2ILNA

Crystal structure of the bowman-birk inhibitor from snail medic seeds in complex with bovine trypsin
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Crystal structure of the anticarcinogenic Bowman-Birk inhibitor from snail medic (Medicago scutellata) seeds complexed with bovine trypsin
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 47
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ilnA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ilnA02
1DS2E 4LXBH 4OGYA 4I8KA 5J4QA 1O2OA 3K6ZA 1WAYB 2ZDVH 1BT7A 1BHXB 2CMYA 3P92A 5CE1A 1AFEH 2THFB 3GICB 3TH2H 2P95A 1A4WH 4CRDA 2ZQ2A 3V7TA 2Y6TA 3MU4A 4X2WA 1NM6A 1GJAB 1OYTH 4GHTA 4WXIA 3RXQA 2ZHFH 2VIWA 4XBDA 4Y7AA 2AIPA 1ELEE 1ZPZA 2A7CA 3QN7A 3UOUA 3ATKA 2R2WU 1GMHG 2OC8A 2HNTC 1V2VT 2TRMA 4WH8A 1DITH 3S9CA 4MPXA 1OWDA 1GBFA 2J4IA 4F49A 4YO9A 1EJAA 2ULLA 4ASHA 3T5FH 1MKWH 1O3CA 3F9HA 3Q77A 2F9OA 3GOVB 2D2DA 1AMHA 1DX5M 1LVMA 1C5MD 3BTFE 4RN6A 2J94A 1D3QB 1OX1A 3A83A 1W7GH 3F6UH 1UK4A 2ZC9H 4AFQA 4B71A 2NU0E 3PLPA 1H1BA 1G3DA 2WPMS 4E05H 5JBAS 1BA8B 2PUXB 4BAKB 4UONA 2AMDA 3M3VA 5EU8A 3B8JA 4ABIA 2ZU4A 1CGIE 3T28A 1UTQA 2A5IA 1PFXC 3AASA 1KYNA 1W13U 3SBKA 3BTME 4Y71A 1ZTKA 3SQHE 1XX9A 4X6PA 3SW2B 1K28D 1BDAA 1NRSH 1P2OA 2GZ7A 1TABE 1ZRBA 2CJIA 2LNCA 2VVUA 3RXGA 3SJKA 9LPRA 4R0IA 3QK1A 2H6MA 4A6LA 1AVWA 3L3TA 1AE8H 2G52A 2PR3A 3GDUA 3E91A 5C5NA 3A87A 1O2XA 1SQTA 4NSVA 3DFLA 3SNDA 3UTUH 3ZVDA 5C67A 4UDWH 1P8VC 2GMTC 1AWFH 1SGIB 3I78A 4K69A 3TH3H 5ABWA 4AN7A 2H1UA 2NU3E 1O36A 1LDTT 3SNCA 1BTXA 4LK4A 1O2ZA 3BTTE 1O3MA 4ZHAA 1D6RA 3PROA 3A84A 1ESAA 4Y0YE 4FUHA 1KTTB 4IC5A 4X1RU 1P3CA 3RXCA 1IQNA 1K2I1 1V2UT 1V2ST 5F03A 3ENSB 2R3UA 5FBIA 2A7HA 2EI8A 1YPLH 3ZZ4A 1O2MA 4A1VA 2XBWA 1O2UA 2ZPRA 3STJA 1EJNA 3QDZB 1C9TA 2QXHA 3D65E 2C4FH 2FTLE 3LDXH 3Q00A 1TRNA 3MWIU 1TALA 1L1JA 4I7YH 2ZHDA 4I33A 1CT4E 1HAPH 1CBWB 5T6FA 1GDUA 2VIQA 2GV6A 4GCHF 2Z9GA 1G3CA 1M9UA 5DP6A 4B2AA 2Z3CA 4ABBA 1O5FH 2OCVB 2W7SA 3SHCH 1QJ6B 1JRTA 2CHAB 2J38A 4MLFB 3E16B 1YLDA 1XXDA 1J8AA 1O0DH 2Y82A 5FPYA 2VIPA 1F92A 5CHAB 1O3FA 4HZHA 3P8OA 2XBXA 5A8YA 2FOEA 2ZF0H 1AU8A 2R9PA 2ZGXH 3SQEE 3TIUA 4FVBA 4BXWA 3O8CA 1FY1A 1ZSKA 2ANMH 1EAXA 1TIOA 1PJPA 2ODPA 4TWWA 3SORA 2VIDA 1P03A 5JB8S 3K2UA 1O38A 2AS9A 2PKAA 2PV9B 4NIWA 4NIVA 1GI3A 1UHBB 1HBTH 2BZ6H 2HNTF 8KME2 5JBCS 1BRAA 2J9NA 2I6QA 2QGRA 4A7IB 2F9PA 1V2KT 1O3GA 2AFQB 4MPUA 1NFWA 3ZZ8A 1VZQH 1X7AC 4RKOB 3ZZAA 1K1MA 1QB1A 2UWPA 5EXMA 3PLKA 1V2JT 3TK6A 1TMUH 3TNTA 3RP2A 1RTLA 2VH0A 1KXFA 1O2GH 1S82A 2NU4E 4E7NA 3RC5A 1UCYK 3SU5A 4GUXA 1Z1JA 3CP7A 1ZTJA 2BXUH 2D26C 3PMHB 3SUEA 1SLXB 2NWNA 1C2MA 1P0SH 4ZUHA 1K22H 2ZFRH 2V6NA 2FOBA 3M36A 1NRQH 1HXFH 1O5DH 2AYWA 4IN2A 3EDXB 2A4OA 1QRWA 5FCKA 1N8OC 3FANA 4TWYA 1IQIA 1YPHC 3GDSA 1ZJDA 1HAOH 1B0FA 1O5GH 3M7UA 1RS0A 3K65B 3R3GB 5A8XA 1HJAB 5C1YA 3ZYEA 3RLYH 1VITF 1TNGA 4JK5A 2ZWLH 2RDLA 2Z94A 1SLWB 1Z1IA 4ABHA 1EAWA 3B9FH 1FMGA 4O3TA 3UNQA 3A7WA 2F91A 4MNWA 5DKMA 4A1XA 2H9TH 1MUEB 1T4VH 4AX9H 1YPMH 1GMDG 1GWAA 3MU1A 5LPEA 1CQQA 3HGNA 1GBKA 1BB0B 3BTWE 3EA9A 2P8OC 1J9CH 3MTYA 3RLWH 4X2XA 2SGFE 1QBOA 1TOMH 1GJ9B 1YP9A 4UE7H 1VCWA 1YPGH 4XFQA 4NIYA 4B73A 1JIRA 4K60A 2EA3A 3TITA 5DP5A 3U9AH 4AORA 2BDIA 1DM4B 2Z3DA 1CO7E 5HM2A 1GBDA 4ZROA 4QT8C 1LVBA 2ZU3A 4JZIA 2PWXA 3F9EA 1GPZA 1C2HA 1HB0B 1DOJA 3OX7U 2GCHG 1NFYA 4UFGH 3PMBB 4GVUA 1WTGH 3GCHB 3LH3A 1WQVH 2PUQH 3L6PA 3GY4A 4BANB 3KQCA 4DIHH 1F2SE 1GDQA 2ZFFH 3QLPH 3T2NA 4WMFA 2Z3EA 1O32A 2D8WA 3PM3A 2VWOA 3DT0H 2SFAA 4D9RA 2ZU2A 3QTOH 2A2QH 1IQMA 1O3HA 3ZVCA 3GCOA 5DG6A 2A7JA 1ETSH 1BQYA 1H8DH 2ZGBH 2JETC 4NFFA 2SGQE 1DUAA 2ILNA 4IMZA 4INLA 4WH6A 1C1NA 3VGCC 2F9BH 3P6ZB 2BVXH 1KXCA 1PPGE 5EPYA 3PO1C 1BMMH 4B76A 4X8UH 2QN5T 1QJ7B 4NG9H 2QF0A 1SI5H 2C3SA 2B7DH 1TWXB 1HJ9A 3RM0H 3V13A 4TY6A 9ESTA 3OYPA 3MNBA 1C5VA 1NTPA 1YPEH 5A0CA 1K9OE 2OC0A 3RU4E 3LGIA 5EPNA 2BDCA 4ZAEA 5ESBA 3VFEA 2BM2A 1QTFA 1UTKA 3VXEH 1K1LA 1IQHA 1FV9A 1V2NT 1GBCA 1MQ5A 1QURH 4B2CA 4Q7ZA 1LKAA 3A8DA 1A1RA 1Z8IB 1GJ5H 3GCTF 1EASA 5HMAA 2ASUB 1AVXA 1PPFE 5GCHG 1ELVA 1CA8B 1EXFA 1Z6EA 1IAUA 1AFQC 1MTNC 2BD7A 5K0HA 3VEQB 1BTWA 1UMAH 3TJNA 1FLEE 4YOIA 4FUBA 1SHYA 1C2LA 4BTTB 2QCYA 1EJMA 1UTPA 1TBRH 4AFZA 2HPPH 1O5CB 2VB0A 3N7OA 2GX4A 1O3NA 1SR5C 1O2KA 1GHWH 2BD9A 1FONA 3LGVA 3RXIA 1O2YA 1EAUA 1ELDE 2UWOA 1SGFG 2ZGHA 1A46H 2A32A 2Z9KA 1SFIA 4A92A 3MH7A 3ZZ7A 3GISB 1C1RA 1C5SA 1MU6B 1N6YA 1JRSA 5EG4A 3U8TH 4ABDA 2GT7A 3VXFH 1ZMJA 5JDUB 3TGIE 2ZZUH 1V2RT 3P70B 3JZ1B 1C5TA 4XBCA 1MKXH 1NRNH 1ID5H 1LHGH 1T8LA 1GBIA 4I8JA 5JBBS 3UWJH 1GHBF 2BY7X 1GVZA 5FPTA 4GLYA 1J15A 1KXDA 2H9HA 1Y8TA 2A0QB 3O8BA 1IQLA 1B7XB 2OBOA 1DWCH 1GG6B 1WBGB 1NFUA 5EODA 4ZHMU 2QXIA 4INKA 1HUTH 3S7HB 1N1LA 5FXLA 1OP2A 3SV6A 2ZGCA 2R0KA 5F8TA 3OU0A 1NRRH 2CV3A 4MTBA 3RMLH 3VB6A 2VU8E 3UR6A 2STBE 4X2VA 3RXRA 4THNH 1CT0E 1QNJA 1EPTA 2XWBI 5FPSA 4CHAB 2TGTA 3A89A 1ETTH 2FTMA 1A0JA 2HLCA 1TBZH 3SNBA 5TCCA 2XNIA 1TFXA 3SUGA 4DVAU 2I6SA 1C1TA 1Z6JH 1NFXA 7LPRA 3W95A 1EP6A 1SPJA 1ZR0A 4VGCC 3SI3H 3SOSA 4CRAA 1D6WA 1FIZA 3DD2H 5L2YH 