5A8ZA

Crystal structure of human neutrophil elastase in complex with a dihydropyrimidone inhibitor
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
218
structure length
215
Chain Sequence
IVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Neutrophil elastase
publication title Potent and Selective Human Neutrophil Elastase Inhibitors with Novel Equatorial Ring Topology: in vivo Efficacy of the Polar Pyrimidopyridazine BAY-8040 in a Pulmonary Arterial Hypertension Rat Model.
pubmed doi rcsb
total genus 42
structure length 215
sequence length 218
ec nomenclature ec 3.4.21.37: Leukocyte elastase.
pdb deposition date 2015-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5a8zA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5a8zA02
1DFPA 4YO9A 3KF2A 1RIWB 1GMHG 4J2YB 2BM2A 4OS2A 4A1XA 1GDUA 1H8DH 1RRKA 1S6HA 5CHAC 1OP2A 3D62A 2XC0A 1BBRE 1HAZB 3SUDA 3ODDA 1W2KH 1DWDH 1T7CA 3ZZ4A 2ANMH 2HLCA 5FAHA 2PGQB 1AU8A 1SLUB 4OS6A 1VJAU 4NGAH 1LQEA 3KIDU 2WUCA 3U9AH 3UNQA 1O5GH 1DWCH 1V2NT 4UFDH 4Y6DA 2Z9GA 1AI8H 5L2ZH 4X6NA 3I78A 2ESTE 1XKAC 1ETSH 3RC6A 1ZLRA 1WSSH 3O8BA 3PMJA 2PV9B 2BYAX 1Z6EA 2P59A 2XNIA 2SGFE 1GCDA 3FZDA 1BOQA 5J4SA 1W7XH 1DY8A 4ASHA 2ZFSA 1BTUA 3MFJA 3FP6E 2PLXA 3G01A 4THNH 1T32A 4OS1A 3VB6A 1TOMH 1V3XA 3PTNA 1HAOH 5F8ZA 1SGCA 1V2ST 4XSKU 1C2JA 4I7YH 4RKJB 3A8AA 2YOLA 2OC8A 1FY3A 2FYQA 2ZHDA 1ZHPA 4CH8B 2GMTB 1W3CA 1ZPBA 3HGPA 2BD3A 5E0JA 2EI6A 1N8OC 1V2JT 2PKSC 3TH2H 3E90B 2XYAA 1KTTB 4MQAA 1ESBA 1MKWK 2ZEBA 2OC1A 2VGCC 2C3SA 1OKXA 1WUNH 1QFKH 1ZSLA 2FO9A 2FS8A 2CHAC 1DOJA 3CENA 2BZ6H 1L1NA 1TNJA 1JOUB 3EQ0H 5T6FA 2BY6X 2J9NA 1WV7H 1GI7B 2ZHEH 4O03A 1O2SA 4B2BA 1FN8A 2ZU5A 5AVDA 3ZYDA 4B2AA 3BG4B 2OD3B 3RXDA 4WMEA 2BZAA 3O8CA 2G5NA 2Z9LA 3Q3KA 3F9FA 4I8JA 1FN6A 4F4OC 1B0FA 1TBQH 2HVXA 1TMTH 4X1RU 8ESTE 1NO9H 1PJPA 1XXDA 3SU4A 3M35A 3QDZB 4Y8YA 2HPQH 4TPIZ 4UFGH 1TE0A 2AEIH 2AMDA 1HRTH 2BD9A 1AFQB 4TWWA 1WCZA 1O2XA 3BG4C 4CR9A 1A2CH 1QR3E 4MNXA 1KSNA 2BLVA 1TBRH 2Y82A 3BEUA 4H6SB 4VGCC 5ETXA 1Y59T 1NROH 1JRSA 4A6LA 3BTTE 1O5BB 3AAUA 3T29A 4R0IA 1YPHE 4X2XA 3PLPA 1GJ8B 2H9EH 3TU7H 3A7ZA 2VIPA 1A5GH 3SNDA 1HYLA 3UFAA 4JYTA 3R3GB 1OWHA 3MH5A 2FLBH 2NWNA 2PSYA 5EG4A 2R0LA 4OGYA 1TGSZ 4YZUA 2FS9A 2VWNA 3LIWA 1UTOA 1LPGB 3U8RH 1BQYA 2JETC 2GGVB 2FOAA 5DP9A 4KTCA 4Y0ZE 1C1NA 1GI0A 1EZXC 1C1SA 1GMDG 1QQUA 2Z6BD 3DT0H 5DP7A 3KN2A 4NZLA 2TGDA 2BX4A 2BDGA 5K7RA 1CBWC 2GX4A 1F5LA 1FLEE 2QXGA 1A4WH 1OYQA 1ZZZA 3P70B 4BTTB 1PYTC 3A7VA 4I8HA 5G4BA 2OQ5A 6LPRA 2G5VA 4K8YA 4LOYH 1GJ9B 2PUXB 2OBOA 1YPEH 1P01A 3BTWE 4IS5A 3CS7A 2H1UA 2ZNKH 5SGAE 1HFDA 3PLKA 3C1KA 1J9CH 1NN6A 2VVUA 4XOJA 1TMBH 1FI8A 4K8BA 2H2ZA 1P2IA 3T62A 4CR5A 4K1SA 1O36A 1NZQH 2BVRH 5EQSA 1EZUC 3BTQE 1TOCB 1GBEA 2GD4B 4GUXA 4DCDA 1JRTA 3GCHB 2FOCA 1IQIA 2Q1JA 1KLIH 5CMXH 5BRRE 1FIZA 2ZU3A 1NFWA 1IQLA 1G3BA 1GBJA 2FOHA 1BIOA 3UNRA 1EOJA 9ESTA 2TGPZ 5DK1A 1B7XB 3F68H 4AB8A 5L2YH 2PTCE 1O2QA 2JH6D 1OWIA 4ABBA 3MMGA 3F1SB 4HTCH 4YESB 2FOBA 3GY8A 5EODA 2ZTYA 1FV9A 1U6QA 1ETTH 2BD4A 3GOVB 1PQ7A 3VB5A 4D76A 1FONA 4NG9H 3U98H 4CBOA 5HM9A 4X8SH 1AZZA 3UUZA 3SV2H 4CRGA 1AKSA 4ZMAH 4RSPA 2BDCA 2ZU1A 1DXWA 1O2VA 1Y5BT 4DIHH 4B76A 4O3TA 1TA6A 2WPMS 3QUMP 4U01A 1O32A 2BDYA 1EXFA 4LK4A 3ZVCA 1JMOH 1THSH 1AE5A 5GWZA 4X6MA 5EPNA 1F5KU 2GZ9A 2ALVA 5A09A 4ISNA 1QJ7B 1SOTA 2ZA5A 3ZVAA 1V6DA 1O2WA 2PSXA 1MMJN 5F8TA 2J2UA 1O5DH 2VINA 4ABGA 3PV4A 3OSYA 2B9LA 1SG8B 5FHTA 1V2KT 2FLRH 1K28D 2QAAA 1LHEH 1MKXK 4K1EA 4ZHAA 1HV7A 2A2QH 2I6QA 1GHZA 7LPRA 1WQSA 2ALPA 3BV9B 3ZV8A 2J4IA 3IWMA 4MTBA 1FPHH 2GTBA 3EA7A 2ZU4A 3PMHB 2VWLA 1SGNE 2SGDE 3KEEA 3UOPA 1O3DA 1RTKA 3SN8A 5GPIB 1EX3A 1YC0A 2QY0B 1Y3UA 4KGAA 4UEHH 1MKWH 1SFIA 2EC9H 3ATWA 1PPEE 2FIRH 2A4RA 3QGNB 3RXEA 1AKSB 3UREA 2ZPSA 1Q2WA 1GJAB 2NU1E 1AGJA 2BQWB 1ETRH 1LHGH 4FXGH 1GJ4H 3ZZ5A 1NU9A 1MAYA 2F3CE 2VJ1A 4Z0KA 8GCHF 1C4V2 1OP8A 2W26A 4Y79A 1UCYE 3A83A 4FVDA 2BXTH 2G51A 1QTFA 3SU3A 1QHRB 1MD7A 2GCTB 1A3BH 3ZZ3A 1OX1A 1CT4E 1YPKH 3LONA 1GI2A 3SU2A 3ITIA 1ZPCA 1T31A 3M5LA 3E91A 1ELDE 1PPBH 4GHQA 1FNIA 2A31A 1ORFA 2TGTA 3SNBA 3BTGE 5DO4H 2GZ7A 3SV6A 2BQ6B 2OUAA 4Y7AA 1T4UH 1BT7A 1TGCA 2HNTC 1LDTT 1O2GH 3T28A 2GDEH 4DT7B 1QB6A 1ZMNA 1Y3YA 2P93A 3SNAA 1EOLA 4YOJA 2QF0A 4DOQA 1IQMA 4AYYB 2G4TA 3NZIA 3V7TA 1ZYOA 3UOUA 3RU4D 1GI1A 4GHTA 2RDLA 4GLYA 4IN1A 2NU3E 4NA8A 3SJ8A 1T8NA 1NM6A 2QV1A 5FPTA 2Z3DA 1SGDE 1MTSA 1K1PA 2R2MB 1GG6B 4NA9H 4ZXXH 1V2VT 1O5AB 5GCHF 2QYIA 1AVWA 5A0BA 2A32A 3SQHE 3E8LA 1GBHA 1BRUP 3S9BA 1TX8A 1BJUA 3GICB 3GDUA 4WWYA 3SI4H 2IJOB 5J4QA 3M3TA 1O0DH 5EQRA 2J34A 1S83A 2Z9KA 1EAUA 1O3CA 1C2EA 2HPPH 5LPFA 4ZROA 3SJKA 1O5FH 2F9OA 3RXLA 1CO7E 1K1JA 1V2OT 2ZFTA 4Y10E 4CH2B 1C5LH 4WH8A 3SU0A 2EI7A 4YT7H 3SNCA 4CHAC 4X6PA 1EB1H 5B6OA 1XUKA 4DJZB 3V3MA 1UVTH 3Q76A 2Y6TA 4NWKA 4X8UH 2VIWA 2ZCKP 3PO1C 2Z9IA 2XC4A 1LPKB 2Y5FA 1O2OA 4DGJA 1MTWA 1FDPA 1ELGA 6CHAC 1DXPA 2XWAA 2P3FH 5T3HA 3HPTB 3P6ZB 1LO6A 3F9GA 1QRZA 3LJJA 4X2YA 3LGYA 5IDKA 3DA9B 1E38B 1MBQA 2ULLA 2C4FH 3ZZ8A 1A0LA 2FZZA 2W3IA 1HJAB 1C5YB 4Y71A 2BDIA 3BSQA 1TRNA 3FP8E 4FUGA 1NRSH 3KQCA 1HPGA 