2ILNA

Crystal structure of the bowman-birk inhibitor from snail medic seeds in complex with bovine trypsin
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title Crystal structure of the anticarcinogenic Bowman-Birk inhibitor from snail medic (Medicago scutellata) seeds complexed with bovine trypsin
pubmed doi rcsb
total genus 47
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ilnA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ilnA02
2ZQ1A 5K7RA 3TU7H 2ALPA 1M9UA 4CRCA 1AVXA 7ESTE 1RRKA 4MNVA 2D1JA 3UY9A 3S69A 1NU7B 4ZHMU 1QTFA 5HGGA 2HPQH 3F9FA 3SUGA 1PJPA 1ARBA 3LGIA 1HPGA 1NFUA 3FP6E 1PPEE 3ZYEA 2A1DB 2VIDA 1V2JT 1JWTA 1OP0A 3NUMA 1GJ5H 4CH2B 3ATLA 4ABBA 3MFJA 2GT8A 1C4Y2 2TGTA 3GCHB 5C5OA 1C1UH 1AIXH 1C2MA 1UVUH 2BVRH 4A6LA 3M7TA 3M36A 2Z7FE 1YPLH 1OSSA 2O8UA 4UEHH 1BB0B 2PSXA 1Z6EA 2GV6A 3ATKA 2CGAA 2EA3A 1NESE 4Y71A 5L6NH 4B74A 2FXRA 5E0GA 2ZFRH 4XSKU 3PLKA 2CF9H 1BTPA 3HGNA 3GY6A 1GMCF 1Z1IA 2WYGA 2IN2A 3TGJE 1V2VT 2G5NA 1TMBH 3QDZB 3KIDU 2UWPA 3ZZ3A 2PV9B 2A4GA 3ZVAA 1C4V2 2WV5A 4RKOB 4RN6A 2BD5A 3Q3YA 1QBOA 2C8WB 1TAWA 1BHXB 1HAGE 2ANMH 1MTNC 4LXBH 3BTDE 2VGCB 2H9HA 1FJSA 1H9HE 2QN5T 2ZNKH 4AX9H 1BHXF 1VITG 3D65E 2FO9A 1EASA 1TNLA 3S7HB 3DA9B 4X6PA 1NM6A 2QXJA 3P95A 1C1WH 2HNTC 5A0CA 1CT0E 1DS2E 2ZIQH 2G52A 5JB9S 1GBKA 3A8DA 1OS8A 1Z1JA 3PWCA 3QWCH 2A7HA 4XDEA 1SSXA 1HYLA 1T8MA 2ZDMA 1P8VC 2XBYA 1K1MA 6GCHG 4UFGH 8KME2 4I33A 5EW2H 2Q6FA 1YKTA 3SJ8A 1UVOA 2AGIX 1Z8RA 4I8KA 3A84A 2R3UA 1A3EH 3HKJB 3QUMP 4MLFB 1SI5H 1SGFG 3R3GB 3SNDA 1IQFA 1F2SE 4CHAC 3MNSA 1EJMA 3A7ZA 1V2QT 1AGJA 3EDXB 3T5FH 2ZDAH 3EYDA 1XX9A 4ABHA 1HBTH 2OXSA 4JMYA 1NC6A 2NU1E 1OWEA 3VFEA 1GG6B 3ZVEA 4CRDA 4CRGA 3ODFA 8LPRA 4OS1A 3RXFA 3M7QA 1GBMA 3MNCA 2ALVA 1WU1A 3L6PA 2UUYA 3BTEE 2BDBA 3E91A 1LKAA 3MH4A 4MDSA 1WSSH 2F9OA 1F0TA 1TPPA 1GBFA 3F1SB 1AZZA 1G3CA 1EOLA 1MBQA 5EU8A 4DGJA 1NPMA 4ZHAA 3MH5A 5GPIB 1JMOH 4Z6AH 3AVZA 2ASUB 4ASHA 1SVPA 1EPTB 1EAUA 1UVTH 1UCYH 4UE7H 3SNAA 2EI8A 1UCYE 3R0FA 2Q6DA 1ZTLA 2QGRA 4WF8A 1FIZA 1W13U 3Q77A 1ZGVA 3T28A 3DUXH 2UUKB 1YPHC 1GMHG 3QN7A 2BXTH 3ZZCA 1BBRK 1NFXA 2ANWA 3V0XA 2DE8A 3M35A 1CHOG 1FY4A 1O2ZA 1NZQH 3BTGE 1ZR0A 1BTZA 1WQVH 1UK4A 5H4IB 1C1TA 1SB1H 4U32A 3Q3KA 2BOHB 1QB9A 1QR3E 1DFPA 1B7XB 2VNTA 3RXJA 1YGCH 1O3FA 2GD4B 1V2MT 3BSQA 1ETTH 4MPWA 2V0BA 2G4TA 3GISB 1LMWB 3UOUA 1C5SA 1WUNH 2FOCA 1QJ6B 1P12E 1HDTH 1CGJE 2J9NA 3OY6U 1D9IA 4Y10E 1LHCH 2D26C 3OU0A 1Y3VA 5HYOA 1O5EH 1QFKH 1Y3UA 3T2NA 1XUFA 4X8UH 3BTHE 4WJG2 1HGTH 4X8TH 1A4WH 1SGYE 2PKSC 3P8FA 4YO9A 2WYJA 3MMGA 5EPNA 1A46H 3UWJH 1INCA 1P9UA 2A5KA 3SU1A 3QZQA 3KHVA 5FBEA 4NCYA 1A7SA 3RXAA 1EP6A 1TNHA 4DIIH 1MH0A 3M3VA 1ACBE 1QNJA 1GBBA 4LK4A 3FFGA 1VCQA 2ZTYA 3LGTA 4CHAB 4ABIA 3M3TA 5EXMA 2XBVA 2HRVA 1UTQA 1SGQE 4NZQA 1MTSA 3TGKE 1VR1H 5L2ZH 5EQRA 3RXBA 3UPEA 3HPTB 4NGAH 4XBDA 1MKWH 4JYUH 1G37A 1J16A 1GI0A 1ZHMA 1GI2A 1JBUH 1ETRH 4JK6A 1YCPH 2FYRA 4U01A 1SPJA 4MPVA 1OKXA 1MUEB 3RDZA 1NRRH 4NFEA 3LJJA 1LHFH 1AO5A 4YZUA 2FLBH 1HAVA 1ZSLA 3OY5U 4CBNA 5T6DA 1QL7A 3ZZ7A 2ANKH 1ANBA 5LGOA 3E8LA 3BTTE 3SQEE 3UFAA 1K1IA 1S81A 4UDWH 3PMHB 1WBGB 1BDAA 2XBWA 3TJVA 4Q7ZA 3VEQB 1DSUA 2FWWA 3RU4T 2ZHQH 3SOSA 1OXGA 1E36B 1GJ4H 3NK8A 1XM1A 3HK3B 5JB8S 1BRBE 4X2WA 5FBIA 3RC5A 5C2ZA 1LQDB 1L4ZA 1HNEE 2GGVB 2AFQB 1L1JA 1W2KH 4X1NU 2WPJS 1SGNE 1L4DA 1P2IA 2XC4A 5GDSH 2ODPA 2QC2A 2A7JA 1C2FA 1NRQH 3ZZ5A 1RD3B 4HTCH 1O2WA 1LVOA 5FPYA 5ETXA 1C5PA 3UQOA 1EZUC 1H4WA 2FYQA 2B8OH 3LKWA 5LPEA 1O3MA 1A0HB 4FXGH 2W26A 2SGAA 1DXPA 3NZIA 1L1NA 4R0IA 3RXIA 5C3NA 1GL1A 4MQAA 1BMAA 1QIXB 2FI3E 1A61H 1BRAA 3UNQA 2FOMB 1VITF 1GHBG 4AFSA 3SU4A 2XWBI 2PKSB 3FAOA 5GIBA 1AKSA 1V2NT 1XVMA 2SGQE 2H5CA 3SJKA 1TIOA 3O8DA 3E16B 2G5VA 2ZWLH 3UNSA 1S5SA 1QL8A 2AGGX 8ESTE 1Z8JB 1OWDA 1DT2A 1GBIA 3NXPA 5PTPA 4ISLA 5GJ4B 1DY8A 1GI4A 2FZZA 3SI3H 1O2RA 2W5EA 3KCGH 4UFEH 1FZZA 1AB9B 2THFB 6GCHF 4X1RU 1ABJH 3ZV8A 2FM2A 3URDA 3W94A 4GHQA 2H9EH 1Z6JH 4NA7A 1MBMA 2VWLA 1DWEH 2JH6D 4OS7A 5FHTA 1H9LB 1XUIA 3DHKH 4CRAA 1A0LA 1HAHH 1SFIA 1C5VA 2PR3A 4IMZA 1WTGH 2CHAC 1S6HA 2VVUA 1Z7KA 1K21H 2Y5HA 2A7CA 1O5DH 3GY7A 3H7TA 5DP7A 1SGCA 5L30H 2P59A 2FOHA 1BJUA 2Z6BD 2XRCA 1HLTH 2VIOA 2IPHA 1H9IE 1IQEA 1GCTC 1ORFA 5F6MA 1TX6A 2GCTB 2NU3E 2ZGXH 4PROA 4X1PU 1QGFA 3KN2A 1IQNA 1ZRBA 4FUJA 3GDSA 1QBNA 3O8CA 1A2CH 2AMQA 2FOEA 3O8BA 3SN8A 3RXLA 2QCYA 1GCDA 3LDXH 1O2LA 3TIUA 1FDPA 1GBAA 1SOZA 1O3HA 1TX7A 1UHBB 1HV7A 1C1QA 1C1NA 1TABE 4MNYA 1GMHF 1O2QA 3NKKA 5T6GA 5A09A 1E34B 1TONA 3ZVCA 1GBJA 5FX6A 1JOUB 5A2MH 1CHOF 4Z0KA 1IQHA 2C3SA 1ELTA 4YT6H 1DOJA 3F68H 1GHXH 1QA7A 1AVWA 4INKA 1J9CH 5JPMH 3W95A 4SGAE 1HXFH 1T8OA 1LHEH 1CA0B 2OLGA 1F92A 2ZP0H 1HRTH 2OP9A 4ZXXH 2BD2A 2FS9A 1KTSB 3QX5H 2C4FH 6CHAC 2R2WU 5AHGH 2ZA5A 2BLQA 3A81A 2PKAA 4CH8B 3Q3XA 4AGJA 2XCNA 3GOVB 2A4OA 3MU4A 1MD8A 4X0WU 3RXEA 3SUFA 4K8BA 1DVAH 3IWMA 1KDQA 1C1MA 1C1OA 1OPHB 4ZH8A 1IHTH 2ZFPH 1B5GH 3AASA 4X1QU 2R9PA 1N1LA 4AB9A 2H9TH 1GHVH 2GZ7A 3RC4A 3TK9A 2Z9GA 2QXGA 1THPB 2ZF0H 2PWXA 5BPEA 1O3LA 3E0PB 1G2MA 2Z94A 3SV6A 3A89A 2F3CE 3F9GA 