5A8ZA

Crystal structure of human neutrophil elastase in complex with a dihydropyrimidone inhibitor
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
218
structure length
215
Chain Sequence
IVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil elastase
publication title Potent and Selective Human Neutrophil Elastase Inhibitors with Novel Equatorial Ring Topology: in vivo Efficacy of the Polar Pyrimidopyridazine BAY-8040 in a Pulmonary Arterial Hypertension Rat Model.
pubmed doi rcsb
molecule tags Hydrolase
total genus 42
structure length 215
sequence length 218
ec nomenclature ec 3.4.21.37: Leukocyte elastase.
pdb deposition date 2015-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5a8zA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5a8zA02
1ZRKA 2W5EA 4ZHMU 3ZYDA 1OKXA 1GBAA 1L1JA 2P16A 2WPMS 1OOKB 3SQHE 3RC6A 3T5FH 4CRAA 1O3HA 4AORA 2Z7FE 3GDVA 5DP8A 5HYOA 2GGVB 1GJ6A 2ZU5A 4IN1A 2PLXA 2BQ6B 2R0KA 2ZCLP 3A82A 1HAZB 1TRNA 1UK2A 3GYLB 1AZ8A 3T26A 3UOUA 2WINI 1MZAA 5JB9S 1EZQA 3UR9A 4ZHAA 2GD4B 1P11E 4NZLA 1EZUC 2O8TA 5SGAE 1TNIA 1TIOA 1TMTH 5TJXA 1XKAC 5T6FA 2BY8X 4AOQA 1XUFA 3BSQA 1SGYE 3RU4T 2IPHA 3FP8E 1GMHG 2TBSA 1Y5AT 3TGKE 1LQDB 5BRRE 1S83A 1JXPA 1W7GH 4X8TH 1S5SA 5G4BA 3K9XB 2G00A 4XSKU 1YPLH 1V2ST 3G01A 4GAWA 3U1JB 1MCTA 3H7OA 3UPEA 5B6OA 5L2ZH 2VWOA 3B8JA 4I33A 4ZKNU 3O8RA 3FANA 1O3CA 3KN2A 2GT8A 4CRGA 4XOJA 1WBGB 3SU2A 4I32A 2D26C 1VCWA 3D23A 3BTDE 1GL1A 4OGYA 1MTNC 2PKSB 5C1UA 3SUFA 4O03A 2GTBA 2C90B 1O2NA 1NS3A 3AW0A 2UWLA 2TRMA 3LGVA 3STIA 2QXJA 1T4UH 2GZ8A 4ISOA 4YO9A 1XUGA 3MU8A 1F7ZA 1NT1A 2BDYA 1G2LA 3Q3XA 2Q6GA 1UK3A 1MD7A 2Y81A 3M5OA 4Q2KA 2Y82A 1AWFH 1BITA 4UFGH 4BAOB 4KTUA 1GCDA 5IYTA 2ZP0H 2HLCA 3TJOA 2JETC 2FI4E 3NZIA 1BT7A 4IS5A 3SJKA 3ENSB 4GCHG 1AWHB 4X2WA 2BY7X 4CR5A 4AYYB 4AFZA 1GVKB 1EUFA 3ZZDA 4A1XA 1X7AC 5DP9A 5E2PA 1RGQA 4B74A 1QRXA 3A7TA 2BY9X 3M36A 1HJAC 1Q3XA 1RTFB 4K1EA 3BTTE 3ZVAA 2WYJA 1YLDA 1O2TA 3M5LA 3PLKA 1O31A 4NIXA 1EB2A 2C8WB 4FUJA 3Q00A 4Y0YE 3ZZ4A 1HGTH 1OWIA 1EJMA 1MD8A 2F83A 2W3KA 5JBTA 1C5OH 1MTUA 2P93A 1FY1A 1YP9A 1CHGA 3GCTF 2Y80A 2ANKH 2OC7A 2XWBI 3K6ZA 1NY22 2BX3A 2R2WU 4BAQB 1O3DA 4NIYA 3ZZ8A 1DWBH 3O8DA 2F9BH 4TY6A 4ABHA 2ZDMA 1V2WT 1UVOA 1LHCH 1XUIA 1P2QA 1P8VC 3SV6A 2ZWLH 2FOGA 2PKAA 2V3OH 4D9RA 4RKJB 2FPZA 1G9IE 2ZECA 2XC0A 5GWZA 2AIQA 1XKBC 2EEKA 1O5BB 4XDEA 1F5KU 3PLPA 4FU7A 2ZFRH 2FOHA 3GY4A 1DY8A 1BMLA 4K8BA 1CO7E 2GDEH 3MO3A 1SL3A 7ESTE 2AMPA 3UWJH 5DP4A 2BDCA 3U69H 4JK6A 3F68H 