3TJOA

Htra1 catalytic domain, mutationally inactivated
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
211
structure length
198
Chain Sequence
MDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTTQDYIQTDAIINYGNAGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFLTESHDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease HTRA1
publication title Structural and Functional Analysis of HtrA1 and Its Subdomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 47
structure length 198
sequence length 211
chains with identical sequence B, D
ec nomenclature ec 3.4.21.-:
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tjoA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tjoA02
1ELCA 5DP8A 5AVDA 5EQRA 1CU1A 2H9HA 2V0BA 3HGPA 5SGAE 2FP7B 1ELFA 2XC0A 2KAIB 3KQCA 2BXTH 1L4DA 4Q80A 1RFNA 1SGFG 4XE4A 3RU4E 1DITH 1PPGE 2AMQA 1UTOA 1H9LB 1P2IA 1CO7E 3RXCA 3BTKE 3Q3KA 1BA8B 3KHVA 2ZGCA 1ZSKA 1ZPZA 2RDLA 1C2JA 1V2TT 4B75A 4WJG2 2F9UA 2SGDE 1MTNC 3VGCC 4YZUA 1G32B 1HPGA 5JBCS 1E38B 3MI4A 1C1UH 1CA0C 2NWNA 2EI6A 3A85A 2G8TA 2Q6GA 2ZU3A 1KXBA 3ZVGA 1XX9A 3URCA 3PLPA 4O3TA 6CHAB 1PPCE 3BEUA 3TK9A 1GBHA 4RKJB 1HJAC 1C5YB 1HBTH 4UONA 1F5LA 1TNKA 2ZHQH 3RXLA 3OX7U 2ANYA 2BD3A 2OUAA 2HGTH 2FXRA 3SW2B 1NPMA 4I8KA 3U8RH 2V3HH 2BDBA 4OS5A 1AWHB 1C2EA 1GHAG 1TGCA 1AO5A 1CHGA 2GKVE 1P3EA 4DCDA 6LPRA 2JH6D 1H9IE 4NZLA 3GY7A 1A0LA 1GDUA 1RIWB 2ZDNA 1O3OA 4IS5A 1B5GH 3K65B 1V6DA 3KF2A 1UVSH 2B7DH 4INKA 2D2DA 2AMDA 4CBNA 4AYYB 2FX6A 3LOXA 1LTOA 1TYNA 4ISIH 1CBWB 1QL8A 4NCYA 3SUGA 4E7NA 5LPRA 1S85A 5ESTE 1VGCB 1RS0A 1WTGH 2Q1JA 3BTQE 3SHAH 3RXOA 8KME2 2O8WA 4RKOB 3RXEA 3S0NA 1OWIA 1EAUA 3MOCA 2J4IA 2ZGHA 2FOFA 3F1SB 1C5XB 1Y59T 3QDZB 1Y5BT 2ZCHP 1GJ8B 4YOIA 2V6NA 4MNXA 1GDNA 6GCHG 2FOCA 3HKJB 1QL7A 3E3TA 3PTNA 1GBAA 3ZYEA 4ABAA 6GCHF 1MUEB 4TY7A 1TRYA 2PKSB 2PWXA 4B2CA 1EAIA 3MWIU 4XBCA 2ZTYA 2A2XH 1M9UA 2V35A 1BMNH 1CT0E 5ESBA 2ULLA 5TCAA 2ZWLH 1DICA 1SB1H 2BLVA 2VVCA 2ANKH 3LT3A 2K1QA 2CMYA 3Q3YA 3EA8A 1WCZA 1KXDA 2BDIA 1ACBE 4U32A 3ATLA 2Y82A 4JZDH 4X2YA 1P9UA 3CENA 1RGQA 3SUDA 3HKIB 4WWYA 1U6QA 3SU6A 2ANWA 2VH6A 1GHBG 1BDAA 1TBRH 3AASA 4U01A 3SI3H 5LGOA 1EZUC 3FZZA 1AB9C 3GCHB 1DXPA 1DPOA 1FQ3A 2JETB 1NC6A 1W12U 2B0FA 1JWTA 3LU9B 2P3UB 1UHBB 1MKWH 4NGAH 5H4IB 2UUFB 3A7YA 3O8CA 5DG6A 1ESTA 1VJ9U 3ZZAA 2A4RA 1AMHA 4WMDA 2ZGXH 3MU1A 2GP9B 3WY8A 1YPEH 1KXAA 2Z9LA 3A87A 2PFEA 3RXRA 2OD3B 1GI3A 4WF8A 2GT8A 1HYLA 1A46H 2FMJA 2XWAA 3S69A 2OQ5A 3ZYDA 1ESAA 3UY9A 5DP7A 1UHBA 1HCGA 4H42U 4YESB 3RXKA 3T26A 2BY5X 1C2IA 2BD2A 4FUBA 3M37A 1ID5H 1JBUH 3E1XB 2P3TB 1GI5A 1RJXB 1TONA 1SR5C 2OC7A 5AFYH 3A7TA 3DFJA 4MNYA 3A89A 3VB6A 1C2KA 1YPJH 1ZGIA 2UUYA 1J8AA 2RA3A 4MTBA 1LPZB 1CHOF 1J14A 4A6LA 3GISB 3LGVA 1TMBH 1QBNA 1TA2A 8ESTE 2STAE 1QY6A 2F9OA 3EYDA 1O36A 1G3DA 2G4UA 1GL0E 2OP9A 1K2I1 1GVKB 3UNRA 2FYQA 5LPFA 1C1QA 2NU2E 1TFXA 1O3PB 1SFQB 1D3DB 3PMHB 2H6MA 1ZGVA 4ISLA 2FWWA 1O3FA 2BDHA 2Z3EA 3RMOH 1DFPA 3M7QA 4YT6H 1GBKA 2AGIX 2FI3E 3GYMA 1KXEA 1UVPA 4Y76A 4XBBA 4AG2A 4VGCB 3T29A 3TVJB 1V2VT 2PTCE 3UREA 5CHAB 2TGDA 3PTBA 1KTSB 1AE8H 6CHAC 1HAGE 2AH4X 4TY6A 2F91A 4R0IA 1V2OT 1V2MT 3SJ9A 5BRRE 3PM3A 4MG3A 2C90B 2C8ZB 3KNXA 5DP5A 4X1PU 3BTDE 5T6DA 3ZV9A 1RXPA 3NPSA 1BJVA 1H9HE 4JZFH 3EDXB 1DVAH 4HTCH 4I33A 3U69H 5GCHG 3MO9A 1RTFB 5JB8S 4ESTE 3SV6A 1O3NA 1RIWC 5AHGH 3K6YA 4CRCA 2VWMA 1BTPA 2J92A 1HAHH 3OSYA 4Y0ZE 1FAXA 4KGAA 1AQ7A 2BY9X 2CXVA 4M7GA 2FOMB 1QB6A 4E05H 1SI5H 3S7HB 1TRMA 4MDSA 3HK6B 1ARCA 1VGCC 3MH6A 1SGRE 1ZR0A 1EB2A 1HAIH 1LPGB 1GI4A 1D6RA 3EGKH 1SLWB 1JXPA 1TNLA 1ARBA 2TPIZ 3RC4A 2VJ1A 1QJ6B 4X8TH 5JBTA 2QY0B 1TALA 1OYQA 1NU9A 1T4UH 1C5PA 3NUMA 1G3CA 1LVBA 1MZDA 1C1MA 4Y7BA 2C4FH 1O33A 1T8NA 2ZDMA 1SSXA 2F9PA 1C2LA 2HNTE 2PKSC 4AN7A 4XOJA 1V2KT 1TRNA 2O8UA 2W5EA 5DP6A 2Z9IA 1O3AA 2IJOB 4YLUA 1K28D 3TH3H 2G55A 1ZHRA 2AIPA 3DA9B 1QNJA 4MVNA 3SV8A 3BTFE 1Q31A 4BAKB 1C5NH 1XKBC 1YLCA 1AUJA 2ZZUH 1EAXA 1C1PA 3LJOA 4NIWA 5FPSA 3LGTA 5ETXA 5JYIA 2BZ6H 2YNAA 4A5TS 4AX9H 1JRSA 2XYAA 1HAYB 1J17T 1D3TB 5HYOA 1A7SA 1OP0A 2QAAA 3SU0A 5JPMH 1IOEA 1DSTA 3T25A 1D4PB 2B5TB 2UWOA 5GWZA 1SFIA 1AFQB 4HFPB 1GJCB 2BOHB 1P8VC 1TPSA 2R3UA 1J15A 4I7YH 2HALA 3M5LA 1YKTA 4CH8B 2GT7A 1OWHA 4JCNA 2STBE 2F83A 1GI9B 1DE7H 2AFQB 1D3PB 2DE9A 2FEQH 3GCHC 3ZVEA 2JETC 1JOUB 3UNSA 4GVUA 4ABJA 1GHYH 4NG9H 1QA0A 1O3EA 1OYTH 3QUMP 1IQMA 4OS4A 3BEFB 3PMJA 1HIAB 1AUTC 1O38A 3MNBA 4CHAB 3PLKA 1P06A 1JIMA 2G5NA 2HWLB 1TGSZ 1S6HA 1YM0A 4FUFA 1XMNB 2FTLE 1AKSB 2HOBA 4YM9A 2QA9E 4UD9H 2BXUH 4ABDA 2GV6A 3MU4A 5FHTA 3ATMA 4DVAU 3ZZDA 3LC3A 1FPHH 1V2JT 3GICB 4Y10E 4WY3A 1SGCA 1G3EA 3VB7A 2XC5A 1K1MA 1GVZA 3E0NB 3PYHA 1Z6EA 2XW9A 3OTJE 4F4OC 3ZVAA 2FTMA 2VH0A 5EXLA 2QC2A 3GY2A 3VEQB 5HGGA 2G5VA 1ZMNA 2BZAA 2FESH 1GJ9B 2ZPQA 2DUCA 3MO3A 4X0WU 1OOKB 1YPMH 1MAXA 1A5GH 1LHFH 3LGYA 4K5ZA 3GCNA 5C67A 1G9IE 3SNEA 2QXJA 1K1JA 4X2XA 1NN6A 3A84A 4AFSA 1BT7A 2ALVA 1F0SA 2I6SA 3BTME 3LPRA 1HXEH 1ZPCA 2ZG0H 3RXMA 3E0PB 2PUXB 4CRGA 1GHXH 4OGXA 1NRQH 2ZQ2A 3NXPA 2ZU4A 3GDUA 2OINA 2A4GA 2UUJB 1H8DH 3CP7A 4Y8YA 2Y81A 1NFYA 