1O2QA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2qA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2qA02
1O34A 1G9IE 1LVMA 3BTHE 3ZVFA 2ZFPH 1GJ5H 2WYJA 5JYIA 2WV5A 5E0JA 2PLXA 1AO5A 1V6DA 3RM0H 1AY6H 1JWTA 2GZ9A 2I6SA 5DP4A 5EU8A 4ABEA 1S82A 1EASA 1HAZB 1JOUB 3SQHE 3H7TA 2IPHA 1A3BH 2Y82A 2ULLA 3MNBA 1XVMA 2AFQB 4A1XA 2C8ZB 1HAVA 1UK2A 3SJIA 2O8UA 1GDUA 3JZ1B 4X0WU 1MTNC 1P2MA 1SGFA 3LJJA 4R8TB 1ZR0A 4O9VA 1SGPE 3MTYA 3MYWA 2R2WU 2XBVA 4KGAA 1UVSH 1O5BB 3A7WA 3QLPH 1ZSJA 1N8OC 3OY5U 3K6YA 3ZYDA 3M5MA 2QC2A 1P05A 5GDSH 5JBCS 1BCUH 1DS2E 1QB6A 2A31A 3TJNA 1ZTKA 3JZ2B 1RIWC 3BTKE 1ELGA 1FMGA 4AFZA 3F68H 4XFQA 4YO9A 1O2XA 5TJXA 1S0QA 2G5VA 2GD4B 3Q3YA 2CHAB 1XKBC 1MU6B 5C1UA 4F49A 2P16A 1GBTA 1O2UA 5C20A 1SFQB 3RXHA 1V3XA 3MH6A 1N6XA 1RD3B 1XXFA 4ZKOU 4NG9H 1UCYE 1ZMJA 5C5OA 1VITH 3P6ZB 2WPMS 1XMNB 1G32B 3RXMA 1DWCH 3A7YA 1BTXA 3GY7A 3ATLA 3PWBA 4MPXA 3SHAH 3TGJE 1A0HB 2C8WB 4NA7A 2G51A 5C1YA 2FDAA 3ATIA 4Y8YA 3LDXH 3URCA 1WTGH 3GY4A 1T31A 1HXFH 3M5OA 4B74A 1W0YH 1FAKH 4NFEA 1EAIA 1O35A 2IOTA 1SGRE 1MKXK 5FXLA 2FMJA 1NRPH 4JYVH 1C1NA 1THSH 4GCHF 4B2BA 2XBYA 2R3YA 1MD7A 1WTHD 2FS9A 1AZ8A 3SU3A 4GVUA 3ATWA 2VB0A 3CP7A 1V2RT 4FUEA 2F9UA 1TMTH 2O8LA 1IQNA 4GHQA 1L2EA 1DDJA 1A7SA 1LHEH 2Y6TA 1O2PA 3MNSA 4IGDA 2XC4A 1Q3XA 2WPHS 4Q7ZA 1TA2A 1F92A 1EJAA 3RXCA 4XOJA 4A5TS 1LVOA 1MTVA 1AVGH 1KDQA 5C2ZA 1P03A 2C93B 5GIBA 4ESTE 2V6NA 4NIWA 3CS7A 2CN0H 2SGFE 1H9HE 2ZFQH 1SLWB 1W7GH 3A87A 1SHHB 1PQ8A 2ZHWH 4NFFA 4FUGA 3S9CA 2HRVA 3EA7A 3D62A 2OQUA 2AGGX 2VWMA 1S81A 4JZEH 2O8MA 3TH4H 3PO1B 1MMJN 1ZPCA 2Z9GA 3OSYA 4WVPE 3ZVAA 2Y7XA 1FY1A 1XUFA 3BEFB 4Y8ZA 1OYQA 7GCHG 1ZTLA 1GHVH 2TBSA 2ZTZA 5DG6A 1TX6A 4FUHA 1KLJH 2OC0A 4FXGH 3VFEA 3FAOA 5LH8A 5J4SA 3RXLA 1EXFA 2H1UA 1IQIA 2Y5GA 5HMAA 5K0HA 4X2YA 1KSNA 3OYPA 5E2PA 1PJPA 2EA3A 3T5FH 1NFXA 1PPCE 2GCHF 2AS9A 2ZG0H 1C4U2 2P95A 1VJ9U 2JH6D 4UE7H 1AB9B 1O2RA 2VJ1A 4HGCA 2C8XB 2BHGA 1O2HA 3KCGH 5EXLA 2BD3A 3O8DA 4AFUA 4B2AA 1ESBA 1C1WH 1OWKA 1NFUA 1ZHPA 3A8DA 3A8BA 3EDXB 1TNLA 3RC4A 1GBHA 1H4WA 3WY8A 1C5NH 1O2LA 2A4GA 2XBXA 3UR9A 2FI4E 1C1PA 1ZMNA 2BD2A 1WQSA 1LHDH 3NZIA 1DANH 2AMPA 4I8LA 2KAIA 3P92A 3SU4A 3VB6A 1INCA 4BTTB 8GCHG 2ZFFH 1WYKA 2AERH 2QYIA 3UWIA 4GAWA 4KKDA 4A6LA 4DCDA 1GBAA 3D49H 1IHSH 4ZHAA 1HAXB 1HJAB 1W8BH 3C27B 9LPRA 3EAJA 4ISOA 1MZDA 3BSQA 1O33A 1G3DA 4NCYA 1WU1A 3EQ0H 1UK4A 2FPZA 4MDSA 1G2LA 2UWLA 3CS0A 3TLOA 2SGDE 3RUOA 1BTYA 3U1IB 1FPHH 1FPCH 1ID5H 1VCWA 4DG4A 1EP6A 3RXUA 2F9PA 1HRTH 3GCTF 1CGJE 4NIXA 4GUXA 4U30A 3RXKA 1QIXB 2XW9A 3UY9A 1F5LA 1V2ST 3E8LA 3BTME 2ZTXA 1AI8H 1C5ZB 2Z3CA 4FUJA 5F6MA 3SN8A 3ATMA 5FX6A 1JBUH 3PO1C 1SLXB 4Y6DA 2PSXA 2G55A 5DP7A 1W11U 5CE1A 2ZI2H 3ZZ4A 3KGPA 3TNSA 1NZQH 1YPGH 2BOHB 2ZDLA 3VGCB 1A0JA 2ZIQH 3ZZAA 5DP6A 1P04A 1YCPK 2BD7A 2BDAA 4D7GA 2TIOA 3SZNA 3T62A 2BDBA 3ZVGA 2GT8A 1QA7A 3RXVA 1C9PA 1QBNA 4Q7YA 1EZUC 1PPFE 1QA0A 3ZYEA 1CQQA 4JZIA 2JKHA 1HIAA 2RCEA 1ZGVA 1GHBF 2HLCA 1TIOA 2BZAA 1CSOE 3KQBA 1BRBE 3MNCA 3RXSA 1D6RA 2FI5E 1K1OA 1O38A 3UOPA 2XXLA 1IHTH 1MTUA 1QFKH 1SGQE 4I8JA 2AIPA 4I8HA 5FHTA 3KIDU 3GOVB 2G8TA 4D9QA 6ESTA 3HATH 2RA3A 2R2MB 3A7ZA 3LH1A 2A45B 1QJ1B 1BHXF 1MBMA 3M3TA 5GPIB 1YCPM 1TE0A 2BB4A 2WPLS 1UK3A 2BLQA 4O3UA 1VJAU 1GI7B 2Z9JA 2D1JA 1WCZA 3P95A 3K65B 1DPOA 2Y5FA 1KXEA 1TBRH 2EI7A 1MKWK 1K21H 4FVBA 2XTTB 1PFXC 2EC9H 2FI3E 1AU8A 1NU7B 3E0NB 1A61H 5AHGH 2ZDNA 1GVZA 1MTWA 2SGQE 2H5DA 3BIUH 3V0XA 3BEIB 3N7OA 1U6QA 1ZTJA 4MTBA 4JZ1A 2ANMH 1F0SA 4I8KA 4ZHMU 1XVOA 3SUFA 3S9BA 4Y79A 1P12E 3S9AA 2Q6GA 1N1LA 2YNBA 4ZROA 3RM2H 1J14A 1NRRH 1UTMA 1AD8H 3DUXH 3MNXA 1ESTA 2VVVA 2SFAA 2BTCE 1C5RA 3PV4A 1TRYA 2OQ5A 3RXFA 1KLTA 3TJVA 1N6YA 2ZGXH 3ITIA 1Z1JA 3SBKA 1JIMA 1KTTB 3GICB 3OY6U 3QUMP 3QZQA 3VGCC 4MNWA 1C5LH 2ZHEH 3RXPA 2WV4A 4I31A 2LPRA 4ABAA 1NROH 2Z9KA 4ABDA 3GY8A 2GZ7A 4BXWA 5BRRE 1ELCA 1TBZH 4SGAE 5TCCA 4LXBH 1NT1A 4WY3A 4NZLA 1HGTH 2ZPSA 1MCTA 1ABJH 3F9HA 2CMYA 1FI8A 1J15A 1EZXC 1TX7A 2QAAA 2BYAX 4NIVA 1W13U 2CGAA 2BLOA 3GDVA 2A5AA 1PQAA 2O9QA 3E0PB 2AIQA 2XBWA 2H6MA 2XCNA 1G37A 1F5KU 2STBE 1S84A 1Y3UA 3OU0A 1O3AA 1YM0A 4B73A 2ZDMA 2BMGB 3K2UA 5E2OA 4MPUA 1W3CA 4YTAA 3GY5A 2BLWA 3T29A 1UTQA 5EGMA 5A0CA 2FODA 1O3DA 4I7YH 1O36A 1GJ8B 1SB1H 1YCPH 2GV7A 2ANYA 1EB1H 1IQEA 1Z7KA 3PLKA 2TGAA 4X8VH 1BMNH 3O8CA 1OWEA 1XUHA 1B7XB 2W26A 2FTLE 3NCLA 5J4QA 1A46H 1TMBH 5DP9A 1TBQH 2ZU3A 3QDZB 1L1JA 4B71A 3I77A 2CF8H 1AE8H 1V2QT 2GT7A 3CENA 3K6ZA 3UQOA 2XWAA 1BUIA 2BY5X 4AFQA 3U1JB 2FYRA 2BY8X 3SQEE 2A2QH 2JETC 4UFFH 1TFXA 2ZGJA 4ZKSU 1XUIA 1DOJA 4XBBA 1TGCA 1BIOA 1TQ7B 1ETRH 1TONA 1TB6H 3TU7H 1CA0B 2HNTF 3SU2A 4CREA 5FAHA 2A4OA 1DY9A 5EXNA 2F91A 1TNHA 1GBEA 1GI2A 2PGBB 1TOCB 4BTIB 2FIRH 1BRCE 1MKWH 3BN9A 2TGDA 3PTBA 6GCHF 3V12A 1G3BA 1QL7A 1GDNA 1UVTH 1FDPA 1O5DH 1HLTH 3M61U 1NPMA 1S6HA 1B0FA 3BF6H 2AGEX 1AGJA 2BY6X 1Y59T 2QXJA 4MQAA 4A7IB 1EZQA 1BBRH 1AFQC 4YESB 4E7RG 4O97A 4JZFH 5AFYH 1G30B 2A2XH 2AEIH 5FPTA 4FU9A 2O8TA 2W5EA 1RTKA 1HPGA 1NS3A 5HM9A 4GCHG 2Y5HA 2ZZUH 2GDEH 3DHKH 