1O2QA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2qA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2qA02
2BD7A 5C5OA 1PPBH 2Z9IA 4O3TA 1GBHA 2VWNA 3OSYA 1HAZB 2QY0B 4AYVB 4BXSA 4YTAA 3A8AA 1C9TA 1AD8H 3RXJA 1K22H 1HAPH 4NSVA 2ANWA 1MCVA 1P2OA 1BZXE 1DANH 5EQSA 2BDHA 4CHAB 1IQNA 1RTFB 5A0AE 1QQ4A 1MU8B 5DP6A 4FUDA 2TRMA 3P92A 3CS7A 1MKXH 3EA7A 4FUJA 3ZVFA 3TITA 3RLWH 1PPCE 1O2IA 3MH4A 3U8TH 2O8WA 1C5QA 3TGJE 4GHTA 4BAQB 2V3OH 2W7SA 4JYUH 1ANDA 4GUXA 3QDZB 1E36B 4ISIH 4K3JA 3MH7A 1O36A 1AWFH 1IHTH 1Y3UA 2ZGBH 1Y8TA 2EI8A 2O8UA 4I8GA 5AHGH 4ZKNU 5JBTA 1EZUC 1NY22 3MU0A 1G2MA 1YBWA 5E0JA 4LXBH 3UQVA 1TGTA 1UTNA 1GGDC 1VJAU 3OY6U 4D9QA 2VNTA 2FS8A 1EB1H 1FI8A 2C3SA 2ZIQH 1DWBH 2XCFA 3ZZCA 4DGJA 4D7FA 3SV8A 2ODQA 4B1TA 1EPTB 2ZFQH 2C8XB 3LGIA 3ODDA 3S9AA 1V2TT 1FY4A 1KXCA 1XUGA 2SGEE 3PMJA 2W7UA 4AGKA 1IQFA 1DOJA 1LQEA 3I29A 3GY2A 3URDA 2J95A 1BIOA 2RA3A 1JBUH 4YM9A 1IQMA 4I32A 1JRTA 2WPIS 3AW0A 2VVUA 5DP5A 3JZ2B 3LJOA 1Z1IA 2FWWA 5DP8A 6ESTA 1NS3A 3SBKA 3OX7U 2O9QA 4XDEA 2WPJS 4OGXA 3RC4A 3DHKH 2VWOA 1KIGH 1NT1A 2NU1E 3I78A 1ZJDA 1CBWC 3SNAA 2FI3E 1YCPM 5TCAA 5F8ZA 1P05A 2PSYA 4D9RA 1HRTH 2FS9A 4OS4A 1Y3VA 3CS0A 3GCTG 4UFEH 3LGUA 2BY6X 1O3JA 1PJPA 1YPLH 5HYOA 3LIWA 1ZHRA 1ZTJA 3HKJB 1KTSB 1DX5M 4X1PU 1EQ9A 1V2VT 1O37A 1C2HA 4IN1A 2ZTZA 4NFFA 4ZXXH 1IQHA 1HUTH 1T31A 4UFDH 4CRCA 1MTWA 1NFYA 3SORA 4GCHF 3MFJA 1W12U 1XUKA 2F9UA 2BM2A 1GBFA 3A8BA 1ELBA 5DG6A 5FXLA 1B0FA 1THSH 1QRXA 4GCHG 3C1KA 2A0QB 1KXDA 3MO9A 2ZKSA 3IWMA 3M5LA 1BB0B 1RS0A 2ANYA 2BZ6H 2GT8A 3QZRA 1EJNA 1PPFE 2Y5HA 2AGIX 1SGEE 4NA9H 1JIRA 1BTHH 2XBYA 4QT8C 1GBAA 2HRVA 2ZO3H 1NN6A 3KN2A 4CHAC 3BTHE 1CBWB 1F0TA 4ABJA 3W94A 3GCTF 5IDKA 4Q7YA 5FX5A 4KTUA 2RDLA 1LHFH 3KEEA 1A61H 1XVOA 2F83A 3A8DA 1SGFA 2XBXA 4NZLA 4TY6A 4B2AA 1H9IE 2V3HH 4J2YB 1BA8B 3SV6A 3K6ZA 3KQDA 2H9EH 1DUAA 1THPB 1BRBE 1P06A 4ISLA 4O97A 2IN2A 3MWIU 1AE5A 3KGPA 1U6QA 8ESTE 1W8BH 1XUIA 2ZGJA 2BQ7B 3T25A 4Q7XA 4FXGH 2ODYB 1GI0A 4JMYA 1A1RA 1S84A 2ZHEH 5GCHG 2C4FH 1LO6A 1TNJA 2QXHA 1N6XA 1SLUB 6GCHF 3BTFE 3LKWA 4UDWH 1ZTLA 2FX4A 2G8TA 2FLBH 1K1LA 2O8LA 1YF4A 2EEKA 3P6ZB 1GI4A 4GLYA 4TWYA 1P11E 1O3OA 2PKSC 1OWKA 2QXGA 2FO9A 1NM6A 4X6OA 4K69A 3ZYDA 1INCA 2BD5A 4MNVA 1LVBA 2HOBA 1P2IA 1ORFA 1O2WA 2GZ9A 3ZZAA 1O5EH 2ANMH 2Y81A 3QTOH 1TNHA 4I8LA 4FVBA 1T7CA 3D65E 4LZ1H 2PGQB 2P16A 2PLXA 3RXDA 2PR3A 2G81E 3LGYA 3U1JB 2ZDVH 5H4IB 2WV5A 4JYVH 1JIMA 4NWKA 3ATMA 3E90B 4CREA 4BAHB 4IMQA 1QBVH 2R3UA 4WXIA 4U32A 3S7KB 4AFZA 1ZGVA 1BRAA 3BEFB 1N1LA 1NFWA 1WQSA 1D3DB 3M5NA 4IGDA 2DE9A 2IJOB 1ZRKA 1A0JA 1Z8RA 3MTYA 1GJ6A 1PQ5A 4CR9A 3A82A 2ZGXH 3RU4E 1AMHA 2XBVA 2NU0E 3M36A 1O2LA 1GBJA 2OC8A 4XSKU 1FMGA 1O5CB 1UK3A 1W14U 1W7GH 3A89A 1GCTC 1GBMA 2XWBI 1YLCA 4WH8A 1Y5UT 1WBGB 2ZGCA 4NIXA 1P57B 1S6FA 1UTLM 1P8VC 2PV9B 4B71A 2SGPE 9ESTA 3I77A 2FOMB 4HI3A 1HAVA 2WINI 4KP0A 1CQQA 2EC9H 2OQUA 1QY6A 2AIQA 3V3MA 1BHXF 1QIXB 1VR1H 4ABHA 5FPSA 3O8RA 1QL7A 3SN8A 1L2EA 3UNRA 4R0IA 2ZHWH 3OTJE 3RXOA 1XUFA 2OQ5A 1ELEE 2H1UA 2JKHA 1HB0B 5AVDA 1DDJA 1Z8JB 4NA8A 3UIRA 4XE4A 3E0PB 2C8WB 1D3QB 5GDSH 1GHAF 1WSSH 1MD7A 1BRUP 4TPIZ 4K60A 1T8OA 3MOCA 1A0HB 4UFGH 2HGTH 3UWIA 3R0FA 1F0SA 1S6HA 2ZU2A 1EAXA 2WV4A 2ZP0H 1RIWC 2J38A 1WTGH 4X0WU 1LPKB 4ABGA 2BDYA 2LPRA 1D3TB 5BPEA 1NRQH 1RJXB 1LPZB 3MO3A 4YLUA 1FLEE 1AUJA 2BOHB 4TPYA 4AG2A 4XOJA 1DY9A 1KDQA 1O3EA 1L4DA 3RXFA 3ODFA 1OWEA 3DFLA 1ZHPA 1NO9H 3GCNA 1P09A 4RSPA 4FUCA 4JK6A 3TPIZ 3U8OH 1C1PA 2ZPRA 3T28A 4X8UH 2XNIA 1W2KH 4RN6A 4NSYA 2OTVA 5J4QA 2OC0A 3SZNA 2ZEBA 1V2JT 4FUBA 1AKSB 4Y0YE 1O2SA 1MTNC 1C2JA 2F91A 1TQ7B 1OWJA 4KELA 1Z6JH 1DE7H 3NZIA 4OS7A 2BX3A 3LU9B 4WVPE 3ZZ8A 1ELGA 1O2QA 1JOUB 3BTEE 1TX8A 1BITA 1DXPA 2SGDE 1GJ9B 4X8VH 5C3NA 2WYJA 3BTQE 3SUEA 2XC5A 1C1OA 1ELVA 1QURH 1T8LA 3VEQB 2EA3A 5EW1H 3KIDU 1OWDA 1TWXB 2ALVA 2AFQB 1BTUA 1OWHA 1G37A 4XBBA 1O2ZA 1IQEA 3TNTA 3HPTB 4ZHMU 2BYAX 1C1NA 4H42U 1AVWA 3SNEA 1AZ8A 1C2LA 1AGJA 4OS2A 2ALPA 2VIQA 1O3DA 2A4GA 2PGBB 2ZG0H 3FANA 1AFQC 4XBDA 3BTKE 3VFEA 1EPTA 2IOTA 2GDDA 2WUBA 2A5IA 3RXBA 4AX9H 1KSNA 1SLVB 1LPGB 1SC8U 1ETSH 3F1SB 1UTQA 4MPUA 2VIVA 1DSTA 1TIOA 1O2JA 1MD8A 3MNCA 1SOZA 1Z1JA 4UE7H 3RXTA 2J2UA 2XC0A 5FX6A 3GDVA 1LVOA 2RCEA 1NU9A 1GBLA 5I25A 3K9XB 2PKAA 4NG9H 5ESBA 4H6SB 3RM2H 2A7HA 1EKBB 1CO7E 4F4OC 3TGIE 5CHAB 4MG3A 2C8YB 1A3EH 1PQ8A 1HAIH 5DP7A 1FQ3A 3PMAB 1FJSA 9LPRA 1S82A 2DE8A 3B8JA 3WY8A 2R9PA 1K28D 3SU4A 5J4SA 1TLDA 1ZZZA 3LT3A 2A7JA 5B6OA 2BD4A 3STJA 2H5DA 4XBCA 4FUIA 1C2GA 1SHYA 1VITH 2FIRH 2BD3A 2H2ZA 1GVZA 4X2YA 1GMHF 4X2XA 5A8YA 2HNTC 4CRFA 1VITF 4INHA 4BAMB 1TX6A 1VZQH 2OP9A 2BDCA 1NU7B 4MNYA 2AH4X 4ABFA 4GPGA 3RMLH 1QTFA 2R2MB 4F49A 1KLIH 4NFEA 2BTCE 5DJ7A 5L6NH 3RXRA 5EPYA 2QCYA 3D23A 7GCHF 1C5NH 3M3TA 2VGCC 1O5GH 3U69H 2ZDMA 1TRYA 1MKWH 1J8AA 3EA8A 3W95A 5JBBS 1ESBA 2FYRA 4AYYB 1K2I1 3MO6A 2H9HA 1GVKB 3M3VA 1BUIA 3MU5A 3SUGA 4AB9A 4A1TA 4YO9A 3O8DA 1TMUH 1YPGH 2ZCLP 1XUJA 1G3BA 1HGTH 5FHTA 5DP9A 1TBQH 1DWEH 2JETC 2G4UA 3L6PA 2LNCA 1SBWA 1FV9A 4M7GA 2PUXB 