1O2QA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2qA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2qA02
1MQ5A 3KL6A 3SO3A 1HAVA 2BD9A 2BOKA 2Z9GA 4CHAC 4ZXXH 3FFGA 1ZHRA 1DT2A 1BMLA 1LHCH 4OS4A 3MNBA 2ALPA 1P2IA 2EEKA 2NU1E 4K3JA 2BY9X 2C8WB 2OD3B 4Y0ZE 2BDAA 1B0EA 5A2MH 1INCA 3GCTF 4QT8C 3STIA 2VNTA 2IOTA 1KYNA 2BVSH 1ZTJA 1W7XH 1TQ7B 3A80A 1DLEA 1Y3XA 1IHSH 2GZ9A 4FUHA 2B5TB 6GCHG 1C2MA 4MQAA 2F9BH 1O3JA 1V2OT 4WH6A 1V6DA 1JWTA 3S7HB 1V2LT 2JH6D 4IN1A 5FXLA 1PFXC 2G55A 2P16A 3SJ8A 1ZOMA 3URCA 1HXFH 2GCTC 1IQFA 1DE7H 1EPTA 4DG4A 1AVGH 1Q3XA 2ZI2H 3OYPA 4Y7AA 4Y8ZA 1ACBE 8GCHF 1GJCB 1O3MA 2SGEE 4B71A 1DSUA 1PPEE 2ZFPH 1YPLH 1YPEH 4WF8A 4UFGH 3MWIU 4UD9H 3RMNH 2A1DB 2FLRH 1SGPE 1W11U 1O2IA 2VVVA 1ZYOA 2ZF0H 1C5YB 5A0BA 2OC8A 3ZZDA 1C5WB 1BMNH 3W95A 3OSYA 4K1TA 4AG2A 1QB1A 2ZU2A 4Y76A 1GDQA 2O8MA 1DY9A 1ZRBA 4FUIA 1XUJA 7GCHG 1KY9A 1T4UH 1F0RA 1NT1A 1UTPA 1DY8A 2RDLA 3P70B 3ATIA 4NWLA 1MAXA 2XNIA 4UFFH 2BB4A 1O3LA 1QRZA 4IBLH 3L6PA 1O3GA 4DURA 4A92A 3GOVB 2R9PA 5HM9A 2AYWA 3TJNA 1IQJA 1LCYA 4Y8XA 2FOFA 1Z1JA 7GCHF 2K1QA 1QL8A 1IHTH 2H5CA 3TK5A 1CHOG 4MNWA 2UWLA 1G3CA 1J17T 1EB2A 4RKJB 5FPSA 2TGPZ 3UY9A 1BMMH 4Y71A 3QLPH 2J2UA 1AFQB 1UCYK 1PQ7A 1TGSZ 1O2TA 1XUKA 2G51A 2ZDNA 1TPAE 3A7TA 1IOEA 4FUFA 3BTKE 1GMDF 2Q1JA 4AYVB 3SU6A 1P02A 1VITH 4X6NA 1DXWA 1UVTH 3TNSA 5DP5A 2WPMS 1EASA 3M5LA 4TY6A 1GBDA 4GCHG 3UR9A 5I46H 1HJAC 5B6OA 5JBTA 1C1TA 2PLXA 5F6MA 5K0HA 1O37A 2XRCA 1P01A 1AY6H 1GBEA 1HJ9A 1ANBA 1LPZB 3CS7A 2ZHFH 1SSXA 2XBXA 3KNXA 3ZZAA 2VB0A 4I33A 4MPWA 1LTOA 1E34B 1YM0A 2ALVA 1ZTKA 2R2MB 1D9IA 2GT7A 1S6HA 2ZFFH 1GGDB 1GL0E 2ZDMA 2HNTE 3PLBA 1EP5A 1TOMH 3LC5A 4YOGA 1PQ8A 1GJ8B 5A09A 4OGYA 3RUOA 1NRSH 2CXVA 1C1WH 1P2NA 3M35A 2QGRA 1Z71A 2XBYA 1W0ZU 4XBBA 1B5GH 2ODYB 1WCZA 4E06H 1UTLM 1T8LA 2FI4E 2HWLB 5T3HA 4WXIA 2V3OH 3URDA 2AFQB 2FXRA 2ULLA 1LQEA 2UUJB 1GBCA 2GDEH 1UK3A 1FAKH 2DE9A 2ZFSA 2HRVA 1TE0A 4AGJA 4R8TB 2FOHA 1LPKB 1J9CH 1P05A 2TGAA 2VGCC 3TITA 3I77A 2WV4A 1G30B 4GHQA 5SGAE 4OS2A 4KTCA 3LKWA 4ABIA 1MKWK 1YC0A 1W2KH 7ESTE 3KF2A 5AVDA 3O8CA 3TPIZ 4Q7ZA 1MQ6A 1WTHD 3AVZA 1UMAH 1KTTB 1EZQA 3M3VA 1SLXB 3Q3XA 1TBQH 2J95A 1QY6A 3S0NA 2VH6A 4AB9A 1SPJA 2Y5FA 1Y5BT 5C1UA 1J14A 1YP9A 1G3DA 3ENSB 4YOJA 1ELEE 4Q2KA 1KXEA 4NA9H 3N7OA 4Q7YA 1OKXA 2B0FA 2UUKB 3EGKH 1CGJE 1Y5AT 1PPGE 1PJPA 4HI3A 2HLCA 1A46H 1GBBA 3BN9A 2ESTE 4IGDA 4UFDH 2ZTZA 1FY3A 3E16B 3AAVA 4JZDH 5C1XA 2Y7ZA 1C5NH 1P09A 3UNQA 1AWHB 1TA2A 2BMGB 3MNXA 3LGUA 1CGIE 1TX7A 3ZZBA 3UQVA 1A0JA 3Q00A 2PGQB 4KKDA 1TNIA 3QTOH 5A0CA 3PMAB 2H9TH 1G2MA 5DP9A 1CT2E 1SGQE 2Z9IA 3GCHC 2QXIA 4X8SH 2CF8H 4INLA 1YLDA 1YCPK 3U8TH 1V2UT 1K1PA 4Z6AH 3NCLA 3GY5A 4ABFA 1ESTA 1RTFB 2SGAA 3SZNA 1T8NA 1GBAA 2Y81A 3GYLB 4ZKNU 1EATA 3GCOA 5EODA 4B76A 2CN0H 3TLOA 4GVUA 3EE0B 1WV7H 3TJUA 4BAKB 1O2JA 2FMJA 4CBOA 3PLPA 5DO4H 1NS3A 1EPTB 1RFNA 5FCRA 3U1JB 3B8JA 4X0WU 1DUAA 4NA8A 1FNIA 1HAXB 1O3KA 1OWHA 3R3GB 2FODA 1GWAA 4VGCB 3SNCA 1FY1A 2HNTF 1HAGE 3SNAA 1BQYA 4B75A 4JMYA 2WYJA 1BB0B 3KEEA 3FANA 2P8OC 1V2NT 5C67A 4TY7A 2HPQH 5DPAA 1ID5H 4BOHA 2CV3A 4ZHLU 4ABDA 1C1NA 1P04A 1JBUH 2QXHA 5JDUB 4MPUA 2Q6FA 2ZPSA 1BJVA 1UO6A 1GI3A 3KQEA 4JYUH 1SGYE 3UFAA 3TH3H 3HGNA 3P95A 3ZVAA 4ZAEA 1GVLA 3A8AA 3OTJE 1GBMA 2B9LA 2PWXA 1ZTLA 3U98H 2XC4A 1FXYA 1OP2A 1LKBA 1SQAA 3ATMA 4YTAA 2VWNA 2BOHB 2D26C 4DGJA 2BY8X 2H9HA 2WPHS 4RKOB 2QC2A 1BHXF 2CMYA 4CRGA 3P6ZB 1TRNA 3VGCB 4B2CA 3EDXB 2A5IA 5HYOA 5F8TA 3TGIE 3BTDE 2ZG0H 1NZQH 1SOTA 2BQWB 1TPSA 1QB6A 3GCNA 3KIDU 2Y7XA 1W7GH 3A86A 1VR1H 3MFJA 5A0AE 3MI4A 4Y79A 2AGEX 1O2PA 1O3IA 1K1JA 2AGGX 3FAOA 1WQVH 3SJ9A 2UUFB 1P2JA 2R3YA 3EA7A 3O8BA 2HALA 4BTIB 1G3EA 1V3XA 1T32A 2B7DH 2F83A 4JCNA 3MTYA 1T8MA 1GBKA 2WV5A 1LHFH 2ZPQA 1XKBC 2QY0B 2XW9A 4SGAE 2FWWA 2G8TA 4CHAB 1TRMA 3T25A 1FY8E 1TABE 1TOCB 1HRTH 1K1NA 3K6ZA 1BTWA 1A0LA 1GVZA 3MU1A 1C1OA 4GSOA 1HUTH 5HM2A 5C20A 1BTHH 1C1PA 4FUDA 1GMHF 1H1BA 4I7YH 4CRDA 1GJ6A 2WPIS 2J92A 1V2TT 3EYDA 1O0DH 4DOQA 3F9EA 1NU9A 5C5OA 4BAHB 1A7SA 2VIQA 1BTPA 3UOPA 2G5VA 1C5TA 1PPFE 2A7HA 2ZCLP 1XXFA 1HXEH 2F9VA 1ARCA 3WY8A 2FOCA 1O31A 1O3CA 1VCPA 5E2OA 1O3EA 1D3TB 1UTQA 4XBCA 1SHYA 1K9OE 4K69A 2B8OH 1S0RA 2V0BA 3E0PB 2GT8A 1C2DA 3SORA 1WBGB 2OC1A 4AFQA 5EQQA 3QK1A 1FPCH 4FVBA 1S0QA 5JBAS 2FX6A 4CRBA 1E36B 2A7CA 1AE8H 1SGFG 5FPTA 1GMDG 2Z6BD 4MNXA 1EOJA 4JZFH 3DT0H 2ZA5A 1MTNB 2BXUH 3MO3A 1GPZA 1GBFA 2O8LA 3SHAH 3MMGA 2V3HH 3A8DA 1JMOH 1V2VT 4O97A 1MTSA 1K1LA 1QHRB 1SQOA 1ZSLA 2FO9A 1QJ1B 1N6YA 1W3CA 4X6PA 4BNRA 5AHGH 1OP8A 4D76A 5BPEA 4TPIZ 1A5GH 3MH6A 4J1YA 1P0SH 2QCYA 1CT0E 2O8WA 3T26A 4A6LA 1Z1IA 1AQ7A 3ZVGA 3EA9A 2A4OA 3SU1A 1SQTA 1E37B 2ZDKA 1TBZH 3HATH 3LDXH 1O5BB 6LPRA 1K1IA 1P2QA 1DICA 4YT6H 1BBRK 5AF9H 1CBWB 1P3CA 4R0IA 5JB9S 2CHAC 1ELDE 3FP7E 3LU9B 3AW1A 3F9HA 1P9UA 1D3DB 1DDJA 2FYRA 1QQUA 1K21H 1T31A 1EZSC 4O03A 2KAIA 1HIAA 2Z7FE 3Q77A 1PPHE 5DP8A 1FN6A 1AFQC 1L1NA 1TBRH 2ZDLA 1ZPCA 1KXCA 1G3BA 1NO9H 1NFUA 4HZHA 4I8JA 1UK2A 1FONA 2ZFRH 1C5XB 3O8DA 1XUFA 1XUGA 1TRYA 4A1VA 