4DOQA 1KIGH 3LPRA 1SGEE 4HGCA 4F4OC 3RXUA 2XCFA 1CHOF 1VJ9U 3CENA 3AAVA 4Y8YA 1DPOA 3KN2A 3RXTA 2VGCB 1OWKA 1MQ6A 1O34A 4GSOA 4IN1A 1G36A 4B74A 1A5HA 4X6MA 3KF2A 1KY9A 1LVOA 3BG4B 1K1NA 2PGQB 4TPYA 3AVZA 1C2KA 1HAYB 1FIWA 2R2MB 3ZVAA 1TGSZ 1BIOA 2PW8H 2BQ6B 1A5GH 2BVSH 2NU2E 3KQDA 4IS5A 4R8TB 1AKSB 3RM2H 2BDYA 4XBBA 1VITG 4ESTE 2FPZA 1BTUA 3IITA 1DXPA 4AOQA 1T4UH 3KNXA 4JYTA 1ANDA 4J2YB 1BBRH 2W5EA 3MNSA 5F8XA 1GBJA 3HGPA 4Y7BA 4B1TA 3QZRA 3T62A 5L30H 5BPEA 3HK6B 4FU8A 4ABEA 1AUJA 1O2NA 2J92A 3B23B 1IQEA 3NUMA 1AB9B 1F5RA 4DW2U 1HAZB 3EQ0H 3R0FA 1V3XA 2FO9A 5F6MA 4LOYH 3VB4A 1MKWK 2SGEE 1C5UA 1EZXC 3OY6U 3SU4A 1QL8A 3RXAA 3KCGH 3RXLA 2VWMA 4INHA 1UVSH 2ZDAH 4WMDA 1SG8B 1SGNE 1IQJA 3K9XB 1GJBB 2Q6FA 1QA7A 3MH6A 1YPKH 1IHSH 2QXJA 1GVKB 2AH4X 1UJ1A 2PKSC 1C1MA 2BX3A 1DWDH 4MNVA 1O33A 1ZYOA 1W14U 2ZTZA 2B8OH 5HGGA 3RU4D 3EA7A 3A86A 5DP7A 3MOCA 2G8TA 1ZHPA 1HFDA 1XUIA 3LGYA 1P2NA 5TJXA 3LU9B 1XUFA 1O3KA 4I31A 2B0FA 2VWNA 5T6DA 3UNSA 5EW2H 2PFEA 4UD9H 3MFJA 3UQVA 3RXOA 1ARCA 4HFPB 1YGCH 1C1UH 1GI5A 5A0BA 4U32A 4WMEA 2BD3A 3I29A 3JZ2B 2HGTH 1NT1A 2PSYA 1G2MA 2ZG0H 3VPKA 3NK8A 3A85A 2OTVA 1UVUH 1HYLA 4NZQA 3SJOA 4JZDH 2PHBA 1C4V2 4YM9A 1FN8A 1C1QA 3PTNA 4ISIH 2SNWA 1SOZA 4Q80A 3SJIA 1C2EA 2BHGA 1PQ7A 2XRCA 2UUFB 2BY8X 1MD7A 5C1UA 1ZRKA 5IYTA 1HAXB 4ZKOU 2JETB 5J4SA 4BNRA 1O3BA 1Y5UT 1JOUB 1G3BA 1TX6A 1OWIA 2FODA 2H9EH 4X1NU 1AI8H 3VGCB 1XUJA 4TY7A 3UREA 1OSSA 4YT6H 3ZZ9A 3PWCA 3S9AA 2V3HH 3PO1B 1GBLA 2FOFA 1Q3XA 3F1SB 3K6YA 3PLBA 2J2UA 3M7QA 1A3BH 2IPHA 1BZXE 3ZZDA 1ELBA 2ZTYA 1L1NA 1ABJH 2O8WA 1FZZA 4Z0KA 1JXPA 1ELTA 1UCYE 2C8YB 2A5AA 3UUZA 1MCVA 1QFKH 1BTPA 3LGWA 4ISOA 2SGAA 1XUKA 1DWBH 2FEQH 3OSYA 2WPKS 4LZ1H 2W3KA 2QV1A 1TNHA 2BMGB 2VVCA 3PWBA 1BRBE 3LC3A 1XUHA 3KEEA 3A7TA 3ZZCA 1EB1H 3HKJB 1UTMA 4IW4E 1OWHA 2TGPZ 1SVPA 3DA9B 1O2VA 1CA0C 3C27B 1TYNA 1PPZA 1O2HA 1C1WH 4K2YA 1RIWB 2HOBA 3RUOA 1AIXH 1EUFA 2OUAA 1MTUA 3H5CB 2V35A 1O3AA 2GKVE 3AW0A 3BEFB 4O03A 1MBMA 1WCZA 3NKKA 3LT3A 2Y81A 1PPBH 3QWCH 4BAHB 1QBVH 4FUJA 4ZKSU 3BTDE 4IBLH 2ZPSA 1J14A 3RU4T 2WPLS 2GP9B 2FOGA 2FMJA 4ZHLU 3IWMA 2ZDLA 4AFSA 1GHBG 1H9HE 3UPEA 4UEHH 1KLTA 1A3EH 1UTOA 1S83A 4WXVA 5LGOA 3M5NA 2P59A 1KSNA 1MZDA 2WYGA 2FI3E 2EI6A 2OQUA 1S6FA 2Y7XA 1CSOE 6GCHF 2AERH 1WOFA 3H7OA 2CF9H 1TRYA 1RRKA 4UFFH 1P57B 5F8ZA 2LPRA 3W94A 1OWEA 4O9VA 4JYUH 1GI9B 2ZKSA 1Y3WA 5C20A 4MG3A 3O8DA 1O2IA 3NCLA 2BXTH 2JH5D 1HAVB 4GAWA 1O35A 1SC8U 4MNYA 1YLCA 3MNCA 1C1SA 1UHBA 3RC4A 1IQKA 2OINA 1MTVA 2ESTE 4K8BA 4XDEA 1DVAH 1WV7H 4MVNA 5AFZH 1BTZA 3V12A 4K1SA 4BAOB 1CE5A 3M35A 3SJ8A 3P95A 4SGBE 5FX6A 1ELFA 4X6NA 3URCA 8LPRA 4JCNA 2BDAA 4X8SH 2Y5GA 2O8MA 5TCAA 1GI1A 2FM2A 3TNSA 3H7TA 1SL3A 4FUDA 6CHAC 1GHAF 5AVDA 3ZV9A 2C8WB 4JZEH 3RXHA 1GGDC 1HGTH 3ATIA 2F9NA 5JBTA 1VJAU 5EW1H 1JBUH 1C1PA 2WUCA 3EAJA 2EI7A 1KTSB 3GCNA 1TGTA 1QCPA 3RXFA 3GYLB 5I46H 2GCTC 1SGRE 2XBVA 1G30B 7GCHF 1C5LH 5A8ZA 1JIMA 1GCTC 2FIRH 3P8NA 3GY5A 4TPIZ 1C5XB 2ZECA 1F0UA 1YPJH 3FP8E 4I8GA 4CRBA 3I77A 1TOCB 1GBMA 2HVXA 4DIIH 1O31A 2Z9JA 4MPWA 3MH4A 1T8OA 4UFDH 3UFAA 1Y3XA 1P2KA 3A81A 3BTHE 4BTUB 1H9IE 3SV7A 2CN0H 4OS7A 2BD2A 3MHWU 3MU0A 4FVDA 1B0EA 1EOJA 4MQAA 1ZJKA 3E6PH 1P11E 2ZCLP 1GI2A 1XKBC 2A2XH 1C4U2 1L2EA 5SGAE 4CBOA 1V2MT 1FPHH 3ODDA 1FJSA 1HCGA 2TPIZ 1HIAB 1KLIH 3AW1A 3TJUA 3BF6H 1LO6A 2BB4A 1SOTA 2ZHEH 2ANKH 1EZUC 2FESH 1SGYE 1UVPA 3GYMA 1MAYA 4CRCA 2SNVA 4NFEA 1QIXB 1NN6A 1JMOH 2BDHA 3ODFA 2ZI2H 5EQRA 2ANYA 2BLVA 2G51A 5EOKA 5GJ4B 3CS0A 1O5AB 3HPTB 4JYVH 1SGFA 1AZZA 3ZVGA 1C2FA 2B9LA 1A0HB 1SQAA 1P9SA 2HPQH 1W11U 4YESB 1A0LA 1W12U 4HTCH 1GMHF 1DXWA 8ESTE 1A5IA 1LPKB 4YZUA 5FAHA 1DWEH 1O37A 5G4BA 1VGCC 2ZU1A 3F9GA 3E0NB 2H5CA 8GCHF 2C8XB 4D8NA 1P02A 5FHTA 3A80A 1D3PB 1BOQA 1S85A 1WYKA 3DUXH 1QQUA 3GY6A 2IJOB 1BJVA 1GHYH 3A88A 4Y76A 3PB1E 1TNLA 3RDZA 1BTYA 1UTNA 1KLJH 1ORFA 3Q76A 2C8ZB 4FU7A 1C5NH 2ZFQH 5DP3A 5T3HA 2BQWB 2ZTXA 1A2CH 1YYY1 2PKSB 2M5TA 5B6OA 3A82A 1C1OA 3RMMH 4HI3A 3RXMA 5AF9H 1V2OT 1AQ7A 1DT2A 2VNTA 4Y10E 1ABIH 1CVWH 1F0SA 2FYRA 2BLQA 4XE4A 1XM1A 4FUGA 3M37A 4ABAA 1T31A 2A1DB 2ZPQA 4O3UA 2O8TA 1DANH 2IN2A 5CMXH 1RGQA 3QGNB 1CGJE 3PV4A 1MBQA 2Q6DA 2ZDMA 2AEIH 3QUMP 3P17H 1ZHRA 7KMEH 2R0LA 4YLUA 3TGJE 2VVVA 3PMJA 1TPSA 2XXLA 4Y0ZE 3RXJA 1CT2E 1INCA 1FNIA 2YOLA 3BTGE 3M61U 3U1JB 1MCTA 1PYTD 1W0ZU 2UWLA 2JH0D 7ESTE 1GMCF 5H4IB 2V0BA 4U30A 3NZIA 2J34A 1E0FD 1O2LA 1YM0A 3MO9A 2BY6X 3ZZ6A 1CBWC 1C4Y2 4KKDA 2WPIS 4AFUA 2G5VA 3M3SA 1O2TA 3LONA 3ZZ5A 1YCPK 3U98H 2GMTB 3MH5A 4RKJB 1HRTH 3KQEA 4ZXXH 2BLWA 1BRCE 1IOEA 4OGXA 4M7GA 3ATLA 2ZGJA 1SMFE 1UTLM 4GCHG 3S7KB 1GBBA 2WPHS 3FAOA 1YCPH 3T27A 1DFPA 2AMQA 2G4UA 2QC2A 5AFYH 2F9VA 3M5MA 2ZFPH 1LQDB 2OQ5A 3SNEA 5CHAC 2BD4A 3SGAE 1BHXF 4K5ZA 1KXBA 3PTBA 3T26A 2KAIB 1MU8B 3GY7A 4AG2A 1MKXK 4NA8A 2UUJB 4E7RG 4X0WU 1T7CA 1SFQB 2VINA 1LMWB 3MU8A 4J1YA 5A09A 1DSUA 1ANBA 1XVOA 4GHQA 3SZNA 2SGDE 2Y80A 5GWZA 2STAE 3U1IB 1LHEH 1TA6A 3RXVA 3RXKA 2CGAA 5T6GA 1P06A 3KQBA 2AIQA 4WJG2 4ABJA 3D62A 1V6DA 3RXEA 1TNIA 5DO4H 1EATA 4TYDA 2FYQA 4B75A 1PQ8A 2FI5E 3ZYDA 1BUIA 