1CGHA 3RMOH 2B8OH 1S81A 3A86A 2QIQA 4ASHA 3PWBA 4VGCC 5EU8A 1K1PA 1G30B 3S7HB 1MBQA 4YOJA 2Q6DA 2CGAA 4Y71A 1SG8B 2A4RA 4AG1A 2B9LA 5I46H 3F9HA 2F3CE 3VB6A 1H8DH 1V2QT 3BN9A 1GBDA 2OINA 1BRCE 4ABDA 1BTWA 2FYQA 4JZDH 1SGQE 2BOKA 3MU1A 2M5TA 2VVCA 1Y5BT 3AASA 1QRWA 3D62A 1C5UA 2QXJA 3RXCA 2OC7A 2RA0A 2BDAA 2VWMA 1C2DA 1H8IH 2QC2A 3RXAA 1V2KT 3NCLA 1DPOA 2TGAA 1P0SH 1BT7A 1BMNH 3P8OA 3PLBA 4DW2U 4U01A 1C5RA 1C1WH 1TNGA 3E91A 4AOQA 4BOHA 1ABJH 2ODPA 3BF6H 1HPGA 5AF9H 2XTTB 1MTSA 1N8OC 3TH3H 2YNAA 1C2IA 1GHZA 4JCNA 2PSXA 5JBCS 1FNIA 1SGFG 3L3TA 1DITH 1TNIA 2ZA5A 3PROA 4MPXA 2ZQ2A 2B7DH 3FAOA 1O2PA 3NK8A 3KNXA 4HGCA 1C5ZB 1HV7A 2TGTA 2VIDA 2I6QA 2A31A 2NWNA 3UR9A 2QV1A 3A83A 2HWLB 1UK4A 3GY7A 1KXBA 3CENA 3E1XB 1ZOMA 3TNSA 5F8TA 1ANCA 1ZPZA 3VXEH 2PKSB 3E3TA 4AB8A 5LGOA 4ZHLU 4IN2A 2ZCKP 2OBQA 5A8ZA 1OPHB 5DK1A 2P3FH 3SV2H 1C1RA 2F9VA 1C4V2 1Y3WA 4OGYA 1O5AB 3ZZ7A 1HCGA 1V2LT 1F92A 1O2MA 3TLOA 4CH8B 2J34A 1SGYE 4XFQA 2WPMS 1SGPE 2HNTE 1ACBE 3T29A 1FN8A 7KMEH 3ATLA 1EXFA 4Y8XA 1O3GA 2ZECA 4ZHAA 1TPPA 3M37A 5T3HA 2UWOA 3TJVA 3UREA 5A8XA 1TGSZ 1NRPH 1DLEA 2YNBA 2ZFSA 1Z8GA 1SSXA 1OSSA 1BBRH 1TB6H 2PTNA 1UHBB 1S85A 5SGAE 1G2LA 1SOTA 3SNDA 4A1XA 1ELTA 1HAHH 1BMMH 2PWXA 5DP4A 4MLFB 4Y8ZA 1C5WB 2SNVA 2BLVA 1GBCA 1GI1A 1AO5A 4O03A 1O38A 4K8BA 1HJ8A 3EA9A 2FEQH 2VIOA 1QA7A 1WOFA 1O32A 2BDGA 5TJXA 2ZQ1A 1BCUH 1WV7H 1DWCH 1WQVH 1D3PB 3F68H 1SLWB 1M9UA 4INLA 3EYDA 1BJUA 1GWAA 3SOSA 3ZZDA 3ATKA 5PTPA 4PROA 3K6YA 1CHOF 4JZFH 1W13U 2A5KA 3PM3A 3GY8A 1F5KU 1K9OE 1P10A 2BZAA 1HAOH 3UWJH 1P12E 4KTSA 3QGJA 1HAVB 4BTIB 1UVTH 2J94A 1GJ7B 2HALA 2TBSA 5HM2A 2BMGB 2OC1A 1P2QA 4GVUA 1MTVA 1NC6A 1PPZA 3QO6A 3ZZ5A 1CGIE 3QTVH 3UQOA 1XXFA 1AKSA 1ARBA 1MAXA 3SU2A 3VPKA 5C67A 3VB4A 5JYIA 1EZXC 2VIPA 3KCGH 4B2CA 3G01A 4ZH8A 1CHOG 1MAYA 4NZQA 3SV9A 2ZPQA 1XKAC 4JZEH 2ZDKA 3O8CA 1ANEA 1HAXB 3A7YA 1TPOA 1Q3XA 1P01A 1S83A 2QGRA 2ESTE 4NGAH 1K1IA 1PPHE 4I33A 1BQYA 1V2PT 4RKJB 2BY5X 5JPMH 5EXLA 4U30A 3K65B 2FLRH 2BQWB 1PYTC 4Y8YA 2C93B 3STIA 1FONA 4Z6AH 3BIUH 2KAIB 2V0BA 3NUMA 3HATH 1T8NA 1HJ9A 1XXDA 4ZKRU 3KQCA 1WCZA 1KXEA 5A0CA 1AVXA 3H5CB 3A80A 4A1VA 1Z8IB 1OS8A 1HBTH 1O2OA 2P93A 5E0GA 2TPIZ 4DVAU 4LOYH 1BMAA 4X1NU 1YC0A 1RGQA 1SVPA 1GBIA 3KHVA 3AW1A 2FODA 1EX3A 4Y10E 1EATA 3FZDA 2HVXA 3ITIA 3SQHE 2YOLA 2SNWA 1GDNA 4DOQA 1OYTH 2OXSA 5C20A 1C5MD 1ZYOA 1MUEB 3RM0H 1EZQA 2SGAA 1A5IA 1OWIA 2CXVA 1O3PB 4A92A 1C4U2 3UUZA 1AQ7A 4SGBE 3VGCB 2Y7XA 3DA9B 1KLTA 1ZTKA 1GI6A 5F8XA 1IOEA 3V7TA 4CRBA 1F5LA 2Z6BD 2A45B 3TJNA 2STBE 1CT2E 3UPEA 1L1GA 4ISHH 2Q1JA 3PMBB 4AN7A 2ZCHP 3ZZ6A 5GXPA 4A7IB 1ZMJA 2HNTF 5F6MA 2UUFB 1ZSLA 1SFIA 4B74A 1MQ6A 4Y0ZE 2Q6FA 3R3GB 3T2NA 1O3CA 4CR5A 4IBLH 3Q76A 1GI8B 3SU6A 4X6PA 1Y59T 1QFKH 2G55A 1TA2A 1AN1E 1GL1A 2PW8H 2PUQH 7LPRA 2EI6A 5E2PA 2QN5T 3NXPA 3GDUA 3BEUA 4WY3A 1OOKB 1VITG 3GDSA 4FUEA 1OP2A 1SGCA 4NCYA 1O5FH 3SV7A 3P95A 5K7RA 3A7XA 2AEIH 3MMGA 1NROH 1DS2E 1E38B 1IQKA 2BY7X 1A4WH 4K1EA 3A84A 2GD4B 4ZROA 1N6YA 3MYWA 1Z71A 2A4OA 3SGBE 2ZU3A 3DUXH 4X6NA 1DXWA 1TNLA 1FZZA 1G3DA 3S9BA 2GCHG 1ZJKA 1GMCG 4IS5A 1O39A 1UTOA 1UCYE 1SQTA 1TA6A 1EOLA 4YOGA 1LVMA 1Z6EA 4ZAEA 4WF8A 2A1DB 2OUAA 1BOQA 1CE5A 3F9EA 4AGJA 2ZFPH 2J9NA 4MPVA 2Y7ZA 1AWHB 4BXWA 1P9UA 4CBOA 1ETRH 2OBOA 1C1SA 3TJUA 1GJBB 3QUMP 2ZI2H 4WXVA 3ZVCA 4GAWA 3IG6B 4JZ1A 2AMPA 4OS5A 1YM0A 4B73A 2Z9KA 4RKOB 1QL8A 3URCA 1DICA 3GYMA 1O2HA 2A4QA 1O2RA 3P70B 3SW2B 4X2VA 3PMHB 2XWAA 4D8NA 5EPNA 2CN0H 1IQLA 2GMTB 1WAYB 1SQOA 2BD9A 4TWWA 1C5TA 4FUHA 4DIHH 2WPLS 4X8TH 2CMYA 1O3LA 1C1QA 1AI8H 2IPHA 4ZKOU 1T4UH 3ZZBA 3M7QA 2VIWA 2G5NA 1UO6A 2FOCA 3ZZ9A 1B5GH 1DM4B 5E8EH 2A32A 3SHAH 1AVGH 3LC5A 1SR5C 2AYWA 3SJ8A 4TYDA 1SFQB 1SI5H 1GHXH 3RDZA 3RXKA 1CA0B 1BTXA 2NU3E 2ZGHA 4MNWA 2D8WA 2FOFA 2ZDNA 5DO4H 2XYAA 3PWCA 2I6SA 1UCYK 1C2KA 2XC4A 3A81A 1HAGE 1P03A 1IQGA 4SGAE 3SJOA 1GJ8B 2V6NA 4IW4E 1GBTA 2BXUH 2PHBA 1TGBA 1NFUA 1C2EA 2RG3A 2ZHQH 1O2GH 1O3NA 1TBZH 1QL9A 1GHBG 2VJ1A 1A5HA 2ZFRH 1HLTH 1DSUA 3MH6A 1LKBA 1YPHE 1CGJE 3LJJA 2ASUB 2CF8H 3SHCH 2K1QA 2XBWA 3SU0A 1LHGH 1P04A 2P3TB 4NWLA 3EE0B 5T6FA 1QB6A 3ZVBA 1MTNB 3FP7E 2BHGA 5AFYH 2R0KA 1QB9A 2J4IA 3LOXA 1GHWH 3S69A 2P8OB 4B75A 2FOBA 1AB9B 1W0ZU 8GCHG 1GCDA 5GWZA 4ZKSU 4Z0KA 1P9SA 2G00A 2B5TB 2VWLA 5FAHA 1GMCF 4Y6DA 3P8NA 1KY9A 2HPPH 4DJZB 2GMTC 2VB0A 6GCHG 1DLKB 1NRSH 2VU8E 1MKWK 5DPAA 2FOEA 1H4WA 4BTTB 3RXSA 1O2TA 2P3UB 3PLPA 3PTNA 4Y11E 2CV3A 1ZLRA 1EJMA 1KYNA 3B23B 2Z9JA 2Y5GA 3SJ9A 1HXEH 5CMXH 3UOPA 2BDIA 1O3BA 2OLGA 3LPRA 1EOJA 2B0FA 1QRZA 1F7ZA 1Y3XA 1O3AA 1SB1H 4JK5A 5FPTA 1O2KA 4MTBA 4YOIA 1GJ4H 1MZDA 3HK6B 1AU8A 3MI4A 3RLYH 3MU4A 1PQAA 2O8MA 4UONA 2GZ7A 3K2UA 5EG4A 2FTLE 4E06H 1GG6B 1P3CA 3DFJA 3UFAA 4MNXA 3QWCH 3SJIA 1GHAG 4AORA 4YESB 1T4VH 3RXPA 4DURA 1HAYB 1OKXA 1K1JA 1O3FA 2Z3EA 8GCHF 2GTBA 1A46H 4JYTA 1UTKA 2AGGX 3Q3KA 1FY8E 1J17T 1KLJH 4DIIH 3S0NA 4THNH 1PFXC 3GICB 3SGAE 4K5ZA 4Q2KA 1KXFA 3KQBA 3OYPA 1O2YA 5LPFA 4ABIA 2HLCA 1P2JA 3AAUA 2QAAA 3PV4A 1SGNE 4R8TB 3SI4H 1CVWH 1AB9C 1BTYA 1S5SA 3MNBA 