2NU3E 3M3TA 1S6FA 3ODDA 2BDGA 2XBWA 4K1EA 3PM3A 1QB9A 2J4IA 1C5PA 1DFPA 2YNAA 1OOKB 1FQ3A 1TALA 3PLKA 1NRPH 3VPKA 5DG6A 2TGDA 2ZGBH 1P10A 5ABWA 6GCHF 9LPRA 1PPZA 1YCPH 3L3TA 4ZHAA 1C2GA 2A31A 2BQ6B 3GDVA 1ZLRA 2PTNA 3A88A 2OBQA 1IQGA 3EAJA 4ASHA 4B2AA 4AB8A 1GMCG 3F9FA 3L33A 1O2VA 1H4WA 3E91A 4LOYH 3A84A 1EB1H 3NUMA 3GY3A 4MDSA 2H5DA 1GBLA 4X6OA 4NSYA 8KME2 1RS0A 4Y6DA 3EA8A 1YLCA 2FLBH 5GXPA 1GI2A 2EI6A 2EI8A 1YPHC 4YESB 2FP7B 2R2WU 4K2YA 4SGBE 3ZV9A 3ZVCA 1GBIA 1QRWA 2BD4A 2VIOA 3MYWA 3TK6A 9ESTA 1EZXC 1HBTH 4ISIH 4H6SB 1E35B 1MU6B 1O39A 5FHTA 2XCNA 2ZHEH 2BX3A 1JRSA 2ZGJA 3A83A 3BTFE 1DWBH 1FLEE 1P8VC 4NA7A 5A8ZA 3QTVH 1GHAF 2ILNA 2GV6A 3RXOA 1O38A 4WVPE 2FESH 5GJ4B 5LGOA 1C2FA 1T8OA 4HGCA 2C8XB 3ZVFA 1CE5A 4BAOB 3H5CB 1K1MA 1HB0B 1L0ZA 2VJ1A 1L4ZA 3MO6A 1TAWA 4GCHF 3F6UH 1EKBB 1A1RA 4UEHH 4ZROA 1CU1A 1YCPM 1ETSH 1KDQA 4NZLA 4FU9A 3BTWE 4ABAA 4Z0KA 2BD7A 1MCVA 1KXAA 3BTME 2OP9A 1MKWH 1LQDB 2BVXH 8LPRA 3RXDA 1DVAH 1RGQA 1MTVA 1TFXA 2ZDVH 4I8KA 2BLQA 5HXFA 1GJAB 1HAIH 3NK8A 1UVPA 1O5FH 4D9QA 2XWBI 3A89A 7LPRA 1QJ6B 1LDTT 1GHWH 1O3HA 2J34A 4RSPA 1ESBA 1LMWB 3UR6A 3SUDA 2GX4A 1EJMA 2IN2A 2ZEBA 5JYIA 4ZMAH 1ELTA 3UQOA 1QRXA 3PTNA 3QX5H 2ZWLH 1BMAA 2GGVB 3RXRA 3K65B 5LPFA 1JIRA 4NIYA 2Z3EA 1N6XA 4KTUA 3RLYH 2FI5E 5K7RA 2H9EH 2FPZA 4KGAA 1SFIA 2ZPRA 2DE8A 3OY6U 2PFEA 3UIRA 1LHDH 2BLVA 2IJOB 3IITA 1TMTH 2C93B 3CS0A 1J16A 1GCTB 1EP6A 3ZZ6A 4KP0A 3P8OA 1DOJA 1FIZA 4NIWA 1MBQA 1OSSA 4ABGA 2ZZUH 1P11E 1ELFA 1OS8A 1H9HE 3PWCA 1GI7B 3S7KB 5JPMH 1SVPA 1ZZZA 5FAHA 4FUCA 3SOSA 1GHAG 3MO9A 4D7GA 5EG4A 4AORA 3HK6B 1ORFA 1TMBH 3TU7H 4Y8YA 4X8UH 3S69A 2FDAA 1NY22 1C5VA 1BZXE 2HOBA 2VIPA 1AUTC 3SQHE 1MKXK 5E2PA 2ANKH 1S85A 1O3AA 1GBHA 3ZZCA 1DX5M 1UK4A 3LIWA 4DIIH 2PV9B 1ANDA 4BXSA 1ZHPA 1F5RA 2A5AA 1EXFA 3A7VA 3K9XB 3S9BA 2HNTC 3KN2A 1FN8A 3SU0A 1EOLA 2GDDA 2BZAA 1P03A 1AKSA 1VCQA 1AB9C 2YOLA 4IS5A 4ABEA 3K6YA 3SUFA 5EXLA 4D8NA 1VITF 1IQMA 1LHGH 3BIVH 4KELA 3ZYEA 2WYGA 5EPYA 1ZHMA 3SU4A 1YPGH 2XBVA 3KGPA 3RC4A 1VJAU 5G4BA 3ZV8A 1NESE 4TYDA 4WWYA 1K1OA 3H7TA 1QBNA 4HTCH 4AX9H 1E38B 1GL1A 4NSVA 4MNVA 1A2CH 1QQ4A 1D4PB 3GDSA 3TGKE 1MH0A 5DP6A 3U8RH 3BG8A 3A82A 2Z9JA 1ELBA 4D7FA 3KHVA 3PYHA 4X8TH 1TNKA 2PSXA 2BLWA 1F2SE 4WMEA 4XE4A 1C1SA 3C1KA 4WH8A 1ABIH 1P3EA 3NXPA 4BAMB 1D6RA 3UNSA 4X2VA 1HV7A 5C3NA 1FAXA 1QGFA 1TGNA 3PROA 1CA0C 1VITG 3BSQA 1PPCE 1NFWA 3QWCH 3FVFB 1BITA 1ZSKA 4ISOA 2SFAA 1Y3UA 3PMBB 1BIOA 2J9NA 2FOAA 6CHAC 3SV2H 4NWKA 2Y5HA 2ZFQH 3PMHB 1FI8A 1NTPA 2BDYA 1LVBA 1Z6JH 3SGQE 1A4WH 3BF6H 1C1QA 4JZIA 1HGTH 5GDSH 1SL3A 5GPIB 1EAIA 3S9CA 1RIWC 1PQAA 1AVWA 1O2MA 4ZXYH 3SNDA 1EAWA 3IWMA 1YGCH 2PUQH 3A7YA 1ETTH 4OS5A 2G5NA 3M61U 4X6MA 1DANH 1VGCB 3BG4B 1J15A 1WSSH 5C5NA 7KMEH 2SNWA 2NU4E 4MLFB 4X2YA 4NG9H 1BTXA 1TX6A 1GDUA 1V2MT 1O2KA 3F68H 4B1TA 1GG6B 1ZGVA 3IG6B 3T29A 4IMQA 4KTSA 1OWKA 4X1QU 1RXPA 4PROA 1FUJA 4AN7A 1O3BA 1O5DH 3RLWH 2FI3E 1SGDE 2QAAA 2WPKS 1KDQB 1P12E 4BXWA 2TGTA 3LONA 1BTUA 1H9LB 1V2RT 3SGBE 2F9OA 1MZDA 2FOEA 2BDCA 3SI4H 2F9UA 2ZHDA 5FBIA 4TPYA 1FJSA 1QTFA 4O3UA 1CA0B 2PKSC 1DS2E 5C2ZA 4GPGA 1L4DA 3BTHE 4NGAH 2EI7A 1OWDA 4X2WA 1JXPA 1TONA 3O8RA 1DWCH 2FIRH 2JETC 3LH3A 3LGIA 1BHXB 2GZ8A 1OWJA 2PR3A 5EW2H 3RU4T 1UVUH 1GJ7B 3TH2H 1Y8TA 3GY4A 4K1SA 3E0NB 1G36A 3V7TA 1MD8A 1IQLA 3SV7A 4OS6A 1Z8IB 2ODPA 2SGPE 1HIAB 4U32A 1RJXB 1UJ1A 3ZZ9A 5E0GA 2ZQ1A 5PTPA 1KLTA 1C2IA 1TNGA 1RRKA 2GMTB 2OQ5A 1IQHA 1L2EA 3SV8A 2ZU5A 3QO6A 4DY7B 3M5OA 4K8BA 1RTKA 5HGGA 4XFQA 5TCCA 4ESTE 1RTLA 2QIQA 5E0JA 1ZPZA 1AUJA 1P2OA 1A5IA 2NU2E 1TX8A 1GHZA 4A1TA 4YOIA 5EOKA 2P8OB 4AOQA 1HAPH 1Q2WA 3RP2A 3PO1C 1ZR0A 2ASUB 1XMNB 1ZMLA 4IC6A 3VGCC 3SW2B 3RXBA 4BANB 4NZQA 2FOBA 1QIXB 2WUBA 3P17H 3G01A 4U01A 3T28A 4B73A 1O2GH 5DK1A 1BDAA 1C2JA 4GUXA 1IAUA 1HCGA 3GY7A 3RC6A 1GGDC 1ANCA 1WQSA 2ZHQH 3BTGE 2Z3CA 4RN6A 4INHA 1O2ZA 3NPSA 3GCTG 4X1RU 1NRRH 4DVAU 4MVNA 3RXUA 4HFPB 3RMOH 3FZZA 1V2QT 3KQBA 3ODFA 4IMZA 1JOUB 2ZP0H 1C5RA 3SJOA 1E0FD 1RD3B 2O8TA 4X1SU 1YPHE 4ZKOU 2CGAA 6ESTA 3I78A 5DKMA 3M36A 1GHVH 1MZAA 3A87A 2OC0A 3KQCA 3RXKA 2A0QB 1O3FA 4X8VH 3ZVEA 3SGAE 3C27B 2R0LA 4JK6A 1Z8RA 1H8DH 3E3TA 2UUYA 2Y80A 1UTJA 3ZZ3A 2OUAA 1Y3WA 1YBWA 2W5EA 4JZEH 1B7XB 4NFEA 3UTUH 3CENA 4O3TA 3M7QA 1P57B 1C9TA 3RXHA 4WY3A 4A5TS 1SLUB 2ANWA 2Q6DA 2R0KA 1MMJN 1O2HA 1SGFA 3E1XB 4Y0YE 1NM6A 4I8LA 4CRCA 3GISB 4FUJA 4JK5A 1O2LA 4YM9A 2BD8A 1YPMH 1DWDH 1CVWH 3HK3B 4UE7H 4Y10E 1V2ST 1MCTA 1PYTD 2VVUA 3TVJB 1P2MA 1NPMA 1PQ5A 1X7AC 1BA8B 3FZDA 4E05H 2RA3A 1MUEB 3A85A 3UWJH 1SLVB 3E6PH 2XCFA 3QGJA 2A2QH 2TBSA 3A8CA 1XM1A 2A32A 1BRCE 1ZMNA 2QN5T 4MPVA 2AERH 1GDNA 2BDIA 3V13A 3S9AA 3ATLA 2UWPA 1AVXA 2WPJS 3ZZ8A 4ISNA 3HGPA 2F3CE 4D9RA 3BEFB 1AMHA 3RXFA 1K2I1 2GP9B 4DW2U 3ZZ7A 1TNHA 2F91A 4INKA 3CP7A 3SV9A 3A81A 1OYTH 1QL9A 2STAE 2GKVE 4H4FA 3RXCA 3HPTB 3MU8A 3MNCA 5FBEA 3GY8A 3LGWA 2ZO3H 3QZQA 1HYLA 1GI5A 2A7JA 1C1MA 2BY5X 1V2JT 2PTCE 1KXDA 1YKTA 2V6NA 1JIMA 1GJ5H 1WUNH 4IC5A 3B9FH 1W8BH 4AFZA 1WTGH 4AGKA 1S82A 2Q6GA 5I25A 3LGTA 4GHTA 4JYVH 