4NZLA 3A7YA 1G2LA 1YPHE 1SGDE 2VIOA 3M7TA 5DK1A 1SB1H 1J17T 5ESTE 6ESTA 1EX3A 4XOJA 2Y5FA 4XSKU 1GJ8B 1QB9A 4YTAA 1YKTA 3E8LA 4ISHH 2BYAX 3LC5A 1C5WB 4I8HA 3A8AA 1Q31A 1O39A 2QAAA 3NWUA 3SNAA 1ELCA 1XXFA 1QBNA 1FY8E 1GI0A 4ABFA 3SUFA 3RXBA 3QGJA 3FZDA 3QZQA 3E0PB 2ZDKA 1KDQB 1ZGIA 3UOPA 2ZEBA 5AHGH 2O8UA 1PYTC 1GI6A 4D76A 2ZO3H 1TGBA 3SV9A 1ZZZA 2F3CE 1XKAC 1V2TT 1C2DA 1HJAC 3LJJA 3TPIZ 5GIBA 3RC6A 1BCUH 4D9QA 5L6NH 2FX6A 4ZKRU 1TX7A 3F68H 3U8RH 1Q2WA 1UK2A 1BBRK 2XW9A 2VWLA 1C5OH 1QB6A 1GJCB 2P93A 2FOHA 2B5TB 1J16A 3UR9A 2FS9A 1ARBA 2Q1JA 1GJDB 1FAKH 2R3YA 5E8EH 3SO3A 1P01A 1RTKA 1WQSA 5GDSH 3LIWA 3L33A 5GPIB 3STIA 3BEUA 2BVRH 2Z6BD 3V3MA 3BTEE 2EC9H 2JH6D 2VJ1A 5EQQA 1Y3YA 1GGDB 1AKSA 2RA0A 5E0HA 1LCYA 5C2ZA 3T25A 1S0QA 3TVJB 1N8OB 1B5GH 1F0TA 3S9BA 4KTCA 4BXSA 5BRRE 1QL7A 1GHZA 2GCTB 2ODYB 1MTWA 1GCTB 1LHCH 1Y3UA 3TU7H 1LPZB 3UWIA 2FZZA 3BIVH 1D3TB 4FUIA 2O8LA 1HAHH 3RXSA 2P3FH 3SHAH 2Y5HA 5GXPA 3GCHC 1GMDF 5FBEA 1IQGA 1TLDA 1TGNA 2HRVA 1DY8A 1GHVH 4ZH8A 4DCDA 3QO6A 2GGVB 1Y5AT 1P04A 1TRMA 1VCQA 2H5DA 2ZU5A 1O3IA 6LPRA 5DP9A 8GCHG 2P8OB 1HV7A 1OXGA 1E35B 1GJ4H 2QIQA 1AN1E 1AZ8A 2XWAA 5FX5A 2RA3A 3A7ZA 1U6QA 1FDPA 1PQ5A 2OC1A 3M5LA 3Q3YA 3Q3KA 5C1XA 1S5SA 4WWYA 2F9UA 4AB9A 4IGDA 1NS3A 1P2QA 2BDGA 4GPGA 3GY3A 4WY3A 2GCHF 1SHHB 3TK5A 3C1KA 1DLEA 1P10A 4NCYA 2BY9X 1D9IA 3MU5A 1C5PA 2QA9E 1SGTA 1GBTA 3DFJA 3SGQE 1C5YB 3VB5A 2H2ZA 1P05A 1G37A 1L1GA 1VGCB 1Z8RA 2VIVA 1H4WA 4DGJA 5LH8A 5EQSA 1BMAA 1P2IA 3DHKH 1ZSJA 1H8IH 4KTUA 1E34B 3MI4A 3M5OA 1Z7KA 2P16A 4CH2B 4DY7B 1TQ0B 3GCTG 2G81E 1GBHA 4FXGH 2OLGA 3RXDA 4BAQB 2G00A 2UUYA 3P8GA 2QF3A 1ANEA 1XVMA 5HXFA 1TX8A 4CRGA 1V2PT 1Z71A 1LVYA 2OC7A 3LOXA 1P3EA 1F0RA 1GMCG 2CF8H 5DGJA 1ESBA 2A5KA 1TPPA 5HYOA 1QJ1B 1Y5BT 1C1VH 1O3LA 3NPSA 3FZZA 2C93B 3F9FA 1ZPCA 4ISLA 1RFNA 1DSTA 1AY6H 4YOJA 5LPFA 1D3DB 3KHVA 5C5OA 1L4DA 5E0JA 2GDDA 4I32A 1RXPA 3LH1A 1TMBH 5GCHF 1YC0A 1TNJA 3ZZ3A 4YOGA 3HKIB 1GI8B 1O2QA 4X1QU 3S69A 4MPVA 3E90B 4H42U 2BOHB 1V2QT 2Z9IA 1BRUP 1TMTH 1AHTH 2P3UB 3ZVEA 4MDSA 1D4PB 1GHXH 1NROH 4K3JA 1T8NA 2ODQA 4CR9A 2XYAA 1UVOA 1AFQB 2ZQ1A 1MTNB 1PQAA 4AG1A 1C5ZB 1TPAE 1MD8A 3NXPA 5E2PA 1NPMA 3TH4H 3HATH 4Q2KA 2J95A 1O5BB 1V2WT 4ZMAH 1GJ6A 1SGCA 4NSYA 1XUGA 1O3DA 1PPHE 1HNEE 2SGPE 1GG6C 2ALVA 1H9LB 1EPTC 4IC6A 1TAWA 1LTOA 1O5EH 1LPGB 1DY9A 2WYJA 4B2BA 5A0AE 1DLKB 1NRPH 1VCPA 1Z8JB 2GT8A 3IG6B 3EGKH 1V2LT 2ZHWH 2PTNA 1QY6A 1T8MA 1OWJA 2FI4E 2PKAB 5L2ZH 1ZTLA 2NU1E 3ELAH 1SGQE 1NU7B 4FU9A 2OBQA 3QTVH 4WVPE 1O3JA 4CHAC 4ZXYH 1NESE 1A61H 2ZFSA 2TIOA 3LKWA 1IQFA 2ZHQH 1GJ7B 1AD8H 1LQEA 4JZFH 4Q7XA 1G32B 2XC4A 1K21H 1W8BH 4LZ4B 1O3EA 2P94A 2Z7FE 4Y6DA 3U69H 1QGFA 2AGEX 4BTIB 1DICA 3UY9A 1OS8A 1LHFH 2VGCC 1AVGH 2DUCA 4X1SU 1HAVA 1HDTH 1FXYA 2Q6GA 3T29A 1AGJA 2D1JA 5DP4A 2BLOA 1CHOG 5I25A 1W7XH 3MYWA 2G55A 3BG4C 5EXNA 2OD3B 5K7RA 1CGHA 3ATMA 1UO6A 2HNTE 3TGKE 1YF4A 4AZ2B 1BTHH 2XCNA 2GV7A 5E0GA 3BV9B 1ACBE 1K1PA 2JKHA 1FI8A 4I8LA 1OKXA 4D7GA 3SU1A 2BQ7B 3A7VA 5EXLA 1NO9H 4SGAE 1UCYH 2WV4A 1S84A 3AAUA 2PTCE 1L0ZA 1W0YH 1HAGE 1NZQH 1AB9C 2FOMB 4VGCB 3D49H 4KGAA 4MNXA 1K1IA 3UQOA 1UVTH 3BEIB 1ZGVA 5LPRA 1FQ3A 4OS2A 2FX4A 3GY2A 4H6SB 3S0NA 2ZCKP 4ZKNU 3EA8A 1E38B 1GBAA 1MTSA 2V3OH 2ZP0H 1RTFB 2WINI 3OTJE 5JYIA 1P2MA 1P9UA 4Y79A 2PLXA 1W3CA 4KTSA 2FS8A 2A4GA 1YBWA 3EE0B 3SU6A 3SJ9A 3BTKE 2BX4A 1TGCA 2WV5A 4AYVB 1ZPBA 2XC5A 2GTBA 1GL1A 1ELGA 1QRZA 1W2KH 4IMQA 3BIUH 2G4TA 1P2JA 1C2IA 4CRFA 3HK3B 3ZV8A 1AWHB 1YCPM 4OS4A 3RMOH 2F83A 2DE8A 3OY5U 3UIRA 2RG3A 1HIAA 1NC6A 4NGAH 3SV2H 2O9QA 3MMGA 3TLOA 1O3OA 2FLBH 4CR5A 4AGKA 1K1JA 1GL0E 4NIXA 4AYYB 2RCEA 1C2JA 1QL9A 2ZNKH 3U8OH 1E36B 2FXRA 1GVLA 1AO5A 1SGPE 1QRXA 1TPOA 1P09A 4Y11E 2QYIA 4NWKA 2CXVA 4FUFA 2W26A 3D23A 4JMYA 2A45B 2A31A 4CREA 1QR3E 2BDBA 4X8TH 2XC0A 3BTQE 1THPB 2G5NA 1EZSC 1A7SA 1GDNA 1QHRB 3BSQA 1C2GA 1G3EA 3PMAB 1K1OA 1Y59T 4X1PU 3P8FA 4D7FA 1PPCE 1TBQH 1O30A 2XTTB 2BY5X 1ELAA 5EGMA 3FP7E 4K1TA 3KL6A 4FUEA 4ISNA 3SUDA 1ZHMA 2IOTA 2PSXA 4KP0A 3ZVFA 4NWLA 4PROA 4X8VH 2GZ8A 4DJZB 2C90B 1L4ZA 4RSPA 4JZ1A 2FOCA 1BJUA 1GCDA 2OP9A 3ATWA 5JB9S 3A7XA 4H4FA 4X6OA 3LGTA 4U01A 1S6HA 3LJOA 1UTJA 4X2YA 1ESTA 2BD8A 5HM9A 3KIDU 5ETXA 4A1TA 3A8BA 1VR1H 3M3TA 3PYHA 2GVFA 2GZ9A 3E3TA 1FY3A 3SI4H 1HJ8A 2DE9A 4DG4A 1TA2A 4A5TS 2TBSA 1O3PB 1ZSLA 1OPHB 2AMPA 2P3TB 2YNBA 4OS6A 1DDJA 2ZFTA 4Y8ZA 2OXSA 3A8CA 4OS1A 1CHGA 1THSH 3RMNH 1CU1A 1NU9A 2BZAA 3FP6E 1WSSH 4YLQH 1TB6H 3SV8A 1AUTC 1GI4A 3ZVBA 4CH8B 3CS7A 1EKBB 3EYDA 1N6XA 2BD5A 3BG8A 3E1XB 2QXGA 2CHAC 1GBEA 1RIWC 4O97A 1QQ4A 1ZMNA 2FWWA 2QY0B 4JK6A 1EAIA 1ZLRA 2A4QA 2A4RA 2W7UA 2UUKB 2AGIX 1BBRE 2WUBA 5PTPA 3SU3A 1Y3VA 4NA9H 1P12E 3SN8A 1O2JA 3URDA 3GDVA 1OOKB 2TGDA 4OS5A 3QX5H 1GI7B 1VITH 5E2OA 1OP8A 1TQ7B 2K1QA 3KGPA 1F7ZA 3LGUA 3O8RA 2YNAA 2ZIQH 5DP8A 3MNXA 3VB3A 1FY4A 1C9PA 3V0XA 4FUCA 3Q3XA 2HALA 2KAIA 1TNKA 1RJXB 4NA7A 1O2RA 3RXPA 1KXAA 4DURA 1QA0A 1SLUB 1F5KU 1JWTA 4E06H 1KXEA 6GCHG 1HXEH 1SLVB 4BOHA 1CA0B 1MZAA 1DUEA 5C3NA 4ABGA 1HAIH 3UNRA 3VB7A 1WU1A 4UFEH 4YT7H 3TJOA 4AB8A 1OYQA 1MMJN 2PGBB 1ZMLA 3G01A 1XMNB 4CBNA 1SSXA 1C5QA 4H6TA 4K8YA 2ANWA 2GDEH 3SU2A 1C5RA 3SU0A 3TJVA 1AE5A 1SBWA 4Z6AH 2VH6A 2XBYA 2GD4B 1NY22 2Y7ZA 1EPTB 1G9IE 1LKBA 1UK3A 1FPCH 1PPEE 1SQOA 4Y8XA 4BAMB 1O2PA 1F5LA 2AGGX 1FAXA 3SGBE 1FN6A 3ITIA 2TGAA 5JPMH 1EOLA 1EB2A 1S0RA 3MO3A 4KELA 1GHAG 1E37B 3TK9A 1EP5A 1FY5A 1WUNH 1MH0A 5A2MH 5IDKA 1ANCA 4AGJA 1HPGA 1BITA 2FP7B 4WF8A 5DPAA 1RD3B 3FVFB 1THRH 1IHTH 7GCHG 1MAXA 2BOKA 2ALPA 2HWLB 1FUJA 1T32A 1W10U 3FFGA 1BMLA 1O2WA 1EZQA 1KDQA 2Z9LA 2FDAA 5FCRA 1ETRH 1O2SA 2W3IA 3WY8A 2EEKA 3GY8A 2FLRH 1LHDH 2FOAA 1HLTH 5DJ7A 1Z8GA 2BTCE 3BN9A 1ZOMA 4Q7YA 4U2WA 2ZCHP 1EQ9A 1WTHD 1BMNH 1DE7H 2ZDNA 3ZZBA 2WPJS 1S81A 6CHAB 1TE0A 1TONA 3ESTA 2ZA5A 1OP0A 4K1EA 3MO6A 4DT7B