4Y0ZE 1JIRA 4XBBA 2CMYA 1QJ1B 1DUAA 1ELFA 1RTKA 3RP2A 3P92A 3SGAE 1O2TA 1UTOA 2HGTH 2B0FA 3K65B 3CP7A 1DWDH 1CHGA 2ZO3H 2CHAB 2VB0A 1QHRB 4RSPA 5DKMA 2BYAX 4Y7AA 4AG2A 1RXPA 1BBRH 4DOQA 1FY3A 1O3OA 1BBRE 2ZHWH 3STJA 4WWYA 1HAZB 1TGTA 1O2MA 3MTYA 1KXEA 3QK1A 4NA8A 3S9AA 3MU1A 2BDCA 3TJUA 4BOHA 1J8AA 2BQWB 5E2OA 3MI4A 1LVBA 4BAKB 1GCTB 1MAYA 5GXPA 1KXAA 2SGEE 1QRXA 4Y0YE 2Z9JA 3M37A 3T25A 1O36A 1QRZA 1ZYOA 4AORA 3U8OH 2NWNA 1ELDE 2RDLA 1CA8B 3BTWE 1O32A 1XUKA 3KQDA 1J14A 3RLYH 1VZQH 1GWAA 2BLWA 3ZZ6A 1F0RA 2QF0A 2ZHEH 5F8ZA 3RU4D 2V3HH 1YP9A 1TPAE 2ZPRA 3DT0H 2FODA 5JYIA 2BY6X 1TYNA 1CO7E 1OYTH 3PLBA 5I46H 1C2IA 1TB6H 4B2CA 2SGFE 2F9UA 2Z9LA 2Z3CA 4LZ4B 2BZAA 1C1RA 1KY9A 4ABAA 1P06A 1SQAA 3QO6A 4R8TB 1NRSH 1K28D 1WTHD 1BA8B 3WY8A 1T31A 4Y8YA 1ANEA 4D7GA 2F9BH 3PV4A 1PQAA 4NIWA 2ODYB 3A87A 2KAIA 1FN8A 1YLDA 1UTMA 2G81E 5E2PA 2ZCHP 1MZAA 3A82A 4B71A 4XFQA 3EE0B 2A5IA 1YYY1 4E7NA 2FOGA 1O5FH 4IW4E 3RUOA 1LPGB 1GHBF 5ESBA 1MKXK 2GZ9A 2J34A 3TITA 1FUJA 1Z71A 2PFEA 1BMLA 3PTBA 4B75A 5GCHG 1CSOE 1FPCH 1IQGA 4FUEA 1O5GH 3LGUA 1YBWA 3T27A 4DW2U 1Q31A 3BG4C 1GBLA 1DX5M 1VJ9U 4U2WA 4ESTE 1KIGH 1V2TT 1OP8A 5BRRE 1GHYH 1O2PA 1T8NA 3B8JA 4F4OC 4INHA 3T26A 3VXEH 3IITA 1SFQB 1KXBA 4ISNA 3TH3H 3TLOA 1LVMA 3PYHA 4UFFH 2W3KA 3RMMH 1HAXB 1ZZZA 2BDIA 3EQ0H 2RCEA 3SJ9A 4D9RA 1JXPA 1C2KA 1A3BH 1QA0A 2B5TB 5C1YA 3VB5A 2FP7B 1FNIA 1V2UT 1E35B 3BEFB 3SW2B 4Q80A 2OC7A 4DURA 4AFUA 3SORA 5C67A 2ZGCA 3RXPA 1SGIB 1P02A 3ZV9A 3TVJB 1V2LT 2I6SA 1UTPA 5CHAC 6LPRA 9LPRA 1EOJA 3SUEA 1NRPH 2BZ6H 2SGPE 1P2OA 1D3TB 1FY8E 2M5TA 5C20A 2FTMA 3S9BA 1AE8H 1HAIH 1MQ6A 3MO9A 3QGNB 5FPSA 3PMJA 1OWKA 1QY6A 3UWIA 2Y7ZA 1SBWA 1P01A 3QZRA 5FCRA 1UTLM 1P57B 1GJAB 1TLDA 5A8XA 5C5NA 1DICA 1TBZH 1FY1A 2GCHG 3ZZAA 1VJAU 1QCPA 1JRTA 3GY5A 1BCUH 2J38A 3RXHA 3E6PH 1HIAA 2FTLE 1ABIH 2ZFQH 1CT2E 5E8EH 2EC9H 1ZPBA 1W11U 3KGPA 1YCPM 2P95A 4K8YA 5DP6A 1GBEA 5FAHA 3LH1A 4AGKA 1C2LA 4K1TA 3D49H 2YOLA 1Q3XA 4CR9A 1OX1A 3BV9B 3RM2H 1TRYA 2ZU4A 3UREA 1HJ8A 2FI5E 1KSNA 2R2MB 2V6NA 2NU4E 3KL6A 3RXSA 2SNVA 2ZU1A 4ZMAH 1T8LA 3UIRA 2R0LA 1ELEE 1DXWA 4NWLA 5A0BA 1ZHRA 5JBAS 1AWHB 3M5OA 3UR6A 2HALA 5JBTA 2EI6A 1MTNB 2BB4A 3SJOA 3BG4B 4X8SH 5DP9A 3LPRA 2B7DH 2UUFB 1F0SA 1WAYB 5HM2A 1KTTB 2RA0A 3B9FH 2BVSH 3VB6A 4GUXA 1TA2A 3E1XB 1WOFA 2W3IA 2BY8X 1C5TA 4KP0A 2DUCA 1HB0B 1EZXC 4H4FA 1IQLA 1EX3A 3RXTA 3SGBE 4DG4A 1OOKB 1SGTA 3A7VA 1SGRE 4BXWA 2F9VA 1PQ8A 1NY22 2BX3A 1V2ST 1AN1E 2HNTF 2ZCKP 4CR5A 2HLCA 4RKJB 2TIOA 1CE5A 1Y5AT 2Z3DA 1GVZA 3RXVA 2ILNA 1SGDE 1AU8A 2AMDA 1GDUA 2AERH 4FVBA 1TOMH 2GZ8A 1ZMNA 5TCAA 3RXQA 1OWJA 4INLA 3SQHE 1ZMJA 1MCVA 2TGAA 1PPZA 3VB7A 1EUFA 5EXNA 1V2PT 2NU0E 2V35A 1FV9A 2FLRH 3VB4A 1YPKH 3MU5A 3SJIA 4GLYA 1XXFA 1L0ZA 3V13A 2C8ZB 1C2DA 3GICB 2AGEX 7KMEH 1TBRH 1O3EA 1TGSZ 3JZ2B 4CRFA 2O8MA 3K2UA 4GCHF 1KYNA 1NROH 3ZZDA 4DCDA 2PGQB 4WXIA 3FP8E 3VGCC 1P2QA 1Y59T 7GCHG 3SV7A 4OS2A 4MVNA 2QV1A 2ZDLA 4GSOA 3S7KB 1UTNA 2AIQA 1ELAA 1SQOA 1P11E 3GY3A 2CJIA 3GDVA 3PO1C 4B1TA 3P6ZB 1O3CA 3KF2A 1GGDC 3ZZ8A 2ZCLP 3SNBA 2XWAA 3I29A 2TGDA 4BAMB 1MMJN 3RXMA 1RS0A 1ZHPA 4JK5A 3EAJA 2PSYA 1FIWA 3EA7A 3MOCA 1ZOMA 3T62A 1FI8A 3RXKA 2OC1A 4A1TA 3U69H 3QLPH 1D6RA 3RXGA 4JCNA 1PPCE 2XC5A 1D3DB 1SHYA 3QTOH 4FUIA 3H5CB 1P2KA 4AN7A 4FUDA 1T4UH 1F7ZA 2BMGB 1KLTA 1V2OT 2DE9A 3F6UH 1C5ZB 1TALA 1N6YA 2ZFFH 3HGPA 3BTKE 1TFXA 2PTNA 1RTLA 1GPZA 1O3IA 3UR9A 1GI7B 4YM9A 1B0FA 1O39A 1V3XA 2JETC 1D6WA 1LDTT 1SGFA 5FCKA 5GCHF 1G36A 2H5DA 1UO6A 1QRWA 2W7UA 1HAVB 1TGCA 3D62A 1UVSH 1FN6A 1BT7A 1E38B 1XUJA 1IQKA 1XMNB 1C5YB 2C93B 4TPIZ 1C5UA 2XYAA 1JIMA 4ZAEA 1TPSA 1DM4B 4Y76A 1C5MD 1ZJDA 3GY8A 1TGNA 3A7WA 3FANA 2WPMS 2XBXA 2RG3A 4YTAA 5HXFA 1AQ7A 1NFWA 3SV9A 1BQYA 1P2NA 3BG8A 1GJCB 3PB1E 3FVFB 1G3DA 1TNJA 4Y8ZA 2FOBA 3RMLH 4JZFH 3TJNA 1EAWA 4MNWA 4D8NA 2YNAA 2GX4A 4OGYA 2FDAA 1NTPA 2R0KA 3V7TA 2ZHFH 3BIUH 1W14U 2TRMA 1GBTA 1BIOA 1C2GA 5A0AE 4YOJA 2OQUA 1HFDA 1P3CA 2FX6A 1PPBH 1DWBH 1TNKA 2A4QA 3H7OA 1BRCE 4O9VA 1C1PA 3VGCB 3SNEA 1QURH 1O2VA 1ESBA 2AEIH 2D2DA 3RXOA 1T7CA 3SU6A 1KXDA 4IN2A 4TY6A 1C5XB 1GHAG 1MKXH 2BQ6B 2ZDVH 1GVLA 1GBCA 2ZPQA 3U98H 5EG4A 4NSYA 1AKSB 1O37A 1C5RA 3PO1B 6ESTA 1S82A 2GKVE 3P8OA 2XTTB 1ESTA 3M3SA 1P9SA 1ZGIA 3LGYA 2AH4X 2GCHF 1XXDA 2QXHA 2A2XH 2BVXH 3HKIB 2QY0B 2FPZA 1C2EA 3SU0A 4YLUA 1BOQA 1SGEE 1IAUA 4X1SU 3OX7U 4KGAA 2VVVA 4ABJA 2WUCA 3A85A 1XUHA 2CN0H 1PFXC 1O3GA 3P70B 2Z3EA 1ANDA 1A5HA 2PHBA 3GYLB 4AFQA 1HAPH 4DVAU 4H6SB 3RXCA 4Y79A 2BD7A 3U1JB 4Q7XA 1G30B 5LH8A 3IG6B 2EEKA 1W0YH 1K1NA 3SU2A 1VITH 3ZYDA 1YM0A 2JETB 1DITH 4HFPB 1VGCC 1TRMA 1FXYA 2IOTA 1ZTJA 2UUJB 4VGCC 1GDNA 3S9CA 3MH6A 1W7XH 2ZKSA 1GHZA 2PTCE 1P04A 4Y7BA 1TGBA 3ZVGA 4TPYA 1DLKB 3TH2H 7LPRA 4KTUA 3UUZA 1D3PB 1FAXA 5EQSA 5CMXH 4J2YB 3C1KA 4E05H 1HCGA 1W7GH 3LONA 1AFQC 5F03A 5GWZA 1DSTA 3UQVA 3A8CA 3GCHC 3LGWA 2FX4A 3ZVBA 1N8OC 4Y11E 1TNGA 2BY9X 2NU2E 1B0EA 1P2MA 4FUGA 4X2XA 2V3OH 3P8NA 1YCPK 3KQBA 1O3KA 2P3FH 3PMAB 4GAWA 1FMGA 4JZEH 4CBOA 5DO4H 8GCHG 1O31A 1RJXB 4WMDA 1BTUA 5AFYH 4BAQB 1YPEH 5FX5A 1A0JA 4TY7A 1O3AA 1DLEA 