3LT3A 1O2MA 1LMWB 2A2XH 1ZHRA 1GJCB 1A3EH 2OP9A 2QN5T 2FWWA 1DUAA 1S6FA 2Q6GA 2F9PA 3H7OA 1BMNH 5C3NA 4Q80A 4DW2U 3Q3YA 3UY9A 1GVZA 1QBOA 2LPRA 6ESTA 1QJ6B 1TNKA 4IC6A 4X2VA 5AFZH 3SZNA 2ZWLH 4JYUH 1A5IA 1O2PA 5LPRA 1RS0A 5DJ7A 1GGDC 1P09A 1IQFA 3TIUA 3RXHA 2H9TH 4B75A 2P3TB 1AIXH 1MCTA 8GCHG 3SU5A 1P2MA 4AOQA 2VIQA 1LVBA 1O2KA 1UTPA 1WQVH 1AUJA 4IMZA 1VITH 1O3KA 3FP7E 4DG4A 5E2PA 5LPEA 3MU8A 2EA3A 3A86A 3MNBA 2ODQA 2WPLS 1TNLA 3ODFA 3SO3A 3TJOA 1GI8B 1MKXH 3U69H 4WXVA 1BMAA 1D3TB 1LVYA 4OGXA 1NFUA 5FXLA 2AGEX 3NPSA 2QXHA 3QZRA 2STAE 3T27A 1GVKB 3TK5A 1O3LA 1GBLA 2A1DB 5C5OA 1TQ0B 4MVNA 4FU9A 1DLEA 4UD9H 1GCTC 1HAPH 3SBKA 1EB2A 2P8OC 1C5VA 1O2UA 5I25A 1LKAA 3SJIA 1V2WT 3BN9A 3T26A 2WUBA 1T4VH 3R0FA 1KXFA 1DSUA 2XBXA 1GJ7B 3B9FH 3KQEA 1K9OE 1THRH 1DICA 4NFFA 1Y8TA 4OS5A 2YNAA 1P2OA 5GCHG 3QO6A 1SGFA 1EQ9A 4Q2KA 2HRVA 3LGTA 3M7TA 4ISHH 2SFAA 2UUJB 4FUEA 1Y3WA 2CF8H 3MO6A 2C90B 2Z94A 1V2PT 3AW1A 1EKBB 1UHBA 1FY1A 1CU1A 1C4U2 3SGBE 3OTJE 1RIWC 3E0NB 5HM2A 3D49H 1XVOA 1SGRE 1ACBE 2BVSH 1Z8IB 3OX7U 1EP6A 2FEQH 2ZDLA 4JZDH 1TX6A 3DFJA 4PROA 1W14U 3M5MA 1AVXA 3QGJA 5GJ4B 4ABAA 3ZVFA 3PWBA 5T6DA 4OS4A 1SQAA 3URDA 1HAYB 2FDAA 1KXEA 1P06A 3RXBA 1THPB 4X1NU 2O8LA 1NRQH 2FOFA 3TPIZ 1H9HE 1JBUH 1UTJA 3ENSB 3U8TH 1LTOA 5L6NH 1BDAA 2ZDNA 3RXTA 2GT7A 1FZZA 4QT8C 4O3UA 1P2JA 4CRDA 3HK3B 1GJ6A 3VXFH 1SGYE 1DT2A 5DP6A 4K5ZA 1GI4A 4XFQA 3HK6B 1KYNA 1YCPK 4RKOB 2ZDMA 3PLBA 3TK6A 1SLVB 3QZQA 1QB1A 3UIRA 5DG6A 3TGIE 2A7HA 1UHBB 4Z6AH 2BLWA 2GMTC 1BTWA 1O3GA 3OY6U 1GMCF 1FPCH 4IN2A 1FUJA 1GJDB 1W0YH 1O39A 4YOIA 2DUCA 2C8ZB 1MU6B 3MO9A 1BMLA 2CF9H 1VITF 3K9XB 3T25A 3RMLH 1PPZA 4AZ2B 1A1RA 3LH3A 1ANCA 3C27B 1UTKA 1YLCA 4SGBE 3A7YA 2TRMA 1GHYH 4INLA 4ABFA 2D26C 1BTXA 4YLQH 3P95A 2PW8H 2ZCHP 2FOMB 4FU7A 1MTUA 2A5KA 3GY2A 2FPZA 4AB9A 3E6PH 3Q3XA 1OXGA 1MH0A 1L1GA 1EATA 3QTVH 2BLQA 5IYTA 1OS8A 4BAMB 2P95A 1YBWA 5JBCS 2ZDKA 4GVUA 3E0PB 2J95A 4H4FA 2ZGCA 4NSVA 1DX5M 1SBWA 4JYVH 2FTMA 1E37B 2BHGA 3ATKA 2DE8A 3MNSA 5LGOA 1CT0E 1DANH 1ZMJA 2ZQ2A 2PHBA 1YM0A 2FI5E 4HFPB 1W0ZU 1WBGB 4UFEH 1G3EA 1J15A 1GBAA 1AFQC 1QURH 4WH6A 2ZFQH 1MZAA 4JK5A 1TFXA 1KXBA 1GBKA 5CE1A 5EQQA 1KTSB 2ZCLP 3SORA 1KLTA 1O5CB 1A0JA 3KL6A 2BD2A 1D6WA 1UK3A 4NSYA 3AAVA 1GBBA 1ZJDA 4JZIA 2A7CA 3HKJB 4DVAU 1EPTA 4TY7A 2JH0D 1NC6A 3P8FA 4OS7A 1NRRH 2VIDA 4K60A 4TWYA 2WPJS 1K1MA 5A8XA 4CRBA 1ELFA 1YLDA 2BVXH 4GPGA 2BDAA 2SGPE 2GCHF 2QIQA 1MAXA 4K2YA 1C1RA 1BRCE 2Y5GA 3I77A 3RLWH 7KMEH 3S9CA 3RXFA 4BAKB 2BTCE 3RXCA 2VWOA 3MU0A 1QRWA 1IQKA 4YLUA 1ZGVA 4A92A 4WF8A 3V0XA 3SNEA 1HAGE 3BF6H 3GY7A 1DUEA 1SGIB 1BTHH 4R8TB 1Y3XA 3STJA 3FVFB 1LVOA 5FX5A 1PPCE 1EZSC 2BY8X 2XWBI 1H9IE 1HGTH 1MTNB 1TBZH 3S9AA 2GKVE 2JKHA 1SQOA 2FXRA 3A88A 1HAIH 1O2ZA 1EAWA 3LJOA 4HI3A 5C5NA 5ABWA 1AB9B 3GCNA 1L4ZA 2D2DA 3VB7A 3U8OH 1W8BH 1C5WB 1MTVA 3SJOA 1AQ7A 2XW9A 3SJ9A 3RM2H 1MD8A 1ZPZA 1GHAF 1D6RA 2QCYA 1EPTB 1KY9A 3GCHC 4UE7H 1IQGA 2OC7A 3M3VA 2WPKS 1Z1JA 2HWLB 4ZKNU 5TCAA 1ELAA 2VVVA 1GI3A 2STBE 4X1PU 1AB9C 3A85A 1GHWH 1IQEA 2ODYB 3DHKH 5ESBA 2B0FA 4B71A 2K1QA 1ELEE 4TPYA 2Y7ZA 3P92A 2C8YB 4CRCA 1V2UT 4D7GA 2C8XB 3O8DA 1O3NA 2ZO3H 3M37A 1T8MA 1GMCG 2FM2A 2AIPA 4KTSA 4A5TS 3RXMA 1X7AC 1HBTH 2Y81A 2FESH 2HOBA 1VITG 4TYDA 1WTHD 2AMQA 2QC2A 1LCYA 1TGBA 1AUTC 2WPIS 1CVWH 3JZ1B 1YKTA 2OXSA 1V2MT 1PFXC 3IG6B 1SFQB 3EA8A 3QLPH 1Z8RA 2RA3A 4ABEA 4NFEA 1GHVH 4AG2A 2C8WB 4I33A 1E35B 2G8TA 3OY5U 1ZSJA 1XXFA 2R3UA 3L3TA 1AHTH 3FFGA 2A4OA 4CBNA 1SVPA 3PYHA 3M7QA 1A7SA 1OP0A 1SHHB 1UVOA 1TPSA 1XM1A 2ILNA 3TNSA 1C1MA 1SQTA 1HIAA 2UUFB 2W7UA 4I8KA 1V2QT 1YCPH 2P3UB 4CREA 4I8LA 1BHXB 2SNWA 1P2QA 4ESTE 1HDTH 5EW1H 2ZGHA 3SUEA 1JWTA 5EXLA 1PPGE 1YPJH 2R0KA 1VZQH 1YCPM 2H6MA 1KXCA 1TPOA 1UVUH 3ZVBA 1H1BA 3TGKE 3PB1E 1Y5UT 1G36A 1ZTKA 1YP9A 1PQAA 3BTKE 1T8OA 2ZDVH 1C5QA 3SGAE 1SGFG 1PPHE 1O2JA 1E0FD 1MBMA 2GCHG 2P94A 4LXBH 2FYRA 2B7DH 1RFNA 1CGIE 4XBBA 1NT1A 1OWKA 3JZ2B 1AE8H 2Y5HA 3GYMA 1OSSA 1OWDA 1VJ9U 1IOEA 1QCPA 2PR3A 4MG3A 2EI8A 1O2YA 1C9TA 1C2KA 2GCTC 3RXJA 3F9EA 2A4QA 2O8WA 1ARCA 1C5OH 1O2HA 1O3IA 3NKKA 3ZVGA 9LPRA 1Q3XA 1S84A 1YF4A 2UUKB 4NCYA 1HIAB 4D7FA 3NUMA 5DKMA 1AVGH 1K1IA 3BG8A 1TYNA 5FCRA 2HNTE 1C5PA 2SGEE 4GCHF 1TGTA 2RCEA 4F49A 2OC0A 3P17H 4FU8A 1WTGH 4MNYA 2ZFFH 2ODPA 3QX5H 5K0HA 2VU8E 1CQQA 4AFZA 1GJ5H 2GV6A 2CN0H 3E3TA 1TPAE 2ZGJA 3A8CA 5JYIA 2ZPQA 1TRMA 1H8IH 1ZRKA 1C1PA 1KLJH 3MH7A 1GHAG 2BD5A 1VCQA 1YGCH 3D65E 1AD8H 1GPZA 2XBWA 1G32B 1LKBA 1TAWA 3A7WA 2G4UA 3EYDA 1XX9A 1XVMA 2ZPRA 3P8NA 3RXIA 3MO3A 1QBVH 1GG6C 3HGNA 4ABJA 1VGCB 3VFEA 2IN2A 3OU0A 1GWAA 1YPMH 2AFQB 2ZGBH 2BDHA 3M7UA 3UTUH 1BHXF 5DP8A 4H42U 3SOSA 1HUTH 3GDSA 1SOZA 3IITA 4Q7YA 1SGEE 3ATMA 3RXPA 2FTLE 1IHSH 2ZHFH 1TNHA 1O3FA 1V2TT 1W7GH 1Y5AT 1QQ4A 4SGAE 5FPYA 1SLXB 1NS3A 4YTAA 4WJG2 4AG1A 2CJIA 1P3CA 2RA0A 2VIOA 1CT2E 5AFYH 4IC5A 1TMUH 5A8YA 2Z9JA 1SPJA 3RXVA 2P16A 3LGIA 2GVFA 4MNVA 3UR6A 1WOFA 1J16A 1BMMH 2ZU2A 3S0NA 1UTQA 1TNGA 3TJVA 3LKWA 5FX6A 3MH6A 1GL0E 1GDNA 1C1UH 3ESTA 1GBCA 1HCGA 1ELVA 3A80A 3RLYH 1W10U 2G55A 3Q00A 3LC5A 4BTIB 5JDUB 1E36B 1L2EA 4XBDA 1QA0A 1CA8B 2SGQE 3GY3A 