2KAIB 3RMLH 2VIWA 5DP4A 4MTBA 4JZ1A 1GJDB 1BBRH 1NFXA 1N8OC 5CHAB 1Y5UT 2P3TB 4U2WA 4ABHA 5EQSA 2JETB 5LPEA 1BCUH 1V2WT 2J94A 1FY5A 1FDPA 1OX1A 1Z8GA 4NIXA 2H6MA 3SUGA 2WUCA 3UREA 3ATKA 2I6QA 1EJAA 5T6FA 1C2LA 2SGDE 3RXPA 3ZVBA 1QURH 1IQIA 1CHOF 4DT7B 3LT3A 1GJ9B 1LHEH 1XKAC 3RXEA 2WPLS 1O2UA 1KSNA 1NRNH 3BIUH 1UCYE 2BD5A 1GJ4H 5AFYH 3LC3A 3SHCH 5CE1A 3TJOA 2FZZA 2BDBA 1FIWA 1F0SA 4K8YA 1P2KA 2ZTXA 1LO6A 1HAVB 5L30H 2FOMB 4BTTB 5TCAA 3VXFH 1H8IH 3PV4A 2ZQ2A 1HAZB 2BD3A 3UPEA 2PGBB 5FX5A 2FTMA 3NZIA 3T27A 2UWOA 3LJOA 3LPRA 4FUEA 1O2RA 2AMQA 3RU4D 3A7ZA 3ZYDA 3SU3A 1N8OB 1MU8B 1NC6A 1CQQA 3PMJA 4THNH 3QGNB 3TNTA 1OYQA 2P3UB 3E8LA 1SGIB 1C4U2 2BD2A 1GHYH 3BEUA 1KLIH 3M5MA 4LXBH 2XXLA 3A7XA 2BLOA 1SI5H 3FP6E 1F5LA 1C2HA 2AIPA 4FU7A 1C1UH 1MD7A 3GCHB 3LOXA 3QDZB 4A1XA 1OP0A 1O5CB 4CRAA 3LGYA 4CR5A 2VVCA 2XC5A 1GVKB 1ANEA 1A61H 1XVMA 2FYQA 1BOQA 1C1RA 1MTUA 3A8BA 1S83A 4FU8A 3TJVA 1O5AB 1HLTH 1DLKB 2A4GA 1Q31A 3M3SA 2FEQH 1D6WA 2ANYA 4OGXA 1TNLA 1O32A 1Z7KA 2QV1A 1GI1A 1JRTA 5DGJA 1BRAA 3MU0A 1FPHH 1K22H 1UHBB 1M9UA 4XDEA 2BDHA 3ZZ4A 4AYYB 1A3EH 1SFQB 1CA8B 3Q3YA 1ZJKA 2OINA 5E0HA 4VGCC 2F9PA 1CHGA 4YT7H 5GIBA 1ABJH 1OXGA 3D62A 3LGVA 2GCHF 4M7GA 2FTLE 3D65E 4YLUA 2JH0D 1TGTA 1VCWA 5GWZA 1AZZA 1ETRH 1VZQH 5F8ZA 3DFJA 3SU5A 1YF4A 4I8HA 3W94A 4LZ1H 3ITIA 4UDWH 3PWBA 2Z94A 1QA7A 3RM0H 4CRFA 3UUZA 1DUEA 2G4UA 3ZZ5A 2VH0A 1G9IE 1CT4E 2BHGA 5ESBA 1A5HA 1C2EA 2GVFA 1J8AA 2VIVA 5AFZH 1AKSB 2O8UA 3RXTA 2ZU1A 3DA9B 4X2XA 4DIHH 4TWWA 2CF9H 4NFFA 2ZKSA 4WMDA 1TLDA 5DJ7A 1C5SA 1LKAA 3SJIA 1LPGB 1BTZA 2XWAA 2THFB 3F9GA 1UTNA 1MTWA 2JH5D 4ABJA 1O2NA 2BX4A 4ZKRU 1UTKA 3OY5U 4ZH8A 4NIVA 1AWFH 1SR5C 3RXLA 1NU7B 3LH1A 5TJXA 1ESAA 3MH5A 3K2UA 1CGHA 1W10U 8ESTE 5L2YH 2BYAX 2ZTYA 3T5FH 1EAXA 1SC8U 2DUCA 1W12U 3U69H 2QXGA 3U8OH 4AFUA 3TH4H 1KXBA 3Q3KA 3NKKA 4CH8B 1F7ZA 5BRRE 4LK4A 1UHBA 3LJJA 3FP8E 2W3IA 1MKXH 2CHAB 4BAQB 3TGJE 3SNEA 4AZ2B 1Z6EA 4JYTA 2A5KA 1YPKH 2BY6X 1HJ8A 1NRQH 2Y5GA 2TPIZ 1O5EH 1YPJH 2HPPH 1ZMJA 4X1PU 4A7IB 2BTCE 2W26A 3QUMP 1TQ0B 1V2PT 2V35A 3PO1B 2ZNKH 3BTQE 5H4IB 4ZKSU 5ESTE 1SMFE 1YYY1 3B23B 4U30A 2R3UA 1F5KU 1C5LH 2VGCB 2STBE 1WYKA 1WU1A 2OTVA 3QZRA 1O34A 3MHWU 4MG3A 3BEIB 3V3MA 1O5GH 2HGTH 1TIOA 4YO9A 1A3BH 1GI9B 2PHBA 3D49H 1C5MD 4K60A 2EA3A 1GJBB 2FX4A 2EC9H 2XYAA 2ZGCA 3MH7A 1O2YA 2QYIA 1SB1H 4FUGA 4FVDA 5T6DA 1S84A 4ZHMU 2C8ZB 4AFSA 1AU8A 2F9NA 4B2BA 1SGTA 1UTMA 1ELGA 1AIXH 1HAHH 3E90B 3DD2H 2O9QA 2AMPA 1GI4A 4NCYA 4ABBA 1O3NA 1KXFA 2XTTB 2RG3A 1LVMA 5DP3A 2GTBA 1KLJH 3UWIA 1LVYA 2BZ6H 1TPPA 1DXPA 4GLYA 4XBDA 1BJUA 1N1LA 1C5UA 1C4Y2 1MTNC 2GD4B 4OS7A 1O3OA 1ARBA 6CHAB 1QJ7B 2BVRH 1BUIA 1O30A 1CBWC 3M37A 4XOJA 1Y3VA 5EXNA 4ISLA 4K5ZA 3HKJB 4O9VA 1UVSH 2FOGA 1DWEH 1ZRKA 1BRUP 1GMHG 2PKAB 3AAUA 4DJZB 3GDUA 4LZ4B 2AH4X 2H1UA 2ZFTA 3TK9A 3VB6A 2G81E 3ESTA 3MOCA 1ZPBA 1FMGA 1O36A 1QL7A 2Z3DA 1SGRE 2W3KA 3SI3H 4Y11E 1G37A 2JKHA 4I8GA 4MPXA 2D1JA 1GG6C 1SG8B 3P8GA 2FS8A 4XSKU 2OQUA 1OWIA 1LVOA 1O2OA 1AZ8A 2SGQE 3DUXH 3D23A 4B74A 1IQKA 5JB8S 1F0TA 1TMUH 3RXGA 4WXVA 3VEQB 2BQ7B 1HJAB 3RU4E 2W7UA 2C8YB 1ELVA 2QA9E 1AI8H 1O2SA 2GCHG 1TWXB 3HKIB 3PTBA 2VWOA 2C4FH 3SJKA 3F1SB 2ZGXH 2OLGA 3GY2A 2Y6TA 8GCHG 1AB9B 1K28D 1THSH 1DSTA 2A4RA 4FXGH 3U1IB 3M5NA 2GZ7A 2SGFE 1BBRE 1FV9A 1GI0A 3V12A 1THPB 4IN2A 1IQNA 5ETXA 1IQEA 1NFYA 1GHXH 5FX6A 1WOFA 1QA0A 1EX3A 1TB6H 2LPRA 2A2XH 2Z9KA 1PYTC 1XVOA 3R0FA 3RM2H 1AO5A 1ZSJA 1GI8B 2AS9A 3QN7A 4GAWA 1W0YH 2P93A 1O3PB 1G2LA 2AIQA 2PKAA 3RC5A 1TYNA 5CHAC 2PSYA 2ZCHP 4ISHH 2I6SA 3SBKA 1O3DA 1Y3YA 1V2KT 3RMMH 2OXSA 5A8XA 3DFLA 2G52A 1HDTH 2AGIX 3OU0A 2GMTC 2M5TA 1Y59T 1TA6A 2IPHA 4X1NU 1AE5A 2QF3A 2ZGHA 4E7NA 1TGBA 3NWUA 2C3SA 1SGNE 1GHBG 3Q76A 2D8WA 1T7CA 2H2ZA 5EPNA 1WAYB 2GCTB 1ELCA 2VIDA 3T2NA 1O35A 3MH4A 1MAYA 2CJIA 1SGCA 1XX9A 3RXAA 5A8YA 1O2WA 2Y82A 2TRMA 1C5OH 2BXTH 1HAOH 1ELAA 2D2DA 1KTSB 3RDZA 3KCGH 1NN6A 4UFEH 3VB4A 1ZJDA 2GV7A 2A4QA 5LH8A 1TPOA 3T62A 1HNEE 1EPTC 1VJ9U 4TWYA 2BY7X 2OC7A 5EXMA 1BTYA 3MNSA 3P92A 1PPBH 4YLQH 1DM4B 1ZGIA 2TIOA 5IYTA 1BRBE 1W14U 2W7SA 1P06A 1C2KA 4F4OC 1F0UA 1GCDA 2ZCKP 1CSOE 2AMDA 2Z9LA 2OCVB 1UCYH 4MNYA 3EQ0H 3JZ1B 2OBOA 1QBVH 2ZIQH 4WJG2 2G4TA 3VB5A 2PUXB 3ATWA 1QNJA 2C90B 1GBTA 4OS1A 2SNVA 4WMFA 5F03A 3RXQA 2ZHWH 1MBMA 1AN1E 2VU8E 1SHHB 5JBCS 2A45B 1L1GA 4DCDA 5C1YA 1BT7A 1EUFA 1EAUA 1CO7E 3MU5A 4YZUA 3JZ2B 2WINI 3U9AH 1C5QA 1GMCF 1O2XA 1F92A 1AHTH 3OX7U 1RIWB 2G00A 2VINA 4CR9A 1TGCA 5F8XA 5L6NH 3V0XA 3VFEA 4I31A 3PB1E 5GCHG 3P8FA 2RCEA 2ODQA 1FZZA 5FCKA 4ZUHA 2ZDAH 2AEIH 1GCTC 5EW1H 1AD8H 3KQDA 1SLWB 2VWLA 5GCHF 1DITH 3SU2A 2HVXA 3ELAH 3UOUA 1D3PB 2P3FH 2QF0A 3VXEH 1HPGA 1QR3E 1B0FA 1NROH 4IW4E 1L1JA 1TNJA 2FS9A 3AW0A 4CBNA 3MU4A 4AG1A 3GYMA 3A7WA 1H9IE 5CMXH 1HFDA 2PKSB 2PW8H 3SNBA 1UTOA 5J4SA 3AASA 1XUHA 2NWNA 1GBJA 1U6QA 1VGCC 3BG4C 4FUBA 4BTUB 1XUIA 4F49A 3SV6A 1W13U 3P8NA 3STJA 5JBBS 2P95A 2BM2A 2P59A 3RXJA 4Q7XA 1A0HB 1G32B 3BTEE 3DHKH 4UONA 1THRH 1D3QB 2J38A 1AFEH 1O33A 1SOZA 1KIGH 4J2YB 1EJNA 3TIUA 5E8EH 3UNRA 1EZUC 1C9PA 3SUEA 2RA0A 1QBOA 1C1VH 1C5ZB 3VB7A 5L2ZH 1EQ9A 1O2QA 3H7OA 1FY4A 5T6GA 1AGJA 3VB3A 4E7RG 5EQRA 3GY6A 4H42U 2ZC9H 4I32A 3RXSA 3ZVDA 2LNCA 1UVOA 4Q80A 3RXMA 1Z8JB 1HAYB 3I29A 1XXDA 5EGMA 5FPYA 3SN8A 5J4QA 1QCPA 2NU0E 3RXVA 3M7TA 1SGEE 5EU8A 1C4V2 2VWMA 1GI6A 2ZU3A 1T4VH 4Y7BA 3GICB 1SBWA 2ZU4A 2ZECA 1DPOA 5HMAA 3M7UA 3SQEE 5LPRA 2FM2A 2YNBA 1OWEA 1S81A 2P94A 2XC0A 1S5SA 5IDKA 2ANMH 1OPHB 3RXIA 2QXJA 5DP7A 1QFKH 4CH2B 4CREA 1P9SA 1GHBF 4H6TA 3BV9B 3BTTE