chains in the Genus database with same CATH superfamily
1DS2E 4LXBH 2IJD1 3OFND 4I8KA 4OGYA 5J4QA 1O2OA 3K6ZA 1WAYB 2ZDVH 1BT7A 5IK2D 3WWBA 1BHXB 2CMYA 3P92A 5CE1A 1AFEH 2THFB 3GICB 3TH2H 2P95A 1A4WH 4CRDA 2ZQ2A 3V7TA 2Y6TA 3MU4A 4X2WA 1NM6A 1GJAB 1OYTH 4GHTA 4WXIA 3F2HA 2ZHFH 2VIWA 4XBDA 3RXQA 4Y7AA 2AIPA 1ELEE 1ZPZA 2A7CA 3QN7A 3UOUA 3ATKA 2R2WU 1GMHG 2WSSD 2OC8A 2HNTC 1V2VT 2TRMA 4WH8A 1DITH 3S9CA 4MPXA 1OWDA 1GBFA 2J4IA 5GNDA 4F49A 4YO9A 1EJAA 3FN8A 2ULLA 4RT0A 4ASHA 3T5FH 1MKWH 1O3CA 3F9HA 3Q77A 2F9OA 3GOVB 2D2DA 1AMHA 1DX5M 1LVMA 1C5MD 3BTFE 4RN6A 2J94A 1D3QB 5KEDA 1OX1A 3DCLA 3A83A 1W7GH 3F6UH 1UK4A 2ZC9H 4AFQA 4B71A 4Q4LA 2NU0E 3PLPA 1H1BA 1G3DA 2WPMS 4E05H 5JBAS 1BA8B 1QZ8A 2PUXB 2W6ID 2AMDA 3M3VA 5EU8A 4BAKB 4UONA 3B8JA 4ABIA 2ZU4A 1CGIE 3T28A 1UTQA 2A5IA 1PFXC 3AASA 4HG6A 1KYNA 1W13U 3SBKA 3BTME 4Y71A 1ZTKA 3SQHE 4F55A 1XX9A 4X6PA 3SW2B 1K28D 1BDAA 1NRSH 1P2OA 2GZ7A 1TABE 1ZRBA 2CJIA 2LNCA 2VVUA 3RXGA 3SJKA 9LPRA 4R0IA 3QK1A 2H6MA 4A6LA 1AVWA 3L3TA 1AE8H 2G52A 2PR3A 4P02A 3N7EA 3GDUA 3E91A 5C5NA 3A87A 1O2XA 1SQTA 4NSVA 3DFLA 3SNDA 3UTUH 3ZVDA 5C67A 4UDWH 1P8VC 2GMTC 1AWFH 1SGIB 3I78A 4K69A 3TH3H 5ABWA 3PRBA 4AN7A 2H1UA 2NU3E 1O36A 1LDTT 3SNCA 1BTXA 4LK4A 1O2ZA 3BTTE 1O3MA 4ZHAA 1D6RA 3PROA 5EJ1A 3A84A 1ESAA 4Y0YE 4FUHA 1KTTB 4IC5A 4X1RU 1P3CA 3RXCA 1IQNA 1K2I1 1V2UT 1V2ST 5F03A 3ENSB 2R3UA 5FBIA 2A7HA 2EI8A 1YPLH 3ZZ4A 1O2MA 4A1VA 3MQKC 2XBWA 1O2UA 2ZPRA 3STJA 1EJNA 2V3MA 3QDZB 1C9TA 2QXHA 3D65E 2C4FH 2FTLE 3LDXH 3Q00A 1TRNA 3MWIU 1TALA 1L1JA 4I7YH 2ZHDA 4I33A 1CT4E 1HAPH 1CBWB 5T6FA 1GDUA 2VIQA 2GV6A 4GCHF 2Z9GA 1G3CA 1M9UA 5DP6A 3F0PA 2Z3CA 4ABBA 4B2AA 1O5FH 2OCVB 2W7SA 3SHCH 1QJ6B 1JRTA 2CHAB 2J38A 4MLFB 3E16B 1YLDA 1XXDA 1J8AA 1O0DH 2Y82A 5FPYA 2VIPA 1F92A 5CHAB 1O3FA 4HZHA 2QE7D 3P8OA 2XBXA 5A8YA 4OM9A 2FOEA 2ZF0H 1AU8A 2R9PA 2LP6A 2ZGXH 3SQEE 3TIUA 4FVBA 4BXWA 3O8CA 1FY1A 1ZSKA 2ANMH 1EAXA 1TIOA 1PJPA 2ODPA 4TWWA 3SORA 2VIDA 1P03A 3H09A 5JB8S 3K2UA 1O38A 2AS9A 2PKAA 2PV9B 4NIWA 4NIVA 1GI3A 1UHBB 1HBTH 2BZ6H 2HNTF 8KME2 5JBCS 1BRAA 2J9NA 2I6QA 2QGRA 4A7IB 2F9PA 1V2KT 1O3GA 2AFQB 4MPUA 1NFWA 3ZZ8A 1VZQH 1X7AC 4RKOB 3ZZAA 1K1MA 1QB1A 2J98A 2UWPA 5EXMA 3PLKA 1V2JT 3TK6A 1TMUH 3TNTA 3RP2A 1RTLA 2VH0A 1KXFA 1O2GH 1S82A 1E1QD 2NU4E 4E7NA 3RC5A 1UCYK 3SU5A 4GUXA 1Z1JA 2KCAA 3CP7A 1ZTJA 2BXUH 2D26C 3PMHB 3SUEA 1SLXB 2NWNA 1C2MA 4DT4A 1P0SH 4ZUHA 1K22H 2ZFRH 2V6NA 2FOBA 3M36A 1NRQH 1HXFH 1O5DH 2AYWA 4IN2A 3EDXB 2A4OA 1QRWA 5FCKA 1N8OC 3FANA 4TWYA 2VBCA 1IQIA 1YPHC 3GDSA 1ZJDA 1HAOH 1B0FA 1O5GH 3M7UA 3PRDA 1RS0A 2V7QD 3K65B 3R3GB 5A8XA 1HJAB 5C1YA 3ZYEA 3RLYH 1VITF 2L6OA 1TNGA 4JK5A 2ZWLH 2RDLA 2Z94A 1SLWB 1Z1IA 4ABHA 1EAWA 3B9FH 1FMGA 4O3TA 3UNQA 3A7WA 2F91A 4MNWA 5DKMA 4A1XA 2H9TH 1MUEB 1T4VH 4AX9H 1YPMH 3EE7A 1GMDG 1GWAA 4ASUD 3MU1A 5LPEA 1CQQA 3HGNA 1GBKA 1BB0B 3BTWE 3EA9A 2P8OC 1J9CH 3MTYA 3RLWH 4X2XA 2SGFE 1QBOA 1TOMH 5CHBA 1GJ9B 1YP9A 2YMSD 1VCWA 1YPGH 4UE7H 4XFQA 5FL7D 4NIYA 4B73A 1JIRA 2EY4C 4K60A 2EA3A 3TITA 5DP5A 3U9AH 4AORA 2BDIA 1DM4B 1W0KD 2Z3DA 1CO7E 5HM2A 1GBDA 1SKYE 4ZROA 4QT8C 1LVBA 2ZU3A 4JZIA 2PWXA 3F9EA 1GPZA 1C2HA 1HB0B 1DOJA 3OX7U 2GCHG 1NFYA 4UFGH 3PMBB 4GVUA 1WTGH 3GCHB 3LH3A 1WQVH 2PUQH 2JJ2D 3L6PA 2JIZD 3GY4A 4BANB 5C0TA 3KQCA 4DIHH 1F2SE 1GDQA 2ZFFH 3QLPH 3T2NA 4WMFA 2Z3EA 1O32A 2D8WA 1NBME 3PM3A 2VWOA 3DT0H 2SFAA 4D9RA 2ZU2A 3QTOH 2A2QH 3KQ5A 1IQMA 1O3HA 3ZVCA 3GCOA 5DG6A 2A7JA 1ETSH 1BQYA 1H8DH 2ZGBH 2JETC 5HIZA 4NFFA 2SGQE 1DUAA 2ILNA 4IMZA 4INLA 4WH6A 1C1NA 3VGCC 2F9BH 3P6ZB 2BVXH 1KXCA 1PPGE 5EPYA 3PO1C 1BMMH 4B76A 3AK5A 4X8UH 2QN5T 1QJ7B 4NG9H 2QF0A 1SI5H 2CK3D 2C3SA 2B7DH 1TWXB 1HJ9A 3RM0H 3V13A 4TY6A 9ESTA 3OYPA 3MNBA 1C5VA 1NTPA 1YPEH 5A0CA 1K9OE 2OC0A 3RU4E 3LGIA 5EPNA 2BDCA 4ZAEA 5ESBA 3VFEA 2BM2A 1QTFA 1UTKA 3VXEH 1K1LA 1IQHA 1FV9A 1V2NT 1GBCA 1MQ5A 1QURH 4B2CA 4Q7ZA 1LKAA 3A8DA 1A1RA 1Z8IB 1GJ5H 3GCTF 1EASA 5HMAA 2ASUB 1AVXA 1PPFE 5GCHG 1ELVA 1CA8B 1E79D 1EXFA 1Z6EA 1IAUA 1AFQC 1MTNC 2BD7A 5K0HA 3VEQB 1BTWA 1UMAH 1VKYA 3TJNA 1FLEE 4YOIA 4FUBA 1SHYA 1C2LA 4BTTB 2QCYA 1EJMA 1UTPA 1TBRH 4AFZA 2HPPH 1O5CB 2VB0A 3SYJA 3N7OA 2GX4A 1O3NA 1SR5C 1O2KA 1GHWH 2BD9A 1FONA 3LGVA 3RXIA 1O2YA 1EAUA 1ELDE 2UWOA 1SGFG 2ZGHA 1A46H 2A32A 2Z9KA 1SFIA 4A92A 3MH7A 3ZZ7A 3GISB 1C1RA 1C5SA 1MU6B 1N6YA 1JRSA 5EG4A 3U8TH 