1FPHH 1THRH 2BXUH 3FP7E 1D3QB 1O34A 1PYTC 3SO3A 1LTOA 1SR5C 2K1QA 4J1YA 4ZKSU 2BDYA 3AW0A 5L2YH 4OGXA 1EAIA 1MD7A 2ZZUH 1G32B 2A32A 4ZKOU 2VGCC 2GDEH 1NFYA 5AF9H 1G3EA 2FOAA 3A88A 4WXVA 2OBOA 3TNTA 4TWYA 2Y5GA 2PKAB 3TH4H 1O38A 3ATWA 3ZZ4A 3RC6A 1O2NA 2OD3B 7GCHF 1NS3A 2G8TA 4A5TS 4WVPE 2HWLB 2F9NA 1KDQB 4K1EA 3ZZBA 5HM9A 1P2JA 2BM2A 1ELCA 2GMTC 2H2ZA 4XE4A 1SLVB 3A83A 1YF4A 4AG1A 2JH5D 1VCPA 1ZTKA 1CGHA 1NN6A 1HUTH 2J4IA 3L33A 4I32A 2ULLA 1QB1A 3LC3A 3MHWU 2QIQA 1W3CA 1WCZA 3KQCA 3ODDA 1UVPA 4NA9H 1Y5UT 3SNCA 5HMAA 2A45B 4K1SA 1N6XA 3P8GA 1GMDG 4X6MA 1O2IA 1CU1A 1ZMLA 2BY7X 1BMMH 1GBHA 3ATMA 1AE5A 4Q2KA 3Q76A 3SBKA 1VGCB 1O2KA 1TOCB 2BD4A 3E3TA 4VGCB 3CS7A 5I25A 1EKBB 3QTVH 1GJBB 1QBVH 1EAXA 1EZSC 1QL9A 6CHAB 1RGQA 5JBBS 4BANB 5JBCS 3M5MA 2LPRA 1GI5A 1GI8B 4A1VA 3RMOH 1O3BA 1E0FD 2VJ1A 3BIVH 4YT7H 2ODQA 2WPKS 4HZHA 3SHAH 4YOGA 1AFQB 4I8HA 1EJNA 1EPTC 4NIXA 2AYWA 1BMNH 1SMFE 5EOKA 2O8WA 4DJZB 3E0NB 2VIPA 3ZVFA 1ELBA 4AZ2B 1N8OB 1C5WB 4FU7A 1W8BH 2ZDNA 1KLIH 1O2YA 2UWLA 2CXVA 2PUXB 5K0HA 3A7YA 2P94A 1TQ0B 1AY6H 1S0QA 1GI3A 3SI4H 4X2VA 1ZPZA 1SQTA 1SC8U 4HGCA 3TJOA 5A8ZA 2ZHDA 1LQEA 1Y3WA 1GJ7B 2GDDA 1BUIA 1X7AC 4O3UA 3EGKH 4JYVH 5IYTA 4JYTA 1D4PB 2WUBA 5F8TA 2QF3A 4WH6A 3EA8A 1SL3A 1IQMA 1K1PA 3TK6A 1AUJA 4IS5A 3MO6A 3MNXA 3QGJA 2C8XB 3P17H 4Y6DA 1J15A 2KAIB 4BTUB 3BEUA 2A5AA 4KTSA 1L2EA 1XUGA 1QJ7B 2VH0A 5J4QA 1CVWH 1MAXA 1LKBA 3CENA 1ZJKA 1ELGA 1A5IA 3BTFE 3ATIA 3GY4A 4TWWA 3TNSA 5E0JA 3DFLA 2PLXA 4FUCA 1Y3XA 1CGIE 1O30A 1LCYA 1GHAF 3ESTA 3SGQE 2G55A 5A8YA 3GCOA 2BD3A 4DY7B 1ID5H 1AI8H 2GMTB 3KNXA 4UFDH 4ISOA 2BLVA 1EPTA 1GBDA 2VWOA 3LU9B 2FS8A 4A7IB 1GJ8B 3RXUA 2P16A 2XW9A 3ZZ9A 1DWCH 3PLPA 1KLJH 1BTYA 4ZXYH 2BX4A 2O9QA 3SV8A 1Z8GA 4NZLA 1H8IH 4M7GA 3A8BA 4OS5A 2Q6GA 1BTXA 3MNBA 3Q00A 1O2UA 4ISHH 3STIA 2SNWA 2VINA 2A2QH 5JDUB 3D23A 1KXFA 4HI3A 3LJOA 1GHWH 4X8VH 5DK1A 3AAVA 5T3HA 2WPHS 1NO9H 5FXLA 1SLWB 1O5BB 1G3BA 1O0DH 5DP3A 2OTVA 3PTNA 2GP9B 1UTKA 4ABFA 4FU8A 1GI1A 2Y6TA 1H1BA 4B73A 1C9PA 2GT7A 2P3TB 3A86A 2STBE 1ZPCA 2ZG0H 1THSH 5SGAE 1XVOA 1W0ZU 1GL0E 3LC5A 1P0SH 2ZFSA 1C4U2 1GI6A 1LPKB 4ZKNU 1ESAA 4NG9H 5DGJA 2YNBA 3SV2H 2ZTZA 3GCNA 2G51A 1O3NA 3RLWH 1DUEA 4IN1A 2OINA 3U8RH 5EPYA 4X2YA 1EATA 4KELA 1TNIA 4X6OA 1BTWA 9ESTA 3SZNA 2B9LA 1L1GA 4I31A 1U6QA 1F5KU 2VWMA 3N7OA 1DPOA 2BDHA 4ZROA 1AHTH 2C90B 1V2RT 3MU8A 4XOJA 1SOTA 2OUAA 4KTCA 1C2HA 2ZC9H 3FZDA 4JZIA 4WH8A 3VXFH 4MG3A 1UMAH 1LVYA 2PUQH 8GCHF 1FONA 3JZ1B 1S85A 3PWBA 1TA6A 3BN9A 2ZPSA 1SG8B 3SU3A 1HIAB 1XKBC 4ZHLU 1P3EA 4JZDH 1WV7H 3U8TH 3KEEA 2ZQ2A 2ZI2H 4F49A 4THNH 2SFAA 2A0QB 4IGDA 1TRNA 2GV7A 2HOBA 3M5NA 4JZ1A 1O35A 2ZGHA 4BXSA 1S84A 1EB1H 4QT8C 3RU4E 4AYYB 2A4RA 3HK6B 1SLUB 3GYMA 4X6NA 3SU5A 1Y3YA 2J92A 1HAYB 1K9OE 3LGVA 2Y5FA 3TK5A 2O8TA 2UWOA 1UTJA 2JKHA 4FUFA 5CHAB 2QXIA 4IC6A 1IQJA 2JH0D 4E7RG 1C1SA 3PM3A 1AB9C 4GHTA 1OP2A 3BEIB 3MWIU 2WINI 1YLCA 4LZ1H 2BD9A 1SGPE 3OSYA 1O2JA 1DE7H 5AFZH 2P3UB 2W7SA 1GJDB 3G01A 1F5RA 2FEQH 5F8XA 1HXEH 4XBCA 1K2I1 5TJXA 1PQ7A 3GCTG 4YLQH 1FAKH 4O03A 2LNCA 1GMDF 2F9PA 3GY2A 2TPIZ 3UTUH 1FY5A 1VCWA 3ENSB 2Z9KA 1C1VH 3KQEA 1P10A 3BF6H 3URCA 1AD8H 1ZRKA 4UD9H 2OC8A 5DG6A 4B76A 3DD2H 3AAUA 2WPIS 3U1IB 2FOFA 3NCLA 1T32A 2GCTC 1EXFA 1LHGH 1P03A 5J4SA 3EA9A 3K9XB 2WV4A 4NSVA 2XNIA 1O2HA 2G4UA 5DP4A 1ZSJA 2HPPH 3F9HA 1OWIA 3A7TA 4ABGA 2VH6A 2ZTXA 2D8WA 1K1OA 4DT7B 1P09A 4Q7YA 3MU0A 1Y8TA 1IQIA 2BOKA 1IHSH 3VPKA 4CRBA 3L3TA 2J94A 4I7YH 1AZ8A 2AIPA 5DP5A 3B23B 1OYQA 2HNTE 1EJAA 2AS9A 1UJ1A 2ZU2A 1TMUH 1NU9A 2FMJA 1MTVA 4AOQA 4B2BA 1MCTA 2GVFA 2ZGJA 1O3DA 5DJ7A 3E90B 1V2KT 4E06H 2P8OC 1CA0C 4OS6A 1PPHE 1ZLRA 4MPXA 3UOPA 4AFZA 2ZDKA 3ELAH 5CE1A 4Y8XA 1V6DA 1ETSH 3UNRA 1EZQA 4K60A 1GMCG 3A80A 4K69A 1J17T 1W10U 2VIQA 4D7FA 2BQ7B 4AB8A 2VWNA 2HVXA 1HJAC 3V12A 1RTFB 3NWUA 4ZUHA 3S0NA 2XCFA 5DP8A 1LHDH 5C1XA 4FVDA 2I6QA 4BTIB 1S0RA 3LOXA 1FLEE 2F91A 3LT3A 1K1JA 2ZU3A 4GPGA 4O97A 5EQQA 1BJVA 3DFJA 2H6MA 1EP5A 1GDQA 4DIHH 2OQ5A 3BTQE 1G2LA 2XXLA 5ABWA 4GVUA 2STAE 4LOYH 3A7XA 1C5QA 4I8GA 1O3JA 3HATH 1UCYK 2ZGBH 1OWHA 3SUDA 1ELVA 1AUTC 1UHBA 3PMBB 3ITIA 5B6OA 1PPGE 2AMPA 4KKDA 3O8RA 1C5OH 2O8LA 4ZKRU 1WYKA 2ZEBA 5EGMA 1HJ9A 1MTWA 3C27B 3K6ZA 4D9QA 3GDUA 1BTHH 1GGDB 3RXRA 3FZZA 1Y5BT 4B2AA 1SHHB 1IOEA 3VB3A 4I8JA 1RIWC 2OC0A 5LPFA 1C5NH 2QYIA 1YPHE 1EB2A 2A31A 5LPRA 1TWXB 4IBLH 2Y7XA 3LH3A 2ANYA 1TQ7B 4MNXA 1XKAC 1O2OA 4WMEA 5C1UA 4FUBA 1O5CB 3SHCH 3M7UA 3T29A 2BDAA 3RXDA 1F5LA 3I78A 1AVGH 5TCCA 1MQ5A 5FPTA 2FESH 1WQSA 4SGBE 2OBQA 4O3TA 4UONA 5E0HA 1UK2A 1W12U 4A1XA 3TGIE 1K1LA 3LIWA 1CBWC 3NPSA 1V2WT 5EW1H 1A1RA 1MZDA 3A8AA 4K2YA 3RMNH 1SLXB 4BNRA 1O2SA 1AWFH 1O33A 1G9IE 3OYPA 1TBQH 2FI4E 3OTJE 1RFNA 4IC5A 4CREA 4YOIA 3M5LA 2BHGA 5EODA 4WY3A 4D76A 1GVKB 2FIRH 3PROA 3RM0H 3U9AH 4ISIH 4MPUA 2RA3A 2P8OB 4I8LA 1QB6A 2TGPZ 1S6FA 2QAAA 2VU8E 3MO3A 1O2XA 2IJOB 4K5ZA 4H42U 1MKWK 1BITA 1KXCA 2GTBA 5DPAA 4A92A 1NT1A 1PQ5A 1O2GH 1LO6A 1MU6B 2EI7A 2XC0A 2CF8H 1HJAB 2VIWA 1EQ9A 1UK3A 2BTCE 4U30A 1JRSA 1ANCA 3M61U 4NIYA 4K3JA 2J2UA 3I77A 1S83A 2PW8H 1NRNH 1DY9A 1YPGH 1YC0A 4BTTB 4IMQA 3MYWA 1O3PB 2BD8A 2BDGA 1AMHA 2Y82A 2J95A 1LPZB 2BLOA 2ZECA 1TPOA 2TBSA 2PGBB 3BTME 1C9TA 2ZFTA 2QA9E 3K6YA 2Y81A 1YPJH 5AVDA 2C8YB 1BZXE 2OCVB 1F0UA 1TX8A 1HAOH 1T4VH 4FUHA 2G00A 1AFEH 4NWKA 1PYTD 5ESTE 2VVCA 5T6FA 4FU9A 4NIVA 3CS0A 3F9EA 2WPLS 1CQQA 1H8DH 1Q2WA 1GJ9B 1CT4E 4OS4A 4AYVB 1RIWB 3GCTF 1TMTH 2Y80A 1DDJA 2ESTE 1K22H 3AW1A 2Q1JA 4BAHB 1ARCA 5EXLA 3TPIZ 1ZSKA 4ABDA 1O5AB 2F83A 4TYDA 1E37B 3V3MA 1DANH 1C5LH 2SGDE 1PPFE 2CV3A 5IDKA 1GI9B 1MU8B 4NFFA 1TE0A 3MH7A 1YPMH 4WMFA 1P05A 1C2JA 1FQ3A 4ABEA 1Z8IB 1GJ6A 1A5GH 2R3YA 1GG6C 1BRUP 2P93A 4GCHG 1MTUA 1QQ4A 4MTBA 4YESB 2Z9IA 3ZVDA 2BY5X 4H6TA 1CBWB 4BAOB 2ZU5A 1QQUA 5G4BA 2H1UA 2VIVA
