5A8ZA

Crystal structure of human neutrophil elastase in complex with a dihydropyrimidone inhibitor
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
218
structure length
215
Chain Sequence
b'IVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil elastase
publication title Potent and Selective Human Neutrophil Elastase Inhibitors with Novel Equatorial Ring Topology: in vivo Efficacy of the Polar Pyrimidopyridazine BAY-8040 in a Pulmonary Arterial Hypertension Rat Model.
pubmed doi rcsb
molecule tags Hydrolase
total genus 42
structure length 215
sequence length 218
ec nomenclature ec 3.4.21.37: Leukocyte elastase.
pdb deposition date 2015-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5a8zA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5a8zA02
1EOLA 1VR1H 3GCNA 3RC5A 1LHDH 4GUXA 1GCTB 4X2XA 3RXTA 1IQEA 2ZC9H 2BD3A 3TLOA 4PROA 1YPKH 2RA0A 1Y3XA 4BAHB 1JRTA 2HPQH 2Z3DA 1LPZB 3OU0A 5FBIA 4BTIB 1O35A 1WQVH 1OP8A 2F9OA 2R9PA 1HAVA 2OXSA 3RLYH 1FNIA 3F68H 2THFB 1C1TA 2HVXA 5DK1A 1HXFH 1TMBH 3UFAA 1V2VT 3ELAH 4O3TA 1O33A 2H1UA 1LPGB 3ATLA 3UR9A 1FMGA 1XVOA 2BDCA 3S9BA 4JZIA 1CHGA 3GISB 1YKTA 1CU1A 1QTFA 1SLVB 3T26A 3LDXH 5JDUB 2XBWA 2O8TA 3PLPA 3GDVA 3RU4T 1P2OA 1F0TA 1QB6A 1ELDE 3QGNB 2P93A 1W3CA 4NSVA 2FODA 3QWCH 7GCHG 4Y6DA 4UONA 1RRKA 4O97A 1WCZA 1F5KU 2SGQE 1SQTA 1LVYA 3NKKA 1GHWH 1QRZA 2AFQB 4DCDA 1O2YA 1ELFA 2J2UA 2G51A 4K3JA 4NIYA 1SFQB 1NTPA 1QY6A 3M61U 3RMMH 1GMCF 2ZCKP 2FO9A 4THNH 2P8OC 2O9QA 2Z9KA 1SR5C 1TRYA 1EZSC 5A8XA 1C1NA 3PMBB 1BTWA 4ISIH 3TJOA 2BD4A 2EI6A 1A7SA 1ESBA 1KXDA 1NFXA 3OYPA 2BTCE 3SN8A 5I25A 1ZMLA 1PQ5A 4Y7BA 1ZGIA 1S5SA 4KELA 4AFQA 1GVKB 1AB9C 1GGDC 1TB6H 1C2MA 1A5IA 2LPRA 1Q31A 2A7CA 1GL0E 2FTLE 2QXJA 1JIRA 4XOJA 3SO3A 1GI4A 2A32A 2JETC 1Z7KA 4I8JA 5GXPA 2OBQA 3TJNA 2FTMA 1O5DH 3A7YA 1AZ8A 1IQLA 4ZH8A 4NA8A 3PO1C 5A09A 1P01A 3O8CA 4K8BA 1HAOH 1DANH 1G37A 1L4DA 1O2UA 5HM9A 4WXVA 4CRCA 4D8NA 4WY3A 2XNIA 4JZEH 5C5NA 4SGBE 1Y5AT 4D9RA 2ZU1A 3M37A 1RTLA 1FV9A 3K6YA 1TX7A 3TK9A 4IS5A 1A2CH 2VWLA 2P3UB 5ETXA 2BOHB 1Z1IA 8LPRA 2WPHS 1AHTH 2PKAB 4B71A 1GJBB 2XCFA 1V2JT 1ZOMA 3LGVA 5LH8A 4ISOA 4ISNA 2Y82A 4UEHH 4WMDA 1MBQA 2ODYB 2FM2A 4UFGH 2VH0A 3GY3A 1FUJA 3P17H 3Q77A 3MNXA 5PTPA 3G01A 5F8TA 1T32A 3LGTA 1ANBA 1O31A 4ABHA 1INCA 1ZSJA 3QX5H 4KTUA 3MH5A 1KTTB 1KDQA 1GVLA 3MTYA 1OWEA 1F5RA 2ZGJA 5FPSA 2STAE 1GL1A 1O3GA 1EOJA 4OS6A 1DITH 5B6OA 2C8YB 2J9NA 1MCTA 4E7RG 3MH4A 3ZVDA 3BTGE 1HXEH 1SGFA 3RXUA 2TGDA 1UJ1A 1KLTA 3RXPA 4Z6AH 1JMOH 1NRPH 4JYUH 3A87A 3I29A 1BQYA 4TPYA 3Q3YA 2VVVA 3GICB 2PV9B 1A1RA 2XBXA 3URDA 1G36A 1GBKA 1XUHA 3R3GB 1M9UA 4Y8ZA 3LGUA 2WINI 1YLCA 3T28A 1FI8A 2ZNKH 1C1UH 1C1PA 3TH4H 1P11E 2AGGX 1BRCE 1EUFA 1KIGH 1IQMA 1PQ7A 6CHAB 2A5KA 3HK3B 3M3VA 1CT2E 2AYWA 4MPWA 4MPXA 1PQ8A 2YNBA 3MNSA 2PGQB 5E0GA 1Q2WA 1CHOG 2P3TB 1GBIA 3RMNH 3SV7A 1BTUA 3RMOH 3W95A 3A85A 4I33A 1SOZA 5DP4A 2V3OH 3S7HB 3AW1A 5LPFA 1THSH 3A7WA 4TY7A 3U1IB 4FXGH 4ZXYH 2FI4E 1V2ST 2G5NA 4CH8B 1O2IA 1O2RA 1GJCB 1G2LA 2PHBA 1C4U2 2ZDNA 2GVFA 1AQ7A 2ZTYA 2SFAA 3NWUA 3TJVA 5HYOA 4YO9A 1IQJA 2B9LA 2FP7B 3O8BA 3P92A 1O3JA 4YM9A 2TPIZ 2H2ZA 2OQUA 1PFXC 2D2DA 2ZWLH 3ZZ3A 3RXEA 2FXRA 4X2VA 1F5LA 1FPHH 2W5EA 4ABEA 4U2WA 2BVSH 4F4OC 2Z6BD 1HAXB 3ZYEA 4ABGA 1LHGH 4H42U 1C2FA 3RU4E 3VB7A 2VIPA 3UOPA 1MTSA 3OX7U 1O2HA 1DXWA 1SGCA 8KME2 1ZMNA 3EGKH 4Y0ZE 3ZZCA 3MO6A 1HUTH 1OX1A 2BLVA 1FY4A 1C9TA 1NFUA 1BTPA 2ZI2H 1FN6A 2HRVA 1GJAB 2FIRH 1C2LA 1GHBG 1LTOA 1THPB 1O39A 4GVUA 3SU6A 2Z9IA 2Z9LA 1UCYK 5T3HA 2SGPE 3BSQA 1N1LA 1Z1JA 1WOFA 4X8UH 4GAWA 4MQAA 2VIDA 4IW4E 1H8DH 1P2KA 1O2GH 1N6XA 1BRBE 2NU4E 1UTKA 4FVDA 1ZGVA 7LPRA 5GCHF 5J4SA 8GCHG 2QF3A 1NRNH 1Z71A 1KDQB 4WH8A 3MOCA 3IG6B 1VGCC 4MNWA 2ZTZA 3ESTA 3Q3XA 1DVAH 3UOUA 4HZHA 5ESBA 3VB4A 1IQIA 1A5HA 3GYMA 1FY5A 1DWDH 1AFQB 1IHSH 2O8LA 4GLYA 3ZVCA 5EXNA 5FX5A 3QUMP 4Y8XA 2VGCB 5LGOA 1KTSB 4TYDA 2VJ1A 3MO9A 1W8BH 3PTNA 3ZVGA 3NK8A 1TWXB 1BITA 1QJ1B 1UVUH 3M7TA 3ZVFA 3PMAB 1EAXA 3V7TA 3A8AA 2ASUB 1UHBA 1W7XH 2Y7ZA 4CRFA 1GHXH 1J8AA 4OGYA 3RXDA 1EP5A 6GCHF 2EEKA 1ABIH 1QA0A 2ZPQA 1C1WH 4FUBA 2YNAA 5DJ7A 2QA9E 1S82A 2FOGA 2FLRH 2IN2A 3UQOA 2XXLA 2Y5HA 2HLCA 4BNRA 1AWHB 3QN7A 4BAMB 2ZG0H 3QK1A 1O30A 4ZHMU 1TNJA 1ARBA 2ANMH 2CJIA 1FDPA 4I32A 3AASA 4AGJA 2PGBB 1E36B 1TAWA 1UK3A 5DP6A 2WV5A 5EOKA 1DY9A 1F0SA 2QN5T 3RXMA 5LPRA 1BZXE 1TFXA 2CN0H 2F9VA 3EA7A 5EPNA 2ZTXA 1EJAA 1HAZB 1H9LB 4X6NA 2H9HA 2XRCA 1TALA 1EJNA 4F49A 2SGAA 5A0AE 1EAWA 4MDSA 1JXPA 2GZ7A 1O3IA 3C1KA 1ESAA 1Y3VA 1C4V2 1C5UA 2BY9X 1MU8B 1PPBH 1P57B 2ZFSA 2IPHA 3RLWH 1D6RA 1SGQE 2J4IA 1PPCE 2ILNA 5GDSH 1NPMA 4D7GA 2AIQA 3SV9A 1T8MA 4NGAH 1SGRE 4HFPB 4DIHH 3TK6A 5F8ZA 2Z9GA 3TGKE 4YLUA 3MI4A 1TX8A 2O8UA 1C1VH 1MKXK 3GCHB 2D1JA 2R0KA 4D76A 2ANWA 2A31A 4J2YB 1D6WA 4H4FA 1VCPA 4JYVH 4BXSA 1N8OC 1P2IA 1QL8A 1V2OT 2ZQ1A 5SGAE 2VIQA 4NIVA 2A1DB 4CHAB 1UTMA 2XC0A 4FU7A 1KY9A 3PWBA 3SNCA 3VB3A 1C5NH 1E0FD 1MCVA 2LNCA 2PR3A 3UWJH 4ZHAA 1ANDA 2BDAA 3K2UA 3SHAH 1H9HE 1C5MD 1CBWC 1ELTA 1FZZA 1K1NA 8ESTE 1WTHD 3SUFA 3BEFB 3FP6E 1GWAA 1P02A 2ZDLA 3UTUH 3PMHB 3E1XB 1QQUA 