1O2QA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2qA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2qA02
4WMEA 1GHAG 1IQKA 5E0HA 3M5LA 4X8VH 5T6DA 1GHBG 4Y8ZA 1S84A 1CA0C 1JBUH 4DG4A 2UUFB 1A3EH 1TRMA 4CRCA 1GI2A 1Z1IA 3QO6A 1QQUA 4X6MA 2VIWA 4Y0ZE 1KXBA 4HGCA 4K8BA 1P05A 3PV4A 2PKSC 3ZZ4A 4I31A 3RXDA 3BEFB 1V2OT 4MVNA 2XYAA 1OOKB 5C2ZA 1CE5A 1A2CH 4XBBA 4CH8B 3SU2A 3LJJA 1MZDA 3UUZA 1GJBB 2XXLA 5EXNA 2ZKSA 1DOJA 2HPQH 1HAPH 3A80A 1FI8A 2BY7X 4JYUH 3BEUA 2PR3A 1IQEA 1IQMA 1TBZH 2AIPA 2WV5A 3TGKE 3KQCA 3T29A 1ETTH 2IOTA 1AN1E 5DKMA 2I6SA 3EA9A 4Y11E 3ZZCA 1MAYA 3VXEH 2GZ7A 3A7YA 3E91A 5L2YH 2JETB 1O3NA 5DO4H 1EASA 1UO6A 2QCYA 3RXLA 4FXGH 3V12A 2R3YA 2ZHDA 5DGJA 3VEQB 4B2CA 1GJDB 2FX6A 8LPRA 2AH4X 2RCEA 1BB0B 5ETXA 4ZROA 1D6WA 3FZDA 3GICB 1THSH 1ZHMA 2STBE 4NSYA 1C1QA 1M9UA 1JRSA 4DCDA 3SUEA 2ULLA 1PJPA 2P94A 1JWTA 1ZPZA 4GCHG 1MTWA 2Z3EA 1ELGA 1XVOA 1RXPA 5A09A 1DUAA 4DIIH 2BY6X 3TU7H 1HUTH 1G37A 2A2XH 3LH3A 1W7XH 1Y3UA 2ZF0H 2ALPA 1QRXA 2EI7A 1QL8A 3RDZA 1MTSA 2VB0A 1GMDG 3ODFA 3A85A 3ATWA 1ZZZA 2VU8E 1OP0A 3VB7A 1ABJH 1SGTA 1S85A 4GSOA 4RKJB 3ESTA 2FESH 3OYPA 1WTHD 4AG2A 5C1UA 5BRRE 1GBLA 4X1PU 5DG6A 3NCLA 4YT6H 4KKDA 1QA0A 4TPIZ 1O2XA 1UVUH 1Z8IB 4UFEH 1U6QA 3K2UA 1XUIA 8GCHF 1S6HA 2Y5GA 1AI8H 3LGIA 1N6YA 1TYNA 2FDAA 2PWXA 2V35A 4AOQA 2J95A 4TYDA 4KTUA 4XBCA 1FY4A 5HM2A 1GI7B 2VWLA 1K1OA 1LPGB 4H6SB 4U01A 5GCHG 1O3HA 1K1PA 2V3HH 2ZIQH 3BTFE 4I8HA 1DFPA 1YCPM 2FYRA 4K1TA 1T32A 4ZKSU 2ZCLP 2BM2A 1C1PA 1WBGB 1AB9B 1KIGH 2HVXA 1L4ZA 1O2GH 3A8AA 2VVVA 2ANMH 2VVCA 1FY1A 1EATA 2H2ZA 1O3FA 4JZDH 1TLDA 2HWLB 3SQHE 1LPKB 3PROA 4YT7H 4FU8A 3F6UH 3GY7A 4ABJA 1PPHE 1P2JA 3F9FA 2Z3CA 1DSUA 1FAXA 4X6PA 3RXHA 1H8DH 1TOCB 2QXGA 2PGBB 3DFLA 1TNGA 1GWAA 4RSPA 7KMEH 3M3SA 1BTXA 2W5EA 1OKXA 1GBBA 2ALVA 4B1TA 1GBHA 1SFIA 4X2YA 4E05H 1MH0A 2D8WA 3U98H 2B0FA 1UK2A 4D7FA 3SI4H 1TX6A 3AAVA 3QTVH 1QJ1B 1TIOA 1O5GH 1GDUA 1SQOA 1C9TA 1VITG 1PPGE 1V2NT 1LTOA 2WYJA 7ESTE 5TJXA 1SGDE 3R0FA 4Y79A 4RN6A 2W3IA 3HK3B 1DXWA 5HMAA 1DT2A 2WPHS 2OD3B 1BTYA 4MNYA 2PSXA 4UFDH 1ID5H 4ESTE 1V2UT 4IN2A 3M7TA 1O0DH 5A8XA 1MTVA 4I8LA 3P8FA 1TMTH 2BTCE 4HFPB 3RMMH 2H6MA 1TNIA 3AASA 4FUHA 3RU4E 3FVFB 4A7IB 4WWYA 3GCNA 4CBNA 2BY9X 3KQBA 4D9QA 1S82A 2K1QA 3MNCA 1FUJA 2XCFA 1P2NA 3SJ8A 1ZGIA 2QF3A 2AIQA 1NFXA 4AGJA 2R2WU 3A7TA 2J34A 1AIXH 1VJ9U 2HPPH 2SGPE 1DS2E 4K69A 5C1XA 5E0GA 3VFEA 3LGYA 1CHGA 1VCQA 4MDSA 2JKHA 1C2MA 4UDWH 3GYMA 4ISLA 3A83A 1Q31A 2GDDA 3BTWE 1BUIA 1UTKA 1XUHA 2BD3A 2UWOA 3PMJA 3SU4A 1SLWB 2BX4A 1O2ZA 1YP9A 3BTDE 3HKJB 1PYTC 4CRBA 2A5IA 2UUKB 1ELFA 4IN1A 3SZNA 1ZSJA 3UQVA 5JBCS 1SGFG 1Y8TA 2CF9H 1UCYE 1IQHA 6LPRA 1DWCH 3RXOA 4K5ZA 1VCPA 2ZFQH 3SQEE 2PTNA 1NRSH 1CA8B 3ATKA 1L1JA 3A87A 1DWDH 1C5WB 3SUDA 1W0ZU 6CHAC 1C1VH 3UOPA 3ZVCA 4JK5A 1FN8A 3P6ZB 4NZLA 2ZGHA 1EKBB 3LDXH 2ODPA 2VIQA 4AGKA 1MQ5A 4DJZB 1XUKA 1QBNA 1W8BH 1ANCA 2ZO3H 1OWKA 1NRQH 2FOAA 3E6PH 1FLEE 1GBMA 2IPHA 5HGGA 1HIAB 1V2RT 2O8TA 3GOVB 1UVSH 1CBWC 1YKTA 4B71A 1E35B 5FXLA 1K1LA 2BDBA 1WV7H 1GI6A 1SGEE 2OC7A 2AMQA 2FI3E 1O2TA 2F9BH 2GV7A 3GYLB 4WMDA 4ZKOU 3S0NA 4A92A 2OLGA 4FUIA 3BG4C 1GCTC 4IC5A 2QC2A 3TJVA 1ZGVA 1GDNA 3RXGA 5DPAA 4BTIB 1N8OC 1PYTD 3BIVH 3RXTA 1J8AA 1PPFE 3EQ0H 1MKXK 1O2YA 3S69A 8GCHG 1MCVA 3M7QA 1TBRH 3SHCH 1AHTH 2VIOA 2WINI 1B0FA 1N6XA 1QQ4A 2Y6TA 3V3MA 1ZMJA 1MBQA 4D7GA 1DX5M 3QN7A 2QYIA 2QA9E 1O3KA 1D4PB 1TNJA 3LU9B 1C2JA 1HJ9A 1ESAA 1C1SA 5EPNA 1ESTA 3TH2H 2ZFSA 1EPTC 1KXAA 2F9PA 1HGTH 3U69H 4HZHA 1AQ7A 3TH4H 1RTKA 1QBOA 2SGEE 4HI3A 3OTJE 1GJ8B 1DITH 1QJ6B 1HXEH 2A0QB 3MI4A 1GVLA 2BHGA 1ARCA 2P8OB 1P9UA 1W12U 3ATMA 1N1LA 1YCPH 2UUYA 5HYOA 1HAVA 3RXJA 4O9VA 1P04A 3MU5A 3GISB 1IQFA 1VGCB 4ABGA 3UQOA 1LHCH 2NU4E 1W0YH 1ZSLA 4FUGA 3KCGH 1ZJKA 1W13U 3E1XB 4ZUHA 1Y5BT 4TWYA 5F6MA 4GPGA 3HATH 3LONA 1PPZA 1YPHC 1H9LB 4WF8A 2ZU3A 3MU8A 4X6OA 3S7KB 1MD7A 2PUXB 1YPGH 2HNTC 1HAXB 3NXPA 3NPSA 2UUJB 2IJOB 3PWCA 2XBVA 1SQAA 4WH6A 3RC5A 3OX7U 3TVJB 2Y7ZA 1X7AC 3UOUA 4ABFA 2ILNA 2ZHWH 3K65B 4H4FA 3ZZ5A 1ELTA 2F9NA 1QRWA 3VB6A 1BTWA 2A45B 1LO6A 3MNBA 4K2YA 2ZU1A 4MNXA 2AERH 5JDUB 4XOJA 2BYAX 1ELCA 4TPYA 1OYTH 3V7TA 1KDQB 5FX6A 1GI1A 1SLXB 2B9LA 3SV6A 1ZMLA 1HAYB 1KXFA 2GCHF 2XCNA 1YPLH 3RXRA 3U8OH 2B8OH 3NUMA 4IBLH 3KEEA 2VVUA 1O2VA 1QB9A 3ZV9A 4B73A 3ZYDA 3Q3YA 3SJ9A 1INCA 4ISNA 4R0IA 2W3KA 1P2OA 1CU1A 3NKKA 4ZAEA 2ZPQA 4NA9H 2SNWA 1NY22 3M7UA 4BNRA 3QLPH 2UWLA 4LK4A 2CHAB 1QRZA 4YM9A 4IS5A 3T2NA 1MMJN 1MUEB 3Q77A 2OBOA 3SV2H 2AGIX 1XUJA 2KAIB 4Y6DA 1T8OA 1ELBA 2VIVA 1Y3WA 5JYIA 4MNWA 1ZMNA 1SG8B 5DP8A 3P70B 3CS7A 4BXWA 1IQJA 3F68H 3FAOA 1FY8E 2A7JA 5JBAS 1P01A 2GZ8A 2YNBA 3GY2A 4RKOB 1HAIH 2OCVB 5GPIB 2F9OA 1T8NA 1O36A 1XKAC 1C2FA 3HGNA 3ZYEA 2CV3A 5B6OA 1TPAE 1H8IH 1NU9A 4CBOA 1LHGH 2BD5A 2NU2E 4X1NU 1ZHRA 2M5TA 2AGEX 3SNCA 3A7ZA 1TPPA 3RXQA 1HFDA 1NS3A 3A8CA 4FUEA 3LC3A 4DY7B 1PQ8A 4ZH8A 2ZFPH 5F8XA 1O3CA 1ELDE 5A0BA 2GV6A 1CBWB 1NU7B 2V3OH 5LPFA 1P9SA 2BVXH 5T6FA 2A4QA 1MTUA 2FOFA 4Z6AH 1UHBB 2LNCA 4BAQB 5L2ZH 1A4WH 1TMUH 