chains in the Genus database with same CATH superfamily
2ZQ1A 5K7RA 3TU7H 2ALPA 2KCYA 1M9UA 4CRCA 1AVXA 7ESTE 1RRKA 4MNVA 2D1JA 3UY9A 3S69A 1NU7B 4ZHMU 1QTFA 5HGGA 2HPQH 3F9FA 3SUGA 1PJPA 1ARBA 3LGIA 1HPGA 1NFUA 3FP6E 3FOAA 1PPEE 3ZYEA 2A1DB 2OK5A 2VIDA 4F48B 1V2JT 1JWTA 1OP0A 3PRDA 3NUMA 1GJ5H 4CH2B 3ATLA 4ABBA 3MFJA 2GT8A 1C4Y2 2TGTA 3GCHB 5C5OA 1C1UH 1AIXH 1C2MA 1UVUH 2BVRH 4A6LA 3M7TA 3M36A 2Z7FE 1YPLH 1OSSA 2O8UA 4UEHH 1BB0B 2PSXA 1Z6EA 2GV6A 3ATKA 2CGAA 2EA3A 1NESE 4Y71A 5L6NH 4B74A 2FXRA 5E0GA 2ZFRH 4XSKU 3PLKA 2CF9H 1BTPA 3HGNA 3GY6A 1GMCF 1Z1IA 2WYGA 2J98A 2IN2A 3TGJE 1V2VT 2G5NA 1TMBH 3QDZB 3KIDU 2UWPA 3ZZ3A 2PV9B 2A4GA 3ZVAA 2WV9A 1C4V2 2WV5A 4RKOB 4RN6A 2BD5A 3Q3YA 1QBOA 4ZCNA 2C8WB 1TAWA 1BHXB 1HAGE 2ANMH 1MTNC 4LXBH 3BTDE 2VGCB 2H9HA 1FJSA 1H9HE 2QN5T 2ZNKH 4AX9H 1BHXF 1VITG 3D65E 2FO9A 1EASA 1TNLA 3S7HB 3DA9B 4X6PA 1NM6A 2QXJA 3P95A 1C1WH 2HNTC 5A0CA 1CT0E 1DS2E 2ZIQH 2G52A 5JB9S 1GBKA 3A8DA 1OS8A 1Z1JA 3PWCA 3QWCH 2A7HA 4XDEA 1SSXA 1HYLA 1T8MA 2ZDMA 1P8VC 2XBYA 1K1MA 6GCHG 4UFGH 8KME2 4I33A 5EW2H 2Q6FA 1YKTA 3F2HA 3SJ8A 1UVOA 2AGIX 1Z8RA 4I8KA 1E1QD 3A84A 2R3UA 1A3EH 3HKJB 3QUMP 4MLFB 1SI5H 1SGFG 3R3GB 3SNDA 1IQFA 1F2SE 4CHAC 3MNSA 1EJMA 3A7ZA 4TSFD 1V2QT 3OEED 1AGJA 5FL7D 3EDXB 3T5FH 2ZDAH 3EYDA 1XX9A 4ABHA 2VBCA 1HBTH 2OXSA 4JMYA 1NC6A 2NU1E 1OWEA 3VFEA 1GG6B 3ZVEA 4CRDA 4CRGA 3ODFA 8LPRA 4OS1A 3RXFA 3M7QA 1GBMA 3MNCA 2ALVA 1WU1A 3L6PA 2UUYA 3BTEE 2BDBA 3E91A 1LKAA 3MH4A 4MDSA 1WSSH 2F9OA 1F0TA 1TPPA 1GBFA 3F1SB 1AZZA 1G3CA 1EOLA 1MBQA 5EU8A 4DGJA 1NPMA 4ZHAA 3MH5A 3F0OA 5GPIB 3OEHD 1JMOH 4Z6AH 3AVZA 2ASUB 4ASHA 1SVPA 1EPTB 1EAUA 1UVTH 1UCYH 4UE7H 3SNAA 2EI8A 1UCYE 3R0FA 5CDFE 2CK3D 2Q6DA 1ZTLA 2QGRA 4WF8A 1FIZA 1W13U 3Q77A 1ZGVA 3T28A 3DUXH 2UUKB 1YPHC 1GMHG 3QN7A 2BXTH 3ZZCA 1BBRK 1NFXA 2ANWA 1SKYE 3V0XA 2DE8A 3M35A 1CHOG 1FY4A 1O2ZA 1NZQH 3BTGE 1ZR0A 1BTZA 1WQVH 1UK4A 5H4IB 1C1TA 1SB1H 4U32A 3Q3KA 3N7DA 2BOHB 1QB9A 1QR3E 1DFPA 1B7XB 2VNTA 3RXJA 1YGCH 1O3FA 2GD4B 1V2MT 3BSQA 1ETTH 4MPWA 2V0BA 2G4TA 3GISB 1LMWB 3UOUA 2JDID 1C5SA 1WUNH 3F3BA 2FOCA 1QJ6B 1P12E 1HDTH 1CGJE 2J9NA 3OY6U 1D9IA 2WZQA 1LHCH 2D26C 4Y10E 3OU0A 1Y3VA 5HYOA 1O5EH 1QFKH 1Y3UA 3T2NA 1XUFA 4X8UH 2AHME 3BTHE 1HGTH 4WJG2 4X8TH 1A4WH 1SGYE 2PKSC 3P8FA 4YO9A 2WYJA 3MMGA 5EPNA 1A46H 3UWJH 1INCA 1P9UA 2A5KA 3SU1A 3QZQA 3KHVA 5FBEA 5C17A 4NCYA 1A7SA 3RXAA 1EP6A 1TNHA 4DIIH 1MH0A 2W6JD 3M3VA 3F2GA 1ACBE 1QNJA 1GBBA 4LK4A 2RDEA 3FFGA 1VCQA 2ZTYA 3LGTA 4CHAB 4ABIA 3M3TA 5EXMA 2XBVA 2HRVA 1UTQA 1SGQE 4NZQA 1MTSA 3TGKE 1VR1H 5L2ZH 5EQRA 3RXBA 2KX4A 3UPEA 4FOUC 3HPTB 4NGAH 4XBDA 1MKWH 4JYUH 1G37A 1J16A 1GI0A 1ZHMA 1GI2A 1JBUH 1ETRH 4JK6A 4Q4LA 1YCPH 2FYRA 2EQNA 4U01A 1SPJA 4MPVA 1OKXA 1MUEB 3RDZA 1NRRH 2QF5A 4NFEA 3LJJA 1LHFH 1AO5A 4YZUA 2FLBH 1HAVA 1ZSLA 3OY5U 4CBNA 5T6DA 4B6FA 1QL7A 3ZZ7A 3WWFA 2ANKH 1ANBA 5LGOA 3E8LA 3BTTE 3SQEE 3UFAA 1K1IA 1S81A 4UDWH 3PMHB 1WBGB 1BDAA 2XBWA 3TJVA 4Q7ZA 3VEQB 1DSUA 2FWWA 3RU4T 2ZHQH 3SOSA 1OXGA 1E36B 1GJ4H 3NK8A 1XM1A 3HK3B 5T1VA 5JB8S 1BRBE 4X2WA 5FBIA 3RC5A 5C2ZA 1LQDB 1L4ZA 1HNEE 2GGVB 2AFQB 1L1JA 1W2KH 4X1NU 2WPJS 1SGNE 1L4DA 1P2IA 2XC4A 5GDSH 2ODPA 2QC2A 2A7JA 1C2FA 1NRQH 3ZZ5A 1RD3B 4HTCH 1O2WA 1LVOA 5FPYA 5ETXA 1C5PA 2F4LA 3UQOA 1EZUC 1H4WA 2FYQA 2B8OH 3LKWA 5LPEA 1O3MA 1A0HB 4FXGH 2W26A 2SGAA 4P00A 1DXPA 3NZIA 1L1NA 4R0IA 3RXIA 5C3NA 1GL1A 4MQAA 1BMAA 1QIXB 2FI3E 1A61H 1BRAA 3UNQA 2FOMB 2F43B 1VITF 1GHBG 4AFSA 3SU4A 2XWBI 2PKSB 3FAOA 5GIBA 1AKSA 1V2NT 1XVMA 2SGQE 2H5CA 5F53A 3SJKA 1TIOA 3O8DA 3E16B 2G5VA 2ZWLH 3UNSA 1S5SA 1W0KD 1QL8A 2AGGX 8ESTE 1Z8JB 1OWDA 1DT2A 1GBIA 3NXPA 5PTPA 4ISLA 3U28C 5GJ4B 1DY8A 1GI4A 2FZZA 3SI3H 1O2RA 2W5EA 3KCGH 4UFEH 1FZZA 1AB9B 2THFB 6GCHF 4X1RU 1ABJH 3ZV8A 2W6ID 2FM2A 3URDA 3W94A 4GHQA 2H9EH 1Z6JH 2KFWA 4NA7A 1MBMA 4RT1A 2VWLA 1DWEH 2JH6D 4OS7A 5FHTA 1H9LB 1XUIA 3DHKH 2KR7A 4CRAA 1A0LA 1K0HA 1HAHH 1SFIA 1C5VA 2PR3A 4IMZA 1WTGH 2CHAC 1S6HA 2VVUA 1Z7KA 1K21H 2Y5HA 2A7CA 1O5DH 3GY7A 3H7TA 4OM9A 5DP7A 1SGCA 5L30H 2P59A 2FOHA 1BJUA 2Z6BD 2XRCA 1HLTH 2VIOA 2IPHA 1H9IE 1IQEA 1GCTC 1ORFA 5F6MA 1TX6A 2GCTB 2NU3E 2ZGXH 4PROA 4X1PU 1QGFA 3KN2A 1IQNA 1ZRBA 4FUJA 3GDSA 1QBNA 3O8CA 1A2CH 2AMQA 2FOEA 3O8BA 3SN8A 3RXLA 2QCYA 1GCDA 3LDXH 1O2LA 3TIUA 1FDPA 1GBAA 1SOZA 1O3HA 1TX7A 1UHBB 1HV7A 1C1QA 1C1NA 1TABE 4MNYA 1GMHF 