1T7CA 1YC0A 2R3UA 2VVCA 3A81A 1C5SA 5DKMA 1QR3E 1O2LA 2PUXB 2ZZUH 3Q76A 4O3UA 2BY7X 2VU8E 2J94A 2ZHQH 1TGBA 3KIDU 2FOAA 2NU3E 1QBNA 1O2QA 1WU1A 1XMNB 2QGRA 1EP6A 4A6LA 1QURH 2XCNA 4FUIA 2CF8H 4X1NU 2GMTB 2CV3A 3VGCB 5E2OA 1UTNA 3KQCA 3ZV9A 5L6NH 2PWXA 3TGJE 2NWNA 4OS1A 1Y5BT 5L2ZH 4A5TS 4AFUA 2BDIA 2AERH 2C3SA 3A8DA 1GDQA 3BF6H 1HIAA 1GI5A 2ZQ2A 2A2XH 1C2DA 2H5CA 1FQ3A 1MKWK 1AUJA 1W10U 1DSUA 1K21H 4AFZA 1RS0A 1Z6JH 2WPJS 1BMNH 1A3EH 1BTZA 1WBGB 1ELCA 1GPZA 3QDZB 5FCRA 3RXVA 2I6QA 1KXFA 3LIWA 4UE7H 1OWHA 1O3CA 1AVGH 1BT7A 1DWBH 2HNTE 3M5MA 4RKOB 1QB9A 4ZMAH 3T2NA 1HB0B 1ELEE 5L30H 2UWLA 1Y3UA 3EA9A 1VCWA 1A5GH 1T8NA 3RUOA 1CA0C 1P8VC 3KNXA 3UQVA 1QNJA 1FAXA 2ZPRA 1DUAA 3AVZA 4Q80A 2P95A 4X1RU 1P2NA 1KLJH 1TGTA 1SL3A 1AZZA 3A8CA 3ZZBA 2RDLA 3SORA 7ESTE 3SBKA 2G00A 3RXIA 5GPIB 1EB1H 1ABJH 1C1SA 1NS3A 1K9OE 3LGWA 4NIWA 1C5VA 4DY7B 2ZU3A 2Q1JA 1O3DA 4Q7YA 4RSPA 5ABWA 2D8WA 1V6DA 5A0CA 1O34A 4I7YH 3QGJA 2QAAA 4ZUHA 2ZKSA 1O3FA 1HGTH 3A7XA 1TA2A 2ANKH 2SGEE 1GMDF 1GMCG 4UDWH 1O5AB 3ZZAA 2Y6TA 3H7OA 1TRMA 1AN1E 2R3YA 1RXPA 3AW0A 4M7GA 1GI2A 5FPTA 1YM0A 3BTHE 1GHAF 3JZ2B 1AKSA 3A89A 5FAHA 2VVUA 4DURA 1VJAU 1S6HA 1K1IA 1GBAA 1Q3XA 1MMJN 2B0FA 3RU4D 2HNTC 2FOHA 2BYAX 2SGFE 4AFSA 1BBRK 2R2MB 2C90B 1GVZA 2RG3A 1L4ZA 3D49H 2XWBI 4RN6A 2ZF0H 1H9IE 2PTNA 3DFJA 3T29A 3MYWA 3FP7E 2XC4A 4R8TB 1O3KA 3SJ8A 1ELGA 1TGNA 2EA3A 1MUEB 2SGDE 2GD4B 1MD7A 1KLIH 2CGAA 1K28D 3BTDE 1EAUA 2ALVA 2PLXA 1KXCA 1Y5UT 2TGTA 4Y79A 2WUBA 4UFFH 5EODA 1OYQA 1C2JA 2OC7A 4GHQA 1QBOA 1P03A 1XXDA 4O03A 1H1BA 3AAUA 1KXEA 3ZZ6A 1LO6A 1MBMA 1GBFA 1W0YH 3MU0A 5DP5A 3ZZ9A 1ZTLA 1UCYH 3HK6B 1O2PA 4K60A 3F9EA 5K0HA 3H7TA 4CH2B 4I8KA 2P8OB 3EYDA 1GBBA 5E0JA 4ZKSU 2W7SA 4X8SH 2FOFA 5F03A 1BHXF 1SGYE 2P59A 3SGBE 4BAKB 1LPKB 4AZ2B 5TJXA 1K22H 1ZZZA 1HNEE 4K2YA 1G9IE 2STBE 4IMQA 3TJUA 3RP2A 1J16A 3GOVB 1AD8H 1QB1A 2QYIA 2FS9A 2TIOA 3GY7A 4U01A 1AB9B 3BTEE 1GGDB 1DT2A 3UR6A 1XUFA 3PLBA 3BTWE 3I78A 5AVDA 2UUYA 2JETB 1T4UH 1P05A 1ACBE 4CBOA 2B5TB 2PKSC 2ZP0H 5EW1H 1T8LA 2FWWA 1P2MA 3SUEA 2BX4A 4YOJA 1E34B 3PO1B 5AFZH 3A7TA 1AO5A 3UUZA 2BLOA 2IJOB 1MAYA 3PTBA 4Y76A 1DSTA 3RXLA 1ETRH 1HJAC 3SU1A 1O3AA 1D9IA 2UUFB 2ZPSA 1BTYA 1ZHMA 1SGPE 3A88A 1HAYB 1TPPA 2QY0B 3GDUA 1NFYA 3GCTF 1K1OA 1GI0A 2A5IA 3P8NA 3F9HA 2OTVA 4Y11E 4HTCH 1RJXB 4ABFA 1LKBA 4DG4A 3SNEA 3KGPA 1F0UA 1HCGA 1SGIB 1O2XA 2AMDA 3RXFA 4K1EA 5EW2H 4QT8C 1YYY1 1BTXA 1C1OA 2F9NA 4GSOA 1HAHH 1NC6A 3TITA 3HGPA 1A3BH 5C5OA 1MU6B 5F6MA 1GDUA 3DA9B 4DOQA 2AMQA 1QGFA 2Z3EA 1ZJDA 1V2MT 1B0FA 3FAOA 2FZZA 5T6DA 1HAVB 3SJIA 2ZFQH 4XDEA 1PPFE 3A82A 2ZGCA 3SU5A 1AKSB 1JWTA 3T25A 4I8HA 1FY1A 2FDAA 2CHAC 3UPEA 5JYIA 2Z3CA 1VCQA 2BXTH 2NU0E 1LKAA 2VWMA 1ZTJA 4IBLH 4X1PU 2BDGA 1NESE 2BDHA 2BQ7B 2P3FH 1AU8A 1C5OH 1K2I1 4IMZA 3AAVA 1DLEA 1QA7A 3M5LA 5FCKA 4MG3A 3V0XA 1MH0A 1XXFA 1V2RT 2ZDKA 4FU8A 1ELBA 3TVJB 3M7QA 5E2PA 4AYYB 4D9QA 4Q7ZA 4ABJA 2HOBA 2Q6FA 1AE8H 4TWYA 3D62A 3KCGH 1TBZH 3KQDA 1SPJA 4Y8YA 3ZZ5A 3LOXA 3MH6A 4ESTE 4FUFA 1ANCA 2XYAA 2WV4A 3L6PA 4NWLA 4ISLA 4DT7B 3EAJA 4BAQB 5FPYA 1G3EA 3LC5A 1GI7B 2TBSA 3SI3H 1QRWA 4XBCA 1GBLA 1A0HB 1HLTH 1UTJA 3V12A 3RXHA 1OS8A 3M7UA 1NROH 1YCPK 2QXGA 4OGXA 5C1YA 9LPRA 1O5FH 1ANEA 3O8DA 4GCHF 3P95A 1PPHE 2FOCA 1DDJA 4TY6A 2Z9JA 2F9PA 1MQ6A 1V2TT 4NA9H 5GCHG 1EPTC 1TNLA 1OSSA 4INKA 5TCCA 3T27A 1KYNA 4YTAA 1GCDA 5HMAA 2H9EH 1A0LA 1GBEA 3PV4A 4Z0KA 1TNGA 5FX6A 2VIOA 1P10A 3W94A 4E06H 3K9XB 4YESB 1BMAA 1SQOA 2OCVB 1HAPH 4TWWA 4A1XA 1S6FA 3ZVAA 3GDSA 3Q00A 3SUGA 3SGAE 4CRBA 1G30B 1SVPA 1ETTH 2Y7XA 2AEIH 1GBTA 1FAKH 3MMGA 1MD8A 1L1JA 3STJA 1DLKB 2A4GA 4MNYA 1ZSKA 3SUDA 5DP3A 3C27B 2A4OA 1IQNA 3A83A 3GY4A 2G5VA 2UUKB 1MKWH 2A7HA 2PFEA 1AVWA 1E38B 3RXBA 4WWYA 1TNHA 1GMHF 2KAIA 4VGCC 1CA8B 2OD3B 2ULLA 2RCEA 2Q6GA 5JB9S 1C5QA 3BN9A 1NU7B 1SGNE 3BTKE 1HPGA 1HRTH 2ZDAH 2V6NA 1UK2A 1AWFH 1TQ0B 1VGCB 1YPGH 1C2HA 1UTPA 1A4WH 2QXHA 3K65B 3BIVH 2OLGA 2WPKS 3MNBA 4YLQH 3SV8A 3U8OH 3BV9B 2AH4X 2BY6X 3E6PH 1XUKA 1YPHE 1LHFH 3M3SA 1VJ9U 1V3XA 3TIUA 1YBWA 1P06A 1TLDA 4X6PA 5FHTA 1GJ7B 4NIXA 2NU2E 1C5RA 1O5BB 3UNRA 3HPTB 4FUHA 4OS2A 2BVXH 3NCLA 4CBNA 1G3DA 5C1XA 1AI8H 4JK5A 1CO7E 1ZSLA 4JK6A 3VEQB 3UWIA 1YP9A 2A0QB 1L1NA 2WPLS 4DW2U 3SQHE 1ELAA 2OC1A 3OY5U 4WXIA 5DP8A 1MTUA 1XM1A 1O32A 1GHBF 1PPGE 2BZAA 3GYLB 1RIWC 1HDTH 1F92A 1YF4A 3ZZ4A 1K1MA 4JZDH 2BLWA 1BBRH 1C2GA 1E35B 2P16A 2GDEH 1EATA 1L0ZA 2WUCA 4I8GA 2BLQA 1SSXA 1O2ZA 3HKIB 3BG4C 1TBRH 2ZU5A 1TE0A 4NG9H 2PTCE 2GTBA 1IQFA 2J92A 3M5NA 4WH6A 1GDNA 3E0PB 2OUAA 8GCHF 3ITIA 2QCYA 4I8LA 5CHAC 4LZ4B 2PUQH 1Z8RA 1TONA 4LZ1H 5JBCS 1D3TB 3E91A 5IYTA 2K1QA 4FUJA 2CXVA 1YPHC 1CT0E 3SU3A 3T5FH 1OPHB 4CR5A 1IOEA 1SFIA 2HALA 1P9UA 3LU9B 1V2WT 1UTQA 3SJ9A 2VB0A 4JYTA 1GI3A 2ZECA 5H4IB 2BDBA 1NT1A 2AIPA 1IQKA 4GPGA 5DP7A 2ZDVH 1EQ9A 1FY8E 2EI7A 3RXCA 1GJ6A 1GJ5H 3PWCA 2JKHA 1HYLA 1BDAA 4FU9A 5EQRA 3E3TA 3LGIA 1SGEE 3U8RH 1TOMH 1S0RA 4AB8A 2BD9A 1O3MA 3UNSA 1TPOA 1GG6C 3LPRA 4JZFH 1GJ4H 2ZGHA 3QTOH 3EDXB 2R0LA 2G4TA 2HNTF 2BDYA 1FIZA 1V2QT 3L33A 3SV2H 4NZLA 2B7DH 3KN2A 1W14U 7KMEH 1YPMH 4Y0YE 3SU4A 6ESTA 1YLDA 1ELVA 1C2KA 