2JH0D 1MU6B 4H6TA 8LPRA 1C5XB 1F2SE 3ATWA 3OU0A 4CRDA 1C5SA 4FVDA 5DP3A 2ULLA 1G3EA 4GSOA 4WH6A 4DY7B 2R2WU 4BAOB 1HJAC 5C5NA 2C90B 1XMNB 1ESAA 4X1RU 1H9HE 2D2DA 1EP5A 3GY4A 3SU5A 4NIYA 2PFEA 2BY9X 4E05H 1AZZA 4CBNA 1CA8B 1JXPA 1LHDH 2Y80A 1O2NA 2GCHF 1O5BB 4I8KA 1F5RA 4AFUA 2ZHDA 5LPEA 1NRRH 2WYGA 5EGMA 1TOCB 2AMQA 5JBAS 1YGCH 2A7CA 3GYLB 3ZZ3A 1ETTH 3RMNH 1LKAA 1GMDF 1GI2A 1P2MA 1J14A 1KDQB 4FUFA 1FAXA 1RXPA 1HIAB 1EASA 2PKAB 2STAE 1NZQH 1VJ9U 3QX5H 4INKA 1FIZA 1GBKA 3NPSA 1K1NA 1FY5A 3EDXB 4Y7BA 1C9PA 3VGCC 5CE1A 1J16A 1JRSA 4KTCA 1AFQB 2C8ZB 1TRNA 4CRAA 1Y5AT 2BLWA 2ZC9H 6CHAB 2FX6A 1RIWB 3FVFB 3SU1A 2WUCA 3F9GA 2BB4A 2R0LA 5LH8A 1FAKH 2W26A 1LDTT 3B9FH 1QQUA 1GDQA 3F6UH 3RC5A 2Y6TA 3SO3A 4NA7A 1SGRE 4I31A 3ZVDA 1SLXB 3LDXH 1S0RA 1C5PA 3FP6E 1GL0E 2BD2A 2QYIA 1FY3A 1EUFA 4KKDA 3NKKA 1BDAA 2D1JA 4MDSA 3NWUA 1EP6A 2CHAC 2G5VA 1B0EA 2UUJB 1FN6A 1FUJA 4UD9H 1UTPA 1BTPA 1JWTA 4X2WA 1B7XB 2KAIA 4ABAA 3TIUA 1PPEE 1YPMH 2ZWLH 4X8SH 2W3KA 2BVSH 1LTOA 2JH5D 4NIVA 2ZFFH 2NU4E 1O5DH 1MTUA 2AIPA 2SGFE 2P8OC 1LMWB 1O2XA 1EJAA 3GCHC 1TE0A 2FI4E 1C2FA 1C1TA 3HGPA 4O3UA 3V13A 1ANBA 3QK1A 1UCYH 2CJIA 2FXRA 3AVZA 3Q3XA 3RU4T 4K2YA 4BTUB 3BSQA 1ZSKA 2BY8X 1WTHD 1TRMA 1G3CA 2FDAA 3SNCA 4E7RG 1BMLA 2A2XH 5HXFA 3H7TA 1PPGE 3RU4D 1BJVA 3ZV8A 5JB9S 3A7WA 2ZU4A 4H4FA 2FMJA 3AAVA 4BNRA 5C1YA 4GHQA 1ID5H 1ELAA 1YPHC 1YP9A 5C1XA 1T32A 1TMBH 3LC3A 1DWDH 1UTJA 3BTGE 4OS1A 5LPRA 5HMAA 1G32B 1SMFE 5A0BA 3BTDE 2ZU5A 5EW2H 3DT0H 2FI5E 1YLDA 1V2NT 4Y76A 2ZU1A 4ABEA 4AFQA 8KME2 3MHWU 4WWYA 2GP9B 3GCHB 2Z7FE 1J9CH 1TYNA 5A2MH 1Q31A 1T8MA 3PLKA 3A7VA 1O3IA 1O35A 4IC5A 3A88A 3SUFA 2F9PA 1P2NA 5GJ4B 2BX4A 1FXYA 2FPZA 3HGNA 4ZXYH 1GVLA 5GIBA 3VB5A 1V2RT 3H7OA 5ESTE 1ZSJA 3ATIA 1QNJA 3LONA 4IMZA 1TFXA 5HM9A 4FUGA 1RTKA 3TJOA 1LVYA 4YT7H 3EAJA 1MZAA 3GISB 2W5EA 3M7UA 3UNQA 2FTMA 2ZFTA 1K1OA 1AE8H 4ISOA 3MNSA 1CT4E 1FPHH 5GCHF 2VINA 5AFZH 3M3SA 1EZSC 2ZZUH 1KXAA 5E2OA 4D7GA 5FCRA 2Y82A 3M35A 2Z3CA 1TGNA 1UVPA 1PYTD 1GI5A 4FU7A 1L4ZA 2G52A 3EQ0H 1H1BA 5FBEA 4Q80A 2G51A 1GMDG 4AFSA 4CH2B 2VH0A 2V35A 3RXEA 3RP2A 1XKBC 1YPJH 3S9CA 2ZTXA 1ELCA 3GY6A 1GG6C 2TIOA 1HXFH 1KTTB 1YPEH 3QZQA 3A8CA 1MQ5A 2W3IA 1K21H 1ZMLA 2JH6D 3A7ZA 4WMFA 3ZYEA 4DT7B 1GJCB 5G4BA 1ABIH 1ESTA 1IAUA 3SGQE 1C5VA 1O31A 4Y7AA 1D6WA 1GGDB 6LPRA 1IHSH 1O30A 3V12A 2AERH 2SFAA 3BV9B 1H9LB 1V6DA 1W3CA 2WPKS 2TGPZ 3RMMH 2ZPSA 4LK4A 2ZHFH 1J15A 1K1MA 3ZVAA 4X1SU 3T5FH 2UUKB 2XW9A 2VGCB 1MCTA 1TNKA 1HJAB 5EXNA 1O2VA 1GJAB 2GZ8A 1C2MA 3BIVH 3FZZA 1ZMNA 1NFXA 1OYQA 3GY5A 1BBRK 1QBNA 2ZDAH 1V2UT 1SPJA 1EAUA 4WMDA 3OY5U 1AHTH 2THFB 4UFFH 3ZVEA 2XCNA 3LGTA 1YCPH 3RXGA 3TK6A 1LHCH 3RXLA 1DUEA 5BRRE 2FESH 3M5OA 1V2WT 3M5MA 3RC6A 1QHRB 1VGCC 2ANKH 2P95A 1D9IA 1EAWA 3ESTA 2BDBA 1Q2WA 5C1UA 2CHAB 4DCDA 3KQEA 3ZZ4A 3SQEE 2FZZA 5L2ZH 4HZHA 2FM2A 1NESE 3EGKH 3ZVGA 3PTBA 1O0DH 2FOHA 4VGCB 4ZUHA 1TABE 2TGDA 4CRGA 1D6RA 1EPTC 1GHBF 3PO1C 4ABBA 2GKVE 4J1YA 2FOGA 2Y5FA 4JZIA 4D76A 1GMHG 2ZTYA 3T62A 1XUHA 1YYY1 1O3MA 4FU9A 4I8HA 2G4TA 4U2WA 3LH1A 1D4PB 1HNEE 3L33A 2AS9A 4WMEA 1BBRE 3E6PH 3RXMA 1TALA 3E8LA 5JB8S 4Y79A 1V2OT 3KL6A 1LHEH 3ENSB 1GI9B 1V2ST 3PYHA 3KF2A 3BTME 2F9NA 1SGTA 1IQIA 1LCYA 3TH4H 3A7TA 1TOMH 1C1VH 1THRH 2AMDA 3CP7A 2BQ6B 2QA9E 4MQAA 3Q00A 3Q77A 2QF3A 1ELDE 1C5YB 3BTTE 3LH3A 4ISNA 5FBIA 1FIWA 3U1IB 5ABWA 4K1SA 4X6MA 5F03A 2SGQE 1SHHB 4UEHH 1E0FD 2P59A 1GI7B 1HFDA 1O33A 1Z7KA 2H9TH 2Z9LA 5FPYA 1ZPBA 4K1TA 1UVSH 1VCQA 3F9FA 3O8BA 1TMTH 3E0NB 1QJ1B 1QR3E 5ETXA 3SNBA 2ZDLA 1GJDB 5E0HA 1TONA 1GHYH 3T26A 1IQJA 3RXVA 1RRKA 1EAIA 3U8RH 3QGNB 1C1UH 1TPSA 5C2ZA 1X7AC 3VB7A 1UK2A 2QXIA 1N8OB 3SJKA 1MMJN 2XXLA 1FY1A 3TVJB 3LGVA 3UY9A 2J92A 3D49H 2BLQA 2ILNA 1FDPA 1XM1A 2GV7A 3RUOA 5JDUB 2VH6A 4BAKB 1QBOA 1AFEH 2AGEX 2GGVB 3BG8A 4DG4A 1GBBA 3SU3A 3PB1E 4HFPB 4NIWA 1RFNA 1GHVH 2O8TA 5DGJA 1JMOH 2GDEH 2GCTC 1QJ6B 2FOAA 4YLQH 1TPAE 3U9AH 1AY6H 1CT0E 1LQDB 1OX1A 1TQ0B 1YKTA 1G9IE 1GBEA 1QJ7B 1ZR0A 1UVUH 1EB2A 3SUDA 2F9OA 1A2CH 2EI7A 4E7NA 4A6LA 1A5GH 1C1MA 1FPCH 2PTCE 3MNXA 5TCCA 2HPQH 1V2MT 4I7YH 5EQQA 1ZPCA 1L1NA 3HK3B 3T27A 1W10U 4I8JA 4OS6A 5T6DA 3MH5A 3QN7A 2BVXH 1P2KA 2QF0A 1HYLA 1TX7A 4B2BA 1O2UA 4BANB 3N7OA 1VCWA 1ELFA 2GX4A 2H5CA 2BLOA 3P8FA 3UOUA 3DD2H 1PQ7A 2WPHS 1WUNH 1E37B 1DT2A 3GY3A 1AUTC 3LGWA 1HIAA 1MKXK 1DVAH 2UWPA 1OXGA 1YPKH 4B76A 3QLPH 1O34A 3MU8A 3RXIA 3TU7H 5EOKA 3BTWE 1GJ5H 1L0ZA 2JETB 2UUYA 1CU1A 2XRCA 3UTUH 1A7SA 3P17H 2R3YA 6CHAC 5L2YH 5K0HA 5EXMA 1P3EA 2OD3B 2F9BH 2A5AA 3TK9A 1UMAH 1ZRBA 1O3KA 1VCPA 1TAWA 1UJ1A 1UTMA 1Y3YA 1ZGIA 4O9VA 1RD3B 1W7XH 3P8GA 3RXQA 5FCKA 1E35B 4TY7A 1V3XA 1SQAA 4IC6A 2ZF0H 1CA0C 1C4Y2 1GPZA 1WYKA 1SGDE 2CF9H 1W0YH 3C27B 3UNSA 3V0XA 2Z94A 4AZ2B 3VXFH 5L30H 1W11U 2GCTB 3ZV9A 3E16B 2D26C 1OP0A 2UWLA 4Q7ZA 3A87A 5T6GA 4LZ4B 2A2QH 1O3HA 4ESTE 1BTZA 4A5TS 1CHGA 2OCVB 3M7TA 1HDTH 2BD8A 3TGKE 3M61U 3BG4B 2NU2E 1GDUA 1GI3A 3A85A 3HKIB 2GV6A 3IITA 3SI3H 2BXTH 2VVVA 1L1JA 1DFPA 4YT6H 2DUCA 2GVFA 2P94A 4WJG2 1TBRH 5CHAC 1NPMA 3FP8E 5EQRA 1F0RA 3RXUA 2FP7B 1SGIB 3GCOA 2GT7A 3RXHA 2ZNKH 3TK5A 1A3BH 3VB3A 1G36A 2BVRH 2Z9GA 1E34B 1C5OH 1XX9A 2Z3DA 1NRNH 1S0QA 1YCPK 5DKMA 1QGFA 1ARCA 4K8YA 3U98H 1DY8A 1ZHMA 2H6MA 1MH0A 3BG4C 4KGAA 7GCHG 3ELAH 5HGGA 1MBMA 1OP8A 4HTCH 3UR6A 1F0UA 1P02A 3BEIB 3FFGA 1RTLA 1SL3A 1VGCB 5IYTA 1BHXB 1XVMA 1UVOA 3GOVB 1C5LH 3JZ1B 1A0LA 4X1QU 1GCTB 7ESTE 5GPIB 1NTPA 5A09A 1QCPA 3Q3YA 1WU1A 2Q6GA 4YZUA 1CSOE 5EODA 1UHBA 1TGCA 1QA0A 1QB1A 3PO1B 1AIXH 4MVNA 4FU8A 4MPWA 3TH2H 4ZMAH