1O2QA 3NKKA 2QE7D 5T6GA 5A09A 1E34B 1TONA 3ZVCA 1GBJA 5FX6A 3GS9A 1JOUB 5A2MH 1CHOF 4Z0KA 1IQHA 2C3SA 1ELTA 4YT6H 1DOJA 3F68H 1GHXH 1QA7A 1AVWA 4INKA 1J9CH 5JPMH 3W95A 4SGAE 1HXFH 1T8OA 1LHEH 1CA0B 2OLGA 1F92A 2ZP0H 1HRTH 2OP9A 4ZXXH 5C0TA 2BD2A 2FS9A 1KTSB 3QX5H 2C4FH 3SZEA 6CHAC 2R2WU 5AHGH 2ZA5A 2BLQA 3A81A 2PKAA 4CH8B 3Q3XA 4AGJA 2XCNA 3GOVB 2A4OA 3MU4A 1MD8A 4X0WU 3RXEA 3SUFA 4K8BA 1DVAH 3IWMA 1KDQA 1C1MA 1C1OA 1OPHB 2KCPA 4ZH8A 1IHTH 3WWBA 2ZFPH 1B5GH 3AASA 4X1QU 2R9PA 1N1LA 4AB9A 2H9TH 1GHVH 2GZ7A 3RC4A 3TK9A 2Z9GA 2QXGA 1THPB 2ZF0H 2V7QD 2PWXA 5BPEA 1O3LA 4Q63A 3E0PB 1G2MA 4B6EA 2Z94A 3SV6A 3A89A 2F3CE 3F9GA 4Y0ZE 1JIRA 4XBBA 2CMYA 1QJ1B 1DUAA 1ELFA 1RTKA 3RP2A 3P92A 3SGAE 1O2TA 1UTOA 2HGTH 2B0FA 3K65B 3CP7A 1DWDH 1CHGA 2ZO3H 2CHAB 2VB0A 1QHRB 4RSPA 5DKMA 2BYAX 4Y7AA 4AG2A 1RXPA 1BBRH 4DOQA 1FY3A 1O3OA 1BBRE 2ZHWH 3STJA 1H8ED 4WWYA 1HAZB 1TGTA 1O2MA 3MTYA 1KXEA 3QK1A 4NA8A 3S9AA 3MU1A 2BDCA 3TJUA 4BOHA 1J8AA 2BQWB 5E2OA 3MI4A 1LVBA 4BAKB 1GCTB 1MAYA 5GXPA 1KXAA 2SGEE 1QRXA 4Y0YE 3NRLA 3MQKC 2Z9JA 3M37A 3T25A 1O36A 1QRZA 1ZYOA 4AORA 3U8OH 2NWNA 1ELDE 2RDLA 1CA8B 3BTWE 1O32A 1XUKA 3FKSD 3KQDA 1J14A 3RLYH 1VZQH 1GWAA 2BLWA 3ZZ6A 1F0RA 2QF0A 2ZHEH 5F8ZA 3RU4D 2V3HH 1YP9A 1TPAE 2ZPRA 3DT0H 2FODA 5JYIA 2BY6X 4M9FA 1TYNA 1CO7E 1OYTH 3PLBA 5I46H 1C2IA 1TB6H 4B2CA 2SGFE 2F9UA 2Z9LA 3H09A 2Z3CA 4LZ4B 1E79D 2BZAA 1C1RA 1KY9A 4ABAA 1P06A 1SQAA 3QO6A 2XNDD 4R8TB 1NRSH 1K28D 1WTHD 1BA8B 3WY8A 1T31A 4Y8YA 1ANEA 4D7GA 2F9BH 3PV4A 1PQAA 4NIWA 2ODYB 2QF4A 3A87A 2KAIA 1FN8A 1YLDA 1EFRD 1UTMA 2G81E 3CNRA 5E2PA 2ZCHP 1MZAA 3A82A 4B71A 4XFQA 3EE0B 2A5IA 1YYY1 4E7NA 2FOGA 1O5FH 4IW4E 3RUOA 1LPGB 1GHBF 5ESBA 1MKXK 2GZ9A 2J34A 3N99A 3TITA 1FUJA 1Z71A 5B6LA 2PFEA 1BMLA 3PTBA 4B75A 5GCHG 1CSOE 1FPCH 1IQGA 4FUEA 1O5GH 3LGUA 1YBWA 3T27A 4DW2U 1Q31A 3BG4C 1GBLA 1DX5M 1VJ9U 4U2WA 4ESTE 1KIGH 1V2TT 1OP8A 5BRRE 1GHYH 1O2PA 1T8NA 3B8JA 4F4OC 4INHA 3T26A 3VXEH 3IITA 1SFQB 1KXBA 3OE7D 4ISNA 3TH3H 3TLOA 1LVMA 3PYHA 4UFFH 2W3KA 3RMMH 1HAXB 1ZZZA 2BDIA 3EQ0H 2RCEA 3SJ9A 4D9RA 1JXPA 1C2KA 1A3BH 1QA0A 2B5TB 5C1YA 3VB5A 2FP7B 1FNIA 1V2UT 1E35B 2J98B 3BEFB 3SW2B 2PP6A 4Q80A 2OC7A 3AK5A 4DURA 2K0QA 4AFUA 3SORA 5C67A 2ZGCA 3RXPA 1SGIB 1P02A 3ZV9A 3TVJB 1V2LT 2I6SA 1UTPA 5CHAC 6LPRA 9LPRA 1EOJA 3SUEA 1NRPH 2BZ6H 2SGPE 1P2OA 1MABB 1D3TB 1FY8E 2M5TA 5C20A 2FTMA 3S9BA 1AE8H 1HAIH 1MQ6A 3MO9A 3QGNB 5FPSA 3PMJA 1OWKA 2GJGA 1QY6A 3UWIA 2Y7ZA 1SBWA 1P01A 3QZRA 5FCRA 1UTLM 1P57B 1GJAB 1TLDA 5A8XA 5C5NA 1DICA 1TBZH 1FY1A 2GCHG 2V3MA 3ZZAA 1VJAU 1QCPA 1JRTA 4I86A 3GY5A 1BCUH 2J38A 3RXHA 3OAAD 3E6PH 1HIAA 2FTLE 2KCAA 1ABIH 2ZFQH 1VKYA 1CT2E 5E8EH 2EC9H 1ZPBA 1W11U 3KGPA 1YCPM 2P95A 4K8YA 5DP6A 1GBEA 5FAHA 3LH1A 4AGKA 1C2LA 4K1TA 3D49H 2YOLA 1Q3XA 4ASUD 4CR9A 1OX1A 3BV9B 1WDIA 1TRYA 3RM2H 2ZU4A 3UREA 1HJ8A 2FI5E 1KSNA 2R2MB 2V6NA 2NU4E 3KL6A 3DSOA 3RXSA 3OTPA 2SNVA 2ZU1A 4HG6A 4ZMAH 1T8LA 3UIRA 2R0LA 1ELEE 1DXWA 4AC9A 4NWLA 4FETA 5A0BA 1ZHRA 5JBAS 1AWHB 3M5OA 3UR6A 2HALA 5JBTA 2EI6A 2HVYB 3PV5A 1MTNB 2BB4A 3SJOA 3BG4B 4DT4A 4X8SH 5DP9A 3LPRA 2B7DH 2UUFB 1F0SA 3FN8A 1WAYB 5HM2A 1KTTB 2RA0A 3B9FH 2BVSH 3VB6A 4GUXA 1TA2A 1WXRA 3E1XB 1WOFA 1UW7A 2W3IA 2BY8X 1C5TA 4KP0A 2RFKC 5EJLA 2DUCA 1HB0B 1EZXC 4H4FA 1IQLA 1EX3A 3RXTA 3SGBE 4DG4A 1OOKB 1SGTA 3A7VA 1SGRE 4BXWA 2F9VA 1PQ8A 1NY22 2BX3A 1V2ST 1AN1E 2HNTF 2ZCKP 4CR5A 2HLCA 4RKJB 2TIOA 1CE5A 1Y5AT 2Z3DA 1GVZA 3RXVA 2ILNA 1SGDE 1AU8A 2AMDA 1GDUA 2AERH 4FVBA 1TOMH 2GZ8A 1ZMNA 5TCAA 3RXQA 1OWJA 4INLA 3SQHE 1ZMJA 1MCVA 2TGAA 1PPZA 3VB7A 1EUFA 5EXNA 1V2PT 2NU0E 2V35A 1FV9A 2FLRH 3VB4A 1YPKH 3MU5A 3SJIA 3KYFA 4GLYA 1XXFA 1L0ZA 3V13A 2C8ZB 1C2DA 3GICB 2AGEX 7KMEH 1TBRH 1O3EA 1TGSZ 3JZ2B 4CRFA 2O8MA 3K2UA 4GCHF 4RI0A 1KYNA 1NROH 3ZZDA 4DCDA 2PGQB 4WXIA 3FP8E 3VGCC 1P2QA 1Y59T 7GCHG 3SV7A 4OS2A 4MVNA 2QV1A 2ZDLA 4GSOA 3S7KB 1UTNA 2AIQA 2WPDD 1ELAA 1SQOA 1P11E 3GY3A 2CJIA 3GDVA 3PO1C 4B1TA 3P6ZB 1O3CA 3KF2A 1GGDC 3ZZ8A 2ZCLP 3OFND 3SNBA 2XWAA 3I29A 2TGDA 4BAMB 1MMJN 3RXMA 1RS0A 3SYJA 1ZHPA 4JK5A 3EAJA 2PSYA 1FIWA 5C0UA 3EA7A 3MOCA 1ZOMA 3T62A 1FI8A 3RXKA 2OC1A 4A1TA 3U69H 3QLPH 1D6RA 3PRBA 3RXGA 4JCNA 1PPCE 2XC5A 1D3DB 1SHYA 3QTOH 4FUIA 3H5CB 1P2KA 4AN7A 4FUDA 1T4UH 1F7ZA 2BMGB 1KLTA 1V2OT 2DE9A 3F6UH 1C5ZB 1TALA 1N6YA 3WW7A 2ZFFH 3HGPA 3BTKE 1TFXA 2PTNA 1RTLA 1GPZA 1KMHB 1O3IA 3UR9A 1GI7B 1COWD 4YM9A 1B0FA 1O39A 1V3XA 2JETC 1D6WA 1LDTT 1SGFA 5FCKA 5GCHF 1G36A 2H5DA 1UO6A 1QRWA 2W7UA 1HAVB 1TGCA 3D62A 1UVSH 1FN6A 1BT7A 1E38B 1XUJA 1IQKA 1XMNB 1C5YB 2C93B 4TPIZ 1C5UA 2XYAA 1JIMA 3FO8D 4ZAEA 1TPSA 1DM4B 4Y76A 1C5MD 1ZJDA 2JIZD 3GY8A 1TGNA 4ACAA 2KZ4A 3A7WA 3FANA 2WPMS 2XBXA 2RG3A 4YTAA 5HXFA 1AQ7A 1NFWA 3SV9A 1BQYA 1P2NA 3BG8A 1GJCB 3PB1E 3F0PA 3FVFB 1G3DA 1TNJA 4Y8ZA 2FOBA 3RMLH 4JZFH 3TJNA 1EAWA 2LP6A 4MNWA 4D8NA 2YNAA 2GX4A 4OGYA 2FDAA 1NTPA 2R0KA 3F2FA 3V7TA 2ZHFH 3BIUH 1W14U 2TRMA 1GBTA 1BIOA 1C2GA 5A0AE 5EIYA 4YOJA 2OQUA 1HFDA 1P3CA 2FX6A 1PPBH 1DWBH 1TNKA 2A4QA 3H7OA 1BRCE 4O9VA 1C1PA 3VGCB 3SNEA 1QURH 1O2VA 1ESBA 2AEIH 2D2DA 