2BOKA 4X8VH 3Q3KA 1N8OB 1V2UT 2AS9A 3QO6A 5T6GA 1OWJA 3SHCH 1ZJKA 1D4PB 4R0IA 1SG8B 3L3TA 2W3IA 5JBBS 2A4RA 4AX9H 4INLA 3TNSA 2A4QA 2BY8X 9ESTA 2ZDMA 1SLUB 1CBWB 1EXFA 2BHGA 5DG6A 1G3BA 1ZPCA 3KF2A 1YPEH 2AGEX 2Z94A 1WV7H 3MU8A 3VXEH 4IN1A 1AVXA 2JH6D 1UMAH 5JBAS 3HKJB 1BTHH 1GI8B 1TX6A 2V35A 1EZQA 4LK4A 1FIWA 2C8XB 1CSOE 1C5ZB 4INHA 3MNCA 5BPEA 5DPAA 5CMXH 1VITF 2D26C 1ZRBA 1GBHA 2ZU4A 4XFQA 2SNWA 1NRRH 2JH5D 1G3CA 5EG4A 4D7FA 3RDZA 5GJ4B 1XX9A 1GJ8B 2W7UA 1UHBB 4MNXA 3SNDA 1W11U 1GMDG 3TU7H 1O2NA 4X1QU 1QCPA 1B0EA 3ZYDA 3BTQE 3STIA 1LQEA 4ABIA 2GT7A 1J9CH 2GZ8A 1GHAG 1ZHPA 2OBOA 2WPIS 3A84A 4DJZB 1T8OA 1C2IA 1O2WA 3IWMA 5CE1A 2GZ9A 3EA8A 1WUNH 1L2EA 1O0DH 3QTVH 2VIWA 2WYJA 2AGIX 3LGYA 3RXOA 1EZUC 4AN7A 2GCTC 1ORFA 1TNKA 1MTNC 1NO9H 1BA8B 2V0BA 3CS7A 1PPZA 3MU4A 1CA0B 4NA7A 3TPIZ 2OC8A 4BAOB 4MVNA 4WMEA 1TABE 1SHHB 4BTTB 2PKAA 4AOQA 2GCHF 5E8EH 2OQ5A 3RXKA 1C5YB 1MZAA 4RKJB 3CS0A 4TPIZ 4SGAE 2GV6A 2ESTE 2ZFPH 1UTOA 1C1RA 2G52A 1PYTC 2TRMA 4CREA 2ZA5A 2A7JA 4LOYH 2ZO3H 3ZZ7A 1P04A 1P9SA 1GCTC 1O2MA 1EJMA 1C1MA 1K1PA 1YCPH 1N6YA 2BB4A 2VIVA 1C5PA 3D65E 1C5XB 1GBJA 3OSYA 3SI4H 6LPRA 2QC2A 3NZIA 1V2PT 4FUDA 1BRAA 4A1VA 1XUJA 4B2CA 1Z8JB 1AIXH 2F9UA 2WYGA 1D3DB 4X8TH 3A80A 4IC5A 1A61H 1O3LA 1EAIA 1V2KT 2P94A 1GI1A 5DO4H 2ZGBH 3SJOA 5C1UA 2ODPA 4UD9H 3UY9A 1BOQA 3PB1E 4Y71A 2H5DA 3FANA 3QZQA 1TGSZ 1SBWA 2QXIA 4BXWA 1ARCA 4ASHA 3TGIE 4ZROA 3M5OA 1W12U 3GY5A 2OP9A 4XBDA 2G8TA 2ZHWH 1O2VA 1BCUH 1OP2A 4AGKA 3SZNA 2ZGXH 4IC6A 3FFGA 1DPOA 3GCTG 1DS2E 2JH0D 2BXUH 3D23A 5I46H 2FS8A 4A7IB 3KEEA 4X2YA 2PSXA 3RC4A 1W2KH 2XBVA 1KSNA 1IQGA 4OS4A 1OKXA 1FPCH 1FN8A 1S81A 1XUGA 3ATMA 4A92A 1QJ7B 5EQQA 1S0QA 1S85A 2ANYA 3LJJA 3TNTA 1EPTA 1SGDE 3B23B 1KXAA 1Y3YA 1SGFG 2IOTA 1BJUA 1CE5A 1L1GA 1ZPZA 2FX4A 1QL7A 2DUCA 2SNVA 1CVWH 4FVBA 1HIAB 1KXBA 5E0HA 1LVBA 5IDKA 3VB5A 1OYTH 1O2TA 3RC6A 1AUTC 4NSYA 4X1SU 3RM0H 3QZRA 4GHTA 1DWEH 4B1TA 1THRH 2PKSB 1O5EH 4KKDA 2GDDA 1ZR0A 1WAYB 4MNVA 3SOSA 4H6SB 4B74A 1CQQA 5C20A 4B2BA 2J95A 4HGCA 3GY6A 7GCHF 2G81E 2BD8A 5L2YH 1HJAB 4WJG2 1UTLM 4DIIH 4K8YA 1PQAA 1XKBC 1JRSA 2FLBH 4X6OA 5BRRE 4MLFB 1SLXB 1ID5H 2B8OH 1HV7A 5HGGA 1YGCH 1Y3WA 2ZEBA 3VFEA 1AFEH 2BX3A 4WF8A 5GIBA 3RMLH 4J1YA 1EZXC 3VXFH 3S9AA 1EX3A 1HJ9A 2WPMS 1AMHA 2BVRH 5G4BA 1O36A 4KTSA 4K1TA 4WVPE 3VB6A 1SMFE 1TRNA 2FOEA 1ZLRA 3HGNA 2FMJA 2HPPH 4DGJA 5C67A 1EB2A 1PPEE 3PM3A 2FEQH 3ZVBA 4OS7A 3T62A 1Z8IB 4CR9A 4B75A 3P8FA 1AY6H 1JIMA 1V2LT 3U98H 3NUMA 1Z6EA 2A2QH 1DUEA 1RGQA 1GJ9B 4I31A 4WMFA 3QLPH 1TA6A 1J14A 1AE5A 1UK4A 1WYKA 4GCHG 2TGAA 3PLKA 1NFWA 4ZAEA 2CHAB 2Y5GA 5LPEA 4OS5A 5K7RA 3SU2A 5DGJA 1RFNA 2W3KA 1ZMJA 2GV7A 1CGIE 5FXLA 5A0BA 3E90B 1UCYE 3BIUH 3FZZA 3PMJA 2CF9H 1JOUB 2W26A 3LH1A 1WSSH 1BB0B 1LQDB 2ZU2A 3U69H 3SNBA 5ESTE 6CHAC 4BOHA 5A8ZA 1E37B 4B2AA 1CGJE 3SV6A 1MKXH 4UFEH 3FVFB 1LHCH 4YOGA 3SGQE 3SNAA 2OC0A 1GBCA 1IQHA 3GY2A 1DX5M 5EQSA 3H5CB 2Z7FE 1UVOA 2BM2A 3F9GA 1B5GH 2R2WU 2VWOA 2J34A 5HXFA 2PSYA 1DICA 3VPKA 4YOIA 2VWNA 1YPLH 1DE7H 1O3BA 1UO6A 3UIRA 5A2MH 4NFFA 3OTJE 1C2EA 3ATWA 5A8YA 3ENSB 1D3PB 1BHXB 3I77A 1J15A 2F9BH 4O9VA 1GMHG 3TH3H 1GI6A 3M3TA 1NRQH 1C5LH 3NXPA 3SJKA 5AHGH 1CGHA 1EPTB 2FESH 1O2JA 3RXAA 1S84A 2FYQA 3LONA 2C8ZB 1AGJA 3S9CA 3ODDA 1DWCH 1GBMA 1SB1H 3CENA 1F7ZA 2UUJB 3MHWU 1PYTD 1UVSH 3KQBA 5T6FA 3TH2H 1TYNA 1YPJH 1IHTH 1HJ8A 3P8GA 1O3HA 1GJDB 4H6TA 2ZHEH 3EQ0H 1K1LA 1V2NT 5DP9A 1D3QB 2VH6A 4NZQA 4LXBH 2ZFTA 1CHOF 1ZRKA 3DFLA 1P2JA 1J17T 2ZIQH 3RXJA 4A1TA 1OWIA 1A46H 3R0FA 1C4Y2 1QJ6B 3LH3A 1O37A 2BMGB 2GX4A 1O3OA 3GCOA 2F3CE 6GCHG 5EPYA 3SW2B 3MU1A 2Y5FA 2TGPZ 4AG1A 4NCYA 1VZQH 4JMYA 1U6QA 2GT8A 1UVPA 1QIXB 4X6MA 3B8JA 1TPAE 2ZFFH 1X7AC 1ZTKA 4VGCB 1W7GH 3S69A 2ZFRH 4U30A 1C5TA 3MU5A 1LHEH 1H8IH 3ZVEA 1HAGE 3JZ1B 1O3EA 1C5WB 2BQ6B 3ZZ8A 1WTGH 1FONA 1QFKH 2ODQA 2UWPA 2G4UA 4Q2KA 1RTKA 4K69A 1AFQC 2HGTH 2XTTB 4HI3A 1QHRB 2EC9H 2VGCC 4E7NA 1BMMH 1IAUA 3EE0B 3S7KB 2A5AA 1NU9A 3RXSA 1P12E 2BQWB 3SQEE 1PJPA 1SHYA 3IITA 2XBYA 3BEUA 4CRDA 2ZHFH 1O38A 1P2QA 3TK5A 1FXYA 1P09A 2DE8A 4JZ1A 4YT7H 1TPSA 2BZ6H 1DOJA 3U1JB 2XC5A 4UFDH 3MFJA 3OY6U 3LJOA 1NM6A 1DFPA 1NN6A 2F91A 2FYRA 2VNTA 4AORA 2M5TA 1SC8U 4XE4A 1O5GH 3DT0H 1O2SA 1DY8A 1RIWB 3LC3A 1Y59T 2A45B 1CT4E 2C4FH 1HBTH 2G55A 5JB8S 1HFDA 3MO3A 4JCNA 4IN2A 4ISHH 3U8TH 2PW8H 1P0SH 1F0RA 2ZCLP 1ZHRA 1SLWB 2QIQA 1MZDA 1SQAA 3BG4B 1TBQH 3CP7A 4XSKU 3WY8A 4X0WU 3F9FA 5J4QA 3RXRA 1OOKB 1LCYA 3KL6A 5CHAB 4ABAA 5GWZA 2GGVB 3DHKH 1GBDA 1EKBB 2ZCHP 2C93B 2H9TH 2VINA 3E16B 3FZDA 4B76A 1GI9B 4K1SA 5JBTA 4MPUA 4B73A 3LT3A 3RXQA 3K6ZA 3V13A 4MTBA 1SI5H 2GKVE 1O3NA 4CRGA 3P8OA 3HATH 2FI3E 2I6SA 2J38A 2FOMB 1FJSA 2XW9A 1UVTH 2AMPA 4K5ZA 4Y10E 3A7VA 1FLEE 3B9FH 4AYVB 1O2KA 1ESTA 3A7ZA 2O8MA 3ZZDA 2BD5A 2OINA 1OXGA 2NU1E 5FBEA 4X2WA 1W0ZU 1GG6B 4YZUA 5EXLA 1QBVH 1MTWA 3KQEA 1VITG 4CRAA 3LKWA 3DUXH 4KP0A 1K1JA 1TMUH 2C8WB 3GCHC 3MH7A 3RXGA 3PROA 3A86A 2GP9B 1NZQH 4Y7AA 1XUIA 1ZPBA 3U9AH 4ABDA 4BANB 1A0JA 3ATIA 1TQ7B 2Y80A 1O3PB 1RTFB 2HWLB 3P6ZB 1G2MA 4CHAC 1BRUP 3F6UH 2F83A 2BY5X 2FOBA 2KAIB 1JBUH 1O5CB 3N7OA 1LVOA 2DE9A 5EGMA 