chains in the Genus database with same CATH superfamily
1MQ5A 3KL6A 3SO3A 1HAVA 2BD9A 2BOKA 2Z9GA 4CHAC 4ZXXH 3FFGA 1W0KD 1ZHRA 1DT2A 1BMLA 1LHCH 4OS4A 3MNBA 2ALPA 1P2IA 2EEKA 2AHME 2NU1E 4K3JA 2BY9X 2C8WB 2OD3B 4Y0ZE 2BDAA 1B0EA 5A2MH 1INCA 3GCTF 4QT8C 3STIA 2VNTA 2IOTA 3PV2A 3NRLA 1KYNA 2BVSH 1ZTJA 1W7XH 3DSPA 1TQ7B 3A80A 1DLEA 1Y3XA 1IHSH 2GZ9A 4FUHA 2B5TB 6GCHG 1C2MA 2V7QD 4MQAA 2F9BH 1O3JA 1V2OT 4WH6A 1V6DA 1JWTA 3S7HB 1V2LT 2JH6D 4IN1A 5FXLA 1PFXC 2G55A 2P16A 3SJ8A 1ZOMA 3URCA 1HXFH 2GCTC 1IQFA 1DE7H 1EPTA 4DG4A 1AVGH 1Q3XA 2ZI2H 3OYPA 4Y7AA 4Y8ZA 1ACBE 8GCHF 1GJCB 1O3MA 2SGEE 4B71A 1DSUA 5B6LA 1PPEE 2ZFPH 1YPLH 1YPEH 4WF8A 4UFGH 3MWIU 4UD9H 3RMNH 2A1DB 2FLRH 1SGPE 1W11U 1O2IA 2VVVA 1ZYOA 2ZF0H 1C5YB 5A0BA 2OC8A 3ZZDA 1C5WB 1BMNH 3W95A 3OSYA 4K1TA 4AG2A 1QB1A 2ZU2A 4Y76A 1GDQA 2O8MA 1DY9A 3FOAA 1ZRBA 4FUIA 1XUJA 7GCHG 1KY9A 1T4UH 1F0RA 1NT1A 1UTPA 1DY8A 2RDLA 3P70B 3ATIA 4NWLA 1MAXA 2XNIA 4UFFH 2BB4A 1O3LA 1QRZA 4IBLH 4ACAA 3L6PA 1O3GA 4DURA 4A92A 3GOVB 2R9PA 5HM9A 2AYWA 3TJNA 1IQJA 1LCYA 4Y8XA 2FOFA 1Z1JA 7GCHF 2K1QA 1QL8A 4RT1A 1IHTH 2H5CA 3TK5A 1CHOG 4MNWA 2UWLA 1G3CA 1J17T 1EB2A 4RKJB 5FPSA 2TGPZ 3UY9A 1BMMH 4Y71A 3QLPH 2J2UA 1AFQB 1UCYK 1PQ7A 1TGSZ 1O2TA 1XUKA 2G51A 2ZDNA 1TPAE 3A7TA 1IOEA 4FUFA 3BTKE 1GMDF 2Q1JA 4AYVB 3SU6A 1P02A 1VITH 4X6NA 1DXWA 1UVTH 3TNSA 5DP5A 2WPMS 1EASA 3M5LA 4TY6A 1GBDA 4GCHG 3UR9A 5I46H 4P00A 3AK5A 1HJAC 4P02A 5B6OA 5JBTA 1C1TA 2PLXA 5F6MA 2KCPA 5K0HA 1O37A 2XRCA 1P01A 1AY6H 1GBEA 1HJ9A 1ANBA 1LPZB 3CS7A 2ZHFH 1SSXA 2XBXA 3KNXA 3ZZAA 2VB0A 4I33A 4MPWA 1LTOA 1E34B 1YM0A 2ALVA 1ZTKA 2R2MB 1D9IA 2GT7A 1S6HA 2ZFFH 1GGDB 1GL0E 2ZDMA 2HNTE 3PLBA 1EP5A 1TOMH 3LC5A 4YOGA 1PQ8A 1GJ8B 5A09A 4OGYA 3RUOA 1NRSH 2CXVA 1C1WH 1P2NA 3M35A 2QGRA 1Z71A 2XBYA 1W0ZU 2IJD1 4XBBA 1B5GH 2ODYB 1WCZA 4E06H 1UTLM 1T8LA 2FI4E 2HWLB 5T3HA 4WXIA 2V3OH 3URDA 2AFQB 2FXRA 2ULLA 1LQEA 2UUJB 1GBCA 2GDEH 2JDID 1FAKH 1UK3A 1WDIA 2DE9A 2ZFSA 2HRVA 1TE0A 4AGJA 4R8TB 2FOHA 1LPKB 1J9CH 1P05A 2TGAA 2VGCC 3TITA 3I77A 2WV4A 1G30B 4GHQA 5SGAE 4OS2A 4KTCA 3LKWA 4ABIA 1MKWK 1YC0A 5T1VA 1W2KH 7ESTE 3KF2A 5AVDA 3O8CA 3TPIZ 4Q7ZA 1MQ6A 1WTHD 3AVZA 1UMAH 1KTTB 1EZQA 3M3VA 1SLXB 3Q3XA 1TBQH 2J95A 1QY6A 2YMSD 3S0NA 2VH6A 4AB9A 1SPJA 2Y5FA 1Y5BT 5C1UA 1J14A 1YP9A 1G3DA 3ENSB 4YOJA 1ELEE 4Q2KA 3WWBA 3PRBA 1KXEA 4NA9H 3N7OA 4Q7YA 1OKXA 2B0FA 2UUKB 3EGKH 4XRNA 1CGJE 1Y5AT 1PPGE 1PJPA 4HI3A 2HLCA 1A46H 1GBBA 3BN9A 2ESTE 4IGDA 4UFDH 2ZTZA 1FY3A 3E16B 3AAVA 4JZDH 1NBMD 5C1XA 2Y7ZA 1C5NH 1P09A 3UNQA 1AWHB 1TA2A 2BMGB 3MNXA 3LGUA 1CGIE 1TX7A 3ZZBA 3UQVA 1A0JA 3Q00A 2PGQB 4KKDA 1TNIA 3QTOH 5A0CA 3PMAB 2H9TH 1G2MA 5DP9A 1CT2E 1SGQE 2Z9IA 3GCHC 2QXIA 4X8SH 2CF8H 4INLA 1YLDA 1YCPK 3U8TH 3SYJA 1V2UT 1K1PA 4Z6AH 3NCLA 3GY5A 4ABFA 1ESTA 1RTFB 2SGAA 3SZNA 1T8NA 5CDFE 1GBAA 2Y81A 3GYLB 4ZKNU 1EATA 3GCOA 5EODA 4B76A 2CN0H 3TLOA 4GVUA 3EE0B 1WV7H 3TJUA 4BAKB 1O2JA 2FMJA 4CBOA 3PLPA 5DO4H 1NS3A 2M2AA 1EPTB 1RFNA 5FCRA 3U1JB 3B8JA 4X0WU 1DUAA 4NA8A 1FNIA 1HAXB 1O3KA 1OWHA 3R3GB 2FODA 1GWAA 4VGCB 3SNCA 1FY1A 2HNTF 1HAGE 3SNAA 1BQYA 4B75A 4RI0A 4JMYA 2WYJA 4Q4LA 1BB0B 4F55A 3KEEA 3FANA 2P8OC 1V2NT 5C67A 4TY7A 2HPQH 5DPAA 1ID5H 4BOHA 2CV3A 4ZHLU 4ABDA 1C1NA 1P04A 1JBUH 2QXHA 5JDUB 4MPUA 2Q6FA 2ZPSA 1BJVA 1UO6A 1GI3A 3KQEA 4JYUH 1SGYE 3UFAA 3TH3H 3HGNA 3P95A 3ZVAA 4ZAEA 1GVLA 3A8AA 3OTJE 1GBMA 2B9LA 2PWXA 1ZTLA 3U98H 2XC4A 1FXYA 1OP2A 1LKBA 1SQAA 3ATMA 4YTAA 2BOHB 2D26C 2VWNA 4DGJA 2BY8X 2H9HA 2WPHS 4RKOB 2QC2A 1BHXF 2CMYA 4ASUD 4CRGA 2W6ID 3P6ZB 1TRNA 3VGCB 4B2CA 3EDXB 2A5IA 5HYOA 5F8TA 3TGIE 3BTDE 2ZG0H 3GS9A 1FX0B 1NZQH 1SOTA 2BQWB 1TPSA 1QB6A 3GCNA 3KIDU 2Y7XA 1W7GH 3A86A 1VR1H 3MFJA 5A0AE 3MI4A 4Y79A 2AGEX 1O2PA 1O3IA 1K1JA 2AGGX 3FAOA 1WQVH 3SJ9A 2UUFB 1P2JA 2R3YA 3EA7A 3O8BA 2HALA 4BTIB 1G3EA 1V3XA 1T32A 2B7DH 2F83A 4JCNA 3MTYA 1T8MA 1GBKA 2WV5A 1LHFH 2ZPQA 1XKBC 2QY0B 2XW9A 4SGAE 2FWWA 2G8TA 4CHAB 1TRMA 3T25A 1FY8E 1TABE 1TOCB 1HRTH 1K1NA 3K6ZA 1BTWA 1A0LA 1GVZA 3MU1A 5C94A 1C1OA 4GSOA 1HUTH 5HM2A 5C20A 1BTHH 1C1PA 4FUDA 1GMHF 1H1BA 4I7YH 4CRDA 1GJ6A 2WPIS 2J92A 1V2TT 3EYDA 1O0DH 4DOQA 3F9EA 1NU9A 5C5OA 4M9FA 4BAHB 1A7SA 2VIQA 1BTPA 3UOPA 2G5VA 1C5TA 1PPFE 2A7HA 2ZCLP 5FL7D 1XXFA 1HXEH 2F9VA 1ARCA 3WY8A 2FOCA 1O31A 1O3CA 5KECA 1VCPA 5E2OA 1O3EA 1D3TB 1UTQA 4XBCA 1SHYA 1K9OE 4K69A 2B8OH 1S0RA 2V0BA 3E0PB 2GT8A 1C2DA 3SORA 1WBGB 2OC1A 4AFQA 5EQQA 3QK1A 1FPCH 3DCLA 4FVBA 1S0QA 5JBAS 2FX6A 4CRBA 1E36B 2A7CA 1AE8H 1SGFG 5FPTA 1GMDG 2Z6BD 4MNXA 1EOJA 4JZFH 3DT0H 