4ABDA 2GT7A 3F2GA 3VXFH 1ZMJA 5JDUB 3TGIE 2ZZUH 1V2RT 3P70B 3JZ1B 1C5TA 4XBCA 1MKXH 1NRNH 1ID5H 1LHGH 1SQRA 2HVYB 1T8LA 1GBIA 4I8JA 5JBBS 3UWJH 1GHBF 2BY7X 1GVZA 5FPTA 4GLYA 1J15A 1KXDA 2H9HA 1Y8TA 2A0QB 3O8BA 1IQLA 3VG8A 1B7XB 2OBOA 1DWCH 1GG6B 1WBGB 1NFUA 5EODA 4ZHMU 2QXIA 4INKA 1HUTH 4I86A 3S7HB 5KECA 1N1LA 5FXLA 1OP2A 3SV6A 2ZGCA 2R0KA 5F8TA 3OU0A 1NRRH 2CV3A 3N7DA 5DSFA 4MTBA 3RMLH 3VB6A 2VU8E 3UR6A 2STBE 4X2VA 3RXRA 4THNH 2K0QA 1CT0E 1QNJA 1EPTA 2XWBI 5FPSA 4CHAB 2TGTA 3A89A 1ETTH 2FTMA 1A0JA 2HLCA 1TBZH 3SNBA 5TCCA 2XNIA 1TFXA 3SUGA 4DVAU 2I6SA 1C1TA 1Z6JH 1NFXA 7LPRA 3W95A 1EP6A 1SPJA 1ZR0A 4VGCC 3SI3H 3SOSA 4CRAA 1D6WA 1FIZA 3DD2H 2KZ4A 5L2YH 4DOQA 1KIGH 3LPRA 1SGEE 4HGCA 4F4OC 3OEED 3RXUA 2XCFA 1CHOF 1VJ9U 3CENA 3AAVA 4FOUC 4Y8YA 1DPOA 3KN2A 3RXTA 2VGCB 2KCPA 1OWKA 1MQ6A 1O34A 4GSOA 4IN1A 1G36A 4B74A 1A5HA 4X6MA 3PV2A 3KF2A 1KY9A 1LVOA 3BG4B 1K1NA 2PGQB 4TPYA 3AVZA 1C2KA 1HAYB 1FIWA 2R2MB 3ZVAA 1TGSZ 1BIOA 2PW8H 2BQ6B 1A5GH 2BVSH 2NU2E 3KQDA 4IS5A 4R8TB 1AKSB 3RM2H 2BDYA 4XBBA 1VITG 4ESTE 2FPZA 1BTUA 3IITA 1DXPA 4AOQA 1T4UH 3KNXA 4JYTA 1ANDA 4J2YB 1BBRH 2W5EA 3MNSA 5F8XA 1GBJA 3HGPA 4Y7BA 4B1TA 3QZRA 3T62A 5L30H 5BPEA 3HK6B 4FU8A 4ABEA 1AUJA 1O2NA 2J92A 5C0UA 3B23B 1IQEA 1NBMD 3NUMA 1AB9B 1F5RA 4DW2U 1HAZB 3EQ0H 3R0FA 1V3XA 2FO9A 5F6MA 4LOYH 3VB4A 1MKWK 1OHHD 1C5UA 1EZXC 2SGEE 3OY6U 3SU4A 1QL8A 3RXAA 3KCGH 3RXLA 2VWMA 4INHA 1UVSH 2ZDAH 4WMDA 1SG8B 1SGNE 1IQJA 3K9XB 1GJBB 2Q6FA 1QA7A 3MH6A 1YPKH 1IHSH 2QXJA 1GVKB 2AH4X 1UJ1A 2PKSC 1C1MA 2BX3A 1DWDH 4B6FA 4MNVA 1O33A 1ZYOA 1W14U 2ZTZA 2B8OH 5HGGA 3RU4D 3EA7A 3A86A 5DP7A 3MOCA 3OAAD 2G8TA 1ZHPA 1HFDA 2EQNA 1XUIA 3LGYA 1P2NA 5TJXA 3LU9B 1XUFA 1O3KA 4I31A 2B0FA 2VWNA 5T6DA 3UNSA 5EW2H 2PFEA 4UD9H 3MFJA 3UQVA 3RXOA 1ARCA 3KYFA 4HFPB 1YGCH 1C1UH 1GI5A 5A0BA 4U32A 4WMEA 2BD3A 3I29A 3JZ2B 2HGTH 1NT1A 2PSYA 1G2MA 2ZG0H 3UAIC 3VPKA 3NK8A 3DSOA 3A85A 2OTVA 1UVUH 1HYLA 4NZQA 2M2AA 3SJOA 4JZDH 2PHBA 1C4V2 4YM9A 1FN8A 1C1QA 3PTNA 4ISIH 2SNWA 1SOZA 4Q80A 3SJIA 1C2EA 2BHGA 1PQ7A 2XRCA 2UUFB 2BY8X 1MD7A 5C1UA 3FKSD 1ZRKA 5IYTA 1HAXB 4ZKOU 2JETB 5J4SA 4BNRA 1O3BA 1Y5UT 1JOUB 1G3BA 1TX6A 1OWIA 2FODA 2H9EH 4X1NU 1AI8H 3VGCB 1XUJA 4TY7A 3UREA 1OSSA 4YT6H 3ZZ9A 3PWCA 3S9AA 2V3HH 3PO1B 1GBLA 2FOFA 1Q3XA 3F1SB 3K6YA 3PLBA 2J2UA 3M7QA 1A3BH 2IPHA 1BZXE 3ZZDA 1ELBA 2ZTYA 1L1NA 1ABJH 2O8WA 1FZZA 4Z0KA 1JXPA 1ELTA 1UCYE 2C8YB 2A5AA 3UUZA 1MCVA 1QFKH 1BTPA 3LGWA 4ISOA 2SGAA 1XUKA 1DWBH 2FEQH 3OSYA 2WPKS 4LZ1H 2W3KA 2QV1A 1TNHA 2BMGB 2VVCA 3PWBA 1BRBE 3LC3A 1XUHA 3KEEA 3A7TA 3ZZCA 1EB1H 3HKJB 1UTMA 3W1EA 4IW4E 1OWHA 2TGPZ 1SVPA 3DA9B 1O2VA 1CA0C 3C27B 1TYNA 1PPZA 1W0JD 1O2HA 1C1WH 4K2YA 1RIWB 2HOBA 3RUOA 1AIXH 1EUFA 2OUAA 1MTUA 2PP6A 3H5CB 2V35A 1O3AA 2GKVE 3AW0A 3BEFB 4O03A 4Q63A 1MBMA 1WCZA 3NKKA 3LT3A 2Y81A 1PPBH 3QWCH 4BAHB 1QBVH 4FUJA 4ZKSU 3BTDE 4IBLH 2ZPSA 1J14A 3RU4T 2WPLS 2GP9B 2FOGA 2FMJA 4ZHLU 2IPQX 3IWMA 2ZDLA 4AFSA 1GHBG 1H9HE 3UPEA 4UEHH 1KLTA 1A3EH 1UTOA 3WW7A 1S83A 2KM0A 4WXVA 5HKKD 5LGOA 3M5NA 2P59A 1KSNA 3WWFA 1MZDA 2WYGA 2FI3E 2EI6A 2OQUA 1S6FA 2Y7XA 1CSOE 4XD7D 6GCHF 2AERH 1WOFA 3H7OA 3NRLA 2CF9H 1TRYA 1RRKA 4UFFH 3OEHD 1P57B 5F8ZA 2LPRA 3W94A 1OWEA 4O9VA 4B6EA 4JYUH 1GI9B 2ZKSA 1Y3WA 5C20A 4MG3A 3O8DA 1O2IA 3NCLA 2BXTH 2JH5D 1HAVB 4GAWA 1O35A 1SC8U 4MNYA 1YLCA 3MNCA 1C1SA 1UHBA 3RC4A 1IQKA 2OINA 1MTVA 2ESTE 2W6JD 4K8BA 4XDEA 1DVAH 1WV7H 4MVNA 5AFZH 1BTZA 3V12A 4K1SA 4BAOB 1CE5A 3M35A 3SJ8A 3P95A 4SGBE 5FX6A 1ELFA 4X6NA 3URCA 8LPRA 4JCNA 2BDAA 4X8SH 2Y5GA 5F53A 1UW7A 2O8MA 5TCAA 1GI1A 2FM2A 3TNSA 3H7TA 1SL3A 4FUDA 6CHAC 1GHAF 5AVDA 3ZV9A 2C8WB 2XNDD 4JZEH 3RXHA 1GGDC 1HGTH 2J5UA 3ATIA 2F9NA 5JBTA 1VJAU 5EW1H 1JBUH 1C1PA 2WUCA 3EAJA 2EI7A 1KTSB 3GCNA 1TGTA 1QCPA 3RXFA 3GYLB 5I46H 2GCTC 1SGRE 2XBVA 3OE7D 1G30B 7GCHF 1C5LH 5A8ZA 1JIMA 1GCTC 2FIRH 3P8NA 3GY5A 4TPIZ 1C5XB 2ZECA 1F0UA 1YPJH 3FP8E 4I8GA 4CRBA 3I77A 1TOCB 5HIYA 1GBMA 2HVXA 4DIIH 1O31A 2Z9JA 4MPWA 3MH4A 1T8OA 4UFDH 3UFAA 1Y3XA 1P2KA 3A81A 3BTHE 4BTUB 4Z1MD 1H9IE 3SV7A 2CN0H 4OS7A 2BD2A 3MHWU 3MU0A 4FVDA 1B0EA 1EOJA 4MQAA 1ZJKA 3E6PH 1P11E 2ZCLP 1GI2A 1XKBC 2A2XH 1C4U2 1H8HD 1L2EA 2QF4A 5SGAE 4CBOA 1V2MT 1FPHH 3ODDA 1FJSA 1HCGA 2TPIZ 1HIAB 1KLIH 3AW1A 3TJUA 3BF6H 1LO6A 2BB4A 1SOTA 2ZHEH 2ANKH 1EZUC 2FESH 1SGYE 1UVPA 3GYMA 1MAYA 4CRCA 2SNVA 4NFEA 1QIXB 1NN6A 1JMOH 2BDHA 3ODFA 2WHXA 2ZI2H 5EQRA 2ANYA 2BLVA 2G51A 5EOKA 5GJ4B 3CS0A 1O5AB 3HPTB 4JYVH 1SGFA 1AZZA 3ZVGA 1C2FA 2B9LA 1A0HB 1SQAA 1P9SA 2HPQH 1W11U 4YESB 1A0LA 1W12U 5DN6D 4HTCH 1GMHF 1DXWA 8ESTE 1A5IA 1LPKB 2KCYA 3ZIAD 4YZUA 5FAHA 1DWEH 1O37A 5G4BA 1VGCC 2ZU1A 3F9GA 3E0NB 2H5CA 8GCHF 2C8XB 4D8NA 1P02A 2RDEA 5FHTA 3A80A 1D3PB 1BOQA 1S85A 3F3BA 1WYKA 3DUXH 1QQUA 3F2FA 3GY6A 2IJOB 1BJVA 1GHYH 3A88A 4Y76A 1E1RD 3PB1E 1TNLA 3RDZA 1BTYA 1UTNA 1KLJH 1ORFA 3Q76A 2C8ZB 4FU7A 1C5NH 2ZFQH 5DP3A 5T3HA 2BQWB 2ZTXA 1A2CH 1YYY1 2PKSB 2M5TA 5B6OA 3A82A 1C1OA 3RMMH 4HI3A 3RXMA 5AF9H 1V2OT 1AQ7A 4RT1A 1DT2A 2VNTA 4Y10E 1ABIH 1MABB 1CVWH 1F0SA 2FYRA 2BLQA 4XE4A 1XM1A 4FUGA 3M37A 