4FUGA 4Q7XA 3SU0A 1DXPA 3BTME 4ABBA 3E0NB 1B7XB 2V3HH 1QQ4A 1MAXA 3ZV8A 2BD2A 2O8WA 1Y8TA 1VITH 2Y81A 1XKAC 4FUEA 3UNQA 1QL9A 1TGCA 1W13U 1XVMA 2EI8A 4KGAA 1OP0A 1T4VH 3NPSA 5EU8A 3BTFE 1NRSH 2GCHG 4BTUB 4ZKRU 2BD7A 1C1QA 4ZKOU 5HM2A 3URCA 1BBRE 1ZYOA 3FP8E 4E05H 3UREA 1LMWB 1GHYH 2ALPA 4YT6H 3KHVA 1Z8GA 4AB9A 1OWDA 2QF0A 2GMTC 1SGTA 1HAIH 3VGCC 5C3NA 5TCAA 1S83A 3BG8A 4DVAU 4XBBA 2FX6A 4ZKNU 1GHVH 1O2OA 5C2ZA 3O8RA 1TIOA 1BUIA 3GY8A 1MQ5A 5AFYH 2ZHDA 5EXMA 4NWKA 2H6MA 4FUCA 2Q6DA 3PYHA 4ZHLU 3P70B 1TOCB 1MTVA 1BJVA 3M35A 1DM4B 1YCPM 3MWIU 1OWKA 2FI5E 4NFEA 4ZXXH 1TMTH 1WQSA 1T31A 4U32A 1GHZA 1FY3A 2GCTB 1MTNB 3ATKA 3RM2H 3BEIB 3ODFA 5F8XA 3S0NA 3V3MA 2YOLA 1H4WA 3BTTE 1SOTA 2CMYA 2RA3A 1F2SE 3F1SB 1P3CA 3A8BA 5JPMH 1BIOA 1LDTT 1TNIA 3DD2H 2FPZA 5AF9H 3E8LA 1C9PA 2UWOA 1NY22 1RD3B 4AG2A 1ETSH 2XWAA 4MPVA 1LVMA 1EASA 1BMLA 2QV1A 4IGDA 3M36A 1QRXA 1G32B 1P3EA 4KTCA
chains in the Genus database with same CATH superfamily
1EOLA 1VR1H 3GCNA 3RC5A 1LHDH 4GUXA 1GCTB 4X2XA 3RXTA 1IQEA 2ZC9H 2BD3A 3TLOA 4PROA 1YPKH 2RA0A 1Y3XA 4BAHB 1JRTA 2HPQH 2Z3DA 5KECA 1LPZB 3OU0A 5FBIA 4BTIB 1O35A 1WQVH 1OP8A 2F9OA 2R9PA 1HAVA 2OXSA 3RLYH 2RFKC 1FNIA 3F68H 2THFB 1C1TA 2HVXA 2GJGA 5DK1A 1HXFH 1TMBH 3UFAA 1V2VT 3ELAH 4ACAA 4O3TA 1O33A 2H1UA 1LPGB 3ATLA 3UR9A 1FMGA 1XVOA 2BDCA 3S9BA 4JZIA 1CHGA 3GISB 1YKTA 1CU1A 1QTFA 1SLVB 3T26A 3LDXH 5JDUB 2XBWA 2O8TA 3PLPA 3GDVA 3RU4T 1P2OA 1F0TA 1QB6A 1ELDE 3QGNB 2P93A 1W3CA 4NSVA 2FODA 3QWCH 7GCHG 4Y6DA 4UONA 1RRKA 4O97A 1WCZA 1F5KU 2SGQE 1SQTA 1LVYA 3NKKA 1GHWH 1QRZA 2AFQB 4DCDA 3PV5A 1O2YA 1ELFA 2J2UA 2G51A 4K3JA 4NIYA 1SFQB 1NTPA 1QY6A 3M61U 2J98B 3RMMH 1GMCF 2ZCKP 2FO9A 4THNH 2P8OC 2O9QA 2Z9KA 1SR5C 1TRYA 1EZSC 5A8XA 2YMSD 1C1NA 3PMBB 1BTWA 1H8ED 4ISIH 3TJOA 2BD4A 2EI6A 1A7SA 1ESBA 1KXDA 1NFXA 3OYPA 2BTCE 3SN8A 5I25A 1ZMLA 1PQ5A 4Y7BA 1ZGIA 1S5SA 4KELA 4AFQA 1GVKB 1AB9C 1GGDC 1TB6H 1C2MA 1A5IA 2LPRA 1Q31A 2A7CA 1GL0E 2FTLE 2QXJA 1JIRA 4XOJA 3SO3A 1GI4A 2A32A 2JETC 1Z7KA 4I8JA 5GXPA 2OBQA 3TJNA 2FTMA 1O5DH 3A7YA 1AZ8A 1IQLA 4ZH8A 4NA8A 3PO1C 5A09A 1P01A 3O8CA 4K8BA 1HAOH 1DANH 1G37A 1NBMD 1L4DA 1O2UA 2XNDD 3F2FA 5HM9A 4WXVA 4CRCA 4D8NA 4WY3A 2XNIA 4JZEH 5C5NA 4SGBE 1Y5AT 4D9RA 2ZU1A 3M37A 1RTLA 1FV9A 3K6YA 1TX7A 3TK9A 4IS5A 1A2CH 2VWLA 2P3UB 5ETXA 2BOHB 1Z1IA 8LPRA 2WPHS 1AHTH 2PKAB 4B71A 1GJBB 2XCFA 1V2JT 1ZOMA 3LGVA 5LH8A 4ISOA 4ISNA 2Y82A 4UEHH 4WMDA 1MBQA 2LP6A 2ODYB 2FM2A 4UFGH 2VH0A 3GY3A 1FUJA 3P17H 3Q77A 3MNXA 5PTPA 3G01A 5F8TA 1T32A 3LGTA 1ANBA 1O31A 4ABHA 1INCA 1ZSJA 3QX5H 4KTUA 3MH5A 1KTTB 1KDQA 1GVLA 3MTYA 1OWEA 1F5RA 2ZGJA 5FPSA 2STAE 1GL1A 2J5UA 1O3GA 1EOJA 4OS6A 1DITH 5B6OA 2C8YB 2J9NA 1MCTA 4E7RG 3MH4A 3ZVDA 3BTGE 1HXEH 1OHHD 1SGFA 3RXUA 2M2AA 2TGDA 1UJ1A 1KLTA 3RXPA 4Z6AH 1JMOH 1NRPH 4JYUH 3A87A 3I29A 1BQYA 4TPYA 3Q3YA 5C0UA 2VVVA 3GICB 2PV9B 1A1RA 2XBXA 3URDA 1G36A 1GBKA 1XUHA 3R3GB 1M9UA 4Y8ZA 3LGUA 2WINI 1YLCA 3T28A 1FI8A 2ZNKH 1C1UH 1C1PA 3TH4H 1P11E 2AGGX 1BRCE 1EUFA 1KIGH 1IQMA 1PQ7A 6CHAB 2A5KA 3HK3B 3M3VA 1CT2E 2AYWA 4MPWA 4MPXA 1PQ8A 3KYFA 2YNBA 3MNSA 2PGQB 5E0GA 1Q2WA 1CHOG 2P3TB 1GBIA 3RMNH 3CNRA 1BTUA 3SV7A 3RMOH 3W95A 2QE7D 3A85A 4I33A 1SOZA 5DP4A 2V3OH 3S7HB 3AW1A 4Z1MD 5LPFA 1THSH 3A7WA 4TY7A 3U1IB 4FXGH 4ZXYH 2FI4E 1V2ST 2G5NA 4CH8B 1O2IA 1O2RA 1GJCB 1G2LA 2PHBA 3UB0A 1C4U2 2ZDNA 2GVFA 1AQ7A 2ZTYA 2J97A 2SFAA 3NWUA 3TJVA 5HYOA 4YO9A 1IQJA 1YY3A 2B9LA 2FP7B 2WHXA 3O8BA 3P92A 1O3JA 4YM9A 2TPIZ 2H2ZA 2OQUA 1PFXC 2D2DA 2ZWLH 3H09A 3ZZ3A 3RXEA 4P00A 2FXRA 4X2VA 3MQKC 1F5LA 1FPHH 2W5EA 4ABEA 4U2WA 2BVSH 4F4OC 2Z6BD 1HAXB 5GNDA 3DSGA 3ZYEA 4ABGA 1LHGH 4H42U 1C2FA 3RU4E 3VB7A 2VIPA 3UOPA 1MTSA 1E1RD 3OX7U 1O2HA 1DXWA 1SGCA 8KME2 2KCPA 1ZMNA 3EGKH 4Y0ZE 3ZZCA 3MO6A 1HUTH 1OX1A 2BLVA 1FY4A 1C9TA 1NFUA 1BTPA 2ZI2H 1FN6A 2HRVA 1GJAB 2FIRH 1C2LA 1GHBG 1LTOA 1THPB 1O39A 2VBCA 4GVUA 3SU6A 2Z9IA 2Z9LA 1UCYK 5T3HA 2SGPE 3BSQA 1N1LA 1Z1JA 1WOFA 4X8UH 4GAWA 3VG8A 4MQAA 2VIDA 4IW4E 1H8DH 1P2KA 1O2GH 1N6XA 1BRBE 2NU4E 1UTKA 4FVDA 1ZGVA 3FOAA 5GCHF 7LPRA 5J4SA 8GCHG 2QF3A 1NRNH 1Z71A 2KZ4A 2QF4A 1KDQB 3DSOA 4WH8A 3MOCA 3IG6B 1VGCC 4MNWA 2ZTZA 3ESTA 3Q3XA 1DVAH 3UOUA 4HZHA 5ESBA 3VB4A 1IQIA 1A5HA 3GYMA 1FY5A 1DWDH 1AFQB 1IHSH 2O8LA 4GLYA 3ZVCA 5EXNA 5FX5A 3QUMP 4Y8XA 2VGCB 5LGOA 1KTSB 2WPDD 4TYDA 2VJ1A 3MO9A 1W8BH 1WXRA 3PTNA 3ZVGA 3NK8A 1TWXB 1BITA 1QJ1B 1UVUH 3M7TA 3ZVFA 3PMAB 1EAXA 3V7TA 3A8AA 2ASUB 1UHBA 1W7XH 2Y7ZA 4CRFA 4YXWD 1GHXH 1J8AA 4OGYA 3RXDA 1EP5A 6GCHF 2EEKA 1ABIH 1QA0A 2ZPQA 1C1WH 4FUBA 2JDID 2YNAA 5DJ7A 2QA9E 3KQ5A 1S82A 2FOGA 2FLRH 2IN2A 3UQOA 2XXLA 2Y5HA 2HLCA 4BNRA 1AWHB 3QN7A 4BAMB 2ZG0H 3QK1A 1O30A 4ZHMU 1TNJA 1ARBA 2ANMH 2YMSB 2CJIA 1FDPA 4I32A 3AASA 4AGJA 2PGBB 1E36B 2OK5A 1TAWA 1UK3A 5DP6A 2WV5A 5EOKA 1DY9A 1F0SA 2QN5T 3RXMA 5LPRA 2L74A 3N99A 1BZXE 1TFXA 2CN0H 5C17A 2F9VA 3EA7A 5EPNA 2ZTXA 1EJAA 1HAZB 1H9LB 4X6NA 2H9HA 2XRCA 1TALA 1EJNA 4F49A 2SGAA 5A0AE 1EAWA 4MDSA 1JXPA 2GZ7A 1O3IA 3C1KA 3WWBA 1ESAA 1Y3VA 1C4V2 1C5UA 2BY9X 1MU8B 1PPBH 1P57B 2ZFSA 2IPHA 3RLWH 1D6RA 1SGQE 5EJZA 2J4IA 1PPCE 2ILNA 5GDSH 1NPMA 