PA 2FTMA 1NTPA 2HPPH 1XUIA 2J4IA 1LHGH 4DURA 2IPHA 1BCUH 1HDTH 1OP2A 4F49A 1DE7H 3CENA 1XMNB 1KY9A 5E0GA 1Y5BT 1BRAA 4WWYA 3LIWA 2BY7X 4JZ1A 1GHWH 1C5XB 2F9VA 1L4ZA 3D49H 2BD8A 2UWLA 3STJA 4XE4A 1DSTA 2GCTB 1O30A 1O3FA 2JETB 1QR3E 2PKAB 1OWIA 3A88A 1QTFA 1QGFA 4DW2U 3UQOA 3ZVCA 2PR3A 1GBFA 1BTWA 1YCPH 2ZU2A 1GHBF 1O2QA 1TWXB 1UCYK 4Y7BA 2FOBA 4D9QA 1MTSA 2ZFRH 2C8WB 1LVYA 2PHBA 1MD7A 3ZVDA 1O3LA 4OS4A 3RUOA 1ARBA 1HAXB 4Y79A 1O2MA 1MBMA 1Y3XA 4E06H 3RC6A 2PGBB 1IQLA 3KQCA 4WVPE 1PJPA 5A8ZA 1TB6H 4LK4A 4JZEH 1GVKB 2ZDVH 1TGBA 3LJJA 2F9OA 4B76A 4E7NA 1ESAA 1RS0A 2NU4E 2TIOA 4XFQA 5DP8A 1C9TA 1GI9B 1ORFA 3CS7A 4NA9H 2Y81A 2UWPA 1OSSA 3U1IB 1NZQH 2QN5T 1O2KA 3SNCA 3SU3A 1P9UA 3S9BA 2Q1JA 1OOKB 2WPIS 4LOYH 5EU8A 2FOMB 2TBSA 1SLWB 1UK3A 2R0LA 1NRNH 2BD3A 1CGHA 2PWXA 2VIOA 1A5IA 4GVUA 1QBVH 3T2NA 2ZCHP 1BJUA 1SGYE 1PQ7A 1Q31A 2J2UA 3TH4H 4AGJA 2F9PA 3A7YA 2ANKH 3C1KA 1GHAG 3BEFB 3A81A 3LGWA 2OXSA 1O2UA 3S9CA 1KTSB 2Z9KA 3KN2A 4ISLA 5JBBS 2ZHQH 2BXUH 3A80A 4A5TS 1TMBH 1C2JA 1YC0A 2RA0A 4ISNA 2ZDNA 1FPCH 1IQFA 2SGFE 2ZGXH 4B2BA 1SQTA 4VGCC 3A7XA 5GWZA 1C1MA 1PPFE 3K9XB 3QWCH 1ETTH 2A2QH 1LO6A 3D65E 1BB0B 5DGJA 5E2OA 1TMTH 5LPRA 4U32A 3ZZ6A 1QA0A 4LXBH 2FZZA 2QXGA 2GGVB 2P59A 1O2HA 1V2UT 1FAXA 1F5KU 4JMYA 2BD4A 1YLCA 1G2MA 2C90B 3UNRA 1BJVA 1AFQB 4ZHLU 2EEKA 1RXPA 2PUXB 1ZMNA 1C2GA 1YPHE 4MNXA 1AVGH 3A86A 3QGJA 1AB9C 2OC1A 2BTCE 2FI4E 3F9GA 4UFGH 1GBJA 1H9IE 3IWMA 2ZF0H 2BD7A 2O8TA 4NFFA 2ZNKH 2J34A 1DY8A 1PFXC 3MU5A 1AWHB 3GOVB 1C2KA 2BOKA 4FUEA 1P0SH 3ENSB 1UTKA 5A0BA 3RDZA 3UIRA 2Y80A 1KLJH 5GCHG 4NIWA 1GI8B 2BVRH 1UMAH 1GCTC 4RKJB 1B5GH 1UHBA 1LHEH 1NU9A 1HLTH 1TBQH 1WU1A 3RXJA 1NFWA 2UUFB 4R8TB 5EGMA 1TNGA 4HI3A 4I32A 1G3CA 1MZAA 5C5OA 4CREA 3HGPA 2AGIX 2ZKSA 1AY6H 1B0FA 2OBQA 3LC3A 4ZKOU 3M61U 5A2MH 1BRUP 4YOJA 1P04A 3UWIA 4I8HA 1DWEH 4X1QU 4ZMAH 4D9RA 3GY5A 3MH4A 1P57B 1ZPZA 3K65B 3GY6A 1HIAA 2QGRA 1EZXC 3BTGE 9LPRA 3U1JB 2GDEH 4FUFA 2J95A 5AHGH 2FTLE 3RXRA 1D4PB 1ZLRA 3SUFA 1BTPA 1FIWA 2ILNA 5K0HA 1GGDC 2XTTB 2ZHEH 5DP5A 4KELA 1UTLM 2BDYA 3C27B 2QYIA 1D3PB 1C5NH 1H8IH 2BDAA 1BBRK 3ZYDA 4CRBA 1OS8A 1W0ZU 3PMJA 3M7TA 2ZCKP 2WV5A 1P2MA 2XNIA 4Q80A 3M3SA 4Q7ZA 1ELEE 1D3DB 3BTQE 2OTVA 4Y71A 1HJ8A 2CF8H 3L6PA 3DA9B 3MNXA 6CHAC 2XWAA 1A1RA 3ZZCA 1SL3A 2ANYA 1NFUA 1ZRBA 1L1NA 1UTNA 1ZGIA 7LPRA 4B75A 1D3QB 3W94A 1ELGA 2FLRH 5AF9H 1BOQA 3UR6A 3M7UA 1GWAA 3QN7A 1A4WH 1P06A 2CF9H 2PLXA 1C2MA 2FM2A 1PPHE 2BXTH 1F0TA 4FUIA 1TYNA 5GDSH 1O32A 5JPMH 2CHAC 5EW2H 1W2KH 1J17T 1BTZA 2JH0D 1NRQH 4SGBE 3P17H 3GYMA 4CRDA 5T6GA 3B23B 2H9EH 1PPCE 2ODQA 3GY2A 3UWJH 3U8OH 1MD8A 4AB8A 1IQGA 1OWKA 4NIXA 1RTFB 1TQ7B 4MPUA 1CA8B 2BDGA 2PKSC 1EAWA 2HWLB 1EP6A 1WTGH 2H6MA 2OP9A 2GCHG 5FX6A 2ESTE 1AI8H 3A8DA 3SU4A 7GCHG 3T29A 1ELFA 1QL8A 4MPXA 3RXQA 5LPFA 1HAZB 4D76A 4YO9A 1PYTC 3VFEA 5FBIA 2ZFSA 3PMHB 1EUFA 1IQEA 3GDVA 5E0JA 1TBZH 3TK5A 4DJZB 1ID5H 2ZU3A 1K22H 1OP0A 4GHTA 3GCHC 2GCTC 1MZDA 2AERH 1XVMA 1L1JA 2O9QA 1FQ3A 5JBCS 1UJ1A 4ABIA 4BAHB 1OYQA 2AH4X 2WUBA 5AFZH 2W3IA 4ISIH 2HNTF 3RXIA 1EPTA 1F0UA 4RSPA 3PYHA 1MKWK 4NSVA 1K1NA 3A7ZA 5JB8S 1YPGH 3E16B 1FONA 1O37A 2G5VA 3VEQB 4GHQA 1N6XA 3Q3KA 1WSSH 3LONA 3A87A 3KQBA 2BD5A 1P03A 1UTPA 3K2UA 4UE7H 3SU2A 4ABJA 2FXRA 2FIRH 2H5DA 3EA8A 1CVWH 5ETXA 3URDA 1AD8H 3TJUA 2C4FH 2Q6FA 1GVZA 2FI5E 2GV6A 4IC6A 2XBVA 4HFPB 5EXMA 2TGDA 3AASA 1L2EA 1NY22 1O3BA 4LZ4B 1MH0A 2O8LA 1GBTA 1O3CA 2ZFFH 2A0QB 2ZDKA 1VCQA 3A8CA 3G01A 2ZQ2A 3VXFH 1IQNA 5LPEA 3UUZA 2NU1E 4X1PU 4CRGA 3MH5A 1PYTD 4NZLA 8GCHG 1Y8TA 1TRNA 3PLKA 3E1XB 5CE1A 1EJMA 2I6SA 1V2LT 1O5FH 1EQ9A 1VZQH 2W7UA 3LJOA 1UTJA 4R0IA 2Z6BD 1A61H 5EXNA 3O8CA 5GIBA 3EDXB 1O2JA 2R2WU 1O3KA 4NSYA 5CHAC 1CHOF 1GBBA 1TNLA 2XXLA 4CRCA 1OXGA 2OC8A 3FP8E 2BM2A 4WXVA 5J4QA 4AFQA 4CHAC 2O8UA 1TMUH 3SNDA 