4ABAA 2KR7A 1T31A 2A1DB 2ZPQA 4O3UA 2O8TA 1DANH 2IN2A 5CMXH 1RGQA 3QGNB 1CGJE 3PV4A 1MBQA 2Q6DA 2ZDMA 2AEIH 3QUMP 3P17H 1ZHRA 7KMEH 2R0LA 4YLUA 3TGJE 2VVVA 3PMJA 1TPSA 2XXLA 4Y0ZE 3RXJA 1CT2E 1INCA 1FNIA 2YOLA 3BTGE 3M61U 3U1JB 1MCTA 1PYTD 1W0ZU 2UWLA 2JH0D 7ESTE 1GMCF 5H4IB 2V0BA 4U30A 3NZIA 2J34A 1E0FD 1O2LA 1YM0A 3MO9A 2BY6X 3ZZ6A 1CBWC 1C4Y2 4KKDA 2WPIS 4AFUA 2G5VA 3M3SA 1O2TA 3LONA 3ZZ5A 1YCPK 3U98H 2GMTB 3MH5A 2YMSC 4RKJB 1HRTH 3KQEA 4ZXXH 2BLWA 1BRCE 1IOEA 4OGXA 4M7GA 3ATLA 2ZGJA 1SMFE 1UTLM 4GCHG 3S7KB 1GBBA 2WPHS 3FAOA 1YCPH 3T27A 1DFPA 2AMQA 4FETA 2G4UA 2QC2A 5AFYH 2F9VA 4ZCNA 3M5MA 2ZFPH 1LQDB 2OQ5A 3SNEA 5CHAC 2BD4A 3SGAE 1BHXF 4K5ZA 1KXBA 3PTBA 3T26A 2KAIB 1MU8B 3GY7A 4AG2A 1MKXK 4NA8A 2UUJB 4E7RG 4X0WU 1T7CA 1SFQB 2VINA 1LMWB 3MU8A 4J1YA 5A09A 1DSUA 1ANBA 1XVOA 4GHQA 3SZNA 2SGDE 2Y80A 5GWZA 2STAE 3U1IB 5CDFE 1LHEH 1TA6A 3RXVA 3RXKA 2CGAA 5T6GA 1P06A 3KQBA 2AIQA 4WJG2 2AHME 4ABJA 3D62A 1V6DA 3RXEA 1TNIA 5DO4H 1EATA 1EFRD 4TYDA 2FYQA 4B75A 1PQ8A 2FI5E 3ZYDA 1BUIA 4NZLA 3A7YA 1G2LA 1YPHE 1SGDE 3GS9A 2VIOA 3M7TA 5DK1A 4YXWD 1SB1H 1J17T 5ESTE 6ESTA 1EX3A 4XOJA 2Y5FA 4XSKU 1GJ8B 1QB9A 2L74A 4YTAA 1YKTA 3E8LA 4ISHH 2BYAX 3LC5A 1C5WB 4I8HA 2WPDD 3A8AA 1Q31A 1O39A 2QAAA 3NWUA 3SNAA 3U28C 1ELCA 1XXFA 1QBNA 1FY8E 1GI0A 4ABFA 3SUFA 3RXBA 3QGJA 3FZDA 3QZQA 2KCOA 3E0PB 2ZDKA 1KDQB 1ZGIA 3UOPA 2ZEBA 5AHGH 2O8UA 1PYTC 1GI6A 4D76A 2ZO3H 1TGBA 3SV9A 1ZZZA 2F3CE 2KX4A 1XKAC 1V2TT 1C2DA 1HJAC 3LJJA 3TPIZ 5GIBA 3RC6A 1BCUH 4D9QA 5L6NH 2FX6A 4ZKRU 1TX7A 3F68H 4M9FA 3FOAA 3U8RH 1Q2WA 1UK2A 1BBRK 2XW9A 2VWLA 1C5OH 1QB6A 1GJCB 2P93A 2FOHA 2B5TB 1K0HA 1J16A 3UR9A 3KYGA 2FS9A 1ARBA 2Q1JA 1GJDB 1FAKH 4ACBA 2R3YA 3DSGA 5E8EH 3SO3A 1P01A 1RTKA 1WQSA 5GDSH 3LIWA 3L33A 5GPIB 3STIA 3BEUA 2BVRH 2Z6BD 3V3MA 3BTEE 5C17A 2EC9H 2JH6D 2VJ1A 5EQQA 1Y3YA 1GGDB 1AKSA 2RA0A 5E0HA 1LCYA 5C2ZA 3T25A 1S0QA 3TVJB 1N8OB 1B5GH 1F0TA 3S9BA 4KTCA 4BXSA 5BRRE 1QL7A 1GHZA 2GCTB 2ODYB 4AC9A 1MTWA 1GCTB 1LHCH 1Y3UA 3TU7H 1LPZB 3UWIA 2FZZA 3BIVH 1D3TB 4FUIA 2O8LA 1HAHH 1YLNA 3RXSA 2P3FH 3SHAH 2Y5HA 5GXPA 3GCHC 1GMDF 2JJ1D 5FBEA 1IQGA 1TLDA 1TGNA 2HRVA 1DY8A 1GHVH 3N99A 4ZH8A 4DCDA 3QO6A 2GGVB 1Y5AT 1P04A 1TRMA 1VCQA 2H5DA 2ZU5A 1O3IA 6LPRA 5DP9A 8GCHG 2P8OB 1HV7A 1OXGA 1E35B 1GJ4H 2QIQA 1AN1E 1AZ8A 2XWAA 5FX5A 2RA3A 3A7ZA 1U6QA 1FDPA 1PQ5A 2OC1A 3M5LA 3Q3YA 3Q3KA 5C1XA 1S5SA 4WWYA 2F9UA 3F0OA 4AB9A 4IGDA 1NS3A 1P2QA 2BDGA 4GPGA 3GY3A 4WY3A 2GCHF 1SHHB 3TK5A 3C1KA 1DLEA 1P10A 4NCYA 2BY9X 1D9IA 3MU5A 1C5PA 2QA9E 1SGTA 1GBTA 3DFJA 3SGQE 1C5YB 5EJZA 3VB5A 2H2ZA 1P05A 1G37A 1L1GA 1VGCB 1Z8RA 2VIVA 1H4WA 4DGJA 5LH8A 5EQSA 1BMAA 1P2IA 3DHKH 1ZSJA 1H8IH 4KTUA 1E34B 3MI4A 3M5OA 2XOKD 1Z7KA 2P16A 1WDIA 4CH2B 4DY7B 1TQ0B 4P00A 3GCTG 2G81E 1GBHA 4FXGH 2OLGA 1H8ED 3RXDA 4BAQB 2G00A 2UUYA 3P8GA 2QF3A 1ANEA 3UB0A 1XVMA 5HXFA 1TX8A 4CRGA 1V2PT 1Z71A 1LVYA 2OC7A 3LOXA 1P3EA 1F0RA 1GMCG 2CF8H 5DGJA 1ESBA 2A5KA 1TPPA 5HYOA 1QJ1B 1Y5BT 1C1VH 1O3LA 3NPSA 3FZZA 2C93B 3F9FA 1ZPCA 4ISLA 1RFNA 1DSTA 1AY6H 4YOJA 5LPFA 1D3DB 3KHVA 5C5OA 1L4DA 5E0JA 3FO8D 2GDDA 4I32A 1RXPA 3LH1A 1TMBH 5GCHF 1YC0A 1TNJA 3ZZ3A 4YOGA 3HKIB 1GI8B 1O2QA 4X1QU 3S69A 4MPVA 3E90B 4H42U 2BOHB 1V2QT 2Z9IA 1BRUP 1TMTH 1AHTH 2P3UB 3ZVEA 4TT3D 4MDSA 1D4PB 1GHXH 1NROH 4K3JA 1T8NA 2ODQA 4CR9A 2XYAA 1UVOA 1AFQB 2ZQ1A 1MTNB 1PQAA 4AG1A 1C5ZB 1TPAE 1MD8A 3NXPA 5E2PA 1NPMA 3TH4H 3HATH 4Q2KA 2J95A 1O5BB 1V2WT 4ZMAH 1GJ6A 1SGCA 4NSYA 1XUGA 2YMSB 1O3DA 1PPHE 1HNEE 2SGPE 1GG6C 2ALVA 1H9LB 2HLDD 1EPTC 4IC6A 1TAWA 3DSPA 1LTOA 1O5EH 1LPGB 1DY9A 2WYJA 4B2BA 5A0AE 1DLKB 1NRPH 1VCPA 5C94A 3OTPA 1Z8JB 2GT8A 4XRNA 3IG6B 3EGKH 1V2LT 2ZHWH 2PTNA 1QY6A 1T8MA 1OWJA 2FI4E 2PKAB 5L2ZH 1ZTLA 2NU1E 3ELAH 1SGQE 1NU7B 4FU9A 2OBQA 3QTVH 4WVPE 1O3JA 4CHAC 4ZXYH 1NESE 5EIYA 1A61H 3SZEA 2ZFSA 2TIOA 3LKWA 1YY3A 1IQFA 2ZHQH 1GJ7B 1AD8H 1LQEA 2J98B 4JZFH 4Q7XA 1G32B 2XC4A 1K21H 1FX0B 1W8BH 4LZ4B 1O3EA 2P94A 2Z7FE 4Y6DA 3U69H 1QGFA 2AGEX 4BTIB 1DICA 3UY9A 1OS8A 1LHFH 2VGCC 1AVGH 2DUCA 4X1SU 1HAVA 1HDTH 1FXYA 2Q6GA 3T29A 1AGJA 2D1JA 5DP4A 2BLOA 1CHOG 5I25A 1W7XH 3MYWA 2G55A 3BG4C 5EXNA 2OD3B 2GJGA 5K7RA 1CGHA 3ATMA 1UO6A 2HNTE 3TGKE 1YF4A 4AZ2B 1BTHH 2XCNA 2GV7A 5E0GA 3BV9B 1ACBE 1K1PA 2JKHA 1FI8A 4I8LA 1OKXA 4D7GA 3SU1A 2BQ7B 3A7VA 5EXLA 1NO9H 4SGAE 1UCYH 2WV4A 1S84A 3AAUA 1KMHB 2PTCE 1L0ZA 1W0YH 1HAGE 1NZQH 1AB9C 2FOMB 4VGCB 3D49H 4KGAA 4MNXA 5B6LA 1K1IA 3UQOA 1UVTH 3BEIB 1ZGVA 5LPRA 1FQ3A 4OS2A 2FX4A 3GY2A 4H6SB 3S0NA 2ZCKP 4ZKNU 3EA8A 1E38B 1GBAA 1MTSA 2V3OH 2ZP0H 1RTFB 2WINI 3OTJE 5JYIA 1P2MA 1P9UA 4Y79A 2PLXA 1W3CA 4KTSA 2FS8A 2A4GA 1YBWA 3EE0B 3SU6A 3SJ9A 3BTKE 2BX4A 1TGCA 2WV5A 4AYVB 1ZPBA 2XC5A 2GTBA 1GL1A 1ELGA 1QRZA 1W2KH 4IMQA 3BIUH 2G4TA 1P2JA 1C2IA 4CRFA 3HK3B 3ZV8A 1AWHB 1YCPM 4OS4A 3RMOH 2F83A 2DE8A 3OY5U 3UIRA 2RG3A 1S6LA 1HIAA 1NC6A 4NGAH 3SV2H 2O9QA 3MMGA 3TLOA 1O3OA 2FLBH 4CR5A 4AGKA 1K1JA 1GL0E 4NIXA 4AYYB 2RCEA 1C2JA 1QL9A 2ZNKH 3U8OH 1E36B 2FXRA 1GVLA 1AO5A 1SGPE 1QRXA 1TPOA 1P09A 4Y11E 2QYIA 4NWKA 2CXVA 4FUFA 2W26A 2KFWA 3D23A 4JMYA 