4D7GA 2AIQA 3SV9A 1T8MA 4NGAH 1SGRE 4HFPB 4DIHH 3TK6A 5F8ZA 2Z9GA 3TGKE 4YLUA 3MI4A 1TX8A 2O8UA 1C1VH 1MKXK 3GCHB 2D1JA 2R0KA 4D76A 2ANWA 2A31A 4J2YB 1D6WA 4H4FA 1VCPA 4JYVH 4BXSA 1N8OC 1P2IA 1QL8A 1V2OT 2ZQ1A 5SGAE 2VIQA 4NIVA 2A1DB 4CHAB 1UTMA 2XC0A 4FU7A 1KY9A 3PWBA 3SNCA 3VB3A 1C5NH 3OEED 1E0FD 1MCVA 2LNCA 2PR3A 3UWJH 4ZHAA 1ANDA 4XRNA 2BDAA 3K2UA 3SHAH 1H9HE 1C5MD 1CBWC 1ELTA 1FZZA 1K1NA 8ESTE 1WTHD 3SUFA 3BEFB 4B6EA 3FP6E 1GWAA 1P02A 2ZDLA 3UTUH 3PMHB 3E1XB 1QQUA 1T7CA 1YC0A 2R3UA 2VVCA 1WDIA 3A81A 1C5SA 5DKMA 1QR3E 1O2LA 2PUXB 2ZZUH 3Q76A 4O3UA 2BY7X 2VU8E 2J94A 2ZHQH 1TGBA 3SYJA 3KIDU 2FOAA 2NU3E 1QBNA 1O2QA 1WU1A 1XMNB 2QGRA 1EP6A 4A6LA 1QURH 2XCNA 4FUIA 2CF8H 4X1NU 2GMTB 2CV3A 3VGCB 5E2OA 1UTNA 3KQCA 3ZV9A 5L6NH 2PWXA 3TGJE 2NWNA 1S6LA 4OS1A 1Y5BT 5L2ZH 4A5TS 4AFUA 2BDIA 2AERH 2C3SA 3A8DA 1GDQA 3BF6H 1HIAA 1GI5A 2ZQ2A 2A2XH 1C2DA 2H5CA 1FQ3A 1MKWK 1AUJA 1W10U 1SKYE 1DSUA 1K21H 4AFZA 1RS0A 1Z6JH 2WPJS 1BMNH 2JJ2D 1A3EH 1BTZA 1WBGB 1ELCA 1GPZA 3QDZB 5FCRA 3RXVA 2I6QA 1KXFA 3LIWA 4UE7H 1OWHA 1O3CA 1AVGH 1BT7A 1DWBH 2HNTE 3M5MA 4RKOB 1QB9A 4ZMAH 3T2NA 4AC9A 1HB0B 1ELEE 5L30H 2UWLA 1Y3UA 3EA9A 1VCWA 1A5GH 1T8NA 3RUOA 1CA0C 1P8VC 3KNXA 3UQVA 1QNJA 1FAXA 2ZPRA 1DUAA 3AVZA 4Q80A 2P95A 4X1RU 1P2NA 1KLJH 1TGTA 1SL3A 1AZZA 3A8CA 3ZZBA 2RDLA 5T1VA 3SORA 7ESTE 3SBKA 2G00A 3RXIA 5GPIB 1EB1H 1ABJH 1C1SA 1NS3A 1K9OE 3LGWA 1COWD 4NIWA 1C5VA 4DY7B 2ZU3A 2Q1JA 1O3DA 4Q7YA 4RSPA 5ABWA 2D8WA 1V6DA 5A0CA 1O34A 4I7YH 3QGJA 2QAAA 4ZUHA 2ZKSA 3DCLA 1O3FA 1HGTH 3A7XA 1TA2A 2ANKH 2SGEE 1GMDF 1GMCG 4UDWH 1O5AB 3ZZAA 2Y6TA 3H7OA 1TRMA 1AN1E 2R3YA 1RXPA 3AW0A 4M7GA 1GI2A 5FPTA 1YM0A 3BTHE 1GHAF 3JZ2B 1AKSA 3A89A 5FAHA 2VVUA 4DURA 1VJAU 1S6HA 1K1IA 1GBAA 1Q3XA 1MMJN 2B0FA 3RU4D 2HNTC 2FOHA 2BYAX 2SGFE 4AFSA 1BBRK 2R2MB 2C90B 1GVZA 2RG3A 1L4ZA 3D49H 2XWBI 4RN6A 2ZF0H 1H9IE 2PTNA 3DFJA 3T29A 3MYWA 3FP7E 2XC4A 4R8TB 1O3KA 3SJ8A 1ELGA 1TGNA 2EA3A 1MUEB 2SGDE 2GD4B 4ACBA 1MD7A 1KLIH 2CGAA 1K28D 3BTDE 1EAUA 2ALVA 2PLXA 1KXCA 1Y5UT 2TGTA 4Y79A 2WUBA 3GS9A 4UFFH 1OYQA 5EODA 1C2JA 2OC7A 4GHQA 1QBOA 1UW7A 1P03A 3FN8A 1XXDA 4O03A 1H1BA 3AAUA 1KXEA 3ZZ6A 1LO6A 1MBMA 1GBFA 1W0YH 2WSSD 3MU0A 5DP5A 3ZZ9A 1ZTLA 1UCYH 3HK6B 1O2PA 4K60A 5EJ1A 3F9EA 2KX4A 5K0HA 3H7TA 4CH2B 4I8KA 2P8OB 3EYDA 1GBBA 5E0JA 4ZKSU 2W7SA 4X8SH 2FOFA 5F03A 1BHXF 1SGYE 2P59A 3SGBE 4BAKB 1LPKB 4AZ2B 5TJXA 1K22H 1ZZZA 1HNEE 4K2YA 1G9IE 5B6LA 2STBE 4IMQA 3TJUA 3RP2A 1J16A 3GOVB 1AD8H 1QB1A 2QYIA 2FS9A 2TIOA 3GY7A 2KFWA 4U01A 1AB9B 3BTEE 1GGDB 1DT2A 3UR6A 1XUFA 3PLBA 3BTWE 3I78A 5AVDA 2UUYA 2JETB 1T4UH 1P05A 1ACBE 4CBOA 2B5TB 2PKSC 2ZP0H 5EW1H 1T8LA 2FWWA 1P2MA 3SUEA 2BX4A 4YOJA 1E34B 3PO1B 5AFZH 3A7TA 1AO5A 3UUZA 2BLOA 2IJOB 1MAYA 3PTBA 4Y76A 1DSTA 3RXLA 1ETRH 1HJAC 3SU1A 1O3AA 1D9IA 2UUFB 2ZPSA 1BTYA 1ZHMA 1SGPE 3A88A 1HAYB 1TPPA 2QY0B 3GDUA 1NFYA 3GCTF 1K1OA 1GI0A 2A5IA 3P8NA 3F9HA 2OTVA 4Y11E 4HTCH 1RJXB 4ABFA 5C94A 1LKBA 4DG4A 3SNEA 5CDFE 3KGPA 1F0UA 1HCGA 1SGIB 1O2XA 2AMDA 3RXFA 4K1EA 5EW2H 4QT8C 1YYY1 1BTXA 1C1OA 2F9NA 4GSOA 1HAHH 1NC6A 3TITA 3HGPA 3U28C 1A3BH 5C5OA 1MU6B 5F6MA 1GDUA 3DA9B 4DOQA 2AMQA 4Q4LA 1QGFA 2Z3EA 1ZJDA 1V2MT 1B0FA 3FAOA 2FZZA 5T6DA 1HAVB 3SJIA 2ZFQH 4XDEA 1PPFE 3A82A 2ZGCA 3SU5A 1AKSB 1JWTA 3F2HA 3T25A 4I8HA 1FY1A 2FDAA 4TT3D 2CHAC 3UPEA 3PRDA 5JYIA 2Z3CA 1VCQA 2BXTH 2NU0E 1LKAA 2VWMA 1ZTJA 4IBLH 4X1PU 2BDGA 1NESE 4B6FA 2BDHA 2BQ7B 2P3FH 1AU8A 1C5OH 1K2I1 4M9FA 4IMZA 3AAVA 1DLEA 1QA7A 3M5LA 5FCKA 4MG3A 3V0XA 1MH0A 1XXFA 1V2RT 2ZDKA 4FU8A 1ELBA 3TVJB 3M7QA 5E2PA 4AYYB 4D9QA 4Q7ZA 4ABJA 2HOBA 2Q6FA 1AE8H 4TWYA 3F0PA 3D62A 3KCGH 1TBZH 3KQDA 1SPJA 4Y8YA 3ZZ5A 3LOXA 1SQRA 3MH6A 4ESTE 4FUFA 1ANCA 2XYAA 2WV4A 4F48B 3L6PA 4NWLA 1MABB 4ISLA 4DT7B 3EAJA 4BAQB 5FPYA 1G3EA 3LC5A 1GI7B 2TBSA 3PRBA 3KYGA 3SI3H 1QRWA 4XBCA 1GBLA 1A0HB 1HLTH 1UTJA 3V12A 3RXHA 1OS8A 3M7UA 1NROH 1YCPK 2QXGA 4OGXA 5C1YA 9LPRA 1O5FH 1ANEA 3O8DA 4GCHF 3P95A 3EE7A 1PPHE 2FOCA 1DDJA 4TY6A 2Z9JA 2F9PA 1MQ6A 1YWUA 4RT1A 1V2TT 4NA9H 3FKSD 5GCHG 1EPTC 1TNLA 1OSSA 4INKA 5TCCA 3T27A 1KYNA 4YTAA 1GCDA 5HMAA 2H9EH 1A0LA 1GBEA 3PV4A 4Z0KA 1TNGA 5FX6A 2VIOA 1P10A 3W94A 4E06H 3K9XB 4YESB 1BMAA 1SQOA 2OCVB 1HAPH 4TWWA 4A1XA 1S6FA 3ZVAA 2CK3D 3GDSA 3Q00A 3SUGA 3SGAE 4CRBA 1G30B 1SVPA 1ETTH 2HVYB 2Y7XA 2AEIH 1GBTA 4F55A 3AK5A 1FAKH 3MMGA 1MD8A 1L1JA 2WV9A 1DLKB 3STJA 2A4GA 4MNYA 1ZSKA 3SUDA 5DP3A 3C27B 2A4OA 1IQNA 3A83A 3GY4A 1W0KD 2G5VA 2UUKB 1MKWH 2A7HA 3ZIAD 1YLNA 2PFEA 1AVWA 1E38B 3RXBA 4WWYA 1E1QD 1TNHA 1GMHF 2KAIA 4VGCC 2IPQX 1CA8B 2OD3B 2ULLA 2RCEA 2Q6GA 5JB9S 1C5QA 3BN9A 1NU7B 1SGNE 3BTKE 1HPGA 1HRTH 2ZDAH 2V6NA 1UK2A 1AWFH 1TQ0B 1VGCB 1YPGH 1C2HA 1UTPA 1A4WH 3OAAD 2QXHA 3K65B 3BIVH 2OLGA 2WPKS 3MNBA 4YLQH 3SV8A 3U8OH 3BV9B 2AH4X 2BY6X 3E6PH 1XUKA 1YPHE 1LHFH 3M3SA 1VJ9U 1V3XA 4XD7D 3TIUA 1YBWA 1P06A 1TLDA 4X6PA 5FHTA 1GJ7B 4NIXA 2NU2E 1C5RA 3OEHD 1O5BB 3UNRA 3HPTB 5HIZA 4FUHA 4OS2A 2BVXH 3NCLA 4CBNA 1G3DA 1H8HD 5C1XA 1AI8H 4JK5A 1CO7E 4Q63A 1ZSLA 4JK6A 3VEQB 3UWIA 1YP9A 2A0QB 1L1NA 2WPLS 4DW2U 3SQHE 1ELAA 2OC1A 3OY5U 4WXIA 5DP8A 1MTUA 1XM1A 1O32A 