2ZA5A 1MTNB 2BXUH 3MO3A 1GPZA 1GBFA 2O8LA 3SHAH 3MMGA 2V3HH 3A8DA 1JMOH 1V2VT 4O97A 1MTSA 1K1LA 1QHRB 1SQOA 1ZSLA 2FO9A 1QJ1B 1N6YA 1W3CA 4X6PA 4BNRA 5AHGH 1OP8A 4D76A 5BPEA 4TPIZ 1A5GH 3MH6A 4J1YA 4YXWD 1P0SH 2QCYA 1CT0E 2O8WA 3T26A 4A6LA 1Z1IA 5EJ1A 1AQ7A 3ZVGA 3EA9A 2A4OA 3SU1A 1SQTA 1E37B 2ZDKA 1TBZH 2KX4A 3HATH 3LDXH 1O5BB 6LPRA 1K1IA 1P2QA 1DICA 4YT6H 1BBRK 2KM0A 2KCAA 5AF9H 1CBWB 1P3CA 4R0IA 5JB9S 2CHAC 1ELDE 3FP7E 3LU9B 2GJGA 3AW1A 3F9HA 1P9UA 1D3DB 1DDJA 2LELA 2FYRA 1QQUA 1K21H 1T31A 1EZSC 4O03A 2KAIA 1HIAA 2Z7FE 3Q77A 1PPHE 5DP8A 1FN6A 1AFQC 1L1NA 1TBRH 2ZDLA 1ZPCA 1KXCA 1G3BA 1NO9H 1NFUA 4HZHA 4I8JA 1UK2A 1YLNA 2J97A 1FONA 2ZFRH 1C5XB 3O8DA 1XUFA 1XUGA 1TRYA 4A1VA 2NU3E 3M3TA 1S6FA 3ODDA 2BDGA 2XBWA 4K1EA 3PM3A 1QB9A 2J4IA 1C5PA 1DFPA 2YNAA 1OOKB 1FQ3A 1TALA 3PLKA 1NRPH 3VPKA 3UB0A 5DG6A 2TGDA 2ZGBH 1P10A 5ABWA 6GCHF 9LPRA 1PPZA 1YCPH 3L3TA 4ZHAA 1C2GA 2A31A 2BQ6B 3GDVA 1ZLRA 2PTNA 3A88A 2OBQA 5EIYA 1IQGA 3EAJA 2XOKD 4ASHA 4B2AA 4AB8A 3ZIAD 1GMCG 2OK5A 4AC9A 3F9FA 3L33A 1O2VA 1H4WA 3E91A 4LOYH 3A84A 1EB1H 1MABB 3NUMA 3GY3A 1SQRA 2QF4A 4MDSA 2H5DA 1GBLA 4X6OA 4NSYA 8KME2 1RS0A 4Y6DA 3EA8A 1YLCA 2FLBH 5GXPA 1GI2A 2EI6A 2EI8A 1YPHC 4YESB 2FP7B 2R2WU 4K2YA 4SGBE 3ZV9A 3ZVCA 1GBIA 1QRWA 2BD4A 3SZEA 2VIOA 3MYWA 5F53A 3TK6A 9ESTA 1EZXC 1HBTH 4ISIH 4H6SB 1E35B 1MU6B 1O39A 5FHTA 2XCNA 2ZHEH 2BX3A 1JRSA 2ZGJA 3A83A 3BTFE 1DWBH 1FLEE 1P8VC 4NA7A 5A8ZA 3QTVH 1GHAF 2WZQA 2ILNA 2GV6A 3RXOA 1O38A 4WVPE 2FESH 4TSFD 5GJ4B 1C2FA 5LGOA 1T8OA 4HGCA 2C8XB 4B6FA 3ZVFA 1CE5A 4BAOB 3H5CB 3FO8D 1K1MA 1HB0B 1L0ZA 1COWD 2VJ1A 2K0QA 1L4ZA 3MO6A 1TAWA 4GCHF 3F6UH 1EKBB 1A1RA 4UEHH 4ZROA 1CU1A 4I86A 1YCPM 1ETSH 1KDQA 4NZLA 4FU9A 3BTWE 4ABAA 4Z0KA 2BD7A 1MCVA 1KXAA 3BTME 2OP9A 1MKWH 1LQDB 2BVXH 2WHXA 8LPRA 3RXDA 1DVAH 1RGQA 1MTVA 1TFXA 2ZDVH 4I8KA 2BLQA 5HXFA 1GJAB 3F3BA 1HAIH 2LP6A 3NK8A 1UVPA 1O5FH 4D9QA 2XWBI 3A89A 7LPRA 1QJ6B 1LDTT 1GHWH 1O3HA 2J34A 4RSPA 1ESBA 1LMWB 3UR6A 3SUDA 2GX4A 1EJMA 2IN2A 2ZEBA 5JYIA 4ZMAH 1ELTA 3UQOA 1QRXA 3PTNA 3QX5H 2ZWLH 1BMAA 2GGVB 3RXRA 3K65B 5LPFA 1JIRA 4NIYA 2Z3EA 1N6XA 2YMSC 4KTUA 3RLYH 2FI5E 5K7RA 2H9EH 2FPZA 4KGAA 1SFIA 2ZPRA 2DE8A 3OY6U 2PFEA 3UIRA 1LHDH 2BLVA 2IJOB 3IITA 1TMTH 2C93B 3CS0A 3PRDA 1J16A 1GCTB 1EP6A 3ZZ6A 4KP0A 3P8OA 1DOJA 1FIZA 4NIWA 1MBQA 1OSSA 4ABGA 2ZZUH 1P11E 1ELFA 1OS8A 4XD7D 5C17A 1H9HE 3PWCA 1GI7B 3S7KB 5JPMH 1SVPA 1ZZZA 5FAHA 4FUCA 3SOSA 1GHAG 3MO9A 4D7GA 5EG4A 4AORA 3HK6B 1ORFA 1TMBH 3TU7H 4Y8YA 4X8UH 3S69A 2FDAA 1NY22 3N7EA 1C5VA 1BZXE 2HOBA 2VIPA 1AUTC 3SQHE 1MKXK 5E2PA 2ANKH 1S6LA 1S85A 1O3AA 1GBHA 3ZZCA 1DX5M 1UK4A 3LIWA 4DIIH 2PV9B 1ANDA 4BXSA 1ZHPA 1F5RA 2A5AA 1EXFA 3A7VA 3K9XB 3S9BA 2HNTC 3KN2A 1FN8A 3SU0A 1EOLA 2GDDA 2BZAA 1P03A 1AKSA 1VCQA 1AB9C 2YOLA 4IS5A 4ABEA 2XNDD 3K6YA 3SUFA 5EXLA 3F2GA 4D8NA 1VITF 1IQMA 1LHGH 3BIVH 4KELA 3ZYEA 2WYGA 5EPYA 1ZHMA 3SU4A 1YPGH 2KZ4A 2XBVA 5IK2D 3KGPA 3RC4A 1VJAU 5G4BA 3ZV8A 1NESE 4TYDA 4WWYA 1K1OA 3H7TA 1QBNA 4HTCH 4AX9H 1E38B 1GL1A 4NSVA 4MNVA 1A2CH 1QQ4A 1D4PB 3GDSA 3EE7A 3TGKE 1MH0A 5DP6A 3U8RH 3BG8A 3A82A 2Z9JA 1ELBA 4D7FA 3KHVA 3PYHA 4X8TH 1TNKA 2PSXA 2BLWA 1F2SE 4WMEA 3F2FA 4XE4A 1C1SA 3C1KA 4TT3D 4WH8A 1ABIH 1P3EA 3NXPA 4BAMB 1D6RA 3UNSA 4X2VA 1HV7A 5C3NA 1FAXA 1QGFA 1TGNA 4RT0A 3PROA 1CA0C 1VITG 3BSQA 1PPCE 1NFWA 3QWCH 3FVFB 1BITA 1ZSKA 4ISOA 2SFAA 1Y3UA 3PMBB 1BIOA 2J9NA 2FOAA 5HIZA 3SV2H 6CHAC 4NWKA 2Y5HA 2ZFQH 3PMHB 1FI8A 1NTPA 2BDYA 1LVBA 1Z6JH 3SGQE 1A4WH 3BF6H 1C1QA 4JZIA 1HGTH 1SKYE 5GDSH 1SL3A 5GPIB 1EAIA 3S9CA 1RIWC 1PQAA 1AVWA 1O2MA 4ZXYH 3SNDA 1EAWA 3IWMA 1YGCH 2PUQH 3A7YA 1ETTH 4OS5A 2G5NA 3M61U 4X6MA 1DANH 1VGCB 3BG4B 1J15A 1WSSH 5C5NA 7KMEH 2SNWA 2NU4E 4MLFB 4X2YA 4NG9H 1BTXA 1TX6A 1GDUA 1V2MT 1O2KA 3F68H 4B1TA 1GG6B 1ZGVA 3IG6B 3T29A 4IMQA 4KTSA 1OWKA 4X1QU 1RXPA 4PROA 1FUJA 4AN7A 1O3BA 1O5DH 3F2HA 3RLWH 2FI3E 1SGDE 2QAAA 2WPKS 1KDQB 1P12E 4BXWA 2TGTA 3LONA 1BTUA 1H9LB 1V2RT 3SGBE 2F9OA 1MZDA 2FOEA 2BDCA 3SI4H 2F9UA 2ZHDA 5FBIA 4TPYA 1FJSA 1QTFA 4O3UA 1CA0B 2PKSC 1DS2E 5C2ZA 4GPGA 1L4DA 3BTHE 4NGAH 2EI7A 1OWDA 4X2WA 1JXPA 1TONA 3O8RA 1DWCH 2FIRH 2JETC 3LH3A 3LGIA 1BHXB 2GZ8A 1OWJA 2PR3A 5EW2H 3RU4T 1UVUH 1GJ7B 3TH2H 1Y8TA 3GY4A 4K1SA 3E0NB 1G36A 3V7TA 1MD8A 1IQLA 3SV7A 4OS6A 1Z8IB 2ODPA 2SGPE 1HIAB 4U32A 1RJXB 1UJ1A 3ZZ9A 5E0GA 2ZQ1A 5PTPA 1KLTA 1C2IA 1TNGA 1RRKA 2GMTB 2OQ5A 1IQHA 1L2EA 3SV8A 2ZU5A 3QO6A 4DY7B 3M5OA 4K8BA 1RTKA 5HGGA 4XFQA 5TCCA 4ESTE 1RTLA 2QIQA 5E0JA 2QF5A 4F48B 1ZPZA 4FETA 1AUJA 1P2OA 1A5IA 2NU2E 1TX8A 1GHZA 4A1TA 4YOIA 5EOKA 2P8OB 4AOQA 1HAPH 1Q2WA 3RP2A 3PO1C 1ZR0A 2J5UA 2F43B 2ASUB 1XMNB 1ZMLA 4IC6A 3VGCC 3SW2B 3W1EA 3RXBA 4BANB 4NZQA 2FOBA 1QIXB 4DT4A 2W6JD 2WUBA 3VG8A 3P17H 2KR7A 3G01A 4U01A 3T28A 4B73A 1O2GH 5DK1A 1BDAA 1C2JA 4GUXA 3OE7D 1IAUA 1HCGA 3F0OA 3GY7A 3RC6A 1GGDC 1ANCA 1WQSA 2ZHQH 3BTGE 2Z3CA 4RN6A 4INHA 1O2ZA 5EJZA 3NPSA 5C0TA 3GCTG 4X1RU 1NRRH 4DVAU 4MVNA 3RXUA 4HFPB 3RMOH 3FZZA 1V2QT 3KQBA 3ODFA 4IMZA 1JOUB 2ZP0H 1C5RA 3SJOA 1E0FD 