2V35A 3H7TA 3MWIU 1LQDB 3ATLA 3LGUA 2Z3CA 3RMNH 2QXIA 1MZDA 1HJAC 1F0TA 4Y7BA 3ATIA 1EAXA 2FOEA 1C1VH 2VIVA 3VGCB 1BTYA 2F9UA 1P2KA 1SMFE 3ZZ6A 3LGWA 3ZZCA 3SHAH 2BX3A 2F91A 4XBCA 1O2IA 2UUYA 5DP4A 2G52A 1DS2E 1NFXA 3H5CB 2ANKH 2TIOA 3PWCA 4ZHLU 1BBRH 5H4IB 3RXUA 4FUJA 3SI3H 1OYTH 2ZTXA 3K6ZA 2D1JA 1KIGH 4O97A 2VH6A 2A7JA 3CS0A 1HLTH 1O3MA 3RMOH 2Q6DA 4ZH8A 2WYJA 2PGBB 5T6GA 1M9UA 5EXNA 4ISOA 3AASA 3TJNA 3S69A 4BXWA 1C1QA 1E34B 2O8UA 1JXPA 1O3OA 4D9RA 4O9VA 5JB9S 4NIVA 1IQHA 3ZVDA 3GISB 1XUJA 3KGPA 3W95A 1O33A 3RUOA 2B8OH 1F0RA 2GP9B 2NU2E 2SNVA 3DUXH 3MYWA 1RJXB 1UVPA 3SV8A 1QL7A 4B73A 4ZXYH 5E2OA 5TJXA 4WVPE 2VH0A 1GBDA 1GBIA 1O34A 1A5HA 3SUGA 3UPEA 3A7XA 3GCTF 4GCHG 1K2I1 1LHDH 1S85A 1QIXB 1O3HA 3M3SA 4FUFA 3RXKA 3RXOA 2XRCA 1GHBF 4ISIH 3PMAB 4UFFH 5CHAB 3LDXH 3QK1A 4LZ4B 4ISLA 1SLWB 1K1LA 2VWMA 1TNIA 2BLOA 4B74A 2A5IA 3VEQB 1G3CA 5E8EH 1OWEA 1C2IA 3NXPA 2WPHS 1HAXB 1TRYA 2O8TA 1ZGIA 4WMDA 3KCGH 1TALA 3UWIA 4Y76A 3BTFE 3PROA 4AGKA 2I6SA 3N7OA 1FAXA 2XBYA 4E7NA 2BDBA 2ZDAH 3GY6A 3K65B 1IQJA 3RMMH 5JB8S 4FUCA 1UK2A 3V12A 3ZZDA 8KME2 4LZ1H 3LH1A 1QRXA 1UCYK 3VXEH 4DIIH 1S81A 3PTBA 4J1YA 1VCPA 2AIQA 2OBQA 3ZYEA 5GXPA 2BY5X 2FX6A 2F9NA 1GHXH 1IHTH 4K69A 4KKDA 1BTZA 1P05A 1BZXE 2H5DA 1P8VC 1BCUH 3QTOH 1NPMA 4X2WA 1G2LA 4JCNA 1ABIH 3GY4A 1PPFE 3MI4A 4UDWH 3KNXA 1GI6A 2ANWA 1Z8JB 2A0QB 5AF9H 2Z3EA 1BRAA 1Z8GA 1L4DA 2VVCA 3A8DA 5BPEA 2W7SA 1SL3A 1AWHB 1C5XB 2FODA 1RXPA 1UK4A 1KXDA 1N8OB 1O2LA 2XBVA 2PKSB 1ABJH 4JZFH 2NU0E 1C5TA 1Z6JH 2ZG0H 2A4GA 1NRNH 2XC5A 4K1TA 4JZ1A 2VGCB 4K3JA 2CHAB 3VPKA 5A8ZA 3L33A 4Y11E 4YT6H 3RP2A 7GCHF 3UQOA 3Q77A 3A81A 2HGTH 2EEKA 2QA9E 3V13A 1K21H 1SGPE 3UQVA 3MU5A 1FMGA 4MLFB 1P10A 2QGRA 1DWBH 2Z7FE 1ZTJA 2J94A 1GI5A 4NIYA 1GBTA 1J14A 2ZHWH 3B8JA 2BD7A 3LC3A 2V3OH 1ESAA 1GBMA 2ZI2H 1F0UA 3GCOA 1C2LA 5HMAA 4H6TA 3MNCA 4DY7B 1O3JA 1O3BA 3NCLA 1DVAH 1F7ZA 4X0WU 1KXAA 1CHOF 2PKAA 1L1JA 2ZHQH 4VGCB 4X8VH 1PYTD 4AYVB 4GAWA 5HGGA 1FY5A 1HXEH 1C1OA 4XE4A 1C5UA 2C93B 5EPYA 2DE9A 2ZZUH 1W11U 2H9HA 3A84A 1ZSKA 4CRAA 1KDQA 3KHVA 1C1WH 1UTLM 2F9BH 3KQBA 1A61H 3ZZAA 1HAVA 4WXIA 3P8GA 5A2MH 1IAUA 4Y0YE 1GJBB 1YPHC 3MOCA 4AGJA 2O9QA 2ANYA 3RXGA 3TITA 1VCWA 1D4PB 4BAQB 4MPWA 1AY6H 1ELBA 2Y80A 1O5EH 1V2LT 5EW2H 1BA8B 1FAKH 1S0RA 1INCA 1SGTA 2XCNA 4MDSA 4Q7XA 2JETB 3GCTG 1GVLA 2PFEA 5E0GA 3TGJE 2BQ7B 3DFLA 1C2GA 1CBWB 1IQNA 1W13U 3M5OA 2HALA 4I32A 4A1TA 1GHBG 2OLGA 1O30A 1SGQE 1WU1A 2YNBA 5FPSA 4INHA 1C5ZB 2GV7A 2V0BA 2FI3E 5EGMA 1LVMA 2CV3A 4AX9H 6GCHF 2PKAB 3K2UA 3A8BA 3PMBB 4DURA 1BB0B 2FP7B 2G00A 5JBTA 1ESTA 5F8XA 2BY9X 3ZV9A 4X1QU 1G2MA 4GSOA 1KDQB 1FY8E 3VB3A 1F5RA 2OINA 1HAVB 2W3KA 3A7TA 3T5FH 3MNXA 1CE5A 2J38A 4ZKRU 3TK9A 2ZIQH 1C9PA 2AS9A 1TWXB 1UVSH 3LPRA 1EJAA 1RTFB 1HJ8A 4WMFA 5FCKA 1HJ9A 4B2CA 2IPHA 4ZHMU 1XUFA 3UR9A 1SSXA 2ZKSA 3MU1A 1N6YA 1RTLA 3UWJH 1JIMA 5LH8A 1QJ1B 1TIOA 3RXSA 3RXRA 3STIA 1EP5A 1K1OA 1MTNC 3UNSA 3SV7A 2F83A 1ZTLA 1BRBE 1ID5H 3CP7A 1NY22 1P03A 1OPHB 2ASUB 2BMGB 1W12U 3M36A 4YOGA 4AFUA 1C5MD 2SGAA 4KP0A 1G3DA 1O35A 1CSOE 3EGKH 1DM4B 1QA7A 4BANB 1QL9A 1QL8A 1C5NH 1J8AA 1EJNA 1EPTC 1T8LA 1A46H 7GCHG 3ZZ9A 5JBBS 2Y7XA 1P0SH 3TNTA 4JK6A 4D9QA 2A5AA 5C2ZA 3RXQA 1UCYH 1ZMLA 2ZTZA 1MCVA 2WINI 2PTNA 1BUIA 1FQ3A 1BBRK 1F2SE 2OCVB 1EJMA 3U1JB 2R3YA 5GIBA 4NIXA 4BAHB 4X1SU 3LU9B 3SU1A 2ZFRH 3BTHE 3ELAH 2W5EA 1GL1A 3SU6A 1DPOA 2KAIA 1CHOG 4KTUA 4RN6A 1N1LA 3TLOA 1BJVA 1TABE 4E7RG 3AVZA 3DD2H 2D8WA 3TJUA 2RG3A 3FANA 5TCCA 2ZQ1A 3TH3H 3RM0H 2ZC9H 3S7KB 1NU7B 4E06H 3TVJB 1O3PB 2H5CA 1C2DA 2BXUH 3ZVEA 1O38A 2LNCA 3KQDA 4ABHA 1ZR0A 1O2NA 2J92A 5EXMA 1AFEH 3P8OA 1AZ8A 2FI4E 1QB9A 5PTPA 1P02A 3OYPA 1C2HA 4ABIA 1NTPA 4IGDA 1D3DB 3F6UH 1DY9A 2ZGXH 5C67A 2A45B 4AFQA 5HYOA 3BTEE 2BD8A 1AWFH 1B0EA 5GDSH 1UJ1A 3FAOA 2PWXA 3GDVA 1YPLH 5C1XA 1XUIA 4FUHA 5A0CA 2WYGA 5EOKA 2AGIX 4Q7ZA 4X8TH 2FOGA 1DWEH 2VB0A 2GT8A 3VB4A 4HGCA 3SHCH 4XDEA 3BTDE 1UMAH 5F03A 2KAIB 3WY8A 6GCHG 5EU8A 2XCFA 1AMHA 2PUQH 3E1XB 4MPVA 3URCA 1BTPA 1Z1IA 2R2WU 1C2MA 2BOKA 4NWLA 1H9LB 8LPRA 2AERH 1C2FA 1MQ5A 1L0ZA 4CRFA 1WAYB 2UWPA 1RD3B 1GDQA 1DSTA 4U30A 4NIWA 3BTME 3SUFA 1Z7KA 4FUBA 1XMNB 1OOKB 4Y8ZA 3M5NA 4ABDA 2OQUA 1TB6H 1ANEA 2XXLA 2AMPA 4UONA 4MNWA 3B23B 4HZHA 1FIWA 3EAJA 1V2RT 3L6PA 1G37A 1F0SA 3S7HB 1G9IE 1ZRBA 4BAOB 5HXFA 5DGJA 5C20A 2FMJA 2CMYA 2NU4E 1HB0B 1NRPH 1Q31A 3BIVH 3PM3A 3D23A 5ESTE 2WV5A 1JIRA 1AN1E 3ZZBA 2IOTA 4ZKOU 1DLKB 4BNRA 2R9PA 3A82A 4FUIA 4WY3A 1C1TA 2FX4A 4MPUA 1GMHF 4ZUHA 2XTTB 3QWCH 1EZQA 4A7IB 3QN7A 4X6OA 4JMYA 3RDZA 3A89A 4CHAB 3SGQE 1HAHH 1DE7H 1HXFH 1Z71A 5JBAS 1ANBA 1MQ6A 1TPPA 1SC8U 2VNTA 1P2NA 3RU4T 3PO1B 4B1TA 2JH5D 1RGQA 3SQEE 1CGJE 2V6NA 4AFSA 1C4Y2 3EDXB 1YPGH 1D3PB 1TA2A 1P04A 1N6XA 1VGCC 1O31A 2QF3A 3FZZA 3MH4A 1S82A 4E05H 1ZHMA 1D3QB 5DPAA 6CHAB 4JZEH 1EUFA 3ZZ7A 3EE0B 1TX7A 2Q6FA 4FUDA 3LOXA 1QNJA 3EA9A 1Y3VA 1SB1H 2ZF0H 3BIUH 3NK8A 1P12E 2ZFPH 4NZQA 3NWUA 1A0HB 1LPZB 1O2TA 2ZP0H 5I46H 1ARBA 3RXAA 4BXSA 3K6YA 1TLDA 3I29A 1DITH 2AYWA 3RU4E 2F9VA 2HNTF 1J17T 1H4WA 5DP3A 2THFB 3A87A 2UWLA 3SV9A 2V3HH 2BOHB 3GYLB 4FVBA 3M61U 1TONA 2G81E 