1GHBF 1PPGE 2BZAA 3GYLB 1RIWC 1HDTH 1F92A 1YF4A 3ZZ4A 1K1MA 4JZDH 2BLWA 1BBRH 1C2GA 1E35B 2P16A 2GDEH 1EATA 1L0ZA 2WUCA 4I8GA 2BLQA 1SSXA 1O2ZA 3HKIB 3BG4C 1TBRH 2ZU5A 1TE0A 4NG9H 2PTCE 2GTBA 1IQFA 2J92A 3M5NA 4WH6A 1GDNA 3E0PB 2OUAA 8GCHF 3ITIA 2QCYA 4I8LA 5CHAC 4LZ4B 2PUQH 1Z8RA 1TONA 4LZ1H 5JBCS 1D3TB 3E91A 5IYTA 2K1QA 4FUJA 2CXVA 1YPHC 1CT0E 3SU3A 3T5FH 1OPHB 4CR5A 1IOEA 1SFIA 2HALA 1P9UA 3LU9B 1V2WT 1UTQA 3SJ9A 2VB0A 4JYTA 1GI3A 2ZECA 5H4IB 2BDBA 1NT1A 2AIPA 1IQKA 4FETA 4GPGA 5DP7A 2ZDVH 1EQ9A 1FY8E 2EI7A 3RXCA 1GJ6A 1GJ5H 3PWCA 2JKHA 1HYLA 1BDAA 4FU9A 5EQRA 2KCOA 3E3TA 3LGIA 1SGEE 3U8RH 1W0JD 1TOMH 1S0RA 4AB8A 2BD9A 1O3MA 2V7QD 3UNSA 1TPOA 1GG6C 3LPRA 3W1EA 4JZFH 1GJ4H 2ZGHA 3QTOH 3EDXB 2R0LA 2G4TA 2HNTF 2BDYA 1FIZA 1V2QT 3L33A 5EJLA 3SV2H 4NZLA 2B7DH 3KN2A 1W14U 7KMEH 1YPMH 4Y0YE 3SU4A 6ESTA 1YLDA 1ELVA 3DSPA 1C2KA 2BOKA 4X8VH 3Q3KA 1N8OB 1V2UT 2AS9A 3QO6A 5T6GA 1OWJA 3SHCH 1ZJKA 1D4PB 4R0IA 1SG8B 3L3TA 2W3IA 5JBBS 2A4RA 4AX9H 4INLA 3TNSA 2A4QA 2BY8X 9ESTA 2ZDMA 1SLUB 1CBWB 1EXFA 2BHGA 4I86A 5DG6A 1G3BA 1ZPCA 3KF2A 1YPEH 2AGEX 2Z94A 1WV7H 3MU8A 3VXEH 4IN1A 1AVXA 2JH6D 1UMAH 5JBAS 3HKJB 1BTHH 1GI8B 1TX6A 2V35A 2F43B 1EZQA 4LK4A 1FIWA 2C8XB 1CSOE 1C5ZB 2WZQA 2J98A 4INHA 3MNCA 2IJD1 5BPEA 5DPAA 1QZ8A 5CMXH 1VITF 2D26C 1ZRBA 1GBHA 2ZU4A 4XFQA 2SNWA 1NRRH 2JH5D 1G3CA 5EG4A 4D7FA 3RDZA 5GJ4B 1XX9A 1GJ8B 2W7UA 1UHBB 3PV2A 4MNXA 3SNDA 3NRLA 1W11U 1GMDG 3TU7H 1O2NA 4X1QU 1QCPA 1B0EA 3ZYDA 3BTQE 3STIA 1LQEA 4ABIA 2GT7A 1J9CH 2GZ8A 1GHAG 1ZHPA 2OBOA 2WPIS 3A84A 4DJZB 1T8OA 1C2IA 1O2WA 3IWMA 5CE1A 2GZ9A 3EA8A 1WUNH 1L2EA 1O0DH 4DT4A 3QTVH 2VIWA 2WYJA 2AGIX 3LGYA 3RXOA 1EZUC 4AN7A 2GCTC 1ORFA 1TNKA 1MTNC 4ZCNA 1NO9H 1BA8B 2V0BA 3CS7A 1PPZA 3MU4A 1CA0B 4NA7A 3TPIZ 3FO8D 2OC8A 4BAOB 4MVNA 4WMEA 1TABE 1SHHB 4BTTB 2PKAA 4AOQA 2GCHF 5E8EH 2OQ5A 3RXKA 1C5YB 1MZAA 4RKJB 3CS0A 4TPIZ 4SGAE 2GV6A 2ESTE 2ZFPH 1UTOA 1C1RA 2G52A 1PYTC 2TRMA 4CREA 2ZA5A 2A7JA 3SZEA 4LOYH 2ZO3H 3ZZ7A 1P04A 1P9SA 1GCTC 5DSFA 1O2MA 1EJMA 1C1MA 1K1PA 1YCPH 1N6YA 2BB4A 2VIVA 1C5PA 3D65E 1C5XB 1GBJA 3OSYA 3SI4H 6LPRA 2PP6A 2QC2A 3NZIA 1V2PT 4FUDA 1BRAA 4FOUC 4A1VA 1XUJA 4B2CA 1Z8JB 1AIXH 2F9UA 2KCAA 1D3DB 2WYGA 3A80A 4X8TH 5EIYA 4IC5A 1A61H 1O3LA 1EAIA 1V2KT 2P94A 1GI1A 5DO4H 1K0HA 2ZGBH 3SJOA 5C1UA 2ODPA 4UD9H 3UY9A 1BOQA 3PB1E 4Y71A 3WW7A 2H5DA 3FANA 3QZQA 1TGSZ 1SBWA 2QXIA 4BXWA 1ARCA 4ASHA 3TGIE 4ZROA 3M5OA 1W12U 3GY5A 2OP9A 4XBDA 5KEDA 2G8TA 2ZHWH 1O2VA 1BCUH 1OP2A 4AGKA 3SZNA 2ZGXH 1E79D 4IC6A 3FFGA 1DPOA 3GCTG 1DS2E 2JH0D 2BXUH 3D23A 5I46H 2FS8A 4A7IB 3KEEA 4X2YA 2PSXA 3RC4A 1W2KH 2XBVA 1KSNA 1IQGA 4OS4A 1OKXA 1FPCH 1FN8A 1S81A 1XUGA 3ATMA 4A92A 1QJ7B 5EQQA 1S0QA 1S85A 2ANYA 3LJJA 3TNTA 1EPTA 1SGDE 3B23B 1KXAA 1Y3YA 1SGFG 2IOTA 1BJUA 1CE5A 1L1GA 1ZPZA 2FX4A 1QL7A 2DUCA 2SNVA 1CVWH 4FVBA 1HIAB 1KXBA 5E0HA 1LVBA 5IDKA 3VB5A 1OYTH 1O2TA 3RC6A 1AUTC 4NSYA 2W6ID 4X1SU 3RM0H 3QZRA 4GHTA 1DWEH 4B1TA 1THRH 2PKSB 1O5EH 4KKDA 2GDDA 1ZR0A 1KMHB 3F2GA 1WAYB 4MNVA 3SOSA 4H6SB 2L6OA 4B74A 1CQQA 5C20A 4B2BA 2J95A 4HGCA 3GY6A 7GCHF 2G81E 2BD8A 5L2YH 1HJAB 4WJG2 1UTLM 4DIIH 4K8YA 1PQAA 1XKBC 1JRSA 2FLBH 4X6OA 5BRRE 4MLFB 1SLXB 1ID5H 2B8OH 1HV7A 5HGGA 1YGCH 1Y3WA 3F0OA 2ZEBA 3VFEA 1AFEH 2BX3A 4WF8A 5GIBA 3RMLH 4J1YA 1EZXC 3VXFH 3S9AA 1EX3A 1HJ9A 2WPMS 1AMHA 2BVRH 5CHBA 5G4BA 1O36A 3OE7D 4KTSA 4K1TA 4WVPE 3VB6A 1SMFE 1TRNA 2FOEA 1ZLRA 3HGNA 2FMJA 2HPPH 4DGJA 5C67A 1EB2A 1PPEE 3PM3A 2RDEA 2FEQH 3ZVBA 4OS7A 3T62A 1Z8IB 4CR9A 4B75A 3P8FA 1AY6H 1JIMA 1V2LT 3U98H 3NUMA 1Z6EA 2A2QH 1DUEA 3UAIC 1RGQA 1GJ9B 4I31A 4WMFA 3QLPH 1TA6A 5KGOA 1J14A 1VKYA 1AE5A 1UK4A 1WYKA 4GCHG 2TGAA 4TSFD 3PLKA 5IK2D 1NFWA 4ZAEA 2CHAB 2Y5GA 5LPEA 4OS5A 5K7RA 3SU2A 5DGJA 1RFNA 3F3BA 2V3MA 2W3KA 1ZMJA 2GV7A 1CGIE 5FXLA 5C0TA 5A0BA 3E90B 1UCYE 3BIUH 3FZZA 3PMJA 2CF9H 1JOUB 2W26A 3LH1A 1WSSH 1BB0B 1LQDB 3OTPA 2ZU2A 3U69H 3SNBA 5ESTE 3N7DA 6CHAC 4BOHA 5A8ZA 1E37B 4B2AA 1CGJE 3SV6A 1MKXH 4UFEH 3FVFB 1LHCH 4YOGA 3SGQE 3SNAA 2OC0A 1GBCA 1IQHA 2JIZD 1DX5M 3GY2A 5EQSA 3H5CB 2Z7FE 1UVOA 2BM2A 3F9GA 1B5GH 2R2WU 2VWOA 2J34A 5HXFA 2PSYA 1DICA 3VPKA 4YOIA 2VWNA 1YPLH 1DE7H 1O3BA 1UO6A 3UIRA 5A2MH 4NFFA 3OTJE 2JJ1D 1C2EA 3ATWA 5A8YA 3ENSB 1D3PB 1BHXB 3I77A 5HIYA 1J15A 2F9BH 4O9VA 1GMHG 3TH3H 1GI6A 3M3TA 1NRQH 1C5LH 3NXPA 3SJKA 5AHGH 1CGHA 1EPTB 2FESH 1O2JA 3RXAA 1S84A 2FYQA 3LONA 2C8ZB 1AGJA 3S9CA 3ODDA 1DWCH 1GBMA 1SB1H 3CENA 1F7ZA 2UUJB 3MHWU 1PYTD 1UVSH 3KQBA 5T6FA 3TH2H 1TYNA 1YPJH 1IHTH 4RI0A 1HJ8A 3P8GA 1O3HA 5DN6D 1GJDB 4H6TA 2ZHEH 3EQ0H 1K1LA 1V2NT 2K0QA 5DP9A 1D3QB 2VH6A 4NZQA 4LXBH 2ZFTA 1CHOF 1ZRKA 3DFLA 1P2JA 1J17T 2ZIQH 3RXJA 4A1TA 1OWIA 1A46H 3R0FA 1C4Y2 1QJ6B 3LH3A 3WWFA 1O37A 2BMGB 2GX4A 1O3OA 3GCOA 2F3CE 6GCHG 5EPYA 3SW2B 3MU1A 2Y5FA 2TGPZ 4AG1A 4NCYA 1VZQH 4JMYA 1U6QA 2GT8A 1UVPA 1QIXB 4X6MA 3B8JA 1TPAE 2ZFFH 1X7AC 1ZTKA 4VGCB 3N7EA 1W7GH 3S69A 2ZFRH 4U30A 1C5TA 3MU5A 1LHEH 2KCYA 1H8IH 3ZVEA 1HAGE 3JZ1B 1O3EA 1C5WB 2BQ6B 3ZZ8A 1WTGH 1FONA 1QFKH 2ODQA 2UWPA 2G4UA 4Q2KA 1RTKA 4K69A 1AFQC 2HGTH 2XTTB 4HI3A 1QHRB 2EC9H 2VGCC 4E7NA 1BMMH 1IAUA 3EE0B 