1SOTA 4THNH 1AWFH 1RGQA 4F4OC 1LPKB 4MNVA 4HTCH 3LGVA 1P2IA 1GBCA 5E0GA 2THFB 1D9IA 1HAYB 5EPYA 5DO4H 2QA9E 3UNRA 2ZQ1A 4YOGA 2FYQA 1O2TA 1IQGA 1C1QA 1FN8A 4MPWA 1DY8A 1C2LA 4GPGA 4UFGH 4Y76A 3PTNA 1BTZA 1IQHA 4WMDA 2Y80A 2PW8H 1QL8A 1SGNE 8LPRA 1C2HA 5DK1A 4CR9A 1GWAA 1V2WT 1G3EA 1E36B 1EAUA 4GLYA 3BTEE 1ZRBA 2BQ7B 1EPTB 4CR5A 3MU0A 4E05H 1FJSA 3M7QA 3VB5A 1FXYA 1LTOA 3UR6A 1T7CA 2FEQH 3KQEA 2H5CA 3VB7A 5EQRA 1Z8JB 1DVAH 5DKMA 1XUKA 2VWNA 3LU9B 2TRMA 4E06H 4HI3A 3C1KA 1NRSH 3ZVEA 1CA0C 1F7ZA 1VCQA 1TWXB 1MTSA 4AG1A 2BVSH 4H6SB 1V2TT 2GCHG 2FX4A 4BOHA 4K8YA 1M9UA 1T4VH 1D3DB 4DIIH 3P17H 3RC6A 2GGVB 2ODQA 3FFGA 3SJKA 1MAYA 2P93A 2TGPZ 3E6PH 4OS2A 3OX7U 2FOGA 1ZSKA 4YZUA 3LGUA 4WJG2 1NN6A 2BD9A 2QV1A 1C2MA 2H9HA 2BX3A 3BTFE 1O3CA 5DPAA 1DICA 1QJ7B 5GCHF 4AFSA 3DD2H 3LPRA 1DXPA 3SW2B 1HAPH 2OP9A 4CRBA 2PTCE 1O2QA 1V2UT 2V3HH 1ANCA 3PB1E 3SUEA 3A84A 2ZKSA 1SVPA 4UFEH 3UFAA 1CT0E 1TYNA 1J8AA 2ZHFH 1QNJA 2NWNA 5JBBS 4MNXA 1CE5A 1HNEE 3SJ8A 5JBAS 1GL0E 1GJAB 2DE9A 2GCTB 1QBOA 1UTPA 3EGKH 5EW2H 1AKSA 1C2GA 1E0FD 2AMDA 3QZRA 4ISIH 4UONA 2A32A 3BTGE 3QTOH 1DWDH 3RU4E 4CH8B 1MCVA 4JMYA 3FP7E 4X1QU 4GHTA 4X6OA 4U01A 5L2YH 1K1PA 1UHBA 5DP5A 3UWJH 2ZDKA 2A7JA 3GCTG 2VIWA 4ZMAH 1Z6EA 1BTHH 3RXRA 1ZMLA 4X6MA 3HPTB 1GMCF 1S85A 2ZHQH 4Q7XA 4X2VA 3UUZA 5C1XA 1JIRA 3L3TA 1GI8B 3E3TA 4WMEA 2A4RA 1C1SA 1AVXA 1EPTC 1RRKA 1GI0A 1H8DH 3LONA 5G4BA 4DY7B 3S7HB 1GI5A 2ZGHA 1QHRB 3RXAA 6LPRA 1ZOMA 3ELAH 1DWEH 2DE8A 1KXBA 2W3KA 4OS4A 3R0FA 4UFDH 4FUIA 4K5ZA 1WSSH 4X8SH 5TCAA 5EPNA 1LKAA 1OYTH 3BV9B 1DITH 2JH0D 4MPVA 5LPEA 1TNKA 3O8BA 1QL9A 4H42U 1TNGA 3KF2A 3L6PA 3URDA 2VGCB 2W7SA 2PSYA 4Y10E 1QY6A 5HM2A 3H5CB 1V2KT 1GHBG 1P3EA 3BIVH 1L4ZA 1BMMH 2UUFB 1BTUA 2ZPRA 1UTKA 3ODDA 1Y8TA 1O3JA 3SJOA 2SNWA 3QTVH 1C2JA 1EP5A 1VCPA 3MFJA 2PKSB 4ZUHA 1AMHA 1C5UA 2B8OH 2K1QA 1LPZB 3QO6A 1HAOH 2P3FH 5AFZH 1FY5A 2BDHA 3BTTE 3E90B 3RXEA 4ZAEA 3U8OH 1A5HA 3SV7A 2PKAB 1TX8A 2BXUH 2W3IA 2HALA 2CHAC 1SI5H 4B1TA 3BTQE 1C1OA 1BTPA 3FANA 1P10A 4MG3A 2B5TB 1YYY1 1PPEE 2LNCA 3SI4H 3QGJA 2ZPQA 4FUFA 3A82A 1LMWB 2SGAA 3BTWE 3TJUA 3A7XA 2HNTC 1O31A 2GCTC 1GI6A 1O3LA 3MWIU 4TPYA 4CRCA 1XXDA 3DFLA 1GI1A 1O3FA 4AN7A 4WMFA 3UREA 5FBIA 2SGEE 3VPKA 4KTSA 4K8BA 1DLKB 1PYTD 3B8JA 1GCDA 1W2KH 4ZXXH 2C8YB 1OXGA 1QB9A 4OS7A 1C2DA 1VGCB 2BY7X 4XDEA 2RDLA 3O8RA 1JRSA 5AVDA 1D4PB 1KXCA 1GL1A 3VEQB 1TNIA 1K2I1 2H9EH 2F83A 5L30H 2OXSA 1TQ0B 2ESTE 1BMLA 3W95A 1C5XB 2FZZA 3TH3H 3MO6A 1BA8B 1GGDB 1THPB 2BY9X 3ATKA 5F8XA 4CHAB 3T25A 1C5WB 1O3BA 4CRDA 1Z6JH 4BAMB 2OC1A 1GHAF 5CHAB 1UTLM 1DUAA 1HXEH 1NC6A 1GHWH 4JCNA 4UDWH 4IW4E 1BBRE 2FOEA 1OP8A 2Z6BD 1P2KA 2QGRA 2VINA 3ZZ5A 1F0UA 3SV8A 3D65E 1YC0A 4RKOB 1VR1H 1HJ8A 1MKXH 4JYUH 2VGCC 3TITA 1V2MT 1UTJA 1TRNA 1NO9H 1SGYE 4BTUB 1SOZA 1TABE 2VWLA 1FONA 2FLRH 3GCHB 1MAXA 1WQVH 5EQSA 3E16B 2H9TH 1CHOF 3SGBE 3LT3A 3ZV8A 4D8NA 1EJNA 1JXPA 3LH3A 1CA8B 2PKSC 2ZWLH 1FY4A 4NSYA 3ZZ3A 1D6WA 1ZPZA 4CRGA 3RXTA 4CRAA 3ZV9A 5E8EH 3S0NA 2G4TA 5FBEA 1S83A 2QF0A 2PWXA 4HFPB 2QXGA 2PUXB 3T2NA 5GXPA 4OS1A 8KME2 4WH8A 1T8NA 4MNYA 2GVFA 2A5IA 4FUBA 1IQJA 5A8XA 1AB9C 2RG3A 2ZGBH 3MU1A 3A7VA 3ZZ7A 1HAIH 1K28D 2Z9IA 1DT2A 5F8TA 3SUGA 1SG8B 3STIA 2QN5T 3HGNA 3ZVDA 1MH0A 1SQOA 3PMAB 4AZ2B 5B6OA 2XC0A 1GMHF 4BANB 1YPLH 3UPEA 3ZVCA 4AX9H 1VGCC 2QY0B 1MQ5A 3T27A 2OCVB 2EI6A 3A81A 3SNAA 2P94A 1LHFH 3GDUA 5GJ4B 3B9FH 1QRXA 2NU3E 1JRTA 9ESTA 4IN2A 1YPHC 1GGDC 1AZZA 1HAVB 1HJAC 3V3MA 1RTFB 4CHAC 4AG2A 3MMGA 4ISHH 2R3UA 4BNRA 4UD9H 2D26C 2ZCHP 4AORA 1FNIA 6GCHG 1MZAA 5CHAC 2ZFSA 1HAGE 1CU1A 5L6NH 1NY22 1OKXA 3T28A 3MU8A 4LZ4B 1LVBA 1C5PA 1O2GH 1SFIA 3GY6A 1FLEE 3LGTA 3AASA 2G81E 3FZDA 4VGCB 4INKA 5JPMH 1Y5AT 2NU0E 1GBJA 2UUJB 4XSKU 5LPRA 7KMEH 1W7XH 1QQ4A 4IN1A 4JK6A 3TK6A 4J1YA 2BM2A 1P3CA 4KTCA 4CBOA 3KEEA 4R0IA 1UVPA 2IJOB 1AVWA 3MI4A 5FX5A 2ZCKP 3SU0A 1MQ6A 2BVRH 3Q3KA 4JYTA 2ZU4A 3GCHC 1E34B 1P57B 2TGTA 3LC3A 2AYWA 3DT0H 5EXMA 3M3VA 2J94A 3M7TA 3RLYH 5SGAE 3HKJB 1O5GH 1QRWA 2OC8A 1FZZA 3IWMA 2A0QB 3ZZ6A 3U98H 1ANDA 4K1TA 1O2OA 1FIWA 3ZZDA 4NWKA 1HDTH 1O5EH 1TRMA 4IMZA 3BG4B 2WINI 1HCGA 1IOEA 1RTLA 1SGIB 1UTOA 3R3GB 2ODPA 2QIQA 5T6FA 2D2DA 1HYLA 3UQVA 1FV9A 3SNEA 2ANWA 1ELVA 1PYTC 1DSTA 3RMOH 1TGNA 1BT7A 1V2PT 4LOYH 3OTJE 1BJUA 1CGIE 1O2SA 1QCPA 2AMQA 2WPJS 5JB8S 3TIUA 3RXDA 2J38A 5T6DA 1A1RA 4AGKA 2DUCA 1SSXA 2CJIA 2Z3DA 2BDIA 4DJZB 1F0TA 4D76A 1GPZA 1K22H 1KDQB 3GISB 3ZZ9A 1O3GA 1P2JA 4YOIA 1L0ZA 3UOUA 3DFJA 1LQDB 5JBTA 2XWBI 2VH6A 1C4V2 4X6NA 2V35A 2OD3B 3I78A 1O2JA 4KP0A 1CT2E 3PMJA 2J2UA 3SUDA 1SGCA 2ZO3H 1ELEE 3GDSA 1KYNA 1O3PB 2JH5D 2ZF0H 2HVXA 2EI8A 2Y81A 3BTDE 4H4FA 1BITA 1GVKB 3P8OA 1O3NA 5GCHG 4VGCC 2XNIA 1BQYA 1WBGB 2HPQH 1KY9A 1EKBB 1YGCH 2WUBA 1SGTA 3GCNA 1ZSLA 5ESTE 2ZQ2A 3NKKA 3TK5A 1IQKA 1HUTH 1ELTA 3A86A 1T32A 3PLBA 3SU1A 1EJMA 2WYGA 1HFDA 1FIZA 1AE5A 4YLQH 4LZ1H 4DT7B 1DX5M 4TWWA 3A89A 4BAOB 1GCTB 3TVJB 4ABGA 3BG4C 1TMUH 1TAWA 1BDAA 1LCYA 3AVZA 3RXJA 4Y8XA 2KAIB 3SGQE 3V7TA 2FOMB 2FOFA 5PTPA 1A5IA 2HPPH 3ZZCA 2VVCA 1GVLA 