5F8XA 4ZXXH 3LH3A 4B2CA 1UK4A 1AHTH 2BDBA 3QO6A 2CV3A 1DFPA 1PPFE 2BY6X 1SLVB 3MU1A 3EDXB 5C1XA 1OPHB 4AB9A 5E8EH 1AFQC 5HGGA 4A1VA 5DO4H 1HAIH 1O3NA 4UFDH 1HUTH 2O9QA 3KHVA 1A5IA 2AMQA 3BTME 5C5OA 3UNSA 1GMHF 2BVSH 1UTQA 4XBBA 1W2KH 1O35A 3KQDA 2GCTB 3LGIA 2ZNKH 2DUCA 4U32A 1P10A 2YNBA 3E1XB 3ODDA 1VR1H 5A8YA 1CT2E 8GCHG 1LTOA 4ZKRU 3MYWA 2FLBH 4CRBA 1BTWA 5DP3A 3ZYEA 2VVVA 6GCHG 1BJVA 1GDNA 4WY3A 1CA0C 1LHGH 2ZHQH 1TGNA 2H5DA 3ODFA 3DA9B 4HTCH 3SQEE 8LPRA 1QY6A 3NWUA 2A7HA 3PMBB 1SLUB 2G8TA 1A4WH 4IBLH 2FOEA 5JBAS 2A4RA 1O3MA 1BTHH 5A09A 5CHAC 4I31A 2BTCE 5JBBS 1TALA 1UTPA 2BHGA 2QY0B 5ESTE 2VIPA 2PTCE 1TE0A 1GI5A 2VINA 2A5KA 1P09A 4WXIA 1IQLA 3EGKH 3OY6U 4AGJA 1FIWA 4DIHH 1CT0E 2B9LA 1BJUA 1DS2E 3SI4H 1SPJA 1TGSZ 4GCHF 2P3UB 1W7XH 4TWWA 3SU3A 2KAIA 1IQEA 1GBMA 1TRMA 3PTNA 2AFQB 2OLGA 1MKWK 5FXLA 4CR9A 1TNKA 3RP2A 1GJBB 4ABJA 2PKAB 3T62A 9LPRA 1HV7A 3DD2H 3PWCA 2FOFA 1KLTA 4GPGA 1GBBA 1EB1H 2FTLE 4X1QU 1HPGA 4MNYA 5L6NH 1GI6A 5C3NA 1P01A 3JZ1B 1CBWB 4BOHA 1Y5UT 1N6YA 1HAPH 1BB0B 2C4FH 3ZVFA 3SV9A 1KDQA 4DY7B 4U2WA 5F03A 4ESTE 1VCQA 2O8LA 1ZJKA 3A80A 1SGDE 2H2ZA 4BXWA 1O5AB 3A87A 5EPNA 2ZQ2A 2UUKB 4WMFA 1K1JA 4LZ4B 2G5VA 3RXRA 4GLYA 4JYUH 1Q2WA 1VGCB 5JPMH 1TBRH 1O2RA 2ZCKP 3RXHA 2TGDA 3S9BA 1CVWH 4Y7BA 3LC3A 2J9NA 1MMJN 2ANWA 2XBYA 1H9IE 1UTMA 3LIWA 3SOSA 7GCHG 4UFFH 1Z71A 4ISNA 2BD4A 5A0AE 4KKDA 3M7TA 3S69A 1T4VH 2VIVA 1CGHA 2ZG0H 3QK1A 1SGQE 3BV9B 1S81A 3A85A 1DUEA 1AGJA 3MO9A 2OTVA 3QDZB 3AAUA 1BA8B 2ANMH 1EZSC 2B0FA 5C20A 1IQKA 3TGJE 3EAJA 2XYAA 1MU6B 3A89A 1SGFG 3RXGA 3TJVA 2BD3A 1ORFA 2H1UA 5T3HA 1BOQA 1QNJA 1O5CB 3RM2H 4AB8A 3O8CA 1L0ZA 4MG3A 3MTYA 1MUEB 2PGQB 1P2IA 2FX6A 1HYLA 1LVOA 1HFDA 3SV8A 3PMHB 1DXPA 3DUXH 1P2MA 1V2JT 4MNWA 1XM1A 3M37A 4BNRA 3SZNA 1F92A 2P3TB 3MWIU 1ARCA 4JYVH 4O3UA 1C5UA 2J2UA 1O2UA 1W3CA 2ZKSA 8GCHF 1JIRA 4B73A 1KXEA 2JH6D 2AIPA 3A7XA 1KXCA 1SOZA 1K1NA 1SGEE 1MAXA 4IN2A 6GCHF 2BXTH 2BVRH 1ZGIA 3GY6A 2ODYB 1HAYB 1BRUP 1HIAA 4K1TA 2YOLA 2Z3CA 1O37A 1ZYOA 2STAE 1WU1A 1IQFA 2KAIB 4TWYA 1LMWB 1GHWH 3ZVCA 4CH2B 1BBRE 1QL7A 4FUEA 5C2ZA 2OBQA 1NRRH 3Q3YA 4I7YH 3BG4B 2OC1A 2QXIA 2V0BA 3FAOA 1GGDB 1HRTH 3HGNA 5L2YH 4IW4E 4UEHH 1ZHRA 1G32B 1Y3WA 1T8OA 2B5TB 1G30B 3AW1A 1ESBA 3P70B 1TGCA 2Z9JA 3SNCA 1KDQB 4SGAE 1O3GA 1RRKA 4NGAH 4ABBA 3LGYA 1A1RA 3A8CA 1IQHA 1O3EA 2J95A 4A7IB 1SFIA 1BCUH 2QC2A 1C2DA 3EA7A 1H4WA 3BF6H 1MKXH 1UTLM 1BMMH 1DSTA 4IGDA 5AF9H 8ESTE 2FYQA 1SGCA 3E90B 4FUCA 1NZQH 3CS0A 3KEEA 4X2VA 3TH4H 2A7CA 3T29A 2A1DB 7LPRA 