1HNEE 4AN7A 3F9HA 2AH4X 1LHCH 3HATH 5A0AE 1CHGA 5DP5A 2BY7X 1P9SA 3HKIB 1SR5C 5FBEA 3T2NA 4I8GA 5F6MA 2TBSA 1G30B 4AORA 1GGDB 4TY6A 1GBFA 1SHYA 2TPIZ 4YM9A 1O2RA 1C5SA 1FXYA 1QGFA 2ZECA 3BEIB 3W94A 1CA0B 1UTNA 1EAIA 4KELA 1FY4A 2TGAA 3E16B 1XUGA 1O3EA 1P3EA 3VGCC 4D8NA 2QXJA 1CGHA 1VR1H 4Y8XA 3U1IB 1PQ8A 2AGGX 1AO5A 1XKBC 3MTYA 4U32A 5L30H 1TGNA 2WV4A 3RC5A 1SI5H 2CXVA 2UWOA 5C1UA 4A1VA 1O37A 1O3AA 5AHGH 4INKA 1CA0C 1XUHA 4IW4E 3MU4A 4BOHA 1UTMA 3TH4H 1NFYA 4ZAEA 3SW2B 5JPMH 5E0HA 1ELTA 1GCTB 1C5RA 2P8OB 1S0QA 1B5GH 1F92A 1BITA 1LHFH 4U2WA 1MUEB 1DDJA 1EASA 1NESE 4I31A 1QY6A 4IBLH 3RC4A 4NA7A 3LGVA 1WYKA 1QBNA 4M7GA 2OTVA 2GDDA 1OWJA 1ELCA 1GI9B 1S5SA 1MU8B 1ZJKA 1P9UA 2GZ8A 1PQ5A 7ESTE 1ZOMA 1D9IA 1P11E 4IMQA 4MPXA 1UO6A 3AW0A 4BTUB 2O8MA 2CGAA 4ZKSU 2M5TA 1FJSA 1K1NA 3MHWU 1ANDA 5C1YA 3GY5A 1K22H 2BB4A 3O8RA 1P57B 1YYY1 2B5TB 5FBIA 3BEFB 1GMDF 1TQ7B
chains in the Genus database with same CATH superfamily
1DFPA 4YO9A 3KF2A 1RIWB 1GMHG 4J2YB 2BM2A 4OS2A 4A1XA 1GDUA 1H8DH 1RRKA 1S6HA 5CHAC 1OP2A 3D62A 2XC0A 1BBRE 1HAZB 3SUDA 3ODDA 1W2KH 1DWDH 1T7CA 3ZZ4A 2ANMH 2HLCA 5FAHA 2PGQB 1AU8A 1SLUB 4OS6A 1VJAU 4NGAH 1LQEA 3KIDU 2WUCA 3U9AH 3UNQA 1O5GH 1DWCH 1V2NT 4UFDH 4Y6DA 2Z9GA 1AI8H 5L2ZH 4X6NA 3I78A 2ESTE 1XKAC 1ETSH 3RC6A 3SYJA 1ZLRA 1WSSH 3O8BA 3PMJA 2PV9B 2BYAX 1Z6EA 2P59A 2XNIA 2SGFE 1GCDA 3FZDA 1BOQA 5J4SA 1W7XH 1DY8A 4ASHA 2ZFSA 1BTUA 3MFJA 3FP6E 2PLXA 3G01A 4THNH 1T32A 4OS1A 3VB6A 1TOMH 1V3XA 3PTNA 1HAOH 5F8ZA 1SGCA 1V2ST 4XSKU 1C2JA 4I7YH 4RKJB 3A8AA 2YOLA 2F43B 3CNRA 2OC8A 1FY3A 2FYQA 2ZHDA 1ZHPA 4CH8B 2GMTB 1W3CA 1ZPBA 3HGPA 2BD3A 5E0JA 2EI6A 1N8OC 1V2JT 2PKSC 3TH2H 3E90B 2XYAA 1KTTB 2EY4C 4MQAA 1ESBA 1MKWK 2ZEBA 2OC1A 2VGCC 2C3SA 1OKXA 1WUNH 1QFKH 1ZSLA 2FO9A 2FS8A 2CHAC 1DOJA 3CENA 2BZ6H 1L1NA 1TNJA 1JOUB 3EQ0H 5T6FA 2BY6X 2J9NA 1WV7H 1GI7B 2ZHEH 2J98A 4O03A 1O2SA 4B2BA 1FN8A 2ZU5A 5AVDA 3ZYDA 4B2AA 3ZIAD 3BG4B 2OD3B 3RXDA 4WMEA 2BZAA 3PRBA 3O8CA 2G5NA 2Z9LA 3Q3KA 3F9FA 4I8JA 1FN6A 4F4OC 1B0FA 1TBQH 2HVXA 1TMTH 3OAAD 4X1RU 8ESTE 1NO9H 1PJPA 1XXDA 3SU4A 3M35A 3QDZB 4Y8YA 2HPQH 4TPIZ 4UFGH 1TE0A 2AEIH 2AMDA 1HRTH 2BD9A 1AFQB 4TWWA 1WCZA 1O2XA 3BG4C 4CR9A 1A2CH 1QR3E 4MNXA 1KSNA 4AC9A 2BLVA 1TBRH 2Y82A 2YMSD 3BEUA 4H6SB 4VGCC 5ETXA 1Y59T 1NROH 1JRSA 4A6LA 3BTTE 1O5BB 3AAUA 4FOUC 3T29A 4R0IA 1YPHE 1E79D 4X2XA 3PLPA 1GJ8B 2H9EH 3TU7H 3A7ZA 2VIPA 1A5GH 3SNDA 1HYLA 3UFAA 4JYTA 4ASUD 3R3GB 3DSGA 1OWHA 3MH5A 5C0UA 2FLBH 2NWNA 2PSYA 5EG4A 2K8IA 2R0LA 4OGYA 1TGSZ 4YZUA 2J98B 2FS9A 2VWNA 3LIWA 1UTOA 1LPGB 3U8RH 1BQYA 2JETC 2GGVB 2FOAA 5DP9A 4KTCA 4Y0ZE 1C1NA 1GI0A 1EZXC 1C1SA 1GMDG 1QQUA 2Z6BD 3DT0H 5DP7A 3KN2A 4NZLA 2TGDA 2BX4A 2BDGA 5K7RA 1CBWC 2GX4A 1F5LA 1FLEE 2QXGA 1A4WH 1OYQA 1ZZZA 3P70B 4BTTB 2YMSB 1PYTC 3A7VA 4I8HA 3N7EA 5G4BA 2OQ5A 6LPRA 2G5VA 4K8YA 4XRNA 4LOYH 1GJ9B 2PUXB 2OBOA 1YPEH 1P01A 3BTWE 4IS5A 3CS7A 2H1UA 2ZNKH 5SGAE 1HFDA 3PLKA 3EE7A 3C1KA 1J9CH 1NN6A 2VVUA 4XOJA 1TMBH 1FI8A 4K8BA 2H2ZA 1P2IA 3T62A 4CR5A 4K1SA 1O36A 1NZQH 2BVRH 5EQSA 1EZUC 3BTQE 1TOCB 1GBEA 2GD4B 4GUXA 4DCDA 1JRTA 3GCHB 2FOCA 1IQIA 2Q1JA 1KLIH 5CMXH 5BRRE 1FIZA 2ZU3A 1NFWA 1IQLA 1G3BA 1GBJA 2FOHA 1BIOA 3UNRA 1EOJA 9ESTA 2TGPZ 5DK1A 1B7XB 3F68H 4AB8A 4ZCNA 5L2YH 2PTCE 1O2QA 2JH6D 1OWIA 4ABBA 3MMGA 3F1SB 4HTCH 4YESB 2FOBA 3GY8A 5EODA 2ZTYA 1FV9A 1U6QA 5HKKD 1ETTH 2BD4A 3GOVB 1PQ7A 3VB5A 4D76A 1FONA 4NG9H 3U98H 4CBOA 5HM9A 4X8SH 1AZZA 3UUZA 3SV2H 4CRGA 1AKSA 1QZ8A 4RSPA 4ZMAH 2BDCA 2ZU1A 1DXWA 1O2VA 1Y5BT 4DIHH 3FKSD 4B76A 4O3TA 1TA6A 2WPMS 3QUMP 4U01A 1O32A 2BDYA 1EXFA 4LK4A 3ZVCA 1JMOH 1THSH 5FL7D 1AE5A 5GWZA 4X6MA 5EPNA 1F5KU 2GZ9A 2ALVA 5A09A 4ISNA 1QJ7B 1SOTA 4YXWD 2ZA5A 3ZVAA 1V6DA 1O2WA 2PSXA 1MMJN 2RDEA 5F8TA 2J2UA 1O5DH 2VINA 4ABGA 3PV4A 3OSYA 2B9LA 1SG8B 5FHTA 1V2KT 2FLRH 1K28D 2QAAA 1LHEH 1MKXK 4K1EA 3MQKC 4ZHAA 1HV7A 2A2QH 2I6QA 1GHZA 7LPRA 1WQSA 2ALPA 3BV9B 3ZV8A 2J4IA 3IWMA 4MTBA 1FPHH 2GTBA 3EA7A 2ZU4A 3PMHB 2VWLA 1SGNE 2SGDE 3KEEA 3UOPA 1O3DA 1RTKA 2F4LA 5IK2D 3SN8A 5GPIB 1EX3A 1YC0A 2QY0B 1Y3UA 4KGAA 4RI0A 4UEHH 1MKWH 1SFIA 2EC9H 3ATWA 1PPEE 2FIRH 2A4RA 3QGNB 3RXEA 1AKSB 3KQ5A 3UREA 1WXRA 2ZPSA 1Q2WA 1GJAB 2NU1E 1AGJA 2BQWB 1ETRH 1LHGH 4FXGH 1GJ4H 3ZZ5A 1NU9A 1MAYA 2F3CE 2VJ1A 4Z0KA 8GCHF 1C4V2 1OP8A 2W26A 4Y79A 1UCYE 3A83A 4FVDA 2BXTH 2G51A 1QTFA 3SU3A 1QHRB 1MD7A 2GCTB 1A3BH 3ZZ3A 1OX1A 1CT4E 1YPKH 3LONA 1GI2A 3SU2A 3ITIA 1ZPCA 1T31A 3M5LA 3E91A 1ELDE 1PPBH 4GHQA 1FNIA 2A31A 1ORFA 2TGTA 3SNBA 3BTGE 5DO4H 2GZ7A 3SV6A 2BQ6B 2OUAA 4Y7AA 1T4UH 1BT7A 1TGCA 2HNTC 1LDTT 1O2GH 3T28A 2GDEH 4DT7B 1QB6A 1ZMNA 1Y3YA 2P93A 3SNAA 1EOLA 4YOJA 2QF0A 4DOQA 1IQMA 4AYYB 2G4TA 3NZIA 3V7TA 1ZYOA 3UOUA 3RU4D 1GI1A 4GHTA 2RDLA 4GLYA 4IN1A 2NU3E 4NA8A 5HIZA 3SJ8A 1T8NA 1NM6A 2QV1A 5FPTA 2Z3DA 1SGDE 1MTSA 1K1PA 2R2MB 1GG6B 4NA9H 4ZXXH 1V2VT 1O5AB 2J97A 5GCHF 2QYIA 1AVWA 5A0BA 2A32A 3SQHE 3E8LA 1GBHA 1BRUP 3S9BA 1TX8A 1BJUA 2KCPA 3GICB 4OM9A 3GDUA 4WWYA 3SI4H 2IJOB 5J4QA 3M3TA 1O0DH 5EQRA 2J34A 1K0HA 1S83A 2Z9KA 1EAUA 1O3CA 1C2EA 2HPPH 5LPFA 4ZROA 3SJKA 1O5FH 2F9OA 3RXLA 1CO7E 1K1JA 1V2OT 