3TJOA 1GMCG 3LGIA 2CV3A 2BZ6H 3PMHB 1O2ZA 1SLUB 1T8MA 3GYMA 4FU7A 4YT7H 1H8IH 1SLVB 2ASUB 4IC6A 4ZKRU 3F1SB 1O32A 2VWOA 1NM6A 2Q6DA 3RLWH 1ARBA 5ABWA 5FPYA 2ZTYA 2G00A 4AB8A 1Y3WA 4AGJA 1CBWB 1SL3A 1L1GA 1Y3YA 5F03A 2IN2A 1ANBA 1QRZA 4BAHB 3TNTA 3RXGA 3I29A 2WUCA 1ABIH 1XM1A 5DP8A 3KQCA 1DSUA 4X8UH 1OPHB 2A1DB 1ZYOA 1O3KA 2F9VA 4TY6A 1O5FH 1O2KA 1LHGH 1LKBA 3ESTA 1MUEB 1K1MA 2Q1JA 1K9OE 1K1IA 5JB9S 1ZJDA 3HK3B 4K3JA 8ESTE 1AN1E 2ZP0H 3MU5A 4K69A 2ZDAH 1PQ5A 1HAHH 5EW1H 1C5MD 2W7UA 3NUMA 1C1TA 2BVXH 1BZXE 1GBBA 5LPFA 1AIXH 1SGFG 4INHA 1H1BA 1BRUP 1HIAB 1YF4A 4X1RU 3DA9B 1P0SH 1SMFE 2AGIX 4ISLA 3ZZ8A 1F5RA 5E0HA 1P2OA 3PYHA 2VVUA 4NSVA 3P70B 1UVUH 1C4Y2 3Q76A 2SGPE 4OS6A 1PPBH 1GCTC 1C5SA 1DM4B 4AB9A 2CXVA 2V3OH 4Q80A 4X2WA 1P02A 1K1JA 1C2IA 1CVWH 1DUEA 3M37A 1ETSH 4PROA 4U32A 3VXEH 2ALPA 3PM3A 3PROA 2ILNA 1F2SE 4DGJA 4JZDH 3M36A 1JMOH 3IITA 4TPIZ 5C5NA 1NFYA 1AUJA 7ESTE 3V13A 1CGHA 1IAUA 3A7TA 2ANKH 1O2WA 4K60A 4A1VA 1WOFA 1C2FA 2FM2A 1EB2A 1ELFA 1GHAG 3LOXA 5CMXH 1TGBA 2XRCA 3MH5A 2QF3A 1YPKH 3ODFA 3SV6A 1HB0B 1PPGE 2J95A 3SORA 1VITF 3UNQA 2BD8A 2PUQH 2F9OA 3T26A 1O3OA 1ARCA 1CBWC 2FS8A 2GDDA 4ZHLU 4RSPA 1W12U 2A4QA 3MH4A 3RMNH 2FLBH 1K1NA 1ZLRA 1YPEH 3A88A 1FQ3A 5A2MH 1NU9A 1CHOG 1W10U 3AW0A 4MLFB 2PHBA 1GMDF 3M3SA 4H6TA 2G52A 1OP2A 3W94A 1SC8U 1DE7H 1SQAA 5F8ZA 1ANEA 1IQLA 3F6UH 2YNAA 2UUYA 1GI9B 1T8OA 1J17T 1S6FA 2B9LA 1SBWA 1DXWA 2BDCA 5ESBA 3H7OA 5EQQA 1RJXB 4ABHA 2G4UA 4NA9H 2CF9H 1T8LA 4OGYA 4BAKB 1TALA 1TPOA 2ZEBA 2R0LA 1Y3XA 2OBOA 2ZDVH 3FZZA 1D3TB 1LPGB 2EEKA 4INLA 1A5GH 2F9BH 5BPEA 3LKWA 4X8TH 1GJCB 3Q77A 3NPSA 1W0ZU 1UJ1A 4YLUA 2STAE 1E35B 2Z3EA 4FUDA 1XKAC 2OLGA 1C1MA 2FO9A 2OTVA 3P8NA 1GMHG 1ZHRA 4K1SA 3EE0B 5DJ7A 4YOJA 1P11E 4GSOA 4AYVB 2H2ZA 1A0LA 1Z8RA 4OS5A 2RA0A 1P2NA 1ZJKA 1ACBE 1SGEE 1QBVH 4TYDA 3RXIA 4BAQB 1TOMH 3MH7A 3GCOA 2ZFTA 3SU5A 3IG6B 1EAXA 1P9SA 1WAYB 1YPJH 2ZU5A 3GY3A 3NWUA 2J34A 2A5KA 3PWCA 1QTFA 3EA9A 1CO7E 4JK5A 3F9FA 4Y7BA 1OS8A 1FUJA 1OWJA 3AW1A 3U8RH 4Y0ZE 5T3HA 3RXQA 1GBKA 2GV6A 1UCYK 1AWHB 1V2NT 4WF8A 1EZSC 1NRNH 3S7KB 5A8ZA 2FWWA 2HNTE 3F9EA 3LIWA 1EQ9A 3AAVA 4LK4A 4I32A 3SO3A 1D3PB 2UWOA 1AFEH 3A8CA 4X1SU 4X6PA 1HJ9A 4DURA 2NU1E 1GBFA 3ZZBA 4RN6A 1TPSA 2PFEA 3UNSA 4DVAU 3SI3H 2ZFRH 2FOCA 1QJ6B 2Q6FA 1QQUA 2FESH 3SOSA 1AHTH 1O5CB 1O37A 1C5QA 3SHCH 2GP9B 2I6QA 4Q2KA 4NWLA 2J92A 1O2MA 4HZHA 1O0DH 1O2YA 2B7DH 2OUAA 1AUTC 1BB0B 4ABFA 4CBNA 4ABBA 4WH6A 4XE4A 2B0FA 2ZCLP 4WXVA 2F9NA 4O03A 5T6GA 4IC5A 4M7GA 1GDQA 4Z6AH 7LPRA 1OWIA 5LGOA 1Q2WA 1C5YB 1P01A 1CHGA 3SNDA 1O2IA 1FY3A 1H9LB 1B0EA 1C5VA 4OGXA 1Z71A 3LJOA 1V2VT 5FCRA 1C1RA 5ETXA 3B23B 2ZU2A 4A1TA 1EPTA 4SGBE 1ELDE 4IS5A 1NTPA 4Y7AA 3KL6A 1TGTA 2SNVA 2A7HA 3M5NA 2OC7A 1E38B 3KQDA 5H4IB 1YP9A 1FAXA 4Z0KA 3M7UA 2P3TB 4ASHA 2P3UB 3VB3A 1PPZA 3RP2A 3M5LA 3EA8A 4FVDA 4D9RA 3KHVA 1Z8GA 4FUCA 1O3HA 3UTUH 4B75A 3ZVBA 1P09A 3F9GA 2GZ8A 2QXHA 1EATA 3A80A 3FP8E 3FVFB 4B2CA 1C5TA 2BX4A 3G01A 5EODA 1EOLA 1F0RA 3PLPA 2FP7B 3TK9A 1GBIA 2J4IA 7GCHF 3FP6E 1TLDA 2Z94A 4MVNA 1KXAA 1C9TA 2XCFA 1GJ7B 5A0BA 1P8VC 4UEHH 2GTBA 2UWPA 1GHZA 1K1LA 2BDYA 2VNTA 1ESAA 1H9IE 3SGAE 2ALVA 1O30A 1CT4E 4ZKNU 1QURH 1RFNA 2HGTH 3ENSB 3RMLH 4BXSA 5A8YA 3M35A 3BEUA 4IBLH 2PGQB 1KXFA 4Y0YE 2D8WA 1YPHE 3RDZA 2O8WA 1O3MA 1XX9A 1O39A 2HWLB 1UCYH 2P59A 3TGKE 5DP3A 2ODYB 2V0BA 3U69H 2GX4A 1BOQA 3QGNB 2C4FH 1BBRK 2OBQA 3VXFH 1ETTH 2JETB 3P8FA 3GYLB 3MHWU 4DIHH 1O2VA 1SGDE 1QGFA 1KIGH 2PR3A 4ZH8A 5L2ZH 2ZGCA 4E7NA 1AKSB 3U9AH 5IDKA 8GCHF 1YLCA 4NZQA 1O3EA 2F3CE 2PV9B 3QK1A 1QR3E 4O3TA 4YM9A 1LQEA 4WXIA 1NESE 1LO6A 1MBQA 3RMMH 3MO9A 4XBDA 5HXFA 1UHBB 4ABJA 2HOBA 4XBCA 2BDGA 3LGWA 1SHYA 2BQWB 1TNJA 4I33A 3SNCA 2GMTB 2BD4A 3UIRA 3QX5H 1O5AB 1YKTA 1L4DA 3K9XB 1HBTH 2AH4X 3L33A 4X1PU 1S5SA 3A83A 4TWYA 1BTWA 1AFQB 1AQ7A 1O2NA 2ZA5A 1GBMA 4ZXYH 3STJA 4NIYA 4RKJB 2FTMA 3BG8A 1ZGIA 3TH2H 2FXRA 1L1NA 4YT6H 2P8OB 1J9CH 1SQTA 1GG6B 2J9NA 4CRFA 1Y3VA 2WPIS 1UVOA 1GHYH 1YBWA 3SV2H 1THRH 1RXPA 4ABIA 5C3NA 1GBDA 2NU4E 2BOKA 2ZHDA 3RU4D 3RU4T 1SR5C 1GJDB 4A92A 5I46H 1EOJA 1GBLA 3Q3XA 4KELA 1ZZZA 3SU6A 1TPPA 3A85A 3LC5A 1WUNH 1Z8IB 2C3SA 2PKAA 2FOAA 3Q00A 2YOLA 3S69A 4DOQA 1PQ7A 1UTNA 1PPHE 1GJBB 1SPJA 2TPIZ 1HV7A 1Y5UT 2UUKB 1C5OH 3LGYA 5A0AE 1GJ4H 5HGGA 1Z1IA 1BJVA 4CH2B 1XUGA 6CHAB 1S0RA 4KTUA 1W14U 1A2CH 1B5GH 5DGJA 4Y71A 4I8GA 3QWCH 2QXIA 4FU8A 3E91A 3KN2A 1KXDA 1MU8B 1A3EH 5AF9H 1KTSB 2VU8E 1G3CA 3HK6B 3RC5A 1ELAA 1GI3A 3NXPA 1OX1A 2A7CA 1QB1A 2FOBA 2NU2E 1EUFA 1C2EA 1OOKB 3AAUA 1T4UH 4NGAH 4ISNA 3MOCA 5GWZA 1BHXB 2VIVA 3P8GA 1DFPA 1FY8E 1VITG 5FPSA 4B76A 1MTNB 1G2MA 4WWYA 2ZU1A 2VIDA 2ZC9H 1ZHMA 1P9UA 1LHCH 1IQFA 1BRAA 1N8OB 2WPKS 4QT8C 4X1NU 1MD8A 1Y5BT 1J16A 2BLVA 2GMTC 3NK8A 2XC5A 2BXTH 2Z9LA 1V2JT 3QN7A 1OSSA 4J2YB 1RIWB 1KLIH 1X7AC 2FX6A 1C1UH 1UO6A 4D7FA 4K1EA 4Y11E 1DWBH 1LVYA 3VB4A 1YLDA 2OINA 3HKIB 5EOKA 2VIPA 1ZPBA 3SJ9A 2Y7ZA 3TGIE 4DW2U 1LDTT 2R0KA 1ELBA 2FOHA 5I25A 1GMDG 1NFWA 2Z7FE 3SV9A 1P2QA 1DLEA 2P8OC 3TPIZ 1ZRKA 2VH0A 1V2LT 3A8AA 1OWDA 3EYDA 4AYYB 1C1VH 3E1XB 4U2WA 3RXOA 1GG6C 1TA6A 1OP0A 2QCYA 2VIQA 3GY2A 1D3QB 3PMBB 2ZECA 3D23A 5K7RA 2PTNA 1FN6A 2GKVE 1EX3A 2BQ6B 1P06A 2VIOA 1A4WH 1TGSZ 2G5NA 2ZNKH 1C2KA 1EAWA 5C67A 4K2YA 1V2OT 1Q31A 5FCKA 3RXBA 1UMAH 1GJ6A 1VZQH 1E37B 1OWHA 1RS0A 5EG4A 1TPAE 5IYTA 5A09A 5HYOA 3SNBA 1O3IA 1GJ9B 1NRQH 1WV7H 1XUJA 3HGPA 3MO3A 4AOQA 4X2XA 1G36A 3KNXA 1ORFA 6CHAC 2C90B 4NA8A 1BMAA 1YPMH 2M5TA 2BD5A 5JDUB 3MU4A 1GHXH 2XYAA 2R9PA 3U8TH 4TY7A 4IMQA 1GI4A 1IQMA