1ABIH 3SHAH 2O8WA 2ZU4A 2ZZUH 1E0FD 4Y76A 1FAKH 3BTME 1YPEH 1SR5C 1O3MA 2BY8X 4INLA 2ZPRA 3SNEA 3A88A 3PB1E 2PW8H 3TPIZ 1RTLA 1MTNC 2TGAA 5EODA 2TPIZ 2FTMA 1RS0A 5ABWA 1QURH 3U8TH 1WTGH 4MLFB 1G3BA 1LKAA 1EJAA 2ANYA 3TITA 2A5KA 4OGXA 5GJ4B 3UIRA 2ZGCA 3BIUH 3CENA 3A86A 4GUXA 3P92A 4MPUA 1GHWH 1RJXB 2H9TH 1OWIA 2CXVA 1BBRK 1SB1H 1SLUB 1VJAU 3PO1C 1GGDB 3LKWA 2VGCC 3S9CA 2BX3A 3OY5U 1ETRH 4J2YB 4TY6A 3LC5A 3ZVAA 1EP6A 1E34B 3I78A 7LPRA 2V0BA 5L30H 5IYTA 5F8TA 5DP6A 1UTQA 1HAHH 2WPKS 1K1NA 4BAMB 3Q00A 1L2EA 3M3TA 3TIUA 1SOZA 3UNQA 2QY0B 1H1BA 2C8XB 3SORA 4AB9A 4BTUB 1K1MA 4BOHA 4XSKU 2A32A 2D2DA 5TCCA 4Y71A 3GDSA 1DLEA 4U30A 4X0WU 5SGAE 1IOEA 3RXSA 1FDPA 1NO9H 3D49H 1HCGA 5DK1A 1HPGA 2QN5T 1GBFA 1MKXH 1TALA 2DE8A 4YOIA 3ZVEA 4VGCB 1MQ6A 1EZUC 3IWMA 2G4UA 1G2LA 1SVPA 2HLCA 4FU9A 5A8YA 4YOJA 7GCHG 1SQTA 1YLCA 1ZJDA 3OY6U 3RXVA 5DP5A 1QGFA 2GT7A 1FQ3A 2D1JA 2XBXA 2V6NA 3UY9A 2ZQ2A 4A5TS 3E90B 4AG1A 1G30B 3U1IB 3B23B 1AVXA 3UNRA 3LGUA 3ELAH 3MH6A 3BTKE 2CN0H 5ESBA 5T3HA 3F9EA 1YCPK 4CREA 2FWWA 1ESBA 3GDUA 4XFQA 4UONA 1MBMA 3M37A 1VZQH 1GMCF 5LPRA 3A81A 4K1SA 3GCHB 4X1QU 3RLYH 4ZMAH 2EC9H 1THPB 4I32A 1FY5A 1C5ZB 3EDXB 2ZTYA 1MAXA 2GCHG 3MU4A 1LHEH 1AFQC 1IQGA 1IHTH 1EPTA 4AB8A 5EW2H 1CO7E 1NRRH 1YC0A 1DPOA 1QIXB 2ZCHP 4I8JA 4ISHH 1F0SA 2RDLA 1A3BH 2AGGX 2BD8A 5EPYA 3PMBB 4SGBE 1SBWA 3TJUA 3MNXA 3VPKA 1SOTA 4AN7A 5C67A 3P8GA 2GCTC 1A46H 1J14A 1K1JA 1F0RA 2QIQA 1MCTA 2H5DA 4AFUA 4NIWA 3KGPA 5FHTA 3HGPA 3PMAB 3S9BA 1GBAA 1CT0E 2BVRH 5I46H 2VIPA 2VNTA 3MOCA 2WPLS 4ZKRU 3L33A 1Z1JA 2ZDKA 1UTJA 1GG6B 1O37A 2VWOA 3ZV8A 5GDSH 1GL0E 1LCYA 4U2WA 1C5TA 1CGHA 1AZZA 1NRPH 1YPHE 3RLWH 1P2MA 1V2WT 1GHYH 4Q7YA 5JB9S 2O8MA 2G00A 1GJCB 1F7ZA 3DFJA 5GIBA 1C1UH 4GHQA 1NN6A 1IQLA 3DHKH 4YLUA 2FS8A 2ZPSA 3QTOH 2TGPZ 3DD2H 2VINA 4WMFA 3ATLA 1DICA 1QL9A 1GHXH 5A0AE 5C20A 1ETSH 2W26A 5E2PA 1TX8A 1EZXC 1O3AA 1C5YB 2Z9IA 1GBEA 1O30A 1NROH 3FFGA 1O5FH 1FXYA 2EI6A 4NIXA 1E37B 3P17H 1BZXE 2ZFFH 1C5OH 4CHAC 1LVYA 3HK6B 2ZDMA 3GDVA 3F9HA 1RGQA 1L1GA 1THRH 1W3CA 1P10A 3PWBA 1W14U 1EXFA 2ZHEH 1K1IA 1FZZA 3MH4A 2J92A 2ZGBH 2HOBA 2BDAA 1XVMA 4NFEA 2YOLA 1CA0B 1O5AB 2BQ7B 1Y3VA 4DT7B 1FONA 3RXIA 4B75A 2BZAA 1AE8H 3MWIU 4SGAE 3MMGA 2PSYA 1AO5A 2PKSB 3EYDA 3TJOA 2ZDNA 3BTTE 5PTPA 3AW0A 4KTSA 1A1RA 3F1SB 2Z9KA 4B74A 5T6GA 1EJMA 1AUJA 2SNVA 4YESB 1O2PA 2NU1E 2B5TB 1O3JA 1ZRKA 3KHVA 3SOSA 1H4WA 2J4IA 1LMWB 2FO9A 4NG9H 5AVDA 3GCTF 1V2MT 1MKWK 1BTUA 3H7OA 3PYHA 2BQWB 2RG3A 1O5CB 2GMTC 3RMNH 2OC1A 2ZDAH 2LPRA 2YNAA 4WXIA 1DDJA 4E7NA 4X8UH 4B2AA 3VGCC 1ZTJA 3FP8E 1V3XA 3EA8A 5H4IB 2FIRH 1WQSA 1GI8B 2W7UA 2BDHA 1Z8GA 4NWLA 4AYVB 1F5KU 1SGFA 5FPTA 3UTUH 1V2PT 3N7OA 4A1TA 1ARBA 1BHXB 1ZTKA 2BDYA 2ZWLH 2ZU2A 1NRNH 2AMPA 4PROA 1ZOMA 1UTNA 5E0JA 2JH6D 1SGPE 4CR5A 1F5LA 3MTYA 1CHOF 1ZTLA 1YF4A 1GBJA 1QCPA 1Q2WA 1CT4E 4Y7AA 3NZIA 3H7TA 5DP7A 1G3DA 4KGAA 1EOLA 2TRMA 1KLIH 5CHAC 2C8WB 4I33A 5EQRA 1BBRH 1XUGA 2PV9B 3M5MA 5JBTA 3TK6A 1OPHB 3QUMP 3T5FH 1MU8B 4O3TA 1P2KA 8KME2 1GMCG 1LVBA 1ELVA 1O32A 1P12E 2FI4E 1BTZA 2TIOA 4H6TA 1C1NA 3LGVA 3RP2A 1LQDB 4IC6A 1GI4A 1NM6A 1TX7A 2B7DH 2UWPA 3RU4T 1WSSH 1JXPA 2ZTXA 3FZZA 2FOMB 2GGVB 2ZHFH 3QZRA 4JZ1A 4ASHA 1C2EA 2ZHQH 3BG8A 1F92A 2VJ1A 1AGJA 4O97A 3A84A 3D65E 1S5SA 1GMHF 2OUAA 1A0LA 1Z6JH 2GVFA 4CR9A 4YO9A 3MO9A 2RA3A 3MNSA 1HRTH 4DOQA 1SGYE 3MFJA 1CVWH 1FIZA 1O2SA 2A2QH 3T62A 2NU0E 2J2UA 5GXPA 2PKAA 2GT8A 1Q3XA 1C1OA 4ZHLU 2I6QA 1LQEA 5AF9H 2J9NA 1TQ0B 3SJIA 1BMNH 1C5VA 1ZPBA 2PGQB 2XC4A 1O2JA 2G5VA 4JMYA 1ELAA 2NU3E 1IHSH 1SHYA 1QY6A 3DA9B 4DVAU 1LPZB 1C1MA 1C2GA 1RRKA 3V13A 1S0RA 1F0UA 3A7VA 5I25A 4J1YA 4ISIH 1C2HA 2BD4A 2ZTZA 2W7SA 2XTTB 3SGBE 3S7HB 1TFXA 3LPRA 3QX5H 1ACBE 2A4GA 3H5CB 3L3TA 4XDEA 1G3EA 3CP7A 2QAAA 4GAWA 1NC6A 1OP2A 2Q1JA 1AU8A 4NWKA 4LXBH 4OS5A 3U8RH 2F83A 3BSQA 1TAWA 5J4SA 1UVPA 2BLQA 4WXVA 1O38A 1QA7A 1XXDA 1GJ7B 2G51A 1Z8JB 3TH3H 1HDTH 4M7GA 3PMHB 1A5HA 1BJVA 1MZAA 2JETC 3ZZAA 1DXPA 3LGTA 1BIOA 5LPEA 2A31A 2AFQB 5L6NH 3KQEA 4Y7BA 1PPBH 1QB6A 1D3DB 4Q80A 3I77A 3KNXA 4MTBA 3KIDU 4K60A 1AFEH 1SL3A 4JYTA 1LVMA 1LKBA 1Y3XA 4GCHF 1O2KA 1B7XB 3SUFA 1G36A 1EB2A 4DGJA 5DP3A 3URCA 2FOBA 3MH5A 3PLKA 1C5XB 1A7SA 1DE7H 1QTFA 3IG6B 1FN6A 3SUGA 3SI3H 4XE4A 2XW9A 5FBEA 2O8UA 3MO3A 3B8JA 2H5CA 3LJOA 3HKIB 3W95A 1XXFA 3EA7A 3RC4A 1RFNA 1KLTA 1O5BB 1KYNA 1BDAA 3R3GB 1EZQA 3K6YA 2XBWA 3E8LA 1O31A 1QNJA 1KTSB 1O3OA 1C5UA 1NFWA 1GBIA 1T4VH 3RXEA 4DIHH 1SGQE 1SLVB 2CGAA 3ZVBA 2BOHB 4FUJA 2XWBI 1AD8H 1WYKA 1AVGH 1WOFA 3A7WA 5FCKA 4FUBA 5E2OA 1ZR0A 1E38B 3M3VA 4INHA 2Z9GA 3U9AH 1V6DA 3SNDA 2Z94A 3BTEE 1O2IA 1BA8B 3GY6A 3BTGE 6CHAB 1C4Y2 2SGQE 1EAXA 1UK4A 2FLBH 1AB9C 2QGRA 2QF0A 1Y5AT 4AZ2B 4AYYB 3P8OA 2F9UA 3SGQE 1TA6A 2EI8A 3KN2A 1JIMA 2H1UA 1YPJH 3SNAA 4FUCA 1O2WA 4OS1A 3UREA 1CHOG 1HAZB 1SMFE 1GJ4H 3MHWU 2A4RA 4OS4A 3LOXA 3D23A 3O8RA 2C8YB 3PTNA 1CT2E 1LHFH 2FPZA 4A1XA 3K9XB 5FCRA 1BJUA 1P09A 4ABHA 2ZP0H 2ANWA 3TGJE 4GLYA 2BVSH 1H9HE 1G9IE 1ANEA 2F3CE 1CGIE 1EQ9A 1P06A 4X2XA 4UFFH 2CF8H 5FAHA 4BAKB 