2A45B 2A31A 4CREA 1QR3E 2BDBA 4X8TH 2XC0A 3BTQE 1THPB 2G5NA 1EZSC 1A7SA 1GDNA 1QHRB 3BSQA 1C2GA 1G3EA 3PMAB 1K1OA 1Y59T 4X1PU 3P8FA 4D7FA 1PPCE 1TBQH 1O30A 2XTTB 2BY5X 1ELAA 5EGMA 3FP7E 4K1TA 3KL6A 4FUEA 4ISNA 3SUDA 1ZHMA 2IOTA 2PSXA 4KP0A 3ZVFA 4NWLA 2WZQA 4PROA 4X8VH 2GZ8A 4DJZB 2C90B 1L4ZA 4RSPA 4JZ1A 2FOCA 1BJUA 1GCDA 2OP9A 3ATWA 5JB9S 3A7XA 4H4FA 4X6OA 3LGTA 4U01A 1S6HA 3LJOA 1UTJA 4X2YA 1ESTA 2BD8A 5HM9A 3KIDU 5ETXA 4A1TA 3A8BA 1VR1H 3M3TA 3PYHA 2GVFA 2GZ9A 3E3TA 1FY3A 3SI4H 1HJ8A 2DE9A 5T1VA 4DG4A 1TA2A 4A5TS 2TBSA 1O3PB 1ZSLA 1OPHB 2AMPA 2P3TB 2YNBA 4OS6A 1DDJA 2ZFTA 4Y8ZA 2F43B 2OXSA 3A8CA 4OS1A 1CHGA 1THSH 3RMNH 1CU1A 1NU9A 2BZAA 3FP6E 1WSSH 4YLQH 1TB6H 3SV8A 1AUTC 1GI4A 5KGOA 3ZVBA 4CH8B 3CS7A 1EKBB 3EYDA 1N6XA 2BD5A 3BG8A 3E1XB 2QXGA 2CHAC 1GBEA 1RIWC 4RI0A 4O97A 1QQ4A 1ZMNA 2FWWA 2QY0B 4JK6A 2F4LA 1EAIA 1ZLRA 3PV5A 5EJLA 2A4QA 2A4RA 2W7UA 2UUKB 2AGIX 1BBRE 4ACAA 2WUBA 5PTPA 3SU3A 1Y3VA 4NA9H 1P12E 3SN8A 1O2JA 3URDA 3GDVA 1OOKB 2TGDA 2K8IA 4OS5A 3QX5H 1GI7B 1VITH 5E2OA 1OP8A 1TQ7B 2K1QA 3KGPA 1F7ZA 3LGUA 3O8RA 2YNAA 2ZIQH 5DP8A 1BMFD 3MNXA 3VB3A 1FY4A 1C9PA 3V0XA 2J97A 4FUCA 3Q3XA 2HALA 2KAIA 1TNKA 1RJXB 4NA7A 1COWD 1O2RA 3RXPA 1KXAA 4DURA 1QA0A 1SLUB 2RFKC 1F5KU 1JWTA 4E06H 1KXEA 6GCHG 1HXEH 1SLVB 4BOHA 1CA0B 1MZAA 1DUEA 5C3NA 4ABGA 1HAIH 3UNRA 3VB7A 1WU1A 4UFEH 4YT7H 3TJOA 4AB8A 2LELA 1OYQA 1MMJN 2PGBB 1ZMLA 3G01A 1XMNB 4CBNA 1SSXA 1C5QA 4H6TA 4K8YA 2ANWA 2GDEH 3SU2A 1C5RA 3SU0A 3TJVA 1AE5A 1SBWA 4Z6AH 2VH6A 2XBYA 2GD4B 1NY22 2Y7ZA 1EPTB 1G9IE 1LKBA 1UK3A 1FPCH 1PPEE 1SQOA 3CNRA 4Y8XA 4BAMB 1O2PA 1F5LA 2AGGX 1FAXA 3SGBE 1FN6A 3ITIA 2TGAA 5JPMH 1EOLA 1EB2A 1S0RA 3MO3A 4KELA 1GHAG 1E37B 3TK9A 1EP5A 1FY5A 1WUNH 1MH0A 5A2MH 5IDKA 1ANCA 4AGJA 1HPGA 2JDID 1BITA 2FP7B 4WF8A 5DPAA 1RD3B 3FVFB 1THRH 1IHTH 7GCHG 1MAXA 4TSFD 2BOKA 2OK5A 2ALPA 2HWLB 1FUJA 1T32A 1W10U 3FFGA 1BMLA 1O2WA 1EZQA 1KDQA 2Z9LA 2FDAA 5FCRA 1ETRH 1O2SA 2W3IA 2QF5A 3WY8A 2EEKA 3GY8A 2FLRH 1LHDH 2FOAA 1HLTH 4F48B 5DJ7A 1Z8GA 2BTCE 3BN9A 1ZOMA 4Q7YA 1WXRA 4U2WA 2ZCHP 1EQ9A 1WTHD 1BMNH 1YWUA 1DE7H 2WV9A 2ZDNA 3ZZBA 2WPJS 1S81A 6CHAB 1TE0A 1TONA 3ESTA 2ZA5A 1OP0A 4K1EA 3MO6A 4DT7B
chains in the Genus database with same CATH topology
1DS2E 4LXBH 4OGYA 4I8KA 5J4QA 1O2OA 3K6ZA 1WAYB 2ZDVH 1BT7A 1BHXB 2CMYA 3P92A 5CE1A 1AFEH 2THFB 3GICB 3TH2H 2P95A 1A4WH 4CRDA 2ZQ2A 3V7TA 2Y6TA 3MU4A 4X2WA 1NM6A 1GJAB 1OYTH 4GHTA 4WXIA 3RXQA 2ZHFH 2VIWA 4XBDA 4Y7AA 2AIPA 1ELEE 1ZPZA 2A7CA 3QN7A 3UOUA 3ATKA 2R2WU 1GMHG 2OC8A 2HNTC 1V2VT 2TRMA 4WH8A 1DITH 3S9CA 4MPXA 1OWDA 1GBFA 2J4IA 4F49A 4YO9A 1EJAA 2ULLA 4ASHA 3T5FH 1MKWH 1O3CA 3F9HA 3Q77A 2F9OA 3GOVB 2D2DA 1AMHA 1DX5M 1LVMA 1C5MD 3BTFE 4RN6A 2J94A 1D3QB 1OX1A 3A83A 1W7GH 3F6UH 1UK4A 2ZC9H 4AFQA 4B71A 2NU0E 3PLPA 1H1BA 1G3DA 2WPMS 4E05H 5JBAS 1BA8B 2PUXB 4BAKB 4UONA 2AMDA 3M3VA 5EU8A 3B8JA 4ABIA 2ZU4A 1CGIE 3T28A 1UTQA 2A5IA 1PFXC 3AASA 1KYNA 1W13U 3SBKA 3BTME 4Y71A 1ZTKA 3SQHE 1XX9A 4X6PA 3SW2B 1K28D 1BDAA 1NRSH 1P2OA 2GZ7A 1TABE 1ZRBA 2CJIA 2LNCA 2VVUA 3RXGA 3SJKA 9LPRA 4R0IA 3QK1A 2H6MA 4A6LA 1AVWA 3L3TA 1AE8H 2G52A 2PR3A 3GDUA 3E91A 5C5NA 3A87A 1O2XA 1SQTA 4NSVA 3DFLA 3SNDA 3UTUH 3ZVDA 5C67A 4UDWH 1P8VC 2GMTC 1AWFH 1SGIB 3I78A 4K69A 3TH3H 5ABWA 4AN7A 2H1UA 2NU3E 1O36A 1LDTT 3SNCA 1BTXA 4LK4A 1O2ZA 3BTTE 1O3MA 4ZHAA 1D6RA 3PROA 3A84A 1ESAA 4Y0YE 4FUHA 1KTTB 4IC5A 4X1RU 1P3CA 3RXCA 1IQNA 1K2I1 1V2UT 1V2ST 5F03A 3ENSB 2R3UA 5FBIA 2A7HA 2EI8A 1YPLH 3ZZ4A 1O2MA 4A1VA 2XBWA 1O2UA 2ZPRA 3STJA 1EJNA 3QDZB 1C9TA 2QXHA 3D65E 2C4FH 2FTLE 3LDXH 3Q00A 1TRNA 3MWIU 1TALA 1L1JA 4I7YH 2ZHDA 4I33A 1CT4E 1HAPH 1CBWB 5T6FA 1GDUA 2VIQA 2GV6A 4GCHF 2Z9GA 1G3CA 1M9UA 5DP6A 4B2AA 2Z3CA 4ABBA 1O5FH 2OCVB 2W7SA 3SHCH 1QJ6B 1JRTA 2CHAB 2J38A 4MLFB 3E16B 1YLDA 1XXDA 1J8AA 1O0DH 2Y82A 5FPYA 2VIPA 1F92A 5CHAB 1O3FA 4HZHA 3P8OA 2XBXA 5A8YA 2FOEA 2ZF0H 1AU8A 2R9PA 2ZGXH 3SQEE 3TIUA 4FVBA 4BXWA 3O8CA 1FY1A 1ZSKA 2ANMH 1EAXA 1TIOA 1PJPA 2ODPA 4TWWA 3SORA 2VIDA 1P03A 5JB8S 3K2UA 1O38A 2AS9A 2PKAA 2PV9B 4NIWA 4NIVA 1GI3A 1UHBB 1HBTH 2BZ6H 2HNTF 8KME2 5JBCS 1BRAA 2J9NA 2I6QA 2QGRA 4A7IB 2F9PA 1V2KT 1O3GA 2AFQB 4MPUA 1NFWA 3ZZ8A 1VZQH 1X7AC 4RKOB 3ZZAA 1K1MA 1QB1A 2UWPA 5EXMA 3PLKA 1V2JT 3TK6A 1TMUH 3TNTA 3RP2A 1RTLA 2VH0A 1KXFA 1O2GH 1S82A 2NU4E 4E7NA 3RC5A 1UCYK 3SU5A 4GUXA 1Z1JA 3CP7A 1ZTJA 2BXUH 2D26C 3PMHB 3SUEA 1SLXB 2NWNA 1C2MA 1P0SH 4ZUHA 1K22H 2ZFRH 2V6NA 2FOBA 3M36A 1NRQH 1HXFH 1O5DH 2AYWA 4IN2A 3EDXB 2A4OA 1QRWA 5FCKA 1N8OC 3FANA 4TWYA 1IQIA 1YPHC 3GDSA 1ZJDA 1HAOH 1B0FA 1O5GH 3M7UA 1RS0A 3K65B 3R3GB 5A8XA 1HJAB 5C1YA 3ZYEA 3RLYH 1VITF 1TNGA 4JK5A 2ZWLH 2RDLA 2Z94A 1SLWB 1Z1IA 4ABHA 1EAWA 3B9FH 1FMGA 4O3TA 3UNQA 3A7WA 2F91A 4MNWA 5DKMA 4A1XA 2H9TH 1MUEB 1T4VH 4AX9H 1YPMH 1GMDG 1GWAA 3MU1A 5LPEA 1CQQA 3HGNA 1GBKA 1BB0B 3BTWE 3EA9A 2P8OC 1J9CH 3MTYA 3RLWH 4X2XA 2SGFE 1QBOA 1TOMH 1GJ9B 1YP9A 4UE7H 1VCWA 1YPGH 4XFQA 4NIYA 4B73A 1JIRA 4K60A 2EA3A 3TITA 5DP5A 3U9AH 4AORA 2BDIA 1DM4B 2Z3DA 1CO7E 5HM2A 1GBDA 4ZROA 4QT8C 1LVBA 2ZU3A 4JZIA 2PWXA 3F9EA 1GPZA 