chains in the Genus database with same CATH superfamily
1O34A 1G9IE 1LVMA 3BTHE 3ZVFA 2ZFPH 1GJ5H 2WYJA 3PV2A 5JYIA 2WV5A 5E0JA 2PLXA 1AO5A 1V6DA 3RM0H 1AY6H 1JWTA 2GZ9A 2I6SA 5DP4A 5EU8A 4Z1MD 4ABEA 4TSFD 1S82A 1EASA 1HAZB 4F55A 1JOUB 3SQHE 3H7TA 2IPHA 4XD7D 4XRNA 1A3BH 2Y82A 2ULLA 3MNBA 1XVMA 2AFQB 3N7EA 4A1XA 2C8ZB 1HAVA 1UK2A 3SJIA 2O8UA 1GDUA 3JZ1B 4Q4LA 1MTNC 1P2MA 4X0WU 1SGFA 3LJJA 4R8TB 1ZR0A 1YY3A 1SGPE 3MTYA 3MYWA 2R2WU 2XBVA 3OTPA 1UVSH 1O5BB 3A7WA 4KGAA 1ZSJA 1N8OC 3OY5U 3K6YA 3ZYDA 3M5MA 2QC2A 1P05A 5GDSH 2L6OA 5JBCS 1BCUH 1DS2E 1QB6A 2YMSD 2A31A 3TJNA 1ZTKA 3JZ2B 1RIWC 3BTKE 1ELGA 1FMGA 4AFZA 3F68H 4XFQA 4YO9A 1O2XA 5TJXA 1S0QA 2KFWA 2G5VA 2GD4B 3Q3YA 2CHAB 1XKBC 1MU6B 5C1UA 4F49A 2P16A 1GBTA 1O2UA 5C20A 1SFQB 3RXHA 1V3XA 3MH6A 1N6XA 1RD3B 1XXFA 4ZKOU 4NG9H 1UCYE 1ZMJA 5C5OA 1VITH 3P6ZB 2WPMS 1XMNB 1G32B 3RXMA 1DWCH 3A7YA 1BTXA 3GY7A 3ATLA 3PWBA 4MPXA 3SHAH 3TGJE 1A0HB 2C8WB 4NA7A 2G51A 5C1YA 2FDAA 3ATIA 4Y8YA 3LDXH 3URCA 1WTGH 3GY4A 1T31A 1HXFH 3M5OA 4B74A 1W0YH 1FAKH 4NFEA 1EAIA 1O35A 2IOTA 1SGRE 1MKXK 5FXLA 2FMJA 1NRPH 4JYVH 1C1NA 1THSH 4GCHF 4B2BA 2XBYA 2R3YA 1MD7A 1WTHD 2FS9A 2WV9A 1AZ8A 3SU3A 4GVUA 3QLPH 3ATWA 2VB0A 3CP7A 3DSGA 1V2RT 4FUEA 2F9UA 2QE7D 1TMTH 2O8LA 1IQNA 4GHQA 1L2EA 3SYJA 1DDJA 1A7SA 1LHEH 2Y6TA 1O2PA 3MNSA 4IGDA 2XC4A 1Q3XA 2WPHS 4Q7ZA 1TA2A 1F92A 1EJAA 3RXCA 4XOJA 4A5TS 1LVOA 1MTVA 1AVGH 1KDQA 5C2ZA 1P03A 2C93B 5GIBA 4ESTE 2V6NA 4NIWA 3CS7A 2CN0H 2SGFE 1H9HE 2ZFQH 1SLWB 1W7GH 3A87A 1SHHB 1PQ8A 1QZ8A 2ZHWH 4NFFA 4FUGA 3S9CA 3N7DA 5CHBA 2HRVA 3EA7A 3D62A 2OQUA 2YMSB 2AGGX 2VWMA 1S81A 4JZEH 2O8MA 3U28C 3TH4H 3PO1B 1MMJN 1ZPCA 2Z9GA 3OSYA 4WVPE 3ZVAA 2Y7XA 1FY1A 1XUFA 3BEFB 4Y8ZA 1OYQA 7GCHG 1ZTLA 1GHVH 2TBSA 2ZTZA 5DG6A 1TX6A 4FUHA 1KLJH 2OC0A 4FXGH 3VFEA 3FAOA 5LH8A 5J4SA 3RXLA 1EXFA 2H1UA 1IQIA 2Y5GA 5HMAA 5K0HA 4X2YA 1KSNA 3OYPA 5E2PA 1PJPA 2EA3A 3T5FH 1NFXA 1PPCE 2GCHF 2AS9A 2ZG0H 1C4U2 2P95A 1VJ9U 2JH6D 4UE7H 1AB9B 1O2RA 2VJ1A 4HGCA 2C8XB 2BHGA 1O2HA 3KCGH 5EXLA 2BD3A 3O8DA 4AFUA 4B2AA 1ESBA 1C1WH 1OWKA 1NFUA 1ZHPA 3A8DA 3A8BA 3EDXB 1TNLA 3RC4A 1GBHA 1H4WA 3WY8A 1C5NH 3FO8D 1O2LA 2A4GA 2XBXA 3UR9A 2FI4E 1C1PA 1ZMNA 2BD2A 1WQSA 1LHDH 3NZIA 1DANH 2AMPA 4I8LA 5EJ1A 2KAIA 3P92A 3SU4A 3VB6A 1INCA 4BTTB 1FX0B 8GCHG 2ZFFH 1WYKA 2AERH 2QYIA 3UWIA 4GAWA 4KKDA 4A6LA 4DCDA 1GBAA 3D49H 1IHSH 4ZHAA 1HAXB 1HJAB 1W8BH 3C27B 9LPRA 3EAJA 4ISOA 1MZDA 3BSQA 1O33A 1G3DA 4NCYA 1WU1A 3EQ0H 1UK4A 3OEHD 2FPZA 4MDSA 1G2LA 2UWLA 3CS0A 3TLOA 2SGDE 3RUOA 1BTYA 3U1IB 1FPHH 1FPCH 1ID5H 2WSSD 1VCWA 4DG4A 1EP6A 2J5UA 2F9PA 3RXUA 1HRTH 3GCTF 1CGJE 4NIXA 4GUXA 4U30A 3RXKA 1QIXB 2XW9A 3UY9A 1F5LA 1V2ST 3E8LA 3BTME 2ZTXA 1AI8H 4RI0A 1C5ZB 2YMSC 2Z3CA 4FUJA 3F0PA 3SN8A 5F6MA 5DSFA 3ATMA 5FX6A 1JBUH 3PO1C 1SLXB 4Y6DA 2PSXA 2G55A 5DP7A 1W11U 5CE1A 2ZI2H 2GJGA 3ZZ4A 3KGPA 3TNSA 1NZQH 1YPGH 2BOHB 2ZDLA 3VGCB 1A0JA 2ZIQH 3ZZAA 2JDID 5DP6A 1P04A 1YCPK 2BD7A 2BDAA 4D7GA 2TIOA 3SZNA 3T62A 2BDBA 3ZVGA 2GT8A 1QA7A 3RXVA 1C9PA 1QBNA 4Q7YA 5KGOA 1EZUC 1PPFE 1QA0A 3ZYEA 1CQQA 4JZIA 2JKHA 1HIAA 2RCEA 1ZGVA 1GHBF 2HLCA 1TIOA 2BZAA 1CSOE 3KQBA 1BRBE 3MNCA 3RXSA 4TT3D 1D6RA 2FI5E 1K1OA 1O38A 3UOPA 2XXLA 1IHTH 1MTUA 1QFKH 1SGQE 4I8JA 2AIPA 4I8HA 5FHTA 3KIDU 3GOVB 2G8TA 4D9QA 6ESTA 3HATH 2RA3A 2R2MB 3A7ZA 3LH1A 2A45B 1QJ1B 1BHXF 1MBMA 3M3TA 5GPIB 1YCPM 1TE0A 2BB4A 2WPLS 1UK3A 2BLQA 3KYFA 4O3UA 1VJAU 1GI7B 2Z9JA 2D1JA 1WCZA 3P95A 3K65B 1DPOA 2Y5FA 1KXEA 1TBRH 2EI7A 1MKWK 1K21H 4FVBA 2KM0A 2XTTB 1PFXC 2EC9H 2FI3E 1AU8A 1NU7B 3E0NB 1A61H 5AHGH 2ZDNA 5FL7D 1GVZA 1MTWA 2SGQE 2H5DA 3BIUH 3V0XA 2WPDD 3BEIB 3N7OA 1U6QA 1ZTJA 4MTBA 4JZ1A 2ANMH 1F0SA 4I8KA 4ZHMU 1XVOA 3SUFA 3S9BA 4Y79A 1P12E 2KCPA 3S9AA 2Q6GA 3WW7A 1N1LA 2YNBA 4ZROA 3RM2H 1J14A 1NRRH 1UTMA 1AD8H 2XNDD 3DUXH 3MNXA 1ESTA 3EE7A 2VVVA 2SFAA 2BTCE 1C5RA 3PV4A 1TRYA 2OQ5A 3PV5A 3RXFA 1KLTA 3TJVA 1N6YA 2ZGXH 3ITIA 1Z1JA 3SBKA 1JIMA 1KTTB 3GICB 3OY6U 3QUMP 3QZQA 3VGCC 4MNWA 1C5LH 2ZHEH 3RXPA 2WV4A 4I31A 2LPRA 4ABAA 1NROH 2Z9KA 4ABDA 3GY8A 2GZ7A 4BXWA 5BRRE 1ELCA 1TBZH 1MABB 4SGAE 5TCCA 4LXBH 1NT1A 4WY3A 2WHXA 4NZLA 1HGTH 2ZPSA 1MCTA 1ABJH 3F9HA 2CMYA 1FI8A 1J15A 1EZXC 1TX7A 2QAAA 3PRBA 2BYAX 4NIVA 1W13U 2CGAA 2BLOA 3GDVA 3OAAD 1H8ED 1NBME 2A5AA 1PQAA 2O9QA 3E0PB 2AIQA 2XBWA 2H6MA 2XCNA 1G37A 1F5KU 2STBE 1EFRD 1S84A 1Y3UA 3OU0A 1O3AA 1YM0A 4B73A 2F4LA 2ZDMA 2BMGB 3K2UA 5E2OA 4MPUA 1W3CA 4YTAA 4ASUD 3GY5A 2BLWA 3T29A 1UTQA 5EGMA 5A0CA 2FODA 1O3DA 4I7YH 1W0KD 1O36A 1GJ8B 1SB1H 1YCPH 2GV7A 2ANYA 