1W3CA 4VGCC 2C8XB 4K1EA 5EQSA 5CHAC 3MMGA 1THSH 2SGQE 2Z9GA 1OWKA 1IHSH 2VIOA 1O2NA 2Z7FE 3B8JA 2XBXA 3QN7A 1DOJA 5JBBS 5F6MA 1QJ1B 3ZZ3A 3RXIA 4I8HA 1BQYA 3RU4D 4DOQA 1ZYOA 1BHXF 2J95A 4YOGA 1HAXB 4JZIA 1SPJA 2P8OB 3QLPH 5TJXA 1C5ZB 2IN2A 4RN6A 2VINA 4ZXXH 3RC6A 4ABEA 2FOGA 4Y79A 1CA8B 1LHCH 4K1TA 2FI4E 2ZHFH 2BM2A 1HJ9A 1TPOA 4FVBA 2ZFQH 5IDKA 3A8BA 1HFDA 2FLRH 3CS7A 1P2QA 1QCPA 3A88A 1SLUB 4KP0A 1C2FA 4YLQH 2EC9H 5FPTA 4ZXYH 4ISOA 2GX4A 3GY8A 3M61U 3P8NA 2EA3A 4AFZA 1DX5M 2ZGBH 2GCHG 3UQVA 1BCUH 2HVXA 1IQHA 3TK5A 4MPWA 2GCHF 3SV9A 2IPHA 5A09A 9ESTA 1ELAA 3P8GA 1GJBB 1S6FA 2CGAA 3MNSA 7ESTE 4TWWA 3HGNA 2BLWA 1PQ8A 4FUJA 1HDTH 2HPQH 1C1TA 4IGDA 1NS3A 1ZOMA 3E90B 1RTLA 2ZTZA 1LVYA 1O2WA 1AY6H 3LGWA 1PPZA 2GGVB 1CT4E 2WYGA 4X1RU 5HXFA 4AFUA 4O97A 1P9SA 1GHZA 1C1WH 4U2WA 1K1IA 1LHGH 4TPIZ 1UCYK 4Y6DA 5LH8A 3KGPA 3RXAA 2A7JA 2Z6BD 1C5OH 1ELTA 1K21H 2BQ7B 1CT2E 4GCHF 4YTAA 5LPEA 1YPHE 2AERH 1NRSH 4ABFA 4CRFA 1P05A 1WU1A 4I8JA 1MQ5A 3D23A 4I8GA 2PLXA 1YGCH 2EI7A 3OYPA 1EZXC 2CF8H 2FODA 2GVFA 2RA0A 5C3NA 5EW2H 2A7CA 1AFQC 2FOAA 3DHKH 4ZKRU 4KTSA 3PLBA 3SGAE 2CF9H 2NU1E 2PHBA 4DJZB 3SQEE 3EQ0H 1DANH 1GI7B 1FY4A 1NT1A 3OY6U 1SGQE 3BTEE 3P70B 4ZHAA 5C5OA 1THPB 2QIQA 2ZO3H 3E91A 2Y5GA 4NIXA 3UWJH 1O3KA 1F5KU 3GOVB 1TGBA 2SNVA 1UVOA 3PMBB 1GBEA 1GJAB 1K1NA 3ZVDA 2Z9JA 1O2ZA 2ZDVH 1DWBH 2UWPA 3OU0A 3E8LA 5I46H 4O3UA 2BYAX 1CGIE 3ZZ7A 4FU8A 5J4SA 2XRCA 1BTWA 4CHAC 1AE5A 5B6OA 3ODFA 1O5BB 1MTUA 1W7GH 3SBKA 1SMFE 2FPZA 5GDSH 3VXFH 3P6ZB 2QXIA 1ZPBA 3TJVA 4Y8XA 1T8MA 2P59A 1P57B 4BANB 4Y8ZA 1YBWA 1LHEH 1HV7A 1FIWA 8LPRA 1NFUA 1OS8A 4CRDA 2TGPZ 3RM0H 4UEHH 4NIYA 3F9EA 1MAYA 1MU8B 4A1TA 5EG4A 1BUIA 2F9VA 1UJ1A 2TGAA 4IW4E 3MH4A 1S81A 1T8LA 3TNTA 1AFEH 3I77A 2QYIA 3SQHE 1YCPM 1YF4A 3STIA 1ZRBA 3R3GB 3G01A 4ZHMU 1AD8H 1FY1A 2OBOA 3GDVA 1Y5UT 2Y80A 1C5MD 1J16A 1PPBH 1L0ZA 2CJIA 1W0ZU 3TH2H 4FU9A 1SOTA 5C1UA 2GCTB 1P2OA 2BQ6B 4AFQA 1MCTA 2YNBA 1PQ7A 2BOKA 3SUFA 4DURA 1SGEE 4GSOA 1KIGH 3GY6A 3LJJA 3SGQE 2C8YB 3Q3XA 1QL9A 4UDWH 2XNIA 4B2BA 1BHXB 3IG6B 1AIXH 4J1YA 4NSVA 5CE1A 3GY3A 4KELA 1XUGA 4MPXA 1TGTA 3CS0A 3MU5A 2P8OC 2G52A 3M3SA 2ANMH 5FPYA 4I32A 3T62A 2UUKB 2VIDA 3BIVH 3A7ZA 3BTTE 3AW1A 2XBWA 3MH7A 1OPHB 1EUFA 1AZ8A 1PYTC 1A3BH 3ELAH 2WPKS 1GDQA 1T8OA 1W0YH 1C1SA 3ZZ8A 1LQEA 1HNEE 1Y3YA 4DY7B 1L2EA 1O2PA 1A3EH 1OWJA 1TLDA 1MD8A 1YPGH 4Q2KA 1G2MA 3RXBA 3RXQA 3A82A 1O2VA 2BD4A 1V2RT 4CH2B 1GPZA 3I78A 2QGRA 3TPIZ 4B74A 2BHGA 1O5GH 1YCPH 4B71A 4MPVA 3V0XA 2O8LA 4R8TB 1CHOG 4FUDA 1Q2WA 1GBFA 4GLYA 3W95A 1ZMJA 1A0HB 3BN9A 4FUEA 5DP3A 3TLOA 5BPEA 2Z94A 3RXGA 1UTPA 1V2PT 1KTTB 1Y3VA 5DGJA 1KLJH 4WXVA 3KQBA 1KY9A 2ODQA 3SUEA 3RXUA 5E0GA 3QZRA 1YPLH 1A61H 4I31A 2VIWA 1GBMA 4NWLA 1P2MA 3RXVA 5HMAA 1BB0B 1BJUA 1BMAA 1BBRK 3MNXA 1T7CA 1TPAE 1CVWH 3NWUA 3BTGE 2BVSH 3T5FH 4ZKOU 1GJ4H 4LK4A 2Y7ZA 3BSQA 1NTPA 1WSSH 1GG6B 4AB8A 1O2YA 3TJOA 4BNRA 1F5RA 2OXSA 2XBYA 1G36A 1XM1A 3FP7E 2JH5D 1SC8U 2LNCA 1LMWB 5GPIB 3BV9B 4D76A 1P0SH 1MQ6A 4BXSA 1TIOA 1V2NT 2R9PA 1UTKA 5A8ZA 3D65E 1V3XA 4BAHB 4HI3A 1DUEA 4CRBA 4B2AA 1W13U 3A80A 2XBVA 4INHA 1O0DH 1O30A 2ZGJA 5EODA 3KCGH 4DT7B 2V3OH 2A4OA 2SGEE 1C2HA 2WPLS 4B73A 2O9QA 4BTIB 3K2UA 1B0EA 2GV7A 2ZDAH 1EPTA 4ASHA 1ZLRA 1W8BH 1DS2E 1O2MA 4K60A 4AYVB 1XXFA 2RG3A 1HAOH 2FX4A 3SZNA 1AZZA 5EQQA 1XXDA 1ZMLA 1O3IA 3QTOH 3A86A 3AW0A 4OS7A 2ASUB 2BD8A 2TBSA 2ZDLA 1EJAA 3F9GA 1C4Y2 1TWXB 2H5CA 1C5QA 2VGCB 4DG4A 2OC0A 3RP2A 2B9LA 5EGMA 1O2TA 1CBWC 3M5MA 4GPGA 4D7FA 2HNTC 2ZIQH 3RLWH 1O2XA 3VB5A 3LIWA 2BDCA 3TGKE 5EPNA 1IQEA 2QF0A 1HUTH 3LKWA 1V2WT 1TNGA 1AU8A 4WMFA 2Y5HA 2XCFA 1FZZA 1G30B 2OCVB 5FBIA 1GJ5H 4X8SH 2ZFTA 1ANCA 2OC1A 1O3MA 3KIDU 3S9BA 4TYDA 3KQDA 4MLFB 3F9HA 2BDGA 1F0RA 1P02A 2BLQA 3SV7A 4D9RA 2VWNA 1MD7A 3F68H 4IC6A 3TNSA 3A83A 1Z8IB 4GHTA 3AAVA 1C1VH 4UFDH 3SN8A 4CRAA 3R0FA 3K6ZA 3S9AA 1O3JA 2F9NA 4MQAA 2P16A 5K7RA 2GCTC 1TQ0B 4OS2A 3ZV8A 1QRZA 1FV9A 3ATWA 4FXGH 1Y8TA 1L1JA 2TGTA 2P3FH 1DWCH 1KXFA 2A0QB 2AYWA 1NRNH 3SU3A 2A1DB 1ABIH 1SQOA 2R0KA 1ZJDA 3ZZBA 4E06H 4UE7H 4ZHLU 1LHDH 2CV3A 3FP8E 2GMTB 2FIRH 1ANBA 1V2LT 3L33A 4BAOB 1O5EH 2BY8X 1DY9A 1BOQA 1ESBA 3UIRA 3V13A 4IMQA 1GVLA 2VB0A 1UTMA 4NFEA 4OS6A 2GDDA 4Q7XA 2A2QH 3RXFA 5E8EH 4LZ1H 1FDPA 5F8XA 1FY8E 3RXTA 2R2MB 5JBAS 1ABJH 1JIRA 1WQSA 3PO1B 2DE8A 2VU8E 2WINI 4NWKA 1CGHA 3MH5A 3M3VA 2WPHS 1FAKH 2W7UA 2JKHA 1G2LA 2OQUA 2TIOA 1OKXA 1T4VH 1S0QA 3A7WA 1Z8RA 1OX1A 2WYJA 1N6YA 4K69A 1OWDA 2WPIS 5FX5A 5HM2A 2A4QA 1O31A 1O34A 1QHRB 1BRBE 1LKAA 5T3HA 4OS1A 1MKXH 1O32A 1UTJA 2FS8A 3BTWE 1EOJA 3I29A 1VITH 4NA9H 1L1GA 4YOJA 2HNTF 2OC8A 4NIVA 4ZAEA 3SJOA 4JZ1A 4Z0KA 4H4FA 2FZZA 2O8TA 1QB9A 4WH6A 4SGAE 1ZSJA 4KTUA 4ABIA 3A8AA 1XUFA 2AIQA 1S0RA 3FP6E 1SGPE 4JYTA 5EU8A 3UUZA 1BTYA 1YP9A 1V2UT 1KDQA 3RLYH 1ETTH 1C1OA 5HM9A 1IQKA 1AVWA 1P04A 1GBBA 1MMJN 3OY5U 2Z3CA 1CGJE 2BY6X 3RDZA 3SU2A 2Y5FA 3U98H 3A8DA 3URDA 2Q6FA 1KYNA 1UK2A 3BG4B 3RUOA 2SFAA 3DFLA 4F49A 3PMAB 5GIBA 1EP6A 1GHVH 1MTWA 2PR3A 3DT0H 4JK5A 2GZ8A 2A5KA 3PB1E 1WUNH 1Y3UA 1ZRKA 1O35A 1E34B 5G4BA 4X2VA 1SGDE 1NRPH 1H4WA 1EX3A 4LXBH 2JH0D 2ZHWH 