2ZFTA 4Y10E 4CH2B 1C5LH 4WH8A 3SU0A 2EI7A 4YT7H 3SNCA 4CHAC 4X6PA 1EB1H 2V3MA 5B6OA 1XUKA 4DJZB 3V3MA 1UVTH 3Q76A 2Y6TA 4NWKA 4X8UH 2VIWA 2ZCKP 3PO1C 2Z9IA 2XC4A 1LPKB 2Y5FA 1O2OA 4DGJA 1MTWA 1FDPA 1ELGA 6CHAC 1DXPA 2XWAA 2P3FH 5T3HA 3HPTB 3P6ZB 5C0TA 1LO6A 3F9GA 1QRZA 3LJJA 4X2YA 3LGYA 5IDKA 3DA9B 1E38B 1MBQA 2ULLA 2C4FH 3ZZ8A 1A0LA 2FZZA 2W3IA 1HJAB 1C5YB 4Y71A 2BDIA 3BSQA 2KFWA 1TRNA 3FP8E 4FUGA 1NRSH 3KQCA 1HPGA 3LT3A 1O2MA 1LMWB 3UB0A 2A2XH 1ZHRA 1GJCB 1A3EH 2OP9A 2QN5T 2FWWA 1DUAA 1S6FA 2Q6GA 2F9PA 3H7OA 1BMNH 5C3NA 4Q80A 3FOAA 4DW2U 3Q3YA 3UY9A 1GVZA 1QBOA 2LPRA 6ESTA 1QJ6B 1TNKA 4IC6A 4X2VA 5AFZH 3SZNA 2ZWLH 4JYUH 1A5IA 1O2PA 3W1EA 5LPRA 1RS0A 5DJ7A 1GGDC 1P09A 1IQFA 3TIUA 3RXHA 2H9TH 4B75A 2P3TB 1AIXH 1MCTA 8GCHG 3SU5A 1P2MA 5C94A 4AOQA 2VIQA 5C17A 1LVBA 1O2KA 1UTPA 1WQVH 1AUJA 4IMZA 1VITH 1O3KA 3FP7E 4DG4A 5E2PA 5LPEA 3MU8A 2EA3A 3A86A 3MNBA 2ODQA 2WPLS 1TNLA 3FN8A 3ODFA 3SO3A 3TJOA 1GI8B 1MKXH 1E1RD 2KCOA 3U69H 4WXVA 1BMAA 1D3TB 1LVYA 4OGXA 1NFUA 4ACAA 5FXLA 2AGEX 3NPSA 2QXHA 3QZRA 2STAE 3T27A 1GVKB 3TK5A 1O3LA 1GBLA 2A1DB 5C5OA 1TQ0B 4MVNA 4FU9A 1DLEA 4UD9H 3WWFA 1GCTC 1HAPH 3SBKA 1EB2A 2P8OC 1C5VA 1O2UA 5I25A 1LKAA 3SJIA 1V2WT 3BN9A 3T26A 4B6FA 2WUBA 1T4VH 3R0FA 1KXFA 1DSUA 2XBXA 1GJ7B 3B9FH 3KQEA 1K9OE 1THRH 1DICA 4NFFA 1Y8TA 4OS5A 2YNAA 1P2OA 5GCHG 3QO6A 1SGFA 1EQ9A 4Q2KA 2HRVA 3LGTA 3M7TA 4ISHH 2SFAA 2UUJB 4FUEA 1Y3WA 2CF8H 3MO6A 3UAIC 2C90B 2Z94A 1V2PT 3AW1A 1EKBB 1UHBA 1FY1A 1CU1A 1C4U2 3SGBE 3OTJE 1RIWC 3E0NB 5HM2A 3D49H 1XVOA 1SGRE 1ACBE 2BVSH 1Z8IB 3OX7U 1EP6A 1COWD 2FEQH 2ZDLA 4JZDH 1TX6A 3DFJA 4PROA 1W14U 3M5MA 5EIYA 1AVXA 3QGJA 5GJ4B 1W0KD 4ABAA 1OHHD 3ZVFA 3PWBA 5T6DA 4OS4A 1SQAA 3URDA 1HAYB 2FDAA 1KXEA 1P06A 3RXBA 1THPB 4X1NU 2O8LA 1YY3A 1NRQH 2FOFA 3TPIZ 1H9HE 1JBUH 1UTJA 3ENSB 3U8TH 1LTOA 5L6NH 1BDAA 2ZDNA 4XD7D 3RXTA 2GT7A 1FZZA 4QT8C 4O3UA 1P2JA 4CRDA 3HK3B 1GJ6A 2XNDD 1S6LA 1SGYE 3VXFH 1DT2A 5DP6A 4K5ZA 4M9FA 1GI4A 4XFQA 3HK6B 1KYNA 1YCPK 4RKOB 2ZDMA 3PLBA 3TK6A 1SLVB 2XOKD 3QZQA 3AK5A 1QB1A 3UIRA 5DG6A 3TGIE 2A7HA 1UHBB 4Z6AH 2BLWA 2GMTC 1BTWA 1O3GA 3OY6U 1GMCF 1FPCH 2KCYA 4IN2A 1FUJA 1GJDB 1W0YH 1O39A 1SQRA 4YOIA 2DUCA 2C8ZB 1MU6B 3MO9A 1BMLA 2CF9H 1VITF 2VBCA 3F2FA 3K9XB 3T25A 3RMLH 1PPZA 4AZ2B 1A1RA 3LH3A 1ANCA 3C27B 1UTKA 1YLCA 4SGBE 3A7YA 2TRMA 1GHYH 4INLA 4ABFA 2D26C 1BTXA 4YLQH 3P95A 2PW8H 2ZCHP 2FOMB 4FU7A 1MTUA 2A5KA 3GY2A 2FPZA 4AB9A 3E6PH 3Q3XA 1OXGA 1MH0A 3GS9A 1L1GA 1EATA 3QTVH 2BLQA 5IYTA 1OS8A 4BAMB 2P95A 1YBWA 5JBCS 2ZDKA 4GVUA 3E0PB 2J95A 4H4FA 2ZGCA 4NSVA 1DX5M 1SBWA 4JYVH 2FTMA 1E37B 2BHGA 3ATKA 2DE8A 3MNSA 5LGOA 1CT0E 1DANH 1ZMJA 4Z1MD 2ZQ2A 2PHBA 1YM0A 2FI5E 4HFPB 5KECA 5T1VA 1W0ZU 1WBGB 4UFEH 1G3EA 1J15A 1GBAA 1AFQC 1QURH 4WH6A 2ZFQH 1MZAA 4JK5A 1TFXA 1KXBA 1GBKA 5CE1A 1SKYE 3PRDA 5EQQA 1KTSB 1KMHB 2ZCLP 3SORA 1KLTA 1O5CB 1A0JA 3KL6A 2BD2A 1D6WA 1UK3A 4NSYA 3AAVA 3DSOA 1GBBA 2JDID 1ZJDA 4JZIA 2A7CA 3HKJB 4DVAU 3PV2A 1EPTA 4TY7A 2JH0D 1MABB 1NC6A 3P8FA 4OS7A 1NRRH 2VIDA 4K60A 4TWYA 2WPJS 1K1MA 5A8XA 2JIZD 4CRBA 1ELFA 1YLDA 2BVXH 4GPGA 2BDAA 2SGPE 2GCHF 2QIQA 1MAXA 4K2YA 1C1RA 1BRCE 2Y5GA 3I77A 3RLWH 2LELA 7KMEH 3S9CA 3RXFA 4BAKB 2BTCE 3RXCA 2VWOA 3MU0A 1QRWA 1IQKA 4YLUA 1ZGVA 4A92A 4WF8A 3V0XA 3SNEA 1HAGE 4RT0A 3BF6H 3GY7A 1DUEA 1SGIB 1BTHH 4R8TB 1Y3XA 2YMSC 3STJA 3FVFB 1LVOA 5FX5A 1PPCE 1EZSC 2BY8X 2XWBI 1H9IE 1HGTH 1MTNB 1TBZH 3S9AA 2GKVE 2JKHA 1SQOA 2FXRA 3A88A 1HAIH 1O2ZA 1EAWA 3LJOA 4HI3A 5C5NA 5ABWA 1AB9B 3GCNA 1UW7A 1L4ZA 2D2DA 3VB7A 3U8OH 1W8BH 1C5WB 1MTVA 3SJOA 1AQ7A 2XW9A 3SJ9A 3RM2H 1MD8A 1ZPZA 1GHAF 1D6RA 2QCYA 1EPTB 1KY9A 3GCHC 4UE7H 1IQGA 2OC7A 3M3VA 2WPKS 1Z1JA 2HWLB 4ZKNU 5TCAA 1ELAA 2VVVA 1GI3A 2STBE 4X1PU 1AB9C 3A85A 1GHWH 1IQEA 2ODYB 3DHKH 3OTPA 5ESBA 2B0FA 1VKYA 4B71A 2K1QA 1ELEE 4TPYA 2Y7ZA 3P92A 2C8YB 4CRCA 1V2UT 4D7GA 2C8XB 3O8DA 1O3NA 2ZO3H 3M37A 1T8MA 1GMCG 2FM2A 2AIPA 2WV9A 4KTSA 4A5TS 3RXMA 1X7AC 1HBTH 2Y81A 2FESH 2HOBA 1VITG 4TYDA 1WTHD 3WW7A 2AMQA 2QC2A 1LCYA 1TGBA 1AUTC 2WPIS 1CVWH 2QE7D 3JZ1B 1YKTA 2OXSA 1V2MT 1PFXC 3IG6B 1SFQB 3EA8A 3QLPH 1Z8RA 2RA3A 4ABEA 2HVYB 4NFEA 1GHVH 4AG2A 2C8WB 4I33A 1E35B 2G8TA 3OY5U 4B6EA 1ZSJA 1XXFA 2R3UA 3L3TA 1AHTH 3FFGA 2A4OA 4CBNA 1SVPA 3PYHA 3M7QA 1A7SA 1OP0A 1SHHB 1UVOA 1TPSA 1XM1A 2ILNA 3TNSA 1C1MA 1SQTA 1HIAA 2UUFB 2W7UA 2KR7A 4I8KA 1V2QT 1YCPH 2P3UB 4CREA 4I8LA 1BHXB 2SNWA 1P2QA 4ESTE 1HDTH 5EW1H 2ZGHA 3SUEA 1JWTA 5EXLA 1PPGE 1YPJH 2R0KA 1W0JD 1VZQH 1YCPM 2H6MA 1KXCA 1TPOA 1YLNA 1UVUH 3ZVBA 1H1BA 3TGKE 3PB1E 1Y5UT 1G36A 1ZTKA 1YP9A 1PQAA 3BTKE 1T8OA 2ZDVH 1C5QA 3SGAE 3DSPA 1SGFG 1PPHE 1O2JA 1E0FD 1MBMA 2GCHG 2P94A 4LXBH 2FYRA 2B7DH 1RFNA 1CGIE 4XBBA 1NT1A 1OWKA 1YWUA 3JZ2B 5HIYA 1AE8H 2Y5HA 3GYMA 1OSSA 1OWDA 1VJ9U 1IOEA 3F2GA 1H8ED 1QCPA 2PR3A 3N7DA 4MG3A 2EI8A 1O2YA 1C9TA 1C2KA 2GCTC 3RXJA 3F9EA 2A4QA 2O8WA 1ARCA 1C5OH 1O2HA 1O3IA 2JJ1D 3NKKA 3ZVGA 9LPRA 1Q3XA 1S84A 3U28C 1YF4A 2UUKB 4NCYA 1HIAB 4TSFD 4D7FA 3NUMA 5DKMA 1AVGH 1K1IA 3BG8A 1TYNA 5FCRA 2HNTE 4FETA 1C5PA 2SGEE 4GCHF 1TGTA 2RCEA 4F49A 2OC0A 3P17H 4FU8A 1WTGH 4MNYA 2ZFFH 2ODPA 