1EB1H 1IQEA 1Z7KA 3PLKA 2TGAA 2J98B 4X8VH 1BMNH 3O8CA 1OWEA 1XUHA 1B7XB 2W26A 2FTLE 3NCLA 5J4QA 1A46H 1TMBH 5DP9A 1TBQH 2ZU3A 4P02A 3QDZB 1L1JA 4B71A 3I77A 2CF8H 1AE8H 1V2QT 2GT7A 3CENA 3K6ZA 3UQOA 2XWAA 1BUIA 2BY5X 2L74A 4AFQA 3U1JB 2FYRA 2BY8X 5B6LA 3SQEE 2A2QH 2JETC 4UFFH 1TFXA 2ZGJA 4ZKSU 4P00A 2VBCA 1XUIA 1DOJA 4XBBA 1TGCA 3ZIAD 1BIOA 1TQ7B 1ETRH 1TONA 1TB6H 3TU7H 1CA0B 2HNTF 3SU2A 4CREA 5FAHA 3MQKC 2A4OA 1DY9A 5EXNA 2F91A 1TNHA 1GBEA 1GI2A 2PGBB 1TOCB 4BTIB 2FIRH 1BRCE 1MKWH 3BN9A 2TGDA 3PTBA 6GCHF 3V12A 1G3BA 1QL7A 1GDNA 1UVTH 1FDPA 1O5DH 1HLTH 3M61U 1NPMA 1S6HA 1B0FA 3BF6H 2AGEX 1AGJA 2BY6X 1Y59T 2QXJA 4MQAA 4A7IB 1EZQA 1BBRH 1AFQC 4YESB 4E7RG 4O97A 4JZFH 5AFYH 1G30B 2A2XH 4HG6A 2AEIH 5FPTA 4FU9A 2O8TA 2W5EA 1RTKA 1HPGA 1NS3A 5HM9A 4GCHG 2Y5HA 2ZZUH 3F2FA 2GDEH 3DHKH 1SOTA 4THNH 1AWFH 1RGQA 3W1EA 4F4OC 1LPKB 4MNVA 4HTCH 3LGVA 1P2IA 1GBCA 5E0GA 2THFB 1D9IA 1HAYB 5EPYA 5DO4H 2QA9E 3UNRA 2ZQ1A 4YOGA 2FYQA 1O2TA 1IQGA 1C1QA 1FN8A 4MPWA 1DY8A 1C2LA 4GPGA 4UFGH 4Y76A 3PTNA 1BTZA 1IQHA 4WMDA 2Y80A 2PW8H 1QL8A 1SGNE 8LPRA 1C2HA 5DK1A 4CR9A 1GWAA 1V2WT 1G3EA 1UW7A 1E36B 3F2GA 1EAUA 4GLYA 3BTEE 1ZRBA 2BQ7B 1EPTB 4CR5A 3MU0A 4E05H 1FJSA 3M7QA 3VB5A 1FXYA 3DSOA 1LTOA 3UR6A 1T7CA 2FEQH 3KQEA 2H5CA 3VB7A 5EQRA 1Z8JB 1DVAH 5DKMA 1XUKA 2VWNA 3LU9B 2TRMA 4E06H 2KZ4A 4HI3A 3C1KA 1NRSH 1WDIA 5C0UA 3ZVEA 1CA0C 1F7ZA 1VCQA 1TWXB 1MTSA 4AG1A 2BVSH 4H6SB 1V2TT 2GCHG 2FX4A 4BOHA 4K8YA 1M9UA 1T4VH 5EIYA 1D3DB 4DIIH 3P17H 3RC6A 2GGVB 2ODQA 2QF4A 3FFGA 3SJKA 1MAYA 2P93A 2TGPZ 3E6PH 4OS2A 1YWUA 3OX7U 2FOGA 1ZSKA 4YZUA 3LGUA 3FN8A 4WJG2 1NN6A 2BD9A 2QV1A 1C2MA 2H9HA 2BX3A 3BTFE 1O3CA 5DPAA 1DICA 1QJ7B 5GCHF 4AFSA 3DD2H 3LPRA 1DXPA 3SW2B 1HAPH 2OP9A 4CRBA 2PTCE 2RDEA 1O2QA 1V2UT 5DN6D 2V3HH 1ANCA 3PB1E 3SUEA 3A84A 2ZKSA 1SVPA 4UFEH 3UFAA 1CT0E 1TYNA 1J8AA 2ZHFH 1QNJA 2NWNA 5JBBS 4MNXA 1CE5A 1HNEE 3SJ8A 5JBAS 1GL0E 1GJAB 2DE9A 2GCTB 1QBOA 1UTPA 3EGKH 5EW2H 1AKSA 1C2GA 1E0FD 2AMDA 3QZRA 4ISIH 4UONA 5CDFE 2A32A 3BTGE 3QTOH 1DWDH 3RU4E 4CH8B 1MCVA 4JMYA 3FP7E 4X1QU 1OHHD 4GHTA 4X6OA 4U01A 5L2YH 1K1PA 1UHBA 5DP5A 3UWJH 2ZDKA 2A7JA 3GCTG 2VIWA 4FOUC 4ZMAH 1Z6EA 1BTHH 3RXRA 1ZMLA 4X6MA 3HPTB 1GMCF 1S85A 2ZHQH 4Q7XA 4X2VA 3UUZA 5C1XA 1JIRA 3SZEA 3L3TA 1GI8B 3E3TA 4WMEA 2A4RA 1C1SA 1AVXA 1EPTC 1RRKA 1GI0A 1H8DH 3LONA 5G4BA 1W0JD 4DY7B 1WXRA 3S7HB 1GI5A 2ZGHA 1QHRB 3RXAA 6LPRA 1ZOMA 5IK2D 3ELAH 1DWEH 2DE8A 1KXBA 2W3KA 4OS4A 3R0FA 4UFDH 4FUIA 4K5ZA 1WSSH 4X8SH 5TCAA 5EPNA 1LKAA 1OYTH 5KECA 3BV9B 2PP6A 1DITH 2JH0D 4MPVA 5LPEA 1TNKA 3O8BA 1QL9A 4H42U 1TNGA 3KF2A 3L6PA 3URDA 2VGCB 2W7SA 2PSYA 4Y10E 1QY6A 5HM2A 3H5CB 1V2KT 1GHBG 1P3EA 3BIVH 1L4ZA 1BMMH 2UUFB 1BTUA 2ZPRA 1UTKA 3ODDA 1Y8TA 1O3JA 3SJOA 2SNWA 3QTVH 1C2JA 1EP5A 1VCPA 3MFJA 2PKSB 4B6FA 4ZUHA 4B6EA 1AMHA 1C5UA 2B8OH 2QF5A 2K1QA 1LPZB 3QO6A 1HAOH 2P3FH 5AFZH 1FY5A 2BDHA 3BTTE 3E90B 3RXEA 4ZAEA 3U8OH 1A5HA 3SV7A 2PKAB 1TX8A 2BXUH 2W3IA 2HALA 2CHAC 1SI5H 4B1TA 3BTQE 1C1OA 1BTPA 3FANA 1P10A 4MG3A 2B5TB 1YYY1 1PPEE 2LNCA 3SI4H 3QGJA 2ZPQA 4FUFA 3A82A 1LMWB 2KCOA 2SGAA 3BTWE 3TJUA 3A7XA 2HNTC 1O31A 2GCTC 1GI6A 1O3LA 3MWIU 4TPYA 1COWD 4CRCA 1XXDA 3DFLA 1GI1A 1O3FA 4AN7A 4WMFA 3UREA 5FBIA 2SGEE 3VPKA 4KTSA 4RT1A 4K8BA 1DLKB 1PYTD 3B8JA 1GCDA 1W2KH 4ZXXH 2C8YB 1OXGA 1QB9A 4OS7A 1C2DA 1VGCB 2BY7X 4XDEA 2RDLA 3O8RA 1JRSA 5AVDA 2JIZD 1D4PB 1KXCA 1GL1A 3VEQB 1TNIA 1K2I1 2H9EH 2F83A 5L30H 2OXSA 1TQ0B 2ESTE 1BMLA 3W95A 1C5XB 2FZZA 3TH3H 3MO6A 1BA8B 1GGDB 1THPB 2BY9X 3ATKA 5F8XA 3VG8A 4CHAB 3T25A 5KEDA 1C5WB 1O3BA 4CRDA 1Z6JH 4BAMB 2OC1A 1GHAF 5CHAB 1UTLM 1DUAA 1HXEH 1NC6A 1GHWH 4JCNA 4UDWH 4IW4E 1BBRE 2FOEA 1OP8A 2Z6BD 1P2KA 2QGRA 2VINA 3ZZ5A 1F0UA 3SV8A 3D65E 1YC0A 4RKOB 1VR1H 1HJ8A 1MKXH 4JYUH 2VGCC 3TITA 1V2MT 1UTJA 1TRNA 1NO9H 1SGYE 4BTUB 1SOZA 1TABE 2VWLA 1FONA 2FLRH 3GCHB 1MAXA 1WQVH 5EQSA 3E16B 2H9TH 1CHOF 2W6JD 3LT3A 3SGBE 3ZV8A 4D8NA 1EJNA 1JXPA 3LH3A 1CA8B 2PKSC 2ZWLH 1FY4A 4NSYA 3ZZ3A 1D6WA 1ZPZA 4CRGA 3RXTA 4CRAA 3ZV9A 5E8EH 3S0NA 2G4TA 5FBEA 1S83A 2QF0A 2PWXA 4HFPB 2QXGA 2PUXB 3T2NA 5GXPA 4OS1A 8KME2 4WH8A 1T8NA 4MNYA 3FKSD 2GVFA 2A5IA 4FUBA 1IQJA 5A8XA 1AB9C 2RG3A 2ZGBH 3MU1A 3A7VA 3ZZ7A 1HAIH 1K28D 2Z9IA 1DT2A 5F8TA 3SUGA 1SG8B 3STIA 2QN5T 3HGNA 3ZVDA 1MH0A 1SQOA 3PMAB 4AZ2B 5B6OA 2XC0A 1GMHF 4BANB 1YPLH 3UPEA 3ZVCA 4AX9H 1VGCC 2QY0B 1MQ5A 3T27A 2OCVB 2EI6A 3A81A 3SNAA 2P94A 1LHFH 3GDUA 5GJ4B 3B9FH 1QRXA 2NU3E 1JRTA 9ESTA 4IN2A 1YPHC 1GGDC 1AZZA 1HAVB 1HJAC 3V3MA 1RTFB 4CHAC 4AG2A 3MMGA 4ISHH 2R3UA 4BNRA 4UD9H 2D26C 2ZCHP 4AORA 1FNIA 6GCHG 1MZAA 5CHAC 2ZFSA 1HAGE 1CU1A 5L6NH 1NY22 1OKXA 3T28A 3MU8A 4LZ4B 1LVBA 1C5PA 1O2GH 1SFIA 3GY6A 1FLEE 3LGTA 3AASA 2G81E 3FZDA 4VGCB 4INKA 5JPMH 1Y5AT 2NU0E 1GBJA 2UUJB 4XSKU 5LPRA 7KMEH 1W7XH 3UB0A 1QQ4A 4IN1A 4JK6A 3TK6A 3OE7D 4J1YA 2BM2A 1P3CA 4KTCA 4CBOA 3KEEA 4R0IA 1UVPA 2IJOB 2W6ID 1AVWA 3MI4A 5FX5A 2ZCKP 3SU0A 1MQ6A 2BVRH 2JJ1D 3Q3KA 4JYTA 2ZU4A 3GCHC 1E34B 1P57B 2WZQA 2TGTA 3LC3A 2AYWA 3DT0H 5EXMA 3M3VA 2J94A 3M7TA 