4Q7YA 1BMLA 1THRH 2PUQH 3P95A 2XTTB 1YLDA 2G51A 1EJNA 3EA7A 1TGNA 1C1RA 3RMLH 2D8WA 1TBZH 5FXLA 3ZZ4A 1FONA 5F03A 4DW2U 1QA7A 2YOLA 4ZUHA 2VWLA 2ZKSA 2P94A 3DUXH 2ZCLP 1SGIB 1N8OB 1XVOA 1O2LA 4KTCA 1MKWK 3C27B 4JZEH 1AB9B 2W3IA 3SGBE 3MNCA 1SGYE 1LVOA 2VGCC 2BD5A 1GCDA 4ABGA 5JDUB 1F2SE 1GBCA 3KN2A 4JYUH 3JZ1B 2G4TA 2A5IA 3ZVBA 4X8VH 2BB4A 1SGNE 2SGFE 2A5AA 1O2OA 1C5VA 3U8OH 1P12E 4BTTB 2ZFPH 1OXGA 1TPPA 2R2WU 5GJ4B 1Y3WA 1HAVA 3BG8A 2NU0E 4IMZA 1DLKB 2D1JA 2WV4A 3RU4T 3STJA 2BLOA 5A8XA 1ZZZA 1Z6JH 1NO9H 1TNHA 2IOTA 3QK1A 2VVVA 4NSYA 5EXNA 4FVDA 4INLA 1YPHC 2HLCA 2O8MA 3LC5A 4YT7H 4X6OA 1V2QT 4WVPE 1SBWA 4U30A 4CR9A 4XBDA 1TX7A 2WV5A 3QO6A 5CMXH 3FFGA 3BF6H 1WBGB 2AGEX 4BAQB 4FU7A 3SU1A 4X8UH 2D26C 4AORA 2ZFSA 4PROA 3E6PH 3GY4A 3VFEA 1OWEA 4GCHG 5DJ7A 1QB1A 2WPMS 1FN8A 5L2ZH 5C1XA 3A81A 2BD7A 3SJIA 1N1LA 1O2UA 1O3CA 3NKKA 1YYY1 5JB9S 5C5NA 2BX4A 2QN5T 1D6WA 1O2RA 1QRWA 2BDAA 3RXPA 3UPEA 1GI8B 1H8IH 1VZQH 2H1UA 1GI0A 1INCA 2BY7X 1LO6A 1ANEA 3V7TA 1YPKH 2TRMA 2KAIA 4GHQA 3TGJE 2M5TA 3DD2H 2PKAB 1MCVA 2BDYA 2GMTC 1TA6A 5A0BA 5ABWA 4Y71A 1GI1A 3TJUA 3VXEH 3S7KB 3RXDA 3U9AH 2C8WB 1SHHB 1P09A 1TOMH 3ENSB 1FN6A 5DP4A 5AF9H 2FOHA 1EJMA 1TAWA 2WPJS 2ZFRH 3Q76A 1HLTH 1ETSH 2BVRH 1TX6A 1ZHMA 4ISNA 4K2YA 4QT8C 1O3DA 2H9TH 1QBVH 1F92A 2BD9A 1N6XA 1HXFH 2ZU1A 4A1VA 1ZSLA 3PO1C 2PKAA 1SOZA 1EATA 3VB4A 2HPPH 3ITIA 1FY3A 3TGIE 1H1BA 1NM6A 2F9BH 3EE0B 1FNIA 3FZDA 2PTNA 3RMMH 3UR9A 3ZZ9A 1AI8H 5EW1H 1GHWH 1IQJA 4Y7AA 1GHAF 1O2GH 1O2HA 1QQUA 1QBOA 1EASA 2PSYA 1UTNA 3QX5H 1GGDB 4ZKSU 3SO3A 1SQTA 1UCYE 1G3BA 1GCTB 2PW8H 3ATIA 5C2ZA 1IQFA 1EXFA 2GZ9A 2EEKA 3A8CA 1BRAA 1NROH 2BVXH 4IN2A 5DK1A 3SOSA 1RRKA 1T32A 1P10A 4AG1A 3K9XB 3QZQA 4FUIA 5FCKA 1TNJA 2ZA5A 3UOPA 4X1SU 3V3MA 1GWAA 4MNVA 5E0JA 1S82A 5C1YA 3H5CB 5GXPA 1EP5A 1PPEE 1VJAU 4K8BA 2G81E 4ZROA 1FLEE 5EPYA 3P17H 3GYLB 4D9QA 1FIZA 1OP8A 7LPRA 1WQVH 1Z8JB 1HAPH 3AAUA 3EAJA 1ELEE 1PQAA 3MHWU 3MU0A 2OBQA 3FAOA 1PYTD 1PQ5A 1DUAA 3BG4C 1C5RA 1XUIA 1WTHD 1KXCA 2A7HA 1WOFA 3KQEA 5EOKA 2ZPRA 1UMAH 3TITA 1SHYA 5AFZH 1J9CH 1VCWA 3GCOA 3IITA 1C5LH 1E0FD 3HK3B 4JYVH 5E0HA 4A92A 2FOEA 2ZI2H 7KMEH 1NFXA 1VCPA 3LGIA 4GUXA 2W7SA 1GBDA 4H6TA 1EOLA 2OTVA 1CQQA 1BRCE 1O5AB 1QRXA 1NFWA 1O5FH 4K3JA 1C5UA 1F0UA 2ZHDA 3RC5A 3VB3A 1DDJA 3O8RA 1GHBF 4X2WA 1BTZA 1GJDB 1N8OC 3P8OA 2C3SA 2FO9A 1VR1H 3BIUH 3U1JB 1A1RA 1P3CA 1EB1H 4ABHA 2PGQB 6ESTA 3MO6A 1GBIA 1SG8B 4K1SA 4E7RG 3P92A 2ALPA 3FANA 1IQIA 3SNAA 4IN1A 3N7OA 1W10U 2J9NA 4Z6AH 1GBLA 2FOBA 4ZMAH 1SGTA 3TK6A 1W11U 1B7XB 3LGUA 3SORA 4YO9A 1WAYB 4ABBA 8GCHG 3HPTB 3PROA 1T31A 2GTBA 1O2SA 3D62A 4HZHA 1MKXK 1MTSA 8GCHF 5DO4H 3QTVH 2J2UA 2ZDKA 4I8LA 3UNQA 4D7GA 4ZKNU 1LKBA 1RD3B 4AGKA 1FUJA 2XXLA 1E37B 1P03A 1ZTLA 2F3CE 1MBQA 1GBJA 5C20A 1EZQA 3HATH 3KEEA 1W7XH 1AGJA 4Y11E 1W2KH 1FMGA 1P2KA 1S5SA 1O5DH 1BRUP 1C5WB 3MFJA 2Y7XA 1O2IA 5A2MH 5J4QA 3UQOA 1EAWA 4B76A 2ZEBA 3T27A 1P11E 2EI8A 1D9IA 1NU7B 1E35B 1BZXE 3M36A 4GAWA 1K22H 1UCYH 1QQ4A 3VPKA 4CREA 1FPCH 1AVGH 2P93A 1JRTA 1ETRH 3L3TA 4X1QU 2PV9B 5PTPA 1SLVB 3FVFB 1HJ8A 5FBEA 4NA8A 3RMNH 1UVTH 1EPTB 1A5HA 1ZTJA 2A31A 5L6NH 1SGFA 4WH8A 1A0JA 1LCYA 3M7TA 1Q3XA 4IC5A 1XUJA 2QXHA 4WXIA 2Z9KA 1B0FA 3ZZCA 1AN1E 1LQDB 3NK8A 2CHAB 1JMOH 2ESTE 3M5NA 1C2GA 1TNIA 4Y0YE 4X6MA 1PPHE 1DY8A 2VIPA 3RXJA 4BTUB 5A0CA 4MPUA 4A1XA 5T6GA 4D8NA 3ODDA 2UWLA 1LVMA 4AOQA 3QGJA 3SNCA 1PFXC 1TABE 5DPAA 2ZECA 4K8YA 3NZIA 3SU5A 1O3LA 2CN0H 3V12A 7GCHG 3T2NA 3PWCA 3M5OA 1SLXB 3SHCH 7GCHF 3QGNB 4KKDA 3MU8A 1EZSC 2HRVA 1Z7KA 1XUHA 1O3BA 1XKAC 1GJ6A 1DM4B 1CSOE 1DT2A 4H6SB 3ZZ6A 3E16B 2ODPA 5GCHF 1GGDC 1TMUH 3UOUA 1G37A 3KL6A 1C4V2 1GCTC 1O39A 1HAZB 2P95A 1UTLM 3ZVFA 5IYTA 1BBRE 1KLIH 5T6FA 2FM2A 4LOYH 4DIHH 1Z8GA 4LZ4B 5A0AE 1ZHPA 3RM2H 2C93B 1GL1A 2ZTXA 1BITA 3BTHE 2RCEA 3SJ8A 2Z3DA 3M7UA 1K1OA 1K9OE 1BIOA 1MH0A 4OGYA 1EKBB 5L30H 1P01A 1TE0A 2FDAA 3Q77A 1OP2A 1O2KA 1Z1IA 1ZTKA 3SJKA 4O9VA 2VIQA 1SL3A 1WYKA 1DXWA 2WUBA 1GMCG 3B23B 1O3HA 1C9PA 1QFKH 2Q6DA 1FXYA 2GDEH 3SNBA 2ZU5A 1GMCF 3EA9A 4UFFH 1QTFA 1L1NA 3SV2H 3ATKA 4X6PA 1K1PA 1TBQH 2ZF0H 4JK6A 4TPYA 1TOCB 2BQWB 3GCTG 1VITG 1F7ZA 1Y3XA 3GCTF 1VITF 1GI6A 3VGCB 1MTNB 1ZJKA 3BEIB 3O8DA 4AGJA 3M35A 2ZFFH 4ZH8A 3F6UH 3GDSA 1F0TA 1W14U 2ZHEH 3D49H 1CA0B 4TWYA 2H2ZA 4UFEH 4J2YB 2H9EH 3LH3A 3ESTA 1QURH 3O8BA 1PPFE 2FYRA 4FUGA 1UK4A 1TX8A 4BXWA 4UFGH 2ZPSA 1GI2A 5L2YH 3PWBA 4MNWA 1A5IA 1RTKA 4O03A 1A2CH 5E2PA 1HJAB 1AVXA 1ANDA 2ILNA 1UVUH 3JZ2B 2J34A 2I6QA 1ELGA 1ORFA 4XFQA 5F8ZA 1QIXB 3QWCH 1DSUA 5F8TA 4XSKU 2THFB 1NY22 1V2ST 1QJ7B 4AB9A 2GZ7A 1S84A 2FI5E 2QXGA 2ZP0H 3M3TA 3F9FA 4DGJA 2BX3A 1CE5A 1FY5A 4THNH 1S83A 2ZU2A 3MTYA 2B8OH 1TMTH 1DLEA 1A4WH 1BMMH 3UTUH 1HB0B 4A7IB 1KDQB 2FS9A 1BTHH 1K1LA 2ODYB 4FUCA 3UWIA 2QV1A 2A45B 3GY5A 1P2JA 4NZQA 2XC4A 1MU6B 2PSXA 4NFFA 1ELVA 1PJPA 3W94A 1C2DA 3MYWA 1HIAA 3C1KA 4AZ2B 9LPRA 1UO6A 3A7VA 2A32A 1MZAA 1NESE 1BTXA 5E2OA 2FLBH 2VVUA 1AKSA 4BAMB 1Z1JA 2QF3A 1MBMA 3UFAA 2OLGA 2VNTA 5A8YA 5TCCA 1IQGA 1SQAA 1X7AC 2NU4E 2NU3E 1LDTT 3LONA 4JMYA 2R0LA 3UR6A 3PV4A 5FCRA 1BBRH 1GG6C 1IHTH 1SVPA 3IWMA 