3TJOA

Htra1 catalytic domain, mutationally inactivated
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
211
structure length
198
Chain Sequence
MDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTTQDYIQTDAIINYGNAGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFLTESHDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Serine protease HTRA1
publication title Structural and Functional Analysis of HtrA1 and Its Subdomains.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 198
sequence length 211
chains with identical sequence B, D
ec nomenclature ec 3.4.21.-:
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tjoA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tjoA02
1O31A 4A7IB 1SGYE 3N7OA 1C2IA 1HIAA 4X2XA 1O2XA 4WWYA 1DXWA 1HJ9A 1A0JA 3HK3B 1UTOA 2Q6FA 1GHZA 5C1UA 2DE9A 1GJDB 1UTKA 3M7QA 3NCLA 1TLDA 3RM2H 3MNCA 6ESTA 1SOTA 4JYTA 3BN9A 1GBTA 4K1TA 4XBDA 3UFAA 3LOXA 2ZZUH 1MTNB 1DDJA 1ZLRA 1ZMJA 3LC5A 1DVAH 2ZDVH 4UFEH 4BAOB 4GCHF 1V2NT 2ZHFH 1FY8E 5EOKA 2PFEA 2ZHWH 2JH6D 1BTXA 4WH8A 3ITIA 1ELGA 2ZDLA 3WY8A 2GCTB 1EATA 2Q1JA 4DJZB 2EC9H 4BTIB 1BBRH 2G52A 1BTZA 2ZTYA 3VB6A 4YTAA 1Q2WA 4WY3A 1AU8A 2WPKS 2XBXA 1C5RA 1DANH 1B5GH 5LH8A 1FV9A 1IQHA 1C2JA 1S6FA 3F9FA 1D3TB 4D7FA 1S6HA 3Q76A 2FI3E 1JXPA 1L0ZA 3G01A 1SHYA 3U98H 1AVGH 5LPFA 4U30A 1QL8A 1QCPA 5A09A 1OX1A 1GBBA 4U2WA 2JETB 3PTNA 5DP5A 4AFZA 4F4OC 5J4QA 2J2UA 3Q00A 4AG2A 5F8ZA 3ZZ4A 3BEIB 3A80A 1TPOA 1TWXB 3RXHA 4FUFA 1PQ7A 4NIVA 2FDAA 3MH5A 4YT7H 3EGKH 1FAXA 1P2QA 1MAYA 1Q3XA 2CF9H 3D65E 2H5DA 5EGMA 1H4WA 3BIUH 1UHBB 1EPTB 1FZZA 1YPJH 1Z7KA 1QRXA 2ZDNA 1DXPA 4BXWA 1PPFE 1C5TA 1HPGA 1YP9A 2BY8X 1S84A 1FAKH 4WF8A 4CREA 1YPHE 1W2KH 2QXHA 1V2OT 2THFB 1YBWA 4Y8YA 3SU0A 3U1JB 4X1SU 2ZEBA 1HAOH 5C1YA 1AGJA 2Y7ZA 2VIWA 2EI7A 4NIXA 5EQQA 2YNAA 3S9CA 1BJUA 3L33A 1UJ1A 1MKWK 2BDCA 1MZDA 4GCHG 1SGEE 1XM1A 8ESTE 1WSSH 4I33A 1T8NA 3BIVH 3E0PB 1V2LT 3GYMA 2RA0A 3ESTA 3TJUA 1G36A 1CQQA 3V3MA 1BJVA 1EQ9A 1OSSA 1P12E 1SQOA 3MU5A 3D23A 3A84A 1V2WT 1V2QT 2SNWA 2XWAA 1Y5AT 1F0UA 3TVJB 2BYAX 1CGJE 1O2SA 2BVSH 3NK8A 2OUAA 1WQSA 6CHAC 3B23B 4HFPB 1NROH 1GHWH 4K5ZA 1G30B 1DUEA 3L6PA 1TGSZ 3EAJA 1LO6A 2ANYA 3RXBA 5FCRA 1GDNA 2G4UA 1OWEA 2CHAC 5EW2H 1EZQA 2XBVA 2ZCLP 2TGDA 3RC6A 1YPGH 2BLVA 2UWPA 4GLYA 4AB8A 2XTTB 2XC0A 3FANA 4A1TA 1OPHB 1IQGA 1RFNA 2BY5X 3TK9A 2BOHB 2VB0A 5C2ZA 2Y80A 1O2GH 2FOMB 2AMQA 1ZSLA 1X7AC 2W3IA 4E05H 5F8TA 1DX5M 1SGTA 4XOJA 4MNXA 4BOHA 2VH0A 1THSH 1DY8A 1FDPA 3OY6U 3EA7A 1ARBA 2ALPA 2Y5HA 5SGAE 5B6OA 1ESAA 1F5LA 3VB3A 2BD3A 3NWUA 3U69H 1DS2E 2O8UA 2TGPZ 2ODQA 2QAAA 3HGNA 3FVFB 4INLA 3ZYDA 2A7JA 2A5IA 4IS5A 2XYAA 3R3GB 1W11U 1C5OH 1C1QA 2H9HA 4RN6A 4AOQA 5JBCS 3P70B 2HLCA 3SV7A 4OGYA 2FOBA 1SVPA 2H9EH 2FIRH 1VITF 5DP6A 4Z6AH 1EAUA 1WCZA 1G2LA 1ZHPA 1MQ5A 2P95A 1GBEA 3GCNA 1V2KT 4GPGA 2FYRA 2ZFPH 1AVWA 3LGTA 1DM4B 2AERH 2BDIA 4SGBE 2ESTE 1GJ8B 2HALA 4ZH8A 1YF4A 1TPAE 3UPEA 1ELTA 1P9SA 2OP9A 3S9AA 3RU4D 1P2NA 2FZZA 2QF3A 1J17T 4X8UH 2WUCA 2C8YB 1LHDH 1UCYK 3A88A 1TBRH 1D4PB 2KAIA 3C27B 1W0YH 2G8TA 1T8OA 3F9EA 1YPEH 1CT0E 3MU0A 3OSYA 4X6PA 1ETRH 1GCTB 3MH6A 1QRZA 1C2KA 2BVXH 4CBNA 3BTQE 3Q3XA 4FUGA 3ELAH 4ZMAH 1GI1A 2PGQB 1B0FA 1PQ8A 3TJVA 2QXIA 3F1SB 3FP6E 1UMAH 2F9VA 4JYUH 2W3KA 4IN2A 1J9CH 1EAIA 1OWJA 1ZPCA 3RXAA 7LPRA 4JMYA 4AN7A 3PO1B 5EQRA 4BAHB 1SHHB 2HWLB 3LJJA 4X6OA 5E0GA 1F5RA 2VIPA 5HM9A 1MD7A 1BITA 4BAMB 5EU8A 1SGPE 1EB1H 4ZKOU 1KTTB 3SUFA 1FNIA 1XKAC 1VITG 1THRH 1S81A 2FEQH 3VEQB 3GCOA 2ZU3A 4B74A 1EJAA 1TMUH 1LPKB 1WAYB 3QZRA 2H2ZA 2ZHEH 3LIWA 2GX4A 2FOEA 3QWCH 2J34A 2ODYB 1GJ5H 1CSOE 1C2MA 2OC7A 3FP8E 4I31A 1UTQA 2VH6A 3GY4A 2GV7A 3NKKA 4CRDA 1H9IE 1JOUB 6GCHF 1B0EA 1C2DA 2ZF0H 3OX7U 1TIOA 1AVXA 5E8EH 2STBE 4OS1A 3UNRA 3NZIA 1T31A 1TGNA 2SNVA 4NZLA 3RXKA 5HYOA 1MQ6A 3T28A 1Y3UA 2BQWB 2XBWA 1UVPA 1INCA 1AKSA 1BTYA 1K1OA 2Z9GA 2OBQA 5FHTA 2W5EA 4VGCB 4ABJA 3BTGE 1YKTA 2A4QA 1BTPA 2AMDA 3QUMP 1QBOA 4H6TA 4X8SH 1A0LA 2C4FH 5F6MA 4U01A 1OWIA 1CA0C 1QURH 1TX7A 1VZQH 1QTFA 2ZG0H 1GL0E 1PJPA 4RKJB 3E16B 2Z94A 5F8XA 3PWBA 7KMEH 1Q31A 4SGAE 4ZXXH 3SV2H 5AFZH 1RTFB 2O8LA 3RXCA 1NRPH 4TPIZ 1O36A 2B9LA 2PKAB 3A7VA 2XBYA 4TYDA 4X1RU 3A7WA 2ASUB 3GDVA 3A89A 4UFGH 1PPEE 4JCNA 1GHYH 4K60A 1KIGH 1H9HE 4WH6A 5GDSH 1P10A 1GJ4H 1HIAB 1TPSA 1N6YA 1ZRKA 2ZGCA 4WMDA 3GDSA 3F68H 2F91A 4WMEA 1KY9A 1BMNH 1UK4A 4K1SA 1ELCA 3VGCB 3SJ8A 1TYNA 1D6RA 3UWJH 1O2NA 1G37A 4A5TS 3DA9B 1C5WB 2Y5FA 1VCPA 2HRVA 3BG4C 3K9XB 1H8DH 1RRKA 3RXFA 1S0QA 2PUQH 1DWBH 4FXGH 4YOIA 6GCHG 1C1RA 2BX3A 2PV9B 4KTCA 1O32A 3P17H 3ZVCA 3HK6B 2TIOA 5DG6A 1K1PA 1W3CA 1K1JA 4IW4E 1RTLA 3MYWA 1QHRB 2XRCA 2BLQA 1UO6A 1O3NA 5E0JA 2FOHA 3BTKE 1BTHH 3GY6A 3H7OA 2RDLA 2IPHA 3SUGA 1QJ6B 2HOBA 1O2ZA 2ANWA 4BAKB 1XUJA 3F6UH 1D6WA 1KLIH 3M36A 3M3SA 4Y79A 1EASA 2VGCC 5FAHA 1EP5A 1JMOH 1HAIH 1BBRK 1W0ZU 1K28D 3M61U 4MPWA 3M37A 3ZZ6A 3PMJA 1O2HA 1AUJA 4AFSA 3OU0A 4X6NA 4FU7A 1XUIA 1NN6A 1UTMA 2Z9KA 1GJBB 3FAOA 2OC0A 3VB5A 2GMTB 2C8ZB 1GHXH 1O33A 1FIZA 1XKBC 3ZZ5A 5CMXH 2BLOA 3K6YA 1O2PA 2XW9A 2FS9A 3I78A 1OWHA 1T32A 4ZHMU 4K8BA 2WPLS 