1RD3B 2O8TA 4X1SU 1YPHE 4ZKOU 2CGAA 2L74A 6ESTA 3I78A 5DKMA 3M36A 1GHVH 1MZAA 3A87A 2OC0A 3KQCA 2RFKC 3RXKA 2A0QB 1O3FA 4X8VH 3ZVEA 3SGAE 3C27B 2R0LA 4JK6A 1Z8RA 1OHHD 1H8DH 3E3TA 2UUYA 2Y80A 1UTJA 3ZZ3A 2OUAA 1Y3WA 1YBWA 2W5EA 2V3MA 1B7XB 4JZEH 4NFEA 3UTUH 3CENA 4O3TA 3M7QA 1P57B 1C9TA 2HLDD 3RXHA 4WY3A 4A5TS 1SLUB 2ANWA 2Q6DA 2WV9A 2R0KA 1MMJN 1O2HA 1SGFA 2L6OA 3E1XB 4OM9A 4Y0YE 1NM6A 2JIZD 4I8LA 4CRCA 3GISB 4FUJA 4JK5A 1O2LA 4YM9A 1BMFD 2BD8A 2WPDD 1YPMH 1DWDH 5DSFA 1CVWH 3HK3B 4UE7H 4Y10E 1V2ST 1MCTA 1PYTD 1E1QD 2VVUA 3TVJB 2EQNA 1P2MA 1NPMA 1PQ5A 1X7AC 1BA8B 3FZDA 4E05H 2RA3A 1MUEB 3A85A 3UWJH 1SLVB 3E6PH 2XCFA 3QGJA 2A2QH 2TBSA 3A8CA 1XM1A 2A32A 1BRCE 1ZMNA 2QN5T 4MPVA 2AERH 1GDNA 2BDIA 3V13A 3S9AA 3ATLA 2UWPA 1AVXA 2WPJS 3ZZ8A 4ISNA 3HGPA 2F3CE 4D9RA 3BEFB 1AMHA 3RXFA 1K2I1 2GP9B 4DW2U 3ZZ7A 1TNHA 2F91A 4INKA 3CP7A 3SV9A 3A81A 1OYTH 1QL9A 2STAE 2GKVE 4H4FA 3RXCA 3HPTB 3MU8A 3MNCA 5FBEA 3GY8A 3LGWA 2ZO3H 3QZQA 1HYLA 3OEED 1GI5A 2A7JA 1C1MA 2BY5X 1V2JT 2PTCE 1KXDA 1YKTA 2V6NA 1JIMA 1GJ5H 2HVYB 1WUNH 4IC5A 3B9FH 1W8BH 4AFZA 1WTGH 4AGKA 1NBME 1S82A 2Q6GA 5I25A 3LGTA 4GHTA 4JYVH 2KAIB 3RMLH 2VIWA 5DP4A 4MTBA 4JZ1A 1GJDB 1BBRH 1NFXA 1N8OC 5CHAB 1Y5UT 2P3TB 4U2WA 4ABHA 5EQSA 2JETB 5LPEA 1BCUH 2CK3D 1V2WT 2J94A 1FY5A 3KYFA 1FDPA 2JJ2D 1OX1A 1Z8GA 4NIXA 2H6MA 3SUGA 2WUCA 3UREA 3ATKA 2I6QA 1EJAA 5T6FA 1C2LA 2SGDE 3RXPA 3ZVBA 1QURH 1IQIA 1CHOF 4DT7B 3LT3A 1GJ9B 1LHEH 1XKAC 3RXEA 2WPLS 3N99A 1O2UA 1KSNA 1NRNH 3BIUH 1UCYE 2BD5A 1GJ4H 5AFYH 3LC3A 3SHCH 5CE1A 3TJOA 2FZZA 2BDBA 1FIWA 1F0SA 4K8YA 1P2KA 2ZTXA 1LO6A 1VKYA 1HAVB 5L30H 2FOMB 4BTTB 5TCAA 3VXFH 1H8IH 3PV4A 2ZQ2A 1HAZB 2BD3A 3UPEA 2PGBB 1H8HD 5FX5A 2FTMA 3NZIA 3OTPA 5EJLA 3T27A 2UWOA 3LJOA 3LPRA 4FUEA 1YWUA 1O2RA 2AMQA 3KYGA 3RU4D 3A7ZA 3ZYDA 3SU3A 1N8OB 1MU8B 1NC6A 1CQQA 3PMJA 4THNH 3QGNB 3TNTA 1E79D 2EY4C 1OYQA 2P3UB 3E8LA 1SGIB 1C4U2 2BD2A 1GHYH 3BEUA 1KLIH 2JJ1D 3M5MA 4LXBH 2XXLA 3A7XA 2BLOA 1SI5H 3FP6E 1F5LA 1C2HA 2AIPA 4FU7A 1C1UH 1MD7A 3GCHB 3LOXA 3QDZB 4A1XA 1OP0A 1O5CB 4CRAA 3LGYA 4CR5A 2VVCA 2XC5A 1GVKB 1ANEA 1A61H 1XVMA 2FYQA 1BOQA 1C1RA 1MTUA 5CHBA 3A8BA 1S83A 2KFWA 4FU8A 3TJVA 1O5AB 1HLTH 1DLKB 2A4GA 1Q31A 3M3SA 2FEQH 1D6WA 2ANYA 4OGXA 1TNLA 1O32A 1Z7KA 2QV1A 1GI1A 1JRTA 5DGJA 1BRAA 3F0PA 3MU0A 1FPHH 1K22H 1UHBB 3OFND 1M9UA 4XDEA 2BDHA 3ZZ4A 4AYYB 1A3EH 1SFQB 1CA8B 3Q3YA 1ZJKA 2OINA 5E0HA 4VGCC 2F9PA 1CHGA 2F4LA 4YT7H 5GIBA 1ABJH 1OXGA 3D62A 3LGVA 5C0UA 2GCHF 4M7GA 2FTLE 3D65E 4YLUA 2JH0D 1TGTA 1VCWA 5GWZA 1QZ8A 1AZZA 1ETRH 1VZQH 5F8ZA 3DFJA 3SU5A 1YF4A 4I8HA 3W94A 4LZ1H 3ITIA 4UDWH 3PWBA 2Z94A 1QA7A 3RM0H 4CRFA 3UUZA 1DUEA 2G4UA 3ZZ5A 2VH0A 1G9IE 1CT4E 2BHGA 5ESBA 1A5HA 1C2EA 2GVFA 1J8AA 2VIVA 5AFZH 1AKSB 2O8UA 3RXTA 2ZU1A 3DA9B 3UAIC 4X2XA 4ZCNA 4DIHH 4TWWA 2CF9H 4NFFA 2ZKSA 4WMDA 1TLDA 5DJ7A 1C5SA 1LKAA 3SJIA 1LPGB 1BTZA 3KQ5A 2XWAA 2THFB 3F9GA 1UTNA 1MTWA 2JH5D 4ABJA 1O2NA 2BX4A 4ZKRU 1UTKA 3OY5U 4ZH8A 4NIVA 1AWFH 1SR5C 3RXLA 1NU7B 3LH1A 5TJXA 4ACBA 1ESAA 3MH5A 3K2UA 1CGHA 1W10U 2PP6A 8ESTE 2BYAX 2ZTYA 3T5FH 5L2YH 1EAXA 1SC8U 2DUCA 1W12U 3U69H 2QXGA 3U8OH 4AFUA 3TH4H 1KXBA 3Q3KA 3NKKA 4CH8B 1F7ZA 5BRRE 4LK4A 1UHBA 3LJJA 3FP8E 2W3IA 1MKXH 2CHAB 4BAQB 3TGJE 1K0HA 3SNEA 4AZ2B 2IPQX 1Z6EA 4JYTA 2A5KA 1YPKH 2BY6X 1HJ8A 1NRQH 2Y5GA 2TPIZ 1O5EH 1YPJH 2HPPH 1ZMJA 4X1PU 4A7IB 2BTCE 1KMHB 2W26A 3QUMP 1TQ0B 1V2PT 2V35A 3PO1B 2ZNKH 3BTQE 5H4IB 4ZKSU 5ESTE 1SMFE 1YYY1 3B23B 4U30A 2R3UA 1F5KU 3MQKC 1C5LH 2VGCB 2STBE 1WYKA 1WU1A 3U28C 2OTVA 3QZRA 1O34A 3MHWU 4MG3A 3BEIB 3V3MA 1O5GH 2HGTH 1TIOA 4YO9A 1A3BH 1GI9B 2PHBA 3D49H 1C5MD 4K60A 2EA3A 1GJBB 2FX4A 2EC9H 2XYAA 2ZGCA 3MH7A 1O2YA 2QYIA 1SB1H 4FUGA 4FVDA 2WSSD 5T6DA 1S84A 4ZHMU 2C8ZB 4AFSA 1AU8A 2F9NA 4B2BA 1SGTA 1UTMA 1ELGA 1AIXH 1HAHH 3E90B 3DD2H 2O9QA 2AMPA 1GI4A 4NCYA 4ABBA 1O3NA 3DSOA 1KXFA 2XTTB 2K8IA 2RG3A 1LVMA 5DP3A 2GTBA 1KLJH 3UWIA 1LVYA 2BZ6H 1TPPA 1DXPA 4GLYA 4XBDA 1BJUA 1N1LA 1C5UA 1C4Y2 1MTNC 2GD4B 4OS7A 1O3OA 1WXRA 1ARBA 6CHAB 1QJ7B 2BVRH 1BUIA 3N7DA 1O30A 1CBWC 3M37A 1EFRD 4XOJA 1Y3VA 5EXNA 4ISLA 4K5ZA 3HKJB 4O9VA 1UVSH 2FOGA 1W0JD 1DWEH 1ZRKA 1BRUP 1GMHG 2PKAB 3AAUA 4DJZB 3GDUA 4LZ4B 2AH4X 2H1UA 2ZFTA 3TK9A 3VB6A 2G81E 3ESTA 3MOCA 1ZPBA 1FMGA 1O36A 1QL7A 2Z3DA 1SGRE 2W3KA 3SI3H 4Y11E 1G37A 2JKHA 4I8GA 4MPXA 2D1JA 1GG6C 1SG8B 3P8GA 2FS8A 4XSKU 2OQUA 1OWIA 1LVOA 3WWFA 1O2OA 1AZ8A 2SGQE 3DUXH 3D23A 4B74A 1IQKA 5JB8S 1F0TA 1TMUH 3RXGA 4WXVA 3VEQB 2BQ7B 1HJAB 3RU4E 2W7UA 2C8YB 1ELVA 2QA9E 1AI8H 1O2SA 2GCHG 1TWXB 3HKIB 3PTBA 2VWOA 2C4FH 3SJKA 3F1SB 2ZGXH 2OLGA 3GY2A 2Y6TA 4B6EA 8GCHG 1AB9B 1K28D 1THSH 1DSTA 2A4RA 4FXGH 3U1IB 3M5NA 2GZ7A 2SGFE 1BBRE 1FV9A 4Z1MD 1GI0A 3V12A 1E1RD 1THPB 4IN2A 1IQNA 5ETXA 1IQEA 1NFYA 1GHXH 5FX6A 1WOFA 1QA0A 1EX3A 1TB6H 5KGOA 2LPRA 2A2XH 2Z9KA 1PYTC 1XVOA 3R0FA 3RM2H 1AO5A 1ZSJA 1GI8B 4Q63A 2AS9A 3QN7A 4GAWA 1W0YH 2P93A 1O3PB 1G2LA 2AIQA 2PKAA 3RC5A 1TYNA 5CHAC 2PSYA 2YMSB 2ZCHP 4ISHH 2I6SA 3SBKA 1O3DA 1Y3YA 1V2KT 3RMMH 3PV5A 2OXSA 5A8XA 