1WV7H 1XUKA 4XDEA 1GJ7B 4RSPA 2W26A 3L6PA 1EPTC 1DWDH 5DKMA 3RXSA 1FI8A 4IBLH 3SU4A 1BTUA 2QCYA 2XWBI 1QGFA 1C5TA 3H7OA 4HGCA 4X1NU 1E36B 3H7TA 5I25A 3NCLA 4WMEA 2H5DA 2CHAC 4Q7ZA 1UTQA 2SNWA 2BMGB 2XCNA 2J38A 3TH4H 1IQNA 1UK3A 1YC0A 3TIUA 2ZNKH 3S9CA 4SGBE 1HGTH 2ZQ1A 4FUHA 3A7XA 1DWEH 2ZCKP 2VWOA 2ZC9H 3LDXH 4DIIH 3LH1A 1C1NA 1O2JA 4NA7A 4X6NA 1D3QB 2J94A 5DP9A 1NZQH 1EQ9A 2R3YA 3P8FA 3B9FH 3ZZ5A 1TQ7B 1HAVB 4ISHH 4B1TA 2PGBB 3TU7H 2SGPE 1OSSA 1QR3E 1HRTH 1LPKB 1VCQA 1IQLA 3U8TH 2WUCA 2Y6TA 3SI4H 1C4U2 1IAUA 1TB6H 2VIVA 4CR5A 3RXHA 1KSNA 1Z71A 3SNDA 3TJNA 1AWFH 5K0HA 1Y5AT 1MTVA 1AHTH 2G00A 1ELDE 4BOHA 1C5SA 3T28A 5FAHA 1GMDG 1GMHG 1P2NA 1NRRH 1KLTA 1O5CB 1O2QA 1YCPK 1C9TA 1FJSA 1GMDF 1GMHF 1XVMA 2W3KA 1O37A 2AMPA 2BTCE 1GBTA 5EXMA 1ELBA 3Q00A 1O3GA 3ZVCA 2GD4B 2AS9A 2SGAA 2LPRA 3AVZA 3U1IB 1L4ZA 5FX6A 2AGGX 2AEIH 4CBOA 1C2MA
chains in the Genus database with same CATH superfamily
1ELCA 5DP8A 5AVDA 5EQRA 1CU1A 2H9HA 2V0BA 3HGPA 5SGAE 2FP7B 1ELFA 2XC0A 2KAIB 3KQCA 2XNDD 2BXTH 1L4DA 2J98A 4Q80A 1RFNA 1SGFG 4XE4A 3RU4E 1DITH 1PPGE 4OM9A 2AMQA 1UTOA 1H9LB 1P2IA 1CO7E 1NBMD 3RXCA 2V7QD 3BTKE 3Q3KA 1BA8B 3KHVA 2ZGCA 1ZSKA 1ZPZA 2RDLA 1C2JA 1V2TT 4B75A 4WJG2 2F9UA 2SGDE 1MTNC 3VGCC 4YZUA 1G32B 1HPGA 5JBCS 1E38B 3MI4A 1C1UH 1CA0C 2NWNA 2EI6A 3A85A 2G8TA 2Q6GA 1E1RD 2ZU3A 1KXBA 3ZVGA 1XX9A 3URCA 3PLPA 4O3TA 6CHAB 1PPCE 3BEUA 3WWFA 3TK9A 1GBHA 4RKJB 1HJAC 1C5YB 1HBTH 4UONA 1F5LA 1TNKA 2ZHQH 3RXLA 3OX7U 2ANYA 2BD3A 2OUAA 2HGTH 2FXRA 3SW2B 1NPMA 2V3MA 4I8KA 3U8RH 2V3HH 2BDBA 4OS5A 1AWHB 1C2EA 1GHAG 1TGCA 1AO5A 1CHGA 2GKVE 1P3EA 4DCDA 6LPRA 2JH6D 1H9IE 4NZLA 3GY7A 1A0LA 1GDUA 1RIWB 2ZDNA 1O3OA 4IS5A 1B5GH 3K65B 1V6DA 3KF2A 1UVSH 2B7DH 4INKA 2D2DA 2AMDA 4CBNA 4AYYB 2FX6A 3LOXA 1LTOA 1TYNA 4ISIH 1CBWB 1QL8A 4NCYA 3SUGA 4E7NA 5LPRA 1S85A 5ESTE 1VGCB 1RS0A 1WTGH 2Q1JA 3BTQE 3SHAH 3RXOA 8KME2 2O8WA 4RKOB 3RXEA 3S0NA 1OWIA 1EAUA 3MOCA 2J4IA 2ZGHA 2FOFA 3F1SB 1C5XB 1W0KD 1Y59T 3QDZB 2F43B 1Y5BT 2ZCHP 1GJ8B 5EJZA 4YOIA 2V6NA 4MNXA 1GDNA 6GCHG 2FOCA 3HKJB 1QL7A 3E3TA 3PTNA 1GBAA 3ZYEA 4ABAA 6GCHF 1MUEB 4TY7A 1TRYA 2PKSB 2PWXA 1COWD 4B2CA 1EAIA 3MWIU 4XBCA 2ZTYA 2A2XH 1M9UA 3F0OA 2V35A 1BMNH 1CT0E 5ESBA 2ULLA 2HVYB 5TCAA 2ZWLH 1DICA 1SB1H 2BLVA 2VVCA 2ANKH 3LT3A 2K1QA 2CMYA 3Q3YA 3EA8A 1WCZA 1KXDA 2BDIA 1ACBE 4U32A 3ATLA 2Y82A 4JZDH 4X2YA 1P9UA 3CENA 2K8IA 1RGQA 3SUDA 3HKIB 4WWYA 1U6QA 3SU6A 2ANWA 2VH6A 1GHBG 1BDAA 1TBRH 3AASA 2M2AA 4U01A 3SI3H 5LGOA 1EZUC 3FZZA 1AB9C 5T1VA 3GCHB 1DXPA 1DPOA 1FQ3A 2JETB 1NC6A 1W12U 2B0FA 1JWTA 3LU9B 2P3UB 5C0TA 1UHBB 1MKWH 4NGAH 5H4IB 2UUFB 3A7YA 3O8CA 5DG6A 1ESTA 1VJ9U 3ZZAA 2A4RA 1AMHA 4WMDA 2ZGXH 3MU1A 2GP9B 3WY8A 1YPEH 1KXAA 2Z9LA 3A87A 2PFEA 3RXRA 2OD3B 1BMFD 1GI3A 4WF8A 2GT8A 1HYLA 1A46H 2FMJA 2XWAA 3S69A 2OQ5A 3ZYDA 1ESAA 3UY9A 5DP7A 1UHBA 1HCGA 4H42U 4YESB 3RXKA 3KYGA 3T26A 2BY5X 1C2IA 2BD2A 4FUBA 3M37A 1ID5H 1JBUH 3E1XB 2P3TB 1GI5A 1RJXB 1TONA 1SR5C 2OC7A 5AFYH 3A7TA 3DFJA 4MNYA 3A89A 3VB6A 1C2KA 1UW7A 1YPJH 1ZGIA 2UUYA 1J8AA 2RA3A 4MTBA 1LPZB 1CHOF 1J14A 4A6LA 3GISB 3LGVA 1TMBH 4ACBA 1QBNA 4ASUD 1TA2A 8ESTE 2STAE 1QY6A 2F9OA 3EYDA 1O36A 1G3DA 5C17A 2G4UA 1GL0E 2OP9A 1K2I1 1GVKB 3UNRA 2FYQA 5LPFA 1C1QA 2NU2E 1TFXA 1O3PB 1SFQB 5HKKD 1D3DB 3PMHB 2H6MA 1ZGVA 4ISLA 2FWWA 1O3FA 2BDHA 2W6ID 2Z3EA 3RMOH 4B6EA 1DFPA 3M7QA 4YT6H 1GBKA 2AGIX 2FI3E 3GYMA 1KXEA 1UVPA 4Y76A 4XBBA 4AG2A 4VGCB 3T29A 3TVJB 1V2VT 2PTCE 3UREA 5CHAB 2TGDA 3PTBA 1KTSB 1AE8H 6CHAC 1HAGE 2AH4X 3N99A 4TY6A 2F91A 4R0IA 1V2OT 1V2MT 3SJ9A 5BRRE 4RT1A 3PM3A 4MG3A 2C90B 2C8ZB 3KNXA 5DP5A 4X1PU 3BTDE 5T6DA 3ZV9A 1RXPA 3NPSA 1BJVA 1H9HE 4JZFH 3EDXB 1DVAH 4HTCH 4I33A 2KX4A 3U69H 5GCHG 3MO9A 1RTFB 5JB8S 4ESTE 3SV6A 1O3NA 1RIWC 5AHGH 3K6YA 4ACAA 4CRCA 2VWMA 1BTPA 2J92A 1HAHH 3OSYA 4Y0ZE 1FAXA 4KGAA 1AQ7A 2BY9X 2CXVA 4M7GA 2FOMB 1QB6A 4E05H 1SI5H 3S7HB 1TRMA 4MDSA 3HK6B 1ARCA 3DCLA 1SKYE 1VGCC 3MH6A 1SGRE 1ZR0A 1EB2A 1HAIH 1LPGB 1GI4A 1D6RA 3EGKH 1SLWB 1JXPA 1TNLA 1ARBA 2TPIZ 3RC4A 2VJ1A 1QJ6B 4X8TH 5JBTA 3NRLA 2QY0B 1TALA 1OYQA 1NU9A 2YMSB 1T4UH 1C5PA 3NUMA 1G3CA 1LVBA 1MZDA 1C1MA 4Y7BA 2C4FH 1O33A 1T8NA 1E1QD 2ZDMA 1SSXA 2F9PA 1C2LA 2HNTE 1FX0B 2PKSC 4AN7A 4XOJA 1V2KT 1TRNA 2O8UA 2W5EA 5DP6A 2Z9IA 1O3AA 2IJOB 4YLUA 1K28D 4M9FA 3TH3H 2KCYA 2G55A 1ZHRA 2AIPA 3DA9B 1QNJA 4MVNA 3SV8A 3BTFE 1Q31A 4BAKB 1C5NH 1XKBC 1YLCA 1AUJA 2ZZUH 1EAXA 1C1PA 2KR7A 3LJOA 4NIWA 3UAIC 2RFKC 5FPSA 3LGTA 5ETXA 5JYIA 2BZ6H 2YNAA 4A5TS 4AX9H 1JRSA 2XYAA 1HAYB 1J17T 1D3TB 5HYOA 1A7SA 1OP0A 2QAAA 3SU0A 5JPMH 1IOEA 1DSTA 3T25A 1D4PB 2B5TB 2UWOA 5GWZA 1SFIA 1AFQB 5EIYA 4HFPB 1GJCB 2BOHB 1P8VC 1TPSA 2R3UA 1J15A 4I7YH 2HALA 3M5LA 1YKTA 4CH8B 2GT7A 1OWHA 3DSPA 4JCNA 2STBE 2F83A 1GI9B 1DE7H 2AFQB 1D3PB 2DE9A 2FEQH 3GCHC 3ZVEA 2JETC 1JOUB 3UB0A 3UNSA 4GVUA 4ABJA 1GHYH 4NG9H 1QA0A 1O3EA 1OYTH 3QUMP 1IQMA 4OS4A 2JDID 3BEFB 3PMJA 1HIAB 2GJGA 1AUTC 1O38A 3MNBA 4CHAB 3PLKA 1P06A 1JIMA 2G5NA 2HWLB 1TGSZ 1S6HA 1YM0A 4FUFA 1XMNB 2FTLE 1AKSB 2HOBA 4YM9A 2QA9E 4UD9H 2BXUH 4ABDA 2GV6A 3MU4A 5FHTA 1MABB 3ATMA 1E79D 4DVAU 