5J4SA 1BHXB 4MPVA 2B0FA 2H2ZA 3ZZDA 4I8LA 1A5HA 4YT7H 1RIWC 1O2YA 1NRPH 4GPGA 1HJ9A 1DUEA 4J1YA 3LGYA 2QC2A 1O36A 1TOMH 2ZGHA 3L33A 1ZSLA 3BTTE 3FANA 1AFEH 2FO9A 2BZAA 5GCHF 3ZVGA 1C5RA 2QF3A 2PTNA 2B5TB 3PTNA 1UTOA 3GICB 1KXAA 2R3YA 4I33A 5DP7A 3ELAH 1FPHH 3H7TA 3RMMH 1MCVA 1ELAA 2NU0E 2ZU4A 2SGEE 8KME2 2CMYA 1J9CH 1O3DA 3VB5A 1BMNH 1TRYA 3UNQA 1GGDB 1QHRB 1SGFG 4IW4E 1AFQC 4Y8ZA 1FI8A 2A4QA 2FOEA 1AKSB 3HK6B 2AMPA 1Z1IA 2BD9A 3TH3H 7KMEH 1NRSH 1G36A 4BTTB 1SI5H 4IMQA 3SW2B 1S83A 1YPHC 1PPBH 2D8WA 1ELBA 4FUDA 2BDHA 1ARCA 1BIOA 1FY5A 2OLGA 6CHAB 4FU9A 3T5FH 1V2PT 1W12U 4BXSA 4I8GA 3A7TA 1A2CH 3A82A 1TABE 2ZI2H 3RXVA 1LKAA 1OWEA 1GJ8B 1K1LA 1CO7E 1XUKA 1MKXK 4GCHG 1HAIH 3TVJB 1TGNA 2CHAB 1HAGE 2STBE 1ETRH 3KGPA 4IMZA 4X0WU 1GJ6A 1J14A 1P2OA 1JRTA 5C2ZA 3BTWE 3P70B 1LCYA 3O8DA 2B7DH 3S7KB 3ZZ5A 1VGCB 1O3PB 4K8BA 2C3SA 2FODA 1HAYB 4ZHAA 1GI7B 3SUEA 2P16A 2PKSB 2VGCB 4MDSA 1LTOA 1IHSH 3MFJA 4KKDA 1ZSKA 1GJBB 1ANDA 2ZFPH 3SNAA 2Z9GA 4INLA 3GY4A 1IQMA 3SI3H 2AIQA 4IC5A 1QFKH 3F9EA 1K28D 3RP2A 2DUCA 5B6OA 4NA7A 3ODFA 1ELDE 3ATIA 2FDAA 1CU1A 3TK6A 5C67A 2J38A 1XKAC 4ZXXH 4O3TA 1FN8A 1S81A 5C5NA 3VXEH 3GCHB 2XBYA 1AN1E 1LQDB 2B9LA 3IITA 1CT4E 1QQ4A 1P9SA 1TNJA 2BY8X 2TGPZ 4K5ZA 1SHHB 5L2ZH 1CBWC 2GCHF 1XKBC 4FUHA 3SI4H 5LGOA 4O97A 3A83A 7GCHF 1BMMH 3PB1E 1QRWA 3KQDA 1PPGE 2PTCE 2A5AA 4NG9H 2KAIA 3TGIE 4AB9A 1CGIE 2Y7XA 3QGNB 4A1TA 1IOEA 1ZRKA 5A0CA 1JWTA 3ZV9A 3MNBA 1HBTH 4U01A 1G2LA 1ESTA 4NIYA 1C1TA 2YNAA 5DPAA 2WPHS 1TQ0B 3U8TH 1LKBA 1O34A 1P2NA 5F03A 1K1JA 1F5LA 2ZDLA 3GDSA 3BTHE 1ELVA 1O2SA 3GDUA 1RTKA 3E91A 1GHYH 1BTXA 4X2WA 1QL7A 1GHXH 3QO6A 3ITIA 3PMAB 4X8TH 3S69A 2Y5HA 1LMWB 2VIDA 1Y3WA 1Q3XA 1WQSA 3F1SB 1TA2A 4U30A 4MNVA 1BA8B 1XM1A 3SGQE 5HM2A 1EZUC 1GJ5H 3U69H 2VVVA 2DE9A 1K21H 3BV9B 3NK8A 4X1SU 2XCNA 2FMJA 3PV4A 7ESTE 2ZECA 1VJ9U 3VPKA 5CHAB 1QB6A 3B9FH 4XOJA 3ZZ7A 2ZHFH 4UDWH 1B0EA 1NU7B 4M7GA 3UPEA 3TNTA 4CHAB 1O3HA 2WPJS 1O5CB 2D1JA 1WYKA 1BRBE
chains in the Genus database with same CATH superfamily
4AYVB 1H8HD 1DLEA 3SNBA 2CGAA 1P2JA 3WWBA 1HCGA 1LQEA 1JIRA 1QNJA 1C9PA 5DP3A 2VBCA 8GCHF 1EATA 1F92A 1RIWB 1C1WH 3HATH 1GI6A 4A7IB 3JZ2B 4LZ1H 3LPRA 1C5QA 1TALA 5EG4A 1VKYA 4YLUA 3VG8A 1KLIH 1DX5M 2BZ6H 3TH2H 1GJAB 1O5EH 1IQIA 1SVPA 3E8LA 2UWOA 1ZSJA 2G4UA 4X6MA 2PSXA 5DSFA 2HRVA 5KGOA 3SQEE 1Y5AT 1W0KD 4HGCA 2C8ZB 1BMAA 2QF0A 2G81E 1WAYB 2TGTA 3PO1C 1KLTA 1TBRH 2ZP0H 4WH8A 2QXIA 4F55A 1RRKA 4TWYA 3MU0A 1LPKB 1YGCH 3URCA 1WV7H 1E0FD 3FVFB 1FJSA 1GBDA 2A31A 4WF8A 1UCYH 4BTUB 1LVMA 2WPMS 1OKXA 3MMGA 3SJ8A 2FOAA 1AKSA 2AYWA 1GPZA 4KP0A 1CHOG 3V12A 1V2MT 2O8WA 3HK3B 2VJ1A 2P93A 5SGAE 1LVOA 1Z7KA 2W3KA 2FPZA 1G30B 1WUNH 1VR1H 5C1UA 1AIXH 4CBNA 2A4OA 1T8NA 4QT8C 2ZU1A 1C5PA 1EZQA 4JZDH 1AZZA 1QJ7B 1AE8H 2OD3B 4D7FA 1LVBA 1V2QT 1JOUB 2J9NA 3U9AH 3LT3A 3RXOA 3STIA 1QA7A 1ZTLA 3QUMP 5C94A 3LGIA 4ESTE 1ABIH 2OBOA 5EQQA 2SGDE 2PW8H 2P8OB 1FXYA 1O3GA 1HB0B 4YM9A 4J2YB 3OU0A 2H9HA 2HPQH 2R9PA 3AAVA 1BITA 2QXJA 4X2YA 2FYRA 3UOPA 3EYDA 4DT4A 3TJVA 1YPMH 1HUTH 1ZJDA 1C1PA 2SGQE 2A45B 2BY6X 2G52A 4IGDA 3RXEA 3WWFA 1A0JA 1T31A 3P8OA 2FOFA 1UO6A 2GP9B 1HAVB 3R0FA 4TPYA 2UUJB 1HNEE 1Z8JB 1E1RD 3TNSA 2A7HA 5DKMA 4MNYA 1SFIA 2RA3A 1SQRA 1EP5A 4K1TA 3BG4C 1YPEH 1C2FA 5IDKA 4MLFB 1O3NA 4MG3A 4ZUHA 4ZKRU 2F91A 4GCHF 1BMLA 3A7WA 4CRAA 5B6LA 2ZPRA 3Q3YA 4AYYB 3AVZA 4UD9H 2BDCA 5HIZA 1CT2E 1Y3UA 5K7RA 3MI4A 1AVXA 1KIGH 1KMHB 4MQAA 3HGNA 5EJLA 1GCDA 2QAAA 1IHTH 2ODPA 1DT2A 4NGAH 4YTAA 3E3TA 4DIHH 2PKAA 3SZNA 1GJ4H 3PWBA 3TITA 5HM9A 4ZCNA 4B6FA 1P02A 3M36A 4I86A 1QL9A 1V3XA 1O3OA 3SUGA 4AFSA 3UY9A 1T4UH 1AQ7A 1CBWB 1O3IA 1O2VA 1V2TT 3DCLA 3VGCC 3MU1A 1SLXB 2BD2A 1EKBB 2OK5A 4FUBA 3I78A 4WMDA 4RN6A 1TPAE 5DO4H 1DWCH 1C5SA 2KCOA 1S85A 1EJAA 2ZFTA 1E79D 1EAUA 3LC5A 