1OXGA 2WPJS 1C5LH 1GBDA 6GCHF 5EU8A 2QXJA 1BTPA 4H42U 1FV9A 3SGAE 2XNIA 3O8DA 3BG4B 1GCTB 1WCZA 5TCAA 1DSTA 1MKWH 1O3BA 3BF6H 4I7YH 1ZLRA 2A5AA 5FX5A 1GBKA 1N8OB 1V2QT 1TE0A 3SW2B 1GI3A 1C2DA 3TLOA 3KQDA 2VWMA 4MPVA 3RC6A 3ZZ9A 1NFYA 2QV1A 1TA2A 1GMHG 3RU4D 1P2QA 3UFAA 3ZZBA 3OSYA 1V2VT 1BQYA 3URDA 4XBDA 2BXTH 2P93A 4KELA 2F9VA 2H9EH 1UTLM 3SU0A 1QJ7B 3LH1A 2FXRA 1DY8A 2P95A 4Y10E 1C5PA 2BLVA 4ZKNU 3UNSA 3AAUA 1NT1A 4Z0KA 5LGOA 4TWWA 2C8ZB 1T4UH 1DWBH 2P3TB 1Y5UT 4UE7H 1EPTB 3MU0A 2SGFE 1GHVH 1OX1A 1ELEE 2BDGA 4AORA 1O2UA 4BANB 1KXDA 4AFQA 1W2KH 2BB4A 4UFGH 3LGWA 2Y5HA 3UPEA 1GVZA 1S83A 4AFSA 2HRVA 1P2IA 8ESTE 3EGKH 1YM0A 3GY5A 3FANA 2Z9LA 1C5QA 2KAIA 2HGTH 2ZC9H 3TGIE 1TRNA 4X1RU 2FOHA 3MO6A 3PTBA 1TGNA 1PPCE 1BRAA 3SU3A 2Q6FA 2A4OA 2EA3A 3ENSB 4X6NA 1CSOE 2FOGA 1YGCH 5CE1A 4ABIA 2Q6DA 4U32A 2BLOA 2OBQA 2FX4A 3K6ZA 4O03A 4JZIA 1K28D 2A7HA 1RD3B 1C1RA 3NWUA 3D62A 1P3EA 1WQVH 3BEIB 2FS9A 2G81E 4I8GA 1TRYA 1DM4B 1C4V2 3EAJA 3WY8A 1SHHB 1XM1A 2BQ6B 1C1WH 2BZ6H 3RXPA 1B0EA 4UEHH 3TNSA 1EAIA 1VITH 3OU0A 3SV8A 1SGNE 1T7CA 1D6RA 1O2HA 1AKSA 2GP9B 2PTCE 1GBTA 4FUDA 2OTVA 3BN9A 4OS2A 2R0KA 3BV9B 1MD8A 3QWCH 3ZZ3A 3W94A 4X8TH 1Z6EA 5EQQA 1UHBA 4JZFH 2BDIA 2THFB 4NCYA 4X2WA 2JH0D 3GY3A 3KF2A 1O34A 2TGDA 4O3UA 2VH0A 1PQAA 2G4TA 4ABEA 3A82A 1HJAC 3P95A 4KTCA 3ZZ6A 3VB5A 2J94A 2Z3DA 1O3LA 1RIWC 1TGBA 1UK3A 3ITIA 3TK5A 4BAHB 1JIRA 4HTCH 3P8NA 1FY3A 3SV9A 1C5NH 2VWNA 3AW1A 1BITA 4GHTA 3IITA 3ODDA 1S81A 1V2ST 1P8VC 3RXMA 2OXSA 2WUBA 1HNEE 4WVPE 2G52A 4K1EA 3QDZB 2FEQH 3T25A 1QR3E 2R0LA 2ANKH 4MG3A 5GWZA 4OS7A 1SC8U 1PPEE 1C9PA 2XRCA 2DUCA 1BRCE 2FMJA 3RUOA 2XWAA 2R9PA 2FOEA 1GL1A 2C93B 2H9HA 1EUFA 5K0HA 1O3IA 1HJ8A 4ABBA 5CMXH 1EB1H 1SFQB 2PUQH 3UWJH 1UCYH 3NK8A 2OC8A 1YYY1 4E7RG 3Q76A 2FI5E 5K7RA 4B2BA 1UMAH 1BHXF 4WJG2 2ESTE 2ZGJA 5C5NA 2AS9A 1XMNB 3A7XA 1VR1H 1Z7KA 2HNTE 1EJNA 3RMLH 1Z71A 2ZFRH 4UD9H 2FLRH 5JBBS 1EOJA 1S0QA 1HAOH 1BRUP 2BD2A 2Y82A 3U1JB 1TB6H 2AMDA 4THNH 2P8OC 3RMOH 1AWHB 2ZA5A 4AFZA 3DT0H 1GI9B 1HXFH 3SU6A 3ZVFA 2CMYA 9LPRA 1FPCH 1DANH 1ZHPA 1EAUA 2AYWA 1DY9A 1VGCC 2JH5D 1TPOA 1HLTH 6GCHG 1C1TA 1OWEA 2FODA 2RA0A 2Q6GA 4IW4E 1HB0B 3QZQA 2GZ9A 1C2LA 1CGJE 5AFZH 1O33A 3QGNB 1D3TB 1EZSC 1TGCA 2FOCA 5EGMA 5BPEA 1V2KT 4K3JA 2ZU5A 1T8MA 4IMZA 4ZHMU 3M5OA 1MTNB 1BCUH 1SSXA 1Z8RA 4X8SH 1H9IE 3A89A 2PFEA 1UTPA 4CRDA 1WAYB 4NGAH 4YLQH 2EEKA 4JZEH 2ASUB 1Y3YA 1GJ9B 2C90B 1GVKB 1O3PB 5ESTE 3PLPA 2Y5FA 3PLBA 3QK1A 3PO1B 2VGCB 1UTOA 5AFYH 2O9QA 1YPMH 1XX9A 3G01A 1C5RA 4DW2U 1AUTC 2Y81A 1KTTB 1GJ5H 3RXFA 2PKAB 4D9RA 2XC5A 3M61U 4CRGA 1JMOH 6ESTA 1NZQH 1ANBA 1O2QA 1OWHA 1P57B 2BOKA 3EE0B 2SGDE 1OWJA 2XBYA 1O2MA 2VIDA 1L4DA 1P03A 2FM2A 1PQ5A 4Y0YE 3ZVDA 2BXUH 4FVDA 2NWNA 5A2MH 3RXCA 3T26A 5A0CA 2CHAC 9ESTA 3MH7A 4YTAA 1QFKH 2R3UA 5E8EH 1GI5A 1DVAH 2GDEH 1O3EA 3TNTA 1HAVB 1DUEA 1UJ1A 3JZ2B 1EX3A 1BRBE 1YPKH 1YBWA 3F9GA 3JZ1B 1GBCA 1O39A 1FIWA 4NZQA 2G55A 3M36A 4QT8C 1O5DH 2ZNKH 3ZZ7A 2HALA 3HPTB 3I29A 2ZGXH 1NFUA 1O3DA 1IQIA 1GJAB 2WUCA 1O2NA 4FVBA 1V2LT 2OINA 4NA8A 2GTBA 2ZEBA 1GCDA 3SO3A 3O8CA 1K22H 5JB8S 5LH8A 1E36B 1IAUA 3RXUA 2GD4B 2Y7XA 1GHZA 3RXAA 1HJAB 4NA7A 1TNLA 1TGTA 1J17T 1BMAA 2P16A 1AFQB 1RIWB 2ZDLA 5J4QA 2F91A 3T27A 1D3PB 3Q3KA 1LVOA 2ZQ1A 3KL6A 3Q3XA 1FNIA 2BY5X 1KXCA 1O35A 3STIA 4JK6A 1F0TA 4A6LA 4D8NA 3SJKA 5DP9A 5A8ZA 1T8LA 3BTHE 1GDQA 1BT7A 2GCTB 4F4OC 3LT3A 1P0SH 1GHAF 3FP6E 1J9CH 5EXLA 1GHBF 1ZSKA 2BD7A 4NIYA 3GY4A 2Z9JA 2WYGA 1L0ZA 1S6FA 3A8DA 3SNBA 1W11U 5C5OA 1KXEA 2A7CA 4NFFA 1HV7A 1W10U 2XC0A 2ZCKP 4Q7XA 1SGIB 2GX4A 3RXKA 3SJOA 1CQQA 4INKA 1K21H 1JRTA 2DE9A 1A5GH 1C4U2 1DWEH 1EAWA 5F8ZA 1ORFA 5EOKA 3S9AA 3VB3A 1OWDA 1Y59T 4CRAA 3UWIA 4BAOB 3M35A 2OQUA 1QB1A 4F49A 1HAGE 1GGDC 1V2TT 2ZECA 3ZZDA 1LHDH 4R8TB 1B5GH 3DUXH 1AE5A 1P3CA 3SU5A 2BD9A 1AWFH 4TY7A 5EXMA 3SBKA 1W7GH 2SFAA 5JPMH 1JOUB 3A8BA 1MU6B 1AY6H 1TBQH 2SGAA 4IMQA 1OP8A 3VXFH 4OS6A 1ZYOA 1QBVH 4YOGA 1GJ6A 1BMMH 1PQ7A 1T31A 1P11E 4ZXYH 2ZI2H 4X2VA 5FPSA 4CHAB 1V2JT 5AHGH 1ZPCA 1TABE 4Q2KA 1HIAA 1L1NA 4KP0A 1WUNH 2Y80A 1O3GA 1UCYK 1BMLA 2C3SA 1O2LA 4Y8YA 3B9FH 1PFXC 1O5EH 4VGCC 2P3UB 2FTLE 2WPMS 3E0PB 3FP7E 7GCHF 1SGCA 3ZVGA 2G5NA 2QXIA 5C3NA 3TK9A 4AX9H 1TPSA 3C27B 1BBRE 1F5RA 3V0XA 1FMGA 1OS8A 3E3TA 2CJIA 1HBTH 3AVZA 4E06H 1GMDF 1OYQA 1AZ8A 5EW1H 2O8LA 1A61H 1A0HB 1QL7A 2BMGB 1A5IA 1O2RA 1G3CA 1TQ7B 3ZZ8A 2GKVE 4MNVA 1O2OA 4BTTB 1KLJH 1RTFB 1ANDA 5HM9A 5IDKA 1K9OE 3MYWA 3GCHC 4K8YA 3ATIA 3RM2H 2WV4A 4NSVA 1SPJA 3GCTG 3E0NB 2GMTB 1D9IA 3C1KA 4DURA 1LDTT 4OGYA 1NPMA 4MPWA 3BTQE 5DJ7A 1G32B 5EG4A 4B76A 1TWXB 3VGCB 3O8BA 2J38A 2OC0A 4NIVA 3PM3A 2P3FH 4I8KA 1WU1A 3L6PA 2IN2A 1BTHH 3M5NA 4CRFA 5GCHF 1SGRE 2FYQA 1AVWA 3LIWA 2ODQA 3MU1A 5G4BA 3STJA 4JCNA 1C5MD 4CH2B 3VB4A 4FUFA 3RM0H 1K2I1 2ZFTA 2OP9A 2D26C 1C2KA 2ZDVH 4YZUA 2HNTF 1UTMA 2STAE 4D76A 4IGDA 2Z7FE 4Y8XA 1TNKA 2AEIH 4ABDA 1VCWA 3SN8A 1XKBC 1UVOA 2Z6BD 3CS0A 5HXFA 1C2IA 4Q7ZA 1A0JA 3UR9A 3SU1A 1GG6C 3T28A 4LZ4B 1J15A 1KY9A 4A1VA 5CHAB 5EQSA 1TGSZ 1TONA 2P59A 4ZXXH 3GCOA 1NTPA 2BDCA 1YLDA 1GPZA 1FJSA 3E16B 1SI5H 1XUFA 1C5SA 1IQNA 2FZZA 2PLXA 3UR6A 1OSSA 5FPYA 1NESE 1FPHH 2PHBA 4MPXA 1TMBH 5C1YA 4JYVH 2G8TA 4ZHAA 4LOYH 1HYLA 1TOMH 5F03A 1D3QB 4WY3A 1VITF 1AMHA 2ZG0H 1AKSB 2TGTA 4X1SU 2A1DB 1J16A 1DLKB 2WPIS 1QHRB 4MQAA 1TNHA 2BLWA 2OQ5A 2FP7B 1KDQA 1KSNA 2ODYB 3QGJA 3SV7A 2VH6A 4WH8A 4FU7A 1G2MA 4BXSA 4GVUA 1EP5A 5FBIA 1GI0A 2TBSA 2QXHA 4ISOA 1ZRBA 3RXBA 3TJNA 2C4FH 4LZ1H 3GY8A 2R2MB 1UVTH 5DP4A 1F2SE 1BOQA 1P02A 4ABAA