3ZZDA 3LC3A 1FPHH 1V2JT 3GICB 4Y10E 4WY3A 1SGCA 1G3EA 3VB7A 2XC5A 1K1MA 1GVZA 3E0NB 3PYHA 1Z6EA 2XW9A 3OTJE 4F4OC 3ZVAA 2FTMA 2VH0A 5EXLA 2QC2A 3GY2A 3VEQB 5HGGA 2G5VA 1ZMNA 2BZAA 2FESH 1GJ9B 2ZPQA 2DUCA 3MO3A 4X0WU 1OOKB 1YPMH 1MAXA 1A5GH 1LHFH 3LGYA 4K5ZA 3GCNA 5C67A 1G9IE 3SNEA 2AHME 2QXJA 1K1JA 4X2XA 1NN6A 3A84A 4AFSA 1BT7A 2ALVA 1F0SA 2I6SA 4Q4LA 3BTME 3LPRA 1HXEH 1ZPCA 2ZG0H 3RXMA 3E0PB 2PUXB 4CRGA 1GHXH 4OGXA 1NRQH 4Z1MD 2ZQ2A 3NXPA 2ZU4A 3GDUA 1YY3A 2OINA 2A4GA 2UUJB 1H8DH 3CP7A 4Y8YA 2Y81A 1NFYA 1W3CA 4VGCC 2C8XB 2W6JD 4K1EA 5EQSA 3PV5A 5CHAC 3MMGA 1THSH 2SGQE 2Z9GA 1OWKA 1IHSH 2VIOA 1O2NA 3U28C 2Z7FE 3B8JA 2XBXA 3QN7A 1DOJA 5JBBS 5F6MA 1QJ1B 3ZZ3A 3RXIA 2LELA 1BQYA 4I8HA 3RU4D 4DOQA 2CK3D 3SYJA 1ZYOA 1BHXF 2J95A 4YOGA 1HAXB 4JZIA 1SPJA 2P8OB 3QLPH 5TJXA 1C5ZB 2IN2A 4RN6A 2VINA 4ZXXH 3RC6A 4ABEA 2FOGA 4Y79A 1CA8B 1LHCH 4K1TA 2FI4E 2ZHFH 2BM2A 1HJ9A 1TPOA 4FVBA 2ZFQH 5IDKA 3A8BA 1HFDA 2FLRH 3CS7A 1P2QA 1QCPA 3A88A 1SLUB 4KP0A 1C2FA 4YLQH 2EC9H 5FPTA 4ZXYH 4ISOA 2GX4A 3GY8A 3M61U 3P8NA 2EA3A 4AFZA 1DX5M 2ZGBH 2GCHG 3UQVA 1BCUH 1K0HA 3F2HA 2HVXA 1IQHA 3TK5A 1EFRD 4MPWA 2GCHF 3SV9A 2IPHA 5A09A 9ESTA 1ELAA 3P8GA 1GJBB 5GNDA 1S6FA 2CGAA 3MNSA 7ESTE 4TWWA 3HGNA 2BLWA 1PQ8A 4FUJA 1HDTH 2HPQH 1C1TA 2YMSC 4IGDA 1NS3A 1ZOMA 3E90B 1RTLA 2ZTZA 1LVYA 1O2WA 1AY6H 3LGWA 1PPZA 4FOUC 2GGVB 1CT4E 2WYGA 4X1RU 5HXFA 4AFUA 4O97A 1P9SA 1GHZA 1YLNA 1C1WH 4U2WA 1K1IA 5IK2D 1LHGH 4TPIZ 1UCYK 4Y6DA 5LH8A 3KGPA 3RXAA 2A7JA 2Z6BD 1C5OH 1ELTA 1K21H 2BQ7B 1CT2E 4GCHF 4YTAA 5LPEA 4F55A 1YPHE 2AERH 3ZIAD 1NRSH 4ABFA 4CRFA 1P05A 1WU1A 4I8JA 1MQ5A 3D23A 4I8GA 2PLXA 1YGCH 2EI7A 3DSOA 1EZXC 2CF8H 2FODA 2GVFA 2RA0A 3OYPA 5C3NA 2A7CA 5EW2H 1AFQC 2FOAA 3DHKH 4ZKRU 4KTSA 3PLBA 3SGAE 2CF9H 2NU1E 2PHBA 4DJZB 3SQEE 3EQ0H 1DANH 1GI7B 1FY4A 1NT1A 3OY6U 1SGQE 3BTEE 3P70B 4ZHAA 5C5OA 1THPB 2QIQA 2ZO3H 3E91A 2Y5GA 4NIXA 3F2FA 3UWJH 1O3KA 1F5KU 3GOVB 1TGBA 2SNVA 2JJ1D 1UVOA 3PMBB 3CNRA 1GBEA 1GJAB 1K1NA 3ZVDA 2Z9JA 1O2ZA 2ZDVH 1DWBH 2KFWA 2UWPA 3OU0A 3E8LA 5I46H 4O3UA 3OFND 2BYAX 1CGIE 3ZZ7A 4FU8A 5J4SA 2XRCA 1BTWA 4CHAC 1AE5A 5B6OA 3ODFA 1O5BB 1MTUA 1W7GH 3SBKA 1SMFE 2FPZA 5GDSH 3VXFH 3P6ZB 2QXIA 1ZPBA 3TJVA 4Y8XA 1T8MA 2P59A 1P57B 4BANB 4Y8ZA 1YBWA 1LHEH 1HV7A 1NBME 1FIWA 8LPRA 1NFUA 1OS8A 4CRDA 2TGPZ 3RM0H 4UEHH 4NIYA 3F9EA 1MAYA 1MU8B 4A1TA 5EG4A 1BUIA 2F9VA 1UJ1A 2TGAA 4IW4E 3MH4A 1S81A 1T8LA 3TNTA 2L74A 1AFEH 3I77A 2QYIA 3SQHE 1YCPM 1YF4A 3STIA 1ZRBA 3R3GB 3G01A 3WW7A 5DSFA 4ZHMU 1AD8H 1FY1A 2OBOA 3GDVA 1Y5UT 2Y80A 1C5MD 1J16A 1PPBH 1L0ZA 2CJIA 1W0ZU 3TH2H 4FU9A 1SOTA 4P00A 5C1UA 2GCTB 1P2OA 2BQ6B 4AFQA 1MCTA 2YNBA 1PQ7A 2BOKA 3SUFA 3N7DA 1SGEE 4GSOA 4DURA 1KIGH 3GY6A 3LJJA 3SGQE 2C8YB 3Q3XA 1QL9A 4UDWH 2XNIA 4B2BA 1BHXB 3IG6B 1AIXH 4J1YA 4NSVA 5CE1A 3GY3A 4KELA 1XUGA 4ZCNA 4MPXA 1TGTA 5KECA 2EQNA 3FKSD 3CS0A 3MU5A 2P8OC 5CDFE 2G52A 3M3SA 2ANMH 5FPYA 4I32A 3T62A 2UUKB 2VIDA 3BIVH 3A7ZA 3BTTE 3AW1A 2XBWA 3MH7A 1OPHB 1EUFA 1AZ8A 1PYTC 1A3BH 3ELAH 2WPKS 1GDQA 1T8OA 1W0YH 1C1SA 3ZZ8A 1LQEA 1HNEE 1Y3YA 4DY7B 2RDEA 1L2EA 4DT4A 1O2PA 1A3EH 1OWJA 1TLDA 1MD8A 1YPGH 4Q2KA 5HIYA 1G2MA 3RXBA 3RXQA 3A82A 1O2VA 2BD4A 1V2RT 3WWBA 4CH2B 1GPZA 3I78A 2QGRA 3TPIZ 4B74A 2BHGA 1O5GH 1YCPH 4B71A 4MPVA 3V0XA 2O8LA 4R8TB 1CHOG 4FUDA 1Q2WA 1GBFA 2WSSD 4GLYA 3W95A 1ZMJA 1A0HB 3BN9A 4FUEA 5DP3A 3TLOA 5BPEA 2Z94A 3RXGA 1UTPA 1V2PT 2WZQA 1KTTB 1Y3VA 5DGJA 1KLJH 4WXVA 2J97A 3KQBA 1KY9A 2ODQA 3SUEA 3RXUA 5E0GA 3QZRA 1YPLH 1A61H 4I31A 2VIWA 1GBMA 4NWLA 1P2MA 3RXVA 5HMAA 1BB0B 1BJUA 1BMAA 1BBRK 3MNXA 1T7CA 1TPAE 1CVWH 3NWUA 3BTGE 4YXWD 2BVSH 3T5FH 4ZKOU 1GJ4H 4LK4A 2Y7ZA 3BSQA 1NTPA 1WSSH 1GG6B 4AB8A 1O2YA 3TJOA 4BNRA 1F5RA 2OXSA 5KGOA 2XBYA 1G36A 1XM1A 3FP7E 2JH5D 1SC8U 2LNCA 1LMWB 5GPIB 3BV9B 4D76A 1P0SH 1MQ6A 4BXSA 1TIOA 1V2NT 2R9PA 1UTKA 5A8ZA 3D65E 1V3XA 4TSFD 4HI3A 4BAHB 1DUEA 4CRBA 4B2AA 1W13U 3A80A 2XBVA 4INHA 1O0DH 1O30A 2ZGJA 4AC9A 5EODA 3KCGH 4DT7B 2V3OH 2A4OA 2SGEE 1C2HA 2WPLS 4B73A 2O9QA 4BTIB 3K2UA 1B0EA 2GV7A 2ZDAH 1EPTA 2KCOA 4ASHA 1ZLRA 1W8BH 1DS2E 1O2MA 4K60A 4AYVB 1XXFA 2RG3A 1HAOH 2FX4A 3SZNA 1AZZA 5EQQA 1XXDA 1ZMLA 1O3IA 3QTOH 3A86A 3AW0A 4OS7A 2ASUB 2BD8A 5EJLA 2TBSA 2ZDLA 1EJAA 1KMHB 3VG8A 3F9GA 1C4Y2 1TWXB 2H5CA 1C5QA 2VGCB 4DG4A 2OC0A 3RP2A 2B9LA 5EGMA 3GS9A 1O2TA 1CBWC 3M5MA 4GPGA 4D7FA 2HNTC 2ZIQH 3RLWH 1O2XA 3VB5A 3LIWA 2BDCA 3TGKE 5EPNA 1IQEA 2QF0A 3H09A 1HUTH 3LKWA 1V2WT 1TNGA 3PRBA 1AU8A 4WMFA 2Y5HA 2XCFA 1FZZA 1G30B 2OCVB 5FBIA 1GJ5H 4X8SH 2ZFTA 1ANCA 2OC1A 1O3MA 3KIDU 3S9BA 4TYDA 3KQDA 4MLFB 3F9HA 2BDGA 1F0RA 1P02A 2BLQA 3SV7A 4D9RA 2VWNA 1MD7A 3F68H 4IC6A 3TNSA 3A83A 1Z8IB 4GHTA 3AAVA 4RT0A 1C1VH 4UFDH 4XRNA 3SN8A 3W1EA 4CRAA 3R0FA 3K6ZA 3S9AA 1O3JA 2F9NA 4MQAA 2P16A 5K7RA 2GCTC 1TQ0B 4OS2A 3ZV8A 1QRZA 1FV9A 3ATWA 4FXGH 1Y8TA 1L1JA 2TGTA 2P3FH 1DWCH 1KXFA 2A0QB 2AYWA 1NRNH 3SU3A 2A1DB 1ABIH 1H8HD 1SQOA 2R0KA 1ZJDA 3ZZBA 4E06H 2KM0A 4UE7H 4ZHLU 1LHDH 2CV3A 3FP8E 2GMTB 2FIRH 1ANBA 1V2LT 3L33A 4BAOB 1O5EH 2BY8X 1DY9A 1BOQA 1ESBA 3UIRA 3V13A 4IMQA 1GVLA 2VB0A 1UTMA 4NFEA 4OS6A 2GDDA 4Q7XA 