2XBWA 1KYNA 1G3BA 3AAUA 3ESTA 5FPSA 1E36B 1O33A 2GDDA 3KQEA 2NU2E 5EODA 3ATMA 3N7EA 2VIPA 1GL0E 1ZHMA 2AS9A 4TY6A 1KDQB 1COWD 5BRRE 1TNIA 4BXWA 4Y10E 4KTCA 2QV1A 3SO3A 4AOQA 1L1GA 9ESTA 2HOBA 4UFEH 1W11U 4KTSA 1C5ZB 2Z9JA 5EW1H 3EA7A 2VU8E 1FY8E 1K1OA 1QJ1B 2BX3A 4YT6H 3U8RH 1P2IA 1UK2A 4HG6A 2Y82A 3P8NA 1ZOMA 3QZQA 1NN6A 3KYFA 5ESTE 1VGCC 2VWOA 1ZTJA 1HV7A 1GMCG 1Z71A 5A09A 6LPRA 1UVSH 4AFUA 3OEED 2G00A 4CRFA 2V35A 1QCPA 5HXFA 2VGCC 2OQ5A 4O03A 1ZHRA 3QK1A 1O3MA 3TGJE 2FX4A 4BNRA 1HFDA 2G51A 1ELTA 1MBQA 1QY6A 3BTDE 4ZXYH 4AORA 5FAHA 2G4TA 4ZKSU 1NBME 4MNWA 3SV7A 1X7AC 2R0KA 1PQ8A 1AU8A 4K3JA 3MO9A 1H1BA 1C2LA 2ANMH 1Z8IB 3VB7A 1AE5A 3FFGA 1XUFA 4I8JA 1D3TB 4K2YA 1TPOA 3F9FA 1ZPCA 1GI0A 4XSKU 2ZZUH 1H9LB 2THFB 4FU7A 2EI7A 4B71A 5L30H 3ZVBA 1LPZB 2FOGA 4KGAA 1QB9A 1NO9H 2EY4C 2SGAA 2KZ4A 1YPKH 1BBRH 1MTWA 1THRH 5PTPA 3TPIZ 1N6YA 4FETA 2ZDAH 3PO1B 1DFPA 4MPWA 5FCRA 2HGTH 1XVOA 1HYLA 4ABGA 1BHXF 1DXPA 2WV9A 1GMHG 4B73A 3ZZ9A 1GG6C 4ACAA 1C1OA 1CT0E 1AMHA 2A1DB 4YZUA 4Z0KA 1WCZA 1O2GH 2BDIA 3PM3A 5EQSA 1JIMA 1T4VH 1SGRE 2TRMA 3RXSA 2FESH 2SGPE 1O5DH 1QRXA 2G8TA 1DANH 4JZIA 1DSUA 4OM9A 4THNH 4IBLH 3ATWA 1GJCB 4OS6A 2BX4A 5FX5A 3OY5U 1ZMLA 3MNSA 1SHYA 1GI4A 2OINA 1T8MA 5TCAA 2LPRA 2EI6A 3RC4A 4AX9H 2Q6GA 1ZPBA 2RCEA 3SHAH 4FU8A 1G9IE 2L6OA 2XCFA 4Q7YA 4X2VA 2SNWA 3W1EA 1ZTKA 3M37A 2OC7A 3P6ZB 4ZKNU 1IAUA 1FUJA 2J97A 2HNTE 2ULLA 3FZDA 5F8TA 1TGTA 4JK5A 2ZFQH 1TRMA 2BY5X 2VH6A 3BTEE 1BT7A 3Q77A 1DITH 5AFYH 4OGYA 5EXLA 3GY8A 1H8ED 1C5WB 3QTOH 1AVWA 2ZPSA 5GJ4B 3SV9A 5C0TA 2QF4A 3DHKH 3FZZA 3SJOA 1O2LA 1SQOA 1HAVA 1GMDG 5JB9S 5FCKA 3ZVFA 3M5NA 1MTVA 2Z94A 1O31A 1E1QD 3F2FA 1J15A 5C0UA 1TONA 1K1MA 1GBMA 4O3UA 1UK4A 3M5LA 3RU4T 3RXUA 3MWIU 3RMLH 1C1QA 3BG4B 5C1XA 2QIQA 1S84A 2XC5A 5C1YA 2FYQA 1EOJA 1WOFA 3R3GB 3HPTB 1TPPA 1DY9A 1UTMA 5CHBA 1V2KT 4CH8B 4FUCA 4YXWD 2HLCA 2GZ8A 3DSPA 2BVXH 2D26C 2F43B 1YF4A 3IG6B 3UB0A 1MQ5A 2CN0H 1W7XH 3AW0A 3CNRA 3S9AA 1MKWH 1SGFA 4OS2A 3NXPA 4NWKA 1IQKA 2FX6A 4JYTA 1EPTC 1TFXA 3SU1A 1C5OH 1V2NT 3BN9A 4JYVH 3A7VA 3RM0H 4DIIH 4NZQA 2WUCA 2J98A 5H4IB 2GZ9A 3SV6A 2W5EA 2QXHA 3MQKC 1OPHB 4KTUA 2ZHWH 3RXBA 2WPKS 1UTQA 1A7SA 1JBUH 1GBLA 1E35B 1DICA 1UVPA 1V2OT 2ZCLP 3KYGA 5G4BA 5A0AE 2WPLS 3MH7A 3K6YA 3VGCB 1V6DA 2GMTC 1G3EA 4D8NA 4TWWA 3LDXH 5DP6A 1YBWA 1YCPK 3MNCA 2EA3A 3SJIA 3BEUA 3T62A 1ELCA 1PQ5A 4WJG2 1ACBE 2FOHA 4K60A 1O38A 1LDTT 2ANWA 1K1IA 1T7CA 4MTBA 1OWDA 2NU3E 1GBAA 2P8OC 5TCCA 1XUJA 3F68H 4A1XA 1O35A 1KTTB 4IN1A 2XNDD 2KM0A 2H5CA 1CHGA 1DDJA 1TX8A 3MO3A 2C93B 3P92A 2J92A 1K2I1 2ZGJA 3DFJA 5FBEA 2SFAA 4BAOB 2KR7A 4D7GA 1K9OE 1FY1A 1GDUA 1G32B 3CS0A 2ZO3H 1LHDH 2Z7FE 3OE7D 2GVFA 2XC0A 2FEQH 1O2OA 1OWJA 1LHFH 4TSFD 4FUJA 1F5RA 1A46H 3V7TA 2F83A 2OQUA 2V3OH 3SBKA 1C5UA 2ALVA 1O2IA 1UHBB 2KX4A 3UQVA 3JZ1B 2F9BH 3F9HA 2F9UA 2PUQH 4Y6DA 3UAIC 1KXCA 4H6TA 3A89A 1GBCA 3NWUA 1A5GH 1FV9A 2A5IA 3FAOA 1G3DA 3Q00A 1C5MD 4OGXA 1GI3A 2B8OH 1QBOA 1XX9A 1BUIA 2EI8A 3NUMA 1HAOH 1DWBH 2YNBA 1YY3A 1Y59T 4NWLA 2F4LA 4ZAEA 1SGPE 1C1VH 4BAMB 2P3UB 3P95A 3QDZB 3SGBE 1YLDA 3DSGA 4WMFA 5EJZA 3PMBB 2P94A 1FZZA 1O5GH 1RTLA 4ABDA 1XUHA 1ZYOA 5C3NA 2BDBA 3RXAA 1O5AB 1QRZA 3MTYA 1W10U 3WY8A 1BRCE 1HIAB 1O2TA 1OP8A 1QBNA 4TT3D 1DS2E 1BTHH 1GMCF 4UFDH 3OY6U 3ATKA 3SJ9A 3TJNA 2GT8A 3BG8A 4E05H 1LHCH 1BQYA 5BPEA 5I46H 1TIOA 1V2ST 1SQAA 1B7XB 3RXKA 1O3AA 3A85A 1T8LA 1SLVB 4YOIA 1CA0B 1DXWA 3UR9A 5DG6A 2VVUA 3BF6H 1FAKH 3DT0H 3TK9A 5ABWA 3BEIB 4X8UH 5I25A 1YKTA 1C4Y2 1VITF 1P01A 4ACBA 3RXCA 2R3UA 1GG6B 2FS8A 4DG4A 4A6LA 1O2RA 5A8XA 1OHHD 3ZZ4A 1ZR0A 5EPYA 1V2WT 2HVXA 3T27A 1F0SA 4X8VH 3FP6E 3QZRA 2YOLA 1Z8GA 1M9UA 1EOLA 1UVOA 1HXEH 1W14U 3PLBA 3N7OA 5TJXA 1YPLH 3O8BA 4A1VA 1BBRE 1FNIA 2AIPA 1NM6A 1SSXA 2ZPQA 3SHCH 1UVTH 1MKXH 4MVNA 4ISOA 1AGJA 3RXGA 