3RLYH 5SGAE 3HKJB 1O5GH 1QRWA 1FZZA 2OC8A 3IWMA 2A0QB 3ZZ6A 3U98H 1ANDA 4K1TA 1O2OA 1FIWA 3ZZDA 4NWKA 1HDTH 1O5EH 1TRMA 4IMZA 3BG4B 2WINI 1HCGA 1IOEA 1RTLA 1SGIB 2HVYB 1UTOA 3R3GB 3UAIC 2ODPA 2QIQA 5T6FA 2D2DA 1HYLA 3UQVA 1FV9A 3SNEA 2ANWA 1ELVA 1PYTC 1DSTA 3RMOH 1TGNA 1BT7A 2K0QA 1V2PT 4LOYH 3OTJE 1BJUA 1CGIE 1O2SA 1QCPA 2AMQA 2WPJS 5JB8S 3TIUA 3RXDA 2J38A 5T6DA 1A1RA 4AGKA 2DUCA 1SSXA 2CJIA 2Z3DA 2BDIA 4DJZB 1F0TA 4D76A 1GPZA 2CK3D 1K22H 1KDQB 4ZCNA 3GISB 3ZZ9A 1O3GA 1P2JA 4YOIA 1L0ZA 3UOUA 3DFJA 1LQDB 5JBTA 2XWBI 2VH6A 1C4V2 4X6NA 2V35A 2OD3B 3I78A 1O2JA 4KP0A 1CT2E 3PMJA 2J2UA 3SUDA 3FOAA 3KQ5A 1SGCA 2ZO3H 1ELEE 3GDSA 5EJLA 1KYNA 1O3PB 2JH5D 2ZF0H 2HVXA 2EI8A 2Y81A 3BTDE 4H4FA 5F53A 1BITA 1GVKB 2EQNA 3P8OA 1O3NA 2KCYA 5GCHG 4VGCC 2XNIA 1BQYA 1WBGB 2HPQH 1KY9A 1EKBB 1YGCH 2WUBA 1SGTA 3GCNA 1ZSLA 5ESTE 2ZQ2A 3NKKA 3TK5A 1IQKA 1HUTH 1ELTA 3A86A 1T32A 3PLBA 3SU1A 1EJMA 2WYGA 1HFDA 1FIZA 1AE5A 4YLQH 4LZ1H 4DT4A 4DT7B 1DX5M 4TWWA 3A89A 4BAOB 1GCTB 3TVJB 4ABGA 3BG4C 3OEED 1TMUH 1TAWA 1BDAA 1LCYA 3AVZA 3RXJA 4Y8XA 2KAIB 3SGQE 3V7TA 3F3BA 2FOMB 2FOFA 5PTPA 1A5IA 2HPPH 3ZZCA 2VVCA 1GVLA 3TJOA 1GMCG 3LGIA 2CV3A 2BZ6H 3PMHB 1O2ZA 1SLUB 1T8MA 3GYMA 4FU7A 4YT7H 1H8IH 5T1VA 1SLVB 3WWBA 2ASUB 4IC6A 4ZKRU 3F1SB 1O32A 2VWOA 1NM6A 2Q6DA 3RLWH 1ARBA 5ABWA 5FPYA 2ZTYA 2G00A 4AB8A 1Y3WA 4AGJA 1CBWB 1SL3A 1L1GA 1Y3YA 5F03A 4AC9A 2IN2A 1ANBA 1QRZA 4BAHB 3TNTA 3RXGA 3I29A 2WUCA 1ABIH 1XM1A 5DP8A 3KQCA 4FETA 1DSUA 4X8UH 2LP6A 1OPHB 2A1DB 1ZYOA 1O3KA 2F9VA 5EJZA 4TY6A 1O5FH 1O2KA 1LHGH 1LKBA 2V7QD 3DCLA 3ESTA 1MUEB 2V3MA 1K1MA 2Q1JA 1K9OE 1K1IA 5JB9S 1ZJDA 3HK3B 4K3JA 8ESTE 1AN1E 2ZP0H 3MU5A 4K69A 2ZDAH 1PQ5A 1HAHH 5EW1H 1C5MD 2W7UA 3NUMA 1C1TA 2BVXH 1BZXE 1GBBA 5LPFA 1AIXH 1SGFG 4INHA 1H1BA 1BRUP 1HIAB 1YF4A 4X1RU 3DA9B 1P0SH 1SMFE 2EY4C 2AGIX 4ISLA 3ZZ8A 1F5RA 5E0HA 1P2OA 3PYHA 2VVUA 4OM9A 4NSVA 3P70B 1UVUH 1C4Y2 3Q76A 2SGPE 4OS6A 1PPBH 1GCTC 1C5SA 1DM4B 4AB9A 2CXVA 2V3OH 4Q80A 4X2WA 1P02A 1K1JA 1C2IA 1CVWH 1DUEA 3M37A 1ETSH 4PROA 4U32A 3VXEH 2ALPA 3PM3A 3PROA 2ILNA 1F2SE 4DGJA 4JZDH 4F48B 3M36A 1JMOH 3IITA 4TPIZ 5C5NA 1NFYA 1AUJA 7ESTE 3V13A 1CGHA 1IAUA 3A7TA 2ANKH 1O2WA 4K60A 4A1VA 1WOFA 1C2FA 2FM2A 1EB2A 1ELFA 1GHAG 3LOXA 5CMXH 1TGBA 2XRCA 3MH5A 2QF3A 5HIYA 1YPKH 3ODFA 3SV6A 1HB0B 1PPGE 2J95A 3SORA 3NRLA 1VITF 3UNQA 2BD8A 2PUQH 2F9OA 3T26A 1O3OA 1ARCA 1CBWC 2FS8A 2GDDA 4ZHLU 4RSPA 1W12U 2A4QA 3MH4A 3RMNH 2FLBH 1K1NA 1ZLRA 1YPEH 3A88A 1FQ3A 3CNRA 5A2MH 1NU9A 1CHOG 1W10U 3AW0A 4MLFB 2PHBA 3OFND 1GMDF 3M3SA 4H6TA 2G52A 1OP2A 3W94A 1SC8U 3GS9A 1DE7H 1SQAA 5C94A 5F8ZA 1ANEA 1IQLA 3F6UH 2YNAA 2UUYA 1GI9B 1T8OA 1J17T 1S6FA 5HIZA 2B9LA 1SBWA 1DXWA 2BDCA 5ESBA 3H7OA 4I86A 2IJD1 5EQQA 1RJXB 4ABHA 2G4UA 4NA9H 2JJ2D 2CF9H 1T8LA 4OGYA 4BAKB 1TALA 1TPOA 2ZEBA 2R0LA 1Y3XA 2OBOA 2ZDVH 3FZZA 3WWFA 1D3TB 1LPGB 2EEKA 4INLA 1A5GH 2F9BH 5BPEA 3LKWA 4M9FA 4X8TH 1GJCB 3Q77A 3NPSA 1W0ZU 4O9VA 1UJ1A 4YLUA 2STAE 1E35B 2J98A 2Z3EA 4FUDA 1XKAC 2OLGA 1C1MA 2FO9A 2OTVA 3P8NA 1GMHG 1ZHRA 4K1SA 3EE0B 5DJ7A 4YOJA 1P11E 4GSOA 4AYVB 2H2ZA 1A0LA 1Z8RA 4OS5A 2RA0A 1P2NA 1ZJKA 1ACBE 1SGEE 1QBVH 4TYDA 3RXIA 4BAQB 1SQRA 1TOMH 3MH7A 3GCOA 2ZFTA 3SU5A 3IG6B 1EAXA 1P9SA 1WAYB 1YPJH 2ZU5A 3GY3A 3NWUA 2J34A 2A5KA 3PWCA 1QTFA 3EA9A 1CO7E 4JK5A 3F9FA 3H09A 4Y7BA 1OS8A 1FUJA 1OWJA 3AW1A 1NBMD 3U8RH 4Y0ZE 5T3HA 3RXQA 1GBKA 2GV6A 1UCYK 1VKYA 1AWHB 1V2NT 4WF8A 1EZSC 1NRNH 3S7KB 5A8ZA 2FWWA 2HNTE 3F9EA 3LIWA 1EQ9A 3AAVA 4LK4A 1H8HD 4I32A 3SO3A 1D3PB 2UWOA 1AFEH 3A8CA 3PRDA 4X1SU 4X6PA 1HJ9A 4DURA 2NU1E 1GBFA 3ZZBA 4RN6A 1TPSA 2PFEA 3UNSA 4DVAU 3SI3H 2ZFRH 2LELA 2FOCA 1QJ6B 2Q6FA 1QQUA 5C17A 2FESH 3SOSA 1AHTH 1O5CB 1O37A 1C5QA 3SHCH 2GP9B 2I6QA 2KX4A 4Q2KA 4NWLA 2J92A 1O2MA 4HZHA 1O0DH 2RFKC 1O2YA 2B7DH 2OUAA 3DSPA 1AUTC 1BB0B 4ABFA 4CBNA 4ABBA 4WH6A 4XE4A 2B0FA 2ZCLP 4WXVA 2F9NA 4O03A 5T6GA 4IC5A 2M2AA 4M7GA 1GDQA 4Q63A 4Z6AH 7LPRA 1OWIA 5LGOA 1Q2WA 1C5YB 1P01A 1CHGA 3SNDA 1O2IA 1FY3A 1H9LB 1B0EA 1C5VA 4OGXA 1Z71A 3LJOA 1V2VT 5FCRA 1C1RA 5ETXA 3B23B 2ZU2A 4A1TA 1EPTA 4SGBE 1E1RD 1ELDE 4IS5A 1NTPA 4Y7AA 3KL6A 1TGTA 2SNVA 2A7HA 3M5NA 2OC7A 1E38B 3KQDA 5H4IB 1YP9A 1FAXA 5C0TA 4Z0KA 3M7UA 2AHME 2P3TB 2HLDD 4ASHA 2P3UB 3VB3A 1PPZA 3RP2A 5GNDA 3M5LA 3EA8A 4FVDA 4D9RA 3KHVA 1K0HA 1Z8GA 4FUCA 1O3HA 3UTUH 4B75A 3ZVBA 1P09A 3F9GA 2GZ8A 2QXHA 1EATA 3A80A 3FP8E 3FVFB 4B2CA 1C5TA 2BX4A 1E79D 3G01A 5EODA 1EOLA 1F0RA 3PLPA 2FP7B 3TK9A 1GBIA 2J4IA 2K8IA 7GCHF 3FP6E 1TLDA 2Z94A 4MVNA 1KXAA 1C9TA 2XCFA 1GJ7B 5A0BA 1P8VC 4UEHH 2GTBA 2UWPA 1GHZA 1K1LA 2BDYA 2VNTA 1ESAA 1H9IE 1YLNA 3SGAE 2ALVA 1O30A 1CT4E 4ZKNU 1QURH 1RFNA 2HGTH 3ENSB 3RMLH 4BXSA 5A8YA 3M35A 3BEUA 4IBLH 2PGQB 1KXFA 4Y0YE 2D8WA 1YPHE 3RDZA 2O8WA 2KR7A 1O3MA 1XX9A 1O39A 2HWLB 1UCYH 2P59A 3TGKE 5DP3A 2ODYB 2V0BA 3U69H 2GX4A 1BOQA 3QGNB 2C4FH 1BBRK 2OBQA 3VXFH 1ETTH 2JETB 2XOKD 3P8FA 3GYLB 3MHWU 4DIHH 1O2VA 1SGDE 1QGFA 1KIGH 2PR3A 4ZH8A 5L2ZH 2ZGCA 4E7NA 1AKSB 3U9AH 5IDKA 8GCHF 1YLCA 4NZQA 1O3EA 2F3CE 2PV9B 