3RXOA 1T7CA 3SU6A 1KXDA 4IN2A 4TY6A 1C5XB 1GHAG 1MKXH 2BQ6B 2ZDVH 1GVLA 1GBCA 2ZPQA 3U98H 5EG4A 4NSYA 1YY3A 1AKSB 1O37A 1C5RA 2YMSC 3PO1B 1S82A 6ESTA 2GKVE 3P8OA 2XTTB 1ESTA 3M3SA 1P9SA 1ZGIA 3LGYA 2AH4X 2GCHF 1XXDA 2QXHA 2A2XH 2BVXH 3HKIB 2QY0B 2FPZA 1C2EA 3SU0A 4YLUA 1BOQA 1SGEE 1IAUA 4X1SU 3OX7U 4KGAA 2VVVA 4ABJA 2WUCA 3A85A 1XUHA 2CN0H 1PFXC 1O3GA 3P70B 2Z3EA 1ANDA 1NBMD 1A5HA 2PHBA 3GYLB 4AFQA 1HAPH 4DVAU 4H6SB 3RXCA 4Y79A 2BD7A 3U1JB 4Q7XA 1G30B 5LH8A 3IG6B 2EEKA 2WHXA 1W0YH 1K1NA 3SU2A 1VITH 3ZYDA 1YM0A 2JETB 1DITH 4HFPB 1VGCC 1TRMA 1FXYA 2IOTA 1ZTJA 2UUJB 3PV2A 4VGCC 1GDNA 3S9CA 3MH6A 1W7XH 2ZKSA 1GHZA 2PTCE 1P04A 4Y7BA 1TGBA 3ZVGA 4TPYA 1DLKB 3TH2H 7LPRA 4KTUA 3UUZA 1D3PB 3ZIAD 1FAXA 5EQSA 5CMXH 4J2YB 3C1KA 4E05H 4Z1MD 1HCGA 1W7GH 3LONA 1AFQC 5F03A 5GWZA 1DSTA 3UQVA 3A8CA 3GCHC 3LGWA 2FX4A 3ZVBA 2M2AA 1N8OC 4Y11E 1TNGA 2BY9X 2NU2E 1B0EA 1P2MA 4FUGA 4X2XA 2V3OH 3P8NA 1YCPK 3KQBA 1O3KA 2P3FH 3PMAB 4GAWA 1FMGA 4JZEH 4CBOA 5DO4H 8GCHG 1O31A 1RJXB 4WMDA 1BTUA 5AFYH 4BAQB 1YPEH 5FX5A 1A0JA 4TY7A 1O3AA 1DLEA 1FPHH 1THRH 2BXUH 3FP7E 1D3QB 1O34A 1PYTC 3SO3A 1LTOA 1SR5C 2K1QA 4J1YA 4ZKSU 2BDYA 3AW0A 5L2YH 4OGXA 1EAIA 1MD7A 2ZZUH 1G32B 2A32A 4ZKOU 1S6LA 2VGCC 2GDEH 1NFYA 5AF9H 1G3EA 2FOAA 3A88A 4WXVA 2OBOA 3TNTA 4TWYA 2Y5GA 2PKAB 3TH4H 1O38A 3ATWA 3ZZ4A 2WSSD 3RC6A 1O2NA 2OD3B 7GCHF 2YMSB 1NS3A 2G8TA 3DSPA 4A5TS 1OHHD 4WVPE 2HWLB 2F9NA 1KDQB 4K1EA 5KGOA 3ZZBA 1P2JA 5HM9A 2BM2A 1ELCA 2GMTC 2H2ZA 4XE4A 1SLVB 2J5UA 3A83A 1YF4A 4AG1A 4P02A 2JH5D 1VCPA 1ZTKA 1CGHA 1NN6A 1HUTH 2J4IA 3L33A 4I32A 2ULLA 1QB1A 3LC3A 3MHWU 2QIQA 1W3CA 1WCZA 3KQCA 5EJZA 3ODDA 1UVPA 4NA9H 1Y5UT 3SNCA 5HMAA 2A45B 4K1SA 1N6XA 3P8GA 1GMDG 4X6MA 1O2IA 1CU1A 1YLNA 1ZMLA 2BY7X 2L6OA 1E1RD 1BMMH 1GBHA 2LELA 3ATMA 1AE5A 4Q2KA 3Q76A 3SBKA 1VGCB 1O2KA 1TOCB 2BD4A 3E3TA 4VGCB 3CS7A 5I25A 1EKBB 3QTVH 1GJBB 1QBVH 1EAXA 1EZSC 1QL9A 6CHAB 1RGQA 5JBBS 4BANB 5JBCS 3M5MA 2LPRA 1GI5A 1GI8B 4A1VA 3RMOH 1O3BA 1E0FD 2VJ1A 3BIVH 4YT7H 2ODQA 2WPKS 4HZHA 3SHAH 4YOGA 1AFQB 4I8HA 1EJNA 1EPTC 4NIXA 2AYWA 1BMNH 1SMFE 5EOKA 2O8WA 4DJZB 3E0NB 2VIPA 3ZVFA 1ELBA 4AZ2B 1N8OB 1C5WB 4FU7A 1W8BH 2ZDNA 1FX0B 1KLIH 1O2YA 2UWLA 2CXVA 2PUXB 5K0HA 3A7YA 1TQ0B 2P94A 1AY6H 1S0QA 1GI3A 3SI4H 4X2VA 1ZPZA 1SQTA 1SC8U 4HGCA 3TJOA 5A8ZA 2ZHDA 1LQEA 1Y3WA 1GJ7B 5IK2D 2GDDA 1BUIA 1X7AC 4O3UA 3EGKH 4JYVH 5IYTA 4JYTA 1D4PB 5HIYA 2WUBA 5F8TA 2QF3A 4WH6A 5HKKD 3EA8A 1SL3A 1IQMA 1K1PA 3TK6A 1AUJA 4IS5A 2K8IA 3MO6A 3MNXA 3QGJA 2C8XB 3P17H 4Y6DA 1J15A 2KAIB 4BTUB 4F55A 3BEUA 2A5AA 4KTSA 3N7EA 1L2EA 2J97A 1XUGA 1QJ7B 2VH0A 5J4QA 1CVWH 1MAXA 1LKBA 3CENA 1ZJKA 1ELGA 1A5IA 3BTFE 3ATIA 3GY4A 4TWWA 3TNSA 5E0JA 3DFLA 2PLXA 4FUCA 1Y3XA 1CGIE 4RT0A 1O30A 1LCYA 1GHAF 3ESTA 3SGQE 2G55A 5A8YA 3GCOA 2BD3A 4DY7B 1ID5H 1AI8H 2GMTB 3KNXA 1NBME 4UFDH 4ISOA 2BLVA 1EPTA 1GBDA 2VWOA 3LU9B 2FS8A 4A7IB 1GJ8B 3RXUA 2P16A 2XW9A 3ZZ9A 1DWCH 3PLPA 3UAIC 1KLJH 1BTYA 2L74A 2BX4A 2O9QA 4ZXYH 3SV8A 1Z8GA 5KEDA 4NZLA 1H8IH 4M7GA 3A8BA 4OS5A 2Q6GA 1BTXA 3MNBA 3Q00A 1O2UA 4ISHH 3STIA 2SNWA 2VINA 2A2QH 5JDUB 3D23A 1KXFA 1SQRA 4HI3A 3LJOA 1GHWH 4X8VH 5DK1A 3AAVA 5T3HA 2WPHS 1NO9H 4XD7D 1SLWB 5FXLA 1O5BB 1G3BA 1O0DH 5DP3A 2OTVA 3PTNA 2GP9B 1UTKA 4ABFA 4FU8A 1GI1A 2Y6TA 1H1BA 4B73A 1C9PA 2GT7A 2P3TB 3A86A 2STBE 4YXWD 1ZPCA 2ZG0H 1THSH 5SGAE 1XVOA 1W0ZU 1GL0E 3LC5A 1P0SH 2ZFSA 1C4U2 1GI6A 1LPKB 4ZKNU 1ESAA 4NG9H 5DGJA 2YNBA 3SV2H 2ZTZA 3GCNA 2G51A 1O3NA 3RLWH 1DUEA 4IN1A 2OINA 3U8RH 5EPYA 4X2YA 1EATA 4KELA 3DCLA 1TNIA 4X6OA 1BTWA 9ESTA 3SZNA 2B9LA 1L1GA 4I31A 1U6QA 1F5KU 2VWMA 3N7OA 1DPOA 2BDHA 4ZROA 1AHTH 2C90B 1V2RT 3MU8A 4XOJA 1SOTA 2OUAA 4KTCA 1C2HA 2ZC9H 3FZDA 4JZIA 3VG8A 4WH8A 3VXFH 4MG3A 1UMAH 1LVYA 2PUQH 5DN6D 8GCHF 1FONA 3JZ1B 1S85A 3PWBA 1TA6A 3BN9A 2ZPSA 1SG8B 3SU3A 1HIAB 1XKBC 4ZHLU 1P3EA 4JZDH 1WV7H 3U8TH 3KEEA 2ZQ2A 2ZI2H 4F49A 4THNH 2SFAA 2A0QB 4IGDA 1TRNA 2GV7A 2HOBA 3M5NA 4JZ1A 1O35A 2ZGHA 4BXSA 1S84A 1EB1H 3DSGA 4QT8C 3RU4E 4AYYB 2A4RA 3HK6B 1SLUB 3GYMA 4X6NA 3SU5A 1Y3YA 2J92A 1HAYB 1K9OE 3LGVA 2Y5FA 3TK5A 2O8TA 2UWOA 1UTJA 2JKHA 4FUFA 5CHAB 2QXIA 4IC6A 1IQJA 2JH0D 4E7RG 1C1SA 3PM3A 3UB0A 1AB9C 4GHTA 1OP2A 3BEIB 3MWIU 2WINI 1YLCA 4LZ1H 2BD9A 1SGPE 3OSYA 1O2JA 1DE7H 5AFZH 2P3UB 2W7SA 1GJDB 3G01A 1F5RA 2FEQH 5F8XA 1HXEH 4XBCA 1K2I1 5TJXA 1PQ7A 3GCTG 4YLQH 1FAKH 4O03A 2LNCA 1GMDF 2F9PA 3GY2A 2TPIZ 3UTUH 1FY5A 1VCWA 3ENSB 2Z9KA 1C1VH 3KQEA 1P10A 3BF6H 3URCA 1AD8H 1ZRKA 4UD9H 2OC8A 5DG6A 4B76A 3DD2H 3AAUA 1W0JD 2WPIS 3U1IB 2FOFA 3NCLA 1T32A 2GCTC 1EXFA 1LHGH 1P03A 5J4SA 3EA9A 1QZ8A 3K9XB 2WV4A 4NSVA 2XNIA 1O2HA 2G4UA 5DP4A 1ZSJA 2HPPH 3F9HA 1OWIA 3A7TA 4ABGA 2VH6A 2ZTXA 2D8WA 1K1OA 4DT7B 1P09A 2KCOA 4Q7YA 3MU0A 1Y8TA 1IQIA 2BOKA 1IHSH 3VPKA 4CRBA 3L3TA 2J94A 4I7YH 1AZ8A 2AIPA 5DP5A 3B23B 1OYQA 2HNTE 3KQ5A 1EJAA 2AS9A 1UJ1A 2ZU2A 4XRNA 1TMUH 1NU9A 3W1EA 2FMJA 1MTVA 4AOQA 4B2BA 1MCTA 2GVFA 2ZGJA 1O3DA 5DJ7A 3E90B 1V2KT 4E06H 2P8OC 2XOKD 1CA0C 4OS6A 1PPHE 1ZLRA 4MPXA 3UOPA 4AFZA 2ZDKA 3ELAH 5CE1A 4Y8XA 1V6DA 1ETSH 3UNRA 1EZQA 4K60A 1GMCG 