2UUYA 1C5YB 1EASA 1P3EA 1HAHH 1GMHF 2G5NA 1GL1A 4AGKA 1TNKA 1F0RA 2ODYB 1TX6A 3E6PH 2JKHA 4DCDA 1TOCB 1FLEE 2QCYA 5EJ1A 1TGCA 1F2SE 2P95A 1HXFH 2ZTZA 5DJ7A 3T28A 3RU4E 3GYLB 1IQJA 3SQHE 1SFQB 1GBEA 4CR5A 1YLNA 5FPYA 2D2DA 1JRSA 1P12E 3RMNH 3LGUA 1HPGA 1SB1H 2BLQA 2ZC9H 1S6HA 1O2XA 2GKVE 1MU6B 3OX7U 4CBOA 1MTNC 3LH3A 2A7CA 2Q6DA 3RXHA 1C5LH 2Z3DA 1MU8B 1ZMJA 1FDPA 4K69A 4CR9A 1W8BH 3SU6A 4H42U 1S0QA 1AO5A 1YPJH 1P10A 3A84A 4XBCA 5F8XA 2SNVA 1QURH 1SLUB 2FS9A 4XBBA 3NCLA 6GCHG 1GJ7B 2VB0A 1FY4A 3TJOA 3PLPA 3CP7A 3SU0A 1C4V2 4DGJA 3QTVH 2KCPA 1T8OA 4INKA 2FWWA 4FVBA 5E8EH 1CE5A 3FO8D 2V3HH 2AGEX 4Q2KA 2ZHDA 1SBWA 2GT7A 3KIDU 1EAXA 1W13U 2C8XB 4GSOA 1SPJA 1AZ8A 2AMQA 1Z1JA 3UTUH 1GMDF 1EPTB 3NPSA 4IN2A 2AEIH 2FP7B 3PRDA 1DVAH 1O3JA 1CQQA 2Z9LA 3RC5A 3KNXA 1C1NA 4U2WA 2HLDD 3OEHD 2VH0A 4IS5A 3VB6A 2A4GA 4X6OA 1O2NA 2ZGCA 4DY7B 2XW9A 2GMTB 1DPOA 2BQ7B 1GVLA 4H6SB 1EAIA 1S5SA 3BIVH 3M5OA 2FI3E 1E37B 1NFXA 5AVDA 4ABHA 3DD2H 1TPSA 1MAXA 3KF2A 2G55A 4WXIA 1S82A 2V7QD 2GZ7A 3KEEA 1ABJH 1O2ZA 2ZTYA 1GJDB 1YM0A 5EOKA 1INCA 1O2WA 1HJAC 1U6QA 3RXFA 2WV4A 1SKYE 1NBMD 2OC0A 4ZH8A 5CDFE 1VJAU 2WHXA 1KSNA 4K8YA 1S0RA 2BY9X 4ABAA 4A92A 4XRNA 4XD7D 3DFLA 1XUGA 2HNTC 1ESBA 3ZZAA 1E38B 1MUEB 4I31A 1T32A 3P8GA 3VB4A 1ZHPA 4X2XA 5EPNA 5T6DA 3A8AA 1W0YH 1P11E 1EZSC 3OSYA 3QX5H 2AGGX 1XXDA 2IN2A 4Y8YA 1WBGB 4TYDA 1N8OC 4FXGH 1GDQA 2A7JA 1Y3VA 5GXPA 1P09A 1SGTA 3MH6A 3DUXH 2VIVA 3RXPA 5F8ZA 1EFRD 2BLOA 3GCTF 3UREA 8LPRA 2BMGB 1QB1A 3RXLA 1BTYA 1NPMA 1QQUA 2LNCA 3H5CB 1RGQA 2JIZD 3I77A 3TLOA 1C2HA 1D6RA 3SUDA 1G37A 2WYGA 4BAQB 3GY3A 5JBTA 2ZQ1A 1NS3A 1MQ6A 1C1RA 2BQ6B 2VIWA 1FMGA 4RT1A 5T6FA 1EX3A 1BMFD 2BB4A 1TGSZ 1NT1A 1Z8RA 4X1NU 8ESTE 1KXFA 1ZJKA 1SOTA 1EJNA 3RM2H 2ALPA 3SU5A 1C2DA 2PSYA 3ZIAD 1FN6A 3Q76A 3RXMA 3F2HA 3UOUA 3ZYEA 3TGKE 2XYAA 2Y5FA 1AWFH 2JH5D 1E34B 2STAE 5GPIB 5DP4A 3PROA 1H8DH 1A3EH 1J8AA 3RXTA 4GUXA 1ZZZA 3BTME 1W3CA 2ASUB 4BAKB 1SGDE 1Z6JH 3FKSD 2Y7ZA 4I8KA 2M5TA 2C8YB 2OCVB 2F3CE 3MO6A 5DK1A 1SGNE 2BHGA 1DLKB 4OS1A 3TIUA 2ZDMA 2IOTA 3MHWU 1P3CA 2XRCA 3OTPA 3ZZ8A 2ZEBA 4Y7AA 3O8RA 1SGQE 3EQ0H 3BTKE 1MMJN 5HYOA 2XWBI 2A2XH 2AMDA 1P2KA 1THSH 3MYWA 3ZV8A 1CGJE 3F6UH 1BTUA 1SG8B 3T25A 4HTCH 1GBKA 2RFKC 1PQAA 1EB2A 2BLWA 1OYTH 1GDNA 2FLBH 5HGGA 1SGIB 1SR5C 4DT7B 5E0HA 1VCPA 4GLYA 4XBDA 2V0BA 3S0NA 1THPB 2F9NA 2WYJA 3TU7H 4AG2A 1AHTH 4X6NA 1NFYA 1AUTC 3LH1A 2BQWB 3ZVEA 1WTHD 2WINI 4NIVA 3GCNA 4H4FA 3M3TA 2BOHB 4ZHMU 5JBAS 3ZZBA 4BANB 1SGCA 4BOHA 1GI5A 1QJ6B 2AHME 1A3BH 1MTUA 1C1UH 2H9TH 4B2AA 1C4U2 2WPDD 2V6NA 4UFFH 2UUKB 3OYPA 3ZVAA 4UEHH 4E7RG 3H09A 3GISB 3KCGH 3V0XA 1C2EA 1DWDH 1JXPA 1L0ZA 1VITG 2TPIZ 3AW1A 3SOSA 1MTNB 2HALA 3P8FA 2BLVA 5IK2D 1UVUH 2QY0B 2V3MA 4NCYA 1GHBG 2A4RA 2FOCA 4ABBA 1BZXE 3AK5A 1NESE 1NC6A 1Y3YA 1QIXB 2W6ID 2O8MA 1YP9A 2W26A 4ABEA 1GJ9B 1OX1A 1D6WA 4Z6AH 3FP7E 1OWHA 1TLDA 3MOCA 1CA0C 4ISHH 2VINA 2VWLA 2JETC 1ANBA 1TAWA 4ABFA 2Y6TA 2ZIQH 5A8YA 5EQRA 4K1SA 1TE0A 4BTIB 2JDID 3NKKA 4OS7A 3V13A 5E2PA 1V2RT 3EGKH 1TA6A 3SYJA 1O3EA 3VB3A 4VGCB 1MCTA 1GHVH 1RJXB 1WQVH 3LKWA 3D23A 1ZGVA 3E90B 4DOQA 3M35A 1DM4B 2EC9H 3ODDA 4OS5A 4RKOB 1GHAF 4Q4LA 3SJKA 1CSOE 4TY7A 2KAIB 4NFEA 1O0DH 3E0PB 5HMAA 2NWNA 2PFEA 4ZROA 3MU4A 2H1UA 6GCHF 1A0HB 4YESB 1S6FA 5DP9A 2XOKD 2A5KA 1O39A 2ZG0H 1GBIA 5JDUB 4Y8XA 3BTFE 1KXEA 2W7SA 2ZGBH 3M7QA 1ANEA 4Y0ZE 1VITH 1V2VT 3MU8A 4JZFH 3PTBA 3RLYH 5F53A 1N1LA 5FPTA 1AB9B 3LU9B 5IYTA 3RLWH 1UCYE 1W0JD 4YOGA 1KXBA 3B8JA 2A32A 3EA9A 3D62A 3N7DA 4B2CA 2GD4B 1JMOH 1HJAB 1L4DA 4XDEA 5F6MA 3PWCA 2PV9B 2JH6D 1C5TA 1Q2WA 4O9VA 2Y5GA 3F0PA 3H7OA 5C20A 2VWNA 3HKIB 4X8SH 4PROA 1TX7A 2PGQB 3SV8A 1W7GH 1LPGB 1RFNA 5FXLA 4UONA 2CXVA 2P3TB 2Z3CA 1XXFA 2RG3A 3E0NB 3OTJE 1ETSH 1YCPM 1N8OB 1GCTB 4Y0YE 2GX4A 2ZU5A 1SMFE 2Z3EA 1P05A 