5EXLA 2JH5D 4MVNA 1HAPH 1C1PA 1J16A 1F5KU 5A8XA 1AE8H 3TU7H 3U8OH 1UK2A 3AAUA 1H9LB 5ESBA 1DWCH 1ZSJA 2FTMA 3MU4A 3PM3A 1ARCA 1CHOF 2ZHDA 3SGBE 1BUIA 1CA8B 1VR1H 4DVAU 3SU3A 1ELFA 2HNTF 1C9PA 2VWOA 2O8WA 2V0BA 2GD4B 1TMTH 2UUKB 1C2HA 1TE0A 2FS8A 5AVDA 1P2KA 1GJAB 1HUTH 4FUJA 1AFQB 1BMLA 2PKSB 3FZDA 4NA9H 1IAUA 1YPKH 4E7RG 4JYVH 1YLCA 1Z8JB 2TPIZ 1N8OC 1O3AA 2J94A 4ABDA 3GOVB 1NU9A 4ZHLU 1GBLA 2AH4X 4B1TA 3QLPH 1GBJA 4KTSA 2Z3CA 2A1DB 2P3FH 5CHAC 3DHKH 3AW1A 4FUHA 3CS0A 2UUJB 1XUFA 1C5XB 1C4U2 3AAVA 3M5OA 3SI4H 1KXCA 2FWWA 4DURA 1Y3YA 1CBWC 1NY22 4DY7B 3KEEA 4AYYB 2NU0E 3IITA 1LVYA 1G32B 1G9IE 2RA3A 4OS6A 1Z8GA 2ZU4A 1P2IA 1ANDA 1QJ1B 5DKMA 5JB8S 1D3PB 1UVSH 5EPNA 2QXJA 1TRYA 4AG1A 1QB1A 4CH8B 1Y5UT 2H6MA 1CHOG 3SUEA 2AIPA 9LPRA 4I7YH 1FJSA 1AWFH 1O3JA 2Z7FE 2XCNA 3M5MA 3RM0H 2WPHS 1YCPH 2OINA 1G2MA 1VITH 3EA8A 4JZDH 4WXVA 3TNSA 1XVOA 1BQYA 1W14U 4CBOA 3QX5H 5EG4A 1HAZB 4HTCH 1TQ0B 5FX6A 1GI4A 4O9VA 3FP7E 1TNIA 2GVFA 4O97A 3TJOA 2BOKA 3MNSA 1F2SE 3SJIA 1Z8RA 2BXUH 1UCYE 3NUMA 1O3FA 1DSUA 2C93B 1LQDB 3QGJA 1YGCH 2VU8E 3ODDA 3SNCA 1K1NA 4Y8ZA 1TB6H 1CVWH 1BIOA 1OP8A 2SFAA 2TBSA 1C5ZB 3M7TA 2KAIB 1P0SH 1IHSH 1N6XA 1WOFA 3MH7A 1JRSA 4AORA 2F9UA 1AWHB 1HXFH 3TK6A 5A8YA 2F9BH 1QIXB 2EI8A 3KIDU 3PYHA 2GT8A 2BY6X 3T5FH 3QTVH 5L30H 1GBHA 2DE8A 2BDAA 3P6ZB 1EZSC 2ZHQH 2FO9A 1W7GH 1KLTA 1W8BH 4JZEH 4DOQA 3SQEE 3GCHB 2ZI2H 3GDUA 2WPJS 1V6DA 1YPLH 1PFXC 3EDXB 4NIWA 2FESH 3UOUA 3MWIU 5EW1H 3KQCA 1THPB 2XNIA 5L2ZH 1O3KA 8GCHF 3PLKA 3DT0H 1LPGB 1TBZH 2Y5GA 1ZTLA 5IYTA 4AYVB 1V2UT 5ABWA 1SQAA 1SB1H 1UVTH 1E34B 4KELA 1PYTD 2VIVA 3SO3A 2GZ8A 5GIBA 4CHAC 2ZPRA 2SGEE 3KF2A 1ZSKA 2ANMH 1GBAA 2R3UA 1K9OE 1ZPZA 2UUFB 1FI8A 3SU4A 1HJ8A 2DUCA 2V3OH 1L1JA 4O3UA 3SU6A 1XUGA 2FOGA 3M5LA 2ZO3H 3MHWU 2J9NA 1C1MA 2BD9A 4TY7A 2A4OA 4FUIA 3Q3YA 4Y0YE 3GCTF 4A1VA 2BDYA 4YZUA 4UDWH 1PYTC 2ZGBH 1FIWA 2OBOA 3AW0A 3H7TA 3I29A 3UWIA 5DP4A 1LKAA 5A2MH 3GY5A 2QIQA 2BY7X 1HCGA 3UREA 1TNGA 1NT1A 1TOCB 1H1BA 4YESB 3RXLA 3RXGA 1JIMA 1YPHC 4IC5A 2VWMA 3SV9A 1SFQB 1AKSB 1ZTJA 4IC6A 2A4GA 1AD8H 2AYWA 3A7TA 1Y8TA 4AGJA 1LHFH 1RJXB 3ZVBA 3KQBA 3ZVFA 1CGIE 2D2DA 1KTSB 1GMCF 4Y10E 1EB2A 5DP9A 1VGCC 6CHAB 1P04A 1SMFE 2ZA5A 2GCHF 1AE5A 2AMPA 1QA0A 1IHTH 4Y7BA 4ABIA 3ATIA 3URCA 2I6QA 3PROA 1A3EH 1VCQA 4MPUA 4GSOA 8GCHG 1A7SA 1MAXA 2XCFA 3EE0B 3CP7A 1SL3A 1AB9C 2CHAB 1CT4E 3RXTA 3LH3A 1IQIA 1KXDA 1L4ZA 2BX4A 4ISLA 1P05A 1AY6H 2VIDA 2AFQB 1V2VT 4ISHH 4I8LA 3RLYH 3P8GA 4YOGA 1A46H 2WUBA 2OC1A 3UR9A 4NFEA 1UTPA 1O2YA 1RGQA 2ZGXH 4NGAH 4FVDA 3SU2A 2Y7XA 3RLWH 6LPRA 5GWZA 1U6QA 3B9FH 5AFYH 1O3LA 5DK1A 1ZOMA 4FU8A 1GCTC 3GCTG 1IQMA 1C5VA 4UE7H 1BRBE 3MI4A 4Y7AA 1BMAA 3ZV8A 1RS0A 1F0TA 4LZ4B 2UUYA 1FMGA 3SJOA 2GV6A 4YM9A 2G51A 3ODFA 1EX3A 1OYTH 2NU3E 1B7XB 1RTKA 4UONA 1K1MA 3S7KB 1NFUA 4Q2KA 2CMYA 4Y6DA 3BTEE 3SNAA 1W13U 5DPAA 2OTVA 1YC0A 3MMGA 4HI3A 3VB7A 3A7YA 3GICB 1BBRE 3LKWA 4WJG2 2Q6GA 3ATWA 5J4SA 2H1UA 3V0XA 4B75A 1SGIB 2D26C 5DP7A 4Y76A 3A81A 1GMCG 1JRTA 1O3GA 3V12A 3T27A 1DE7H 4NSYA 3VFEA 1BRCE 2GCHG 1ZR0A 2FI5E 1CU1A 4ZROA 1F0SA 4D76A 3KGPA 4CRBA 1LQEA 1OXGA 5EXNA 2R0KA 3LU9B 3LJOA 3M5NA 2PTCE 1BCUH 3PMHB 1ELAA 5C67A 4DT7B 3ATMA 1QRWA 1HAVB 1BOQA 3OY5U 5FPSA 4ABAA 1TX6A 2EI6A 4BXSA 1AHTH 2BB4A 2W7SA 1Y3XA 2NWNA 1NESE 5JBBS 4Q7XA 1LDTT 2Z9IA 4LOYH 1V2PT 2P8OC 2YNBA 2IOTA 2LNCA 1GBIA 2WPMS 3HGPA 3W94A 4XBBA 1BMMH 1GBCA 3GYLB 2J95A 4MLFB 2A45B 1GG6C 4D9RA 5E0HA 4ZKNU 3S69A 1GBKA 5JBTA 1O5DH 3A7XA 4D9QA 1O2TA 1HYLA 2PTNA 4NCYA 2AS9A 2R3YA 3NPSA 3SN8A 2FLBH 1C2GA 2PSXA 3ZZ8A 4RKOB 1A5GH 1MBMA 1NTPA 5DJ7A 1AMHA 1ELDE 3AVZA 1E0FD 4XSKU 1VJ9U 3O8RA 2WYJA 1EJMA 3E0NB 4ABFA 2GT7A 2A4RA 4NA8A 4I32A 1QR3E 5T6GA 1AQ7A 3RMNH 1E37B 5FPTA 1GMDF 1SGFA 2ZP0H 2BDHA 1AZZA 1HJAB 2Z3DA 3RMMH 1K2I1 3IG6B 1NRRH 4FUBA 4OS5A 2GZ9A 1DY9A 4BTTB 4XDEA 3VGCC 2BD5A 8LPRA 1YYY1 1N1LA 2XC5A 1T4UH 3H5CB 2Q6DA 2O9QA 1P57B 3BEUA 4K1EA 2Y81A 1O5BB 4X6MA 1A0HB 1DUAA 1FUJA 3P92A 4H6SB 2ZDAH 1LVBA 9ESTA 1AIXH 4RSPA 4MNVA 4X8TH 1TPPA 3S7HB 3ZVDA 2SGPE 1EUFA 1C4V2 1E36B 1S5SA 1GGDB 5TCCA 3V13A 1KDQA 3MO6A 4YLQH 2F9PA 3D62A 4X2YA 4KKDA 4WVPE 2BD8A 4ISNA 1OS8A 1HAHH 4MPXA 4X1NU 5EODA 1HRTH 3ZV9A 2PHBA 4R0IA 4CH2B 1O2JA 3A7ZA 3SJ9A 1DWDH 1K1IA 3BV9B 1QGFA 1EKBB 1G3EA 2SGAA 5T3HA 1TMBH 3PB1E 3T26A 4Y0ZE 1YCPM 3HKIB 1A61H 1QNJA 4PROA 3TGJE 1FN8A 2V35A 1GDQA 1MKXH 2WPIS 2BLWA 3PV4A 4DIIH 2C90B 1QJ7B 2HVXA 4ABBA 2FOFA 3F9HA 4CRAA 2D8WA 1KLJH 1YCPK 4MQAA 2J4IA 1NS3A 5IDKA 1TONA 5AF9H 4A1XA 2QY0B 1K1LA 1NFXA 1C5YB 3ENSB 1LPZB 1O3PB 1AFEH 1RIWB 1PPCE 1GMDG 2Z9JA 2Y82A 3BG4B 4E06H 1AN1E 1GVKB 2AGGX 1W10U 2ZKSA 1F7ZA 3A85A 3QTOH 1KXFA 4JK6A 1QL9A 1SOZA 1IQLA 2RG3A 1MH0A 2OXSA 4YT6H 4Q7YA 1HAVA 1MTSA 2ZQ1A 1CT2E 1TA2A 4R8TB 4CRGA 4DIHH 4NIYA 2G00A 3I77A 2F9OA 5FBEA 5I25A 3PWCA 4CR5A 3STIA 3KQEA 3M7UA 1NO9H 3BTWE 4IGDA 4B2AA 1ORFA 2BXTH 4FUCA 3HATH 1NC6A 1LTOA 3UIRA 7ESTE 2G4TA 4MG3A 5L2YH 3W95A 2VVCA 2VIOA 2ZGHA 3A8DA 4ZKRU 1P02A 4LZ1H 3TK5A 3ZZDA 1LVMA 1KSNA 1PQAA 1HGTH 5C3NA 1YLDA 3SV6A 1TFXA 2ZCHP 1NU7B 2FTLE 4I8JA 3UUZA 3RU4T 5K0HA 2ZPSA 2ZTZA 1P03A 2ILNA 