3A80A 4K69A 1J17T 1W10U 2VIQA 4D7FA 2BQ7B 4AB8A 2VWNA 2HVXA 1HJAC 4TT3D 3V12A 1RTFB 3NWUA 4ZUHA 3S0NA 2XCFA 5DP8A 1LHDH 5C1XA 4FVDA 5C94A 2I6QA 4BTIB 1S0RA 3LOXA 1FLEE 2F91A 3LT3A 1K1JA 2ZU3A 4GPGA 2HLDD 4O97A 5EQQA 1BJVA 3DFJA 2H6MA 1EP5A 1GDQA 4DIHH 2OQ5A 3BTQE 1G2LA 2XXLA 5ABWA 5KECA 4GVUA 2STAE 4LOYH 3A7XA 1C5QA 4I8GA 1O3JA 3HATH 1UCYK 2ZGBH 1OWHA 3SUDA 1ELVA 1AUTC 2IJD1 1UHBA 3PMBB 3ITIA 5B6OA 1PPGE 2AMPA 4KKDA 3EE7A 3O8RA 1C5OH 2O8LA 4ZKRU 1WYKA 2ZEBA 5EGMA 1HJ9A 1MTWA 3C27B 3K6ZA 4D9QA 3GDUA 1BTHH 1GGDB 3RXRA 3FZZA 1Y5BT 4B2AA 1SHHB 1IOEA 3VB3A 4I8JA 1RIWC 2OC0A 5CHBA 5LPFA 1C5NH 2QYIA 1YPHE 2YMSD 1EB2A 2A31A 5LPRA 1TWXB 4IBLH 2Y7XA 3LH3A 3KYGA 2ANYA 1TQ7B 4MNXA 1XKAC 1BMFD 1O2OA 4WMEA 5C1UA 4FUBA 1O5CB 3SHCH 3M7UA 5HIZA 3T29A 2BDAA 3RXDA 1F5LA 3I78A 1AVGH 5TCCA 1MQ5A 5FPTA 2FESH 1WQSA 4SGBE 2OBQA 4O3TA 4UONA 5E0HA 1UK2A 1W12U 4A1XA 3TGIE 1K1LA 3LIWA 1CBWC 3NPSA 1V2WT 5GNDA 5EW1H 1A1RA 1MZDA 3A8AA 4K2YA 3RMNH 1SLXB 4BNRA 1O2SA 2IPQX 1AWFH 1O33A 1G9IE 3OYPA 1TBQH 2FI4E 3OTJE 1RFNA 4IC5A 4CREA 4YOIA 3M5LA 2BHGA 5EODA 4WY3A 4D76A 1GVKB 2FIRH 3PROA 3RM0H 3U9AH 4ISIH 4MPUA 2RA3A 2P8OB 4I8LA 1QB6A 2JJ2D 1S6FA 2TGPZ 2QAAA 2VU8E 3MO3A 1O2XA 2IJOB 4K5ZA 4H42U 1MKWK 1BITA 1KXCA 2GTBA 5DPAA 4A92A 1NT1A 1PQ5A 1O2GH 1LO6A 1MU6B 2JJ1D 2EI7A 2XC0A 2CF8H 1HJAB 2VIWA 1EQ9A 1UK3A 2BTCE 4U30A 1JRSA 1ANCA 3M61U 4NIYA 4K3JA 2J2UA 3I77A 1S83A 2PW8H 1NRNH 1DY9A 1YPGH 1YC0A 4BTTB 4IMQA 3MYWA 1O3PB 2BD8A 2BDGA 4ACBA 1AMHA 2Y82A 2J95A 1LPZB 2BLOA 2ZECA 1TPOA 2TBSA 2PGBB 3BTME 1C9TA 2ZFTA 2QA9E 3K6YA 2Y81A 1YPJH 5AVDA 2C8YB 1BZXE 2OCVB 1F0UA 1TX8A 1HAOH 1T4VH 4FUHA 2G00A 1AFEH 4NWKA 1PYTD 5ESTE 2VVCA 5T6FA 4FU9A 4NIVA 3CS0A 3F9EA 2WPLS 1CQQA 1H8DH 1YWUA 1Q2WA 1GJ9B 1CT4E 4OS4A 4AYVB 1RIWB 3GCTF 1H8HD 1TMTH 2Y80A 1DDJA 2ESTE 1K22H 3AW1A 5DSFA 2Q1JA 4BAHB 1ARCA 5EJ1A 5EXLA 3TPIZ 1ZSKA 4ABDA 1O5AB 2EY4C 2F83A 4TYDA 1E37B 3V3MA 1DANH 1C5LH 2SGDE 1PPFE 2CV3A 5IDKA 1GI9B 2KM0A 1MU8B 4NFFA 1TE0A 3MH7A 1YPMH 4WMFA 1P05A 1C2JA 1FQ3A 4ABEA 1Z8IB 1GJ6A 1A5GH 2R3YA 1GG6C 1BRUP 2P93A 4GCHG 1MTUA 1QQ4A 4MTBA 4YESB 2Z9IA 3ZVDA 2BY5X 4H6TA 1CBWB 4BAOB 2ZU5A 1QQUA 5G4BA 2H1UA 2VIVA
chains in the Genus database with same CATH topology
2ZQ1A 5K7RA 3TU7H 2ALPA 1M9UA 4CRCA 1AVXA 7ESTE 1RRKA 4MNVA 2D1JA 3UY9A 3S69A 1NU7B 4ZHMU 1QTFA 5HGGA 2HPQH 3F9FA 3SUGA 1PJPA 1ARBA 3LGIA 1HPGA 1NFUA 3FP6E 1PPEE 3ZYEA 2A1DB 2VIDA 1V2JT 1JWTA 1OP0A 3NUMA 1GJ5H 4CH2B 3ATLA 4ABBA 3MFJA 2GT8A 1C4Y2 2TGTA 3GCHB 5C5OA 1C1UH 1AIXH 1C2MA 1UVUH 2BVRH 4A6LA 3M7TA 3M36A 2Z7FE 1YPLH 1OSSA 2O8UA 4UEHH 1BB0B 2PSXA 1Z6EA 2GV6A 3ATKA 2CGAA 2EA3A 1NESE 4Y71A 5L6NH 4B74A 2FXRA 5E0GA 2ZFRH 4XSKU 3PLKA 2CF9H 1BTPA 3HGNA 3GY6A 1GMCF 1Z1IA 2WYGA 2IN2A 3TGJE 1V2VT 2G5NA 1TMBH 3QDZB 3KIDU 2UWPA 3ZZ3A 2PV9B 2A4GA 3ZVAA 1C4V2 2WV5A 4RKOB 4RN6A 2BD5A 3Q3YA 1QBOA 2C8WB 1TAWA 1BHXB 1HAGE 2ANMH 1MTNC 4LXBH 3BTDE 2VGCB 2H9HA 1FJSA 1H9HE 2QN5T 2ZNKH 4AX9H 1BHXF 1VITG 3D65E 2FO9A 1EASA 1TNLA 3S7HB 3DA9B 4X6PA 1NM6A 2QXJA 3P95A 1C1WH 2HNTC 5A0CA 1CT0E 1DS2E 2ZIQH 2G52A 5JB9S 1GBKA 3A8DA 1OS8A 1Z1JA 3PWCA 3QWCH 2A7HA 4XDEA 1SSXA 1HYLA 1T8MA 2ZDMA 1P8VC 2XBYA 1K1MA 6GCHG 4UFGH 8KME2 4I33A 5EW2H 2Q6FA 1YKTA 3SJ8A 1UVOA 2AGIX 1Z8RA 4I8KA 3A84A 2R3UA 1A3EH 3HKJB 3QUMP 4MLFB 1SI5H 1SGFG 3R3GB 3SNDA 1IQFA 1F2SE 4CHAC 3MNSA 1EJMA 3A7ZA 1V2QT 1AGJA 3EDXB 3T5FH 2ZDAH 3EYDA 1XX9A 4ABHA 1HBTH 2OXSA 4JMYA 1NC6A 2NU1E 1OWEA 3VFEA 1GG6B 3ZVEA 4CRDA 4CRGA 3ODFA 8LPRA 4OS1A 3RXFA 3M7QA 1GBMA 3MNCA 2ALVA 1WU1A 3L6PA 2UUYA 3BTEE 2BDBA 3E91A 1LKAA 3MH4A 4MDSA 1WSSH 2F9OA 1F0TA 1TPPA 1GBFA 3F1SB 1AZZA 1G3CA 1EOLA 1MBQA 5EU8A 4DGJA 1NPMA 4ZHAA 3MH5A 5GPIB 1JMOH 4Z6AH 3AVZA 2ASUB 4ASHA 1SVPA 1EPTB 1EAUA 1UVTH 1UCYH 4UE7H 3SNAA 2EI8A 1UCYE 3R0FA 2Q6DA 1ZTLA 2QGRA 4WF8A 1FIZA 1W13U 3Q77A 1ZGVA 3T28A 3DUXH 2UUKB 1YPHC 1GMHG 3QN7A 2BXTH 3ZZCA 1BBRK 1NFXA 2ANWA 3V0XA 2DE8A 3M35A 1CHOG 1FY4A 1O2ZA 1NZQH 3BTGE 1ZR0A 1BTZA 1WQVH 1UK4A 5H4IB 1C1TA 1SB1H 4U32A 3Q3KA 2BOHB 1QB9A 1QR3E 1DFPA 1B7XB 2VNTA 3RXJA 1YGCH 1O3FA 2GD4B 1V2MT 3BSQA 1ETTH 4MPWA 2V0BA 2G4TA 3GISB 1LMWB 3UOUA 1C5SA 1WUNH 2FOCA 1QJ6B 1P12E 1HDTH 1CGJE 2J9NA 3OY6U 1D9IA 4Y10E 1LHCH 2D26C 3OU0A 1Y3VA 5HYOA 1O5EH 1QFKH 1Y3UA 3T2NA 1XUFA 4X8UH 3BTHE 4WJG2 1HGTH 4X8TH 1A4WH 1SGYE 2PKSC 3P8FA 4YO9A 2WYJA 3MMGA 5EPNA 1A46H 3UWJH 1INCA 1P9UA 2A5KA 3SU1A 3QZQA 3KHVA 5FBEA 4NCYA 1A7SA 3RXAA 1EP6A 1TNHA 4DIIH 1MH0A 3M3VA 1ACBE 1QNJA 1GBBA 4LK4A 3FFGA 1VCQA 2ZTYA 3LGTA 4CHAB 4ABIA 3M3TA 5EXMA 2XBVA 2HRVA 1UTQA 1SGQE 4NZQA 1MTSA 3TGKE 1VR1H 5L2ZH 5EQRA 3RXBA 3UPEA 3HPTB 4NGAH 4XBDA 1MKWH 4JYUH 1G37A 1J16A 1GI0A 1ZHMA 1GI2A 1JBUH 1ETRH 4JK6A 1YCPH 2FYRA 4U01A 1SPJA 4MPVA 1OKXA 1MUEB 3RDZA 1NRRH 4NFEA 3LJJA 1LHFH 1AO5A 4YZUA 2FLBH 1HAVA 1ZSLA 3OY5U 4CBNA 5T6DA 1QL7A 3ZZ7A 2ANKH 1ANBA 5LGOA 3E8LA 3BTTE 3SQEE 3UFAA 1K1IA 1S81A 4UDWH 3PMHB 1WBGB 1BDAA 2XBWA 3TJVA 4Q7ZA 3VEQB 1DSUA 2FWWA 3RU4T 2ZHQH 3SOSA 1OXGA 1E36B 1GJ4H 3NK8A 1XM1A 3HK3B 5JB8S 1BRBE 4X2WA 5FBIA 3RC5A 5C2ZA 1LQDB 1L4ZA 1HNEE 