3QX5H 5K0HA 2VU8E 1CQQA 4AFZA 1GJ5H 2GV6A 2CN0H 3E3TA 1TPAE 2OK5A 2ZGJA 3A8CA 5JYIA 2ZPQA 1TRMA 1H8IH 1ZRKA 1C1PA 1KLJH 3MH7A 1GHAG 2BD5A 1VCQA 1YGCH 3D65E 1AD8H 1GPZA 2XBWA 1G32B 1LKBA 1TAWA 3A7WA 2G4UA 3EYDA 1XX9A 1XVMA 2ZPRA 3P8NA 3RXIA 3MO3A 1QBVH 1GG6C 3HGNA 4ABJA 1VGCB 3VFEA 3FO8D 2IN2A 3OU0A 4DT4A 1GWAA 1YPMH 2AFQB 2ZGBH 2BDHA 3M7UA 3UTUH 1BHXF 5DP8A 4H42U 3SOSA 1HUTH 3GDSA 1SOZA 3IITA 4HG6A 4Q7YA 1SGEE 3ATMA 3RXPA 2FTLE 1IHSH 2ZHFH 1TNHA 1O3FA 1V2TT 3OE7D 4Q4LA 1W7GH 1Y5AT 1QQ4A 4SGAE 5FPYA 1SLXB 1NS3A 4YTAA 4WJG2 4AG1A 2CJIA 1P3CA 2RA0A 2VIOA 1CT2E 5AFYH 4IC5A 1TMUH 1NBME 5A8YA 2Z9JA 1SPJA 3RXVA 2P16A 3LGIA 2GVFA 4MNVA 3UR6A 1WOFA 1J16A 1BMMH 2ZU2A 3S0NA 1UTQA 1TNGA 3TJVA 3LKWA 5FX6A 3MH6A 1GL0E 1GDNA 1C1UH 3ESTA 1GBCA 1HCGA 1ELVA 3A80A 3RLYH 1W10U 2G55A 3Q00A 3LC5A 4BTIB 5JDUB 1E36B 1L2EA 4XBDA 1QA0A 5CHBA 1CA8B 2SGQE 3GY3A 2V35A 3H7TA 3SZEA 3MWIU 1LQDB 3ATLA 3LGUA 2Z3CA 3RMNH 2QXIA 1MZDA 1HJAC 1F0TA 4Y7BA 3ATIA 2CK3D 1EAXA 2FOEA 1C1VH 5KEDA 2VIVA 3VGCB 1BTYA 2F9UA 1P2KA 1SMFE 2K0QA 3ZZ6A 3LGWA 3ZZCA 3SHAH 2BX3A 2F91A 4XBCA 1O2IA 2UUYA 5DP4A 2G52A 1DS2E 1NFXA 3H5CB 2ANKH 2TIOA 3PWCA 4ZHLU 1BBRH 3OEED 5H4IB 3RXUA 4FUJA 3SI3H 1OYTH 2ZTXA 3K6ZA 2D1JA 1KIGH 4O97A 5DN6D 2VH6A 2A7JA 3CS0A 1HLTH 1O3MA 3RMOH 2Q6DA 4ZH8A 2WYJA 2PGBB 5T6GA 1M9UA 5EXNA 4ISOA 3AASA 3TJNA 3S69A 4BXWA 1C1QA 1E34B 2O8UA 1JXPA 1O3OA 4D9RA 4O9VA 5F53A 5JB9S 4NIVA 1IQHA 3ZVDA 3GISB 1XUJA 2WZQA 3KGPA 3W95A 1O33A 3RUOA 2B8OH 1F0RA 2GP9B 2NU2E 2SNVA 3DUXH 3F3BA 3MYWA 1RJXB 1UVPA 3SV8A 1QL7A 4B73A 2W6JD 4ZXYH 2KZ4A 3F0OA 5E2OA 5TJXA 4WVPE 2L6OA 2VH0A 1GBDA 1GBIA 1O34A 1A5HA 3SUGA 3UPEA 3A7XA 3GCTF 4GCHG 1K2I1 1LHDH 1S85A 1QIXB 1O3HA 3M3SA 4FUFA 3RXKA 3RXOA 2XRCA 1GHBF 4ISIH 3PMAB 4UFFH 5CHAB 3LDXH 3QK1A 2J5UA 4LZ4B 4ISLA 1SLWB 1K1LA 2VWMA 1TNIA 2BLOA 4B74A 2A5IA 4I86A 3VEQB 1G3CA 5E8EH 1OWEA 1C2IA 3NXPA 2WPHS 1HAXB 1TRYA 2O8TA 1ZGIA 4WMDA 3KCGH 1TALA 3UWIA 4Y76A 3BTFE 3PROA 4AGKA 2I6SA 3N7OA 1FAXA 2XBYA 4E7NA 2BDBA 2ZDAH 3GY6A 3K65B 1IQJA 3RMMH 5JB8S 4FUCA 1UK2A 3V12A 3ZZDA 8KME2 4LZ1H 3LH1A 2LP6A 1QRXA 1UCYK 3VXEH 4DIIH 1S81A 3PTBA 4J1YA 1VCPA 2AIQA 2OBQA 2PP6A 3ZYEA 5GXPA 2BY5X 2FX6A 2F9NA 1GHXH 1IHTH 4K69A 4KKDA 1BTZA 1P05A 1BZXE 2H5DA 1P8VC 1BCUH 3QTOH 1NPMA 5B6LA 4X2WA 1G2LA 4JCNA 1ABIH 3GY4A 4F48B 1PPFE 3MI4A 4UDWH 3KNXA 1GI6A 2ANWA 2WHXA 1Z8JB 2A0QB 5AF9H 2Z3EA 1BRAA 3N99A 1Z8GA 1L4DA 2VVCA 3A8DA 5BPEA 2W7SA 1SL3A 1AWHB 1C5XB 4RT1A 2FODA 1RXPA 1UK4A 1KXDA 1N8OB 1O2LA 2XBVA 2PKSB 1ABJH 4JZFH 2NU0E 1C5TA 1Z6JH 2ZG0H 2A4GA 1NRNH 2XC5A 4K1TA 4JZ1A 2VGCB 4K3JA 2CHAB 3VPKA 5A8ZA 3PV5A 3L33A 4Y11E 4YT6H 3RP2A 7GCHF 3UQOA 3Q77A 3A81A 2HGTH 2EEKA 2QA9E 3V13A 1K21H 1SGPE 3UQVA 3MU5A 1FMGA 4MLFB 1P10A 2QGRA 1DWBH 2Z7FE 1ZTJA 2J94A 1GI5A 4NIYA 4Q63A 1GBTA 1J14A 2ZHWH 3B8JA 2BD7A 3LC3A 2V3OH 1ESAA 1GBMA 2ZI2H 1F0UA 3GCOA 1C2LA 5HMAA 4H6TA 3MNCA 4DY7B 1O3JA 1O3BA 3NCLA 1DVAH 1F7ZA 4X0WU 1KXAA 1CHOF 2PKAA 1L1JA 2ZHQH 4VGCB 4X8VH 1PYTD 4AYVB 4GAWA 5HGGA 3VG8A 1FY5A 1HXEH 1C1OA 4XE4A 1C5UA 2C93B 5EPYA 2DE9A 2ZZUH 1W11U 2H9HA 3A84A 1ZSKA 4CRAA 1KDQA 3KHVA 1C1WH 1UTLM 2F9BH 3KQBA 1A61H 3ZZAA 1HAVA 4WXIA 3P8GA 5A2MH 1IAUA 4Y0YE 1GJBB 1YPHC 3MOCA 4AGJA 2O9QA 2ANYA 4P00A 3RXGA 3TITA 1VCWA 1D4PB 4BAQB 2QF5A 4MPWA 1AY6H 1ELBA 2Y80A 1O5EH 1V2LT 5EW2H 1BA8B 1FAKH 1S0RA 1INCA 1SGTA 2XCNA 4MDSA 4Q7XA 2JETB 3GCTG 1GVLA 2PFEA 5E0GA 3TGJE 2BQ7B 3DFLA 1C2GA 1CBWB 1IQNA 1W13U 3M5OA 2HALA 4I32A 4A1TA 1GHBG 3F2HA 2OLGA 3DCLA 1O30A 1SGQE 1WU1A 2YNBA 5FPSA 4INHA 1C5ZB 2GV7A 2V0BA 2FI3E 5EGMA 1LVMA 2CV3A 4AX9H 6GCHF 2PKAB 3K2UA 3A8BA 3PMBB 4DURA 1BB0B 2FP7B 2G00A 5JBTA 1ESTA 3KYGA 5F8XA 2BY9X 3ZV9A 4X1QU 1G2MA 4GSOA 1KDQB 1FY8E 3VB3A 1F5RA 2OINA 1HAVB 2W3KA 3A7TA 3T5FH 3MNXA 1CE5A 2J38A 4ZKRU 3TK9A 2ZIQH 1C9PA 2AS9A 1TWXB 1UVSH 3LPRA 3OEHD 1EJAA 1RTFB 1HJ8A 4WMFA 5FCKA 1HJ9A 4B2CA 2IPHA 4ZHMU 1XUFA 3UR9A 1SSXA 2ZKSA 3MU1A 1N6YA 1RTLA 3UWJH 1JIMA 5LH8A 1QJ1B 1TIOA 3RXSA 3RXRA 3STIA 1EP5A 1K1OA 1MTNC 1FX0B 3UNSA 3SV7A 2F83A 1ZTLA 1BRBE 1ID5H 3CP7A 1NY22 1P03A 1OPHB 2ASUB 1E1QD 2BMGB 1W12U 3M36A 4YOGA 4AFUA 1C5MD 2SGAA 4KP0A 1G3DA 1O35A 2EQNA 1CSOE 3EGKH 1DM4B 4TT3D 1QA7A 4BANB 1QL9A 3H09A 3OFND 1QL8A 1C5NH 1J8AA 1EJNA 1EPTC 1T8LA 1A46H 7GCHG 5EJLA 3ZZ9A 5JBBS 2Y7XA 1P0SH 3TNTA 4JK6A 4D9QA 2A5AA 5C2ZA 3RXQA 1UCYH 1ZMLA 2ZTZA 1MCVA 2WINI 2PTNA 1BUIA 1FQ3A 1BBRK 1F2SE 2OCVB 1EJMA 3U1JB 2GJGA 2R3YA 5GIBA 4NIXA 4BAHB 4X1SU 3LU9B 3SU1A 2ZFRH 4ACBA 3BTHE 3ELAH 2W5EA 1GL1A 3SU6A 1DPOA 2KAIA 1CHOG 4KTUA 4RN6A 1N1LA 3TLOA 1BJVA 1TABE 4E7RG 3AVZA 3DD2H 2D8WA 3TJUA 2RG3A 3FANA 3F0PA 5TCCA 2ZQ1A 3TH3H 5EJZA 3RM0H 2ZC9H 3S7KB 1NU7B 4E06H 3TVJB 1O3PB 2H5CA 1C2DA 2BXUH 3ZVEA 1O38A 2LNCA 3KQDA 4ABHA 1EFRD 2WPDD 1ZR0A 2QF4A 1O2NA 2J92A 5EXMA 1AFEH 3P8OA 1AZ8A 2FI4E 1QB9A 5PTPA 1P02A 3OYPA 1C2HA 4ABIA 1NTPA 4IGDA 1D3DB 3F6UH 1DY9A 2ZGXH 5C67A 2A45B 4AFQA 5HYOA 3BTEE 1H8HD 2BD8A 1AWFH 1B0EA 5GDSH 1UJ1A 3FAOA 2PWXA 3GDVA 1YPLH 5C1XA 1XUIA 4FUHA 5A0CA 2WYGA 5EOKA 2AGIX 4Q7ZA 4X8TH 2FOGA 1DWEH 2VB0A 2JJ2D 2GT8A 3VB4A 4HGCA 3SHCH 4XDEA 3BTDE 