chains in the Genus database with same CATH superfamily
4WMEA 1GHAG 1IQKA 5E0HA 3M5LA 4X8VH 5T6DA 1GHBG 4Y8ZA 1S84A 3U28C 1CA0C 1JBUH 4DG4A 2UUFB 1A3EH 1TRMA 4CRCA 1GI2A 2WZQA 1Z1IA 3QO6A 1QQUA 4X6MA 2VIWA 4Y0ZE 1KXBA 4HGCA 4K8BA 1P05A 3PV4A 2PKSC 3ZZ4A 4I31A 3RXDA 3BEFB 3WWBA 1V2OT 4MVNA 2XYAA 1OOKB 5C2ZA 1CE5A 1A2CH 4XBBA 4CH8B 3SU2A 3LJJA 1MZDA 3UUZA 1GJBB 2XXLA 5EXNA 2ZKSA 1DOJA 2F4LA 2HPQH 1HAPH 3F3BA 3A80A 1FI8A 2BY7X 4JYUH 3BEUA 2PR3A 1IQEA 1IQMA 1TBZH 2AIPA 2WV5A 3TGKE 3KQCA 3T29A 1ETTH 2IOTA 1AN1E 5DKMA 2I6SA 3EA9A 3EE7A 4Y11E 3ZZCA 1MAYA 3VXEH 2GZ7A 3A7YA 3E91A 5L2YH 2JETB 1O3NA 5DO4H 1EASA 1UO6A 2QCYA 3RXLA 4FXGH 3V12A 5T1VA 2R3YA 2ZHDA 5DGJA 3VEQB 4B2CA 1GJDB 2FX6A 8LPRA 2AH4X 2RCEA 1BB0B 5ETXA 4P00A 4ZROA 1D6WA 2V3MA 3FZDA 3GICB 1THSH 1ZHMA 2KCAA 2STBE 4NSYA 1C1QA 1M9UA 1JRSA 4DCDA 3SUEA 2ULLA 1PJPA 2P94A 1JWTA 1ZPZA 4GCHG 5F53A 4B6EA 1MTWA 2Z3EA 1ELGA 1XVOA 1RXPA 5A09A 1DUAA 4DIIH 2BY6X 3TU7H 1HUTH 1G37A 2A2XH 3LH3A 1W7XH 2HVYB 1Y3UA 2ZF0H 2ALPA 1QRXA 2EI7A 1QL8A 3RDZA 1MTSA 2VB0A 1GMDG 3ODFA 3A85A 4OM9A 3ATWA 1ZZZA 2VU8E 1OP0A 3VB7A 1ABJH 1SGTA 1S85A 4GSOA 4RKJB 3ESTA 2FESH 3OYPA 1WTHD 4DT4A 4AG2A 5C1UA 5BRRE 1GBLA 4X1PU 5DG6A 3NCLA 4YT6H 4KKDA 1QA0A 4TPIZ 1O2XA 1UVUH 1Z8IB 4UFEH 1U6QA 3K2UA 5B6LA 1XUIA 8GCHF 1S6HA 1W0KD 2Y5GA 1AI8H 3LGIA 1N6YA 1TYNA 2FDAA 2PWXA 2V35A 4AOQA 2J95A 4TYDA 4KTUA 4XBCA 1FY4A 5HM2A 1GI7B 2VWLA 1K1OA 1LPGB 4H6SB 4U01A 5GCHG 1O3HA 1K1PA 2V3HH 2ZIQH 3BTFE 4I8HA 1DFPA 1YCPM 2FYRA 4K1TA 1T32A 4ZKSU 2ZCLP 2BM2A 1C1PA 1WBGB 1AB9B 1KIGH 2HVXA 5IK2D 1L4ZA 5HIYA 1O2GH 3A8AA 2VVVA 2ANMH 2VVCA 1FY1A 1EATA 2H2ZA 1O3FA 4JZDH 1TLDA 2HWLB 3SQHE 1LPKB 3PROA 4YT7H 4FU8A 3F6UH 3GY7A 4ABJA 1PPHE 1P2JA 3F9FA 2Z3CA 1DSUA 1FAXA 4X6PA 3RXHA 1H8DH 1TOCB 2QXGA 2PGBB 3DFLA 1TNGA 1GWAA 4RSPA 7KMEH 3M3SA 1BTXA 2W5EA 1OKXA 1GBBA 2ALVA 4B1TA 1GBHA 1SFIA 4X2YA 4E05H 1MH0A 2D8WA 3U98H 2B0FA 1UK2A 4D7FA 3SI4H 1TX6A 3AAVA 2K8IA 3QTVH 1QJ1B 1TIOA 1O5GH 1GDUA 1SQOA 1YWUA 1C9TA 1VITG 1PPGE 1V2NT 1LTOA 2WYJA 7ESTE 5TJXA 1SGDE 3R0FA 4Y79A 4RN6A 2W3IA 3HK3B 1DXWA 5HMAA 1DT2A 2WPHS 2KX4A 2OD3B 1BTYA 4MNYA 2KM0A 2PSXA 4UFDH 1ID5H 4ESTE 5CHBA 1V2UT 4IN2A 3M7TA 1O0DH 5A8XA 1MTVA 4I8LA 3P8FA 1TMTH 2BTCE 4HFPB 3RMMH 2H6MA 1TNIA 3AASA 4FUHA 3RU4E 3FVFB 4A7IB 4WWYA 3GCNA 4CBNA 2BY9X 3KQBA 4D9QA 1S82A 2K1QA 3MNCA 1FUJA 2XCFA 1P2NA 3SJ8A 1ZGIA 2QF3A 2AIQA 1NFXA 4AGJA 2R2WU 3A7TA 2J34A 1AIXH 1VJ9U 2HPPH 2SGPE 1DS2E 4K69A 5C1XA 5E0GA 3VFEA 3LGYA 1CHGA 1VCQA 4MDSA 2JKHA 1C2MA 4UDWH 2RFKC 3GYMA 4XRNA 4ISLA 3A83A 1Q31A 2GDDA 3BTWE 1BUIA 1UTKA 1XUHA 2BD3A 2UWOA 3PMJA 3SU4A 1SLWB 3N99A 2BX4A 1O2ZA 1YP9A 3BTDE 3HKJB 1PYTC 4CRBA 2A5IA 2UUKB 1ELFA 4IN1A 3SZNA 1ZSJA 3UQVA 5JBCS 1SGFG 1Y8TA 2CF9H 1UCYE 1IQHA 6LPRA 1DWCH 3RXOA 4K5ZA 1VCPA 1QZ8A 2ZFQH 3SQEE 2PTNA 1NRSH 1CA8B 3ATKA 1L1JA 3A87A 1DWDH 1C5WB 3SUDA 1W0ZU 6CHAC 1C1VH 3UOPA 3ZVCA 4JK5A 1FN8A 3P6ZB 4NZLA 2ZGHA 4B6FA 1EKBB 3LDXH 2ODPA 2VIQA 4AGKA 1MQ5A 4DJZB 1XUKA 1QBNA 1W8BH 3NRLA 1ANCA 3FN8A 2ZO3H 1OWKA 1NRQH 2FOAA 3E6PH 1FLEE 1GBMA 2IPHA 4HG6A 5HGGA 1HIAB 1V2RT 2O8TA 3GOVB 1H8ED 1CBWC 1UVSH 1YKTA 4B71A 1E35B 5FXLA 1K1LA 2BDBA 1WV7H 1GI6A 1SGEE 2OC7A 3FOAA 2AMQA 2FI3E 1O2TA 2F9BH 2GV7A 3GYLB 2HLDD 4WMDA 4ZKOU 3S0NA 4A92A 2OLGA 4FUIA 3BG4C 1GCTC 4IC5A 2QC2A 3TJVA 1ZGVA 1GDNA 3RXGA 5DPAA 4BTIB 2W6ID 1N8OC 1PYTD 3BIVH 3RXTA 1J8AA 1PPFE 3DSGA 3EQ0H 1MKXK 1O2YA 3S69A 8GCHG 1MCVA 3M7QA 1TBRH 3SHCH 1AHTH 2VIOA 2WINI 3PV2A 1B0FA 1N6XA 1QQ4A 2Y6TA 3V3MA 1ZMJA 1MBQA 4D7GA 1DX5M 3QN7A 5KECA 2QYIA 2QA9E 3FKSD 1O3KA 1D4PB 1TNJA 1W0JD 3LU9B 1C2JA 1HJ9A 1ESAA 1C1SA 5EPNA 1ESTA 3TH2H 2ZFSA 1EPTC 1KXAA 2F9PA 1HGTH 3U69H 4HZHA 1AQ7A 3TH4H 1YLNA 1RTKA 1QBOA 2SGEE 4HI3A 3OTJE 1GJ8B 1DITH 1QJ6B 1HXEH 2A0QB 3MQKC 2K0QA 3MI4A 1GVLA 2BHGA 1ARCA 2P8OB 1P9UA 1W12U 3ATMA 1N1LA 1YCPH 2UUYA 5HYOA 1HAVA 4ACBA 3RXJA 4O9VA 1P04A 3MU5A 3GISB 1IQFA 1VGCB 4RT1A 4ABGA 3UQOA 1LHCH 2NU4E 1W0YH 1ZSLA 4FUGA 3KCGH 1ZJKA 1W13U 3E1XB 4ZUHA 1Y5BT 4TWYA 5F6MA 4GPGA 3HATH 3LONA 1PPZA 1YPHC 1H9LB 4RI0A 4WF8A 2ZU3A 3MU8A 4X6OA 3S7KB 1MD7A 1WDIA 3VG8A 2PUXB 1YPGH 2HNTC 1HAXB 3NXPA 5C0TA 3NPSA 2UUJB 2IJOB 3PWCA 2XBVA 1SQAA 4FETA 4WH6A 3OX7U 3RC5A 3TVJB 2Y7ZA 1X7AC 3UOUA 4ABFA 2ILNA 2ZHWH 3K65B 4H4FA 3ZZ5A 2OK5A 5C17A 1ELTA 2F9NA 1QRWA 3VB6A 1BTWA 2A45B 1LO6A 3MNBA 4K2YA 2ZU1A 4MNXA 1EFRD 2AERH 5JDUB 4XOJA 2BYAX 1ELCA 4TPYA 1OYTH 3V7TA 1KDQB 5FX6A 1GI1A 1SLXB 2B9LA 1UW7A 3SV6A 1ZMLA 1HAYB 1KXFA 2GCHF 2XCNA 1YPLH 3RXRA 3UAIC 3U8OH 2B8OH 