1C2HA 1HB0B 1DOJA 3OX7U 2GCHG 1NFYA 4UFGH 3PMBB 4GVUA 1WTGH 3GCHB 3LH3A 1WQVH 2PUQH 3L6PA 3GY4A 4BANB 3KQCA 4DIHH 1F2SE 1GDQA 2ZFFH 3QLPH 3T2NA 4WMFA 2Z3EA 1O32A 2D8WA 3PM3A 2VWOA 3DT0H 2SFAA 4D9RA 2ZU2A 3QTOH 2A2QH 1IQMA 1O3HA 3ZVCA 3GCOA 5DG6A 2A7JA 1ETSH 1BQYA 1H8DH 2ZGBH 2JETC 4NFFA 2SGQE 1DUAA 2ILNA 4IMZA 4INLA 4WH6A 1C1NA 3VGCC 2F9BH 3P6ZB 2BVXH 1KXCA 1PPGE 5EPYA 3PO1C 1BMMH 4B76A 4X8UH 2QN5T 1QJ7B 4NG9H 2QF0A 1SI5H 2C3SA 2B7DH 1TWXB 1HJ9A 3RM0H 3V13A 4TY6A 9ESTA 3OYPA 3MNBA 1C5VA 1NTPA 1YPEH 5A0CA 1K9OE 2OC0A 3RU4E 3LGIA 5EPNA 2BDCA 4ZAEA 5ESBA 3VFEA 2BM2A 1QTFA 1UTKA 3VXEH 1K1LA 1IQHA 1FV9A 1V2NT 1GBCA 1MQ5A 1QURH 4B2CA 4Q7ZA 1LKAA 3A8DA 1A1RA 1Z8IB 1GJ5H 3GCTF 1EASA 5HMAA 2ASUB 1AVXA 1PPFE 5GCHG 1ELVA 1CA8B 1EXFA 1Z6EA 1IAUA 1AFQC 1MTNC 2BD7A 5K0HA 3VEQB 1BTWA 1UMAH 3TJNA 1FLEE 4YOIA 4FUBA 1SHYA 1C2LA 4BTTB 2QCYA 1EJMA 1UTPA 1TBRH 4AFZA 2HPPH 1O5CB 2VB0A 3N7OA 2GX4A 1O3NA 1SR5C 1O2KA 1GHWH 2BD9A 1FONA 3LGVA 3RXIA 1O2YA 1EAUA 1ELDE 2UWOA 1SGFG 2ZGHA 1A46H 2A32A 2Z9KA 1SFIA 4A92A 3MH7A 3ZZ7A 3GISB 1C1RA 1C5SA 1MU6B 1N6YA 1JRSA 5EG4A 3U8TH 4ABDA 2GT7A 3VXFH 1ZMJA 5JDUB 3TGIE 2ZZUH 1V2RT 3P70B 3JZ1B 1C5TA 4XBCA 1MKXH 1NRNH 1ID5H 1LHGH 1T8LA 1GBIA 4I8JA 5JBBS 3UWJH 1GHBF 2BY7X 1GVZA 5FPTA 4GLYA 1J15A 1KXDA 2H9HA 1Y8TA 2A0QB 3O8BA 1IQLA 1B7XB 2OBOA 1DWCH 1GG6B 1WBGB 1NFUA 5EODA 4ZHMU 2QXIA 4INKA 1HUTH 3S7HB 1N1LA 5FXLA 1OP2A 3SV6A 2ZGCA 2R0KA 5F8TA 3OU0A 1NRRH 2CV3A 4MTBA 3RMLH 3VB6A 2VU8E 3UR6A 2STBE 4X2VA 3RXRA 4THNH 1CT0E 1QNJA 1EPTA 2XWBI 5FPSA 4CHAB 2TGTA 3A89A 1ETTH 2FTMA 1A0JA 2HLCA 1TBZH 3SNBA 5TCCA 2XNIA 1TFXA 3SUGA 4DVAU 2I6SA 1C1TA 1Z6JH 1NFXA 7LPRA 3W95A 1EP6A 1SPJA 1ZR0A 4VGCC 3SI3H 3SOSA 4CRAA 1D6WA 1FIZA 3DD2H 5L2YH 4DOQA 1KIGH 3LPRA 1SGEE 4HGCA 4F4OC 3RXUA 2XCFA 1CHOF 1VJ9U 3CENA 3AAVA 4Y8YA 1DPOA 3KN2A 3RXTA 2VGCB 1OWKA 1MQ6A 1O34A 4GSOA 4IN1A 1G36A 4B74A 1A5HA 4X6MA 3KF2A 1KY9A 1LVOA 3BG4B 1K1NA 2PGQB 4TPYA 3AVZA 1C2KA 1HAYB 1FIWA 2R2MB 3ZVAA 1TGSZ 1BIOA 2PW8H 2BQ6B 1A5GH 2BVSH 2NU2E 3KQDA 4IS5A 4R8TB 1AKSB 3RM2H 2BDYA 4XBBA 1VITG 4ESTE 2FPZA 1BTUA 3IITA 1DXPA 4AOQA 1T4UH 3KNXA 4JYTA 1ANDA 4J2YB 1BBRH 2W5EA 3MNSA 5F8XA 1GBJA 3HGPA 4Y7BA 4B1TA 3QZRA 3T62A 5L30H 5BPEA 3HK6B 4FU8A 4ABEA 1AUJA 1O2NA 2J92A 3B23B 1IQEA 3NUMA 1AB9B 1F5RA 4DW2U 1HAZB 3EQ0H 3R0FA 1V3XA 2FO9A 5F6MA 4LOYH 3VB4A 1MKWK 2SGEE 1C5UA 1EZXC 3OY6U 3SU4A 1QL8A 3RXAA 3KCGH 3RXLA 2VWMA 4INHA 1UVSH 2ZDAH 4WMDA 1SG8B 1SGNE 1IQJA 3K9XB 1GJBB 2Q6FA 1QA7A 3MH6A 1YPKH 1IHSH 2QXJA 1GVKB 2AH4X 1UJ1A 2PKSC 1C1MA 2BX3A 1DWDH 4MNVA 1O33A 1ZYOA 1W14U 2ZTZA 2B8OH 5HGGA 3RU4D 3EA7A 3A86A 5DP7A 3MOCA 2G8TA 1ZHPA 1HFDA 1XUIA 3LGYA 1P2NA 5TJXA 3LU9B 1XUFA 1O3KA 4I31A 2B0FA 2VWNA 5T6DA 3UNSA 5EW2H 2PFEA 4UD9H 3MFJA 3UQVA 3RXOA 1ARCA 4HFPB 1YGCH 1C1UH 1GI5A 5A0BA 4U32A 4WMEA 2BD3A 3I29A 3JZ2B 2HGTH 1NT1A 2PSYA 1G2MA 2ZG0H 3VPKA 3NK8A 3A85A 2OTVA 1UVUH 1HYLA 4NZQA 3SJOA 4JZDH 2PHBA 1C4V2 4YM9A 1FN8A 1C1QA 3PTNA 4ISIH 2SNWA 1SOZA 4Q80A 3SJIA 1C2EA 2BHGA 1PQ7A 2XRCA 2UUFB 2BY8X 1MD7A 5C1UA 1ZRKA 5IYTA 1HAXB 4ZKOU 2JETB 5J4SA 4BNRA 1O3BA 1Y5UT 1JOUB 1G3BA 1TX6A 1OWIA 2FODA 2H9EH 4X1NU 1AI8H 3VGCB 1XUJA 4TY7A 3UREA 1OSSA 4YT6H 3ZZ9A 3PWCA 3S9AA 2V3HH 3PO1B 1GBLA 2FOFA 1Q3XA 3F1SB 3K6YA 3PLBA 2J2UA 3M7QA 1A3BH 2IPHA 1BZXE 3ZZDA 1ELBA 2ZTYA 1L1NA 1ABJH 2O8WA 1FZZA 4Z0KA 1JXPA 1ELTA 1UCYE 2C8YB 2A5AA 3UUZA 1MCVA 1QFKH 1BTPA 3LGWA 4ISOA 2SGAA 1XUKA 1DWBH 2FEQH 3OSYA 2WPKS 4LZ1H 2W3KA 2QV1A 1TNHA 2BMGB 2VVCA 3PWBA 1BRBE 3LC3A 1XUHA 3KEEA 3A7TA 3ZZCA 1EB1H 3HKJB 1UTMA 4IW4E 1OWHA 2TGPZ 1SVPA 3DA9B 1O2VA 1CA0C 3C27B 1TYNA 1PPZA 1O2HA 1C1WH 4K2YA 1RIWB 2HOBA 3RUOA 1AIXH 1EUFA 2OUAA 1MTUA 3H5CB 2V35A 1O3AA 2GKVE 3AW0A 3BEFB 4O03A 1MBMA 1WCZA 3NKKA 3LT3A 2Y81A 1PPBH 3QWCH 4BAHB 1QBVH 4FUJA 4ZKSU 3BTDE 4IBLH 2ZPSA 1J14A 3RU4T 2WPLS 2GP9B 2FOGA 2FMJA 4ZHLU 3IWMA 2ZDLA 4AFSA 1GHBG 1H9HE 3UPEA 4UEHH 1KLTA 1A3EH 1UTOA 1S83A 4WXVA 5LGOA 3M5NA 2P59A 1KSNA 1MZDA 2WYGA 2FI3E 2EI6A 2OQUA 1S6FA 2Y7XA 1CSOE 6GCHF 2AERH 1WOFA 3H7OA 2CF9H 1TRYA 1RRKA 4UFFH 1P57B 5F8ZA 2LPRA 3W94A 1OWEA 4O9VA 4JYUH 1GI9B 2ZKSA 1Y3WA 5C20A 4MG3A 3O8DA 1O2IA 3NCLA 2BXTH 2JH5D 1HAVB 4GAWA 1O35A 1SC8U 4MNYA 1YLCA 3MNCA 1C1SA 1UHBA 3RC4A 1IQKA 2OINA 1MTVA 2ESTE 4K8BA 4XDEA 1DVAH 1WV7H 4MVNA 5AFZH 1BTZA 3V12A 4K1SA 4BAOB 1CE5A 3M35A 3SJ8A 3P95A 4SGBE 5FX6A 1ELFA 4X6NA 3URCA 8LPRA 4JCNA 2BDAA 4X8SH 2Y5GA 2O8MA 5TCAA 1GI1A 2FM2A 3TNSA 3H7TA 1SL3A 4FUDA 6CHAC 1GHAF 5AVDA 3ZV9A 2C8WB 4JZEH 3RXHA 1GGDC 1HGTH 3ATIA 2F9NA 5JBTA 1VJAU 5EW1H 1JBUH 1C1PA 2WUCA 3EAJA 2EI7A 1KTSB 3GCNA 1TGTA 1QCPA 3RXFA 3GYLB 5I46H 2GCTC 1SGRE 2XBVA 1G30B 7GCHF 1C5LH 5A8ZA 1JIMA 1GCTC 2FIRH 3P8NA 3GY5A 4TPIZ 1C5XB 2ZECA 1F0UA 1YPJH 3FP8E 4I8GA 4CRBA 3I77A 1TOCB 1GBMA 2HVXA 4DIIH 1O31A 2Z9JA 4MPWA 3MH4A 1T8OA 4UFDH 3UFAA 1Y3XA 1P2KA 3A81A 3BTHE 4BTUB 1H9IE 3SV7A 2CN0H 4OS7A 2BD2A 3MHWU 3MU0A 4FVDA 1B0EA 1EOJA 4MQAA 1ZJKA 3E6PH 1P11E 2ZCLP 1GI2A 1XKBC 2A2XH 1C4U2 1L2EA 5SGAE 4CBOA 1V2MT 1FPHH 3ODDA 1FJSA 1HCGA 2TPIZ 1HIAB 1KLIH 3AW1A 3TJUA