3QK1A 1QR3E 4O3TA 4YM9A 1LQEA 4WXIA 1NESE 1LO6A 1MBQA 3RMMH 3MO9A 5HKKD 4XBDA 5HXFA 1UHBB 4ABJA 2HOBA 4XBCA 2BDGA 3LGWA 1SHYA 2BQWB 1TNJA 4I33A 3SNCA 2GMTB 2BD4A 3UIRA 3QX5H 1O5AB 1YKTA 1L4DA 3K9XB 1HBTH 2AH4X 3L33A 4X1PU 1S5SA 3A83A 4TWYA 1BTWA 1AFQB 1AQ7A 1O2NA 2ZA5A 1GBMA 4ZXYH 3STJA 4NIYA 4RKJB 2FTMA 3BG8A 1ZGIA 3N99A 3TH2H 2FXRA 3KYGA 1L1NA 1S6LA 4YT6H 2P8OB 1J9CH 1SQTA 1GG6B 2J9NA 4CRFA 1Y3VA 2WPIS 4RT0A 1UVOA 1GHYH 1YBWA 3SV2H 1THRH 1RXPA 4ABIA 5C3NA 1GBDA 2NU4E 2BOKA 2ZHDA 3RU4D 3RU4T 1SR5C 1GJDB 2IPQX 4A92A 5I46H 1EOJA 1GBLA 3Q3XA 3AK5A 4KELA 1ZZZA 3SU6A 1TPPA 3A85A 3LC5A 1WUNH 1Z8IB 2C3SA 2PKAA 1E1QD 2FOAA 3Q00A 2YOLA 3S69A 4DOQA 1PQ7A 1UTNA 2F43B 1PPHE 1GJBB 1SPJA 2TPIZ 1HV7A 1Y5UT 2UUKB 1C5OH 2KCAA 3LGYA 5A0AE 1GJ4H 5HGGA 1Z1IA 1BJVA 4CH2B 1XUGA 6CHAB 1S0RA 4KTUA 4ACAA 1W14U 1A2CH 1B5GH 5DGJA 4Y71A 4I8GA 3QWCH 2QXIA 4FU8A 3E91A 3KN2A 1KXDA 1MU8B 1A3EH 5AF9H 1KTSB 2VU8E 1G3CA 3HK6B 1BMFD 3RC5A 1ELAA 1GI3A 3NXPA 1OX1A 2A7CA 1QB1A 2FOBA 2NU2E 3F2HA 1EUFA 1C2EA 1OOKB 3AAUA 1T4UH 4NGAH 4ISNA 3MOCA 5GWZA 1BHXB 2VIVA 2OK5A 3P8GA 1DFPA 1FY8E 1VITG 5FPSA 4B76A 1MTNB 1G2MA 4WWYA 2ZU1A 2VIDA 3F0OA 2ZC9H 1ZHMA 1P9UA 1LHCH 1IQFA 1BRAA 1N8OB 2WPKS 4QT8C 4X1NU 1MD8A 1Y5BT 1J16A 2BLVA 2GMTC 3NK8A 2XC5A 2BXTH 2Z9LA 1V2JT 3QN7A 1OSSA 4J2YB 1RIWB 1KLIH 1X7AC 2FX6A 1C1UH 1UO6A 4D7FA 4K1EA 4Y11E 1DWBH 1LVYA 3VB4A 1YLDA 2OINA 3HKIB 5EOKA 2VIPA 1ZPBA 3SJ9A 2Y7ZA 3TGIE 4DW2U 1LDTT 2R0KA 1ELBA 2FOHA 5I25A 1GMDG 1NFWA 2Z7FE 3SV9A 1P2QA 1DLEA 2P8OC 3TPIZ 1ZRKA 2VH0A 1V2LT 3A8AA 1OWDA 3EYDA 4AYYB 1C1VH 3E1XB 4U2WA 3RXOA 1GG6C 1TA6A 1OP0A 2QCYA 2VIQA 3GY2A 1D3QB 3PMBB 2ZECA 3D23A 5K7RA 2PTNA 1FN6A 2GKVE 1EX3A 4YXWD 2BQ6B 1P06A 2VIOA 1A4WH 1TGSZ 2G5NA 2ZNKH 1C2KA 1EAWA 1KMHB 5C67A 4K2YA 1V2OT 1Q31A 5FCKA 3RXBA 1UMAH 1GJ6A 1VZQH 4ACBA 1E37B 1OWHA 1RS0A 5EG4A 1TPAE 5IYTA 5A09A 5HYOA 3SNBA 1O3IA 1GJ9B 1NRQH 1WV7H 1XUJA 3HGPA 3MO3A 4AOQA 4X2XA 1G36A 2J97A 3KNXA 1ORFA 6CHAC 2C90B 4NA8A 1BMAA 1YPMH 1SKYE 2M5TA 2BD5A 5JDUB 3MU4A 1GHXH 2XYAA 2R9PA 3U8TH 4TY7A 4IMQA 1GI4A 1IQMA
chains in the Genus database with same CATH topology
1O34A 1G9IE 1LVMA 3BTHE 3ZVFA 2ZFPH 1GJ5H 2WYJA 5JYIA 2WV5A 5E0JA 2PLXA 1AO5A 1V6DA 3RM0H 1AY6H 1JWTA 2GZ9A 2I6SA 5DP4A 5EU8A 4ABEA 1S82A 1EASA 1HAZB 1JOUB 3SQHE 3H7TA 2IPHA 1A3BH 2Y82A 2ULLA 3MNBA 1XVMA 2AFQB 4A1XA 2C8ZB 1HAVA 1UK2A 3SJIA 2O8UA 1GDUA 3JZ1B 4X0WU 1MTNC 1P2MA 1SGFA 3LJJA 4R8TB 1ZR0A 4O9VA 1SGPE 3MTYA 3MYWA 2R2WU 2XBVA 4KGAA 1UVSH 1O5BB 3A7WA 3QLPH 1ZSJA 1N8OC 3OY5U 3K6YA 3ZYDA 3M5MA 2QC2A 1P05A 5GDSH 5JBCS 1BCUH 1DS2E 1QB6A 2A31A 3TJNA 1ZTKA 3JZ2B 1RIWC 3BTKE 1ELGA 1FMGA 4AFZA 3F68H 4XFQA 4YO9A 1O2XA 5TJXA 1S0QA 2G5VA 2GD4B 3Q3YA 2CHAB 1XKBC 1MU6B 5C1UA 4F49A 2P16A 1GBTA 1O2UA 5C20A 1SFQB 3RXHA 1V3XA 3MH6A 1N6XA 1RD3B 1XXFA 4ZKOU 4NG9H 1UCYE 1ZMJA 5C5OA 1VITH 3P6ZB 2WPMS 1XMNB 1G32B 3RXMA 1DWCH 3A7YA 1BTXA 3GY7A 3ATLA 3PWBA 4MPXA 3SHAH 3TGJE 1A0HB 2C8WB 4NA7A 2G51A 5C1YA 2FDAA 3ATIA 4Y8YA 3LDXH 3URCA 1WTGH 3GY4A 1T31A 1HXFH 3M5OA 4B74A 1W0YH 1FAKH 4NFEA 1EAIA 1O35A 2IOTA 1SGRE 1MKXK 5FXLA 2FMJA 1NRPH 4JYVH 1C1NA 1THSH 4GCHF 4B2BA 2XBYA 2R3YA 1MD7A 1WTHD 2FS9A 1AZ8A 3SU3A 4GVUA 3ATWA 2VB0A 3CP7A 1V2RT 4FUEA 2F9UA 1TMTH 2O8LA 1IQNA 4GHQA 1L2EA 1DDJA 1A7SA 1LHEH 2Y6TA 1O2PA 3MNSA 4IGDA 2XC4A 1Q3XA 2WPHS 4Q7ZA 1TA2A 1F92A 1EJAA 3RXCA 4XOJA 4A5TS 1LVOA 1MTVA 1AVGH 1KDQA 5C2ZA 1P03A 2C93B 5GIBA 4ESTE 2V6NA 4NIWA 3CS7A 2CN0H 2SGFE 1H9HE 2ZFQH 1SLWB 1W7GH 3A87A 1SHHB 1PQ8A 2ZHWH 4NFFA 4FUGA 3S9CA 2HRVA 3EA7A 3D62A 2OQUA 2AGGX 2VWMA 1S81A 4JZEH 2O8MA 3TH4H 3PO1B 1MMJN 1ZPCA 2Z9GA 3OSYA 4WVPE 3ZVAA 2Y7XA 1FY1A 1XUFA 3BEFB 4Y8ZA 1OYQA 7GCHG 1ZTLA 1GHVH 2TBSA 2ZTZA 5DG6A 1TX6A 4FUHA 1KLJH 2OC0A 4FXGH 3VFEA 3FAOA 5LH8A 5J4SA 3RXLA 1EXFA 2H1UA 1IQIA 2Y5GA 5HMAA 5K0HA 4X2YA 1KSNA 3OYPA 5E2PA 1PJPA 2EA3A 3T5FH 1NFXA 1PPCE 2GCHF 2AS9A 2ZG0H 1C4U2 2P95A 1VJ9U 2JH6D 4UE7H 1AB9B 1O2RA 2VJ1A 4HGCA 2C8XB 2BHGA 1O2HA 3KCGH 5EXLA 2BD3A 3O8DA 4AFUA 4B2AA 1ESBA 1C1WH 1OWKA 1NFUA 1ZHPA 3A8DA 3A8BA 3EDXB 1TNLA 3RC4A 1GBHA 1H4WA 3WY8A 1C5NH 1O2LA 2A4GA 2XBXA 3UR9A 2FI4E 1C1PA 1ZMNA 2BD2A 1WQSA 1LHDH 3NZIA 1DANH 2AMPA 4I8LA 2KAIA 3P92A 3SU4A 3VB6A 1INCA 4BTTB 8GCHG 2ZFFH 1WYKA 2AERH 2QYIA 3UWIA 4GAWA 4KKDA 4A6LA 4DCDA 1GBAA 3D49H 1IHSH 4ZHAA 1HAXB 1HJAB 1W8BH 3C27B 9LPRA 3EAJA 4ISOA 1MZDA 3BSQA 1O33A 1G3DA 4NCYA 1WU1A 3EQ0H 1UK4A 2FPZA 4MDSA 1G2LA 2UWLA 3CS0A 3TLOA 2SGDE 3RUOA 1BTYA 3U1IB 1FPHH 1FPCH 1ID5H 1VCWA 4DG4A 1EP6A 3RXUA 2F9PA 1HRTH 3GCTF 1CGJE 4NIXA 4GUXA 4U30A 3RXKA 1QIXB 2XW9A 3UY9A 1F5LA 1V2ST 3E8LA 3BTME 2ZTXA 1AI8H 1C5ZB 2Z3CA 4FUJA 5F6MA 3SN8A 3ATMA 5FX6A 1JBUH 3PO1C 1SLXB 4Y6DA 2PSXA 2G55A 5DP7A 1W11U 5CE1A 2ZI2H 3ZZ4A 3KGPA 3TNSA 1NZQH 1YPGH 2BOHB 2ZDLA 3VGCB 1A0JA 2ZIQH 3ZZAA 5DP6A 1P04A 1YCPK 2BD7A 2BDAA 4D7GA 2TIOA 3SZNA 3T62A 2BDBA 3ZVGA 2GT8A 1QA7A 3RXVA 1C9PA 1QBNA 4Q7YA 1EZUC 1PPFE 1QA0A 3ZYEA 1CQQA 4JZIA 2JKHA 1HIAA 2RCEA 1ZGVA 1GHBF 2HLCA 1TIOA 2BZAA 1CSOE 3KQBA 1BRBE 3MNCA 