1UMAH 5F03A 2KAIB 3WY8A 6GCHG 5EU8A 2XCFA 1AMHA 2PUQH 3E1XB 4MPVA 3URCA 1BTPA 1Z1IA 2R2WU 1C2MA 2BOKA 2L74A 4NWLA 1H9LB 8LPRA 2AERH 1C2FA 1MQ5A 1L0ZA 4CRFA 1WAYB 2UWPA 1BMFD 1RD3B 1GDQA 5EJ1A 1NBMD 1DSTA 4U30A 4NIWA 3BTME 5KGOA 3SUFA 1Z7KA 4FUBA 1XMNB 1OOKB 4Y8ZA 3M5NA 4ABDA 2OQUA 2RFKC 1TB6H 1ANEA 2XXLA 2AMPA 4UONA 4MNWA 3B23B 4HZHA 1FIWA 3EAJA 1V2RT 3L6PA 1G37A 1F0SA 3S7HB 1G9IE 1ZRBA 4BAOB 5HXFA 2HLDD 5DGJA 5C20A 2FMJA 2CMYA 2NU4E 1HB0B 1NRPH 1Q31A 3BIVH 3PM3A 3D23A 5ESTE 2WV5A 1JIRA 1AN1E 3ZZBA 2IOTA 4ZKOU 1DLKB 4BNRA 2R9PA 3A82A 4FUIA 4WY3A 1C1TA 2FX4A 4MPUA 1GMHF 2KM0A 4ZUHA 2XTTB 3QWCH 1EZQA 4A7IB 3QN7A 4X6OA 4JMYA 3RDZA 3A89A 5DSFA 4CHAB 3SGQE 1HAHH 1DE7H 1HXFH 1Z71A 5JBAS 1ANBA 1MQ6A 5GNDA 1TPPA 1SC8U 2VNTA 1P2NA 3RU4T 3PO1B 2KCAA 2JH5D 1RGQA 3SQEE 1CGJE 2V6NA 4AFSA 4B1TA 1C4Y2 3EDXB 1YPGH 1D3PB 1TA2A 1P04A 1N6XA 1VGCC 1O31A 2QF3A 3FZZA 3MH4A 1S82A 4E05H 1WDIA 1ZHMA 1D3QB 5DPAA 2KX4A 6CHAB 4JZEH 1EUFA 3ZZ7A 3EE0B 1TX7A 2Q6FA 4FUDA 3WWBA 3LOXA 1QNJA 3EA9A 1Y3VA 1SB1H 2ZF0H 3BIUH 3NK8A 1P12E 2ZFPH 4NZQA 3NWUA 1A0HB 2M2AA 1LPZB 1O2TA 2ZP0H 5I46H 1ARBA 3RXAA 4BXSA 3K6YA 1TLDA 3I29A 1DITH 2AYWA 3RU4E 2F9VA 2HNTF 1J17T 1H4WA 5DP3A 2THFB 3A87A 2UWLA 2IJD1 3SV9A 2V3HH 2AHME 2BOHB 3GYLB 4FVBA 3M61U 1TONA 2G81E 1HNEE 4AN7A 3F9HA 2AH4X 1LHCH 3KYFA 3HATH 5A0AE 1CHGA 5DP5A 2BY7X 1P9SA 3HKIB 1SR5C 5FBEA 3T2NA 4I8GA 5F6MA 2TBSA 1G30B 4AORA 1GGDB 4TY6A 1GBFA 1SHYA 2TPIZ 4YM9A 1O2RA 1C5SA 1FXYA 1QGFA 2ZECA 3BEIB 2IPQX 3W94A 1CA0B 1UTNA 1EAIA 4KELA 1FY4A 2TGAA 3E16B 1XUGA 1O3EA 1P3EA 3VGCC 4D8NA 2QXJA 1CGHA 1VR1H 4Y8XA 3U1IB 1PQ8A 2AGGX 1AO5A 1XKBC 3MTYA 4U32A 5L30H 1TGNA 2WV4A 3RC5A 1SI5H 2CXVA 2UWOA 5C1UA 4A1VA 1O37A 1O3AA 5AHGH 4INKA 1CA0C 1XUHA 4IW4E 3MU4A 4BOHA 1UTMA 3TH4H 1NFYA 4ZAEA 3SW2B 5JPMH 5E0HA 1ELTA 1GCTB 3NRLA 1C5RA 2P8OB 1S0QA 1B5GH 1F92A 4F55A 1BITA 1LHFH 4U2WA 1MUEB 1DDJA 1EASA 2V7QD 1NESE 4I31A 1QY6A 4IBLH 3RC4A 4NA7A 3LGVA 1WYKA 1QBNA 4M7GA 2OTVA 2GDDA 2WSSD 1OWJA 1ELCA 1GI9B 1S5SA 1MU8B 1ZJKA 4P02A 1P9UA 2GZ8A 1PQ5A 7ESTE 1ZOMA 1D9IA 5CDFE 1P11E 2W6ID 4IMQA 4MPXA 1UO6A 3AW0A 4BTUB 2O8MA 2CGAA 4ZKSU 2M5TA 1FJSA 1K1NA 3MHWU 1ANDA 5C1YA 3GY5A 1K22H 2BB4A 3O8RA 1P57B 1YYY1 2B5TB 5FBIA 3BEFB 1GMDF 1TQ7B
chains in the Genus database with same CATH topology
1DFPA 4YO9A 3KF2A 1RIWB 1GMHG 4J2YB 2BM2A 4OS2A 4A1XA 1GDUA 1H8DH 1RRKA 1S6HA 5CHAC 1OP2A 3D62A 2XC0A 1BBRE 1HAZB 3SUDA 3ODDA 1W2KH 1DWDH 1T7CA 3ZZ4A 2ANMH 2HLCA 5FAHA 2PGQB 1AU8A 1SLUB 4OS6A 1VJAU 4NGAH 1LQEA 3KIDU 2WUCA 3U9AH 3UNQA 1O5GH 1DWCH 1V2NT 4UFDH 4Y6DA 2Z9GA 1AI8H 5L2ZH 4X6NA 3I78A 2ESTE 1XKAC 1ETSH 3RC6A 1ZLRA 1WSSH 3O8BA 3PMJA 2PV9B 2BYAX 1Z6EA 2P59A 2XNIA 2SGFE 1GCDA 3FZDA 1BOQA 5J4SA 1W7XH 1DY8A 4ASHA 2ZFSA 1BTUA 3MFJA 3FP6E 2PLXA 3G01A 4THNH 1T32A 4OS1A 3VB6A 1TOMH 1V3XA 3PTNA 1HAOH 5F8ZA 1SGCA 1V2ST 4XSKU 1C2JA 4I7YH 4RKJB 3A8AA 2YOLA 2OC8A 1FY3A 2FYQA 2ZHDA 1ZHPA 4CH8B 2GMTB 1W3CA 1ZPBA 3HGPA 2BD3A 5E0JA 2EI6A 1N8OC 1V2JT 2PKSC 3TH2H 3E90B 2XYAA 1KTTB 4MQAA 1ESBA 1MKWK 2ZEBA 2OC1A 2VGCC 2C3SA 1OKXA 1WUNH 1QFKH 1ZSLA 2FO9A 2FS8A 2CHAC 1DOJA 3CENA 2BZ6H 1L1NA 1TNJA 1JOUB 3EQ0H 5T6FA 2BY6X 2J9NA 1WV7H 1GI7B 2ZHEH 4O03A 1O2SA 4B2BA 1FN8A 2ZU5A 5AVDA 3ZYDA 4B2AA 3BG4B 2OD3B 3RXDA 4WMEA 2BZAA 3O8CA 2G5NA 2Z9LA 3Q3KA 3F9FA 4I8JA 1FN6A 4F4OC 1B0FA 1TBQH 2HVXA 1TMTH 4X1RU 8ESTE 1NO9H 1PJPA 1XXDA 3SU4A 3M35A 3QDZB 4Y8YA 2HPQH 4TPIZ 4UFGH 1TE0A 2AEIH 2AMDA 1HRTH 2BD9A 1AFQB 4TWWA 1WCZA 1O2XA 3BG4C 4CR9A 1A2CH 1QR3E 4MNXA 1KSNA 2BLVA 1TBRH 2Y82A 3BEUA 4H6SB 4VGCC 5ETXA 1Y59T 1NROH 1JRSA 4A6LA 3BTTE 1O5BB 3AAUA 3T29A 4R0IA 1YPHE 4X2XA 3PLPA 1GJ8B 2H9EH 3TU7H 3A7ZA 2VIPA 1A5GH 3SNDA 1HYLA 3UFAA 4JYTA 3R3GB 1OWHA 3MH5A 2FLBH 2NWNA 2PSYA 5EG4A 2R0LA 4OGYA 1TGSZ 4YZUA 2FS9A 2VWNA 3LIWA 1UTOA 1LPGB 3U8RH 1BQYA 2JETC 2GGVB 2FOAA 5DP9A 4KTCA 4Y0ZE 1C1NA 1GI0A 1EZXC 1C1SA 1GMDG 1QQUA 2Z6BD 3DT0H 5DP7A 3KN2A 4NZLA 2TGDA 2BX4A 2BDGA 5K7RA 1CBWC 2GX4A 1F5LA 1FLEE 2QXGA 1A4WH 1OYQA 1ZZZA 3P70B 4BTTB 1PYTC 3A7VA 4I8HA 5G4BA 2OQ5A 6LPRA 2G5VA 4K8YA 4LOYH 1GJ9B 2PUXB 2OBOA 1YPEH 1P01A 3BTWE 4IS5A 3CS7A 2H1UA 2ZNKH 5SGAE 1HFDA 3PLKA 3C1KA 1J9CH 1NN6A 2VVUA 4XOJA 1TMBH 1FI8A 4K8BA 2H2ZA 1P2IA 3T62A 4CR5A 4K1SA 1O36A 1NZQH 2BVRH 5EQSA 1EZUC 3BTQE 1TOCB 1GBEA 2GD4B 4GUXA 4DCDA 1JRTA 3GCHB 2FOCA 1IQIA 2Q1JA 1KLIH 5CMXH 5BRRE 1FIZA 2ZU3A 1NFWA 1IQLA 1G3BA 1GBJA 2FOHA 1BIOA 3UNRA 1EOJA 9ESTA 2TGPZ 5DK1A 1B7XB 3F68H 4AB8A 5L2YH 2PTCE 1O2QA 2JH6D 1OWIA 4ABBA 3MMGA 3F1SB 4HTCH 4YESB 2FOBA 3GY8A 5EODA 2ZTYA 1FV9A 1U6QA 1ETTH 2BD4A 3GOVB 1PQ7A 3VB5A 4D76A 1FONA 4NG9H 3U98H 4CBOA 5HM9A 4X8SH 1AZZA 3UUZA 3SV2H 4CRGA 1AKSA 4ZMAH 4RSPA 2BDCA 2ZU1A 1DXWA 1O2VA 1Y5BT 4DIHH 4B76A 4O3TA 1TA6A 2WPMS 3QUMP 4U01A 1O32A 2BDYA 1EXFA 4LK4A 3ZVCA 1JMOH 1THSH 1AE5A 5GWZA 4X6MA 5EPNA 1F5KU 2GZ9A 2ALVA 5A09A 4ISNA 1QJ7B 1SOTA 2ZA5A 3ZVAA 1V6DA 1O2WA 2PSXA 1MMJN 5F8TA 2J2UA 1O5DH 2VINA 4ABGA 3PV4A 3OSYA 2B9LA 1SG8B 5FHTA 1V2KT 2FLRH 1K28D 2QAAA 1LHEH 1MKXK 4K1EA 4ZHAA 1HV7A 2A2QH 2I6QA 1GHZA 7LPRA 1WQSA 2ALPA 3BV9B 3ZV8A 2J4IA 3IWMA 4MTBA 1FPHH 