5F53A 2A2QH 3RXFA 5E8EH 4LZ1H 1FDPA 5F8XA 1FY8E 2QF5A 2R2MB 2XOKD 3RXTA 5JBAS 1ABJH 1JIRA 1WQSA 3PO1B 2DE8A 2VU8E 2WINI 4NWKA 1CGHA 3MH5A 3M3VA 2WPHS 1FAKH 2W7UA 2JKHA 1G2LA 2OQUA 2TIOA 1OKXA 1T4VH 1S0QA 3A7WA 1Z8RA 1OX1A 2WYJA 1N6YA 4K69A 1OWDA 2K0QA 2WPIS 5FX5A 5HM2A 2A4QA 1O31A 1O34A 1QHRB 1BRBE 1LKAA 5T3HA 4OS1A 1MKXH 1O32A 1UTJA 2FS8A 3BTWE 1EOJA 3I29A 1VITH 4NA9H 1L1GA 4YOJA 2HNTF 2OC8A 4NIVA 4ZAEA 3SJOA 4JZ1A 4Z0KA 4H4FA 2FZZA 2O8TA 1QB9A 4WH6A 4SGAE 3DSGA 1ZSJA 4KTUA 3F0PA 2F4LA 4ABIA 3A8AA 1XUFA 2AIQA 1S0RA 3FP6E 1SGPE 4JYTA 5EU8A 3UUZA 1BTYA 1YP9A 1V2UT 1KDQA 3RLYH 1ETTH 1C1OA 5HM9A 2JJ2D 1IQKA 1AVWA 1P04A 1GBBA 1MMJN 3OY5U 2Z3CA 1CGJE 2BY6X 3RDZA 3SU2A 2Y5FA 3U98H 3A8DA 3URDA 2Q6FA 1KYNA 1UK2A 3BG4B 3RUOA 2SFAA 3DFLA 4F49A 3PMAB 5GIBA 1EP6A 1GHVH 1MTWA 2PR3A 3DT0H 4JK5A 2GZ8A 2A5KA 3PB1E 1WUNH 1Y3UA 1ZRKA 1O35A 1E34B 5G4BA 4X2VA 1SGDE 1NRPH 1H4WA 1EX3A 4LXBH 1WDIA 2JH0D 2ZHWH 4Q7YA 1BMLA 1THRH 2PUQH 3P95A 2XTTB 1YLDA 2G51A 1EJNA 3EA7A 1TGNA 1C1RA 3RMLH 2D8WA 1TBZH 5FXLA 3ZZ4A 1FONA 5F03A 4DW2U 1QA7A 2YOLA 4ZUHA 2VWLA 2ZKSA 2YMSD 2P94A 3DUXH 2ZCLP 2KZ4A 1SGIB 1N8OB 1XVOA 1O2LA 4KTCA 1MKWK 3C27B 4JZEH 1AB9B 2W3IA 3SGBE 3MNCA 1SGYE 1LVOA 2VGCC 5EJ1A 2BD5A 1GCDA 4ABGA 5JDUB 1F2SE 1GBCA 3KN2A 4JYUH 3JZ1B 2G4TA 2A5IA 3ZVBA 4X8VH 2BB4A 1SGNE 2SGFE 2A5AA 1O2OA 1C5VA 3U8OH 1P12E 4BTTB 2ZFPH 1OXGA 1TPPA 2R2WU 3OE7D 5GJ4B 1Y3WA 1HAVA 3BG8A 2NU0E 4IMZA 1DLKB 2D1JA 2WV4A 3RU4T 3STJA 2BLOA 5A8XA 1ZZZA 1Z6JH 1NO9H 1TNHA 2IOTA 3QK1A 2VVVA 4I86A 4NSYA 5EXNA 4FVDA 4INLA 1YPHC 2HLCA 2O8MA 3LC5A 4YT7H 4X6OA 1V2QT 4WVPE 1VKYA 1SBWA 4U30A 4CR9A 4XBDA 1TX7A 2WV5A 3QO6A 5CMXH 3FFGA 4RI0A 3BF6H 1WBGB 2AGEX 4BAQB 4FU7A 3SU1A 2J5UA 4X8UH 2D26C 2PP6A 4AORA 2ZFSA 4PROA 3E6PH 3GY4A 3VFEA 1OWEA 4GCHG 5B6LA 5DJ7A 1QB1A 2WPMS 1FN8A 5L2ZH 5C1XA 1OHHD 3A81A 2BD7A 3SJIA 1N1LA 1O2UA 1O3CA 3NKKA 1YYY1 5JB9S 5C5NA 2BX4A 2QN5T 1D6WA 1O2RA 1QRWA 2BDAA 3RXPA 3UPEA 1GI8B 1H8IH 1VZQH 2H1UA 1GI0A 1INCA 2BY7X 1LO6A 1ANEA 3V7TA 1YPKH 2TRMA 2KAIA 4GHQA 3TGJE 2M5TA 3DD2H 2PKAB 1MCVA 2BDYA 2GMTC 1TA6A 5A0BA 5ABWA 4Y71A 1GI1A 3TJUA 3VXEH 3S7KB 3RXDA 3U9AH 2C8WB 1SHHB 1P09A 1TOMH 3ENSB 1FN6A 5DP4A 5AF9H 2FOHA 1EJMA 1TAWA 2WPJS 2ZFRH 3Q76A 1HLTH 1ETSH 2BVRH 1TX6A 1ZHMA 4ISNA 4K2YA 4QT8C 1O3DA 2H9TH 1QBVH 1F92A 2BD9A 1N6XA 5FL7D 1HXFH 2ZU1A 4A1VA 1ZSLA 3PO1C 2PKAA 1SOZA 1EATA 3VB4A 2HPPH 3ITIA 1FY3A 3TGIE 1H1BA 1NM6A 2F9BH 3EE0B 1FNIA 3FZDA 2PTNA 3RMMH 3UR9A 3ZZ9A 1AI8H 5EW1H 1GHWH 1IQJA 4Y7AA 1GHAF 1O2GH 1O2HA 1QQUA 1QBOA 1EASA 4XD7D 2PSYA 1UTNA 3QX5H 1GGDB 2L6OA 4FETA 4ZKSU 3SO3A 1SQTA 1UCYE 1G3BA 1GCTB 2PW8H 3ATIA 3FOAA 5C2ZA 1IQFA 1EXFA 2GZ9A 2EEKA 3A8CA 1BRAA 1NROH 2BVXH 4IN2A 5DK1A 3SOSA 1RRKA 1T32A 1P10A 4AG1A 3K9XB 3QZQA 4FUIA 5FCKA 1TNJA 5C94A 2ZA5A 3UOPA 4X1SU 3V3MA 1GWAA 4MNVA 2KCAA 5E0JA 1S82A 5C1YA 3H5CB 5GXPA 1EP5A 5C0UA 1PPEE 1VJAU 4K8BA 2G81E 4ZROA 1FLEE 5EPYA 3P17H 3GYLB 4D9QA 3N7EA 1FIZA 1OP8A 7LPRA 1WQVH 1Z8JB 1HAPH 3AAUA 3EAJA 1ELEE 1PQAA 3MHWU 1H8ED 3MU0A 2OBQA 3FAOA 1PYTD 1PQ5A 1DUAA 3BG4C 4B6FA 1C5RA 1XUIA 1WTHD 1KXCA 2A7HA 1WOFA 3KQEA 5EOKA 2ZPRA 1UMAH 3TITA 1SHYA 5AFZH 1J9CH 1VCWA 3GCOA 3IITA 1C5LH 1E0FD 3HK3B 4JYVH 5E0HA 4A92A 2FOEA 2ZI2H 7KMEH 1NFXA 1SQRA 1VCPA 3LGIA 4GUXA 2W7SA 1GBDA 4H6TA 1EOLA 3PRDA 2OTVA 1CQQA 1BRCE 1O5AB 2IPQX 2QE7D 1QRXA 1NFWA 1O5FH 4K3JA 1C5UA 1F0UA 4TT3D 2ZHDA 3RC5A 3VB3A 1DDJA 3O8RA 1GHBF 4X2WA 1BTZA 1GJDB 1N8OC 3P8OA 2C3SA 2FO9A 1VR1H 3BIUH 3U1JB 1A1RA 1P3CA 1EB1H 4ABHA 2PGQB 6ESTA 3MO6A 1GBIA 1SG8B 4K1SA 4E7RG 3P92A 4HG6A 2ALPA 5HIZA 3FANA 1IQIA 3SNAA 4IN1A 3N7OA 1W10U 2J9NA 4Z6AH 1GBLA 2FOBA 4ZMAH 1SGTA 2OK5A 3TK6A 1W11U 1B7XB 3LGUA 3SORA 4YO9A 1WAYB 4ABBA 8GCHG 3HPTB 3PROA 1T31A 2GTBA 1O2SA 3D62A 4HZHA 1MKXK 1MTSA 8GCHF 5DO4H 3QTVH 2J2UA 2VBCA 2ZDKA 4I8LA 3UNQA 4ZKNU 4D7GA 1LKBA 1RD3B 4AGKA 2HLDD 1FUJA 2XXLA 1E37B 1P03A 1ZTLA 2F3CE 1MBQA 1GBJA 5C20A 1EZQA 3HATH 3KEEA 3FN8A 1W7XH 1AGJA 4Y11E 1W2KH 1FMGA 1P2KA 1S5SA 1O5DH 1BRUP 1C5WB 3MFJA 2Y7XA 1O2IA 5A2MH 5J4QA 3UQOA 1EAWA 4B76A 2ZEBA 3T27A 1P11E 2EI8A 1D9IA 1NU7B 1E35B 1W0JD 1BZXE 3M36A 4GAWA 1K22H 1UCYH 1QQ4A 3VPKA 4CREA 1FPCH 1AVGH 2LP6A 3F3BA 2P93A 1JRTA 1ETRH 3L3TA 4X1QU 2PV9B 5PTPA 1SLVB 3FVFB 1HJ8A 5FBEA 4NA8A 3RMNH 1UVTH 1EPTB 1A5HA 1ZTJA 2A31A 5L6NH 1SGFA 4WH8A 1A0JA 1LCYA 3M7TA 1Q3XA 4IC5A 1XUJA 2QXHA 4WXIA 2Z9KA 4P02A 1B0FA 3ZZCA 1AN1E 1LQDB 3NK8A 2CHAB 1JMOH 2ESTE 3M5NA 1C2GA 1TNIA 4Y0YE 4X6MA 1PPHE 1DY8A 2VIPA 3OEHD 3RXJA 4BTUB 5A0CA 4MPUA 4A1XA 5T6GA 4D8NA 3ODDA 2UWLA 2WPDD 1LVMA 4AOQA 3QGJA 3SNCA 1PFXC 1TABE 5DPAA 2ZECA 4K8YA 3NZIA 3SU5A 1O3LA 2CN0H 3V12A 3AK5A 7GCHG 3T2NA 3PWCA 2KCPA 3M5OA 1SLXB 4Q63A 3SHCH 7GCHF 3QGNB 4KKDA 3MU8A 1EZSC 2HRVA 1Z7KA 1XUHA 1O3BA 1XKAC 1GJ6A 3FO8D 1DM4B 1CSOE 1DT2A 4H6SB 3ZZ6A 3E16B 2ODPA 5GCHF 1GGDC 1TMUH 3UOUA 1G37A 3KL6A 1C4V2 1GCTC 1O39A 1HAZB 2P95A 2JIZD 1UTLM 3ZVFA 5IYTA 1BBRE 1KLIH 5T6FA 2FM2A 4LOYH 4DIHH 1Z8GA 4LZ4B 5A0AE 1ZHPA 3RM2H 2WHXA 2C93B 1GL1A 2ZTXA 1BITA 3BTHE 2RCEA 3SJ8A 2Z3DA 3M7UA 1K1OA 1K9OE 1BIOA 1MH0A 4OGYA 1EKBB 