4M7GA 1C5PA 1LHCH 3RXDA 1O3OA 2G55A 3MU8A 2F3CE 2GDDA 1GHBF 3BG8A 5K7RA 4OGXA 1SGQE 4INKA 1BHXB 1L1NA 1GI3A 3TLOA 1DLKB 1O2QA 3A8CA 5BRRE 1WQVH 1SFIA 2P59A 3O8DA 5DP3A 1K22H 4MNWA 4X1QU 2ZFRH 4ZAEA 3DFJA 4B2BA 1CGHA 7GCHF 1DPOA 1QQ4A 1C5NH 3LGYA 4NZQA 3KL6A 4Z0KA 3K2UA 3PMBB 3F9GA 1MCTA 2VINA 2PWXA 2J92A 4UEHH 1GVZA 1UTJA 2QXGA 1ZYOA 1MUEB 4NSVA 1SSXA 1T7CA 2HPPH 3LC3A 3FFGA 1MTNC 1GHAF 1TABE 2IN2A 2ULLA 1C2LA 3RXIA 4AGKA 3ZZ3A 3GISB 3BTHE 1C5UA 1C5MD 2HNTC 1ESTA 3MNXA 1DOJA 4H4FA 1EAXA 1GI5A 1SG8B 2OQUA 3ZZ9A 2A0QB 1K21H 4IN1A 4KTUA 1KXAA 1G3CA 1O2MA 2XWBI 4YOJA 3BF6H 2GCTC 2B7DH 5FBIA 1ZZZA 4FVBA 4OS2A 3P8FA 1TALA 4FU9A 1IQFA 1EZUC 2R2WU 5CHAB 3RMOH 1BDAA 5C5OA 3RXSA 1NRNH 2ZU5A 3SV8A 2GP9B 2BTCE 2ZECA 1EZXC 2F9NA 1WTGH 2G5VA 2QF0A 1O3CA 1OOKB 1XVMA 3FZZA 3SGQE 5ETXA 1CBWB 2JETC 2F83A 2VJ1A 3AASA 2ZWLH 4I8HA 1GJCB 3LGIA 1GHBG 2G5NA 4J1YA 1O2OA 3BEFB 1UTNA 1FQ3A 2QA9E 1O39A 1A1RA 3S0NA 4Y11E 3UQVA 3RXPA 1DSTA 3MFJA 4E7NA 1IQNA 1EPTC 3VB4A 1C2EA 2D1JA 5PTPA 5TJXA 4B71A 1GI9B 3ATLA 4NWKA 3GCHC 2NU2E 2IJOB 2FXRA 2ZU2A 3UQOA 1E35B 7GCHG 1ZPBA 2BDGA 2EEKA 2OCVB 4OS4A 3BSQA 2M5TA 1L2EA 1XUKA 2FLRH 4ZXYH 2LPRA 5GJ4B 2O8MA 4X2VA 3QDZB 4K69A 2W26A 3M3TA 2BDBA 4O03A 1GHVH 5HM2A 1ETSH 1PQ5A 3UNSA 5C20A 2WV5A 4ESTE 1HXEH 4YO9A 1WYKA 4BANB 2ZCKP 2P93A 1GHAG 1GPZA 2FX4A 2WV4A 3LPRA 4Y8XA 1ZRBA 3URDA 5GCHF 2PW8H 1C2FA 2ZDKA 1D3QB 1ZJDA 3MNBA 4JZ1A 1QY6A 3JZ2B 3A82A 3RXUA 3SNDA 5JB9S 1T8MA 1SLWB 3PLPA 4ABEA 1P09A 1QA7A 1V2ST 2FMJA 2Z9LA 1GDUA 2QV1A 2C8WB 3T29A 5T6FA 2H5CA 4TWWA 2WYGA 3RXQA 2K1QA 1XXDA 4ZKSU 2C8XB 1C9TA 1ELVA 1HV7A 1O2IA 2VWNA 1ZMLA 3M35A 2CJIA 2VNTA 1A2CH 1XXFA 1YM0A 2VVVA 1TX8A 1S82A 2PR3A 2B8OH 4KP0A 2FODA 5FCKA 1C1UH 1JWTA 2RCEA 3SOSA 1XMNB 3A86A 3EYDA 1ANCA 5DO4H 3LONA 1BB0B 5BPEA 4X2WA 5DGJA 4HZHA 1A4WH 1C1SA 2QGRA 4AFUA 2BQ7B 4CHAB 2ZU1A 2FI4E 4D7GA 2SGQE 1Z6EA 2BZAA 3RXJA 3UNQA 1HFDA 2Z3EA 1H8IH 2ZQ2A 1SR5C 3RXOA 1W7XH 3KQDA 1C1TA 1WTHD 5GXPA 3E1XB 4GHQA 1ELBA 3MU1A 3M3VA 4ASHA 1Y59T 1QQUA 1UVUH 1O0DH 1ZJKA 1O34A 3EQ0H 1GWAA 3QN7A 5FXLA 1SGFG 2GZ7A 3OYPA 5GCHG 2G81E 1BTWA 1NFWA 5FX5A 4NA7A 1GJ6A 4XE4A 1SGRE 2QCYA 2A32A 4A6LA 5G4BA 4MTBA 1FXYA 1ID5H 1O2RA 5TCAA 2QN5T 1T8LA 2ANKH 1PPGE 3PLBA 5AHGH 1A5IA 1TNKA 3BTTE 1O3BA 2GTBA 5L6NH 3KNXA 1FY1A 1O3EA 1J15A 4IBLH 1ZMNA 4NWLA 2PUXB 3ZZBA 1IQEA 1ANBA 4IMQA 1OYQA 3BTFE 3DFLA 3SGAE 2OD3B 3O8CA 4UFDH 4UD9H 2STAE 1BRAA 4K2YA 3SUDA 5CE1A 1KDQB 1VGCB 1IQKA 1EOLA 4WXIA 3RU4E 1O2KA 2V6NA 4U32A 3ZVEA 1QBNA 2A5KA 2BQ6B 4B76A 2NU1E 5A0AE 2ODPA 2BD7A 3T62A 1O37A 3SZNA 4NG9H 4MNYA 2ZFSA 3MO3A 3RP2A 5A0BA 2BZ6H 2SGFE 4DG4A 3VXEH 1EXFA 1AI8H 1P2MA 1AB9B 1FPHH 1CE5A 1NRQH 1D3DB 3TH3H 1LVOA 3TJNA 1J8AA 1WBGB 3QZQA 3TH2H 4Q80A 2BD4A 2ZGJA 2ZPQA 3RXVA 1FLEE 1Z8IB 8KME2 4A92A 4GAWA 1HNEE 2BM2A 2FYQA 5EXMA 1O2VA 3PTBA 1BRUP 3PO1C 1QBVH 4OS7A 4ZHAA 4CRCA 1GBFA 2FPZA 2W7UA 3RC4A 2J38A 1MKXK 5T6DA 3A87A 1O2LA 1MU6B 3SU5A 1OP0A 1S0RA 1UHBA 3TGKE 1TNJA 3RXRA 1EPTA 1NM6A 2GGVB 1XUHA 2BMGB 4CRFA 4YLUA 1Z1IA 1HB0B 3Q77A 1MKWH 5LGOA 2ZC9H 3K6ZA 1C5LH 1TNHA 4F49A 1ZTKA 5E2OA 2VVUA 4KGAA 4BTUB 3MTYA 1MTUA 2A31A 1EOJA 1KXEA 5F03A 1EJNA 2YOLA 2XC4A 2PGBB 5ESTE 2Z6BD 2CF8H 3TITA 1WU1A 2P3TB 4XBCA 2GDEH 1V2RT 5A0CA 1GI7B 1BT7A 3Q3KA 1LCYA 1EP6A 1GI0A 1SLVB 4IMZA 3ZZCA 1P3EA 3T2NA 1UK3A 2CV3A 5LPRA 1O5AB 2ZDMA 1HDTH 1NRSH 4DW2U 3KCGH 4VGCC 3UY9A 2TRMA 1TGBA 1TA6A 1DWEH 2OQ5A 1Y5BT 1SGDE 1YPMH 2R9PA 1T4VH 3SNBA 1O35A 4I8GA 3RXEA 1G3DA 2B0FA 2A5AA 1KYNA 4H42U 3SORA 4K3JA 1Z71A 2I6SA 4LXBH 1TRMA 1ABJH 1PPBH 1HJAC 3CS7A 3S9BA 1AZ8A 1C5QA 2P3UB 4UFFH 3BTME 2A2XH 1SI5H 1WUNH 2ZFTA 3LDXH 1V3XA 4THNH 3SJKA 4BAQB 1ETTH 3GY8A 5JPMH 1LKBA 1A3BH 1GBMA 3P8OA 2AEIH 1O3DA 3DD2H 5DP8A 2PLXA 4O3TA 3PMAB 2P8OB 3ZZAA 1DFPA 1HLTH 2EA3A 1NPMA 4QT8C 5H4IB 5JDUB 4ISOA 3E91A 4AX9H 3DUXH 3BTDE 3GY2A 1P01A 2ZIQH 1SLXB 2A7CA 1GG6B 1ZGVA 2BHGA 5FPYA 1P2OA 4ISIH 1AUTC 1GGDC 4B2CA 1FY4A 1CHGA 1O3MA 2SGDE 1VCWA 3SQHE 3C1KA 2UWOA 1TOMH 3LT3A 3A8AA 1D9IA 1GMHF 1SBWA 1RD3B 5C1XA 1F92A 3SBKA 1ELEE 1LMWB 1GI8B 2B5TB 1LHGH 1CA0B 1OWKA 2P16A 3RMLH 1CO7E 4LK4A 4NFFA 4DCDA 3QK1A 4K8YA 1DITH 3RUOA 3LH1A 4ABGA 2FOAA 1JBUH 1UCYH 3SU1A 1C5SA 1MBQA 2ALVA 1GL1A 1F0RA 1P06A 1C1NA 3L3TA 3KN2A 1O5CB 1RIWC 5HXFA 1KXBA 5A8ZA 2C3SA 1SLUB 3ZZ7A 1BTUA 5C5NA 2V3HH 1TBQH 1UTLM 2QYIA 1OWDA 1ABIH 3SHCH 1O2WA 5EQSA 1BHXF 2O8TA 3K65B 4JZIA 3A83A 4AFQA 1GI6A 1M9UA 3U8TH 1HAYB 1O30A 1SQTA 3SI3H 3EA9A 1GBDA 5EPYA 2ZFQH 2GMTC 4FUEA 3VPKA 1P9UA 4TY6A 3TNTA 4MPVA 1RXPA 3JZ1B 2HGTH 4B73A 5GPIB 3TGIE 2OLGA 3B8JA 3E8LA 1ZHRA 3T25A 1TRNA 5JYIA 3NXPA 3P8NA 4TWYA 5LPEA 1ANEA 3SW2B 3R0FA 3TH4H 1BZXE 2ZNKH 3KHVA 1MD8A 1ESBA 3STJA 1IQJA 4D8NA 1L1GA 2FM2A 4Y71A 2WINI 1TGTA 3UR6A 3P95A 4X1PU 1GVLA 1TAWA 2AGEX 4GHTA 3E90B 1HAGE 4HGCA 1TNLA 1O3IA 1XX9A 1SPJA 2H9TH 1GMHG 1O5FH 2BD2A 4X0WU 1MTWA 3IWMA 2CGAA 1P3CA 3D49H 4XFQA 2GKVE 3U8RH 2FX6A 2JKHA 1L4DA 2FOCA 1C1OA 2VGCB 3GY7A 1Y3WA 1DLEA 1AFQC 5I46H 2PKSC 1GJ9B 2CXVA 1V2JT 1IOEA 1TQ7B 1P2JA 3U9AH 1O3HA 1WV7H 1P11E 1HBTH 4ABHA 2NU4E 1LHEH 1JIRA 1MZAA 1FY3A 