4K1EA 5FHTA 5LH8A 1QZ8A 3BIUH 1SGEE 1FIZA 3SORA 4FUGA 1MAYA 4FVDA 4WMEA 1F7ZA 2CJIA 4JCNA 1P2QA 2BYAX 3KL6A 4WH6A 2J94A 4X1RU 1Z6EA 1D9IA 1GBHA 1AUJA 1V2JT 2TGAA 4AN7A 2ZWLH 3M3VA 4X6PA 2I6QA 4Q7XA 3UNSA 3Q3XA 5DN6D 1HRTH 1P8VC 2BVSH 2CV3A 1KXDA 4JYUH 1SOZA 3PRBA 1HAPH 3L3TA 3V3MA 5CMXH 3GY7A 3LGTA 5L6NH 2VIQA 3NRLA 3LOXA 4B74A 4Y76A 1BDAA 2RDLA 2DE8A 3KHVA 3UFAA 3SNEA 1TNHA 1GI1A 1C2IA 2OUAA 3U98H 2GTBA 5L2YH 4TPIZ 4WY3A 3A8BA 4HZHA 2GV7A 2IJOB 2R2MB 4DVAU 2Z9IA 3SN8A 4CH2B 3M5MA 2VVCA 4GAWA 3ATLA 2IPQX 4I7YH 1Y5UT 5GNDA 1GI2A 1O2PA 1A0LA 3T26A 4INHA 3BSQA 4JK6A 1O5BB 3LGVA 3RU4D 3EAJA 1H4WA 3GCTG 1H9HE 2VWMA 1YYY1 1GHZA 1KDQA 1NROH 3RXDA 1C5VA 2QA9E 1DOJA 1ANCA 4AG1A 3W95A 5T3HA 4AZ2B 2HVYB 2AFQB 1SC8U 2ZTXA 3QLPH 1RD3B 2P3FH 3HKJB 3RMOH 4SGAE 2VNTA 2XC4A 4NA8A 5JYIA 3GCOA 3I29A 1EB1H 1C1SA 1PPEE 3SV2H 1HGTH 1PPZA 1DUAA 6ESTA 3S7HB 1FY3A 3SGAE 3NZIA 4F4OC 3KQ5A 2XBXA 4YLQH 1EXFA 4Y11E 4AFZA 3ZZ3A 1J16A 4B1TA 3K6ZA 1VCWA 3EE0B 4ASHA 2ZA5A 2K1QA 1IQHA 1NRRH 2KCYA 5ESBA 1K1PA 2FTMA 4RT0A 1NTPA 2HPPH 1XUIA 2J4IA 1LHGH 4DURA 2IPHA 1BCUH 1HDTH 1OP2A 4F49A 1DE7H 3CENA 4B6EA 1XMNB 1KY9A 5E0GA 1Y5BT 1BRAA 4WWYA 3LIWA 2BY7X 4JZ1A 1GHWH 1C5XB 2F9VA 1L4ZA 2YMSB 3D49H 2BD8A 2UWLA 3STJA 4XE4A 1DSTA 2GCTB 1O30A 1O3FA 2JETB 1QR3E 2PKAB 1OWIA 3A88A 1QTFA 1QGFA 4DW2U 3UQOA 3ZVCA 2PR3A 1GBFA 1BTWA 1YCPH 2ZU2A 1GHBF 3F2GA 1O2QA 1TWXB 1UCYK 1YWUA 4Y7BA 2FOBA 4D9QA 1MTSA 2ZFRH 2C8WB 1LVYA 2PHBA 1MD7A 3ZVDA 1O3LA 4OS4A 4P02A 3RUOA 1ARBA 1HAXB 4Y79A 1O2MA 1MBMA 1Y3XA 4E06H 3RC6A 2PGBB 1IQLA 3KQCA 4WVPE 1PJPA 5A8ZA 1TB6H 4LK4A 4JZEH 1GVKB 2ZDVH 1TGBA 3LJJA 2F9OA 4B76A 4E7NA 1ESAA 1RS0A 2NU4E 2TIOA 4XFQA 5DP8A 1C9TA 1GI9B 4RI0A 1ORFA 1K0HA 3CS7A 4NA9H 2Y81A 2UWPA 1OSSA 3U1IB 1NZQH 2QN5T 1O2KA 3SNCA 3SU3A 1P9UA 3S9BA 2Q1JA 1OOKB 2WPIS 4LOYH 5EU8A 2FOMB 4ASUD 2TBSA 1SLWB 1UK3A 2R0LA 1NRNH 3U28C 2BD3A 1CGHA 2PWXA 2VIOA 1A5IA 4GVUA 1QBVH 3T2NA 2ZCHP 1BJUA 1SGYE 1PQ7A 1Q31A 2J2UA 3TH4H 4AGJA 2F9PA 3A7YA 2ANKH 3C1KA 1GHAG 3BEFB 3A81A 3LGWA 2OXSA 1O2UA 3S9CA 1KTSB 2Z9KA 3KN2A 4ISLA 5JBBS 2ZHQH 2BXUH 3A80A 4A5TS 1TMBH 1C2JA 1YC0A 2RA0A 4ISNA 2ZDNA 1FPCH 1IQFA 2SGFE 2ZGXH 4B2BA 2W6JD 3GS9A 1SQTA 4VGCC 2PP6A 3A7XA 5GWZA 1C1MA 1PPFE 3K9XB 3QWCH 1FX0B 1ETTH 2A2QH 1LO6A 3D65E 1BB0B 5DGJA 5E2OA 1TMTH 5LPRA 4U32A 3ZZ6A 1QA0A 4LXBH 2FZZA 2QXGA 2GGVB 4M9FA 2P59A 1O2HA 1V2UT 1FAXA 1F5KU 4JMYA 2BD4A 1YLCA 1G2MA 2C90B 3UNRA 1BJVA 1AFQB 4ZHLU 2EEKA 1RXPA 2PUXB 1ZMNA 1C2GA 1YPHE 4MNXA 1AVGH 3A86A 3QGJA 1AB9C 2OC1A 2BTCE 2FI4E 3F9GA 4UFGH 1GBJA 1H9IE 3IWMA 2ZF0H 2BD7A 2O8TA 4NFFA 2ZNKH 2J34A 1DY8A 1PFXC 3PV5A 3MU5A 1AWHB 3GOVB 1C2KA 2BOKA 4FUEA 1P0SH 5EIYA 3ENSB 1UTKA 4AC9A 5A0BA 3RDZA 3UIRA 2Y80A 3FN8A 1KLJH 5GCHG 4NIWA 1GI8B 2BVRH 1UMAH 1GCTC 4RKJB 2WSSD 1B5GH 1UHBA 1LHEH 1NU9A 1HLTH 1TBQH 1WU1A 3RXJA 1NFWA 2UUFB 4R8TB 5EGMA 1TNGA 2QF5A 4HI3A 4I32A 1G3CA 1MZAA 3EE7A 5C5OA 4CREA 3HGPA 2AGIX 2ZKSA 1AY6H 1B0FA 4Q63A 1UW7A 2OBQA 3LC3A 4ZKOU 3M61U 5A2MH 1BRUP 4YOJA 1P04A 2JJ1D 3UWIA 4I8HA 1DWEH 4X1QU 4ZMAH 4D9RA 3GY5A 2GJGA 3MH4A 4Z1MD 1P57B 1MABB 1ZPZA 3K65B 3GY6A 1HIAA 2QGRA 1EZXC 3BTGE 9LPRA 3U1JB 2GDEH 4FUFA 2J95A 5AHGH 2FTLE 3RXRA 1D4PB 1ZLRA 3SUFA 2LP6A 1BTPA 1FIWA 2ILNA 5K0HA 1GGDC 2XTTB 2ZHEH 5DP5A 4KELA 1UTLM 2BDYA 3C27B 2QYIA 1D3PB 1C5NH 1H8IH 2BDAA 1BBRK 5T1VA 3ZYDA 4CRBA 2J98B 1OS8A 1W0ZU 3PMJA 3M7TA 2ZCKP 2WV5A 1P2MA 2XNIA 4Q80A 3M3SA 4Q7ZA 1ELEE 1D3DB 3BTQE 2OTVA 5HKKD 4Y71A 1HJ8A 2CF8H 3L6PA 3DA9B 3MNXA 6CHAC 2XWAA 1A1RA 3ZZCA 1SL3A 2ANYA 1NFUA 1ZRBA 4F48B 1L1NA 1UTNA 1ZGIA 3FOAA 7LPRA 4B75A 1D3QB 3W94A 1ELGA 2FLRH 5AF9H 1BOQA 3UR6A 3M7UA 1GWAA 3QN7A 1A4WH 1P06A 2CF9H 2PLXA 1C2MA 2FM2A 1PPHE 2BXTH 1F0TA 4FUIA 1TYNA 5GDSH 1O32A 5JPMH 2CHAC 5EW2H 1W2KH 1J17T 1BTZA 2JH0D 1NRQH 