chains in the Genus database with same CATH superfamily
2BD7A 5C5OA 2KCYA 1PPBH 2Z9IA 4O3TA 1GBHA 2VWNA 3OSYA 1HAZB 2QY0B 4AYVB 4BXSA 4YTAA 1OHHD 3A8AA 1C9TA 1AD8H 3RXJA 1K22H 1HAPH 4NSVA 2ANWA 1MCVA 1P2OA 1BZXE 1DANH 5EQSA 2BDHA 4CHAB 1YY3A 1IQNA 1RTFB 5A0AE 1QQ4A 1MU8B 5DP6A 2J98B 4FUDA 2TRMA 3P92A 3CS7A 1MKXH 3EA7A 4FUJA 3ZVFA 3TITA 3RLWH 1PPCE 1O2IA 3MH4A 3U8TH 2O8WA 1C5QA 3TGJE 4GHTA 4BAQB 2V3OH 2W7SA 4JYUH 1ANDA 4GUXA 3QDZB 1E36B 4ISIH 4K3JA 3MH7A 1O36A 1AWFH 1IHTH 1Y3UA 2ZGBH 1Y8TA 2EI8A 2KCAA 2O8UA 4I8GA 5AHGH 4ZKNU 5JBTA 1EZUC 1NY22 3MU0A 4AC9A 1G2MA 1YBWA 5E0JA 4LXBH 3UQVA 3UB0A 1TGTA 3KQ5A 1UTNA 1GGDC 1VJAU 3OY6U 4D9QA 2VNTA 2FS8A 1EB1H 1FI8A 2C3SA 2ZIQH 1DWBH 2XCFA 3ZZCA 4DGJA 4D7FA 3SV8A 2ODQA 4B1TA 1EPTB 2ZFQH 2C8XB 3LGIA 3ODDA 3S9AA 1V2TT 1FY4A 1KXCA 1XUGA 2SGEE 3PMJA 2W7UA 4AGKA 1IQFA 1DOJA 1LQEA 3I29A 3GY2A 3URDA 2J95A 1BIOA 2RA3A 1JBUH 4YM9A 1IQMA 4I32A 1JRTA 2WPIS 3AW0A 2VVUA 5DP5A 3JZ2B 3LJOA 1Z1IA 2FWWA 5DP8A 6ESTA 1NS3A 3SBKA 3OX7U 2O9QA 4XDEA 2WPJS 4OGXA 3RC4A 3DHKH 2VWOA 1KIGH 1NT1A 2NU1E 3I78A 1ZJDA 1CBWC 3SNAA 2FI3E 1YCPM 5TCAA 5F8ZA 1VKYA 1P05A 2PSYA 4D9RA 5B6LA 1HRTH 2FS9A 4OS4A 1Y3VA 3CS0A 3GCTG 4UFEH 3LGUA 2BY6X 1O3JA 1PJPA 1YPLH 5HYOA 3LIWA 1ZHRA 1ZTJA 3HKJB 1KTSB 1DX5M 4X1PU 1EQ9A 1V2VT 1O37A 1C2HA 4IN1A 2ZTZA 4NFFA 4ZXXH 1IQHA 1HUTH 1T31A 4UFDH 4CRCA 1MTWA 1NFYA 3SORA 4GCHF 3MFJA 1W12U 1XUKA 2F9UA 2BM2A 1GBFA 3A8BA 1ELBA 5DG6A 5FXLA 1B0FA 1THSH 1QRXA 4GCHG 3C1KA 2A0QB 1KXDA 3MO9A 2ZKSA 3IWMA 3M5LA 1BB0B 1RS0A 2ANYA 2BZ6H 2GT8A 3QZRA 1EJNA 4TT3D 1PPFE 2Y5HA 2AGIX 1SGEE 4NA9H 4ACAA 1JIRA 1BTHH 2XBYA 4QT8C 1GBAA 2HRVA 2ZO3H 1NN6A 3KN2A 1K0HA 4CHAC 3BTHE 1CBWB 1F0TA 4ABJA 1W0JD 3W94A 3GCTF 5IDKA 4Q7YA 4M9FA 5FX5A 4KTUA 2RDLA 1LHFH 3KEEA 1A61H 1XVOA 2F83A 3A8DA 1SGFA 2XBXA 4NZLA 4TY6A 4B2AA 1H9IE 2V3HH 4J2YB 1BA8B 3SV6A 3K6ZA 5EJLA 3KQDA 2H9EH 1DUAA 2OK5A 1THPB 1BRBE 1P06A 4ISLA 4O97A 4XD7D 2IN2A 3MWIU 1AE5A 3F2FA 3KGPA 1U6QA 2AHME 8ESTE 1W8BH 1XUIA 2ZGJA 2BQ7B 3T25A 4Q7XA 4FXGH 2ODYB 1GI0A 4JMYA 1A1RA 1S84A 2ZHEH 5GCHG 2C4FH 1LO6A 1TNJA 2QXHA 1N6XA 1SLUB 6GCHF 3BTFE 3LKWA 4UDWH 1ZTLA 1NBMD 2FX4A 2G8TA 2FLBH 1K1LA 2O8LA 1YF4A 2EEKA 3P6ZB 5F53A 1GI4A 4GLYA 2W6JD 4TWYA 1P11E 1O3OA 2PKSC 1OWKA 4ZCNA 2QXGA 2FO9A 1NM6A 4X6OA 4K69A 3ZYDA 1INCA 5T1VA 2BD5A 3F2GA 4MNVA 1LVBA 2HOBA 1P2IA 1ORFA 1O2WA 2GZ9A 3ZZAA 1O5EH 2ANMH 2Y81A 3QTOH 1TNHA 4I8LA 4FVBA 1T7CA 3D65E 4LZ1H 2PGQB 2P16A 2PLXA 3RXDA 2PR3A 2G81E 3LGYA 3U1JB 2ZDVH 5H4IB 2WV5A 4JYVH 1JIMA 4NWKA 3ATMA 3E90B 4CREA 4BAHB 4IMQA 1QBVH 2R3UA 3N7DA 4WXIA 4U32A 4I86A 3S7KB 4AFZA 1ZGVA 1BRAA 3BEFB 1N1LA 1NFWA 1WQSA 1D3DB 3EE7A 3M5NA 4IGDA 2DE9A 2IJOB 1ZRKA 3DSPA 1A0JA 1Z8RA 3MTYA 1GJ6A 1PQ5A 4CR9A 3A82A 2ZGXH 3RU4E 1AMHA 2XBVA 2NU0E 3M36A 1O2LA 1GBJA 2OC8A 4XSKU 1FMGA 1O5CB 1UK3A 1W14U 1W7GH 3A89A 1GCTC 1GBMA 2XWBI 1YLCA 4WH8A 1Y5UT 1WBGB 1E1RD 2ZGCA 4NIXA 1P57B 1S6FA 1UTLM 1P8VC 2PV9B 4B71A 2SGPE 9ESTA 3I77A 2FOMB 4HI3A 1HAVA 2WINI 4KP0A 1CQQA 2EC9H 2OQUA 1QY6A 2AIQA 3V3MA 1BHXF 1QIXB 1VR1H 4ABHA 5FPSA 3O8RA 2J97A 1QL7A 3SN8A 1L2EA 3UNRA 4R0IA 2ZHWH 2QE7D 2JJ1D 3OTJE 3RXOA 1XUFA 2OQ5A 1ELEE 2H1UA 2JKHA 1HB0B 5AVDA 1DDJA 1Z8JB 4NA8A 3UIRA 4XE4A 4FETA 3E0PB 2C8WB 1D3QB 1COWD 5GDSH 1GHAF 1WSSH 1MD7A 1BRUP 4TPIZ 4K60A 1T8OA 3MOCA 1A0HB 4UFGH 2HGTH 3UWIA 3WWFA 3R0FA 1F0SA 1S6HA 2ZU2A 1EAXA 2WV4A 2ZP0H 1RIWC 2J38A 1WTGH 4B6EA 5C94A 4X0WU 1LPKB 4ABGA 2BDYA 2IPQX 2LPRA 1D3TB 5BPEA 1NRQH 1RJXB 1LPZB 3MO3A 4YLUA 1FLEE 1AUJA 2YMSB 2BOHB 4TPYA 4AG2A 4XOJA 1DY9A 1KDQA 1O3EA 1L4DA 3RXFA 3ODFA 1OWEA 3DFLA 1ZHPA 1NO9H 3GCNA 1P09A 4RSPA 4FUCA 4JK6A 3TPIZ 3U8OH 1C1PA 2ZPRA 3T28A 4X8UH 2XNIA 1W2KH 4RN6A 1UW7A 4NSYA 2OTVA 5J4QA 2QF4A 2OC0A 3SZNA 2ZEBA 1V2JT 4FUBA 1AKSB 4Y0YE 1O2SA 1MTNC 1C2JA 2F91A 1TQ7B 1OWJA 4KELA 1Z6JH 1DE7H 3NZIA 4OS7A 2BX3A 3LU9B 4WVPE 3ZZ8A 1ELGA 1O2QA 1JOUB 3BTEE 3KYFA 4HG6A 1TX8A 1BITA 1DXPA 2SGDE 1GJ9B 4X8VH 5C3NA 2WYJA 3PRDA 3BTQE 3SUEA 2XC5A 1C1OA 1ELVA 1QURH 1YWUA 1T8LA 3VEQB 2EA3A 5EW1H 3KIDU 1OWDA 1TWXB 2ALVA 2AFQB 1BTUA 3WW7A 1OWHA 1G37A 4XBBA 1O2ZA 1IQEA 3TNTA 3HPTB 4ZHMU 2BYAX 1C1NA 3OAAD 4H42U 1AVWA 3SNEA 1AZ8A 1C2LA 1AGJA 4OS2A 2ALPA 2VIQA 1O3DA 2A4GA 2PGBB 2ZG0H 3FANA 1AFQC 2KFWA 4XBDA 3BTKE 5CDFE 3VFEA 1EPTA 2IOTA 2GDDA 2WUBA 2A5IA 2XNDD 3RXBA 4AX9H 1KSNA 2KR7A 1SLVB 1LPGB 1SC8U 1ETSH 3F1SB 1UTQA 4MPUA 2VIVA 1DSTA 1TIOA 1O2JA 1MD8A 3MNCA 1SOZA 1Z1JA 4UE7H 3RXTA 2J2UA 2J98A 2XC0A 5FX6A 3GDVA 1LVOA 1MABB 2RCEA 1NU9A 1GBLA 5I25A 3K9XB 2PKAA 