4ZUHA 3E6PH 3UTUH 2AGIX 1MMJN 1FY5A 4X8VH 2A7HA 3LGVA 4J2YB 4JZFH 5HMAA 3RXMA 4MDSA 4BNRA 1Y3VA 4WMFA 1AO5A 1V2MT 2AIQA 5HGGA 3LGUA 3MOCA 3UOPA 2A2QH 5JBAS 1VJAU 1W12U 1FN6A 3RC5A 3QO6A 3E3TA 1O38A 2CN0H 1ZHMA 3QGNB 1GI2A 3HKJB 2HNTE 1Z6JH 4GUXA 1EAWA 2VWLA 2ZTXA 1HAXB 1E38B 3MH4A 2VIQA 2HPQH 2UWLA 4I8KA 1OP2A 4AB9A 3CENA 1QFKH 4AZ2B 1FONA 1O5GH 5E2PA 1ACBE 3GY3A 1QB6A 3MO9A 1QB9A 3RDZA 2R0LA 1UVOA 2BVRH 4INHA 2JH0D 2R2MB 1SC8U 3ATKA 1S83A 3ZVGA 2PSYA 1DICA 1MU8B 1GCDA 2P94A 3TIUA 1NZQH 1ZGIA 2XXLA 4TPYA 1BA8B 1FPCH 4Q7ZA 1DT2A 1SGCA 1C4Y2 1C1VH 4GVUA 3V7TA 2OC8A 3TPIZ 1J14A 4CR9A 1V2TT 3O8BA 4FUDA 3A8BA 2FP7B 1GJ7B 1PPZA 1P8VC 3U1IB 1O5EH 2BY9X 3ZYEA 1PPHE 1MCVA 1O2UA 1C1WH 1MTVA 1S85A 3SHAH 1N8OB 3VXFH 1G3BA 3ZVAA 1NFYA 3HPTB 2Y6TA 1SGNE 2PKAA 1QL7A 2ZFFH 2TGAA 4DGJA 2QC2A 1TGCA 3SNEA 2TGTA 3OTJE 1OKXA 4JK5A 1A5HA 1Z1JA 3LGWA
chains in the Genus database with same CATH superfamily
1O31A 4A7IB 1SGYE 3N7OA 1C2IA 1HIAA 4X2XA 1O2XA 4WWYA 1DXWA 1HJ9A 1A0JA 3HK3B 1UTOA 2Q6FA 3PV5A 1GHZA 5C1UA 1H8ED 5T1VA 2DE9A 1GJDB 1UTKA 3M7QA 3NCLA 1TLDA 3RM2H 3MNCA 6ESTA 1SOTA 4JYTA 3BN9A 1GBTA 4K1TA 4XBDA 3UFAA 3LOXA 2ZZUH 1MTNB 1DDJA 1ZLRA 4B6FA 1ZMJA 3LC5A 1DVAH 2ZDVH 4UFEH 4BAOB 4GCHF 1V2NT 2ZHFH 1FY8E 5EOKA 2PFEA 2ZHWH 2JH6D 1BTXA 4WH8A 3ITIA 1ELGA 2ZDLA 3WY8A 2GCTB 1EATA 2Q1JA 4DJZB 2EC9H 4BTIB 1BBRH 2G52A 1BTZA 2ZTYA 3VB6A 4YTAA 1Q2WA 4WY3A 1AU8A 2WPKS 2XBXA 1C5RA 1DANH 1B5GH 5LH8A 1FV9A 1IQHA 1C2JA 1S6FA 3F9FA 1D3TB 4D7FA 1S6HA 3Q76A 2FI3E 1JXPA 1L0ZA 3F2GA 3G01A 1SHYA 3U98H 1AVGH 5LPFA 4U30A 1QL8A 1QCPA 5A09A 1OX1A 1GBBA 4U2WA 2JETB 3PTNA 5DP5A 4AFZA 4F4OC 5J4QA 2J2UA 3Q00A 4AG2A 5F8ZA 3ZZ4A 3BEIB 3A80A 1TPOA 1TWXB 3RXHA 3F0PA 4FUFA 1PQ7A 4NIVA 2FDAA 3MH5A 4YT7H 3EGKH 1FAXA 1P2QA 1MAYA 1Q3XA 2CF9H 3D65E 2H5DA 5EGMA 1H4WA 3BIUH 1UHBB 2WHXA 1EPTB 1FZZA 1YPJH 1Z7KA 2KCAA 1QRXA 2ZDNA 1DXPA 4BXWA 1PPFE 1C5TA 1HPGA 1YP9A 2BY8X 1S84A 1FAKH 4WF8A 4CREA 1YPHE 1W2KH 2QXHA 1UW7A 1V2OT 2THFB 1YBWA 4Y8YA 3SU0A 3U1JB 4X1SU 2ZEBA 1HAOH 5C1YA 1AGJA 2Y7ZA 2VIWA 2EI7A 4NIXA 5EQQA 2YNAA 3S9CA 1BJUA 3L33A 1UJ1A 1MKWK 2BDCA 5DN6D 1MZDA 4GCHG 1SGEE 1XM1A 8ESTE 1WSSH 4I33A 1T8NA 3BIVH 3E0PB 1V2LT 3GYMA 2RA0A 3ESTA 3TJUA 1G36A 3CNRA 1CQQA 3V3MA 1BJVA 1EQ9A 1OSSA 1P12E 1SQOA 3MU5A 3D23A 3A84A 3KYGA 1V2WT 1V2QT 2SNWA 2XWAA 1Y5AT 1F0UA 3TVJB 2BYAX 1CGJE 1O2SA 2BVSH 3NK8A 2OUAA 1WQSA 6CHAC 3B23B 4HFPB 1NROH 1GHWH 4K5ZA 1G30B 1DUEA 3L6PA 1TGSZ 3EAJA 5EIYA 1LO6A 2ANYA 3RXBA 5FCRA 2KCOA 1GDNA 3UB0A 2G4UA 1OWEA 2CHAC 5EW2H 1EZQA 2XBVA 2ZCLP 2TGDA 3RC6A 1YPGH 2BLVA 2UWPA 4GLYA 4AB8A 2XTTB 2XC0A 3FANA 4A1TA 1OPHB 1IQGA 1RFNA 2BY5X 5DSFA 2BOHB 2VB0A 3TK9A 5C2ZA 2Y80A 1O2GH 2FOMB 2AMQA 1ZSLA 1X7AC 2W3IA 4E05H 2W6ID 5F8TA 1DX5M 1SGTA 4XOJA 4MNXA 4BOHA 2VH0A 1THSH 1DY8A 1FDPA 3OY6U 3EA7A 1ARBA 2ALPA 2YMSD 2Y5HA 4Z1MD 5SGAE 5B6OA 1ESAA 1F5LA 3VB3A 2BD3A 3NWUA 3U69H 1DS2E 2O8UA 2TGPZ 2EY4C 2J97A 2QF4A 2ODQA 2QAAA 3OE7D 3HGNA 3FVFB 4INLA 3ZYDA 2A7JA 2A5IA 4IS5A 2XYAA 3R3GB 1W11U 1C5OH 1C1QA 2H9HA 4RN6A 4AOQA 5JBCS 3P70B 2HLCA 3SV7A 4OGYA 2FOBA 1SVPA 2H9EH 2YMSC 2FIRH 1VITF 2JDID 5DP6A 4Z6AH 1EAUA 1WCZA 1G2LA 1ZHPA 3U28C 1MQ5A 2P95A 1GBEA 3GCNA 1V2KT 4GPGA 2FYRA 2ZFPH 1E79D 1AVWA 3LGTA 1DM4B 2AERH 2BDIA 4SGBE 2ESTE 1GJ8B 2HALA 4ZH8A 1YF4A 1TPAE 3UPEA 1ELTA 1P9SA 2OP9A 2JIZD 3S9AA 3RU4D 1P2NA 2FZZA 2QF3A 1J17T 2PP6A 4X8UH 2WUCA 2C8YB 1LHDH 1UCYK 3A88A 1TBRH 1D4PB 2KAIA 3C27B 3OFND 1W0YH 2G8TA 1T8OA 3F9EA 1YPEH 1CT0E 3MU0A 3OSYA 4X6PA 1ETRH 1GCTB 3MH6A 1QRZA 1C2KA 2BVXH 4CBNA 3BTQE 3Q3XA 4FUGA 3ELAH 4ZMAH 1GI1A 2PGQB 1VKYA 1B0FA 1PQ8A 3TJVA 2JJ1D 2QXIA 3F1SB 2CK3D 3FP6E 1UMAH 2F9VA 4JYUH 2W3KA 4IN2A 1J9CH 1EAIA 1OWJA 1ZPCA 3RXAA 7LPRA 4JMYA 4AN7A 3PO1B 5EQRA 4BAHB 1SHHB 2HWLB 3LJJA 4X6OA 5E0GA 1F5RA 2VIPA 1H8HD 5HM9A 1MD7A 1BITA 4BAMB 2JJ2D 2KZ4A 1SGPE 1EB1H 5EU8A 4ZKOU 1KTTB 3SUFA 1FNIA 1XKAC 1VITG 1THRH 1S81A 2FEQH 3VEQB 3GCOA 2ZU3A 4B74A 1EJAA 1TMUH 1LPKB 1WAYB 3QZRA 2H2ZA 2ZHEH 3LIWA 2GX4A 2FOEA 3QWCH 2J34A 1GJ5H 1CSOE 2ODYB 1C2MA 2OC7A 3WW7A 3FP8E 4I31A 1UTQA 2VH6A 3GY4A 2GV7A 3NKKA 4CRDA 1H9IE 1JOUB 1WDIA 3WWFA 6GCHF 1B0EA 1C2DA 2ZF0H 3OX7U 1TIOA 1AVXA 5E8EH 2STBE 3DSOA 4OS1A 3UNRA 3NZIA 1T31A 5HKKD 1TGNA 5C0UA 2SNVA 4NZLA 3RXKA 5HYOA 1MQ6A 3T28A 1Y3UA 2BQWB 2XBWA 1UVPA 1INCA 1AKSA 1BTYA 1K1OA 2Z9GA 2OBQA 5FHTA 2W5EA 4VGCB 4ABJA 3BTGE 1YKTA 2LP6A 2A4QA 1BTPA 2AMDA 3QUMP 2L6OA 1QBOA 4H6TA 4X8SH 1A0LA 2C4FH 5F6MA 4U01A 1OWIA 1CA0C 1QURH 1TX7A 5EJLA 1VZQH 1QTFA 2ZG0H 1GL0E 1PJPA 4RKJB 3E16B 2Z94A 5F8XA 1YY3A 3PWBA 7KMEH 1Q31A 4SGAE 4ZXXH 3SV2H 5AFZH 1RTFB 2O8LA 3RXCA 5IK2D 1NRPH 4TPIZ 1O36A 2B9LA 2PKAB 3A7VA 2XBYA 4TYDA 4X1RU 3A7WA 2ASUB 3GDVA 3A89A 4UFGH 1PPEE 4JCNA 1GHYH 4K60A 1KIGH 1H9HE 3DSGA 4WH6A 5GDSH 1P10A 1GJ4H 1HIAB 1TPSA 1N6YA 1ZRKA 2ZGCA 4WMDA 3GDSA 3F68H 2F91A 4WMEA 1KY9A 4M9FA 1BMNH 4HG6A 1UK4A 4K1SA 1ELCA 3VGCB 3SJ8A 1TYNA 2QE7D 1D6RA 3UWJH 1O2NA 1G37A 5KEDA 4A5TS 3DA9B 1C5WB 2Y5FA 1VCPA 2HRVA 3BG4C 3K9XB 1H8DH 1RRKA 3RXFA 1S0QA 2PUQH 1DWBH 3PRBA 4FXGH 4YOIA 6GCHG 1C1RA 2BX3A 2PV9B 