3DFLA 2G52A 1HDTH 2AGIX 3OU0A 2GMTC 2M5TA 3OAAD 1Y59T 1TA6A 2IPHA 4X1NU 1AE5A 2QF3A 2ZGHA 4E7NA 1TGBA 1YY3A 3NWUA 2C3SA 3WW7A 1SGNE 3FKSD 1GHBG 3Q76A 2D8WA 1T7CA 2H2ZA 5EPNA 1WAYB 2GCTB 1ELCA 2VIDA 3T2NA 1O35A 3MH4A 1MAYA 2CJIA 1SGCA 2RDEA 1XX9A 3RXAA 5A8YA 1O2WA 2Y82A 2TRMA 1C5OH 2BXTH 1HAOH 1ELAA 2D2DA 1KTSB 3RDZA 3KCGH 1NN6A 4UFEH 3VB4A 1ZJDA 2GV7A 2A4QA 5LH8A 1TPOA 5HIYA 3T62A 1HNEE 1EPTC 1VJ9U 5HKKD 4TWYA 2BY7X 2OC7A 5EXMA 1BTYA 5KEDA 3MNSA 3P92A 1PPBH 4YLQH 1DM4B 1ZGIA 2TIOA 5IYTA 1BRBE 1W14U 2W7SA 1P06A 1C2KA 4F4OC 1F0UA 1GCDA 2ZCKP 3DSGA 1CSOE 2AMDA 2Z9LA 3FN8A 2OCVB 1UCYH 4MNYA 3EQ0H 3JZ1B 2OBOA 1QBVH 2ZIQH 4WJG2 2VBCA 2G4TA 3VB5A 2PUXB 3ATWA 1QNJA 2C90B 1GBTA 4HG6A 3CNRA 1H8ED 4OS1A 2SNVA 4WMFA 5F03A 3RXQA 1UW7A 2ZHWH 1MBMA 1AN1E 2VU8E 1SHHB 5JBCS 2A45B 1L1GA 4DCDA 5C1YA 1BT7A 1EUFA 2KCYA 1EAUA 1CO7E 3MU5A 4YZUA 3JZ2B 2WINI 3U9AH 1C5QA 1GMCF 1O2XA 1F92A 1AHTH 3OX7U 1RIWB 2G00A 2VINA 4CR9A 1TGCA 5F8XA 5L6NH 3V0XA 3VFEA 4I31A 3PB1E 5GCHG 3P8FA 2RCEA 2ODQA 1FZZA 5FCKA 4ZUHA 2ZDAH 2AEIH 1GCTC 5EW1H 1AD8H 5GNDA 3KQDA 1SLWB 2VWLA 5GCHF 1DITH 3SU2A 2HVXA 3ELAH 3UOUA 1D3PB 2P3FH 2QF0A 3VXEH 3H09A 2J98A 1HPGA 1QR3E 1B0FA 1NROH 4IW4E 1L1JA 1TNJA 2FS9A 3AW0A 4CBNA 3MU4A 4AG1A 3GYMA 3A7WA 1H9IE 5CMXH 1HFDA 2PKSB 2PW8H 3SNBA 1UTOA 5J4SA 3AASA 1XUHA 2NWNA 1GBJA 1U6QA 1VGCC 3BG4C 4FUBA 4BTUB 1XUIA 4F49A 3SV6A 1W13U 3P8NA 3STJA 5JBBS 2P95A 2BM2A 2P59A 3RXJA 3OEHD 4Q7XA 1A0HB 1G32B 3BTEE 3DHKH 4UONA 1THRH 1D3QB 2J38A 1AFEH 1O33A 1SOZA 2KCOA 1KIGH 4J2YB 1EJNA 3TIUA 5E8EH 3UNRA 1EZUC 1C9PA 3SUEA 2RA0A 1QBOA 1C1VH 1C5ZB 3VB7A 5L2ZH 1EQ9A 1O2QA 3H7OA 1FY4A 5T6GA 1AGJA 3VB3A 4E7RG 5EQRA 3GY6A 4H42U 2ZC9H 4I32A 3RXSA 3ZVDA 2LNCA 1UVOA 4Q80A 3RXMA 1Z8JB 5DN6D 1HAYB 2QE7D 3I29A 1XXDA 5EGMA 5FPYA 3SN8A 5J4QA 1QCPA 2NU0E 3RXVA 3M7TA 1SGEE 5EU8A 1C4V2 2VWMA 1GI6A 2ZU3A 1T4VH 4Y7BA 3GICB 1SBWA 2ZU4A 2ZECA 1DPOA 5HMAA 2J98B 3M7UA 3SQEE 5LPRA 2FM2A 2YNBA 1OWEA 1S81A 2P94A 1S5SA 2XC0A 4FOUC 5IDKA 2ANMH 1OPHB 3RXIA 2QXJA 5DP7A 1QFKH 4CH2B 4CREA 1P9SA 1GHBF 4H6TA 3BV9B 3BTTE
chains in the Genus database with same CATH topology
1MQ5A 3KL6A 3SO3A 1HAVA 2BD9A 2BOKA 2Z9GA 4CHAC 4ZXXH 3FFGA 1ZHRA 1DT2A 1BMLA 1LHCH 4OS4A 3MNBA 2ALPA 1P2IA 2EEKA 2NU1E 4K3JA 2BY9X 2C8WB 2OD3B 4Y0ZE 2BDAA 1B0EA 5A2MH 1INCA 3GCTF 4QT8C 3STIA 2VNTA 2IOTA 1KYNA 2BVSH 1ZTJA 1W7XH 1TQ7B 3A80A 1DLEA 1Y3XA 1IHSH 2GZ9A 4FUHA 2B5TB 6GCHG 1C2MA 4MQAA 2F9BH 1O3JA 1V2OT 4WH6A 1V6DA 1JWTA 3S7HB 1V2LT 2JH6D 4IN1A 5FXLA 1PFXC 2G55A 2P16A 3SJ8A 1ZOMA 3URCA 1HXFH 2GCTC 1IQFA 1DE7H 1EPTA 4DG4A 1AVGH 1Q3XA 2ZI2H 3OYPA 4Y7AA 4Y8ZA 1ACBE 8GCHF 1GJCB 1O3MA 2SGEE 4B71A 1DSUA 1PPEE 2ZFPH 1YPLH 1YPEH 4WF8A 4UFGH 3MWIU 4UD9H 3RMNH 2A1DB 2FLRH 1SGPE 1W11U 1O2IA 2VVVA 1ZYOA 2ZF0H 1C5YB 5A0BA 2OC8A 3ZZDA 1C5WB 1BMNH 3W95A 3OSYA 4K1TA 4AG2A 1QB1A 2ZU2A 4Y76A 1GDQA 2O8MA 1DY9A 1ZRBA 4FUIA 1XUJA 7GCHG 1KY9A 1T4UH 1F0RA 1NT1A 1UTPA 1DY8A 2RDLA 3P70B 3ATIA 4NWLA 1MAXA 2XNIA 4UFFH 2BB4A 1O3LA 1QRZA 4IBLH 3L6PA 1O3GA 4DURA 4A92A 3GOVB 2R9PA 5HM9A 2AYWA 3TJNA 1IQJA 1LCYA 4Y8XA 2FOFA 1Z1JA 7GCHF 2K1QA 1QL8A 1IHTH 2H5CA 3TK5A 1CHOG 4MNWA 2UWLA 1G3CA 1J17T 1EB2A 4RKJB 5FPSA 2TGPZ 3UY9A 1BMMH 4Y71A 3QLPH 2J2UA 1AFQB 1UCYK 1PQ7A 1TGSZ 1O2TA 1XUKA 2G51A 2ZDNA 1TPAE 3A7TA 1IOEA 4FUFA 3BTKE 1GMDF 2Q1JA 4AYVB 3SU6A 1P02A 1VITH 4X6NA 1DXWA 1UVTH 3TNSA 5DP5A 2WPMS 1EASA 3M5LA 4TY6A 1GBDA 4GCHG 3UR9A 5I46H 1HJAC 5B6OA 5JBTA 1C1TA 2PLXA 5F6MA 5K0HA 1O37A 2XRCA 1P01A 1AY6H 1GBEA 1HJ9A 1ANBA 1LPZB 3CS7A 2ZHFH 1SSXA 2XBXA 3KNXA 3ZZAA 2VB0A 4I33A 4MPWA 1LTOA 1E34B 1YM0A 2ALVA 1ZTKA 2R2MB 1D9IA 2GT7A 1S6HA 2ZFFH 1GGDB 1GL0E 2ZDMA 2HNTE 3PLBA 1EP5A 1TOMH 3LC5A 4YOGA 1PQ8A 1GJ8B 5A09A 4OGYA 3RUOA 1NRSH 2CXVA 1C1WH 1P2NA 3M35A 2QGRA 1Z71A 2XBYA 1W0ZU 4XBBA 1B5GH 2ODYB 1WCZA 4E06H 1UTLM 1T8LA 2FI4E 2HWLB 5T3HA 4WXIA 2V3OH 3URDA 2AFQB 2FXRA 2ULLA 1LQEA 2UUJB 1GBCA 2GDEH 1UK3A 1FAKH 2DE9A 2ZFSA 2HRVA 1TE0A 4AGJA 4R8TB 2FOHA 1LPKB 1J9CH 1P05A 2TGAA 2VGCC 3TITA 3I77A 2WV4A 1G30B 4GHQA 5SGAE 4OS2A 4KTCA 3LKWA 4ABIA 1MKWK 1YC0A 1W2KH 7ESTE 3KF2A 5AVDA 3O8CA 3TPIZ 4Q7ZA 1MQ6A 1WTHD 3AVZA 1UMAH 1KTTB 1EZQA 3M3VA 1SLXB 3Q3XA 1TBQH 2J95A 1QY6A 3S0NA 2VH6A 4AB9A 1SPJA 2Y5FA 1Y5BT 5C1UA 1J14A 1YP9A 1G3DA 3ENSB 4YOJA 1ELEE 4Q2KA 1KXEA 4NA9H 3N7OA 4Q7YA 1OKXA 2B0FA 2UUKB 3EGKH 1CGJE 1Y5AT 1PPGE 1PJPA 4HI3A 2HLCA 1A46H 1GBBA 3BN9A 2ESTE 4IGDA 4UFDH 2ZTZA 1FY3A 3E16B 3AAVA 4JZDH 5C1XA 2Y7ZA 1C5NH 1P09A 3UNQA 1AWHB 1TA2A 2BMGB 3MNXA 3LGUA 1CGIE 1TX7A 3ZZBA 3UQVA 1A0JA 3Q00A 2PGQB 4KKDA 1TNIA 3QTOH 5A0CA 3PMAB 2H9TH 1G2MA 5DP9A 1CT2E 1SGQE 2Z9IA 3GCHC 2QXIA 4X8SH 2CF8H 4INLA 1YLDA 1YCPK 3U8TH 1V2UT 1K1PA 4Z6AH 3NCLA 3GY5A 4ABFA 1ESTA 1RTFB 2SGAA 3SZNA 1T8NA 1GBAA 2Y81A 3GYLB 4ZKNU 1EATA 3GCOA 5EODA 4B76A 2CN0H 3TLOA 4GVUA 3EE0B 1WV7H 3TJUA 4BAKB 1O2JA 2FMJA 4CBOA 3PLPA 5DO4H 1NS3A 1EPTB 1RFNA 5FCRA 3U1JB 3B8JA 4X0WU 1DUAA 4NA8A 1FNIA 1HAXB 1O3KA 1OWHA 3R3GB 2FODA 1GWAA 4VGCB 3SNCA 1FY1A 2HNTF 1HAGE 3SNAA 1BQYA 