1JIMA 1K22H 4NSYA 4Y10E 5AHGH 1QTFA 3TLOA 1P3CA 4LK4A 1ABJH 1V2TT 1AQ7A 1S6FA 4TY7A 1O3OA 3CP7A 3N7OA 3CS7A 1DPOA 1P0SH 1C2KA 1OYTH 1V3XA 1SQAA 4OS6A 4X0WU 4Q7XA 5FPTA 4Z0KA 4KELA 4X8VH 3UNQA 1JWTA 1DWCH 1GMDF 4F49A 1ANEA 2K1QA 3A86A 1DANH 4DVAU 1Y3YA 1KXFA 2CHAB 1IHTH 1E36B 4JZFH 3TJUA 4AN7A 5JB8S 4NIVA 1LQEA 2ZGCA 5JYIA 3SV7A 3RUOA 3UQOA 1GHBG 1ELEE 1GJCB 3RMLH 2BLVA 7GCHF 2PKSC 1F0SA 1U6QA 3MNXA 1L1NA 2PUXB 1ID5H 1FQ3A 1LPKB 1BTYA 4WXVA 1HCGA 2GX4A 3SU4A 2ZDNA 3ATWA 4I8HA 1QA7A 4E06H 1LDTT 3GYMA 1AD8H 1S6HA 2ESTE 2A4OA 3HGPA 1ELFA 1MQ6A 1OP8A 5TCAA 3SUDA 1GI4A 1MH0A 4DG4A 2UWPA 1YBWA 1BTUA 4X6NA 3HK3B 1ZOMA 3ZZ6A 1WTHD 4CHAC 1QBOA 5HM2A 4FUGA 4WVPE 4AYVB 1P2NA 2G52A 4UE7H 1SHYA 3ESTA 1V2NT 2ZU3A 1IQIA 2F9NA 1D6WA 4UFEH 1DWEH 1SVPA 1NRPH 2VNTA 2OBOA 1E37B 1LKAA 3RXTA 3SJ9A 1A7SA 1N8OB 1FY5A 1YCPM 3KQEA 5IDKA 5LH8A 2VJ1A 2HWLB 5GIBA 3U8TH 3RLWH 1DXWA 5DP5A 5K0HA 3MOCA 5FPYA 4MNVA 2FS8A 2ZFQH 1SQTA 4H4FA 1T8MA 1TQ7B 1T7CA 2Z9LA 1O3KA 1RTKA 2BQWB 1XVOA 1L4ZA 1SGIB 1FY4A 1ELTA 5GXPA 3VPKA 1PPHE 5CMXH 5DKMA 2AGGX 2EI7A 4K69A 2R0LA 4JZIA 3SUGA 2BMGB 1YYY1 1FONA 3HKIB 2CN0H 5A0BA 3LGWA 1G36A 1TPOA 1B0EA 3RXUA 3ZVDA 2A0QB 1H1BA 4LZ1H 1C5QA 4X1RU 1EP5A 1FUJA 2VIQA 1H8DH 1C5MD 3MFJA 2THFB 3MHWU 1SQOA 2O8MA 2VGCC 6LPRA 4WMEA 2F3CE 1EPTA 1ZSLA 2P59A 2UUJB 2WPHS 2QIQA 1KLIH 1O2IA 1GBDA 1AE8H 1LO6A 2Q6DA 3RXVA 1MBMA 1NN6A 1F0RA 3LC5A 4WH6A 5EOKA 1YPEH 1BBRK 2RDLA 1WUNH 2QXGA 3RC4A 1V2OT 4JZEH 1NROH 4I8GA 2P95A 4X8SH 4UDWH 1WV7H 2R3UA 4ASHA 3S7HB 3T27A 4MLFB 3AASA 5J4SA 2AERH 3SU6A 1TNGA 1AKSA 1TQ0B 3U98H 1W10U 3BG8A 3DFLA 3P8GA 2ZTZA 2GCTC 2A5AA 2HALA 1NRSH 1CT4E 1OP0A 3KQBA 1YCPK 2SGPE 1V2KT 4DW2U 1IQGA 5K7RA 1L4DA 1GI0A 1Y3VA 1JBUH 3R0FA 1QCPA 1E38B 1O2GH 1TGTA 1K1PA 3GCHB 2TGAA 3KQCA 5EGMA 1O2PA 1GHBF 2BYAX 3NPSA 2GMTC 1C1MA 1MTVA 3FVFB 1RFNA 1G3EA 4GHQA 3RDZA 1YPGH 2BB4A 2G4TA 2W7SA 3OY5U 3AAVA 1VITG 1FN6A 1QA0A 1P04A 1XUHA 4X6PA 2GZ7A 3ATMA 2NU3E 2SNWA 3HATH 1LPZB 5EG4A 3SNDA 3GY3A 4BAMB 4A6LA 4KTCA 2PV9B 2HGTH 1MTSA 1AO5A 2XW9A 1QQUA 2DE9A 3Q77A 2WV5A 8KME2 1TA6A 4FU8A 1NU9A 1BZXE 4NG9H 2VIWA 2OCVB 1P02A 4WWYA 2JH5D 1JOUB 2ZI2H 4JZDH 3SW2B 1C4V2 2NU2E 2ZU2A 1P9UA 1AB9C 1F2SE 1CBWC 3TH2H 4JZ1A 5ESBA 1TBQH 5DPAA 1ZGVA 4FVDA 3JZ2B 3EA9A 2QGRA 5DJ7A 2GCHG 1SC8U 1EPTB 1PPBH 3ZZ5A 1DITH 3RXCA 1KY9A 1Q31A 1T8LA 1NPMA 1G3BA 3SORA 2PWXA 1Z8JB 2B8OH 2BD9A 3ATKA 2EA3A 1HJ8A 4XFQA 3RXAA 2GDDA 1C1TA 1UVUH 3GDUA 2CF8H 5DG6A 3RXJA 3F9GA 1C2GA 1S84A 4DURA 1P2OA 1RS0A 1O2OA 4YOIA 1ZSKA 