4NG9H 5ESBA 4H6SB 3RM2H 2A7HA 1EKBB 1CO7E 4F4OC 3TGIE 5CHAB 4MG3A 2C8YB 2M2AA 1A3EH 1PQ8A 1HAIH 5DP7A 1FQ3A 3PMAB 1FJSA 4B6FA 9LPRA 1S82A 2DE8A 3B8JA 3WY8A 2R9PA 2HLDD 1K28D 3SU4A 5J4SA 1TLDA 1SKYE 1ZZZA 3LT3A 2A7JA 5B6OA 2BD4A 3STJA 2H5DA 4XBCA 4FUIA 1C2GA 1SHYA 1VITH 2FIRH 2BD3A 2H2ZA 1GVZA 4X2YA 1GMHF 4X2XA 5A8YA 2HNTC 4CRFA 1VITF 4INHA 4BAMB 1TX6A 1VZQH 2OP9A 2BDCA 1NU7B 4MNYA 2AH4X 4ABFA 4GPGA 3RMLH 1QTFA 2R2MB 4F49A 1KLIH 4NFEA 3PV5A 2BTCE 5DJ7A 5L6NH 3RXRA 5EPYA 2QCYA 3D23A 7GCHF 1C5NH 3M3TA 2VGCC 1O5GH 3U69H 2ZDMA 3DCLA 1TRYA 1MKWH 1J8AA 3EA8A 3W95A 5JBBS 1ESBA 2FYRA 4AYYB 1K2I1 3MO6A 2H9HA 1GVKB 3M3VA 1BUIA 3MU5A 3SUGA 4AB9A 4A1TA 4YO9A 3O8DA 1TMUH 1YPGH 2ZCLP 1XUJA 1G3BA 1HGTH 5FHTA 5DP9A 1TBQH 1DWEH 2JETC 2G4UA 3L6PA 2LNCA 1SBWA 4P02A 1FV9A 4M7GA 2PUXB 1CGHA 3RMOH 2B8OH 3F3BA 1S81A 3A86A 2QIQA 4ASHA 3PWBA 4VGCC 5EU8A 1K1PA 1G30B 3S7HB 1MBQA 4YOJA 2Q6DA 2CGAA 4Y71A 1SG8B 2A4RA 5IK2D 4AG1A 2B9LA 5I46H 3F9HA 2F3CE 3VB6A 1H8DH 1V2QT 3BN9A 1GBDA 2OINA 1BRCE 4ABDA 1BTWA 2FYQA 4JZDH 2RFKC 1SGQE 2BOKA 3MU1A 2M5TA 2VVCA 3DSOA 1Y5BT 3AASA 1QRWA 3D62A 1C5UA 2QXJA 3RXCA 2OC7A 2RA0A 2BDAA 2VWMA 1C2DA 1H8IH 2QC2A 3VG8A 3RXAA 1V2KT 3NCLA 1DPOA 2TGAA 1P0SH 1BT7A 1BMNH 3P8OA 3PLBA 4DW2U 4U01A 1C5RA 1C1WH 1TNGA 3E91A 4AOQA 4BOHA 1ABJH 2ODPA 3BF6H 1HPGA 5AF9H 2XTTB 1MTSA 1N8OC 4Z1MD 3TH3H 2YNAA 1C2IA 1GHZA 4JCNA 2PSXA 5JBCS 1FNIA 1SGFG 3L3TA 1DITH 1TNIA 2ZA5A 3PROA 4MPXA 2ZQ2A 2B7DH 3FAOA 5C0TA 1O2PA 3NK8A 3KNXA 4HGCA 1W0KD 1C5ZB 1HV7A 2TGTA 2VIDA 2LP6A 2I6QA 2A31A 2NWNA 3UR9A 2QV1A 3A83A 4TSFD 2HWLB 1UK4A 3GY7A 1KXBA 3CENA 3E1XB 1ZOMA 3TNSA 5F8TA 1ANCA 2W6ID 1ZPZA 3VXEH 2PKSB 3E3TA 4AB8A 5LGOA 4ZHLU 4IN2A 4F48B 2ZCKP 2OBQA 5A8ZA 1OPHB 5DK1A 2P3FH 2CK3D 3FOAA 3SV2H 1C1RA 2F9VA 1C4V2 1Y3WA 4OGYA 5GNDA 1O5AB 3ZZ7A 1HCGA 1V2LT 1F92A 1O2MA 3TLOA 4CH8B 2J34A 1SGYE 4XFQA 2WPMS 1SGPE 2HNTE 1ACBE 3T29A 1FN8A 7KMEH 2LELA 3ATLA 1EXFA 4Y8XA 1O3GA 2ZECA 4ZHAA 1TPPA 3PV2A 3M37A 5T3HA 2UWOA 3TJVA 5C17A 3UREA 5A8XA 1TGSZ 1NRPH 1DLEA 2YNBA 2ZFSA 4F55A 1Z8GA 1SSXA 1OSSA 1BBRH 1TB6H 2PTNA 1UHBB 3UAIC 1S85A 5SGAE 1G2LA 1SOTA 3SNDA 4DT4A 4A1XA 1ELTA 1HAHH 1BMMH 2PWXA 5DP4A 4MLFB 4Y8ZA 1C5WB 2SNVA 2BLVA 1GBCA 1GI1A 1AO5A 4O03A 1O38A 4K8BA 1HJ8A 3EA9A 2FEQH 1QA7A 1WOFA 2VIOA 1O32A 2BDGA 5TJXA 2ZQ1A 1BCUH 1WV7H 1DWCH 1WQVH 1D3PB 3F68H 1SLWB 1M9UA 4INLA 3EYDA 1BJUA 1GWAA 3SOSA 3ZZDA 3ATKA 5PTPA 4PROA 3K6YA 1CHOF 4ASUD 4JZFH 1W13U 2A5KA 3PM3A 3GY8A 1F5KU 1K9OE 1P10A 2BZAA 1HAOH 3UWJH 1P12E 4KTSA 3QGJA 1HAVB 4BTIB 1UVTH 2J94A 1GJ7B 2HALA 2TBSA 5HM2A 2BMGB 2OC1A 1P2QA 4GVUA 1MTVA 1NC6A 1PPZA 3QO6A 3ZZ5A 1CGIE 3QTVH 3UQOA 1XXFA 1AKSA 1ARBA 1MAXA 3SU2A 3VPKA 5C67A 3VB4A 5JYIA 1EZXC 2VIPA 3KCGH 4B2CA 3G01A 4ZH8A 1CHOG 1MAYA 4NZQA 3SV9A 2ZPQA 1XKAC 4JZEH 2ZDKA 3O8CA 1ANEA 1HAXB 3A7YA 1TPOA 1Q3XA 1P01A 1S83A 2QGRA 2ESTE 4NGAH 1K1IA 5HIZA 1PPHE 4I33A 1BQYA 3OTPA 1V2PT 4RKJB 2BY5X 5JPMH 5HIYA 5EXLA 4U30A 3K65B 2FLRH 2BQWB 1PYTC 4Y8YA 2C93B 3STIA 1FONA 4Z6AH 3BIUH 2KAIB 2V0BA 3NUMA 3HATH 1T8NA 1HJ9A 1XXDA 4ZKRU 3KQCA 1WCZA 1KXEA 5A0CA 1AVXA 3H5CB 1SQRA 3A80A 4A1VA 1Z8IB 1OS8A 1HBTH 1O2OA 2P93A 5E0GA 2TPIZ 4DVAU 4LOYH 1BMAA 4X1NU 1YC0A 1RGQA 1SVPA 1GBIA 3KHVA 3AW1A 2FODA 1EX3A 4Y10E 1EATA 3FZDA 2HVXA 3ITIA 3SQHE 2YOLA 2SNWA 1GDNA 4DOQA 1OYTH 2OXSA 5C20A 3N99A 3SZEA 1C5MD 1ZYOA 1MUEB 3RM0H 1EZQA 2SGAA 1A5IA 1OWIA 2CXVA 1O3PB 4A92A 2WV9A 1C4U2 3UUZA 1AQ7A 4SGBE 3VGCB 2Y7XA 3DA9B 1KLTA 1ZTKA 1GI6A 5F8XA 1IOEA 5KEDA 3V7TA 4CRBA 1F5LA 2Z6BD 2A45B 2YMSD 2JJ2D 2STBE 3TJNA 1CT2E 3UPEA 1L1GA 4ISHH 2Q1JA 3PMBB 4AN7A 2ZCHP 3ZZ6A 5GXPA 4A7IB 1ZMJA 2HNTF 5F6MA 2UUFB 1ZSLA 1SFIA 4B74A 1MQ6A 4Y0ZE 2Q6FA 3R3GB 3T2NA 1O3CA 4CR5A 4IBLH 3Q76A 1GI8B 3SU6A 4X6PA 1Y59T 1QFKH 2G55A 1TA2A 1AN1E 1GL1A 2PW8H 2PUQH 7LPRA 2EI6A 5E2PA 2QN5T 3NXPA 3GDUA 3BEUA 4WY3A 1OOKB 1VITG 3GDSA 3OE7D 4FUEA 1OP2A 1SGCA 4NCYA 1O5FH 3SV7A 3P95A 5K7RA 3A7XA 2AEIH 3MMGA 1NROH 1DS2E 2F4LA 1E38B 1IQKA 2BY7X 1A4WH 4K1EA 3A84A 2GD4B 4ZROA 1N6YA 3MYWA 1Z71A 2A4OA 3SGBE 2ZU3A 3DUXH 4X6NA 1DXWA 1TNLA 2VBCA 1FZZA 1G3DA 3S9BA 2GCHG 1ZJKA 1GMCG 4IS5A 1O39A 1UTOA 3F2HA 1UCYE 1SQTA 1TA6A 1EOLA 4YOGA 1LVMA 1Z6EA 4ZAEA 4WF8A 2A1DB 2OUAA 3FN8A 1BOQA 1CE5A 3F9EA 4AGJA 3ZIAD 2ZFPH 2J9NA 4P00A 4MPVA 2Y7ZA 1AWHB 4BXWA 1P9UA 4CBOA 1ETRH 2OBOA 1C1SA 3TJUA 1GJBB 3QUMP 2ZI2H 4WXVA 3ZVCA 4GAWA 3IG6B 4JZ1A 2AMPA 4OS5A 1YM0A 4B73A 5HKKD 2Z9KA 4RKOB 1QL8A 3URCA 1DICA 3GYMA 1O2HA 2A4QA 1O2RA 3P70B 3SW2B 4X2VA 3PMHB 2XWAA 4D8NA 5EPNA 2CN0H 1IQLA 2GMTB 1WAYB 1SQOA 2BD9A 4TWWA 1C5TA 4FUHA 4DIHH 2WPLS 4X8TH 2CMYA 1O3LA 1C1QA 1AI8H 2IPHA 4ZKOU 1T4UH 3ZZBA 3M7QA 1E79D 2VIWA 2G5NA 1UO6A 2FOCA 3ZZ9A 1B5GH 1DM4B 5E8EH 2A32A 3SHAH 1AVGH 3LC5A 1SR5C 2AYWA 2KCPA 4TYDA 3SJ8A 1WXRA 1SFQB 1SI5H 1GHXH 3RDZA 3RXKA 1CA0B 1BTXA 2NU3E 2ZGHA 4MNWA 2D8WA 2FOFA 2ZDNA 5DO4H 2XYAA 3PWCA 2I6SA 1UCYK 1C2KA 2XC4A 3A81A 1HAGE 1P03A 1IQGA 4SGAE 3SJOA 1GJ8B 2V6NA 3CNRA 4IW4E 1GBTA 2BXUH 2PHBA 1TGBA 1NFUA 1C2EA 2RG3A 2V7QD 2V3MA 