4SGBE 5KECA 3P17H 3GYMA 4CRDA 5T6GA 3B23B 2H9EH 1PPCE 2ODQA 3GY2A 3UWJH 3WW7A 3U8OH 1MD8A 4AB8A 1IQGA 1OWKA 4NIXA 1RTFB 1TQ7B 4MPUA 1CA8B 2BDGA 2PKSC 1EAWA 2HWLB 1EP6A 1WTGH 2H6MA 2OP9A 2GCHG 5FX6A 2ESTE 1AI8H 3A8DA 3SU4A 7GCHG 3T29A 1ELFA 1QL8A 4MPXA 3RXQA 5LPFA 1HAZB 4D76A 4YO9A 1PYTC 3VFEA 5FBIA 2ZFSA 3PMHB 1EUFA 1IQEA 3GDVA 5E0JA 1TBZH 3TK5A 4DJZB 2YMSC 1ID5H 2ZU3A 1K22H 1OP0A 4GHTA 3GCHC 2GCTC 1MZDA 2AERH 1XVMA 1L1JA 2O9QA 1FQ3A 5JBCS 1UJ1A 4ABIA 4BAHB 1OYQA 2AH4X 2WUBA 5AFZH 2W3IA 4ISIH 2RDEA 2HNTF 3RXIA 2M2AA 1EPTA 1F0UA 4RSPA 3PYHA 1MKWK 1WDIA 1K1NA 3A7ZA 4NSVA 5JB8S 1YPGH 3E16B 1FONA 1O37A 2G5VA 3VEQB 4P00A 4GHQA 1N6XA 3Q3KA 1WSSH 3OAAD 3LONA 3A87A 3KQBA 2BD5A 1P03A 1UTPA 3K2UA 4UE7H 3SU2A 4ABJA 2FXRA 2FIRH 2H5DA 3EA8A 1CVWH 5ETXA 3URDA 1AD8H 3TJUA 2C4FH 2Q6FA 1GVZA 2FI5E 2GV6A 4IC6A 2XBVA 4HFPB 5EXMA 2TGDA 3AASA 1L2EA 1NY22 1O3BA 4LZ4B 1MH0A 2O8LA 1GBTA 1O3CA 2ZFFH 2A0QB 2ZDKA 1VCQA 3A8CA 3G01A 2ZQ2A 3VXFH 2IJD1 1IQNA 5LPEA 3UUZA 2NU1E 4X1PU 4CRGA 2LELA 3MH5A 5C17A 1PYTD 4NZLA 8GCHG 1Y8TA 3OFND 1TRNA 3PLKA 3E1XB 5CE1A 5KEDA 1EJMA 2I6SA 2YMSD 1V2LT 1O5FH 2KCAA 1EQ9A 1VZQH 2W7UA 3LJOA 1UTJA 4R0IA 2Z6BD 1A61H 5EXNA 3O8CA 5GIBA 3EDXB 1O2JA 2R2WU 1O3KA 4NSYA 5CHAC 4FOUC 1CHOF 1GBBA 1TNLA 2XXLA 4CRCA 1OXGA 2OC8A 3FP8E 2BM2A 4WXVA 5J4QA 4AFQA 4CHAC 2O8UA 2WZQA 1TMUH 3SNDA 5J4SA 1BHXB 4MPVA 2B0FA 2H2ZA 3ZZDA 4I8LA 1A5HA 4YT7H 1RIWC 1O2YA 1NRPH 4GPGA 1HJ9A 1DUEA 4J1YA 3LGYA 2QC2A 1O36A 1TOMH 2ZGHA 3L33A 1ZSLA 3BTTE 3FANA 1AFEH 2FO9A 2BZAA 5GCHF 3ZVGA 1C5RA 2QF3A 2PTNA 2B5TB 3PTNA 1UTOA 3GICB 1KXAA 2R3YA 4I33A 5DP7A 3ELAH 1FPHH 3H7TA 3RMMH 3PV2A 1MCVA 1ELAA 2NU0E 2ZU4A 2SGEE 8KME2 2CMYA 1J9CH 1O3DA 3VB5A 1BMNH 1TRYA 3UNQA 1GGDB 1QHRB 1SGFG 4IW4E 1AFQC 2L74A 4Y8ZA 5HIYA 2EQNA 1FI8A 2A4QA 2FOEA 1AKSB 3HK6B 2AMPA 1Z1IA 2BD9A 3TH3H 7KMEH 1NRSH 1G36A 4BTTB 1SI5H 4IMQA 3SW2B 1S83A 1YPHC 1PPBH 2D8WA 1ELBA 4FUDA 2BDHA 1ARCA 1BIOA 1FY5A 2OLGA 3N99A 4FU9A 3T5FH 6CHAB 1V2PT 1W12U 4BXSA 4I8GA 3A7TA 1A2CH 3A82A 1TABE 2ZI2H 3RXVA 1LKAA 1OWEA 1GJ8B 1K1LA 1CO7E 1XUKA 1MKXK 4GCHG 1HAIH 3DSOA 3TVJB 1TGNA 2CHAB 1HAGE 2STBE 1S6LA 1ETRH 3KGPA 4IMZA 4X0WU 1GJ6A 1J14A 1P2OA 1JRTA 5C2ZA 2J5UA 3BTWE 2JJ2D 3P70B 1LCYA 3O8DA 2B7DH 3S7KB 3ZZ5A 1VGCB 1O3PB 2K0QA 4K8BA 2C3SA 2FODA 1HAYB 4ZHAA 1GI7B 3SUEA 2P16A 2PKSB 2VGCB 4MDSA 1LTOA 1IHSH 3MFJA 4KKDA 1ZSKA 1GJBB 1ANDA 2ZFPH 3SNAA 2Z9GA 4INLA 3GY4A 3F3BA 1IQMA 3SI3H 2AIQA 4IC5A 1QFKH 3F9EA 1K28D 3RP2A 2DUCA 5B6OA 4NA7A 3ODFA 1WXRA 1ELDE 3ATIA 2FDAA 1CU1A 3TK6A 5C67A 2J38A 1XKAC 4ZXXH 4O3TA 1FN8A 1S81A 5C5NA 3VXEH 3GCHB 2XBYA 1AN1E 1LQDB 2CK3D 2B9LA 5FL7D 3IITA 1CT4E 1QQ4A 1P9SA 1TNJA 2BY8X 2TGPZ 3F0OA 4K5ZA 1SHHB 5L2ZH 1CBWC 2GCHF 1XKBC 4FUHA 3SI4H 5LGOA 4O97A 3A83A 7GCHF 1BMMH 3PB1E 1QRWA 3KQDA 1PPGE 2PTCE 2A5AA 4NG9H 2KAIA 3TGIE 4AB9A 1CGIE 2Y7XA 3QGNB 4A1TA 1IOEA 1ZRKA 5A0CA 1JWTA 3ZV9A 3MNBA 1HBTH 4U01A 1G2LA 3SZEA 1ESTA 4NIYA 1C1TA 2YNAA 5DPAA 2WPHS 1TQ0B 3U8TH 1LKBA 1O34A 1P2NA 5F03A 1K1JA 1F5LA 2ZDLA 3GDSA 3BTHE 1ELVA 1O2SA 3GDUA 2K8IA 1RTKA 3E91A 1GHYH 1BTXA 4X2WA 1QL7A 1GHXH 3QO6A 3ITIA 3PMAB 4X8TH 3S69A 2Y5HA 1LMWB 2VIDA 1Y3WA 1Q3XA 1WQSA 3F1SB 2QE7D 1TA2A 4U30A 4MNVA 1BA8B 1XM1A 3SGQE 5HM2A 1EZUC 1GJ5H 3U69H 2VVVA 2DE9A 1K21H 2KFWA 3BV9B 3NK8A 4X1SU 2XCNA 2FMJA 3PV4A 7ESTE 2ZECA 1VJ9U 3VPKA 5CHAB 1QB6A 3B9FH 4XOJA 3ZZ7A 2ZHFH 4UDWH 1B0EA 1NU7B 4M7GA 3UPEA 3TNTA 4CHAB 1O3HA 2WPJS 1O5CB 2D1JA 1WYKA 1BRBE
chains in the Genus database with same CATH topology