1GBHA 2UWOA 1AKSB 1PQ7A 3QTVH 2ZF0H 2D2DA 3OYPA 3M61U 1DM4B 1C4U2 1C9PA 4PROA 4X2YA 1QB1A 3NK8A 1AVGH 1PQAA 2J92A 1J17T 2Z6BD 3PYHA 1ZRBA 3V3MA 2CGAA 4MPXA 1D4PB 1SR5C 4FUFA 2WYGA 4GHTA 1RTLA 3RMOH 3GISB 3SJIA 2FLRH 1C5TA 2IJOB 3H7TA 2H6MA 1G2MA 2ZU4A 3Q3KA 2A2XH 3RXLA 1TPAE 1YGCH 2W3IA 2A2QH 4YT6H 5T6DA 1VJAU 1QL9A 1MTNB 4MPVA 1GBKA 1YPJH 1O5EH 4ZH8A 2BD7A 2PSXA 3U8OH 2WPIS 3SU0A 1TMBH 1ZPZA 1RJXB 4YTAA 2FWWA 3LT3A 2NU0E 4E7RG 4XBCA 4YESB 2PHBA 1UMAH 3QX5H 4BAHB 2OP9A 1PPCE 1LHFH 1XUJA 1Z8IB 1ESAA 1ELAA 1BIOA 3TK5A 1O2XA 2FMJA 1BMAA 3UFAA 1TNLA 1ZTJA 1WQVH 3BTQE 2SNVA 3T25A 3BTKE 2LNCA 3UTUH 4UONA 4ZAEA 4D7FA 1BHXB 1HAOH 2Z9GA 3BTEE 1O2VA 4WF8A 1V2PT 1GGDC 3SGAE 1THSH 1C5WB 4BTUB 3DFJA 3FZDA 1FLEE 2BLQA 1VITF 1LHEH 3LDXH 1H9HE 1ZHMA 2RA3A 3F6UH 1ZZZA 3GOVB 1AZZA 2J94A 1OSSA 1PYTC 1C5XB 4UD9H 4D76A 1NRQH 1P2JA 4ZMAH 5EXLA 2BVXH 1TWXB 1ETSH 2P8OB 2FODA 1PPEE 3E0PB 1PQ8A 1O3FA 3E0NB 1C1PA 1GPZA 4XE4A 2WPJS 1LVMA 1GCTB 1ZMJA 2QV1A 1BMNH 1JRSA 1V2UT 3Q76A 2A7JA 1GJAB 3VB3A 1ZPBA 4NSVA 1C5LH 3F9FA 2ZCHP 1ZHPA 1EOLA 2Z9KA 1W13U 4WJG2 1CGIE 1GBJA 2SGEE 4YLUA 5F6MA 3VGCB 4YZUA 1A5HA 4RKOB 2FOBA 3M7UA 1HAVA 1Y59T 1S0QA 2GCHF 5AFYH 2F9PA 1DX5M 2PUQH 5E0HA 1GJDB 2ZDVH 1C5RA 2A4QA 2AYWA 3SU5A 1AU8A 2JH0D 2ZHDA 2FEQH 4FVBA 2BY5X 5F8ZA 3TIUA 1QIXB 1SGTA 2QYIA 5C67A 3ZZ9A 1C2IA 3PWBA 2CHAC 1GHAG 5F8TA 5GCHG 3MH5A 5EXMA 4Q7YA 3KNXA 1KTTB 3HK6B 1NU7B 3P17H 3I77A 2TIOA 1PYTD 1Y5BT 2GKVE 2XCFA 3ZVGA 1O2JA 2FDAA 1NFYA 2FX4A 3GY8A 3S9AA 1BRBE 3BTFE 4K8YA 1WYKA 4ABAA 1HB0B 1KIGH 1K9OE 4HZHA 1IQJA 4B71A 1D9IA 3VB4A 2BOKA 2PTNA 4NFFA 1PPZA 1ELVA 1O36A 4K60A 4NZQA 3RXFA 2TPIZ 2W7UA 2QF0A 3QWCH 3TITA 1J14A 4MQAA 1KXAA 3QTOH 5A8ZA 4H6SB 3S7KB 3RXQA 5A2MH 1J9CH 1O3AA 2J38A 1OXGA 2OC8A 2WPLS 1ETRH 2TGTA 1GJ5H 1NFWA 1CA0B 2SGQE 4ZROA 3QGNB 4X1PU 1GJ7B 3MNSA 1BQYA 3S0NA 2F9VA 1DVAH 4YT7H 5A8XA 3SNAA 4YOJA 4K1SA 1PJPA 1A46H 4DGJA 4NCYA 4X2XA 2DE8A 3PO1B 3K2UA 2WPKS 1MAYA 1QBNA 1TPSA 2VWNA 3TPIZ 5FAHA 1WOFA 3RMNH 2SGFE 1LVBA 2O8WA 4B2BA 5LPFA 3TK9A 5ABWA 3EYDA 1GI9B 1LKBA 1UHBA 1ZR0A 2HNTE 3EQ0H 4VGCB 3L33A 3SNEA 4OS7A 2OQ5A 5JDUB 5FX6A 4Y8ZA 1O2ZA 4NIWA 4Y71A 4B75A 4Z6AH 1C1UH 4CRDA 3BTGE 4AFQA 1J15A 4BANB 1NO9H 1J8AA 1UCYH 4RSPA 2O8UA 1BRAA 1OWEA 1HAVB 1A5GH 3MU4A 3NCLA 4M7GA 4BTTB 3A7VA 1MU8B 3FFGA 1WSSH 2BLWA 3SBKA 3SU1A 1TA2A 3SO3A 1YF4A 1C1QA 5HMAA 2J34A 1MZDA 3MI4A 1WTGH 3LOXA 3VFEA 2RA0A 1YPKH 4NWKA 1QR3E 5FBEA 1Z1IA 1FDPA 2EI6A 1XXDA 4IC5A 1WCZA 5E0GA 4F4OC 4IC6A 3TGIE 1C9TA 1XXFA 