3RXSA 1D6RA 2FI5E 1K1OA 1O38A 3UOPA 2XXLA 1IHTH 1MTUA 1QFKH 1SGQE 4I8JA 2AIPA 4I8HA 5FHTA 3KIDU 3GOVB 2G8TA 4D9QA 6ESTA 3HATH 2RA3A 2R2MB 3A7ZA 3LH1A 2A45B 1QJ1B 1BHXF 1MBMA 3M3TA 5GPIB 1YCPM 1TE0A 2BB4A 2WPLS 1UK3A 2BLQA 4O3UA 1VJAU 1GI7B 2Z9JA 2D1JA 1WCZA 3P95A 3K65B 1DPOA 2Y5FA 1KXEA 1TBRH 2EI7A 1MKWK 1K21H 4FVBA 2XTTB 1PFXC 2EC9H 2FI3E 1AU8A 1NU7B 3E0NB 1A61H 5AHGH 2ZDNA 1GVZA 1MTWA 2SGQE 2H5DA 3BIUH 3V0XA 3BEIB 3N7OA 1U6QA 1ZTJA 4MTBA 4JZ1A 2ANMH 1F0SA 4I8KA 4ZHMU 1XVOA 3SUFA 3S9BA 4Y79A 1P12E 3S9AA 2Q6GA 1N1LA 2YNBA 4ZROA 3RM2H 1J14A 1NRRH 1UTMA 1AD8H 3DUXH 3MNXA 1ESTA 2VVVA 2SFAA 2BTCE 1C5RA 3PV4A 1TRYA 2OQ5A 3RXFA 1KLTA 3TJVA 1N6YA 2ZGXH 3ITIA 1Z1JA 3SBKA 1JIMA 1KTTB 3GICB 3OY6U 3QUMP 3QZQA 3VGCC 4MNWA 1C5LH 2ZHEH 3RXPA 2WV4A 4I31A 2LPRA 4ABAA 1NROH 2Z9KA 4ABDA 3GY8A 2GZ7A 4BXWA 5BRRE 1ELCA 1TBZH 4SGAE 5TCCA 4LXBH 1NT1A 4WY3A 4NZLA 1HGTH 2ZPSA 1MCTA 1ABJH 3F9HA 2CMYA 1FI8A 1J15A 1EZXC 1TX7A 2QAAA 2BYAX 4NIVA 1W13U 2CGAA 2BLOA 3GDVA 2A5AA 1PQAA 2O9QA 3E0PB 2AIQA 2XBWA 2H6MA 2XCNA 1G37A 1F5KU 2STBE 1S84A 1Y3UA 3OU0A 1O3AA 1YM0A 4B73A 2ZDMA 2BMGB 3K2UA 5E2OA 4MPUA 1W3CA 4YTAA 3GY5A 2BLWA 3T29A 1UTQA 5EGMA 5A0CA 2FODA 1O3DA 4I7YH 1O36A 1GJ8B 1SB1H 1YCPH 2GV7A 2ANYA 1EB1H 1IQEA 1Z7KA 3PLKA 2TGAA 4X8VH 1BMNH 3O8CA 1OWEA 1XUHA 1B7XB 2W26A 2FTLE 3NCLA 5J4QA 1A46H 1TMBH 5DP9A 1TBQH 2ZU3A 3QDZB 1L1JA 4B71A 3I77A 2CF8H 1AE8H 1V2QT 2GT7A 3CENA 3K6ZA 3UQOA 2XWAA 1BUIA 2BY5X 4AFQA 3U1JB 2FYRA 2BY8X 3SQEE 2A2QH 2JETC 4UFFH 1TFXA 2ZGJA 4ZKSU 1XUIA 1DOJA 4XBBA 1TGCA 1BIOA 1TQ7B 1ETRH 1TONA 1TB6H 3TU7H 1CA0B 2HNTF 3SU2A 4CREA 5FAHA 2A4OA 1DY9A 5EXNA 2F91A 1TNHA 1GBEA 1GI2A 2PGBB 1TOCB 4BTIB 2FIRH 1BRCE 1MKWH 3BN9A 2TGDA 3PTBA 6GCHF 3V12A 1G3BA 1QL7A 1GDNA 1UVTH 1FDPA 1O5DH 1HLTH 3M61U 1NPMA 1S6HA 1B0FA 3BF6H 2AGEX 1AGJA 2BY6X 1Y59T 2QXJA 4MQAA 4A7IB 1EZQA 1BBRH 1AFQC 4YESB 4E7RG 4O97A 4JZFH 5AFYH 1G30B 2A2XH 2AEIH 5FPTA 4FU9A 2O8TA 2W5EA 1RTKA 1HPGA 1NS3A 5HM9A 4GCHG 2Y5HA 2ZZUH 2GDEH 3DHKH 1SOTA 4THNH 1AWFH 1RGQA 4F4OC 1LPKB 4MNVA 4HTCH 3LGVA 1P2IA 1GBCA 5E0GA 2THFB 1D9IA 1HAYB 5EPYA 5DO4H 2QA9E 3UNRA 2ZQ1A 4YOGA 2FYQA 1O2TA 1IQGA 1C1QA 1FN8A 4MPWA 1DY8A 1C2LA 4GPGA 4UFGH 4Y76A 3PTNA 1BTZA 1IQHA 4WMDA 2Y80A 2PW8H 1QL8A 1SGNE 8LPRA 1C2HA 5DK1A 4CR9A 1GWAA 1V2WT 1G3EA 1E36B 1EAUA 4GLYA 3BTEE 1ZRBA 2BQ7B 1EPTB 4CR5A 3MU0A 4E05H 1FJSA 3M7QA 3VB5A 1FXYA 1LTOA 3UR6A 1T7CA 2FEQH 3KQEA 2H5CA 3VB7A 5EQRA 1Z8JB 1DVAH 5DKMA 1XUKA 2VWNA 3LU9B 2TRMA 4E06H 4HI3A 3C1KA 1NRSH 3ZVEA 1CA0C 1F7ZA 1VCQA 1TWXB 1MTSA 4AG1A 2BVSH 4H6SB 1V2TT 2GCHG 2FX4A 4BOHA 4K8YA 1M9UA 1T4VH 1D3DB 4DIIH 3P17H 3RC6A 2GGVB 2ODQA 3FFGA 3SJKA 1MAYA 2P93A 2TGPZ 3E6PH 4OS2A 3OX7U 2FOGA 1ZSKA 4YZUA 3LGUA 4WJG2 1NN6A 2BD9A 2QV1A 1C2MA 2H9HA 2BX3A 3BTFE 1O3CA 5DPAA 1DICA 1QJ7B 5GCHF 4AFSA 3DD2H 3LPRA 1DXPA 3SW2B 1HAPH 2OP9A 4CRBA 2PTCE 1O2QA 1V2UT 2V3HH 1ANCA 3PB1E 3SUEA 3A84A 2ZKSA 1SVPA 4UFEH 3UFAA 1CT0E 1TYNA 1J8AA 2ZHFH 1QNJA 2NWNA 5JBBS 4MNXA 1CE5A 1HNEE 3SJ8A 5JBAS 1GL0E 1GJAB 2DE9A 2GCTB 1QBOA 1UTPA 3EGKH 5EW2H 1AKSA 1C2GA 1E0FD 2AMDA 3QZRA 4ISIH 4UONA 2A32A 3BTGE 3QTOH 1DWDH 3RU4E 4CH8B 1MCVA 4JMYA 3FP7E 4X1QU 4GHTA 4X6OA 4U01A 5L2YH 1K1PA 1UHBA 5DP5A 3UWJH 2ZDKA 2A7JA 3GCTG 2VIWA 4ZMAH 1Z6EA 1BTHH 3RXRA 1ZMLA 4X6MA 3HPTB 1GMCF 1S85A 2ZHQH 4Q7XA 4X2VA 3UUZA 5C1XA 1JIRA 3L3TA 1GI8B 3E3TA 4WMEA 2A4RA 1C1SA 1AVXA 1EPTC 1RRKA 1GI0A 1H8DH 3LONA 5G4BA 4DY7B 3S7HB 1GI5A 2ZGHA 1QHRB 3RXAA 6LPRA 1ZOMA 3ELAH 1DWEH 2DE8A 1KXBA 2W3KA 4OS4A 3R0FA 4UFDH 4FUIA 4K5ZA 1WSSH 4X8SH 5TCAA 5EPNA 1LKAA 1OYTH 3BV9B 1DITH 2JH0D 4MPVA 5LPEA 1TNKA 3O8BA 1QL9A 4H42U 1TNGA 3KF2A 3L6PA 3URDA 2VGCB 2W7SA 2PSYA 4Y10E 1QY6A 5HM2A 3H5CB 1V2KT 1GHBG 1P3EA 3BIVH 1L4ZA 1BMMH 2UUFB 1BTUA 2ZPRA 1UTKA 3ODDA 1Y8TA 1O3JA 3SJOA 2SNWA 3QTVH 1C2JA 1EP5A 1VCPA 3MFJA 2PKSB 4ZUHA 1AMHA 1C5UA 2B8OH 2K1QA 1LPZB 3QO6A 1HAOH 2P3FH 5AFZH 1FY5A 2BDHA 3BTTE 3E90B 3RXEA 4ZAEA 3U8OH 1A5HA 3SV7A 2PKAB 1TX8A 2BXUH 2W3IA 2HALA 2CHAC 1SI5H 4B1TA 3BTQE 1C1OA 1BTPA 3FANA 1P10A 4MG3A 2B5TB 1YYY1 1PPEE 2LNCA 3SI4H 3QGJA 2ZPQA 4FUFA 3A82A 1LMWB 2SGAA 3BTWE 3TJUA 3A7XA 2HNTC 1O31A 2GCTC 1GI6A 1O3LA 3MWIU 4TPYA 4CRCA 1XXDA 3DFLA 1GI1A 1O3FA 4AN7A 4WMFA 3UREA 5FBIA 2SGEE 3VPKA 4KTSA 4K8BA 1DLKB 1PYTD 3B8JA 1GCDA 1W2KH 4ZXXH 2C8YB 1OXGA 1QB9A 4OS7A 1C2DA 1VGCB 2BY7X 4XDEA 2RDLA 3O8RA 1JRSA 5AVDA 1D4PB 1KXCA 1GL1A 3VEQB 1TNIA 1K2I1 2H9EH 2F83A 5L30H 2OXSA 1TQ0B 2ESTE 1BMLA 3W95A 1C5XB 2FZZA 3TH3H 3MO6A 1BA8B 1GGDB 1THPB 2BY9X 3ATKA 5F8XA 4CHAB 3T25A 1C5WB 1O3BA 4CRDA 1Z6JH 4BAMB 2OC1A 1GHAF 5CHAB 1UTLM 1DUAA 1HXEH 1NC6A 1GHWH 4JCNA 4UDWH 4IW4E 1BBRE 2FOEA 1OP8A 2Z6BD 1P2KA 2QGRA 2VINA 3ZZ5A 1F0UA 3SV8A 3D65E 1YC0A 4RKOB 1VR1H 1HJ8A 1MKXH 4JYUH 2VGCC 3TITA 1V2MT 1UTJA 1TRNA 1NO9H 1SGYE 4BTUB 1SOZA 1TABE 2VWLA 1FONA 2FLRH 3GCHB 1MAXA 1WQVH 5EQSA 3E16B 2H9TH 1CHOF 3SGBE 3LT3A 3ZV8A 4D8NA 1EJNA 1JXPA 3LH3A 1CA8B 2PKSC 2ZWLH 1FY4A 4NSYA 3ZZ3A 1D6WA 1ZPZA 4CRGA 3RXTA 4CRAA 3ZV9A 5E8EH 3S0NA 2G4TA 5FBEA