4AYVB 1DLEA 3SNBA 2CGAA 1P2JA 1HCGA 1LQEA 1JIRA 1QNJA 1C9PA 5DP3A 8GCHF 1EATA 1F92A 1RIWB 1C1WH 3HATH 1GI6A 4A7IB 3JZ2B 4LZ1H 3LPRA 1C5QA 1TALA 5EG4A 4YLUA 1KLIH 1DX5M 2BZ6H 3TH2H 1GJAB 1O5EH 1IQIA 1SVPA 3E8LA 2UWOA 1ZSJA 2G4UA 4X6MA 2PSXA 2HRVA 3SQEE 1Y5AT 4HGCA 2C8ZB 1BMAA 2QF0A 2G81E 1WAYB 2TGTA 3PO1C 1KLTA 1TBRH 2ZP0H 4WH8A 2QXIA 1RRKA 4TWYA 3MU0A 1LPKB 1YGCH 3URCA 1WV7H 1E0FD 3FVFB 1FJSA 1GBDA 2A31A 4WF8A 1UCYH 4BTUB 1LVMA 2WPMS 1OKXA 3MMGA 3SJ8A 2FOAA 1AKSA 2AYWA 1GPZA 4KP0A 1CHOG 3V12A 1V2MT 2O8WA 3HK3B 2VJ1A 2P93A 5SGAE 1LVOA 1Z7KA 2W3KA 2FPZA 1G30B 1WUNH 1VR1H 5C1UA 1AIXH 4CBNA 2A4OA 1T8NA 4QT8C 2ZU1A 1C5PA 1EZQA 4JZDH 1AZZA 1QJ7B 1AE8H 2OD3B 4D7FA 1LVBA 1V2QT 1JOUB 2J9NA 3U9AH 3LT3A 3RXOA 3STIA 1QA7A 1ZTLA 3QUMP 3LGIA 4ESTE 1ABIH 2OBOA 5EQQA 2SGDE 2PW8H 2P8OB 1FXYA 1O3GA 1HB0B 4YM9A 4J2YB 3OU0A 2H9HA 2HPQH 2R9PA 3AAVA 1BITA 2QXJA 4X2YA 2FYRA 3UOPA 3EYDA 3TJVA 1YPMH 1HUTH 1ZJDA 1C1PA 2SGQE 2A45B 2BY6X 2G52A 4IGDA 3RXEA 1A0JA 1T31A 3P8OA 2FOFA 1UO6A 2GP9B 1HAVB 3R0FA 4TPYA 2UUJB 1HNEE 1Z8JB 3TNSA 2A7HA 5DKMA 4MNYA 1SFIA 2RA3A 1EP5A 4K1TA 3BG4C 1YPEH 1C2FA 5IDKA 4MLFB 1O3NA 4MG3A 4ZUHA 4ZKRU 2F91A 4GCHF 1BMLA 3A7WA 4CRAA 2ZPRA 3Q3YA 4AYYB 3AVZA 4UD9H 2BDCA 1CT2E 1Y3UA 5K7RA 3MI4A 1AVXA 1KIGH 4MQAA 3HGNA 1GCDA 2QAAA 1IHTH 2ODPA 1DT2A 4NGAH 4YTAA 3E3TA 4DIHH 2PKAA 3SZNA 1GJ4H 3PWBA 3TITA 5HM9A 1P02A 3M36A 1QL9A 1V3XA 1O3OA 3SUGA 4AFSA 3UY9A 1T4UH 1AQ7A 1CBWB 1O3IA 1O2VA 1V2TT 3VGCC 3MU1A 1SLXB 2BD2A 1EKBB 4FUBA 3I78A 4WMDA 4RN6A 1TPAE 5DO4H 1DWCH 1C5SA 1S85A 1EJAA 2ZFTA 1EAUA 3LC5A 2XBWA 1KYNA 1G3BA 3AAUA 3ESTA 5FPSA 1E36B 1O33A 2GDDA 3KQEA 2NU2E 5EODA 3ATMA 2VIPA 1GL0E 1ZHMA 2AS9A 4TY6A 1KDQB 5BRRE 1TNIA 4BXWA 4Y10E 4KTCA 2QV1A 3SO3A 4AOQA 1L1GA 9ESTA 2HOBA 4UFEH 1W11U 4KTSA 1C5ZB 2Z9JA 5EW1H 3EA7A 2VU8E 1FY8E 1K1OA 1QJ1B 2BX3A 4YT6H 3U8RH 1P2IA 1UK2A 2Y82A 3P8NA 1ZOMA 3QZQA 1NN6A 5ESTE 1VGCC 2VWOA 1ZTJA 1HV7A 1GMCG 1Z71A 5A09A 6LPRA 1UVSH 4AFUA 4CRFA 2G00A 2V35A 1QCPA 5HXFA 2VGCC 2OQ5A 4O03A 1ZHRA 3QK1A 1O3MA 3TGJE 2FX4A 4BNRA 1HFDA 2G51A 1ELTA 1MBQA 1QY6A 3BTDE 4ZXYH 4AORA 5FAHA 2G4TA 4ZKSU 4MNWA 3SV7A 1X7AC 2R0KA 1PQ8A 1AU8A 4K3JA 3MO9A 1H1BA 1C2LA 2ANMH 1Z8IB 3VB7A 1AE5A 3FFGA 1XUFA 4I8JA 1D3TB 4K2YA 1TPOA 3F9FA 1ZPCA 1GI0A 4XSKU 2ZZUH 1H9LB 2THFB 4FU7A 2EI7A 4B71A 5L30H 3ZVBA 1LPZB 2FOGA 4KGAA 1QB9A 1NO9H 2SGAA 1YPKH 1BBRH 1MTWA 1THRH 5PTPA 3TPIZ 1N6YA 2ZDAH 3PO1B 1DFPA 4MPWA 5FCRA 2HGTH 1XVOA 1HYLA 4ABGA 1BHXF 1DXPA 1GMHG 4B73A 3ZZ9A 1GG6C 1C1OA 1CT0E 1AMHA 2A1DB 4YZUA 4Z0KA 1WCZA 1O2GH 2BDIA 3PM3A 5EQSA 1JIMA 1T4VH 1SGRE 2TRMA 3RXSA 2FESH 2SGPE 1O5DH 1QRXA 2G8TA 1DANH 4JZIA 1DSUA 4THNH 4IBLH 3ATWA 1GJCB 4OS6A 2BX4A 5FX5A 3OY5U 1ZMLA 3MNSA 1SHYA 1GI4A 2OINA 1T8MA 5TCAA 2LPRA 2EI6A 3RC4A 4AX9H 2Q6GA 1ZPBA 2RCEA 3SHAH 4FU8A 1G9IE 2XCFA 4Q7YA 4X2VA 2SNWA 1ZTKA 3M37A 2OC7A 3P6ZB 4ZKNU 1IAUA 1FUJA 2HNTE 2ULLA 3FZDA 5F8TA 1TGTA 4JK5A 2ZFQH 1TRMA 2BY5X 2VH6A 3BTEE 1BT7A 3Q77A 1DITH 5AFYH 4OGYA 5EXLA 3GY8A 1C5WB 3QTOH 1AVWA 2ZPSA 5GJ4B 3SV9A 3DHKH 3FZZA 3SJOA 1O2LA 1SQOA 1HAVA 1GMDG 5JB9S 5FCKA 3ZVFA 3M5NA 1MTVA 2Z94A 1O31A 1J15A 1TONA 1K1MA 1GBMA 4O3UA 1UK4A 3M5LA 3RU4T 3RXUA 3MWIU 3RMLH 1C1QA 3BG4B 5C1XA 2QIQA 1S84A 2XC5A 5C1YA 2FYQA 1EOJA 1WOFA 3R3GB 3HPTB 1TPPA 1DY9A 1UTMA 4CH8B 1V2KT 4FUCA 2HLCA 2GZ8A 2BVXH 2D26C 1YF4A 3IG6B 1MQ5A 2CN0H 1W7XH 3AW0A 3S9AA 1MKWH 1SGFA 4OS2A 3NXPA 4NWKA 1IQKA 2FX6A 4JYTA 1EPTC 1TFXA 3SU1A 1C5OH 1V2NT 3BN9A 4JYVH 3A7VA 3RM0H 4DIIH 4NZQA 2WUCA 5H4IB 2GZ9A 3SV6A 2W5EA 2QXHA 1OPHB 4KTUA 2ZHWH 3RXBA 2WPKS 1UTQA 1A7SA 1JBUH 1GBLA 1E35B 1DICA 1UVPA 1V2OT 2ZCLP 5G4BA 5A0AE 2WPLS 3MH7A 3K6YA 3VGCB 1V6DA 2GMTC 1G3EA 4D8NA 4TWWA 3LDXH 5DP6A 1YBWA 1YCPK 3MNCA 2EA3A 3SJIA 3BEUA 3T62A 1ELCA 1PQ5A 4WJG2 1ACBE 2FOHA 4K60A 1O38A 1LDTT 2ANWA 1K1IA 1T7CA 4MTBA 1OWDA 2NU3E 1GBAA 2P8OC 5TCCA 1XUJA 3F68H 4A1XA 1O35A 1KTTB 4IN1A 2H5CA 1CHGA 1DDJA 1TX8A 3MO3A 2C93B 3P92A 2J92A 1K2I1 2ZGJA 3DFJA 5FBEA 2SFAA 4BAOB 4D7GA 1K9OE 1FY1A 1GDUA 1G32B 3CS0A 2ZO3H 1LHDH 2Z7FE 2GVFA 2XC0A 2FEQH 