3BIUH 1ABIH 1HDTH 4U01A 4GSOA 4LOYH 2OINA 4AGKA 3M3TA 2Q6FA 3QUMP 2PW8H 1ACBE 2ODPA 4R0IA 1EAIA 4ZUHA 2Z9IA 2ZU1A 3ZZ7A 2ZPRA 1QFKH 1THPB 1B7XB 2R2MB 4D8NA 4A5TS 1C5SA 1SSXA 4QT8C 3GICB 2ZTYA 1IOEA 1DLEA 2G81E 1O0DH 1GHAF 1HJ9A 3I78A 5GCHF 2C8XB 3GCHC 4DIIH 1O3BA 4I8KA 4INLA 1A0LA 3E16B 3UOPA 1S0RA 2XCNA 2BDAA 2Y7XA 2VH0A 2AS9A 4ZKOU 4ABDA 1HIAB 1W12U 3PLBA 2H9TH 2ZGBH 2ZHFH 4FUHA 4INHA 3HPTB 1P57B 4Y7AA 1LPGB 3KF2A 1QB6A 4YOGA 5GDSH 1GDQA 1N6XA 3ZZCA 1CU1A 5EQSA 3O8BA 3TNTA 3STJA 1PPGE 3M7QA 1OX1A 1Z6EA 4Y8YA 4E05H 3EA8A 3ATLA 4CREA 3SHCH 3KCGH 2BLOA 3QZQA 1ANCA 1V2MT 4AG2A 1EJAA 2FOAA 5ETXA 1FPCH 4OS1A 3URDA 3H5CB 3RXIA 2NWNA 2QF3A 3VB6A 3KL6A 1UHBB 1XX9A 3I29A 3V7TA 2GT7A 3RXBA 2XRCA 1HAXB 1AUJA 5GJ4B 3A8BA 1BTPA 2QXHA 2A31A 2AEIH 3K65B 1UTKA 2AGIX 1QJ7B 1TX8A 3P92A 1C1VH 3RXOA 1RIWB 1FN8A 2FIRH 1RD3B 1EPTC 1FAKH 4TYDA 1CSOE 1OWHA 1AI8H 1GHVH 1YKTA 3QZRA 2UUYA 2XBVA 1AUTC 1MKWH 4OS5A 3TNSA 1XVMA 2M5TA 2TGPZ 3AVZA 1EASA 1EOJA 1Z8RA 3PM3A 4DCDA 1ZTKA 1JMOH 1HAHH 4JMYA 3MNCA 3P8FA 1XUKA 2OD3B 2HNTC 2ALVA 2XXLA 3DT0H 5H4IB 3RXSA 3E8LA 3QGJA 4ISLA 3SUEA 3ZV8A 1O2LA 1DUAA 3TJNA 2BOHB 2SFAA 1AY6H 2IN2A 3A83A 1UTJA 1QURH 2GV7A 2STBE 4X1SU 3TK6A 1EKBB 3FP6E 4RN6A 2D1JA 1DICA 1C1RA 1A61H 2ZPQA 2ZPSA 2CXVA 1AE5A 1GG6B 3NUMA 5EW1H 3M5NA 3V0XA 2FS9A 1SGNE 4U30A 3D62A 1W8BH 1QGFA 2ODQA 1O3JA 5FCKA 1RXPA 4WMDA 1FY3A 2Y5GA 5EODA 1KLJH 3V12A 2BD5A 1SI5H 1GI8B 2UUFB 2GZ9A 3HKJB 4Y76A 1CHOG 2CJIA 1QL8A 3WY8A 3SJOA 4NFEA 3UY9A 4K5ZA 4Y6DA 1DOJA 1EAXA 2HRVA 3P8OA 2XWAA 1C5NH 2XTTB 3GCOA 4GUXA 3LU9B 1GJ4H 1C5ZB 1E0FD 4ABIA 1BRCE 1EJNA 4I8LA 1DLKB 2OC0A 5J4QA 1GBCA 4AX9H 1FV9A 1V2RT 5FBIA 5PTPA 3S9CA 1SLWB 4H42U 1KTSB 3T28A 1CA8B 2AH4X 3L6PA 2FOMB 1D3QB 1GL0E 5EW2H 1P12E 1BDAA 1QBVH 3ZZ3A 1UTNA 3ZVBA 4CHAB 3OSYA 4D9QA 1P2KA 2ZFPH 4MPWA 2Z3DA 3P8NA 4Y0ZE 4A1TA 1D6RA 2CF9H 1ZLRA 1ELDE 1THRH 1DDJA 4CBOA 2VU8E 4MDSA 3K6YA 3RMMH 3LH1A 3ZZAA 2PR3A 1SBWA 1G3DA 2ZFTA 1V2LT 1O33A 1ELBA 1Z6JH 2I6SA 2AGEX 1C1NA 1ANBA 1D3PB 1GI2A 2QN5T 2YNAA 1VJ9U 2VIOA 1A3BH 1HNEE 3BEUA 1HLTH 1E35B 1L2EA 1ELCA 1EAWA 1TONA 1C4Y2 1A3EH 1W0YH 1B0FA 4NA9H 3RXPA 1TX6A 5FPSA 5A0CA 1ELGA 4MPUA 1QHRB 2P8OC 1SG8B 1GI1A 1NFXA 2FP7B 1B5GH 1SMFE 1TPPA 1MKXK 3TH3H 1DY9A 2A5IA 2HPPH 2VVUA 6CHAB 4HI3A 1GCTC 2FXRA 1UCYK 1YC0A 3E3TA 3P6ZB 1NC6A 1QJ6B 3F9EA 1F0TA 4ABGA 2VWLA 4KGAA 5EQQA 1GMCG 1QJ1B 2ULLA 1GHYH 1O38A 2BD2A 4KP0A 3T2NA 1YPHE 1EAUA 2V6NA 1AN1E 3TVJB 1VCPA 4YLQH 5EXNA 1VGCC 2VH6A 3MU5A 3VGCC 5TCCA 2ZQ1A 4TPIZ 4X8UH 