2W6JD 3NUMA 4IBLH 3KEEA 2VVUA 1O2VA 1QB9A 3ZV9A 4B73A 3ZYDA 3Q3YA 3DSOA 3SJ9A 1INCA 4ISNA 3ZIAD 4R0IA 2W3KA 1P2OA 1CU1A 3NKKA 4ZAEA 2ZPQA 4NA9H 2SNWA 1NY22 3M7UA 4BNRA 3QLPH 2UWLA 4LK4A 2CHAB 1QRZA 1E1RD 4YM9A 4IS5A 3T2NA 5GNDA 1MMJN 1MUEB 3Q77A 2OBOA 3SV2H 2AGIX 1XUJA 2KAIB 4Y6DA 2CK3D 1T8OA 1ELBA 2VIVA 1Y3WA 5JYIA 4MNWA 1ZMNA 1SG8B 5DP8A 3P70B 3CS7A 4BXWA 1IQJA 3F68H 3FAOA 1FY8E 2A7JA 5JBAS 1P01A 2GZ8A 2YNBA 3GY2A 4RKOB 1HAIH 2OCVB 5GPIB 2F9OA 1T8NA 1O36A 1XKAC 2M2AA 1C2FA 3HGNA 3ZYEA 2CV3A 5B6OA 2LP6A 1TPAE 1H8IH 1NU9A 4CBOA 1LHGH 2BD5A 2NU2E 4X1NU 1ZHRA 2M5TA 2AGEX 3SNCA 3KYGA 3A7ZA 1TPPA 3RXQA 1HFDA 1NS3A 3A8CA 4FUEA 3LC3A 4DY7B 1PQ8A 4ZH8A 2ZFPH 5F8XA 1O3CA 1ELDE 5A0BA 2GV6A 1CBWB 1NU7B 2V3OH 5LPFA 1P9SA 2BVXH 5T6FA 2A4QA 1MTUA 2FOFA 3N7DA 4Z6AH 1UHBB 2LNCA 4BAQB 5L2ZH 2F43B 1A4WH 1TMUH 1ABIH 3SHAH 2O8WA 2ZU4A 2ZZUH 5HKKD 1E0FD 4Y76A 1FAKH 3BTME 1YPEH 1SR5C 1O3MA 2BY8X 4INLA 2ZPRA 3SNEA 3A88A 3PB1E 2PW8H 3TPIZ 1RTLA 1MTNC 2TGAA 5EODA 2TPIZ 2FTMA 1RS0A 5ABWA 1QURH 3UB0A 3U8TH 1WTGH 4MLFB 1G3BA 1LKAA 1EJAA 2ANYA 3TITA 2A5KA 4OGXA 2IPQX 5GJ4B 3UIRA 2ZGCA 3BIUH 3CENA 3A86A 4GUXA 3P92A 4MPUA 1GHWH 1RJXB 2H9TH 1OWIA 2CXVA 1BBRK 1SB1H 1SLUB 1VJAU 3PO1C 1GGDB 3LKWA 2VGCC 3S9CA 2BX3A 3OY5U 1ETRH 4J2YB 4TY6A 3LC5A 3ZVAA 1EP6A 1E34B 3I78A 5CDFE 7LPRA 2V0BA 5L30H 5IYTA 5F8TA 5DP6A 1UTQA 1HAHH 2WPKS 1K1NA 4BAMB 3Q00A 1L2EA 3M3TA 3TIUA 1SOZA 3UNQA 2QY0B 1H1BA 2C8XB 3SORA 4AB9A 4BTUB 1K1MA 3H09A 4BOHA 4XSKU 2YMSC 2A32A 2D2DA 5TCCA 4Y71A 3GDSA 1DLEA 4U30A 4X0WU 5SGAE 1IOEA 3RXSA 1FDPA 1NO9H 3D49H 2LELA 1HCGA 5DK1A 1HPGA 2QN5T 1GBFA 1MKXH 1TALA 2DE8A 4YOIA 3ZVEA 4VGCB 1MQ6A 3DCLA 1EZUC 3IWMA 2G4UA 1G2LA 1SVPA 2HLCA 4FU9A 5A8YA 4YOJA 7GCHG 1SQTA 1YLCA 1ZJDA 3OY6U 3RXVA 5DP5A 1QGFA 2GT7A 5DSFA 1FQ3A 2D1JA 3CNRA 2XBXA 2V6NA 3UY9A 2ZQ2A 4A5TS 3E90B 4AG1A 1G30B 3U1IB 3B23B 1AVXA 3UNRA 3LGUA 3ELAH 3MH6A 3BTKE 2CN0H 5ESBA 5T3HA 3F9EA 1YCPK 4CREA 2FWWA 4RT0A 1ESBA 3GDUA 4XFQA 4UONA 1MBMA 3M37A 1VZQH 1GMCF 5LPRA 3N7EA 3A81A 4K1SA 3GCHB 4X1QU 3RLYH 4ZMAH 2EC9H 5DN6D 1THPB 4I32A 1FY5A 1C5ZB 3EDXB 2ZTYA 1MAXA 2GCHG 3MU4A 1LHEH 1AFQC 1IQGA 1IHTH 1EPTA 4AB8A 5EW2H 1CO7E 1NRRH 1YC0A 1DPOA 1QIXB 2ZCHP 4I8JA 4ISHH 1F0SA 2RDLA 1A3BH 2AGGX 2BD8A 5EPYA 3PMBB 4SGBE 2IJD1 4F55A 1SBWA 3TJUA 3MNXA 3VPKA 1SOTA 2YMSD 4AN7A 5C67A 3P8GA 2GCTC 1A46H 1J14A 1K1JA 1F0RA 2QIQA 1MCTA 2H5DA 4AFUA 4NIWA 3KGPA 5FHTA 3HGPA 3PMAB 3S9BA 1GBAA 1CT0E 2BVRH 5I46H 2VIPA 2VNTA 2KCOA 3MOCA 2WPLS 4ZKRU 3L33A 1Z1JA 2ZDKA 2QF4A 1UTJA 1GG6B 1O37A 2VWOA 3ZV8A 5GDSH 1GL0E 1LCYA 4U2WA 1C5TA 1CGHA 2RDEA 1AZZA 1NRPH 1YPHE 3RLWH 1P2MA 3SZEA 1V2WT 1GHYH 4Q7YA 5JB9S 2O8MA 2G00A 1GJCB 1F7ZA 3DFJA 5GIBA 1C1UH 5EJ1A 4GHQA 1NN6A 4ZCNA 1IQLA 3DHKH 4YLUA 2FS8A 2ZPSA 3QTOH 2TGPZ 3DD2H 2VINA 4WMFA 3ATLA 1DICA 1QL9A 1GHXH 5A0AE 5C20A 1ETSH 2W26A 5E2PA 1TX8A 1EZXC 1O3AA 1C5YB 2Z9IA 1GBEA 1O30A 1NROH 3FFGA 1O5FH 1FXYA 2EI6A 4NIXA 1E37B 3P17H 1BZXE 2ZFFH 1C5OH 4CHAC 1LVYA 3HK6B 3AK5A 2ZDMA 3GDVA 3F9HA 1RGQA 1L1GA 1THRH 1W3CA 1P10A 2KCPA 2JJ2D 1W14U 3PWBA 1EXFA 2ZHEH 2QE7D 1K1IA 1FZZA 3MH4A 2J92A 2ZGBH 2HOBA 2BDAA 1XVMA 4NFEA 2YOLA 1CA0B 1O5AB 2BQ7B 2WPDD 1Y3VA 4DT7B 1FONA 3RXIA 4B75A 2BZAA 1AE8H 3F2FA 3MWIU 4SGAE 3MMGA 2PSYA 1AO5A 2PKSB 3EYDA 3TJOA 2ZDNA 3BTTE 5PTPA 3AW0A 3PRBA 4KTSA 4Q4LA 1A1RA 3F1SB 2Z9KA 4B74A 5T6GA 1EJMA 1AUJA 2SNVA 4YESB 1O2PA 2NU1E 2B5TB 1O3JA 1ZRKA 3KHVA 3SOSA 1H4WA 2J4IA 1LMWB 2FO9A 4NG9H 5AVDA 2WSSD 3GCTF 1V2MT 1MKWK 1BTUA 3H7OA 3PYHA 2BQWB 2RG3A 1O5CB 2GMTC 3RMNH 2OC1A 2ZDAH 2LPRA 2YNAA 4WXIA 4ASUD 1DDJA 4E7NA 4X8UH 4B2AA 3VGCC 1ZTJA 3FP8E 1V3XA 3EA8A 5H4IB 2FIRH 4ACAA 1WQSA 1GI8B 2W7UA 2BDHA 1Z8GA 4NWLA 4AYVB 1F5KU 1SGFA 5FPTA 3UTUH 1V2PT 3N7OA 4A1TA 1ARBA 1BHXB 1ZTKA 2BDYA 2ZWLH 2ZU2A 1NRNH 2AMPA 4PROA 1ZOMA 1UTNA 5E0JA 2JH6D 1SGPE 4CR5A 1F5LA 3MTYA 1CHOF 1ZTLA 1YF4A 1GBJA 1QCPA 1Q2WA 1CT4E 4Y7AA 3NZIA 3H7TA 5DP7A 1G3DA 4KGAA 1EOLA 2TRMA 1KLIH 5CHAC 2C8WB 4I33A 5EQRA 1BBRH 1XUGA 2PV9B 3M5MA 5JBTA 3TK6A 1OPHB 3QUMP 3T5FH 1MU8B 4O3TA 1P2KA 8KME2 1GMCG 1LVBA 1ELVA 1O32A 1P12E 2FI4E 1BTZA 2TIOA 4H6TA 1C1NA 3LGVA 3RP2A 1S6LA 1LQDB 4IC6A 1GI4A 1NM6A 1TX7A 2B7DH 2UWPA 3RU4T 1WSSH 1JXPA 2ZTXA 3FZZA 2FOMB 2GGVB 2ZHFH 3QZRA 4JZ1A 4ASHA 1C2EA 2ZHQH 3BG8A 1F92A 2VJ1A 1AGJA 4O97A 3A84A 3D65E 1S5SA 1GMHF 2OUAA 1A0LA 1Z6JH 2GVFA 4CR9A 4YO9A 3MO9A 2RA3A 3MNSA 1HRTH 4DOQA 1SGYE 3MFJA 1CVWH 1FIZA 1O2SA 2A2QH 3T62A 2NU0E 2J2UA 5GXPA 1YY3A 2PKAA 2GT8A 1Q3XA 1C1OA 4ZHLU 2I6QA 1LQEA 5AF9H 2J9NA 1TQ0B 5KGOA 3SJIA 1BMNH 1C5VA 1ZPBA 2PGQB 2J98B 2XC4A 1O2JA 2G5VA 4JMYA 1ELAA 2NU3E 1IHSH 1SHYA 1QY6A 3DA9B 4DVAU 1LPZB 1C1MA 1C2GA 1RRKA 3V13A 1S0RA 1F0UA 3A7VA 5I25A 4J1YA 4ISIH 1C2HA 2JJ1D 2JDID 2BD4A 2ZTZA 2W7SA 2XTTB 3SGBE 3S7HB 1TFXA 3LPRA 3QX5H 4Q63A 1ACBE 2A4GA 3H5CB 3L3TA 4XDEA 1G3EA 3CP7A 2QAAA 4GAWA 1NC6A 1OP2A 2Q1JA 1AU8A 4NWKA 4LXBH 4OS5A 3U8RH 2F83A 3BSQA 1TAWA 5J4SA 1UVPA 2BLQA 4WXVA 1O38A 1QA7A 1XXDA 1GJ7B 2G51A 3OEHD 1Z8JB 3TH3H 1HDTH 4M7GA 3PMHB 