2ZHQH 1O2GH 1O3NA 1TBZH 1QL9A 1GHBG 2VJ1A 1A5HA 2ZFRH 1HLTH 1DSUA 3MH6A 1LKBA 1YPHE 1CGJE 3LJJA 1S6LA 2ASUB 2CF8H 3SHCH 2K1QA 2XBWA 1BMFD 3SU0A 1LHGH 1P04A 2P3TB 4NWLA 3EE0B 5T6FA 1QB6A 3ZVBA 1MTNB 3FP7E 2BHGA 5AFYH 2R0KA 1QB9A 2J4IA 3LOXA 1GHWH 3S69A 2P8OB 4B75A 2FOBA 1AB9B 1W0ZU 3FO8D 8GCHG 1GCDA 5GWZA 4ZKSU 4Z0KA 1P9SA 2G00A 2B5TB 1WDIA 2VWLA 5FAHA 5EIYA 1GMCF 4Y6DA 3P8NA 1KY9A 2HPPH 4DJZB 2GMTC 2VB0A 6GCHG 1DLKB 1NRSH 2VU8E 1MKWK 5DPAA 2FOEA 1H4WA 4BTTB 3RXSA 1O2TA 2P3UB 3PLPA 3PTNA 4Y11E 2CV3A 1QZ8A 1ZLRA 1EJMA 1KYNA 3B23B 2Z9JA 2Y5GA 3SJ9A 1HXEH 5CMXH 3UOPA 2BDIA 1O3BA 2OLGA 3LPRA 1EOJA 2B0FA 1QRZA 1F7ZA 1Y3XA 1O3AA 1SB1H 4JK5A 5FPTA 1O2KA 4MTBA 4YOIA 1GJ4H 1MZDA 3HK6B 1AU8A 3MI4A 3RLYH 3MU4A 1PQAA 2O8MA 4UONA 2GZ7A 3K2UA 5EG4A 2FTLE 4E06H 1GG6B 1P3CA 3DFJA 3UFAA 4MNXA 3QWCH 3SJIA 1GHAG 4AORA 4YESB 1T4VH 3RXPA 4DURA 1HAYB 1OKXA 1K1JA 3F0OA 1O3FA 2Z3EA 8GCHF 2GTBA 1A46H 4JYTA 1UTKA 2AGGX 3Q3KA 1FY8E 1J17T 1KLJH 4DIIH 2YMSC 3S0NA 4THNH 1PFXC 3GICB 3SGAE 4K5ZA 4Q2KA 1KXFA 3KQBA 3OYPA 1O2YA 3SYJA 5LPFA 4ABIA 2EY4C 2HLCA 1P2JA 3AAUA 2QAAA 3PV4A 1SGNE 4R8TB 3SI4H 2WPDD 1CVWH 1AB9C 1BTYA 1S5SA 3MNBA 2JH0D 1MU6B 4H6TA 3GS9A 8LPRA 1C5XB 1F2SE 3ATWA 3OU0A 3FKSD 4CRDA 1C5SA 4FVDA 5DP3A 2ULLA 1G3EA 2K8IA 4GSOA 4WH6A 4DY7B 2R2WU 4BAOB 1HJAC 5C5NA 2C90B 1XMNB 1ESAA 4X1RU 1H9HE 2D2DA 1EP5A 3GY4A 3SU5A 4NIYA 2PFEA 2BY9X 4E05H 1AZZA 4CBNA 1CA8B 1JXPA 1LHDH 2Y80A 1O2NA 2GCHF 1O5BB 4I8KA 4OM9A 1F5RA 4AFUA 2ZHDA 5LPEA 1YLNA 1NRRH 2IJD1 2WYGA 5EGMA 1TOCB 2AMQA 5JBAS 1YGCH 2A7CA 3GYLB 3ZZ3A 3H09A 1ETTH 3RMNH 2XOKD 1LKAA 1GMDF 1GI2A 1P2MA 1J14A 1KDQB 4FUFA 1FAXA 1RXPA 1HIAB 1EASA 4XRNA 2PKAB 2STAE 1NZQH 1VJ9U 3QX5H 4INKA 1FIZA 1GBKA 3NPSA 1K1NA 1FY5A 2GJGA 3EDXB 4Y7BA 1C9PA 3VGCC 5CE1A 1J16A 1JRSA 4KTCA 1AFQB 2C8ZB 1TRNA 4CRAA 1Y5AT 2BLWA 2ZC9H 6CHAB 2FX6A 1RIWB 3FVFB 3SU1A 2WUCA 1H8ED 3F9GA 2BB4A 2R0LA 5LH8A 1FAKH 2W26A 5EJ1A 1LDTT 3B9FH 2K0QA 1QQUA 1GDQA 3F6UH 3RC5A 2Y6TA 3SO3A 4NA7A 1SGRE 4I31A 3ZVDA 1SLXB 3LDXH 1S0RA 1C5PA 3FP6E 1GL0E 2BD2A 2QYIA 1FY3A 1EUFA 4KKDA 3NKKA 1BDAA 2D1JA 4MDSA 3NWUA 1EP6A 2CHAC 2G5VA 1B0EA 2UUJB 1FN6A 1FUJA 4UD9H 1UTPA 1BTPA 1JWTA 4X2WA 1B7XB 2KAIA 4ABAA 3TIUA 1PPEE 1YPMH 2ZWLH 4X8SH 2W3KA 2BVSH 1LTOA 2JH5D 4NIVA 2ZFFH 2NU4E 1O5DH 1MTUA 2AIPA 2SGFE 2P8OC 1LMWB 4ACBA 1O2XA 1EJAA 3GCHC 4Q63A 1TE0A 2FI4E 1C2FA 1C1TA 5EJZA 3HGPA 4O3UA 2HVYB 3V13A 1ANBA 3QK1A 1FX0B 1UCYH 2CJIA 2FXRA 3AVZA 3Q3XA 3RU4T 4K2YA 4BTUB 3DSGA 3BSQA 1ZSKA 2BY8X 1WTHD 1TRMA 1G3CA 2FDAA 3SNCA 4E7RG 5DN6D 1BMLA 2A2XH 5HXFA 3H7TA 1PPGE 3RU4D 2L6OA 1BJVA 3ZV8A 5JB9S 3A7WA 2ZU4A 4H4FA 2FMJA 3AAVA 4BNRA 5C1YA 4GHQA 1ID5H 1ELAA 1YPHC 1YP9A 5C1XA 1T32A 1TMBH 3LC3A 1DWDH 1UTJA 3BTGE 4OS1A 5LPRA 5HMAA 1G32B 1SMFE 4YXWD 5A0BA 3BTDE 2ZU5A 5EW2H 2RDEA 3DT0H 2FI5E 1YLDA 1V2NT 4Y76A 2ZU1A 4ABEA 4AFQA 8KME2 3MHWU 4WWYA 2GP9B 3GCHB 2Z7FE 1J9CH 1TYNA 5A2MH 1Q31A 1T8MA 3PLKA 3A7VA 1O3IA 1O35A 4IC5A 3A88A 3SUFA 2F9PA 1P2NA 5GJ4B 2BX4A 1FXYA 2FPZA 3HGNA 4ZXYH 1GVLA 5GIBA 3VB5A 1V2RT 3H7OA 5ESTE 3U28C 1ZSJA 3ATIA 1QNJA 3LONA 4IMZA 1TFXA 5HM9A 4FUGA 1RTKA 3TJOA 1LVYA 5KECA 4YT7H 3EAJA 1MZAA 3GISB 2W5EA 3M7UA 3UNQA 2FTMA 2ZFTA 1K1OA 1AE8H 4ISOA 3MNSA 1CT4E 1FPHH 5GCHF 2VINA 5AFZH 3M3SA 1EZSC 2ZZUH 1KXAA 5E2OA 4D7GA 5FCRA 2Y82A 3M35A 2L74A 2Z3CA 2WHXA 1TGNA 1UVPA 1PYTD 1GI5A 4FU7A 1L4ZA 2G52A 3EQ0H 1H1BA 5FBEA 4Q80A 2G51A 1GMDG 4AFSA 4CH2B 2VH0A 2V35A 3RXEA 3RP2A 1XKBC 1YPJH 3S9CA 2ZTXA 1ELCA 3GY6A 1GG6C 2TIOA 1HXFH 2KCOA 1KTTB 1YPEH 3QZQA 3A8CA 1MQ5A 2W3IA 1K21H 1ZMLA 2JH6D 3A7ZA 4WMFA 3ZYEA 4DT7B 1GJCB 5G4BA 4RT1A 1ABIH 1ESTA 1IAUA 3SGQE 1C5VA 1O31A 4Y7AA 1D6WA 1GGDB 6LPRA 1IHSH 1O30A 3V12A 2AERH 2SFAA 3BV9B 1H9LB 1V6DA 1W3CA 2WPKS 2TGPZ 3RMMH 2ZPSA 4LK4A 2ZHFH 1J15A 1K1MA 3ZVAA 4X1SU 3T5FH 2UUKB 2XW9A 2VGCB 1MCTA 1TNKA 1HJAB 5EXNA 1O2VA 1GJAB 2GZ8A 1C2MA 3BIVH 3FZZA 1ZMNA 1NFXA 5KGOA 1OYQA 3GY5A 1BBRK 1QBNA 2ZDAH 1V2UT 1SPJA 1EAUA 4WMDA 3KYGA 3OY5U 1AHTH 2THFB 4UFFH 3ZVEA 2XCNA 3LGTA 1YCPH 3RXGA 3TK6A 1LHCH 3RXLA 1EFRD 2JDID 1DUEA 5BRRE 2FESH 3M5OA 1V2WT 3M5MA 4RI0A 1QHRB 3RC6A 1VGCC 2ANKH 2P95A 1D9IA 1EAWA 3ESTA 2BDBA 1Q2WA 5C1UA 2CHAB 2EQNA 3KQEA 4DCDA 3ZZ4A 4FOUC 2JIZD 2FZZA 3SQEE 4HZHA 2FM2A 5L2ZH 1NESE 3EGKH 3ZVGA 3PTBA 1O0DH 2FOHA 4VGCB 4ZUHA 1TABE 2TGDA 4CRGA 1D6RA 1EPTC 1GHBF 3PO1C 4ABBA 2GKVE 4J1YA 2FOGA 2Y5FA 1KMHB 4JZIA 4D76A 1GMHG 2ZTYA 3T62A 1XUHA 1YYY1 1O3MA 4FU9A 4I8HA 5CHBA 2F43B 2G4TA 2KZ4A 4U2WA 3LH1A 1D4PB 1HNEE 3L33A 2AS9A 4WMEA 1BBRE 3E6PH 3RXMA 1TALA 3E8LA 4RT0A 5JB8S 4Y79A 2PP6A 1E1QD 1V2OT 3KL6A 1LHEH 3ENSB 1GI9B 1V2ST 3PYHA 3KF2A 3BTME 2F9NA 1SGTA 1IQIA 1LCYA 3TH4H 3A7TA 1TOMH 1C1VH 1THRH 2AMDA 3CP7A 2BQ6B 2QA9E 4MQAA 3Q00A 3Q77A 2QF3A 1ELDE 1C5YB 3BTTE 3LH3A 4ISNA 5FBIA 1FIWA 3U1IB 5ABWA 4K1SA 4X6MA 5F03A 2SGQE 1SHHB 2WZQA 1E0FD 2P59A 1GI7B 1HFDA 1O33A 1Z7KA 2H9TH 4UEHH 2Z9LA 5FPYA 1ZPBA 4K1TA 1UVSH 1VCQA 3F9FA 3O8BA 1TMTH 3E0NB 1QJ1B 1QR3E 5ETXA 3SNBA 2ZDLA 1GJDB 5E0HA 1TONA 1GHYH 3T26A 1IQJA 