3UQVA 1O5FH 2H5CA 4HFPB 3UWIA 1AIXH 4ISHH 3GCNA 3LPRA 1Z1JA 2ZC9H 1EX3A 2HVXA 3F9HA 2VGCB 1QRZA 1D3DB 1GHZA 1TABE 5E2OA 3V13A 1CGJE 1SGFA 1T8NA 3IG6B 1OP2A 2QA9E 1GVLA 3BTHE 1UTOA 2OXSA 2PFEA 3LGTA 1GI7B 4NA7A 3PMAB 3OX7U 2A4GA 2VVCA 4ISIH 1TAWA 2OQUA 1UVTH 4AG1A 1EZXC 1V2VT 1GBLA 3RXKA 4I8JA 2H9EH 2XBWA 2FM2A 5LGOA 5CE1A 3ZVEA 4E7NA 1BUIA 5FX5A 3RU4D 1GHXH 1H9LB 2FYRA 2FI5E 1TOCB 1NTPA 1GJ9B 3IWMA 1TMUH 1DT2A 1XMNB 4HGCA 2ZIQH 1AVWA 6ESTA 2PSYA 5LPEA 1GBEA 4O97A 2FESH 3U9AH 1YLCA 3LONA 2AMDA 5L30H 2FOCA 2G51A 3MO6A 2XC5A 5EPYA 2BDHA 5C1YA 2H9HA 3A7WA 1O39A 1YM0A 3PV4A 1C2HA 1K1IA 3RXMA 1CHOF 4B1TA 2A32A 2EI8A 4FUDA 1INCA 1FY8E 1UJ1A 2ZGXH 1KYNA 3GDSA 4A92A 1LVYA 1KXDA 1SHHB 4CRFA 2JETB 2GMTB 3IITA 1FNIA 2GVFA 4B2AA 1MQ5A 2HPQH 1ZPCA 3PB1E 2G4UA 3BG4C 2Z3EA 2QCYA 1VITH 1EATA 3A8AA 2VB0A 1G37A 3PO1C 3SI3H 2ZFFH 1OWDA 1HJAB 4CBNA 5HXFA 3UREA 1GWAA 1P9SA 5LPRA 1IHSH 1O30A 4CH8B 1O2HA 1TRYA 1C5VA 3B9FH 3KIDU 2XC4A 4INKA 1O3PB 3MMGA 4X1NU 1IAUA 1O5DH 3MH4A 4VGCC 4OS2A 2BD8A 1EP6A 1K1OA 3SJ8A 2Y7ZA 3A88A 4FUBA 1MTWA 2ZEBA 1H8IH 1PFXC 2R3YA 3UNRA 5FCRA 1OWJA 1ESTA 4NA8A 1OYQA 1AB9B 1O2SA 3A81A 2BX4A 3PROA 1O5GH 2C93B 2RG3A 3LJOA 2FTMA 4R8TB 1Z7KA 1K21H 3VEQB 1GMDG 2WV4A 2C8ZB 2BM2A 3NXPA 3FZZA 4MVNA 3URCA 1GMCF 1K1LA 4O9VA 4WH8A 7KMEH 1S82A 3ZV9A 2F9UA 2XNIA 1YPHC 3R3GB 1KXBA 3VXFH 1AMHA 1WQSA 2IOTA 3MH6A 3MH7A 1P03A 4FXGH 2BDGA 2FO9A 1TBZH 1KSNA 1F5LA 5AVDA 3A7YA 1OWKA 3ITIA 1VZQH 2RCEA 3LGUA 3U8RH 4DJZB 4MNXA 1W11U 1BBRH 3LJJA 1AFQB 2C3SA 1K2I1 1J16A 3BEFB 1DSUA 1AVXA 1C2JA 1V2QT 1QQ4A 5T6GA 1T32A 4LXBH 5C5NA 1JRTA 1F0UA 5BPEA 1P3EA 3E6PH 2EC9H 3U1IB 3ZZBA 1E34B 4Q7ZA 2ZHWH 1Y3UA 1O3LA 3LKWA 4OS4A 3M5MA 3L3TA 1ETTH 3M3SA 1GVZA 3ELAH 1FPHH 4K2YA 1ZMLA 1Y3XA 2ZO3H 3GY5A 4JCNA 4JYTA 3TU7H 1YCPH 1ZTLA 1SGRE 5EQRA 2HNTF 4TPYA 1N8OC 4YM9A 1EQ9A 2J4IA 4AFUA 3BN9A 2C8YB 1FIZA 4Q80A 3RXEA 2HOBA 1NESE 3PTBA 4JK5A 1DE7H 2F9OA 1C2FA 2ZA5A 2Q1JA 1O34A 1EXFA 5CHAB 4KTSA 1W14U 1W0ZU 3A8DA 1LCYA 3UUZA 2SGAA 4ZKSU 3VB5A 4DT7B 1BTZA 5I46H 1A2CH 1MCVA 2P3FH 4AZ2B 2D8WA 1O2WA 1NRNH 1O32A 1Y8TA 4GVUA 1C2LA 3C27B 2R9PA 2ZDLA 1N1LA 1V6DA 3SV2H 1S85A 2ZZUH 3SGQE 2ANYA 3QLPH 1AFEH 3BIVH 1RIWC 3BTWE 1D3TB 1ZJDA 2ZTXA 1O2QA 1NM6A 2ZDAH 2I6QA 1FAXA 1M9UA 4NWLA 9ESTA 4XBDA 3D49H 1SLXB 2BQ7B 4DOQA 1CE5A 1LHDH 1TGBA 5AFZH 4BAKB 1MBQA 3RC5A 2ZFSA 3P95A 2PGBB 2Y5FA 1Z8GA 3E91A 3M3VA 2NU4E 3MNBA 1ZSJA 1P06A 1GBFA 4B76A 2ZDKA 4Y11E 1WAYB 2VWMA 3SHAH 1GDUA 1TB6H 1UVSH 1ARBA 1YPMH 3PMJA 4FU9A 1QRWA 