4KTCA 1O32A 3P17H 3ZVCA 3HK6B 2TIOA 5DG6A 1K1PA 5KGOA 1W3CA 1K1JA 4IW4E 1RTLA 3MYWA 1QHRB 2XRCA 2HLDD 2BLQA 1UO6A 1O3NA 5E0JA 2FOHA 3BTKE 1BTHH 3GY6A 3H7OA 2RDLA 2IPHA 3SUGA 1SQRA 1QJ6B 2HOBA 1O2ZA 2ANWA 4OM9A 4BAKB 1XUJA 3F6UH 1D6WA 1KLIH 3M36A 3M3SA 4Y79A 1EASA 2VGCC 5FAHA 1EP5A 1JMOH 5HIYA 1HAIH 1BBRK 1W0ZU 1K28D 3M61U 4MPWA 3M37A 3ZZ6A 3PMJA 2QF5A 1O2HA 1AUJA 4AFSA 3OU0A 4X6NA 4FU7A 1XUIA 1NN6A 1UTMA 2Z9KA 1GJBB 3FAOA 4B6EA 2OC0A 3VB5A 2GMTB 2C8ZB 1GHXH 1O33A 1FIZA 1XKBC 3ZZ5A 5CMXH 2BLOA 3K6YA 1O2PA 2XW9A 2FS9A 3I78A 1OWHA 1T32A 4ZHMU 4K8BA 2WPLS 1W0KD 5EXLA 2JH5D 4MVNA 1HAPH 1C1PA 1J16A 1F5KU 5A8XA 1AE8H 3TU7H 3U8OH 1UK2A 3AAUA 3FKSD 1H9LB 5ESBA 1DWCH 1ZSJA 2FTMA 3MU4A 3PM3A 1ARCA 1CHOF 4F55A 2ZHDA 3SGBE 1BUIA 1CA8B 1VR1H 4DVAU 3F2FA 3SU3A 1ELFA 2HNTF 1C9PA 2VWOA 2J5UA 2O8WA 2V0BA 1COWD 2GD4B 1TMTH 2UUKB 3F3BA 1C2HA 1TE0A 2FS8A 2AHME 5AVDA 1P2KA 1GJAB 1HUTH 4FUJA 1AFQB 1BMLA 2KCPA 2PKSB 3FZDA 4NA9H 2KCYA 1IAUA 1YPKH 4E7RG 5FL7D 4JYVH 1YLCA 1Z8JB 2TPIZ 1EFRD 1N8OC 3FN8A 1O3AA 2J94A 4ABDA 3GOVB 1NU9A 4ZHLU 1GBLA 2AH4X 4B1TA 3QLPH 1GBJA 4KTSA 2Z3CA 2A1DB 2P3FH 5CHAC 3DHKH 4I86A 3AW1A 4FUHA 3CS0A 2UUJB 1XUFA 1C5XB 1C4U2 3AAVA 3M5OA 3SI4H 1OHHD 1KXCA 2FWWA 5CHBA 4DURA 1Y3YA 1CBWC 1NY22 4DY7B 1YWUA 3KEEA 4AYYB 2NU0E 3IITA 1LVYA 1G32B 1G9IE 2RA3A 4OS6A 1Z8GA 2ZU4A 1P2IA 1ANDA 1QJ1B 5DKMA 5JB8S 1D3PB 1UVSH 5EPNA 2QXJA 1TRYA 4AG1A 3EE7A 1QB1A 4CH8B 1Y5UT 2H6MA 1CHOG 3F2HA 2WSSD 3SUEA 2AIPA 9LPRA 4I7YH 1FJSA 1AWFH 1O3JA 2Z7FE 2XCNA 3M5MA 3RM0H 2VBCA 2WPHS 1YCPH 2OINA 1G2MA 1VITH 3EA8A 2J98A 4JZDH 4WXVA 3TNSA 3UAIC 1XVOA 1BQYA 1W14U 4CBOA 3QX5H 5C94A 5EG4A 1HAZB 4HTCH 1TQ0B 5FX6A 1GI4A 4O9VA 3FP7E 1TNIA 2GVFA 4O97A 3TJOA 2BOKA 3MNSA 1F2SE 3SJIA 1Z8RA 2BXUH 1UCYE 3NUMA 5GNDA 1O3FA 1DSUA 2C93B 1LQDB 3QGJA 1YGCH 2VU8E 3ODDA 3SNCA 1K1NA 4Y8ZA 1TB6H 1CVWH 1BIOA 1OP8A 2SFAA 2TBSA 1C5ZB 3M7TA 3N99A 2KAIB 1P0SH 1IHSH 1BMFD 1N6XA 1WOFA 3MH7A 1JRSA 4AORA 2F9UA 1AWHB 1HXFH 3TK6A 5A8YA 2F9BH 1QIXB 2EI8A 3KIDU 3PYHA 2GT8A 2BY6X 3T5FH 3QTVH 5L30H 1GBHA 2DE8A 2BDAA 3KQ5A 1EZSC 2ZHQH 3P6ZB 2FO9A 1W7GH 1KLTA 1W8BH 4JZEH 4DOQA 3SQEE 3GCHB 2ZI2H 3GDUA 2KX4A 2WPJS 1V6DA 1YPLH 1PFXC 3EDXB 4NIWA 2FESH 3UOUA 3MWIU 5EW1H 3KQCA 1THPB 2XNIA 5L2ZH 1O3KA 8GCHF 2V3MA 3PLKA 3DT0H 1LPGB 1TBZH 2Y5GA 1ZTLA 5IYTA 4AYVB 1V2UT 5ABWA 1SQAA 1SB1H 1UVTH 1E34B 4KELA 1PYTD 2VIVA 3SO3A 3OAAD 2GZ8A 5GIBA 4CHAC 2ZPRA 2SGEE 3KF2A 1ZSKA 2ANMH 1GBAA 2R3UA 1K9OE 1ZPZA 2UUFB 1FI8A 3SU4A 1HJ8A 2DUCA 2V3OH 1L1JA 4O3UA 3SU6A 1XUGA 2FOGA 3M5LA 2ZO3H 3MHWU 2J9NA 1C1MA 2BD9A 4TY7A 2A4OA 4FUIA 3Q3YA 4Y0YE 3GCTF 4A1VA 2BDYA 4YZUA 4UDWH 1PYTC 2ZGBH 1FIWA 2OBOA 3AW0A 2F43B 3H7TA 3I29A 3UWIA 5DP4A 5CDFE 1LKAA 5A2MH 3GY5A 2QIQA 2BY7X 1HCGA 3UREA 1TNGA 1NT1A 1TOCB 1H1BA 2WPDD 4YESB 3RXLA 3RXGA 1JIMA 1YPHC 4IC5A 2VWMA 3SV9A 1SFQB 1AKSB 1ZTJA 4IC6A 2A4GA 1AD8H 2AYWA 3A7TA 1Y8TA 2LELA 4AGJA 1LHFH 1RJXB 3ZVBA 3KQBA 3ZVFA 1CGIE 3FOAA 2D2DA 1KTSB 1GMCF 4Y10E 1EB2A 5DP9A 1VGCC 6CHAB 1P04A 1SMFE 2ZA5A 2GCHF 1AE5A 2AMPA 1QA0A 1IHTH 4Y7BA 4ABIA 3ATIA 3URCA 2I6QA 3PROA 1A3EH 1NBME 1VCQA 4MPUA 4GSOA 8GCHG 1A7SA 1MAXA 2XCFA 3EE0B 3SZEA 3CP7A 1SL3A 1AB9C 2CHAB 1CT4E 3RXTA 3LH3A 1IQIA 1KXDA 1L4ZA 2BX4A 4ISLA 1P05A 1AY6H 2VIDA 2AFQB 1V2VT 4ISHH 4I8LA 3RLYH 3P8GA 4YOGA 1A46H 2WUBA 2OC1A 3UR9A 5C17A 4NFEA 1UTPA 1O2YA 1RGQA 2ZGXH 4NGAH 4FVDA 3SU2A 2Y7XA 3RLWH 6LPRA 5GWZA 1U6QA 3B9FH 5AFYH 1O3LA 5DK1A 1ZOMA 4FU8A 1GCTC 3GCTG 1IQMA 1C5VA 4UE7H 1BRBE 3MI4A 4Y7AA 1BMAA 3ZV8A 1RS0A 1F0TA 4LZ4B 2UUYA 1FMGA 3SJOA 2GV6A 4YM9A 2G51A 3ODFA 1EX3A 1OYTH 2NU3E 1B7XB 1RTKA 2GJGA 1K1MA 4UONA 5B6LA 3S7KB 1NFUA 4Q2KA 2CMYA 4Y6DA 3BTEE 3SNAA 1W13U 5DPAA 2OTVA 1YC0A 3MMGA 4HI3A 3VB7A 3A7YA 3GICB 1BBRE 3LKWA 4WJG2 2Q6GA 3ATWA 5J4SA 2H1UA 3V0XA 4B75A 1SGIB 2D26C 5DP7A 4Y76A 3A81A 1GMCG 1JRTA 1O3GA 3V12A 3T27A 1DE7H 4NSYA 3VFEA 1BRCE 2GCHG 1ZR0A 2FI5E 1CU1A 4ZROA 1F0SA 4D76A 3KGPA 4CRBA 1LQEA 1OXGA 5EXNA 2W6JD 2R0KA 3LU9B 3LJOA 3M5NA 2PTCE 1BCUH 3PMHB 3DCLA 1ELAA 5C67A 4DT7B 3ATMA 1QRWA 1HAVB 1BOQA 3OY5U 5FPSA 4ABAA 2K8IA 1TX6A 2EI6A 4BXSA 1AHTH 2BB4A 3MQKC 2W7SA 1Y3XA 2NWNA 3VG8A 1NESE 5JBBS 4Q7XA 1LDTT 2Z9IA 3SYJA 4LOYH 1V2PT 2P8OC 2YNBA 2IOTA 4ASUD 2LNCA 1GBIA 2WPMS 3HGPA 3W94A 4XBBA 1BMMH 1GBCA 3GYLB 2J95A 4MLFB 2A45B 1GG6C 4D9RA 5E0HA 4ZKNU 3S69A 1GBKA 5JBTA 1O5DH 3A7XA 4FETA 4D9QA 1O2TA 4P00A 1HYLA 2PTNA 4NCYA 2AS9A 2XOKD 2R3YA 3NPSA 3SN8A 2FLBH 1C2GA 2PSXA 3ZZ8A 4RKOB 1A5GH 1MBMA 1NTPA 5DJ7A 1AMHA 1ELDE 3AVZA 1E0FD 4XSKU 1VJ9U 4RI0A 3O8RA 2WYJA 1EJMA 3E0NB 4ABFA 2GT7A 2A4RA 4NA8A 4I32A 1QR3E 5T6GA 1AQ7A 3RMNH 1E37B 5FPTA 1GMDF 1SGFA 2ZP0H 2BDHA 1AZZA 1HJAB 2Z3DA 3RMMH 1K2I1 3IG6B 1NRRH 4FUBA 4OS5A 2GZ9A 1DY9A 4BTTB 3PRDA 4XDEA 3VGCC 2BD5A 8LPRA 1YYY1 1N1LA 2XC5A 1T4UH 3H5CB 2Q6DA 2O9QA 1P57B 3BEUA 4K1EA 2Y81A 1O5BB 4X6MA 1A0HB 1DUAA 1FUJA 3P92A 4H6SB 2ZDAH 1LVBA 9ESTA 1AIXH 4P02A 4RSPA 4MNVA 4X8TH 1TPPA 3S7HB 3ZVDA 2SGPE 1EUFA 1C4V2 1E36B 1S5SA 1GGDB 5TCCA 3V13A 1KDQA 3MO6A 4YLQH 2F9PA 3D62A 4X2YA 4KKDA 4WVPE 2BD8A 4ISNA 1OS8A 1HAHH 4MPXA 4X1NU 5EODA 