1A5HA 1BJVA 1MZAA 2JETC 3ZZAA 1DXPA 3LGTA 1BIOA 5LPEA 2A31A 2AFQB 5L6NH 3KQEA 4Y7BA 1PPBH 1QB6A 1D3DB 4Q80A 3I77A 3KNXA 4MTBA 3KIDU 4K60A 1AFEH 1SL3A 4JYTA 1LVMA 1LKBA 1Y3XA 4GCHF 1O2KA 1B7XB 3SUFA 1G36A 1EB2A 4DGJA 5DP3A 3URCA 2FOBA 3MH5A 3PLKA 1C5XB 1A7SA 1DE7H 1QTFA 3IG6B 1FN6A 3SUGA 3SI3H 4XE4A 2XW9A 3DSPA 5FBEA 2O8UA 3MO3A 3B8JA 2H5CA 3LJOA 3HKIB 2KCYA 3W95A 5EJLA 1FX0B 1XXFA 3EA7A 3RC4A 1RFNA 1KLTA 1O5BB 1KYNA 1BDAA 3R3GB 1EZQA 2VBCA 3K6YA 2XBWA 2EY4C 3E8LA 1O31A 1QNJA 2L6OA 1KTSB 1O3OA 1C5UA 1NFWA 1GBIA 1T4VH 3RXEA 4DIHH 1SGQE 1SLVB 2CGAA 3ZVBA 2BOHB 4FUJA 3OE7D 2XWBI 1AD8H 1WYKA 1AVGH 1WOFA 3A7WA 5FCKA 4FUBA 5E2OA 1ZR0A 1E38B 2J5UA 3M3VA 4INHA 5EJZA 2Z9GA 3U9AH 1V6DA 3SNDA 2Z94A 3BTEE 1O2IA 1BA8B 3PV5A 3GY6A 3BTGE 6CHAB 1C4Y2 2SGQE 1EAXA 1UK4A 2FLBH 1AB9C 2QGRA 2QF0A 1Y5AT 4AZ2B 4AYYB 3P8OA 2F9UA 3SGQE 1TA6A 2EI8A 3KN2A 1JIMA 2H1UA 1YPJH 3SNAA 4FUCA 1O2WA 4OS1A 3UREA 1CHOG 1HAZB 1SMFE 1GJ4H 3MHWU 2A4RA 4OS4A 3LOXA 3D23A 3O8RA 2C8YB 3PTNA 1CT2E 1LHFH 2FPZA 4A1XA 3K9XB 5FCRA 1BJUA 1P09A 4ABHA 2ZP0H 2ANWA 3TGJE 4GLYA 3F2HA 2BVSH 1H9HE 1G9IE 1ANEA 2F3CE 1CGIE 1EQ9A 1P06A 4X2XA 4UFFH 2CF8H 5FAHA 4BAKB 1OXGA 2WPJS 5C94A 1C5LH 1GBDA 6GCHF 5EU8A 2QXJA 1BTPA 4H42U 1FV9A 3SGAE 2XNIA 3O8DA 3BG4B 3OFND 1GCTB 1WCZA 5TCAA 1DSTA 1MKWH 1O3BA 3BF6H 2V7QD 1ZLRA 2A5AA 5FX5A 4I7YH 1GBKA 1N8OB 1V2QT 1TE0A 3SW2B 1GI3A 1SQRA 1C2DA 3TLOA 3KQDA 2VWMA 4MPVA 3RC6A 3ZZ9A 1NFYA 2QV1A 1TA2A 1GMHG 3RU4D 1P2QA 3UFAA 3ZZBA 3OSYA 1V2VT 1BQYA 3URDA 4XBDA 2BXTH 2P93A 4KELA 2F9VA 2H9EH 1UTLM 3SU0A 1QJ7B 3LH1A 2FXRA 1DY8A 2P95A 4Y10E 1C5PA 2BLVA 1VKYA 4ZKNU 3UNSA 3AAUA 1NT1A 4Z0KA 5LGOA 4TWWA 2C8ZB 1T4UH 1DWBH 2P3TB 1Y5UT 4UE7H 1EPTB 3MU0A 2SGFE 1GHVH 1OX1A 1ELEE 2BDGA 4AORA 5EIYA 1O2UA 4BANB 1KXDA 4AFQA 1W2KH 2BB4A 4UFGH 3LGWA 2Y5HA 3UPEA 1GVZA 1S83A 4AFSA 2HRVA 1P2IA 8ESTE 3EGKH 1YM0A 3GY5A 3FANA 2Z9LA 1C5QA 2KAIA 2HGTH 2ZC9H 3TGIE 1TRNA 4X1RU 2FOHA 3MO6A 3PTBA 1TGNA 1PPCE 4TSFD 1BRAA 3SU3A 2Q6FA 2A4OA 2EA3A 3ENSB 4X6NA 1CSOE 2FOGA 1YGCH 5CE1A 4ABIA 2Q6DA 4U32A 2BLOA 2OBQA 2FX4A 3K6ZA 4O03A 4JZIA 1K28D 4FOUC 2A7HA 1RD3B 1C1RA 3NWUA 3D62A 1P3EA 1WQVH 3BEIB 1NBMD 2FS9A 2L74A 2G81E 4I8GA 1TRYA 1DM4B 1C4V2 3EAJA 3WY8A 1SHHB 1XM1A 2BQ6B 1C1WH 2BZ6H 3RXPA 1B0EA 4UEHH 2KFWA 3TNSA 1EAIA 1VITH 3OU0A 3SV8A 4XD7D 1SGNE 1T7CA 1D6RA 1O2HA 1AKSA 2GP9B 2PTCE 1GBTA 4FUDA 2OTVA 3BN9A 4OS2A 2R0KA 3BV9B 1MD8A 3QWCH 5HIZA 3ZZ3A 3W94A 4X8TH 1Z6EA 5EQQA 1UHBA 4JZFH 2BDIA 2THFB 4NCYA 4X2WA 2JH0D 3FO8D 3GY3A 3KF2A 1O34A 2TGDA 4O3UA 2VH0A 1PQAA 2G4TA 4ABEA 3A82A 1HJAC 3P95A 4KTCA 3ZZ6A 3VB5A 4AC9A 2J94A 2Z3DA 1O3LA 1RIWC 1TGBA 1UK3A 3ITIA 4P02A 3TK5A 1JIRA 4BAHB 4HTCH 3P8NA 1FY3A 3SV9A 1C5NH 2VWNA 3AW1A 1BITA 4GHTA 3IITA 3ODDA 1S81A 1V2ST 1P8VC 3RXMA 2OXSA 2WUBA 1HNEE 4WVPE 2G52A 4K1EA 1E1QD 3QDZB 2FEQH 3T25A 4YXWD 1QR3E 2R0LA 2ANKH 4MG3A 3WWFA 5GWZA 4OS7A 1SC8U 1PPEE 1C9PA 2XRCA 2DUCA 1BRCE 2FMJA 3RUOA 2XWAA 2R9PA 2FOEA 1GL1A 4F48B 2C93B 2H9HA 1EUFA 5K0HA 1O3IA 1HJ8A 4ABBA 5CMXH 1EB1H 1SFQB 2PUQH 3UWJH 1UCYH 3NK8A 3KQ5A 2OC8A 3GS9A 1YYY1 4E7RG 3Q76A 2FI5E 2JIZD 5K7RA 4B2BA 1UMAH 1BHXF 4WJG2 2ESTE 2ZGJA 5C5NA 2AS9A 4M9FA 1XMNB 3A7XA 1VR1H 1Z7KA 2HNTE 1EJNA 3RMLH 1Z71A 2ZFRH 4UD9H 2FLRH 5JBBS 1EOJA 1S0QA 1HAOH 1BRUP 2BD2A 2Y82A 3U1JB 1H8HD 1TB6H 2AMDA 2KZ4A 2P8OC 4THNH 3RMOH 1AWHB 2ZA5A 4AFZA 3DT0H 1GI9B 1HXFH 3SU6A 3ZVFA 2CMYA 9LPRA 1FPCH 1DANH 1ZHPA 1EAUA 2AYWA 1DY9A 1VGCC 2JH5D 1COWD 1TPOA 1HLTH 6GCHG 1C1TA 1OWEA 2FODA 2RA0A 2Q6GA 4IW4E 1HB0B 3QZQA 2WV9A 2GZ9A 1C2LA 1CGJE 5AFZH 1O33A 3QGNB 1D3TB 1EZSC 1TGCA 2FOCA 5EGMA 3SYJA 5BPEA 1V2KT 4K3JA 2ZU5A 1T8MA 4IMZA 4ZHMU 3M5OA 1MTNB 1BCUH 1SSXA 1Z8RA 1MABB 4X8SH 1H9IE 3A89A 2PFEA 1UTPA 4CRDA 1WAYB 4NGAH 4YLQH 2EEKA 4JZEH 2ASUB 1Y3YA 1GJ9B 2C90B 1GVKB 1O3PB 5ESTE 3PLPA 2Y5FA 3PLBA 3QK1A 3PO1B 2VGCB 1UTOA 5AFYH 2O9QA 1YPMH 1XX9A 3F0OA 3G01A 1C5RA 4DW2U 1AUTC 2Y81A 1KTTB 1GJ5H 3RXFA 2PP6A 1SKYE 2PKAB 4D9RA 2XC5A 3M61U 4CRGA 1JMOH 6ESTA 1NZQH 1ANBA 2AHME 1O2QA 1OWHA 1P57B 2BOKA 3EE0B 2SGDE 1OWJA 2XBYA 3F0PA 1O2MA 4Z1MD 2VIDA 1L4DA 1P03A 2FM2A 1PQ5A 2YMSB 4Y0YE 3ZVDA 2BXUH 4FVDA 2NWNA 5A2MH 3RXCA 3T26A 5A0CA 2CHAC 9ESTA 3MH7A 4YTAA 1QFKH 2R3UA 5E8EH 1GI5A 3OEED 1DVAH 2GDEH 1O3EA 3TNTA 1HAVB 1DUEA 1UJ1A 3JZ2B 1OHHD 1EX3A 1BRBE 1E79D 1YPKH 1YBWA 3F9GA 3JZ1B 1GBCA 1O39A 1FIWA 4NZQA 1K0HA 2WHXA 2G55A 3M36A 4QT8C 1O5DH 2ZNKH 3ZZ7A 2HALA 3HPTB 3I29A 2ZGXH 1NFUA 1O3DA 1IQIA 1GJAB 2WUCA 1O2NA 4FVBA 1V2LT 2OINA 4NA8A 1NBME 2GTBA 2ZEBA 1GCDA 3SO3A 3O8CA 1K22H 5JB8S 5LH8A 2GJGA 1E36B 1IAUA 3RXUA 2GD4B 2Y7XA 1GHZA 3RXAA 1HJAB 4NA7A 1TNLA 1TGTA 1J17T 4TT3D 1BMAA 2P16A 1AFQB 1RIWB 2ZDLA 5J4QA 2F91A 3T27A 1D3PB 3Q3KA 1KMHB 2EQNA 1LVOA 2ZQ1A 3KL6A 3Q3XA 1FNIA 2BY5X 1KXCA 1O35A 3STIA 4JK6A 1F0TA 4A6LA 4D8NA 3SJKA 5DP9A 5A8ZA 1T8LA 3BTHE 3KYFA 1GDQA 1BT7A 2GCTB 2KR7A 4F4OC 3LT3A 1P0SH 1GHAF 3FP6E 1J9CH 4I86A 5EXLA 1GHBF 1ZSKA 2BD7A 4NIYA 3GY4A 2Z9JA 2WYGA 1L0ZA 1S6FA 3A8DA 3SNBA 1W11U 5C5OA 1KXEA 2A7CA 4NFFA 