1TNJA 3W94A 2OUAA 1QB9A 5HM9A 1GBIA 4MTBA 2ALPA 1C5PA 4THNH 2V3HH 1UO6A 1C1SA 4H6TA 1C1WH 3EE0B 2BXUH 5FHTA 1IQMA 3ATIA 2FI3E 2BDIA 1BHXF 5DK1A 1O2KA 2XBXA 1SB1H 3VXEH 2G5NA 1DWDH 1HXEH 1SFQB 1GG6C 1HXFH 1FJSA 1HBTH 1FMGA 1T31A 1TLDA 1P05A 4SGBE 3OU0A 2LPRA 1O3IA 2V35A 3GY2A 3W95A 3C1KA 1OS8A 4ZXYH 1TOMH 3FP7E 1PQ5A 3A7ZA 2WUCA 1TNHA 1TYNA 1GBTA 1A0JA 1C1OA 1O2MA 3OTJE 3F1SB 5DP6A 4FUIA 5EU8A 3VB7A 2FZZA 1C2EA 1L1GA 1CQQA 3SNBA 1A0HB 1SGPE 3DHKH 1TX7A 1C2MA 2JKHA 2Z94A 4J2YB 4ZHLU 5DP7A 4BXSA 1ZMNA 3RXDA 1IQNA 3QN7A 1G3CA 2GP9B 2ZHEH 4D7GA 1UCYE 2ILNA 3SN8A 2GV6A 1GJ8B 4O3TA 2B7DH 4CRCA 4X6MA 4X6OA 3RM0H 5I25A 2ASUB 4OGXA 1O2YA 3UIRA 3A84A 4IMZA 4ABEA 1K28D 1NFUA 4BTIB 1TFXA 4AFSA 3UR6A 5GPIB 4ABFA 1BTXA 1UVPA 4K3JA 4Y8XA 2F91A 3M35A 5E0JA 1FXYA 5DGJA 2WUBA 3BEIB 3SGBE 1FI8A 3GCTG 2VIDA 1FZZA 3RLYH 2SGDE 2QAAA 1GI3A 2CMYA 3B23B 3RU4E 2G55A 2Y6TA 2P94A 3NKKA 4Y79A 4IMQA 2NU1E 2ZGJA 2Y5HA 3CENA 2W26A 3KGPA 2ZGHA 1HAGE 2BZAA 1C5YB 1SOTA 3D65E 2BZ6H 3GY7A 2A45B 1K1MA 1F5RA 6CHAC 3MU0A 5JBCS 4J1YA 1ANDA
chains in the Genus database with same CATH superfamily
1ZRKA 2W5EA 4ZHMU 3ZYDA 1OKXA 1GBAA 1L1JA 2P16A 2WPMS 1OOKB 3SQHE 3RC6A 3T5FH 4CRAA 1O3HA 4AORA 2Z7FE 3GDVA 5DP8A 5HYOA 2GGVB 1GJ6A 2ZU5A 4IN1A 3WW7A 2PLXA 2BQ6B 2R0KA 2ZCLP 3A82A 1HAZB 1TRNA 1UK2A 3GYLB 1WXRA 1AZ8A 3T26A 2M2AA 3UOUA 2WINI 1MZAA 5JB9S 1EZQA 3UR9A 4ZHAA 2GD4B 1P11E 2J5UA 4NZLA 1EZUC 2O8TA 5SGAE 1TNIA 1TIOA 1TMTH 5TJXA 1XKAC 2WV9A 5T6FA 2BY8X 4AOQA 1XUFA 3BSQA 1SGYE 3RU4T 2IPHA 3FP8E 1GMHG 2TBSA 1Y5AT 3TGKE 1LQDB 5BRRE 1S83A 1JXPA 1W7GH 4X8TH 1S5SA 5G4BA 3K9XB 2G00A 4XSKU 1YPLH 1V2ST 3G01A 4GAWA 3U1JB 1MCTA 3H7OA 3OEED 3UPEA 5B6OA 5L2ZH 2VWOA 3B8JA 4I33A 1NBMD 4ZKNU 3O8RA 3FANA 1O3CA 3KN2A 3KYFA 2GT8A 4CRGA 2KCPA 4XOJA 1WBGB 3SU2A 4I32A 2D26C 1VCWA 3D23A 3BTDE 1GL1A 4OGYA 1MTNC 2PKSB 5C1UA 3SUFA 4O03A 2GTBA 2C90B 1O2NA 1NS3A 3AW0A 2UWLA 2TRMA 3LGVA 3STIA 2QXJA 1T4UH 2GZ8A 4ISOA 4YO9A 5T1VA 1XUGA 3MU8A 1F7ZA 1NT1A 2BDYA 1G2LA 2HLDD 3Q3XA 5GNDA 2Q6GA 1UK3A 1MD7A 2Y81A 3M5OA 4Q2KA 2Y82A 1AWFH 1BITA 1H8ED 4UFGH 4BAOB 4KTUA 1GCDA 5IYTA 2ZP0H 2HLCA 3TJOA 2JETC 2FI4E 3WWFA 3NZIA 1BT7A 4IS5A 3SJKA 3ENSB 4GCHG 1AWHB 4X2WA 2BY7X 4CR5A 4AYYB 2KZ4A 4AFZA 1GVKB 1EUFA 3ZZDA 4A1XA 1X7AC 5DP9A 5E2PA 1RGQA 4B74A 1QRXA 3A7TA 2BY9X 2KCOA 3M36A 1HJAC 1Q3XA 1RTFB 4K1EA 3BTTE 3ZVAA 2WYJA 1YLDA 1O2TA 3M5LA 3PLKA 1O31A 4NIXA 1EB2A 2C8WB 4FUJA 3Q00A 4Y0YE 3ZZ4A 1HGTH 1OWIA 1EJMA 1MD8A 2F83A 2W3KA 5JBTA 1C5OH 1MTUA 2P93A 