1HRTH 3ZV9A 2PHBA 4R0IA 4CH2B 1O2JA 3A7ZA 3SJ9A 1DWDH 1K1IA 2J98B 3BV9B 1QGFA 1EKBB 1G3EA 2SGAA 5T3HA 1TMBH 3PB1E 3T26A 4Y0ZE 1YCPM 3HKIB 1A61H 1QNJA 1W0JD 4PROA 3TGJE 1FN8A 2V35A 1GDQA 1MKXH 2WPIS 2BLWA 3PV4A 4DIIH 2C90B 1QJ7B 2HVXA 4ABBA 5C0TA 2FOFA 3F9HA 4CRAA 2IPQX 2D8WA 1KLJH 1YCPK 4MQAA 2J4IA 1NS3A 5IDKA 1TONA 5AF9H 1YLNA 4A1XA 2QY0B 1K1LA 1NFXA 1C5YB 3ENSB 1LPZB 1O3PB 1AFEH 1RIWB 1PPCE 1GMDG 2Z9JA 2Y82A 3BG4B 4E06H 1AN1E 1GVKB 2AGGX 1W10U 2ZKSA 1F7ZA 3A85A 3QTOH 1KXFA 4JK6A 1QL9A 1SOZA 1IQLA 2RG3A 1MH0A 3FO8D 2OXSA 4XRNA 4YT6H 4Q7YA 1HAVA 1MTSA 2ZQ1A 1CT2E 1TA2A 4R8TB 4CRGA 4DIHH 4NIYA 2G00A 3I77A 2F9OA 5FBEA 5I25A 3PWCA 4CR5A 3STIA 3KQEA 3M7UA 1NO9H 3BTWE 4IGDA 4B2AA 1ORFA 2BXTH 4FUCA 3HATH 1NC6A 1LTOA 3UIRA 7ESTE 2G4TA 4MG3A 5L2YH 3W95A 2VVCA 2VIOA 2ZGHA 3A8DA 4ZKRU 1P02A 4LZ1H 3TK5A 3ZZDA 1LVMA 1KSNA 1PQAA 1HGTH 5C3NA 1YLDA 3SV6A 2XNDD 1TFXA 4ZCNA 2ZCHP 1NU7B 2FTLE 4I8JA 3UUZA 3RU4T 5K0HA 2ZPSA 2ZTZA 1P03A 2ILNA 4M7GA 1C5PA 1LHCH 3RXDA 1O3OA 2G55A 3MU8A 2F3CE 2GDDA 1GHBF 3BG8A 5K7RA 4OGXA 1SGQE 4INKA 1BHXB 1L1NA 1GI3A 5F53A 3TLOA 1DLKB 1O2QA 3A8CA 5BRRE 1WQVH 1SFIA 2P59A 3O8DA 5DP3A 1K22H 4MNWA 4RT0A 4X1QU 2ZFRH 4ZAEA 3DFJA 4B2BA 1CGHA 7GCHF 1DPOA 1QQ4A 1C5NH 3LGYA 4NZQA 3NRLA 3KL6A 4Z0KA 3K2UA 3PMBB 3F9GA 1MCTA 2VINA 2PWXA 2J92A 4UEHH 1GVZA 1UTJA 2QXGA 1ZYOA 1MUEB 4NSVA 1SSXA 1T7CA 2HPPH 3LC3A 2RFKC 3FFGA 1MTNC 1GHAF 1TABE 2IN2A 2ULLA 1C2LA 3RXIA 4AGKA 3ZZ3A 3GISB 2V7QD 3BTHE 1C5UA 1C5MD 2HNTC 1ESTA 3MNXA 1DOJA 4H4FA 1EAXA 1GI5A 1SG8B 2OQUA 3ZZ9A 2KM0A 2A0QB 1K21H 4IN1A 4KTUA 1KXAA 1G3CA 3N7EA 1O2MA 2XWBI 4YOJA 3BF6H 2GCTC 2B7DH 5FBIA 1ZZZA 4FVBA 4OS2A 3P8FA 1TALA 4FU9A 1IQFA 1EZUC 2R2WU 5CHAB 3RMOH 1BDAA 5C5OA 3RXSA 1NRNH 2ZU5A 3SV8A 2GP9B 2BTCE 2ZECA 1EZXC 2F9NA 2L74A 1WTGH 2G5VA 2QF0A 1O3CA 1OOKB 1XVMA 3FZZA 3SGQE 5ETXA 1CBWB 2JETC 2F83A 2VJ1A 3AASA 2ZWLH 4I8HA 1GJCB 3LGIA 1GHBG 2G5NA 4J1YA 1O2OA 3BEFB 1UTNA 1FQ3A 2QA9E 1O39A 1A1RA 3S0NA 4Y11E 3UQVA 3RXPA 1DSTA 3MFJA 4E7NA 1IQNA 2WV9A 1EPTC 3VB4A 1C2EA 2D1JA 5PTPA 5TJXA 4B71A 1GI9B 3ATLA 4NWKA 3GCHC 2IJOB 2NU2E 2FXRA 2ZU2A 2M2AA 1E35B 3UQOA 7GCHG 4XD7D 1ZPBA 2BDGA 2EEKA 2OCVB 4OS4A 3BSQA 2M5TA 1L2EA 1XUKA 2FLRH 4ZXYH 2LPRA 5GJ4B 2O8MA 4X2VA 3QDZB 4K69A 2W26A 3M3TA 2BDBA 4O03A 1GHVH 5HM2A 1ETSH 1PQ5A 3UNSA 5C20A 2WV5A 4ESTE 1HXEH 4YO9A 1WYKA 4BANB 3AK5A 2ZCKP 2P93A 1GHAG 1GPZA 2FX4A 2WV4A 3LPRA 4ACBA 4Y8XA 1ZRBA 3URDA 5GCHF 2PW8H 1C2FA 4TT3D 2ZDKA 1S6LA 1D3QB 1ZJDA 3MNBA 4JZ1A 1QY6A 3JZ2B 3A82A 3RXUA 3SNDA 5JB9S 1T8MA 1SLWB 3PLPA 4ABEA 1P09A 1QA7A 1V2ST 2FMJA 2Z9LA 1GDUA 2QV1A 2C8WB 3T29A 5T6FA 2H5CA 4TWWA 2WYGA 3RXQA 2K1QA 1XXDA 4ZKSU 2C8XB 1C9TA 1ELVA 1HV7A 1O2IA 2VWNA 4TSFD 1ZMLA 4RT1A 3M35A 2CJIA 1E1QD 2VNTA 1A2CH 1XXFA 1YM0A 2VVVA 1TX8A 1S82A 2PR3A 4Q63A 2B8OH 4KP0A 4FOUC 2FODA 5FCKA 1C1UH 1JWTA 2RCEA 3SOSA 1XMNB 3A86A 3EYDA 1ANCA 5DO4H 3LONA 3OEED 1BB0B 5BPEA 4X2WA 5DGJA 4HZHA 1A4WH 1C1SA 2QGRA 4AFUA 2BQ7B 4CHAB 2ZU1A 2FI4E 5KECA 3OTPA 4D7GA 2SGQE 1Z6EA 2BZAA 3RXJA 3UNQA 1HFDA 2Z3EA 1H8IH 2ZQ2A 1SR5C 3RXOA 1W7XH 3KQDA 1C1TA 1WTHD 5GXPA 3GS9A 3E1XB 4GHQA 1ELBA 3MU1A 3F0OA 3M3VA 4ASHA 1Y59T 1QQUA 1UVUH 1O0DH 1ZJKA 1O34A 4AC9A 3EQ0H 1GWAA 3QN7A 5FXLA 1SGFG 2GZ7A 3OYPA 5GCHG 2G81E 3KYFA 1BTWA 1NFWA 5FX5A 4NA7A 1GJ6A 4XE4A 1SGRE 3H09A 2QCYA 2A32A 4A6LA 4F48B 5G4BA 4MTBA 1FXYA 1ID5H 1O2RA 5TCAA 2QN5T 1T8LA 1E1RD 2ANKH 1PPGE 3PLBA 5AHGH 1A5IA 1TNKA 3BTTE 1O3BA 2GTBA 5L6NH 3KNXA 1FY1A 1O3EA 1J15A 4IBLH 5EJZA 1ZMNA 2IJD1 4NWLA 2PUXB 3ZZBA 1IQEA 1ANBA 4IMQA 1OYQA 3BTFE 3DFLA 3SGAE 2OD3B 3O8CA 4UFDH 4UD9H 2STAE 1BRAA 4K2YA 3SUDA 5CE1A 1KDQB 1VGCB 1IQKA 1EOLA 1NBMD 4WXIA 1KMHB 1O2KA 2V6NA 3RU4E 4U32A 3ZVEA 1QBNA 2A5KA 2BQ6B 4B76A 2NU1E 5A0AE 2ODPA 2BD7A 3T62A 1O37A 3SZNA 4NG9H 4MNYA 2ZFSA 3MO3A 3RP2A 5A0BA 2BZ6H 2SGFE 4Q4LA 4DG4A 3VXEH 1EXFA 1AI8H 1P2MA 1AB9B 1FPHH 2WZQA 1CE5A 1NRQH 1D3DB 3TH3H 1LVOA 1WXRA 3TJNA 1J8AA 1WBGB 3QZQA 3TH2H 4Q80A 2BD4A 2ZGJA 2ZPQA 3RXVA 1FLEE 1Z8IB 8KME2 4A92A 4GAWA 1HNEE 2BM2A 2FYQA 5EXMA 2YMSB 1O2VA 3PTBA 1BRUP 3WWBA 3PO1C 2OK5A 1QBVH 4OS7A 4ZHAA 2RDEA 1GBFA 4CRCA 2FPZA 2W7UA 3RC4A 2J38A 1MKXK 5T6DA 3A87A 1O2LA 1MU6B 3SU5A 1OP0A 1S0RA 1UHBA 3TGKE 1TNJA 3RXRA 1EPTA 1NM6A 2GGVB 1MABB 1XUHA 2BMGB 4CRFA 4YLUA 1Z1IA 1HB0B 3Q77A 1MKWH 5LGOA 2ZC9H 3K6ZA 1C5LH 1TNHA 4F49A 1ZTKA 5E2OA 2VVUA 4KGAA 4BTUB 3MTYA 1MTUA 2A31A 1EOJA 1KXEA 2KR7A 5F03A 1EJNA 2YOLA 2XC4A 2PGBB 5ESTE 2Z6BD 2CF8H 3TITA 1WU1A 2P3TB 4XBCA 2GDEH 1V2RT 5A0CA 1GI7B 1BT7A 3Q3KA 1LCYA 1EP6A 1GI0A 1SLVB 4IMZA 3ZZCA 1P3EA 3T2NA 1UK3A 2CV3A 4YXWD 2HVYB 5LPRA 1O5AB 2ZDMA 1HDTH 1NRSH 4DW2U 3KCGH 4VGCC 3UY9A 2TRMA 1TGBA 1TA6A 1DWEH 2OQ5A 1Y5BT 1SKYE 5HIZA 1SGDE 1YPMH 2R9PA 1T4VH 3SNBA 1O35A 4I8GA 3RXEA 1G3DA 2B0FA 2A5AA 1KYNA 4H42U 3SORA 4K3JA 1Z71A 2I6SA 4LXBH 1TRMA 1ABJH 1PPBH 1HJAC 3CS7A 3S9BA 1AZ8A 1C5QA 2P3UB 4UFFH 3BTME 2A2XH 1SI5H 1WUNH 2ZFTA 3LDXH 1V3XA 4THNH 3SJKA 4BAQB 1ETTH 3GY8A 5JPMH 1LKBA 1A3BH 1GBMA 5EJ1A 3P8OA 2AEIH 1O3DA 3DD2H 5DP8A 2PLXA 4O3TA 3PMAB 2P8OB 3ZZAA 1DFPA 1HLTH 2EA3A 1NPMA 4QT8C 5H4IB 