3RXVA 1RRKA 1EAIA 3U8RH 3QGNB 1C1UH 1TPSA 5C2ZA 1X7AC 3VB7A 1UK2A 2QXIA 1N8OB 3SJKA 1MMJN 2XXLA 1FY1A 4Q4LA 3LGVA 3TVJB 3UY9A 2J92A 3D49H 2BLQA 2ILNA 1FDPA 1XM1A 2GV7A 3RUOA 5JDUB 2VH6A 4BAKB 1QBOA 1AFEH 2AGEX 2GGVB 3BG8A 4DG4A 1GBBA 3SU3A 3PB1E 4HFPB 4NIWA 1RFNA 1GHVH 2O8TA 5DGJA 1JMOH 2GDEH 2GCTC 1QJ6B 2FOAA 4YLQH 1TPAE 3U9AH 1AY6H 1CT0E 1LQDB 1OX1A 1TQ0B 1YKTA 1G9IE 2WSSD 1GBEA 1QJ7B 1ZR0A 1UVUH 1EB2A 3SUDA 2F9OA 1A2CH 2EI7A 4E7NA 4A6LA 1A5GH 1C1MA 1FPCH 2PTCE 3MNXA 5TCCA 2HPQH 1V2MT 2KM0A 4I7YH 5EQQA 1ZPCA 1L1NA 3HK3B 3T27A 1W10U 4I8JA 4OS6A 5T6DA 3MH5A 3QN7A 1H8HD 3OEHD 2BVXH 1P2KA 2QF0A 1HYLA 1TX7A 4B2BA 1O2UA 4BANB 3N7OA 3W1EA 1VCWA 1ELFA 2GX4A 2H5CA 2BLOA 3P8FA 3UOUA 3DD2H 1PQ7A 2WPHS 5DSFA 1WUNH 1E37B 1DT2A 3GY3A 1AUTC 3LGWA 1HIAA 1MKXK 1DVAH 2UWPA 1OXGA 1YPKH 4B76A 3QLPH 1O34A 3MU8A 3RXIA 3TU7H 5EOKA 3BTWE 1GJ5H 2UUYA 1L0ZA 2JETB 1CU1A 2XRCA 3MQKC 3UTUH 1A7SA 3P17H 2R3YA 6CHAC 5L2YH 5K0HA 5EXMA 1P3EA 2OD3B 2F9BH 5C0UA 2A5AA 3TK9A 1UMAH 1ZRBA 1O3KA 1VCPA 1TAWA 1UJ1A 1UTMA 1Y3YA 1ZGIA 4O9VA 1RD3B 1W7XH 3P8GA 3OEED 3RXQA 5FCKA 1E35B 4TY7A 1V3XA 1SQAA 4IC6A 2ZF0H 1CA0C 1C4Y2 1GPZA 1WYKA 1SGDE 2CF9H 1W0YH 3C27B 3UNSA 3V0XA 2Z94A 4AZ2B 3VXFH 5L30H 1W11U 2GCTB 3ZV9A 3E16B 2D26C 1OP0A 2UWLA 4Q7ZA 3A87A 5T6GA 4LZ4B 2A2QH 1O3HA 4ESTE 1BTZA 4A5TS 2OCVB 1CHGA 3M7TA 1HDTH 2BD8A 3TGKE 3M61U 3BG4B 2NU2E 1GDUA 1GI3A 3A85A 3HKIB 2GV6A 2QF5A 3IITA 3SI3H 2BXTH 3PRBA 2VVVA 1L1JA 1DFPA 4YT6H 2DUCA 2GVFA 2P94A 4WJG2 1TBRH 5CHAC 1NPMA 3FP8E 2KX4A 5EQRA 1F0RA 3RXUA 3WWBA 2FP7B 1SGIB 3GCOA 2GT7A 3RXHA 2ZNKH 3TK5A 1A3BH 3VB3A 1G36A 2BVRH 2Z9GA 3N7EA 1E34B 3NRLA 1C5OH 1XX9A 2Z3DA 1NRNH 1S0QA 1YCPK 5DKMA 1QGFA 1ARCA 4K8YA 3U98H 1DY8A 1ZHMA 2H6MA 1MH0A 3BG4C 4KGAA 7GCHG 3ELAH 5HGGA 1MBMA 1OP8A 4HTCH 3UR6A 1F0UA 1P02A 3BEIB 3FFGA 1RTLA 3OFND 1SL3A 1VGCB 5IYTA 1BHXB 1XVMA 2J5UA 1UVOA 3GOVB 1C5LH 1NBME 3JZ1B 1A0LA 4X1QU 1GCTB 3F0PA 5GPIB 7ESTE 3AK5A 1NTPA 5A09A 1QCPA 3Q3YA 1WU1A 2Q6GA 4YZUA 1CSOE 5EODA 1UHBA 1TGCA 1QA0A 1QB1A 3PO1B 1AIXH 5FL7D 4MVNA 4FU8A 4MPWA 3TH2H 4ZMAH
chains in the Genus database with same CATH topology
2BD7A 5C5OA 1PPBH 2Z9IA 4O3TA 1GBHA 2VWNA 3OSYA 1HAZB 2QY0B 4AYVB 4BXSA 4YTAA 3A8AA 1C9TA 1AD8H 3RXJA 1K22H 1HAPH 4NSVA 2ANWA 1MCVA 1P2OA 1BZXE 1DANH 5EQSA 2BDHA 4CHAB 1IQNA 1RTFB 5A0AE 1QQ4A 1MU8B 5DP6A 4FUDA 2TRMA 3P92A 3CS7A 1MKXH 3EA7A 4FUJA 3ZVFA 3TITA 3RLWH 1PPCE 1O2IA 3MH4A 3U8TH 2O8WA 1C5QA 3TGJE 4GHTA 4BAQB 2V3OH 2W7SA 4JYUH 1ANDA 4GUXA 3QDZB 1E36B 4ISIH 4K3JA 3MH7A 1O36A 1AWFH 1IHTH 1Y3UA 2ZGBH 1Y8TA 2EI8A 2O8UA 4I8GA 5AHGH 4ZKNU 5JBTA 1EZUC 1NY22 3MU0A 1G2MA 1YBWA 5E0JA 4LXBH 3UQVA 1TGTA 1UTNA 1GGDC 1VJAU 3OY6U 4D9QA 2VNTA 2FS8A 1EB1H 1FI8A 2C3SA 2ZIQH 1DWBH 2XCFA 3ZZCA 4DGJA 4D7FA 3SV8A 2ODQA 4B1TA 1EPTB 2ZFQH 2C8XB 3LGIA 3ODDA 3S9AA 1V2TT 1FY4A 1KXCA 1XUGA 2SGEE 3PMJA 2W7UA 4AGKA 1IQFA 1DOJA 1LQEA 3I29A 3GY2A 3URDA 2J95A 1BIOA 2RA3A 1JBUH 4YM9A 1IQMA 4I32A 1JRTA 2WPIS 3AW0A 2VVUA 5DP5A 3JZ2B 3LJOA 1Z1IA 2FWWA 5DP8A 6ESTA 1NS3A 3SBKA 3OX7U 2O9QA 4XDEA 2WPJS 4OGXA 3RC4A 3DHKH 2VWOA 1KIGH 1NT1A 2NU1E 3I78A 1ZJDA 1CBWC 3SNAA 2FI3E 1YCPM 5TCAA 5F8ZA 1P05A 2PSYA 4D9RA 1HRTH 2FS9A 4OS4A 1Y3VA 3CS0A 3GCTG 4UFEH 3LGUA 2BY6X 1O3JA 1PJPA 1YPLH 5HYOA 3LIWA 1ZHRA 1ZTJA 3HKJB 1KTSB 1DX5M 4X1PU 1EQ9A 1V2VT 1O37A 1C2HA 4IN1A 2ZTZA 4NFFA 4ZXXH 1IQHA 1HUTH 1T31A 4UFDH 4CRCA 1MTWA 1NFYA 3SORA 4GCHF 3MFJA 1W12U 1XUKA 2F9UA 2BM2A 1GBFA 3A8BA 1ELBA 5DG6A 5FXLA 1B0FA 1THSH 1QRXA 4GCHG 3C1KA 2A0QB 1KXDA 3MO9A 2ZKSA 3IWMA 3M5LA 1BB0B 1RS0A 2ANYA 2BZ6H 2GT8A 3QZRA 1EJNA 1PPFE 2Y5HA 2AGIX 1SGEE 4NA9H 1JIRA 1BTHH 2XBYA 4QT8C 1GBAA 2HRVA 2ZO3H 1NN6A 3KN2A 4CHAC 3BTHE 1CBWB 1F0TA 4ABJA 3W94A 3GCTF 5IDKA 4Q7YA 5FX5A 4KTUA 2RDLA 1LHFH 3KEEA 1A61H 1XVOA 2F83A 3A8DA 1SGFA 2XBXA 4NZLA 4TY6A 4B2AA 1H9IE 2V3HH 4J2YB 1BA8B 3SV6A 3K6ZA 3KQDA 2H9EH 1DUAA 1THPB 1BRBE 1P06A 4ISLA 4O97A 2IN2A 3MWIU 1AE5A 3KGPA 1U6QA 8ESTE 1W8BH 1XUIA 2ZGJA 2BQ7B 3T25A 4Q7XA 4FXGH 2ODYB 1GI0A 4JMYA 1A1RA 1S84A 2ZHEH 5GCHG 2C4FH 1LO6A 1TNJA 2QXHA 1N6XA 1SLUB 6GCHF 3BTFE 3LKWA 4UDWH 1ZTLA 2FX4A 2G8TA 2FLBH 1K1LA 2O8LA 1YF4A 2EEKA 3P6ZB 1GI4A 4GLYA 4TWYA 1P11E 1O3OA 2PKSC 1OWKA 2QXGA 2FO9A 1NM6A 4X6OA 4K69A 3ZYDA 1INCA 2BD5A 4MNVA 1LVBA 2HOBA 1P2IA 1ORFA 1O2WA 2GZ9A 3ZZAA 1O5EH 2ANMH 2Y81A 3QTOH 1TNHA 4I8LA 4FVBA 1T7CA 3D65E 4LZ1H 2PGQB 2P16A 2PLXA 3RXDA 2PR3A 2G81E 3LGYA 3U1JB 2ZDVH 5H4IB 2WV5A 4JYVH 1JIMA 4NWKA 3ATMA 3E90B 4CREA 4BAHB 4IMQA 1QBVH 2R3UA 4WXIA 4U32A 3S7KB 4AFZA 1ZGVA 1BRAA 3BEFB 1N1LA 1NFWA 1WQSA 1D3DB 3M5NA 4IGDA 2DE9A 2IJOB 1ZRKA 1A0JA 1Z8RA 3MTYA 1GJ6A 1PQ5A 4CR9A 3A82A 2ZGXH 3RU4E 1AMHA 2XBVA 2NU0E 3M36A 1O2LA 1GBJA 2OC8A 4XSKU 1FMGA 1O5CB 1UK3A 1W14U 1W7GH 3A89A 1GCTC 1GBMA 2XWBI 1YLCA 4WH8A 1Y5UT 1WBGB 2ZGCA 4NIXA 1P57B 1S6FA 1UTLM 1P8VC 2PV9B 4B71A 2SGPE 9ESTA 3I77A 2FOMB 4HI3A 1HAVA 2WINI 4KP0A 1CQQA 2EC9H 2OQUA 1QY6A 2AIQA 3V3MA 1BHXF 1QIXB 1VR1H 4ABHA 5FPSA 3O8RA 1QL7A 3SN8A 1L2EA 3UNRA 4R0IA 2ZHWH 3OTJE 3RXOA 