5L30H 1P01A 1TE0A 2FDAA 3Q77A 1OP2A 1O2KA 1Z1IA 1ZTKA 3SJKA 4O9VA 2VIQA 1SL3A 1WYKA 1DXWA 2WUBA 1GMCG 3B23B 1O3HA 1C9PA 1QFKH 2Q6DA 1FXYA 2GDEH 3SNBA 2ZU5A 1GMCF 3EA9A 4UFFH 3KQ5A 1QTFA 1L1NA 3SV2H 3ATKA 4X6PA 1K1PA 1TBQH 2ZF0H 4JK6A 4TPYA 1TOCB 2BQWB 3GCTG 1VITG 1F7ZA 1Y3XA 3SZEA 3OTPA 3GCTF 1VITF 1GI6A 3VGCB 1MTNB 1ZJKA 3BEIB 3O8DA 4AGJA 3F2GA 3M35A 2ZFFH 4ZH8A 3F6UH 3GDSA 1F0TA 3PV2A 1W14U 2ZHEH 3D49H 1CA0B 2IJD1 4TWYA 2H2ZA 4UFEH 4J2YB 2H9EH 3LH3A 3ESTA 1QURH 3O8BA 1PPFE 2FYRA 4FUGA 1UK4A 1TX8A 4BXWA 4UFGH 2ZPSA 1GI2A 5L2YH 3PWBA 3OEED 1A5IA 4MNWA 1RTKA 4O03A 1A2CH 5E2PA 1HJAB 1AVXA 1ANDA 2ILNA 1UVUH 3JZ2B 2J34A 2I6QA 1ELGA 1ORFA 4XFQA 5F8ZA 1QIXB 3QWCH 1DSUA 5F8TA 4XSKU 1YWUA 2THFB 1NY22 1V2ST 1QJ7B 4AB9A 2GZ7A 1S84A 2FI5E 2QXGA 2ZP0H 2WV9A 3M3TA 3F9FA 4DGJA 2BX3A 1CE5A 1FY5A 4THNH 1S83A 2QF4A 2ZU2A 3MTYA 2B8OH 1TMTH 1DLEA 1A4WH 1BMMH 3UTUH 1HB0B 4A7IB 1KDQB 2FS9A 1BTHH 1K1LA 2ODYB 4FUCA 3UWIA 2QV1A 5CHBA 2A45B 3GY5A 1P2JA 4NZQA 2XC4A 1MU6B 2PSXA 4NFFA 1ELVA 1PJPA 3W94A 1C2DA 3MYWA 1HIAA 3C1KA 4AZ2B 3OAAD 1QZ8A 9LPRA 1UO6A 3A7VA 2A32A 1MZAA 1NESE 1BTXA 5E2OA 2FLBH 2VVUA 1AKSA 4BAMB 1Z1JA 2QF3A 1MBMA 3UFAA 2OLGA 2VNTA 5A8YA 5TCCA 1IQGA 1SQAA 1X7AC 2NU4E 2NU3E 1LDTT 4F48B 3LONA 4JMYA 2R0LA 3UR6A 3PV4A 5FCRA 1BBRH 1GG6C 1IHTH 1SVPA 3IWMA 1WV7H 1XUKA 1WXRA 4XDEA 1GJ7B 4RSPA 5DN6D 2W26A 3L6PA 1EPTC 1DWDH 5DKMA 3RXSA 1FI8A 4IBLH 3SU4A 1BTUA 2QCYA 2XWBI 1QGFA 1C5TA 3H7OA 4HGCA 4X1NU 1E36B 3H7TA 5I25A 3NCLA 4WMEA 2H5DA 2CHAC 4Q7ZA 1UTQA 2SNWA 2BMGB 2XCNA 2J38A 3TH4H 1IQNA 1UK3A 3MQKC 1YC0A 3TIUA 2ZNKH 3S9CA 4SGBE 1HGTH 2ZQ1A 4FUHA 3A7XA 1DWEH 1S6LA 2VWOA 2ZC9H 2ZCKP 3LDXH 4DIIH 3LH1A 1C1NA 1O2JA 3EE7A 4NA7A 4X6NA 1D3QB 2J94A 5DP9A 1NZQH 5KEDA 1EQ9A 2R3YA 3P8FA 3B9FH 3ZZ5A 1TQ7B 1HAVB 4ISHH 4B1TA 2PGBB 3KYFA 3TU7H 2SGPE 1OSSA 2EY4C 1QR3E 1HRTH 1LPKB 1VCQA 1IQLA 3U8TH 2WUCA 2Y6TA 3SI4H 1C4U2 1IAUA 1TB6H 2VIVA 4CR5A 3RXHA 1KSNA 1Z71A 3SNDA 3TJNA 1AWFH 5K0HA 1Y5AT 1MTVA 1AHTH 2G00A 1ELDE 4BOHA 1C5SA 3T28A 5FAHA 1GMDG 1GMHG 1P2NA 1NRRH 1KLTA 1O5CB 2J98B 1O2QA 1YCPK 1C9TA 1FJSA 1GMDF 1GMHF 1XVMA 2W3KA 1O37A 2AMPA 2BTCE 1GBTA 5EXMA 1ELBA 3Q00A 1O3GA 3ZVCA 2GD4B 2AS9A 2SGAA 2LPRA 3AVZA 3U1IB 1L4ZA 5FX6A 2AGGX 2AEIH 4CBOA 1C2MA
chains in the Genus database with same CATH topology
1ELCA 5DP8A 5AVDA 5EQRA 1CU1A 2H9HA 2V0BA 3HGPA 5SGAE 2FP7B 1ELFA 2XC0A 2KAIB 3KQCA 2BXTH 1L4DA 4Q80A 1RFNA 1SGFG 4XE4A 3RU4E 1DITH 1PPGE 2AMQA 1UTOA 1H9LB 1P2IA 1CO7E 3RXCA 3BTKE 3Q3KA 1BA8B 3KHVA 2ZGCA 1ZSKA 1ZPZA 2RDLA 1C2JA 1V2TT 4B75A 4WJG2 2F9UA 2SGDE 1MTNC 3VGCC 4YZUA 1G32B 1HPGA 5JBCS 1E38B 3MI4A 1C1UH 1CA0C 2NWNA 2EI6A 3A85A 2G8TA 2Q6GA 2ZU3A 1KXBA 3ZVGA 1XX9A 3URCA 3PLPA 4O3TA 6CHAB 1PPCE 3BEUA 3TK9A 1GBHA 4RKJB 1HJAC 1C5YB 1HBTH 4UONA 1F5LA 1TNKA 2ZHQH 3RXLA 3OX7U 2ANYA 2BD3A 2OUAA 2HGTH 2FXRA 3SW2B 1NPMA 4I8KA 3U8RH 2V3HH 2BDBA 4OS5A 1AWHB 1C2EA 1GHAG 1TGCA 1AO5A 1CHGA 2GKVE 1P3EA 4DCDA 6LPRA 2JH6D 1H9IE 4NZLA 3GY7A 1A0LA 1GDUA 1RIWB 2ZDNA 1O3OA 4IS5A 1B5GH 3K65B 1V6DA 3KF2A 1UVSH 2B7DH 4INKA 2D2DA 2AMDA 4CBNA 4AYYB 2FX6A 3LOXA 1LTOA 1TYNA 4ISIH 1CBWB 1QL8A 4NCYA 3SUGA 4E7NA 5LPRA 1S85A 5ESTE 1VGCB 1RS0A 1WTGH 2Q1JA 3BTQE 3SHAH 3RXOA 8KME2 2O8WA 4RKOB 3RXEA 3S0NA 1OWIA 1EAUA 3MOCA 2J4IA 2ZGHA 2FOFA 3F1SB 1C5XB 1Y59T 3QDZB 1Y5BT 2ZCHP 1GJ8B 4YOIA 2V6NA 4MNXA 1GDNA 6GCHG 2FOCA 3HKJB 1QL7A 3E3TA 3PTNA 1GBAA 3ZYEA 4ABAA 6GCHF 1MUEB 4TY7A 1TRYA 2PKSB 2PWXA 4B2CA 1EAIA 3MWIU 4XBCA 2ZTYA 2A2XH 1M9UA 2V35A 1BMNH 1CT0E 5ESBA 2ULLA 5TCAA 2ZWLH 1DICA 1SB1H 2BLVA 2VVCA 2ANKH 3LT3A 2K1QA 2CMYA 3Q3YA 3EA8A 1WCZA 1KXDA 2BDIA 1ACBE 4U32A 3ATLA 2Y82A 4JZDH 4X2YA 1P9UA 3CENA 1RGQA 3SUDA 3HKIB 4WWYA 1U6QA 3SU6A 2ANWA 2VH6A 1GHBG 1BDAA 1TBRH 3AASA 4U01A 3SI3H 5LGOA 1EZUC 3FZZA 1AB9C 3GCHB 1DXPA 1DPOA 1FQ3A 2JETB 1NC6A 1W12U 2B0FA 1JWTA 3LU9B 2P3UB 1UHBB 1MKWH 4NGAH 5H4IB 2UUFB 3A7YA 3O8CA 5DG6A 1ESTA 1VJ9U 3ZZAA 2A4RA 1AMHA 4WMDA 2ZGXH 3MU1A 2GP9B 3WY8A 1YPEH 1KXAA 2Z9LA 3A87A 2PFEA 3RXRA 2OD3B 1GI3A 4WF8A 2GT8A 1HYLA 1A46H 2FMJA 2XWAA 3S69A 2OQ5A 3ZYDA 1ESAA 3UY9A 5DP7A 1UHBA 1HCGA 4H42U 4YESB 3RXKA 3T26A 2BY5X 1C2IA 2BD2A 4FUBA 3M37A 1ID5H 1JBUH 3E1XB 2P3TB 1GI5A 1RJXB 1TONA 1SR5C 2OC7A 5AFYH 3A7TA 3DFJA 4MNYA 3A89A 3VB6A 1C2KA 1YPJH 1ZGIA 2UUYA 1J8AA 2RA3A 4MTBA 1LPZB 1CHOF 1J14A 4A6LA 3GISB 3LGVA 1TMBH 1QBNA 1TA2A 8ESTE 2STAE 1QY6A 2F9OA 3EYDA 1O36A 1G3DA 2G4UA 1GL0E 2OP9A 1K2I1 1GVKB 3UNRA 2FYQA 5LPFA 1C1QA 2NU2E 1TFXA 1O3PB 1SFQB 1D3DB 3PMHB 2H6MA 1ZGVA 4ISLA 2FWWA 1O3FA 2BDHA 2Z3EA 3RMOH 1DFPA 3M7QA 4YT6H 1GBKA 2AGIX 2FI3E 3GYMA 1KXEA 1UVPA 4Y76A 4XBBA 4AG2A 4VGCB 3T29A 3TVJB 1V2VT 2PTCE 3UREA 5CHAB 2TGDA 3PTBA 1KTSB 1AE8H 6CHAC 1HAGE 2AH4X 4TY6A 2F91A 4R0IA 1V2OT 1V2MT 3SJ9A 5BRRE 3PM3A 4MG3A 2C90B 2C8ZB 3KNXA 5DP5A 4X1PU 3BTDE 5T6DA 3ZV9A 1RXPA 3NPSA 1BJVA 1H9HE 4JZFH 3EDXB 1DVAH 4HTCH 4I33A 3U69H 5GCHG 3MO9A 1RTFB 5JB8S 4ESTE 3SV6A 1O3NA 1RIWC 5AHGH 3K6YA 4CRCA 2VWMA 1BTPA 2J92A 1HAHH 3OSYA 4Y0ZE 1FAXA 4KGAA 1AQ7A 2BY9X 2CXVA 4M7GA 2FOMB 1QB6A 4E05H 1SI5H 3S7HB 1TRMA 4MDSA 3HK6B 1ARCA 