5JDUB 4ISOA 3E91A 4AX9H 3DUXH 3BTDE 3GY2A 1P01A 2ZIQH 1SLXB 3N7DA 2A7CA 1GG6B 1ZGVA 2BHGA 5FPYA 3DSPA 1P2OA 4ISIH 1AUTC 1GGDC 4B2CA 1FY4A 1CHGA 1O3MA 2SGDE 1VCWA 3SQHE 3C1KA 2UWOA 1TOMH 3LT3A 3A8AA 1D9IA 1GMHF 1SBWA 1RD3B 5C1XA 1F92A 3SBKA 1ELEE 1LMWB 1GI8B 2B5TB 1LHGH 1CA0B 1OWKA 2P16A 3RMLH 1CO7E 4LK4A 2KFWA 4NFFA 4DCDA 3QK1A 4K8YA 1DITH 3RUOA 3LH1A 4ABGA 2FOAA 1JBUH 1UCYH 3SU1A 1C5SA 1MBQA 2ALVA 1GL1A 1F0RA 1P06A 1C1NA 3L3TA 3KN2A 1O5CB 1RIWC 5HXFA 1KXBA 5A8ZA 2C3SA 1SLUB 3ZZ7A 1BTUA 5C5NA 2V3HH 1TBQH 1UTLM 2QYIA 1OWDA 1ABIH 4DT4A 3SHCH 2K0QA 1O2WA 5EQSA 1BHXF 2O8TA 3K65B 4JZIA 3A83A 4AFQA 1GI6A 1M9UA 3U8TH 1HAYB 1O30A 1SQTA 3SI3H 3EA9A 1GBDA 3W1EA 5EPYA 2ZFQH 2GMTC 4FUEA 3VPKA 1P9UA 4TY6A 3TNTA 4MPVA 1RXPA 3JZ1B 2HGTH 4B73A 5GPIB 3TGIE 2OLGA 3B8JA 3E8LA 1ZHRA 3T25A 1TRNA 5JYIA 3NXPA 3P8NA 4TWYA 5LPEA 1ANEA 3SW2B 3R0FA 3TH4H 1BZXE 2ZNKH 3KHVA 1MD8A 1ESBA 3STJA 1IQJA 4D8NA 1L1GA 2FM2A 3OEHD 4Y71A 2WINI 1TGTA 3UR6A 3P95A 4X1PU 1GVLA 4ACAA 1TAWA 2AGEX 4GHTA 3E90B 1HAGE 4HGCA 1TNLA 1O3IA 1XX9A 1SPJA 2H9TH 1GMHG 1O5FH 2BD2A 4X0WU 1MTWA 3IWMA 2CGAA 1P3CA 3D49H 4XFQA 2GKVE 3U8RH 2FX6A 2JKHA 1L4DA 2FOCA 1C1OA 2VGCB 3GY7A 1Y3WA 1DLEA 1AFQC 5I46H 2PKSC 1GJ9B 2CXVA 1V2JT 1IOEA 1TQ7B 1P2JA 3U9AH 1O3HA 1WV7H 1P11E 1HBTH 4ABHA 2NU4E 1LHEH 1JIRA 1MZAA 1FY3A 4ZUHA 3E6PH 3UTUH 2AGIX 1MMJN 1FY5A 4X8VH 2A7HA 3LGVA 2F4LA 4J2YB 1FX0B 4JZFH 5HMAA 3RXMA 4MDSA 3ZIAD 1Y3VA 4WMFA 4BNRA 1AO5A 1V2MT 2AIQA 5HGGA 3LGUA 3MOCA 3UOPA 2A2QH 5JBAS 1VJAU 1W12U 1FN6A 3RC5A 3QO6A 3E3TA 1O38A 2CN0H 1ZHMA 3QGNB 1GI2A 3HKJB 2HNTE 1Z6JH 4GUXA 1EAWA 2VWLA 3PV2A 2ZTXA 1HAXB 1E38B 3MH4A 2VIQA 2HPQH 2UWLA 4I8KA 1OP2A 4AB9A 3CENA 1QFKH 4AZ2B 1FONA 1O5GH 5E2PA 1K0HA 1ACBE 3GY3A 1QB6A 3MO9A 1QB9A 3RDZA 2R0LA 1UVOA 2BVRH 4INHA 2JH0D 2R2MB 1SC8U 3ATKA 1S83A 3ZVGA 2PSYA 1DICA 1MU8B 1GCDA 2P94A 3TIUA 1NZQH 1ZGIA 2XXLA 4TPYA 1BA8B 1FPCH 4Q7ZA 1DT2A 1SGCA 1C4Y2 1C1VH 4GVUA 3V7TA 2OC8A 3TPIZ 1J14A 4CR9A 1V2TT 3O8BA 4FUDA 3A8BA 2FP7B 1GJ7B 1PPZA 1P8VC 3U1IB 1O5EH 2BY9X 3ZYEA 1PPHE 1MCVA 1O2UA 1C1WH 1MTVA 1S85A 3SHAH 2EQNA 1N8OB 3VXFH 1G3BA 3ZVAA 1NFYA 3HPTB 2Y6TA 1QZ8A 1SGNE 2PKAA 1QL7A 2ZFFH 2TGAA 4DGJA 2QC2A 1TGCA 3SNEA 2TGTA 3OTJE 1OKXA 4JK5A 1A5HA 1Z1JA 3LGWA
chains in the Genus database with same CATH topology
1O31A 4A7IB 1SGYE 3N7OA 1C2IA 1HIAA 4X2XA 1O2XA 4WWYA 1DXWA 1HJ9A 1A0JA 3HK3B 1UTOA 2Q6FA 1GHZA 5C1UA 2DE9A 1GJDB 1UTKA 3M7QA 3NCLA 1TLDA 3RM2H 3MNCA 6ESTA 1SOTA 4JYTA 3BN9A 1GBTA 4K1TA 4XBDA 3UFAA 3LOXA 2ZZUH 1MTNB 1DDJA 1ZLRA 1ZMJA 3LC5A 1DVAH 2ZDVH 4UFEH 4BAOB 4GCHF 1V2NT 2ZHFH 1FY8E 5EOKA 2PFEA 2ZHWH 2JH6D 1BTXA 4WH8A 3ITIA 1ELGA 2ZDLA 3WY8A 2GCTB 1EATA 2Q1JA 4DJZB 2EC9H 4BTIB 1BBRH 2G52A 1BTZA 2ZTYA 3VB6A 4YTAA 1Q2WA 4WY3A 1AU8A 2WPKS 2XBXA 1C5RA 1DANH 1B5GH 5LH8A 1FV9A 1IQHA 1C2JA 1S6FA 3F9FA 1D3TB 4D7FA 1S6HA 3Q76A 2FI3E 1JXPA 1L0ZA 3G01A 1SHYA 3U98H 1AVGH 5LPFA 4U30A 1QL8A 1QCPA 5A09A 1OX1A 1GBBA 4U2WA 2JETB 3PTNA 5DP5A 4AFZA 4F4OC 5J4QA 2J2UA 3Q00A 4AG2A 5F8ZA 3ZZ4A 3BEIB 3A80A 1TPOA 1TWXB 3RXHA 4FUFA 1PQ7A 4NIVA 2FDAA 3MH5A 4YT7H 3EGKH 1FAXA 1P2QA 1MAYA 1Q3XA 2CF9H 3D65E 2H5DA 5EGMA 1H4WA 3BIUH 1UHBB 1EPTB 1FZZA 1YPJH 1Z7KA 1QRXA 2ZDNA 1DXPA 4BXWA 1PPFE 1C5TA 1HPGA 1YP9A 2BY8X 1S84A 1FAKH 4WF8A 4CREA 1YPHE 1W2KH 2QXHA 1V2OT 2THFB 1YBWA 4Y8YA 3SU0A 3U1JB 4X1SU 2ZEBA 1HAOH 5C1YA 1AGJA 2Y7ZA 2VIWA 2EI7A 4NIXA 5EQQA 2YNAA 3S9CA 1BJUA 3L33A 1UJ1A 1MKWK 2BDCA 1MZDA 4GCHG 1SGEE 1XM1A 8ESTE 1WSSH 4I33A 1T8NA 3BIVH 3E0PB 1V2LT 3GYMA 2RA0A 3ESTA 3TJUA 1G36A 1CQQA 3V3MA 1BJVA 1EQ9A 1OSSA 1P12E 1SQOA 3MU5A 3D23A 3A84A 1V2WT 1V2QT 2SNWA 2XWAA 1Y5AT 1F0UA 3TVJB 2BYAX 1CGJE 1O2SA 2BVSH 3NK8A 2OUAA 1WQSA 6CHAC 3B23B 4HFPB 1NROH 1GHWH 4K5ZA 1G30B 1DUEA 3L6PA 1TGSZ 3EAJA 1LO6A 2ANYA 3RXBA 5FCRA 1GDNA 2G4UA 1OWEA 2CHAC 5EW2H 1EZQA 2XBVA 2ZCLP 2TGDA 3RC6A 1YPGH 2BLVA 2UWPA 4GLYA 4AB8A 2XTTB 2XC0A 3FANA 4A1TA 1OPHB 1IQGA 1RFNA 2BY5X 3TK9A 2BOHB 2VB0A 5C2ZA 2Y80A 1O2GH 2FOMB 2AMQA 1ZSLA 1X7AC 2W3IA 4E05H 5F8TA 1DX5M 1SGTA 4XOJA 4MNXA 4BOHA 2VH0A 1THSH 1DY8A 1FDPA 3OY6U 3EA7A 1ARBA 2ALPA 2Y5HA 5SGAE 5B6OA 1ESAA 1F5LA 3VB3A 2BD3A 3NWUA 3U69H 1DS2E 2O8UA 2TGPZ 2ODQA 2QAAA 3HGNA 3FVFB 4INLA 3ZYDA 2A7JA 2A5IA 4IS5A 2XYAA 3R3GB 1W11U 1C5OH 1C1QA 2H9HA 4RN6A 4AOQA 5JBCS 3P70B 2HLCA 3SV7A 4OGYA 2FOBA 1SVPA 2H9EH 2FIRH 1VITF 5DP6A 4Z6AH 1EAUA 1WCZA 1G2LA 1ZHPA 1MQ5A 2P95A 1GBEA 3GCNA 1V2KT 4GPGA 2FYRA 2ZFPH 1AVWA 3LGTA 1DM4B 2AERH 2BDIA 4SGBE 2ESTE 1GJ8B 2HALA 4ZH8A 1YF4A 1TPAE 3UPEA 1ELTA 1P9SA 2OP9A 3S9AA 3RU4D 1P2NA 2FZZA 2QF3A 1J17T 4X8UH 2WUCA 2C8YB 1LHDH 1UCYK 3A88A 1TBRH 1D4PB 2KAIA 3C27B 1W0YH 2G8TA 1T8OA 3F9EA 1YPEH 1CT0E 3MU0A 3OSYA 4X6PA 1ETRH 1GCTB 3MH6A 1QRZA 1C2KA 2BVXH 4CBNA 3BTQE 3Q3XA 4FUGA 3ELAH 4ZMAH 1GI1A 2PGQB 1B0FA 1PQ8A 3TJVA 2QXIA 3F1SB 3FP6E 1UMAH 2F9VA 4JYUH 2W3KA 4IN2A 1J9CH 1EAIA 1OWJA 1ZPCA 3RXAA 7LPRA 4JMYA 4AN7A 3PO1B 5EQRA 4BAHB 1SHHB 2HWLB 3LJJA 4X6OA 5E0GA 1F5RA 2VIPA 5HM9A 1MD7A 1BITA 4BAMB 5EU8A 1SGPE 1EB1H 4ZKOU 1KTTB 3SUFA 1FNIA 1XKAC 1VITG 1THRH 1S81A 2FEQH 3VEQB 3GCOA 