3S7KB 2A5AA 1NU9A 3RXSA 1P12E 2BQWB 3SQEE 1PJPA 1SHYA 3IITA 2QF5A 4ASUD 2XBYA 3BEUA 4CRDA 2ZHFH 1O38A 1P2QA 3TK5A 1FXYA 1P09A 2DE8A 4JZ1A 4YT7H 1TPSA 2BZ6H 1DOJA 3U1JB 2XC5A 4UFDH 3MFJA 3OY6U 3LJOA 1NM6A 1DFPA 1NN6A 2F91A 1NBME 2FYRA 2VNTA 4AORA 2M5TA 1SC8U 4XE4A 1O5GH 3DT0H 1O2SA 1DY8A 1BMFD 1RIWB 3LC3A 1Y59T 2A45B 1CT4E 2C4FH 1HBTH 2G55A 5JB8S 1HFDA 3MO3A 4JCNA 4P02A 4IN2A 4ISHH 3U8TH 2PW8H 1P0SH 1F0RA 2ZCLP 1ZHRA 1SLWB 2QIQA 1MZDA 1SQAA 3BG4B 1TBQH 3CP7A 4XSKU 3WY8A 4X0WU 3F9FA 5J4QA 3RXRA 2AHME 1OOKB 1LCYA 3KL6A 2YMSC 5CHAB 4ABAA 2HLDD 5GWZA 2GGVB 2XOKD 3DHKH 1GBDA 1EKBB 2ZCHP 2C93B 2H9TH 2VINA 3E16B 5F53A 3FZDA 4B76A 1GI9B 4K1SA 5JBTA 4MPUA 4B73A 3LT3A 3RXQA 3K6ZA 3V13A 4MTBA 1SI5H 4RT0A 2GKVE 1O3NA 4CRGA 3P8OA 3HATH 2FI3E 2I6SA 2J38A 2FOMB 1FJSA 2XW9A 1UVTH 2AMPA 4K5ZA 4Y10E 3A7VA 1FLEE 3B9FH 4AYVB 1O2KA 1ESTA 3A7ZA 2O8MA 3ZZDA 2BD5A 2OINA 1OXGA 2NU1E 5FBEA 4X2WA 1W0ZU 1FX0B 1GG6B 4YZUA 5EXLA 1QBVH 1MTWA 3KQEA 1VITG 2LELA 4CRAA 3LKWA 3DUXH 4KP0A 1K1JA 1TMUH 2C8WB 3GCHC 3MH7A 3RXGA 3PROA 3A86A 2GP9B 1NZQH 4Y7AA 4HG6A 1XUIA 1EFRD 1ZPBA 3U9AH 4ABDA 4BANB 1A0JA 3ATIA 1TQ7B 2Y80A 1O3PB 1RTFB 2HWLB 3P6ZB 1G2MA 2EQNA 1BRUP 4CHAC 3F6UH 2F83A 2BY5X 2FOBA 2KAIB 1JBUH 1O5CB 3N7OA 1LVOA 2DE9A 5EGMA 4FUGA 4Q7XA 3SU0A 1DXPA 3BTME 4ABBA 3E0NB 2KM0A 1B7XB 2V3HH 1QQ4A 1MAXA 3ZV8A 2BD2A 2O8WA 1Y8TA 4OM9A 1VITH 2Y81A 1XKAC 4FUEA 3UNQA 1QL9A 1TGCA 1W13U 1XVMA 2EI8A 4KGAA 1OP0A 1T4VH 3NPSA 5FL7D 5EU8A 3BTFE 1NRSH 2GCHG 4BTUB 4ZKRU 2BD7A 1C1QA 4ZKOU 5HM2A 3URCA 1BBRE 1ZYOA 3FP8E 4E05H 2KR7A 3UREA 1LMWB 1GHYH 2ALPA 4YT6H 3KHVA 1Z8GA 4AB9A 1OWDA 2QF0A 2GMTC 1SGTA 1HAIH 3VGCC 5C3NA 5TCAA 1S83A 3BG8A 4DVAU 4XBBA 2FX6A 4ZKNU 1GHVH 2W6JD 1O2OA 5C2ZA 2F4LA 3O8RA 1TIOA 1BUIA 3GY8A 1MQ5A 5AFYH 2ZHDA 5EXMA 4NWKA 2H6MA 4FUCA 2Q6DA 3OFND 3PYHA 4ZHLU 3P70B 1TOCB 1MTVA 1BJVA 3M35A 1DM4B 1YCPM 3MWIU 1OWKA 2EY4C 2FI5E 4NFEA 4ZXXH 1TMTH 1WQSA 1T31A 4U32A 1GHZA 1FY3A 2GCTB 1MTNB 3ATKA 3RM2H 3BEIB 3ODFA 5F8XA 3S0NA 3V3MA 2YOLA 1H4WA 3BTTE 1SOTA 2CMYA 2K8IA 2RA3A 1F2SE 3F1SB 5HKKD 1P3CA 3A8BA 5JPMH 1BIOA 1LDTT 1TNIA 3DD2H 2FPZA 5AF9H 3E8LA 1C9PA 2UWOA 1NY22 1RD3B 4AG2A 1ETSH 2XWAA 4MPVA 1LVMA 1EASA 1BMLA 2QV1A 4IGDA 3M36A 1QRXA 1G32B 1P3EA 4KTCA
chains in the Genus database with same CATH topology
1EOLA 1VR1H 3GCNA 3RC5A 1LHDH 4GUXA 1GCTB 4X2XA 3RXTA 1IQEA 2ZC9H 2BD3A 3TLOA 4PROA 1YPKH 2RA0A 1Y3XA 4BAHB 1JRTA 2HPQH 2Z3DA 1LPZB 3OU0A 5FBIA 4BTIB 1O35A 1WQVH 1OP8A 2F9OA 2R9PA 1HAVA 2OXSA 3RLYH 1FNIA 3F68H 2THFB 1C1TA 2HVXA 5DK1A 1HXFH 1TMBH 3UFAA 1V2VT 3ELAH 4O3TA 1O33A 2H1UA 1LPGB 3ATLA 3UR9A 1FMGA 1XVOA 2BDCA 3S9BA 4JZIA 1CHGA 3GISB 1YKTA 1CU1A 1QTFA 1SLVB 3T26A 3LDXH 5JDUB 2XBWA 2O8TA 3PLPA 3GDVA 3RU4T 1P2OA 1F0TA 1QB6A 1ELDE 3QGNB 2P93A 1W3CA 4NSVA 2FODA 3QWCH 7GCHG 4Y6DA 4UONA 1RRKA 4O97A 1WCZA 1F5KU 2SGQE 1SQTA 1LVYA 3NKKA 1GHWH 1QRZA 2AFQB 4DCDA 1O2YA 1ELFA 2J2UA 2G51A 4K3JA 4NIYA 1SFQB 1NTPA 1QY6A 3M61U 3RMMH 1GMCF 2ZCKP 2FO9A 4THNH 2P8OC 2O9QA 2Z9KA 1SR5C 1TRYA 1EZSC 5A8XA 1C1NA 3PMBB 1BTWA 4ISIH 3TJOA 2BD4A 2EI6A 1A7SA 1ESBA 1KXDA 1NFXA 3OYPA 2BTCE 3SN8A 5I25A 1ZMLA 1PQ5A 4Y7BA 1ZGIA 1S5SA 4KELA 4AFQA 1GVKB 1AB9C 1GGDC 1TB6H 1C2MA 1A5IA 2LPRA 1Q31A 2A7CA 1GL0E 2FTLE 2QXJA 1JIRA 4XOJA 3SO3A 1GI4A 2A32A 2JETC 1Z7KA 4I8JA 5GXPA 2OBQA 3TJNA 2FTMA 1O5DH 3A7YA 1AZ8A 1IQLA 4ZH8A 4NA8A 3PO1C 5A09A 1P01A 3O8CA 4K8BA 1HAOH 1DANH 1G37A 1L4DA 1O2UA 5HM9A 4WXVA 4CRCA 4D8NA 4WY3A 2XNIA 4JZEH 5C5NA 4SGBE 1Y5AT 4D9RA 2ZU1A 3M37A 1RTLA 1FV9A 3K6YA 1TX7A 3TK9A 4IS5A 1A2CH 2VWLA 2P3UB 5ETXA 2BOHB 1Z1IA 8LPRA 2WPHS 1AHTH 2PKAB 4B71A 1GJBB 2XCFA 1V2JT 1ZOMA 3LGVA 5LH8A 4ISOA 4ISNA 2Y82A 4UEHH 4WMDA 1MBQA 2ODYB 2FM2A 4UFGH 2VH0A 3GY3A 1FUJA 3P17H 3Q77A 3MNXA 5PTPA 3G01A 5F8TA 1T32A 3LGTA 1ANBA 1O31A 4ABHA 1INCA 1ZSJA 3QX5H 4KTUA 3MH5A 1KTTB 1KDQA 1GVLA 3MTYA 1OWEA 1F5RA 2ZGJA 5FPSA 2STAE 1GL1A 1O3GA 1EOJA 4OS6A 1DITH 5B6OA 2C8YB 2J9NA 1MCTA 4E7RG 3MH4A 3ZVDA 3BTGE 1HXEH 1SGFA 3RXUA 2TGDA 1UJ1A 1KLTA 3RXPA 4Z6AH 1JMOH 1NRPH 4JYUH 3A87A 3I29A 1BQYA 4TPYA 3Q3YA 2VVVA 3GICB 2PV9B 1A1RA 2XBXA 3URDA 1G36A 1GBKA 1XUHA 3R3GB 1M9UA 4Y8ZA 3LGUA 2WINI 1YLCA 3T28A 1FI8A 2ZNKH 1C1UH 1C1PA 3TH4H 1P11E 2AGGX 1BRCE 1EUFA 1KIGH 1IQMA 1PQ7A 6CHAB 2A5KA 3HK3B 3M3VA 1CT2E 2AYWA 4MPWA 4MPXA 1PQ8A 2YNBA 3MNSA 2PGQB 5E0GA 1Q2WA 1CHOG 2P3TB 1GBIA 3RMNH 3SV7A 1BTUA 3RMOH 3W95A 3A85A 4I33A 1SOZA 5DP4A 2V3OH 3S7HB 3AW1A 5LPFA 1THSH 3A7WA 4TY7A 3U1IB 4FXGH 4ZXYH 2FI4E 1V2ST 2G5NA 4CH8B 1O2IA 1O2RA 1GJCB 1G2LA 2PHBA 1C4U2 2ZDNA 2GVFA 1AQ7A 2ZTYA 2SFAA 3NWUA 3TJVA 5HYOA 4YO9A 1IQJA 2B9LA 2FP7B 3O8BA 3P92A 1O3JA 4YM9A 2TPIZ 2H2ZA 2OQUA 1PFXC 2D2DA 2ZWLH 3ZZ3A 3RXEA 2FXRA 4X2VA 1F5LA 1FPHH 2W5EA 4ABEA 4U2WA 2BVSH 4F4OC 2Z6BD 1HAXB 3ZYEA 4ABGA 1LHGH 4H42U 1C2FA 3RU4E 3VB7A 2VIPA 3UOPA 1MTSA 3OX7U 1O2HA 1DXWA 1SGCA 8KME2 1ZMNA 3EGKH 4Y0ZE 3ZZCA 3MO6A 1HUTH 1OX1A 2BLVA 1FY4A 1C9TA 1NFUA 1BTPA 2ZI2H 1FN6A 2HRVA 1GJAB 2FIRH 1C2LA 1GHBG 1LTOA 1THPB 1O39A 4GVUA 3SU6A 2Z9IA 2Z9LA 1UCYK 5T3HA 2SGPE 3BSQA 1N1LA 1Z1JA 1WOFA 4X8UH 4GAWA 4MQAA 2VIDA 4IW4E 