1HV7A 1W10U 2XC0A 2ZCKP 4Q7XA 1SGIB 2GX4A 3RXKA 3SJOA 1CQQA 4INKA 1K21H 1JRTA 2DE9A 1A5GH 1C4U2 1DWEH 1EAWA 5F8ZA 1ORFA 5EOKA 3S9AA 3VB3A 1OWDA 1Y59T 4CRAA 3UWIA 4BAOB 3M35A 2OQUA 1QB1A 4F49A 1HAGE 2QF5A 1GGDC 1V2TT 2ZECA 3ZZDA 1LHDH 4R8TB 1B5GH 3DUXH 1AE5A 1P3CA 3SU5A 2BD9A 1AWFH 4TY7A 5EXMA 3SBKA 5KEDA 1W7GH 2SFAA 5JPMH 1JOUB 3A8BA 1MU6B 1AY6H 1TBQH 5C0UA 2SGAA 3W1EA 4IMQA 1OP8A 3VXFH 4OS6A 1ZYOA 3WW7A 1QBVH 2XNDD 4YOGA 1GJ6A 1BMMH 1PQ7A 1T31A 1P11E 4ZXYH 2ZI2H 4X2VA 5FPSA 4CHAB 1V2JT 5AHGH 1ZPCA 1TABE 4Q2KA 1HIAA 1L1NA 4KP0A 1WUNH 2Y80A 1O3GA 1UCYK 1BMLA 2C3SA 1O2LA 4Y8YA 3B9FH 1PFXC 1O5EH 4VGCC 2P3UB 2FTLE 2WPMS 3E0PB 3F2GA 3FP7E 7GCHF 1SGCA 3ZVGA 2G5NA 2QXIA 5C3NA 3TK9A 4AX9H 1TPSA 3C27B 1BBRE 1F5RA 3V0XA 1FMGA 1OS8A 3E3TA 2CJIA 1HBTH 3AVZA 4E06H 1GMDF 1OYQA 1AZ8A 5EW1H 2O8LA 1A61H 3PRDA 1A0HB 1QL7A 2BMGB 1A5IA 1O2RA 1G3CA 1TQ7B 3ZZ8A 2GKVE 4MNVA 1O2OA 4BTTB 1KLJH 1RTFB 1ANDA 5HM9A 5IDKA 1K9OE 3MYWA 3GCHC 4K8YA 3ATIA 3RM2H 5FL7D 2WV4A 4NSVA 1SPJA 3GCTG 3E0NB 2J98A 2GMTB 1D9IA 3C1KA 4DURA 1LDTT 4OGYA 1NPMA 4MPWA 3BTQE 5DJ7A 1G32B 5EG4A 4B76A 1TWXB 3VGCB 3O8BA 2J38A 2OC0A 4NIVA 3PM3A 2P3FH 4I8KA 1WU1A 3OTPA 3L6PA 2IN2A 1BTHH 3M5NA 4CRFA 5GCHF 1SGRE 2FYQA 1AVWA 3LIWA 2ODQA 3MU1A 5G4BA 3STJA 4JCNA 1C5MD 4CH2B 3VB4A 4FUFA 3RM0H 1K2I1 2ZFTA 2D26C 1C2KA 2OP9A 2XOKD 2ZDVH 4YZUA 2HNTF 1UTMA 2STAE 4D76A 4IGDA 2Z7FE 4Y8XA 1TNKA 2AEIH 4ABDA 1VCWA 3SN8A 1XKBC 1UVOA 2Z6BD 3CS0A 5HXFA 1C2IA 4Q7ZA 1A0JA 3UR9A 3SU1A 1GG6C 3T28A 4LZ4B 1J15A 1KY9A 4A1VA 5CHAB 5EQSA 1TGSZ 1TONA 2P59A 4ZXXH 3GCOA 1NTPA 2BDCA 1YLDA 1GPZA 1FJSA 3E16B 1SI5H 1XUFA 1C5SA 1IQNA 2FZZA 2PLXA 3UR6A 1OSSA 5FPYA 1NESE 1FPHH 2PHBA 4MPXA 1TMBH 5C1YA 4JYVH 2G8TA 1WXRA 4ZHAA 4LOYH 1HYLA 1TOMH 5F03A 1D3QB 4WY3A 1VITF 1AMHA 2ZG0H 1AKSB 2TGTA 3OAAD 4X1SU 2A1DB 1J16A 1DLKB 2WPIS 1BMFD 1QHRB 2J97A 4MQAA 1TNHA 2BLWA 2OQ5A 2FP7B 1KDQA 1KSNA 2ODYB 3QGJA 3SV7A 2VH6A 4WH8A 4FU7A 1G2MA 4BXSA 4GVUA 1EP5A 5FBIA 1GI0A 2TBSA 2QXHA 4ISOA 1ZRBA 3RXBA 3TJNA 2C4FH 4LZ1H 3GY8A 2R2MB 1UVTH 5DP4A 1F2SE 1BOQA 1P02A 4ABAA
chains in the Genus database with same CATH topology
4WMEA 1GHAG 1IQKA 5E0HA 3M5LA 4X8VH 5T6DA 1GHBG 4Y8ZA 1S84A 1CA0C 1JBUH 4DG4A 2UUFB 1A3EH 1TRMA 4CRCA 1GI2A 1Z1IA 3QO6A 1QQUA 4X6MA 2VIWA 4Y0ZE 1KXBA 4HGCA 4K8BA 1P05A 3PV4A 2PKSC 3ZZ4A 4I31A 3RXDA 3BEFB 1V2OT 4MVNA 2XYAA 1OOKB 5C2ZA 1CE5A 1A2CH 4XBBA 4CH8B 3SU2A 3LJJA 1MZDA 3UUZA 1GJBB 2XXLA 5EXNA 2ZKSA 1DOJA 2HPQH 1HAPH 3A80A 1FI8A 2BY7X 4JYUH 3BEUA 2PR3A 1IQEA 1IQMA 1TBZH 2AIPA 2WV5A 3TGKE 3KQCA 3T29A 1ETTH 2IOTA 1AN1E 5DKMA 2I6SA 3EA9A 4Y11E 3ZZCA 1MAYA 3VXEH 2GZ7A 3A7YA 3E91A 5L2YH 2JETB 1O3NA 5DO4H 1EASA 1UO6A 2QCYA 3RXLA 4FXGH 3V12A 2R3YA 2ZHDA 5DGJA 3VEQB 4B2CA 1GJDB 2FX6A 8LPRA 2AH4X 2RCEA 1BB0B 5ETXA 4ZROA 1D6WA 3FZDA 3GICB 1THSH 1ZHMA 2STBE 4NSYA 1C1QA 1M9UA 1JRSA 4DCDA 3SUEA 2ULLA 1PJPA 2P94A 1JWTA 1ZPZA 4GCHG 1MTWA 2Z3EA 1ELGA 1XVOA 1RXPA 5A09A 1DUAA 4DIIH 2BY6X 3TU7H 1HUTH 1G37A 2A2XH 3LH3A 1W7XH 1Y3UA 2ZF0H 2ALPA 1QRXA 2EI7A 1QL8A 3RDZA 1MTSA 2VB0A 1GMDG 3ODFA 3A85A 3ATWA 1ZZZA 2VU8E 1OP0A 3VB7A 1ABJH 1SGTA 1S85A 4GSOA 4RKJB 3ESTA 2FESH 3OYPA 1WTHD 4AG2A 5C1UA 5BRRE 1GBLA 4X1PU 5DG6A 3NCLA 4YT6H 4KKDA 1QA0A 4TPIZ 1O2XA 1UVUH 1Z8IB 4UFEH 1U6QA 3K2UA 1XUIA 8GCHF 1S6HA 2Y5GA 1AI8H 3LGIA 1N6YA 1TYNA 2FDAA 2PWXA 2V35A 4AOQA 2J95A 4TYDA 4KTUA 4XBCA 1FY4A 5HM2A 1GI7B 2VWLA 1K1OA 1LPGB 4H6SB 4U01A 5GCHG 1O3HA 1K1PA 2V3HH 2ZIQH 3BTFE 4I8HA 1DFPA 1YCPM 2FYRA 4K1TA 1T32A 4ZKSU 2ZCLP 2BM2A 1C1PA 1WBGB 1AB9B 1KIGH 2HVXA 1L4ZA 1O2GH 3A8AA 2VVVA 2ANMH 2VVCA 1FY1A 1EATA 2H2ZA 1O3FA 4JZDH 1TLDA 2HWLB 3SQHE 1LPKB 3PROA 4YT7H 4FU8A 3F6UH 3GY7A 4ABJA 1PPHE 1P2JA 3F9FA 2Z3CA 1DSUA 1FAXA 4X6PA 3RXHA 1H8DH 1TOCB 2QXGA 2PGBB 3DFLA 1TNGA 1GWAA 4RSPA 7KMEH 3M3SA 1BTXA 2W5EA 1OKXA 1GBBA 2ALVA 4B1TA 1GBHA 1SFIA 4X2YA 4E05H 1MH0A 2D8WA 3U98H 2B0FA 1UK2A 4D7FA 3SI4H 1TX6A 3AAVA 3QTVH 1QJ1B 1TIOA 1O5GH 1GDUA 1SQOA 1C9TA 1VITG 1PPGE 1V2NT 1LTOA 2WYJA 7ESTE 5TJXA 1SGDE 3R0FA 4Y79A 4RN6A 2W3IA 3HK3B 1DXWA 5HMAA 1DT2A 2WPHS 2OD3B 1BTYA 4MNYA 2PSXA 4UFDH 1ID5H 4ESTE 1V2UT 4IN2A 3M7TA 1O0DH 5A8XA 1MTVA 4I8LA 3P8FA 1TMTH 2BTCE 4HFPB 3RMMH 2H6MA 1TNIA 3AASA 4FUHA 3RU4E 3FVFB 4A7IB 4WWYA 3GCNA 4CBNA 2BY9X 3KQBA 4D9QA 1S82A 2K1QA 3MNCA 1FUJA 2XCFA 1P2NA 3SJ8A 1ZGIA 2QF3A 2AIQA 1NFXA 4AGJA 2R2WU 3A7TA 2J34A 1AIXH 1VJ9U 2HPPH 2SGPE 1DS2E 4K69A 5C1XA 5E0GA 3VFEA 3LGYA 1CHGA 1VCQA 4MDSA 2JKHA 1C2MA 4UDWH 3GYMA 4ISLA 3A83A 1Q31A 2GDDA 3BTWE 1BUIA 1UTKA 1XUHA 2BD3A 2UWOA 3PMJA 3SU4A 1SLWB 2BX4A 1O2ZA 1YP9A 3BTDE 3HKJB 1PYTC 4CRBA 2A5IA 2UUKB 1ELFA 4IN1A 3SZNA 1ZSJA 3UQVA 5JBCS 1SGFG 1Y8TA 2CF9H 1UCYE 1IQHA 6LPRA 1DWCH 3RXOA 4K5ZA 1VCPA 2ZFQH 3SQEE 2PTNA 1NRSH 1CA8B 3ATKA 1L1JA 3A87A 1DWDH 1C5WB 3SUDA 1W0ZU 6CHAC 1C1VH 3UOPA 3ZVCA 4JK5A 1FN8A 3P6ZB 4NZLA 2ZGHA 1EKBB 3LDXH 2ODPA 2VIQA 4AGKA 1MQ5A 4DJZB 1XUKA 1QBNA 1W8BH 1ANCA 2ZO3H 1OWKA 1NRQH 2FOAA 3E6PH 1FLEE 1GBMA 2IPHA 5HGGA 1HIAB 1V2RT 2O8TA 3GOVB 1UVSH 1CBWC 1YKTA 