4B75A 4JMYA 2WYJA 1BB0B 3KEEA 3FANA 2P8OC 1V2NT 5C67A 4TY7A 2HPQH 5DPAA 1ID5H 4BOHA 2CV3A 4ZHLU 4ABDA 1C1NA 1P04A 1JBUH 2QXHA 5JDUB 4MPUA 2Q6FA 2ZPSA 1BJVA 1UO6A 1GI3A 3KQEA 4JYUH 1SGYE 3UFAA 3TH3H 3HGNA 3P95A 3ZVAA 4ZAEA 1GVLA 3A8AA 3OTJE 1GBMA 2B9LA 2PWXA 1ZTLA 3U98H 2XC4A 1FXYA 1OP2A 1LKBA 1SQAA 3ATMA 4YTAA 2VWNA 2BOHB 2D26C 4DGJA 2BY8X 2H9HA 2WPHS 4RKOB 2QC2A 1BHXF 2CMYA 4CRGA 3P6ZB 1TRNA 3VGCB 4B2CA 3EDXB 2A5IA 5HYOA 5F8TA 3TGIE 3BTDE 2ZG0H 1NZQH 1SOTA 2BQWB 1TPSA 1QB6A 3GCNA 3KIDU 2Y7XA 1W7GH 3A86A 1VR1H 3MFJA 5A0AE 3MI4A 4Y79A 2AGEX 1O2PA 1O3IA 1K1JA 2AGGX 3FAOA 1WQVH 3SJ9A 2UUFB 1P2JA 2R3YA 3EA7A 3O8BA 2HALA 4BTIB 1G3EA 1V3XA 1T32A 2B7DH 2F83A 4JCNA 3MTYA 1T8MA 1GBKA 2WV5A 1LHFH 2ZPQA 1XKBC 2QY0B 2XW9A 4SGAE 2FWWA 2G8TA 4CHAB 1TRMA 3T25A 1FY8E 1TABE 1TOCB 1HRTH 1K1NA 3K6ZA 1BTWA 1A0LA 1GVZA 3MU1A 1C1OA 4GSOA 1HUTH 5HM2A 5C20A 1BTHH 1C1PA 4FUDA 1GMHF 1H1BA 4I7YH 4CRDA 1GJ6A 2WPIS 2J92A 1V2TT 3EYDA 1O0DH 4DOQA 3F9EA 1NU9A 5C5OA 4BAHB 1A7SA 2VIQA 1BTPA 3UOPA 2G5VA 1C5TA 1PPFE 2A7HA 2ZCLP 1XXFA 1HXEH 2F9VA 1ARCA 3WY8A 2FOCA 1O31A 1O3CA 1VCPA 5E2OA 1O3EA 1D3TB 1UTQA 4XBCA 1SHYA 1K9OE 4K69A 2B8OH 1S0RA 2V0BA 3E0PB 2GT8A 1C2DA 3SORA 1WBGB 2OC1A 4AFQA 5EQQA 3QK1A 1FPCH 4FVBA 1S0QA 5JBAS 2FX6A 4CRBA 1E36B 2A7CA 1AE8H 1SGFG 5FPTA 1GMDG 2Z6BD 4MNXA 1EOJA 4JZFH 3DT0H 2ZA5A 1MTNB 2BXUH 3MO3A 1GPZA 1GBFA 2O8LA 3SHAH 3MMGA 2V3HH 3A8DA 1JMOH 1V2VT 4O97A 1MTSA 1K1LA 1QHRB 1SQOA 1ZSLA 2FO9A 1QJ1B 1N6YA 1W3CA 4X6PA 4BNRA 5AHGH 1OP8A 4D76A 5BPEA 4TPIZ 1A5GH 3MH6A 4J1YA 1P0SH 2QCYA 1CT0E 2O8WA 3T26A 4A6LA 1Z1IA 1AQ7A 3ZVGA 3EA9A 2A4OA 3SU1A 1SQTA 1E37B 2ZDKA 1TBZH 3HATH 3LDXH 1O5BB 6LPRA 1K1IA 1P2QA 1DICA 4YT6H 1BBRK 5AF9H 1CBWB 1P3CA 4R0IA 5JB9S 2CHAC 1ELDE 3FP7E 3LU9B 3AW1A 3F9HA 1P9UA 1D3DB 1DDJA 2FYRA 1QQUA 1K21H 1T31A 1EZSC 4O03A 2KAIA 1HIAA 2Z7FE 3Q77A 1PPHE 5DP8A 1FN6A 1AFQC 1L1NA 1TBRH 2ZDLA 1ZPCA 1KXCA 1G3BA 1NO9H 1NFUA 4HZHA 4I8JA 1UK2A 1FONA 2ZFRH 1C5XB 3O8DA 1XUFA 1XUGA 1TRYA 4A1VA 2NU3E 3M3TA 1S6FA 3ODDA 2BDGA 2XBWA 4K1EA 3PM3A 1QB9A 2J4IA 1C5PA 1DFPA 2YNAA 1OOKB 1FQ3A 1TALA 3PLKA 1NRPH 3VPKA 5DG6A 2TGDA 2ZGBH 1P10A 5ABWA 6GCHF 9LPRA 1PPZA 1YCPH 3L3TA 4ZHAA 1C2GA 2A31A 2BQ6B 3GDVA 1ZLRA 2PTNA 3A88A 2OBQA 1IQGA 3EAJA 4ASHA 4B2AA 4AB8A 1GMCG 3F9FA 3L33A 1O2VA 1H4WA 3E91A 4LOYH 3A84A 1EB1H 3NUMA 3GY3A 4MDSA 2H5DA 1GBLA 4X6OA 4NSYA 8KME2 1RS0A 4Y6DA 3EA8A 1YLCA 2FLBH 5GXPA 1GI2A 2EI6A 2EI8A 1YPHC 4YESB 2FP7B 2R2WU 4K2YA 4SGBE 3ZV9A 3ZVCA 1GBIA 1QRWA 2BD4A 2VIOA 3MYWA 3TK6A 9ESTA 1EZXC 1HBTH 4ISIH 4H6SB 1E35B 1MU6B 1O39A 5FHTA 2XCNA 2ZHEH 2BX3A 1JRSA 2ZGJA 3A83A 3BTFE 1DWBH 1FLEE 1P8VC 4NA7A 5A8ZA 3QTVH 1GHAF 2ILNA 2GV6A 3RXOA 1O38A 4WVPE 2FESH 5GJ4B 5LGOA 1C2FA 1T8OA 4HGCA 2C8XB 3ZVFA 1CE5A 4BAOB 3H5CB 1K1MA 1HB0B 1L0ZA 2VJ1A 1L4ZA 3MO6A 1TAWA 4GCHF 3F6UH 1EKBB 1A1RA 4UEHH 4ZROA 1CU1A 1YCPM 1ETSH 1KDQA 4NZLA 4FU9A 3BTWE 4ABAA 4Z0KA 2BD7A 1MCVA 1KXAA 3BTME 2OP9A 1MKWH 1LQDB 2BVXH 8LPRA 3RXDA 1DVAH 1RGQA 1MTVA 1TFXA 2ZDVH 4I8KA 2BLQA 5HXFA 1GJAB 1HAIH 3NK8A 1UVPA 1O5FH 4D9QA 2XWBI 3A89A 7LPRA 1QJ6B 1LDTT 1GHWH 1O3HA 2J34A 4RSPA 1ESBA 1LMWB 3UR6A 3SUDA 2GX4A 1EJMA 2IN2A 2ZEBA 5JYIA 4ZMAH 1ELTA 3UQOA 1QRXA 3PTNA 3QX5H 2ZWLH 1BMAA 2GGVB 3RXRA 3K65B 5LPFA 1JIRA 4NIYA 2Z3EA 1N6XA 4KTUA 3RLYH 2FI5E 5K7RA 2H9EH 2FPZA 4KGAA 1SFIA 2ZPRA 2DE8A 3OY6U 2PFEA 3UIRA 1LHDH 2BLVA 2IJOB 3IITA 1TMTH 2C93B 3CS0A 1J16A 1GCTB 1EP6A 3ZZ6A 4KP0A 3P8OA 1DOJA 1FIZA 4NIWA 1MBQA 1OSSA 4ABGA 2ZZUH 1P11E 1ELFA 1OS8A 1H9HE 3PWCA 1GI7B 3S7KB 5JPMH 1SVPA 1ZZZA 5FAHA 4FUCA 3SOSA 1GHAG 3MO9A 4D7GA 5EG4A 4AORA 3HK6B 1ORFA 1TMBH 3TU7H 4Y8YA 4X8UH 3S69A 2FDAA 1NY22 1C5VA 1BZXE 2HOBA 2VIPA 1AUTC 3SQHE 1MKXK 5E2PA 2ANKH 1S85A 1O3AA 1GBHA 3ZZCA 1DX5M 1UK4A 3LIWA 4DIIH 2PV9B 1ANDA 4BXSA 1ZHPA 1F5RA 2A5AA 1EXFA 3A7VA 3K9XB 3S9BA 2HNTC 3KN2A 1FN8A 3SU0A 1EOLA 2GDDA 2BZAA 1P03A 1AKSA 1VCQA 1AB9C 2YOLA 4IS5A 4ABEA 3K6YA 3SUFA 5EXLA 4D8NA 1VITF 1IQMA 1LHGH 3BIVH 4KELA 3ZYEA 2WYGA 5EPYA 1ZHMA 3SU4A 1YPGH 2XBVA 3KGPA 3RC4A 1VJAU 5G4BA 3ZV8A 1NESE 4TYDA 4WWYA 1K1OA 3H7TA 1QBNA 4HTCH 4AX9H 1E38B 1GL1A 4NSVA 4MNVA 1A2CH 1QQ4A 1D4PB 3GDSA 3TGKE 1MH0A 5DP6A 3U8RH 3BG8A 3A82A 2Z9JA 1ELBA 4D7FA 3KHVA 3PYHA 4X8TH 1TNKA 2PSXA 2BLWA 1F2SE 4WMEA 4XE4A 1C1SA 3C1KA 4WH8A 1ABIH 1P3EA 3NXPA 4BAMB 1D6RA 3UNSA 4X2VA 1HV7A 5C3NA 1FAXA 1QGFA 1TGNA 3PROA 1CA0C 1VITG 3BSQA 1PPCE 1NFWA 3QWCH 3FVFB 1BITA 1ZSKA 4ISOA 2SFAA 1Y3UA 3PMBB 1BIOA 2J9NA 2FOAA 6CHAC 3SV2H 4NWKA 2Y5HA 2ZFQH 3PMHB 1FI8A 1NTPA 2BDYA 1LVBA 1Z6JH 3SGQE 1A4WH 3BF6H 1C1QA 4JZIA 1HGTH 5GDSH 1SL3A 5GPIB 1EAIA 3S9CA 1RIWC 1PQAA 1AVWA 1O2MA 4ZXYH 3SNDA 1EAWA 3IWMA 1YGCH 2PUQH 3A7YA 1ETTH 4OS5A 2G5NA 3M61U 4X6MA 1DANH 1VGCB 3BG4B 1J15A 1WSSH 5C5NA 7KMEH 2SNWA 2NU4E 4MLFB 4X2YA 4NG9H 1BTXA 1TX6A 1GDUA 1V2MT 1O2KA 3F68H 4B1TA 1GG6B 1ZGVA 3IG6B 3T29A 4IMQA 4KTSA 1OWKA 4X1QU 1RXPA 4PROA 1FUJA 4AN7A 1O3BA 1O5DH 3RLWH 2FI3E 1SGDE 2QAAA 2WPKS 1KDQB 1P12E 4BXWA 2TGTA 3LONA 1BTUA 1H9LB 1V2RT 3SGBE 2F9OA