2GGVB 2AFQB 1L1JA 1W2KH 4X1NU 2WPJS 1SGNE 1L4DA 1P2IA 2XC4A 5GDSH 2ODPA 2QC2A 2A7JA 1C2FA 1NRQH 3ZZ5A 1RD3B 4HTCH 1O2WA 1LVOA 5FPYA 5ETXA 1C5PA 3UQOA 1EZUC 1H4WA 2FYQA 2B8OH 3LKWA 5LPEA 1O3MA 1A0HB 4FXGH 2W26A 2SGAA 1DXPA 3NZIA 1L1NA 4R0IA 3RXIA 5C3NA 1GL1A 4MQAA 1BMAA 1QIXB 2FI3E 1A61H 1BRAA 3UNQA 2FOMB 1VITF 1GHBG 4AFSA 3SU4A 2XWBI 2PKSB 3FAOA 5GIBA 1AKSA 1V2NT 1XVMA 2SGQE 2H5CA 3SJKA 1TIOA 3O8DA 3E16B 2G5VA 2ZWLH 3UNSA 1S5SA 1QL8A 2AGGX 8ESTE 1Z8JB 1OWDA 1DT2A 1GBIA 3NXPA 5PTPA 4ISLA 5GJ4B 1DY8A 1GI4A 2FZZA 3SI3H 1O2RA 2W5EA 3KCGH 4UFEH 1FZZA 1AB9B 2THFB 6GCHF 4X1RU 1ABJH 3ZV8A 2FM2A 3URDA 3W94A 4GHQA 2H9EH 1Z6JH 4NA7A 1MBMA 2VWLA 1DWEH 2JH6D 4OS7A 5FHTA 1H9LB 1XUIA 3DHKH 4CRAA 1A0LA 1HAHH 1SFIA 1C5VA 2PR3A 4IMZA 1WTGH 2CHAC 1S6HA 2VVUA 1Z7KA 1K21H 2Y5HA 2A7CA 1O5DH 3GY7A 3H7TA 5DP7A 1SGCA 5L30H 2P59A 2FOHA 1BJUA 2Z6BD 2XRCA 1HLTH 2VIOA 2IPHA 1H9IE 1IQEA 1GCTC 1ORFA 5F6MA 1TX6A 2GCTB 2NU3E 2ZGXH 4PROA 4X1PU 1QGFA 3KN2A 1IQNA 1ZRBA 4FUJA 3GDSA 1QBNA 3O8CA 1A2CH 2AMQA 2FOEA 3O8BA 3SN8A 3RXLA 2QCYA 1GCDA 3LDXH 1O2LA 3TIUA 1FDPA 1GBAA 1SOZA 1O3HA 1TX7A 1UHBB 1HV7A 1C1QA 1C1NA 1TABE 4MNYA 1GMHF 1O2QA 3NKKA 5T6GA 5A09A 1E34B 1TONA 3ZVCA 1GBJA 5FX6A 1JOUB 5A2MH 1CHOF 4Z0KA 1IQHA 2C3SA 1ELTA 4YT6H 1DOJA 3F68H 1GHXH 1QA7A 1AVWA 4INKA 1J9CH 5JPMH 3W95A 4SGAE 1HXFH 1T8OA 1LHEH 1CA0B 2OLGA 1F92A 2ZP0H 1HRTH 2OP9A 4ZXXH 2BD2A 2FS9A 1KTSB 3QX5H 2C4FH 6CHAC 2R2WU 5AHGH 2ZA5A 2BLQA 3A81A 2PKAA 4CH8B 3Q3XA 4AGJA 2XCNA 3GOVB 2A4OA 3MU4A 1MD8A 4X0WU 3RXEA 3SUFA 4K8BA 1DVAH 3IWMA 1KDQA 1C1MA 1C1OA 1OPHB 4ZH8A 1IHTH 2ZFPH 1B5GH 3AASA 4X1QU 2R9PA 1N1LA 4AB9A 2H9TH 1GHVH 2GZ7A 3RC4A 3TK9A 2Z9GA 2QXGA 1THPB 2ZF0H 2PWXA 5BPEA 1O3LA 3E0PB 1G2MA 2Z94A 3SV6A 3A89A 2F3CE 3F9GA 4Y0ZE 1JIRA 4XBBA 2CMYA 1QJ1B 1DUAA 1ELFA 1RTKA 3RP2A 3P92A 3SGAE 1O2TA 1UTOA 2HGTH 2B0FA 3K65B 3CP7A 1DWDH 1CHGA 2ZO3H 2CHAB 2VB0A 1QHRB 4RSPA 5DKMA 2BYAX 4Y7AA 4AG2A 1RXPA 1BBRH 4DOQA 1FY3A 1O3OA 1BBRE 2ZHWH 3STJA 4WWYA 1HAZB 1TGTA 1O2MA 3MTYA 1KXEA 3QK1A 4NA8A 3S9AA 3MU1A 2BDCA 3TJUA 4BOHA 1J8AA 2BQWB 5E2OA 3MI4A 1LVBA 4BAKB 1GCTB 1MAYA 5GXPA 1KXAA 2SGEE 1QRXA 4Y0YE 2Z9JA 3M37A 3T25A 1O36A 1QRZA 1ZYOA 4AORA 3U8OH 2NWNA 1ELDE 2RDLA 1CA8B 3BTWE 1O32A 1XUKA 3KQDA 1J14A 3RLYH 1VZQH 1GWAA 2BLWA 3ZZ6A 1F0RA 2QF0A 2ZHEH 5F8ZA 3RU4D 2V3HH 1YP9A 1TPAE 2ZPRA 3DT0H 2FODA 5JYIA 2BY6X 1TYNA 1CO7E 1OYTH 3PLBA 5I46H 1C2IA 1TB6H 4B2CA 2SGFE 2F9UA 2Z9LA 2Z3CA 4LZ4B 2BZAA 1C1RA 1KY9A 4ABAA 1P06A 1SQAA 3QO6A 4R8TB 1NRSH 1K28D 1WTHD 1BA8B 3WY8A 1T31A 4Y8YA 1ANEA 4D7GA 2F9BH 3PV4A 1PQAA 4NIWA 2ODYB 3A87A 2KAIA 1FN8A 1YLDA 1UTMA 2G81E 5E2PA 2ZCHP 1MZAA 3A82A 4B71A 4XFQA 3EE0B 2A5IA 1YYY1 4E7NA 2FOGA 1O5FH 4IW4E 3RUOA 1LPGB 1GHBF 5ESBA 1MKXK 2GZ9A 2J34A 3TITA 1FUJA 1Z71A 2PFEA 1BMLA 3PTBA 4B75A 5GCHG 1CSOE 1FPCH 1IQGA 4FUEA 1O5GH 3LGUA 1YBWA 3T27A 4DW2U 1Q31A 3BG4C 1GBLA 1DX5M 1VJ9U 4U2WA 4ESTE 1KIGH 1V2TT 1OP8A 5BRRE 1GHYH 1O2PA 1T8NA 3B8JA 4F4OC 4INHA 3T26A 3VXEH 3IITA 1SFQB 1KXBA 4ISNA 3TH3H 3TLOA 1LVMA 3PYHA 4UFFH 2W3KA 3RMMH 1HAXB 1ZZZA 2BDIA 3EQ0H 2RCEA 3SJ9A 4D9RA 1JXPA 1C2KA 1A3BH 1QA0A 2B5TB 5C1YA 3VB5A 2FP7B 1FNIA 1V2UT 1E35B 3BEFB 3SW2B 4Q80A 2OC7A 4DURA 4AFUA 3SORA 5C67A 2ZGCA 3RXPA 1SGIB 1P02A 3ZV9A 3TVJB 1V2LT 2I6SA 1UTPA 5CHAC 6LPRA 9LPRA 1EOJA 3SUEA 1NRPH 2BZ6H 2SGPE 1P2OA 1D3TB 1FY8E 2M5TA 5C20A 2FTMA 3S9BA 1AE8H 1HAIH 1MQ6A 3MO9A 3QGNB 5FPSA 3PMJA 1OWKA 1QY6A 3UWIA 2Y7ZA 1SBWA 1P01A 3QZRA 5FCRA 1UTLM 1P57B 1GJAB 1TLDA 5A8XA 5C5NA 1DICA 1TBZH 1FY1A 2GCHG 3ZZAA 1VJAU 1QCPA 1JRTA 3GY5A 1BCUH 2J38A 3RXHA 3E6PH 1HIAA 2FTLE 1ABIH 2ZFQH 1CT2E 5E8EH 2EC9H 1ZPBA 1W11U 3KGPA 1YCPM 2P95A 4K8YA 5DP6A 1GBEA 5FAHA 3LH1A 4AGKA 1C2LA 4K1TA 3D49H 2YOLA 1Q3XA 4CR9A 1OX1A 3BV9B 3RM2H 1TRYA 2ZU4A 3UREA 1HJ8A 2FI5E 1KSNA 2R2MB 2V6NA 2NU4E 3KL6A 3RXSA 2SNVA 2ZU1A 4ZMAH 1T8LA 3UIRA 2R0LA 1ELEE 1DXWA 4NWLA 5A0BA 1ZHRA 5JBAS 1AWHB 3M5OA 3UR6A 2HALA 5JBTA 2EI6A 1MTNB 2BB4A 3SJOA 3BG4B 4X8SH 5DP9A 3LPRA 2B7DH 2UUFB 1F0SA 1WAYB 5HM2A 1KTTB 2RA0A 3B9FH 2BVSH 3VB6A 4GUXA 1TA2A 3E1XB 1WOFA 2W3IA 2BY8X 1C5TA 4KP0A 2DUCA 1HB0B 1EZXC 4H4FA 1IQLA 1EX3A 3RXTA 3SGBE 4DG4A 1OOKB 1SGTA 3A7VA 1SGRE 4BXWA 2F9VA 1PQ8A 1NY22 2BX3A 1V2ST 1AN1E 2HNTF 2ZCKP 4CR5A 2HLCA 4RKJB 2TIOA 1CE5A 1Y5AT 2Z3DA 1GVZA 3RXVA 2ILNA 1SGDE 1AU8A 2AMDA 1GDUA 2AERH 4FVBA 1TOMH 2GZ8A 1ZMNA 5TCAA 3RXQA 1OWJA 4INLA 3SQHE 1ZMJA 1MCVA 2TGAA 1PPZA 3VB7A 1EUFA 5EXNA 1V2PT 2NU0E 2V35A 1FV9A 2FLRH 3VB4A 1YPKH 3MU5A 3SJIA 4GLYA 1XXFA 1L0ZA 3V13A 2C8ZB 1C2DA 3GICB 2AGEX 7KMEH 1TBRH 1O3EA 1TGSZ 3JZ2B 4CRFA 2O8MA 3K2UA 4GCHF 1KYNA 1NROH 3ZZDA 4DCDA 2PGQB 4WXIA 3FP8E 3VGCC 1P2QA 1Y59T 7GCHG 3SV7A 4OS2A 4MVNA 2QV1A 2ZDLA 4GSOA 3S7KB 1UTNA 2AIQA 1ELAA 1SQOA 1P11E 3GY3A 2CJIA 3GDVA 3PO1C 4B1TA 3P6ZB 1O3CA 3KF2A 1GGDC 3ZZ8A 2ZCLP 3SNBA 2XWAA 3I29A 2TGDA 4BAMB 1MMJN 3RXMA 1RS0A 1ZHPA 4JK5A 3EAJA 2PSYA 1FIWA 3EA7A 3MOCA 1ZOMA 3T62A 1FI8A 3RXKA 2OC1A 4A1TA 3U69H 3QLPH 1D6RA 3RXGA 4JCNA 1PPCE 2XC5A 1D3DB 1SHYA 3QTOH 4FUIA 3H5CB 1P2KA 4AN7A 4FUDA 1T4UH 1F7ZA 2BMG