1VGCC 3MH6A 1SGRE 1ZR0A 1EB2A 1HAIH 1LPGB 1GI4A 1D6RA 3EGKH 1SLWB 1JXPA 1TNLA 1ARBA 2TPIZ 3RC4A 2VJ1A 1QJ6B 4X8TH 5JBTA 2QY0B 1TALA 1OYQA 1NU9A 1T4UH 1C5PA 3NUMA 1G3CA 1LVBA 1MZDA 1C1MA 4Y7BA 2C4FH 1O33A 1T8NA 2ZDMA 1SSXA 2F9PA 1C2LA 2HNTE 2PKSC 4AN7A 4XOJA 1V2KT 1TRNA 2O8UA 2W5EA 5DP6A 2Z9IA 1O3AA 2IJOB 4YLUA 1K28D 3TH3H 2G55A 1ZHRA 2AIPA 3DA9B 1QNJA 4MVNA 3SV8A 3BTFE 1Q31A 4BAKB 1C5NH 1XKBC 1YLCA 1AUJA 2ZZUH 1EAXA 1C1PA 3LJOA 4NIWA 5FPSA 3LGTA 5ETXA 5JYIA 2BZ6H 2YNAA 4A5TS 4AX9H 1JRSA 2XYAA 1HAYB 1J17T 1D3TB 5HYOA 1A7SA 1OP0A 2QAAA 3SU0A 5JPMH 1IOEA 1DSTA 3T25A 1D4PB 2B5TB 2UWOA 5GWZA 1SFIA 1AFQB 4HFPB 1GJCB 2BOHB 1P8VC 1TPSA 2R3UA 1J15A 4I7YH 2HALA 3M5LA 1YKTA 4CH8B 2GT7A 1OWHA 4JCNA 2STBE 2F83A 1GI9B 1DE7H 2AFQB 1D3PB 2DE9A 2FEQH 3GCHC 3ZVEA 2JETC 1JOUB 3UNSA 4GVUA 4ABJA 1GHYH 4NG9H 1QA0A 1O3EA 1OYTH 3QUMP 1IQMA 4OS4A 3BEFB 3PMJA 1HIAB 1AUTC 1O38A 3MNBA 4CHAB 3PLKA 1P06A 1JIMA 2G5NA 2HWLB 1TGSZ 1S6HA 1YM0A 4FUFA 1XMNB 2FTLE 1AKSB 2HOBA 4YM9A 2QA9E 4UD9H 2BXUH 4ABDA 2GV6A 3MU4A 5FHTA 3ATMA 4DVAU 3ZZDA 3LC3A 1FPHH 1V2JT 3GICB 4Y10E 4WY3A 1SGCA 1G3EA 3VB7A 2XC5A 1K1MA 1GVZA 3E0NB 3PYHA 1Z6EA 2XW9A 3OTJE 4F4OC 3ZVAA 2FTMA 2VH0A 5EXLA 2QC2A 3GY2A 3VEQB 5HGGA 2G5VA 1ZMNA 2BZAA 2FESH 1GJ9B 2ZPQA 2DUCA 3MO3A 4X0WU 1OOKB 1YPMH 1MAXA 1A5GH 1LHFH 3LGYA 4K5ZA 3GCNA 5C67A 1G9IE 3SNEA 2QXJA 1K1JA 4X2XA 1NN6A 3A84A 4AFSA 1BT7A 2ALVA 1F0SA 2I6SA 3BTME 3LPRA 1HXEH 1ZPCA 2ZG0H 3RXMA 3E0PB 2PUXB 4CRGA 1GHXH 4OGXA 1NRQH 2ZQ2A 3NXPA 2ZU4A 3GDUA 2OINA 2A4GA 2UUJB 1H8DH 3CP7A 4Y8YA 2Y81A 1NFYA 1W3CA 4VGCC 2C8XB 4K1EA 5EQSA 5CHAC 3MMGA 1THSH 2SGQE 2Z9GA 1OWKA 1IHSH 2VIOA 1O2NA 2Z7FE 3B8JA 2XBXA 3QN7A 1DOJA 5JBBS 5F6MA 1QJ1B 3ZZ3A 3RXIA 4I8HA 1BQYA 3RU4D 4DOQA 1ZYOA 1BHXF 2J95A 4YOGA 1HAXB 4JZIA 1SPJA 2P8OB 3QLPH 5TJXA 1C5ZB 2IN2A 4RN6A 2VINA 4ZXXH 3RC6A 4ABEA 2FOGA 4Y79A 1CA8B 1LHCH 4K1TA 2FI4E 2ZHFH 2BM2A 1HJ9A 1TPOA 4FVBA 2ZFQH 5IDKA 3A8BA 1HFDA 2FLRH 3CS7A 1P2QA 1QCPA 3A88A 1SLUB 4KP0A 1C2FA 4YLQH 2EC9H 5FPTA 4ZXYH 4ISOA 2GX4A 3GY8A 3M61U 3P8NA 2EA3A 4AFZA 1DX5M 2ZGBH 2GCHG 3UQVA 1BCUH 2HVXA 1IQHA 3TK5A 4MPWA 2GCHF 3SV9A 2IPHA 5A09A 9ESTA 1ELAA 3P8GA 1GJBB 1S6FA 2CGAA 3MNSA 7ESTE 4TWWA 3HGNA 2BLWA 1PQ8A 4FUJA 1HDTH 2HPQH 1C1TA 4IGDA 1NS3A 1ZOMA 3E90B 1RTLA 2ZTZA 1LVYA 1O2WA 1AY6H 3LGWA 1PPZA 2GGVB 1CT4E 2WYGA 4X1RU 5HXFA 4AFUA 4O97A 1P9SA 1GHZA 1C1WH 4U2WA 1K1IA 1LHGH 4TPIZ 1UCYK 4Y6DA 5LH8A 3KGPA 3RXAA 2A7JA 2Z6BD 1C5OH 1ELTA 1K21H 2BQ7B 1CT2E 4GCHF 4YTAA 5LPEA 1YPHE 2AERH 1NRSH 4ABFA 4CRFA 1P05A 1WU1A 4I8JA 1MQ5A 3D23A 4I8GA 2PLXA 1YGCH 2EI7A 3OYPA 1EZXC 2CF8H 2FODA 2GVFA 2RA0A 5C3NA 5EW2H 2A7CA 1AFQC 2FOAA 3DHKH 4ZKRU 4KTSA 3PLBA 3SGAE 2CF9H 2NU1E 2PHBA 4DJZB 3SQEE 3EQ0H 1DANH 1GI7B 1FY4A 1NT1A 3OY6U 1SGQE 3BTEE 3P70B 4ZHAA 5C5OA 1THPB 2QIQA 2ZO3H 3E91A 2Y5GA 4NIXA 3UWJH 1O3KA 1F5KU 3GOVB 1TGBA 2SNVA 1UVOA 3PMBB 1GBEA 1GJAB 1K1NA 3ZVDA 2Z9JA 1O2ZA 2ZDVH 1DWBH 2UWPA 3OU0A 3E8LA 5I46H 4O3UA 2BYAX 1CGIE 3ZZ7A 4FU8A 5J4SA 2XRCA 1BTWA 4CHAC 1AE5A 5B6OA 3ODFA 1O5BB 1MTUA 1W7GH 3SBKA 1SMFE 2FPZA 5GDSH 3VXFH 3P6ZB 2QXIA 1ZPBA 3TJVA 4Y8XA 1T8MA 2P59A 1P57B 4BANB 4Y8ZA 1YBWA 1LHEH 1HV7A 1FIWA 8LPRA 1NFUA 1OS8A 4CRDA 2TGPZ 3RM0H 4UEHH 4NIYA 3F9EA 1MAYA 1MU8B 4A1TA 5EG4A 1BUIA 2F9VA 1UJ1A 2TGAA 4IW4E 3MH4A 1S81A 1T8LA 3TNTA 1AFEH 3I77A 2QYIA 3SQHE 1YCPM 1YF4A 3STIA 1ZRBA 3R3GB 3G01A 4ZHMU 1AD8H 1FY1A 2OBOA 3GDVA 1Y5UT 2Y80A 1C5MD 1J16A 1PPBH 1L0ZA 2CJIA 1W0ZU 3TH2H 4FU9A 1SOTA 5C1UA 2GCTB 1P2OA 2BQ6B 4AFQA 1MCTA 2YNBA 1PQ7A 2BOKA 3SUFA 4DURA 1SGEE 4GSOA 1KIGH 3GY6A 3LJJA 3SGQE 2C8YB 3Q3XA 1QL9A 4UDWH 2XNIA 4B2BA 1BHXB 3IG6B 1AIXH 4J1YA 4NSVA 5CE1A 3GY3A 4KELA 1XUGA 4MPXA 1TGTA 3CS0A 3MU5A 2P8OC 2G52A 3M3SA 2ANMH 5FPYA 4I32A 3T62A 2UUKB 2VIDA 3BIVH 3A7ZA 3BTTE 3AW1A 2XBWA 3MH7A 1OPHB 1EUFA 1AZ8A 1PYTC 1A3BH 3ELAH 2WPKS 1GDQA 1T8OA 1W0YH 1C1SA 3ZZ8A 1LQEA 1HNEE 1Y3YA 4DY7B 1L2EA 1O2PA 1A3EH 1OWJA 1TLDA 1MD8A 1YPGH 4Q2KA 1G2MA 3RXBA 3RXQA 3A82A 1O2VA 2BD4A 1V2RT 4CH2B 1GPZA 3I78A 2QGRA 3TPIZ 4B74A 2BHGA 1O5GH 1YCPH 4B71A 4MPVA 3V0XA 2O8LA 4R8TB 1CHOG 4FUDA 1Q2WA 1GBFA 4GLYA 3W95A 1ZMJA 1A0HB 3BN9A 4FUEA 5DP3A 3TLOA 5BPEA 2Z94A 3RXGA 1UTPA 1V2PT 1KTTB 1Y3VA 5DGJA 1KLJH 4WXVA 3KQBA 1KY9A 2ODQA 3SUEA 3RXUA 5E0GA 3QZRA 1YPLH 1A61H 4I31A 2VIWA 1GBMA 4NWLA 1P2MA 3RXVA 5HMAA 1BB0B 1BJUA 1BMAA 1BBRK 3MNXA 1T7CA 1TPAE 1CVWH 3NWUA 3BTGE 2BVSH 3T5FH 4ZKOU 1GJ4H 4LK4A 2Y7ZA 3BSQA 1NTPA 1WSSH 1GG6B 4AB8A 1O2YA 3TJOA 4BNRA 1F5RA 2OXSA 2XBYA 1G36A 1XM1A 3FP7E 2JH5D 1SC8U 2LNCA 1LMWB 5GPIB 3BV9B 4D76A 1P0SH 1MQ6A 4BXSA 1TIOA 1V2NT 2R9PA 1UTKA 5A8ZA 3D65E 1V3XA 4BAHB 4HI3A 1DUEA 4CRBA 4B2AA 1W13U 3A80A 2XBVA 4INHA 1O0DH 1O30A 2ZGJA 5EODA 3KCGH 4DT7B 2V3OH 2A4OA 2SGEE 1C2HA 2WPLS 4B73A 2O9QA 4BTIB 3K2UA 1B0EA 2GV7A 2ZDAH 1EPTA 4ASHA 1ZLRA 1W8BH 1DS2E 1O2MA 4K60A 4AYVB 1XXFA 2RG3A 1HAOH 2FX4A 3SZNA 1AZZA 5EQQA 1XXDA 1ZMLA 1O3IA 3QTOH 3A86A 3AW0A 4OS7A 2ASUB 2BD8A 2TBSA 2ZDLA 1EJAA 3F9GA 1C4Y2 1TWXB 2H5CA 1C5QA 2VGCB 4DG4A 2OC0A 3RP2A 2B9LA 5EGMA 1O2TA 1CBWC 3M5MA 4GPGA 4D7FA 2HNTC 2ZIQH 3RLWH 1O2XA