2ZU3A 4B74A 1EJAA 1TMUH 1LPKB 1WAYB 3QZRA 2H2ZA 2ZHEH 3LIWA 2GX4A 2FOEA 3QWCH 2J34A 2ODYB 1GJ5H 1CSOE 1C2MA 2OC7A 3FP8E 4I31A 1UTQA 2VH6A 3GY4A 2GV7A 3NKKA 4CRDA 1H9IE 1JOUB 6GCHF 1B0EA 1C2DA 2ZF0H 3OX7U 1TIOA 1AVXA 5E8EH 2STBE 4OS1A 3UNRA 3NZIA 1T31A 1TGNA 2SNVA 4NZLA 3RXKA 5HYOA 1MQ6A 3T28A 1Y3UA 2BQWB 2XBWA 1UVPA 1INCA 1AKSA 1BTYA 1K1OA 2Z9GA 2OBQA 5FHTA 2W5EA 4VGCB 4ABJA 3BTGE 1YKTA 2A4QA 1BTPA 2AMDA 3QUMP 1QBOA 4H6TA 4X8SH 1A0LA 2C4FH 5F6MA 4U01A 1OWIA 1CA0C 1QURH 1TX7A 1VZQH 1QTFA 2ZG0H 1GL0E 1PJPA 4RKJB 3E16B 2Z94A 5F8XA 3PWBA 7KMEH 1Q31A 4SGAE 4ZXXH 3SV2H 5AFZH 1RTFB 2O8LA 3RXCA 1NRPH 4TPIZ 1O36A 2B9LA 2PKAB 3A7VA 2XBYA 4TYDA 4X1RU 3A7WA 2ASUB 3GDVA 3A89A 4UFGH 1PPEE 4JCNA 1GHYH 4K60A 1KIGH 1H9HE 4WH6A 5GDSH 1P10A 1GJ4H 1HIAB 1TPSA 1N6YA 1ZRKA 2ZGCA 4WMDA 3GDSA 3F68H 2F91A 4WMEA 1KY9A 1BMNH 1UK4A 4K1SA 1ELCA 3VGCB 3SJ8A 1TYNA 1D6RA 3UWJH 1O2NA 1G37A 4A5TS 3DA9B 1C5WB 2Y5FA 1VCPA 2HRVA 3BG4C 3K9XB 1H8DH 1RRKA 3RXFA 1S0QA 2PUQH 1DWBH 4FXGH 4YOIA 6GCHG 1C1RA 2BX3A 2PV9B 4KTCA 1O32A 3P17H 3ZVCA 3HK6B 2TIOA 5DG6A 1K1PA 1W3CA 1K1JA 4IW4E 1RTLA 3MYWA 1QHRB 2XRCA 2BLQA 1UO6A 1O3NA 5E0JA 2FOHA 3BTKE 1BTHH 3GY6A 3H7OA 2RDLA 2IPHA 3SUGA 1QJ6B 2HOBA 1O2ZA 2ANWA 4BAKB 1XUJA 3F6UH 1D6WA 1KLIH 3M36A 3M3SA 4Y79A 1EASA 2VGCC 5FAHA 1EP5A 1JMOH 1HAIH 1BBRK 1W0ZU 1K28D 3M61U 4MPWA 3M37A 3ZZ6A 3PMJA 1O2HA 1AUJA 4AFSA 3OU0A 4X6NA 4FU7A 1XUIA 1NN6A 1UTMA 2Z9KA 1GJBB 3FAOA 2OC0A 3VB5A 2GMTB 2C8ZB 1GHXH 1O33A 1FIZA 1XKBC 3ZZ5A 5CMXH 2BLOA 3K6YA 1O2PA 2XW9A 2FS9A 3I78A 1OWHA 1T32A 4ZHMU 4K8BA 2WPLS 5EXLA 2JH5D 4MVNA 1HAPH 1C1PA 1J16A 1F5KU 5A8XA 1AE8H 3TU7H 3U8OH 1UK2A 3AAUA 1H9LB 5ESBA 1DWCH 1ZSJA 2FTMA 3MU4A 3PM3A 1ARCA 1CHOF 2ZHDA 3SGBE 1BUIA 1CA8B 1VR1H 4DVAU 3SU3A 1ELFA 2HNTF 1C9PA 2VWOA 2O8WA 2V0BA 2GD4B 1TMTH 2UUKB 1C2HA 1TE0A 2FS8A 5AVDA 1P2KA 1GJAB 1HUTH 4FUJA 1AFQB 1BMLA 2PKSB 3FZDA 4NA9H 1IAUA 1YPKH 4E7RG 4JYVH 1YLCA 1Z8JB 2TPIZ 1N8OC 1O3AA 2J94A 4ABDA 3GOVB 1NU9A 4ZHLU 1GBLA 2AH4X 4B1TA 3QLPH 1GBJA 4KTSA 2Z3CA 2A1DB 2P3FH 5CHAC 3DHKH 3AW1A 4FUHA 3CS0A 2UUJB 1XUFA 1C5XB 1C4U2 3AAVA 3M5OA 3SI4H 1KXCA 2FWWA 4DURA 1Y3YA 1CBWC 1NY22 4DY7B 3KEEA 4AYYB 2NU0E 3IITA 1LVYA 1G32B 1G9IE 2RA3A 4OS6A 1Z8GA 2ZU4A 1P2IA 1ANDA 1QJ1B 5DKMA 5JB8S 1D3PB 1UVSH 5EPNA 2QXJA 1TRYA 4AG1A 1QB1A 4CH8B 1Y5UT 2H6MA 1CHOG 3SUEA 2AIPA 9LPRA 4I7YH 1FJSA 1AWFH 1O3JA 2Z7FE 2XCNA 3M5MA 3RM0H 2WPHS 1YCPH 2OINA 1G2MA 1VITH 3EA8A 4JZDH 4WXVA 3TNSA 1XVOA 1BQYA 1W14U 4CBOA 3QX5H 5EG4A 1HAZB 4HTCH 1TQ0B 5FX6A 1GI4A 4O9VA 3FP7E 1TNIA 2GVFA 4O97A 3TJOA 2BOKA 3MNSA 1F2SE 3SJIA 1Z8RA 2BXUH 1UCYE 3NUMA 1O3FA 1DSUA 2C93B 1LQDB 3QGJA 1YGCH 2VU8E 3ODDA 3SNCA 1K1NA 4Y8ZA 1TB6H 1CVWH 1BIOA 1OP8A 2SFAA 2TBSA 1C5ZB 3M7TA 2KAIB 1P0SH 1IHSH 1N6XA 1WOFA 3MH7A 1JRSA 4AORA 2F9UA 1AWHB 1HXFH 3TK6A 5A8YA 2F9BH 1QIXB 2EI8A 3KIDU 3PYHA 2GT8A 2BY6X 3T5FH 3QTVH 5L30H 1GBHA 2DE8A 2BDAA 3P6ZB 1EZSC 2ZHQH 2FO9A 1W7GH 1KLTA 1W8BH 4JZEH 4DOQA 3SQEE 3GCHB 2ZI2H 3GDUA 2WPJS 1V6DA 1YPLH 1PFXC 3EDXB 4NIWA 2FESH 3UOUA 3MWIU 5EW1H 3KQCA 1THPB 2XNIA 5L2ZH 1O3KA 8GCHF 3PLKA 3DT0H 1LPGB 1TBZH 2Y5GA 1ZTLA 5IYTA 4AYVB 1V2UT 5ABWA 1SQAA 1SB1H 1UVTH 1E34B 4KELA 1PYTD 2VIVA 3SO3A 2GZ8A 5GIBA 4CHAC 2ZPRA 2SGEE 3KF2A 1ZSKA 2ANMH 1GBAA 2R3UA 1K9OE 1ZPZA 2UUFB 1FI8A 3SU4A 1HJ8A 2DUCA 2V3OH 1L1JA 4O3UA 3SU6A 1XUGA 2FOGA 3M5LA 2ZO3H 3MHWU 2J9NA 1C1MA 2BD9A 4TY7A 2A4OA 4FUIA 3Q3YA 4Y0YE 3GCTF 4A1VA 2BDYA 4YZUA 4UDWH 1PYTC 2ZGBH 1FIWA 2OBOA 3AW0A 3H7TA 3I29A 3UWIA 5DP4A 1LKAA 5A2MH 3GY5A 2QIQA 2BY7X 1HCGA 3UREA 1TNGA 1NT1A 1TOCB 1H1BA 4YESB 3RXLA 3RXGA 1JIMA 1YPHC 4IC5A 2VWMA 3SV9A 1SFQB 1AKSB 1ZTJA 4IC6A 2A4GA 1AD8H 2AYWA 3A7TA 1Y8TA 4AGJA 1LHFH 1RJXB 3ZVBA 3KQBA 3ZVFA 1CGIE 2D2DA 1KTSB 1GMCF 4Y10E 1EB2A 5DP9A 1VGCC 6CHAB 1P04A 1SMFE 2ZA5A 2GCHF 1AE5A 2AMPA 1QA0A 1IHTH 4Y7BA 4ABIA 3ATIA 3URCA 2I6QA 3PROA 1A3EH 1VCQA 4MPUA 4GSOA 8GCHG 1A7SA 1MAXA 2XCFA 3EE0B 3CP7A 1SL3A 1AB9C 2CHAB 1CT4E 3RXTA 3LH3A 1IQIA 1KXDA 1L4ZA 2BX4A 4ISLA 1P05A 1AY6H 2VIDA 2AFQB 1V2VT 4ISHH 4I8LA 3RLYH 3P8GA 4YOGA 1A46H 2WUBA 2OC1A 3UR9A 4NFEA 1UTPA 1O2YA 1RGQA 2ZGXH 4NGAH 4FVDA 3SU2A 2Y7XA 3RLWH 6LPRA 5GWZA 1U6QA 3B9FH 5AFYH 1O3LA 5DK1A 1ZOMA 4FU8A 1GCTC 3GCTG 1IQMA 1C5VA 4UE7H 1BRBE 3MI4A 4Y7AA 1BMAA 3ZV8A 1RS0A 1F0TA 4LZ4B 2UUYA 1FMGA 3SJOA 2GV6A 4YM9A 2G51A 3ODFA 1EX3A 1OYTH 2NU3E 1B7XB 1RTKA 4UONA 1K1MA 3S7KB 1NFUA 4Q2KA 2CMYA 4Y6DA 3BTEE 3SNAA 1W13U 5DPAA 2OTVA 1YC0A 3MMGA 4HI3A 3VB7A 3A7YA 3GICB 1BBRE 3LKWA 4WJG2 2Q6GA 3ATWA 5J4SA 2H1UA 3V0XA 4B75A 1SGIB 2D26C 5DP7A 4Y76A 3A81A 1GMCG 1JRTA 1O3GA 3V12A 3T27A 1DE7H 4NSYA 3VFEA 1BRCE 2GCHG 1ZR0A 2FI5E 1CU1A 4ZROA 1F0SA 4D76A 3KGPA 4CRBA 1LQEA 1OXGA 5EXNA 2R0KA 3LU9B 3LJOA 3M5NA 2PTCE 1BCUH 3PMHB 1ELAA 5C67A 4DT7B 3ATMA 1QRWA 1HAVB 1BOQA 3OY5U 5FPSA 4ABAA 1TX6A 2EI6A 4BXSA 1AHTH 2BB4A 2W7SA 1Y3XA 2NWNA 1NESE 5JBBS 4Q7XA 1LDTT 2Z9IA 4LOYH 1V2PT 2P8OC 2YNBA 2IOTA 2LNCA 1GBIA 2WPMS 3HGPA 3W94A 4XBBA 1BMMH 1GBCA 3GYLB 2J95A 4MLFB 2A45B 1GG6C 4D9RA 5E0HA 4ZKNU 3S69A 1GBKA 5JBTA 1O5DH 3A7XA 4D9QA 1O2TA 1HYLA 2PTNA 4NCYA 2AS9A