1O2OA 1OWJA 1LHFH 4FUJA 1F5RA 1A46H 3V7TA 2F83A 2OQUA 2V3OH 3SBKA 1C5UA 2ALVA 1O2IA 1UHBB 3UQVA 3JZ1B 2F9BH 3F9HA 2F9UA 2PUQH 4Y6DA 1KXCA 4H6TA 3A89A 1GBCA 3NWUA 1A5GH 1FV9A 2A5IA 3FAOA 1G3DA 3Q00A 1C5MD 4OGXA 1GI3A 2B8OH 1QBOA 1XX9A 1BUIA 2EI8A 3NUMA 1HAOH 1DWBH 2YNBA 1Y59T 4NWLA 4ZAEA 1SGPE 1C1VH 4BAMB 2P3UB 3P95A 3QDZB 3SGBE 1YLDA 4WMFA 3PMBB 2P94A 1FZZA 1O5GH 1RTLA 4ABDA 1XUHA 1ZYOA 5C3NA 2BDBA 3RXAA 1O5AB 1QRZA 3MTYA 1W10U 3WY8A 1BRCE 1HIAB 1O2TA 1OP8A 1QBNA 1DS2E 1BTHH 1GMCF 4UFDH 3OY6U 3ATKA 3SJ9A 3TJNA 2GT8A 3BG8A 4E05H 1LHCH 1BQYA 5BPEA 5I46H 1TIOA 1V2ST 1SQAA 1B7XB 3RXKA 1O3AA 3A85A 1T8LA 1SLVB 4YOIA 1CA0B 1DXWA 3UR9A 5DG6A 2VVUA 3BF6H 1FAKH 3DT0H 3TK9A 5ABWA 3BEIB 4X8UH 5I25A 1YKTA 1C4Y2 1VITF 1P01A 3RXCA 2R3UA 1GG6B 2FS8A 4DG4A 4A6LA 1O2RA 5A8XA 3ZZ4A 1ZR0A 5EPYA 1V2WT 2HVXA 3T27A 1F0SA 4X8VH 3FP6E 3QZRA 2YOLA 1Z8GA 1M9UA 1EOLA 1UVOA 1HXEH 1W14U 3PLBA 3N7OA 5TJXA 1YPLH 3O8BA 4A1VA 1BBRE 1FNIA 2AIPA 1NM6A 1SSXA 2ZPQA 3SHCH 1UVTH 1MKXH 4MVNA 4ISOA 1AGJA 3RXGA 2UUYA 1C5YB 1EASA 1P3EA 1HAHH 1GMHF 2G5NA 1GL1A 4AGKA 1TNKA 1F0RA 2ODYB 1TX6A 3E6PH 2JKHA 4DCDA 1TOCB 1FLEE 2QCYA 1TGCA 1F2SE 2P95A 1HXFH 2ZTZA 5DJ7A 3T28A 3RU4E 3GYLB 1IQJA 3SQHE 1SFQB 1GBEA 4CR5A 5FPYA 2D2DA 1JRSA 1P12E 3RMNH 3LGUA 1HPGA 1SB1H 2BLQA 2ZC9H 1S6HA 1O2XA 2GKVE 1MU6B 3OX7U 4CBOA 1MTNC 3LH3A 2A7CA 2Q6DA 3RXHA 1C5LH 2Z3DA 1MU8B 1ZMJA 1FDPA 4K69A 4CR9A 1W8BH 3SU6A 4H42U 1S0QA 1AO5A 1YPJH 1P10A 3A84A 4XBCA 5F8XA 2SNVA 1QURH 1SLUB 2FS9A 4XBBA 3NCLA 6GCHG 1GJ7B 2VB0A 1FY4A 3TJOA 3PLPA 3CP7A 3SU0A 1C4V2 4DGJA 3QTVH 1T8OA 4INKA 2FWWA 4FVBA 5E8EH 1CE5A 2V3HH 2AGEX 4Q2KA 2ZHDA 1SBWA 2GT7A 3KIDU 1EAXA 1W13U 2C8XB 4GSOA 1SPJA 1AZ8A 2AMQA 1Z1JA 3UTUH 1GMDF 1EPTB 3NPSA 4IN2A 2AEIH 2FP7B 1DVAH 1O3JA 1CQQA 2Z9LA 3RC5A 3KNXA 1C1NA 4U2WA 2VH0A 4IS5A 3VB6A 2A4GA 4X6OA 1O2NA 2ZGCA 4DY7B 2XW9A 2GMTB 1DPOA 2BQ7B 1GVLA 4H6SB 1EAIA 1S5SA 3BIVH 3M5OA 2FI3E 1E37B 1NFXA 5AVDA 4ABHA 3DD2H 1TPSA 1MAXA 3KF2A 2G55A 4WXIA 1S82A 2GZ7A 3KEEA 1ABJH 1O2ZA 2ZTYA 1GJDB 1YM0A 5EOKA 1INCA 1O2WA 1HJAC 1U6QA 3RXFA 2WV4A 2OC0A 4ZH8A 1VJAU 1KSNA 4K8YA 1S0RA 2BY9X 4ABAA 4A92A 3DFLA 1XUGA 2HNTC 1ESBA 3ZZAA 1E38B 1MUEB 4I31A 1T32A 3P8GA 3VB4A 1ZHPA 4X2XA 5EPNA 5T6DA 3A8AA 1W0YH 1P11E 1EZSC 3OSYA 3QX5H 2AGGX 1XXDA 2IN2A 4Y8YA 1WBGB 4TYDA 1N8OC 4FXGH 1GDQA 2A7JA 1Y3VA 5GXPA 1P09A 1SGTA 3MH6A 3DUXH 2VIVA 3RXPA 5F8ZA 2BLOA 3GCTF 3UREA 8LPRA 2BMGB 1QB1A 3RXLA 1BTYA 1NPMA 1QQUA 2LNCA 3H5CB 1RGQA 3I77A 3TLOA 1C2HA 1D6RA 3SUDA 1G37A 2WYGA 4BAQB 3GY3A 5JBTA 2ZQ1A 1NS3A 1MQ6A 1C1RA 2BQ6B 2VIWA 1FMGA 5T6FA 1EX3A 2BB4A 1TGSZ 1NT1A 1Z8RA 4X1NU 8ESTE 1KXFA 1ZJKA 1SOTA 1EJNA 3RM2H 2ALPA 3SU5A 1C2DA 2PSYA 1FN6A 3Q76A 3RXMA 3ZYEA 3UOUA 3TGKE 2XYAA 2Y5FA 1AWFH 2JH5D 1E34B 2STAE 5GPIB 5DP4A 3PROA 1H8DH 1A3EH 1J8AA 3RXTA 4GUXA 1ZZZA 3BTME 1W3CA 2ASUB 4BAKB 1SGDE 1Z6JH 2Y7ZA 4I8KA 2M5TA 2C8YB 2OCVB 2F3CE 3MO6A 5DK1A 1SGNE 2BHGA 1DLKB 4OS1A 3TIUA 2ZDMA 2IOTA 3MHWU 1P3CA 2XRCA 3ZZ8A 2ZEBA 4Y7AA 3O8RA 1SGQE 3EQ0H 3BTKE 1MMJN 5HYOA 2XWBI 2A2XH 2AMDA 1P2KA 1THSH 3MYWA 3ZV8A 1CGJE 3F6UH 1BTUA 1SG8B 3T25A 4HTCH 1GBKA 1PQAA 1EB2A 2BLWA 1OYTH 1GDNA 2FLBH 5HGGA 1SGIB 1SR5C 4DT7B 5E0HA 1VCPA 4GLYA 4XBDA 2V0BA 3S0NA 1THPB 2F9NA 2WYJA 3TU7H 4AG2A 1AHTH 4X6NA 1NFYA 1AUTC 3LH1A 2BQWB 3ZVEA 1WTHD 2WINI 4NIVA 3GCNA 4H4FA 3M3TA 2BOHB 4ZHMU 5JBAS 3ZZBA 4BANB 1SGCA 4BOHA 1GI5A 1QJ6B 1A3BH 1MTUA 1C1UH 2H9TH 4B2AA 1C4U2 2V6NA 4UFFH 2UUKB 3OYPA 3ZVAA 4UEHH 4E7RG 3GISB 3KCGH 3V0XA 1C2EA 1DWDH 1JXPA 1L0ZA 1VITG 2TPIZ 3AW1A 3SOSA 1MTNB 2HALA 3P8FA 2BLVA 1UVUH 2QY0B 4NCYA 1GHBG 2A4RA 2FOCA 4ABBA 1BZXE 1NESE 1NC6A 1Y3YA 1QIXB 2O8MA 1YP9A 2W26A 4ABEA 1GJ9B 1OX1A 1D6WA 4Z6AH 3FP7E 1OWHA 1TLDA 3MOCA 1CA0C 4ISHH 2VINA 2VWLA 2JETC 1ANBA 1TAWA 4ABFA 2Y6TA 2ZIQH