2GTBA 3EA7A 2ZU4A 3PMHB 2VWLA 1SGNE 2SGDE 3KEEA 3UOPA 1O3DA 1RTKA 3SN8A 5GPIB 1EX3A 1YC0A 2QY0B 1Y3UA 4KGAA 4UEHH 1MKWH 1SFIA 2EC9H 3ATWA 1PPEE 2FIRH 2A4RA 3QGNB 3RXEA 1AKSB 3UREA 2ZPSA 1Q2WA 1GJAB 2NU1E 1AGJA 2BQWB 1ETRH 1LHGH 4FXGH 1GJ4H 3ZZ5A 1NU9A 1MAYA 2F3CE 2VJ1A 4Z0KA 8GCHF 1C4V2 1OP8A 2W26A 4Y79A 1UCYE 3A83A 4FVDA 2BXTH 2G51A 1QTFA 3SU3A 1QHRB 1MD7A 2GCTB 1A3BH 3ZZ3A 1OX1A 1CT4E 1YPKH 3LONA 1GI2A 3SU2A 3ITIA 1ZPCA 1T31A 3M5LA 3E91A 1ELDE 1PPBH 4GHQA 1FNIA 2A31A 1ORFA 2TGTA 3SNBA 3BTGE 5DO4H 2GZ7A 3SV6A 2BQ6B 2OUAA 4Y7AA 1T4UH 1BT7A 1TGCA 2HNTC 1LDTT 1O2GH 3T28A 2GDEH 4DT7B 1QB6A 1ZMNA 1Y3YA 2P93A 3SNAA 1EOLA 4YOJA 2QF0A 4DOQA 1IQMA 4AYYB 2G4TA 3NZIA 3V7TA 1ZYOA 3UOUA 3RU4D 1GI1A 4GHTA 2RDLA 4GLYA 4IN1A 2NU3E 4NA8A 3SJ8A 1T8NA 1NM6A 2QV1A 5FPTA 2Z3DA 1SGDE 1MTSA 1K1PA 2R2MB 1GG6B 4NA9H 4ZXXH 1V2VT 1O5AB 5GCHF 2QYIA 1AVWA 5A0BA 2A32A 3SQHE 3E8LA 1GBHA 1BRUP 3S9BA 1TX8A 1BJUA 3GICB 3GDUA 4WWYA 3SI4H 2IJOB 5J4QA 3M3TA 1O0DH 5EQRA 2J34A 1S83A 2Z9KA 1EAUA 1O3CA 1C2EA 2HPPH 5LPFA 4ZROA 3SJKA 1O5FH 2F9OA 3RXLA 1CO7E 1K1JA 1V2OT 2ZFTA 4Y10E 4CH2B 1C5LH 4WH8A 3SU0A 2EI7A 4YT7H 3SNCA 4CHAC 4X6PA 1EB1H 5B6OA 1XUKA 4DJZB 3V3MA 1UVTH 3Q76A 2Y6TA 4NWKA 4X8UH 2VIWA 2ZCKP 3PO1C 2Z9IA 2XC4A 1LPKB 2Y5FA 1O2OA 4DGJA 1MTWA 1FDPA 1ELGA 6CHAC 1DXPA 2XWAA 2P3FH 5T3HA 3HPTB 3P6ZB 1LO6A 3F9GA 1QRZA 3LJJA 4X2YA 3LGYA 5IDKA 3DA9B 1E38B 1MBQA 2ULLA 2C4FH 3ZZ8A 1A0LA 2FZZA 2W3IA 1HJAB 1C5YB 4Y71A 2BDIA 3BSQA 1TRNA 3FP8E 4FUGA 1NRSH 3KQCA 1HPGA 3LT3A 1O2MA 1LMWB 2A2XH 1ZHRA 1GJCB 1A3EH 2OP9A 2QN5T 2FWWA 1DUAA 1S6FA 2Q6GA 2F9PA 3H7OA 1BMNH 5C3NA 4Q80A 4DW2U 3Q3YA 3UY9A 1GVZA 1QBOA 2LPRA 6ESTA 1QJ6B 1TNKA 4IC6A 4X2VA 5AFZH 3SZNA 2ZWLH 4JYUH 1A5IA 1O2PA 5LPRA 1RS0A 5DJ7A 1GGDC 1P09A 1IQFA 3TIUA 3RXHA 2H9TH 4B75A 2P3TB 1AIXH 1MCTA 8GCHG 3SU5A 1P2MA 4AOQA 2VIQA 1LVBA 1O2KA 1UTPA 1WQVH 1AUJA 4IMZA 1VITH 1O3KA 3FP7E 4DG4A 5E2PA 5LPEA 3MU8A 2EA3A 3A86A 3MNBA 2ODQA 2WPLS 1TNLA 3ODFA 3SO3A 3TJOA 1GI8B 1MKXH 3U69H 4WXVA 1BMAA 1D3TB 1LVYA 4OGXA 1NFUA 5FXLA 2AGEX 3NPSA 2QXHA 3QZRA 2STAE 3T27A 1GVKB 3TK5A 1O3LA 1GBLA 2A1DB 5C5OA 1TQ0B 4MVNA 4FU9A 1DLEA 4UD9H 1GCTC 1HAPH 3SBKA 1EB2A 2P8OC 1C5VA 1O2UA 5I25A 1LKAA 3SJIA 1V2WT 3BN9A 3T26A 2WUBA 1T4VH 3R0FA 1KXFA 1DSUA 2XBXA 1GJ7B 3B9FH 3KQEA 1K9OE 1THRH 1DICA 4NFFA 1Y8TA 4OS5A 2YNAA 1P2OA 5GCHG 3QO6A 1SGFA 1EQ9A 4Q2KA 2HRVA 3LGTA 3M7TA 4ISHH 2SFAA 2UUJB 4FUEA 1Y3WA 2CF8H 3MO6A 2C90B 2Z94A 1V2PT 3AW1A 1EKBB 1UHBA 1FY1A 1CU1A 1C4U2 3SGBE 3OTJE 1RIWC 3E0NB 5HM2A 3D49H 1XVOA 1SGRE 1ACBE 2BVSH 1Z8IB 3OX7U 1EP6A 2FEQH 2ZDLA 4JZDH 1TX6A 3DFJA 4PROA 1W14U 3M5MA 1AVXA 3QGJA 5GJ4B 4ABAA 3ZVFA 3PWBA 5T6DA 4OS4A 1SQAA 3URDA 1HAYB 2FDAA 1KXEA 1P06A 3RXBA 1THPB 4X1NU 2O8LA 1NRQH 2FOFA 3TPIZ 1H9HE 1JBUH 1UTJA 3ENSB 3U8TH 1LTOA 5L6NH 1BDAA 2ZDNA 3RXTA 2GT7A 1FZZA 4QT8C 4O3UA 1P2JA 4CRDA 3HK3B 1GJ6A 3VXFH 1SGYE 1DT2A 5DP6A 4K5ZA 1GI4A 4XFQA 3HK6B 1KYNA 1YCPK 4RKOB 2ZDMA 3PLBA 3TK6A 1SLVB 3QZQA 1QB1A 3UIRA 5DG6A 3TGIE 2A7HA 1UHBB 4Z6AH 2BLWA 2GMTC 1BTWA 1O3GA 3OY6U 1GMCF 1FPCH 4IN2A 1FUJA 1GJDB 1W0YH 1O39A 4YOIA 2DUCA 2C8ZB 1MU6B 3MO9A 1BMLA 2CF9H 1VITF 3K9XB 3T25A 3RMLH 1PPZA 4AZ2B 1A1RA 3LH3A 1ANCA 3C27B 1UTKA 1YLCA 4SGBE 3A7YA 2TRMA 1GHYH 4INLA 4ABFA 2D26C 1BTXA 4YLQH 3P95A 2PW8H 2ZCHP 2FOMB 4FU7A 1MTUA 2A5KA 3GY2A 2FPZA 4AB9A 3E6PH 3Q3XA 1OXGA 1MH0A 1L1GA 1EATA 3QTVH 2BLQA 5IYTA 1OS8A 4BAMB 2P95A 1YBWA 5JBCS 2ZDKA 4GVUA 3E0PB 2J95A 4H4FA 2ZGCA 4NSVA 1DX5M 1SBWA 4JYVH 2FTMA 1E37B 2BHGA 3ATKA 2DE8A 3MNSA 5LGOA 1CT0E 1DANH 1ZMJA 2ZQ2A 2PHBA 1YM0A 2FI5E 4HFPB 1W0ZU 1WBGB 4UFEH 1G3EA 1J15A 1GBAA 1AFQC 1QURH 4WH6A 2ZFQH 1MZAA 4JK5A 1TFXA 1KXBA 1GBKA 5CE1A 5EQQA 1KTSB 2ZCLP 3SORA 1KLTA 1O5CB 1A0JA 3KL6A 2BD2A 1D6WA 1UK3A 4NSYA 3AAVA 1GBBA 1ZJDA 4JZIA 2A7CA 3HKJB 4DVAU 1EPTA 4TY7A 2JH0D 1NC6A 3P8FA 4OS7A 1NRRH 2VIDA 4K60A 4TWYA 2WPJS 1K1MA 5A8XA 4CRBA 1ELFA 1YLDA 2BVXH 4GPGA 2BDAA 2SGPE 2GCHF 2QIQA 1MAXA 4K2YA 1C1RA 1BRCE 2Y5GA 3I77A 3RLWH 7KMEH 3S9CA 3RXFA 4BAKB 2BTCE 3RXCA 2VWOA 3MU0A 1QRWA 1IQKA 4YLUA 1ZGVA 4A92A 4WF8A 3V0XA 3SNEA 1HAGE 3BF6H 3GY7A 1DUEA 1SGIB 1BTHH 4R8TB 1Y3XA 3STJA 3FVFB 1LVOA 5FX5A 1PPCE 1EZSC 2BY8X 2XWBI 1H9IE 1HGTH 1MTNB 1TBZH 3S9AA 2GKVE 2JKHA 1SQOA 2FXRA 3A88A 1HAIH 1O2ZA 1EAWA 3LJOA 4HI3A 5C5NA 5ABWA 1AB9B 3GCNA 1L4ZA 2D2DA 3VB7A 3U8OH 1W8BH 1C5WB 1MTVA 3SJOA 1AQ7A 2XW9A 3SJ9A 3RM2H 1MD8A 1ZPZA 1GHAF 1D6RA 2QCYA 1EPTB 1KY9A 3GCHC 4UE7H 1IQGA 2OC7A 3M3VA 2WPKS 1Z1JA 2HWLB 4ZKNU 5TCAA 1ELAA 2VVVA 1GI3A 2STBE 4X1PU 1AB9C 3A85A 1GHWH 1IQEA 2ODYB 3DHKH 5ESBA 2B0FA 4B71A 2K1QA 1ELEE 4TPYA 2Y7ZA 3P92A 2C8YB 4CRCA 1V2UT 4D7GA 2C8XB 3O8DA 1O3NA 2ZO3H 3M37A 1T8MA 1GMCG 2FM2A 2AIPA 4KTSA 4A5TS 3RXMA 1X7AC 1HBTH 2Y81A 2FESH 2HOBA 1VITG 4TYDA 1WTHD 2AMQA 2QC2A 1LCYA 1TGBA 1AUTC 2WPIS 1CVWH 3JZ1B 1YKTA 2OXSA 1V2MT 1PFXC 3IG6B 1SFQB 3EA8A 3QLPH 1Z8RA 2RA3A 4ABEA 4NFEA 1GHVH 4AG2A 2C8WB 4I33A 1E35B 2G8TA 3OY5U 1ZSJA 1XXFA 2R3UA 3L3TA 1AHTH 3FFGA 2A4OA 4CBNA 1SVPA 3PYHA 3M7QA 1A7SA 1OP0A 1SHHB 1UVOA 1TPSA 1XM1A 2ILNA 3TNSA 1C1MA 1SQTA 1HIAA 2UUFB 2W7UA 4I8KA