4B71A 1E35B 5FXLA 1K1LA 2BDBA 1WV7H 1GI6A 1SGEE 2OC7A 2AMQA 2FI3E 1O2TA 2F9BH 2GV7A 3GYLB 4WMDA 4ZKOU 3S0NA 4A92A 2OLGA 4FUIA 3BG4C 1GCTC 4IC5A 2QC2A 3TJVA 1ZGVA 1GDNA 3RXGA 5DPAA 4BTIB 1N8OC 1PYTD 3BIVH 3RXTA 1J8AA 1PPFE 3EQ0H 1MKXK 1O2YA 3S69A 8GCHG 1MCVA 3M7QA 1TBRH 3SHCH 1AHTH 2VIOA 2WINI 1B0FA 1N6XA 1QQ4A 2Y6TA 3V3MA 1ZMJA 1MBQA 4D7GA 1DX5M 3QN7A 2QYIA 2QA9E 1O3KA 1D4PB 1TNJA 3LU9B 1C2JA 1HJ9A 1ESAA 1C1SA 5EPNA 1ESTA 3TH2H 2ZFSA 1EPTC 1KXAA 2F9PA 1HGTH 3U69H 4HZHA 1AQ7A 3TH4H 1RTKA 1QBOA 2SGEE 4HI3A 3OTJE 1GJ8B 1DITH 1QJ6B 1HXEH 2A0QB 3MI4A 1GVLA 2BHGA 1ARCA 2P8OB 1P9UA 1W12U 3ATMA 1N1LA 1YCPH 2UUYA 5HYOA 1HAVA 3RXJA 4O9VA 1P04A 3MU5A 3GISB 1IQFA 1VGCB 4ABGA 3UQOA 1LHCH 2NU4E 1W0YH 1ZSLA 4FUGA 3KCGH 1ZJKA 1W13U 3E1XB 4ZUHA 1Y5BT 4TWYA 5F6MA 4GPGA 3HATH 3LONA 1PPZA 1YPHC 1H9LB 4WF8A 2ZU3A 3MU8A 4X6OA 3S7KB 1MD7A 2PUXB 1YPGH 2HNTC 1HAXB 3NXPA 3NPSA 2UUJB 2IJOB 3PWCA 2XBVA 1SQAA 4WH6A 3RC5A 3OX7U 3TVJB 2Y7ZA 1X7AC 3UOUA 4ABFA 2ILNA 2ZHWH 3K65B 4H4FA 3ZZ5A 1ELTA 2F9NA 1QRWA 3VB6A 1BTWA 2A45B 1LO6A 3MNBA 4K2YA 2ZU1A 4MNXA 2AERH 5JDUB 4XOJA 2BYAX 1ELCA 4TPYA 1OYTH 3V7TA 1KDQB 5FX6A 1GI1A 1SLXB 2B9LA 3SV6A 1ZMLA 1HAYB 1KXFA 2GCHF 2XCNA 1YPLH 3RXRA 3U8OH 2B8OH 3NUMA 4IBLH 3KEEA 2VVUA 1O2VA 1QB9A 3ZV9A 4B73A 3ZYDA 3Q3YA 3SJ9A 1INCA 4ISNA 4R0IA 2W3KA 1P2OA 1CU1A 3NKKA 4ZAEA 2ZPQA 4NA9H 2SNWA 1NY22 3M7UA 4BNRA 3QLPH 2UWLA 4LK4A 2CHAB 1QRZA 4YM9A 4IS5A 3T2NA 1MMJN 1MUEB 3Q77A 2OBOA 3SV2H 2AGIX 1XUJA 2KAIB 4Y6DA 1T8OA 1ELBA 2VIVA 1Y3WA 5JYIA 4MNWA 1ZMNA 1SG8B 5DP8A 3P70B 3CS7A 4BXWA 1IQJA 3F68H 3FAOA 1FY8E 2A7JA 5JBAS 1P01A 2GZ8A 2YNBA 3GY2A 4RKOB 1HAIH 2OCVB 5GPIB 2F9OA 1T8NA 1O36A 1XKAC 1C2FA 3HGNA 3ZYEA 2CV3A 5B6OA 1TPAE 1H8IH 1NU9A 4CBOA 1LHGH 2BD5A 2NU2E 4X1NU 1ZHRA 2M5TA 2AGEX 3SNCA 3A7ZA 1TPPA 3RXQA 1HFDA 1NS3A 3A8CA 4FUEA 3LC3A 4DY7B 1PQ8A 4ZH8A 2ZFPH 5F8XA 1O3CA 1ELDE 5A0BA 2GV6A 1CBWB 1NU7B 2V3OH 5LPFA 1P9SA 2BVXH 5T6FA 2A4QA 1MTUA 2FOFA 4Z6AH 1UHBB 2LNCA 4BAQB 5L2ZH 1A4WH 1TMUH 1ABIH 3SHAH 2O8WA 2ZU4A 2ZZUH 1E0FD 4Y76A 1FAKH 3BTME 1YPEH 1SR5C 1O3MA 2BY8X 4INLA 2ZPRA 3SNEA 3A88A 3PB1E 2PW8H 3TPIZ 1RTLA 1MTNC 2TGAA 5EODA 2TPIZ 2FTMA 1RS0A 5ABWA 1QURH 3U8TH 1WTGH 4MLFB 1G3BA 1LKAA 1EJAA 2ANYA 3TITA 2A5KA 4OGXA 5GJ4B 3UIRA 2ZGCA 3BIUH 3CENA 3A86A 4GUXA 3P92A 4MPUA 1GHWH 1RJXB 2H9TH 1OWIA 2CXVA 1BBRK 1SB1H 1SLUB 1VJAU 3PO1C 1GGDB 3LKWA 2VGCC 3S9CA 2BX3A 3OY5U 1ETRH 4J2YB 4TY6A 3LC5A 3ZVAA 1EP6A 1E34B 3I78A 7LPRA 2V0BA 5L30H 5IYTA 5F8TA 5DP6A 1UTQA 1HAHH 2WPKS 1K1NA 4BAMB 3Q00A 1L2EA 3M3TA 3TIUA 1SOZA 3UNQA 2QY0B 1H1BA 2C8XB 3SORA 4AB9A 4BTUB 1K1MA 4BOHA 4XSKU 2A32A 2D2DA 5TCCA 4Y71A 3GDSA 1DLEA 4U30A 4X0WU 5SGAE 1IOEA 3RXSA 1FDPA 1NO9H 3D49H 1HCGA 5DK1A 1HPGA 2QN5T 1GBFA 1MKXH 1TALA 2DE8A 4YOIA 3ZVEA 4VGCB 1MQ6A 1EZUC 3IWMA 2G4UA 1G2LA 1SVPA 2HLCA 4FU9A 5A8YA 4YOJA 7GCHG 1SQTA 1YLCA 1ZJDA 3OY6U 3RXVA 5DP5A 1QGFA 2GT7A 1FQ3A 2D1JA 2XBXA 2V6NA 3UY9A 2ZQ2A 4A5TS 3E90B 4AG1A 1G30B 3U1IB 3B23B 1AVXA 3UNRA 3LGUA 3ELAH 3MH6A 3BTKE 2CN0H 5ESBA 5T3HA 3F9EA 1YCPK 4CREA 2FWWA 1ESBA 3GDUA 4XFQA 4UONA 1MBMA 3M37A 1VZQH 1GMCF 5LPRA 3A81A 4K1SA 3GCHB 4X1QU 3RLYH 4ZMAH 2EC9H 1THPB 4I32A 1FY5A 1C5ZB 3EDXB 2ZTYA 1MAXA 2GCHG 3MU4A 1LHEH 1AFQC 1IQGA 1IHTH 1EPTA 4AB8A 5EW2H 1CO7E 1NRRH 1YC0A 1DPOA 1QIXB 2ZCHP 4I8JA 4ISHH 1F0SA 2RDLA 1A3BH 2AGGX 2BD8A 5EPYA 3PMBB 4SGBE 1SBWA 3TJUA 3MNXA 3VPKA 1SOTA 4AN7A 5C67A 3P8GA 2GCTC 1A46H 1J14A 1K1JA 1F0RA 2QIQA 1MCTA 2H5DA 4AFUA 4NIWA 3KGPA 5FHTA 3HGPA 3PMAB 3S9BA 1GBAA 1CT0E 2BVRH 5I46H 2VIPA 2VNTA 3MOCA 2WPLS 4ZKRU 3L33A 1Z1JA 2ZDKA 1UTJA 1GG6B 1O37A 2VWOA 3ZV8A 5GDSH 1GL0E 1LCYA 4U2WA 1C5TA 1CGHA 1AZZA 1NRPH 1YPHE 3RLWH 1P2MA 1V2WT 1GHYH 4Q7YA 5JB9S 2O8MA 2G00A 1GJCB 1F7ZA 3DFJA 5GIBA 1C1UH 4GHQA 1NN6A 1IQLA 3DHKH 4YLUA 2FS8A 2ZPSA 3QTOH 2TGPZ 3DD2H 2VINA 4WMFA 3ATLA 1DICA 1QL9A 1GHXH 5A0AE 5C20A 1ETSH 2W26A 5E2PA 1TX8A 1EZXC 1O3AA 1C5YB 2Z9IA 1GBEA 1O30A 1NROH 3FFGA 1O5FH 1FXYA 2EI6A 4NIXA 1E37B 3P17H 1BZXE 2ZFFH 1C5OH 4CHAC 1LVYA 3HK6B 2ZDMA 3GDVA 3F9HA 1RGQA 1L1GA 1THRH 1W3CA 1P10A 3PWBA 1W14U 1EXFA 2ZHEH 1K1IA 1FZZA 3MH4A 2J92A 2ZGBH 2HOBA 2BDAA 1XVMA 4NFEA 2YOLA 1CA0B 1O5AB 2BQ7B 1Y3VA 4DT7B 1FONA 3RXIA 4B75A 2BZAA 1AE8H 3MWIU 4SGAE 3MMGA 2PSYA 1AO5A 2PKSB 3EYDA 3TJOA 2ZDNA 3BTTE 5PTPA 3AW0A 4KTSA 1A1RA 3F1SB 2Z9KA 4B74A 5T6GA 1EJMA 1AUJA 2SNVA 4YESB 1O2PA 2NU1E 2B5TB 1O3JA 1ZRKA 3KHVA 3SOSA 1H4WA 2J4IA 1LMWB 2FO9A 4NG9H 5AVDA 3GCTF 1V2MT 1MKWK 1BTUA 3H7OA 3PYHA 2BQWB 2RG3A 1O5CB 2GMTC 3RMNH 2OC1A 2ZDAH 2LPRA 2YNAA 4WXIA 1DDJA 4E7NA 4X8UH 4B2AA 3VGCC 1ZTJA 3FP8E 1V3XA 3EA8A 5H4IB 2FIRH 1WQSA 1GI8B 2W7UA 2BDHA 1Z8GA 4NWLA 4AYVB 1F5KU 1SGFA 5FPTA 3UTUH 1V2PT 3N7OA 4A1TA 1ARBA 1BHXB 1ZTKA 2BDYA 2ZWLH 2ZU2A 1NRNH 2AMPA 4PROA 1ZOMA 1UTNA 5E0JA 2JH6D 1SGPE 4CR5A 1F5LA 3MTYA 1CHOF 1ZTLA 1YF4A 1GBJA 1QCPA 1Q2WA 1CT4E 4Y7AA 3NZIA 3H7TA 5DP7A 1G3DA 4KGAA 1EOLA 2TRMA 1KLIH 5CHAC 2C8WB 4I33A 5EQRA 1BBRH 1XUGA 2PV9B 3M5MA 5JBTA 3TK6A 1OPHB 3QUMP 3T5FH 1MU8B 4O3TA 1P2KA