1XUFA 2OQ5A 1ELEE 2H1UA 2JKHA 1HB0B 5AVDA 1DDJA 1Z8JB 4NA8A 3UIRA 4XE4A 3E0PB 2C8WB 1D3QB 5GDSH 1GHAF 1WSSH 1MD7A 1BRUP 4TPIZ 4K60A 1T8OA 3MOCA 1A0HB 4UFGH 2HGTH 3UWIA 3R0FA 1F0SA 1S6HA 2ZU2A 1EAXA 2WV4A 2ZP0H 1RIWC 2J38A 1WTGH 4X0WU 1LPKB 4ABGA 2BDYA 2LPRA 1D3TB 5BPEA 1NRQH 1RJXB 1LPZB 3MO3A 4YLUA 1FLEE 1AUJA 2BOHB 4TPYA 4AG2A 4XOJA 1DY9A 1KDQA 1O3EA 1L4DA 3RXFA 3ODFA 1OWEA 3DFLA 1ZHPA 1NO9H 3GCNA 1P09A 4RSPA 4FUCA 4JK6A 3TPIZ 3U8OH 1C1PA 2ZPRA 3T28A 4X8UH 2XNIA 1W2KH 4RN6A 4NSYA 2OTVA 5J4QA 2OC0A 3SZNA 2ZEBA 1V2JT 4FUBA 1AKSB 4Y0YE 1O2SA 1MTNC 1C2JA 2F91A 1TQ7B 1OWJA 4KELA 1Z6JH 1DE7H 3NZIA 4OS7A 2BX3A 3LU9B 4WVPE 3ZZ8A 1ELGA 1O2QA 1JOUB 3BTEE 1TX8A 1BITA 1DXPA 2SGDE 1GJ9B 4X8VH 5C3NA 2WYJA 3BTQE 3SUEA 2XC5A 1C1OA 1ELVA 1QURH 1T8LA 3VEQB 2EA3A 5EW1H 3KIDU 1OWDA 1TWXB 2ALVA 2AFQB 1BTUA 1OWHA 1G37A 4XBBA 1O2ZA 1IQEA 3TNTA 3HPTB 4ZHMU 2BYAX 1C1NA 4H42U 1AVWA 3SNEA 1AZ8A 1C2LA 1AGJA 4OS2A 2ALPA 2VIQA 1O3DA 2A4GA 2PGBB 2ZG0H 3FANA 1AFQC 4XBDA 3BTKE 3VFEA 1EPTA 2IOTA 2GDDA 2WUBA 2A5IA 3RXBA 4AX9H 1KSNA 1SLVB 1LPGB 1SC8U 1ETSH 3F1SB 1UTQA 4MPUA 2VIVA 1DSTA 1TIOA 1O2JA 1MD8A 3MNCA 1SOZA 1Z1JA 4UE7H 3RXTA 2J2UA 2XC0A 5FX6A 3GDVA 1LVOA 2RCEA 1NU9A 1GBLA 5I25A 3K9XB 2PKAA 4NG9H 5ESBA 4H6SB 3RM2H 2A7HA 1EKBB 1CO7E 4F4OC 3TGIE 5CHAB 4MG3A 2C8YB 1A3EH 1PQ8A 1HAIH 5DP7A 1FQ3A 3PMAB 1FJSA 9LPRA 1S82A 2DE8A 3B8JA 3WY8A 2R9PA 1K28D 3SU4A 5J4SA 1TLDA 1ZZZA 3LT3A 2A7JA 5B6OA 2BD4A 3STJA 2H5DA 4XBCA 4FUIA 1C2GA 1SHYA 1VITH 2FIRH 2BD3A 2H2ZA 1GVZA 4X2YA 1GMHF 4X2XA 5A8YA 2HNTC 4CRFA 1VITF 4INHA 4BAMB 1TX6A 1VZQH 2OP9A 2BDCA 1NU7B 4MNYA 2AH4X 4ABFA 4GPGA 3RMLH 1QTFA 2R2MB 4F49A 1KLIH 4NFEA 2BTCE 5DJ7A 5L6NH 3RXRA 5EPYA 2QCYA 3D23A 7GCHF 1C5NH 3M3TA 2VGCC 1O5GH 3U69H 2ZDMA 1TRYA 1MKWH 1J8AA 3EA8A 3W95A 5JBBS 1ESBA 2FYRA 4AYYB 1K2I1 3MO6A 2H9HA 1GVKB 3M3VA 1BUIA 3MU5A 3SUGA 4AB9A 4A1TA 4YO9A 3O8DA 1TMUH 1YPGH 2ZCLP 1XUJA 1G3BA 1HGTH 5FHTA 5DP9A 1TBQH 1DWEH 2JETC 2G4UA 3L6PA 2LNCA 1SBWA 1FV9A 4M7GA 2PUXB 1CGHA 3RMOH 2B8OH 1S81A 3A86A 2QIQA 4ASHA 3PWBA 4VGCC 5EU8A 1K1PA 1G30B 3S7HB 1MBQA 4YOJA 2Q6DA 2CGAA 4Y71A 1SG8B 2A4RA 4AG1A 2B9LA 5I46H 3F9HA 2F3CE 3VB6A 1H8DH 1V2QT 3BN9A 1GBDA 2OINA 1BRCE 4ABDA 1BTWA 2FYQA 4JZDH 1SGQE 2BOKA 3MU1A 2M5TA 2VVCA 1Y5BT 3AASA 1QRWA 3D62A 1C5UA 2QXJA 3RXCA 2OC7A 2RA0A 2BDAA 2VWMA 1C2DA 1H8IH 2QC2A 3RXAA 1V2KT 3NCLA 1DPOA 2TGAA 1P0SH 1BT7A 1BMNH 3P8OA 3PLBA 4DW2U 4U01A 1C5RA 1C1WH 1TNGA 3E91A 4AOQA 4BOHA 1ABJH 2ODPA 3BF6H 1HPGA 5AF9H 2XTTB 1MTSA 1N8OC 3TH3H 2YNAA 1C2IA 1GHZA 4JCNA 2PSXA 5JBCS 1FNIA 1SGFG 3L3TA 1DITH 1TNIA 2ZA5A 3PROA 4MPXA 2ZQ2A 2B7DH 3FAOA 1O2PA 3NK8A 3KNXA 4HGCA 1C5ZB 1HV7A 2TGTA 2VIDA 2I6QA 2A31A 2NWNA 3UR9A 2QV1A 3A83A 2HWLB 1UK4A 3GY7A 1KXBA 3CENA 3E1XB 1ZOMA 3TNSA 5F8TA 1ANCA 1ZPZA 3VXEH 2PKSB 3E3TA 4AB8A 5LGOA 4ZHLU 4IN2A 2ZCKP 2OBQA 5A8ZA 1OPHB 5DK1A 2P3FH 3SV2H 1C1RA 2F9VA 1C4V2 1Y3WA 4OGYA 1O5AB 3ZZ7A 1HCGA 1V2LT 1F92A 1O2MA 3TLOA 4CH8B 2J34A 1SGYE 4XFQA 2WPMS 1SGPE 2HNTE 1ACBE 3T29A 1FN8A 7KMEH 3ATLA 1EXFA 4Y8XA 1O3GA 2ZECA 4ZHAA 1TPPA 3M37A 5T3HA 2UWOA 3TJVA 3UREA 5A8XA 1TGSZ 1NRPH 1DLEA 2YNBA 2ZFSA 1Z8GA 1SSXA 1OSSA 1BBRH 1TB6H 2PTNA 1UHBB 1S85A 5SGAE 1G2LA 1SOTA 3SNDA 4A1XA 1ELTA 1HAHH 1BMMH 2PWXA 5DP4A 4MLFB 4Y8ZA 1C5WB 2SNVA 2BLVA 1GBCA 1GI1A 1AO5A 4O03A 1O38A 4K8BA 1HJ8A 3EA9A 2FEQH 2VIOA 1QA7A 1WOFA 1O32A 2BDGA 5TJXA 2ZQ1A 1BCUH 1WV7H 1DWCH 1WQVH 1D3PB 3F68H 1SLWB 1M9UA 4INLA 3EYDA 1BJUA 1GWAA 3SOSA 3ZZDA 3ATKA 5PTPA 4PROA 3K6YA 1CHOF 4JZFH 1W13U 2A5KA 3PM3A 3GY8A 1F5KU 1K9OE 1P10A 2BZAA 1HAOH 3UWJH 1P12E 4KTSA 3QGJA 1HAVB 4BTIB 1UVTH 2J94A 1GJ7B 2HALA 2TBSA 5HM2A 2BMGB 2OC1A 1P2QA 4GVUA 1MTVA 1NC6A 1PPZA 3QO6A 3ZZ5A 1CGIE 3QTVH 3UQOA 1XXFA 1AKSA 1ARBA 1MAXA 3SU2A 3VPKA 5C67A 3VB4A 5JYIA 1EZXC 2VIPA 3KCGH 4B2CA 3G01A 4ZH8A 1CHOG 1MAYA 4NZQA 3SV9A 2ZPQA 1XKAC 4JZEH 2ZDKA 3O8CA 1ANEA 1HAXB 3A7YA 1TPOA 1Q3XA 1P01A 1S83A 2QGRA 2ESTE 4NGAH 1K1IA 1PPHE 4I33A 1BQYA 1V2PT 4RKJB 2BY5X 5JPMH 5EXLA 4U30A 3K65B 2FLRH 2BQWB 1PYTC 4Y8YA 2C93B 3STIA 1FONA 4Z6AH 3BIUH 2KAIB 2V0BA 3NUMA 3HATH 1T8NA 1HJ9A 1XXDA 4ZKRU 3KQCA 1WCZA 1KXEA 5A0CA 1AVXA 3H5CB 3A80A 4A1VA 1Z8IB 1OS8A 1HBTH 1O2OA 2P93A 5E0GA 2TPIZ 4DVAU 4LOYH 1BMAA 4X1NU 1YC0A 1RGQA 1SVPA 1GBIA 3KHVA 3AW1A 2FODA 1EX3A 4Y10E 1EATA 3FZDA 2HVXA 3ITIA 3SQHE 2YOLA 2SNWA 1GDNA 4DOQA 1OYTH 2OXSA 5C20A 1C5MD 1ZYOA 1MUEB 3RM0H 1EZQA 2SGAA 1A5IA 1OWIA 2CXVA 1O3PB 4A92A 1C4U2 3UUZA 1AQ7A 4SGBE 3VGCB 2Y7XA 3DA9B 1KLTA 1ZTKA 1GI6A 5F8XA 1IOEA 3V7TA 4CRBA 1F5LA 2Z6BD 2A45B 3TJNA 2STBE 1CT2E 3UPEA 1L1GA 4ISHH 2Q1JA 3PMBB 4AN7A 2ZCHP 3ZZ6A 5GXPA 4A7IB 1ZMJA 2HNTF 5F6MA 2UUFB 1ZSLA 1SFIA 4B74A 1MQ6A 4Y0ZE 2Q6FA 3R3GB 3T2NA 1O3CA 4CR5A 4IBLH 3Q76A 1GI8B 3SU6A 4X6PA 1Y59T 1QFKH 2G55A 1TA2A 1AN1E 1GL1A 2PW8H 2PUQH 7LPRA 2EI6A 5E2PA 2QN5T 3NXPA 3GDUA 3BEUA 4WY3A 1OOKB 1VITG 3GDSA 4FUEA 1OP2A 1SGCA 4NCYA 1O5FH 3SV7A 3P95A 5K7RA 3A7XA 2AEIH 3MMGA 1NROH 1DS2E 1E38B 1IQKA 2BY7X 1A4WH 4K1EA 3A84A 2GD4B 4ZROA 1N6YA 3MYWA 1Z71A