1H8DH 1P2KA 1O2GH 1N6XA 1BRBE 2NU4E 1UTKA 4FVDA 1ZGVA 7LPRA 5GCHF 5J4SA 8GCHG 2QF3A 1NRNH 1Z71A 1KDQB 4WH8A 3MOCA 3IG6B 1VGCC 4MNWA 2ZTZA 3ESTA 3Q3XA 1DVAH 3UOUA 4HZHA 5ESBA 3VB4A 1IQIA 1A5HA 3GYMA 1FY5A 1DWDH 1AFQB 1IHSH 2O8LA 4GLYA 3ZVCA 5EXNA 5FX5A 3QUMP 4Y8XA 2VGCB 5LGOA 1KTSB 4TYDA 2VJ1A 3MO9A 1W8BH 3PTNA 3ZVGA 3NK8A 1TWXB 1BITA 1QJ1B 1UVUH 3M7TA 3ZVFA 3PMAB 1EAXA 3V7TA 3A8AA 2ASUB 1UHBA 1W7XH 2Y7ZA 4CRFA 1GHXH 1J8AA 4OGYA 3RXDA 1EP5A 6GCHF 2EEKA 1ABIH 1QA0A 2ZPQA 1C1WH 4FUBA 2YNAA 5DJ7A 2QA9E 1S82A 2FOGA 2FLRH 2IN2A 3UQOA 2XXLA 2Y5HA 2HLCA 4BNRA 1AWHB 3QN7A 4BAMB 2ZG0H 3QK1A 1O30A 4ZHMU 1TNJA 1ARBA 2ANMH 2CJIA 1FDPA 4I32A 3AASA 4AGJA 2PGBB 1E36B 1TAWA 1UK3A 5DP6A 2WV5A 5EOKA 1DY9A 1F0SA 2QN5T 3RXMA 5LPRA 1BZXE 1TFXA 2CN0H 2F9VA 3EA7A 5EPNA 2ZTXA 1EJAA 1HAZB 1H9LB 4X6NA 2H9HA 2XRCA 1TALA 1EJNA 4F49A 2SGAA 5A0AE 1EAWA 4MDSA 1JXPA 2GZ7A 1O3IA 3C1KA 1ESAA 1Y3VA 1C4V2 1C5UA 2BY9X 1MU8B 1PPBH 1P57B 2ZFSA 2IPHA 3RLWH 1D6RA 1SGQE 2J4IA 1PPCE 2ILNA 5GDSH 1NPMA 4D7GA 2AIQA 3SV9A 1T8MA 4NGAH 1SGRE 4HFPB 4DIHH 3TK6A 5F8ZA 2Z9GA 3TGKE 4YLUA 3MI4A 1TX8A 2O8UA 1C1VH 1MKXK 3GCHB 2D1JA 2R0KA 4D76A 2ANWA 2A31A 4J2YB 1D6WA 4H4FA 1VCPA 4JYVH 4BXSA 1N8OC 1P2IA 1QL8A 1V2OT 2ZQ1A 5SGAE 2VIQA 4NIVA 2A1DB 4CHAB 1UTMA 2XC0A 4FU7A 1KY9A 3PWBA 3SNCA 3VB3A 1C5NH 1E0FD 1MCVA 2LNCA 2PR3A 3UWJH 4ZHAA 1ANDA 2BDAA 3K2UA 3SHAH 1H9HE 1C5MD 1CBWC 1ELTA 1FZZA 1K1NA 8ESTE 1WTHD 3SUFA 3BEFB 3FP6E 1GWAA 1P02A 2ZDLA 3UTUH 3PMHB 3E1XB 1QQUA 1T7CA 1YC0A 2R3UA 2VVCA 3A81A 1C5SA 5DKMA 1QR3E 1O2LA 2PUXB 2ZZUH 3Q76A 4O3UA 2BY7X 2VU8E 2J94A 2ZHQH 1TGBA 3KIDU 2FOAA 2NU3E 1QBNA 1O2QA 1WU1A 1XMNB 2QGRA 1EP6A 4A6LA 1QURH 2XCNA 4FUIA 2CF8H 4X1NU 2GMTB 2CV3A 3VGCB 5E2OA 1UTNA 3KQCA 3ZV9A 5L6NH 2PWXA 3TGJE 2NWNA 4OS1A 1Y5BT 5L2ZH 4A5TS 4AFUA 2BDIA 2AERH 2C3SA 3A8DA 1GDQA 3BF6H 1HIAA 1GI5A 2ZQ2A 2A2XH 1C2DA 2H5CA 1FQ3A 1MKWK 1AUJA 1W10U 1DSUA 1K21H 4AFZA 1RS0A 1Z6JH 2WPJS 1BMNH 1A3EH 1BTZA 1WBGB 1ELCA 1GPZA 3QDZB 5FCRA 3RXVA 2I6QA 1KXFA 3LIWA 4UE7H 1OWHA 1O3CA 1AVGH 1BT7A 1DWBH 2HNTE 3M5MA 4RKOB 1QB9A 4ZMAH 3T2NA 1HB0B 1ELEE 5L30H 2UWLA 1Y3UA 3EA9A 1VCWA 1A5GH 1T8NA 3RUOA 1CA0C 1P8VC 3KNXA 3UQVA 1QNJA 1FAXA 2ZPRA 1DUAA 3AVZA 4Q80A 2P95A 4X1RU 1P2NA 1KLJH 1TGTA 1SL3A 1AZZA 3A8CA 3ZZBA 2RDLA 3SORA 7ESTE 3SBKA 2G00A 3RXIA 5GPIB 1EB1H 1ABJH 1C1SA 1NS3A 1K9OE 3LGWA 4NIWA 1C5VA 4DY7B 2ZU3A 2Q1JA 1O3DA 4Q7YA 4RSPA 5ABWA 2D8WA 1V6DA 5A0CA 1O34A 4I7YH 3QGJA 2QAAA 4ZUHA 2ZKSA 1O3FA 1HGTH 3A7XA 1TA2A 2ANKH 2SGEE 1GMDF 1GMCG 4UDWH 1O5AB 3ZZAA 2Y6TA 3H7OA 1TRMA 1AN1E 2R3YA 1RXPA 3AW0A 4M7GA 1GI2A 5FPTA 1YM0A 3BTHE 1GHAF 3JZ2B 1AKSA 3A89A 5FAHA 2VVUA 4DURA 1VJAU 1S6HA 1K1IA 1GBAA 1Q3XA 1MMJN 2B0FA 3RU4D 2HNTC 2FOHA 2BYAX 2SGFE 4AFSA 1BBRK 2R2MB 2C90B 1GVZA 2RG3A 1L4ZA 3D49H 2XWBI 4RN6A 2ZF0H 1H9IE 2PTNA 3DFJA 3T29A 3MYWA 3FP7E 2XC4A 4R8TB 1O3KA 3SJ8A 1ELGA 1TGNA 2EA3A 1MUEB 2SGDE 2GD4B 1MD7A 1KLIH 2CGAA 1K28D 3BTDE 1EAUA 2ALVA 2PLXA 1KXCA 1Y5UT 2TGTA 4Y79A 2WUBA 4UFFH 5EODA 1OYQA 1C2JA 2OC7A 4GHQA 1QBOA 1P03A 1XXDA 4O03A 1H1BA 3AAUA 1KXEA 3ZZ6A 1LO6A 1MBMA 1GBFA 1W0YH 3MU0A 5DP5A 3ZZ9A 1ZTLA 1UCYH 3HK6B 1O2PA 4K60A 3F9EA 5K0HA 3H7TA 4CH2B 4I8KA 2P8OB 3EYDA 1GBBA 5E0JA 4ZKSU 2W7SA 4X8SH 2FOFA 5F03A 1BHXF 1SGYE 2P59A 3SGBE 4BAKB 1LPKB 4AZ2B 5TJXA 1K22H 1ZZZA 1HNEE 4K2YA 1G9IE 2STBE 4IMQA 3TJUA 3RP2A 1J16A 3GOVB 1AD8H 1QB1A 2QYIA 2FS9A 2TIOA 3GY7A 4U01A 1AB9B 3BTEE 1GGDB 1DT2A 3UR6A 1XUFA 3PLBA 3BTWE 3I78A 5AVDA 2UUYA 2JETB 1T4UH 1P05A 1ACBE 4CBOA 2B5TB 2PKSC 2ZP0H 5EW1H 1T8LA 2FWWA 1P2MA 3SUEA 2BX4A 4YOJA 1E34B 3PO1B 5AFZH 3A7TA 1AO5A 3UUZA 2BLOA 2IJOB 1MAYA 3PTBA 4Y76A 1DSTA 3RXLA 1ETRH 1HJAC 3SU1A 1O3AA 1D9IA 2UUFB 2ZPSA 1BTYA 1ZHMA 1SGPE 3A88A 1HAYB 1TPPA 2QY0B 3GDUA 1NFYA 3GCTF 1K1OA 1GI0A 2A5IA 3P8NA 3F9HA 2OTVA 4Y11E 4HTCH 1RJXB 4ABFA 1LKBA 4DG4A 3SNEA 3KGPA 1F0UA 1HCGA 1SGIB 1O2XA 2AMDA 3RXFA 4K1EA 5EW2H 4QT8C 1YYY1 1BTXA 1C1OA 2F9NA 4GSOA 1HAHH 1NC6A 3TITA 3HGPA 1A3BH 5C5OA 1MU6B 5F6MA 1GDUA 3DA9B 4DOQA 2AMQA 1QGFA 2Z3EA 1ZJDA 1V2MT 1B0FA 3FAOA 2FZZA 5T6DA 1HAVB 3SJIA 2ZFQH 4XDEA 1PPFE 3A82A 2ZGCA 3SU5A 1AKSB 1JWTA 3T25A 4I8HA 1FY1A 2FDAA 2CHAC 3UPEA 5JYIA 2Z3CA 1VCQA 2BXTH 2NU0E 1LKAA 2VWMA 1ZTJA 4IBLH 4X1PU 2BDGA 1NESE 2BDHA 2BQ7B 2P3FH 1AU8A 1C5OH 1K2I1 4IMZA 3AAVA 1DLEA 1QA7A 3M5LA 5FCKA 4MG3A 3V0XA 1MH0A 1XXFA 1V2RT 2ZDKA 4FU8A 1ELBA 3TVJB 3M7QA 5E2PA 4AYYB 4D9QA 4Q7ZA 4ABJA 2HOBA 2Q6FA 1AE8H 4TWYA 3D62A 3KCGH 1TBZH 3KQDA 1SPJA 4Y8YA 3ZZ5A 3LOXA 3MH6A 4ESTE 4FUFA 1ANCA 2XYAA 2WV4A 3L6PA 4NWLA 4ISLA 4DT7B 3EAJA 4BAQB 5FPYA 1G3EA 3LC5A 1GI7B 2TBSA 3SI3H 1QRWA 4XBCA 1GBLA 1A0HB 1HLTH 1UTJA 3V12A 3RXHA 1OS8A 3M7UA 1NROH 1YCPK 2QXGA 4OGXA 5C1YA 9LPRA 1O5FH 1ANEA 3O8DA 4GCHF 3P95A 1PPHE 2FOCA 1DDJA 4TY6A 2Z9JA 2F9PA 1MQ6A 1V2TT 4NA9H 5GCHG 1EPTC 1TNLA 1OSSA 4INKA 5TCCA 3T27A 1KYNA 4YTAA 1GCDA 5HMAA 2H9EH 1A0LA 1GBEA 3PV4A 4Z0KA 1TNGA 5FX6A 2VIOA 1P10A 3W94A 4E06H 3K9XB 4YESB 1BMAA 1SQOA 2OCVB 1HAPH 4TWWA 4A1XA 1S6FA 3ZVAA 3GDSA 3Q00A 3SUGA 3SGAE 4CRBA 1G30B 1SVPA 1ETTH 2Y7XA 2AEIH 1GBTA 1FAKH 3MMGA 1MD8A 1L1JA 3STJA <