1FY1A 1YP9A 1CHGA 3GCTF 2Y80A 2ANKH 2OC7A 2XWBI 3K6ZA 1NY22 2BX3A 5F53A 2R2WU 4BAQB 1O3DA 4TSFD 4NIYA 3FOAA 3ZZ8A 1DWBH 3O8DA 2F9BH 4TY6A 4ABHA 2ZDMA 1V2WT 1UVOA 1LHCH 1XUIA 1P2QA 1P8VC 3SV6A 2ZWLH 2FOGA 4B6FA 2PKAA 2V3OH 4D9RA 4RKJB 2FPZA 2JJ2D 1G9IE 2ZECA 2K8IA 2XC0A 5GWZA 2AIQA 1XKBC 2EEKA 1O5BB 4XDEA 1F5KU 3PLPA 4FU7A 2ZFRH 2FOHA 3GY4A 1DY8A 1BMLA 4K8BA 1CO7E 2GDEH 3MO3A 1SL3A 7ESTE 2AMPA 3UWJH 3VG8A 2KCYA 5DP4A 2BDCA 3U69H 4JK6A 3F68H 5F8XA 4ZXXH 3LH3A 4B2CA 1UK4A 1AHTH 2BDBA 3QO6A 2CV3A 1DFPA 1PPFE 2BY6X 2LP6A 1SLVB 3MU1A 3EDXB 4HG6A 5C1XA 1OPHB 4AB9A 5E8EH 1AFQC 5HGGA 4A1VA 5KGOA 5DO4H 1HAIH 1O3NA 4UFDH 1HUTH 2O9QA 3KHVA 1A5IA 2AMQA 3BTME 5C5OA 3UNSA 1GMHF 2BVSH 1UTQA 4XBBA 1W2KH 1O35A 3KQDA 2GCTB 3LGIA 2ZNKH 2DUCA 4U32A 1P10A 2YNBA 3E1XB 3ODDA 1VR1H 5A8YA 1CT2E 8GCHG 1LTOA 2J97A 4ZKRU 3MYWA 2FLBH 4CRBA 1BTWA 5DP3A 3ZYEA 2VVVA 6GCHG 1BJVA 1GDNA 4WY3A 1CA0C 1LHGH 2ZHQH 1TGNA 2H5DA 3ODFA 3DA9B 4HTCH 3SQEE 8LPRA 1QY6A 3NWUA 2A7HA 3PMBB 1SLUB 1MABB 2KFWA 2G8TA 1A4WH 4IBLH 2FOEA 5JBAS 2A4RA 1O3MA 1BTHH 5A09A 5CHAC 4I31A 2BTCE 5JBBS 1TALA 1UTPA 2BHGA 2QY0B 5ESTE 2VIPA 2PTCE 1TE0A 1GI5A 5FL7D 2VINA 2A5KA 1P09A 4WXIA 1IQLA 3EGKH 3OY6U 4AGJA 1FIWA 4DIHH 1CT0E 2B9LA 1BJUA 1DS2E 3SI4H 1SPJA 1TGSZ 4GCHF 2P3UB 1W7XH 4TWWA 3SU3A 2KAIA 1IQEA 1GBMA 4B6EA 1TRMA 2V3MA 3PTNA 2AFQB 1FX0B 2OLGA 1MKWK 5FXLA 4CR9A 1TNKA 3RP2A 1GJBB 1E1QD 2PKAB 3T62A 4ABJA 1HV7A 9LPRA 3DD2H 3PWCA 2FOFA 5CHBA 1KLTA 4GPGA 1GBBA 1EB1H 1WDIA 2FTLE 4X1QU 1HPGA 4MNYA 5L6NH 1GI6A 5C3NA 1P01A 3JZ1B 1CBWB 4BOHA 1Y5UT 2F43B 1N6YA 5DN6D 1HAPH 1BB0B 2C4FH 3ZVFA 3SV9A 1KDQA 4DY7B 4U2WA 5F03A 4ESTE 1VCQA 2O8LA 1ZJKA 3A80A 1SGDE 5HIZA 2H2ZA 4BXWA 1O5AB 3A87A 1S6LA 2ZQ2A 2UUKB 4WMFA 5EPNA 1K1JA 4LZ4B 2G5VA 3RXRA 4GLYA 4JYUH 1Q2WA 1VGCB 5JPMH 5CDFE 1TBRH 1O2RA 2ZCKP 3RXHA 2TGDA 3S9BA 1CVWH 4Y7BA 3LC3A 2J9NA 1MMJN 2ANWA 2XBYA 1H9IE 1UTMA 3LIWA 3SOSA 7GCHG 4UFFH 1Z71A 2QF5A 4ISNA 2BD4A 5A0AE 4KKDA 3M7TA 3S69A 1T4VH 2VIVA 1CGHA 2ZG0H 3QK1A 1SGQE 3BV9B 1S81A 3A85A 1DUEA 1AGJA 3MO9A 2OTVA 3QDZB 3AAUA 1BA8B 2ANMH 1EZSC 2B0FA 5C20A 1EFRD 2K0QA 1IQKA 3TGJE 3EAJA 2XYAA 1MU6B 3A89A 1SGFG 3RXGA 3TJVA 2BD3A 1ORFA 3WWBA 2H1UA 5T3HA 1BOQA 1QNJA 1O5CB 3RM2H 4AB8A 3O8CA 3SYJA 1L0ZA 4MG3A 3MTYA 1MUEB 2PGQB 1P2IA 2FX6A 1HYLA 1LVOA 1HFDA 3SV8A 3PMHB 1DXPA 3DUXH 1P2MA 1V2JT 4MNWA 1XM1A 3M37A 4M9FA 3F3BA 4BNRA 3SZNA 1F92A 2P3TB 3MWIU 1ARCA 4JYVH 4O3UA 1C5UA 2J2UA 1O2UA 1W3CA 1YLNA 2ZKSA 8GCHF 1JIRA 4B73A 1KXEA 2JH6D 2AIPA 4RT1A 3A7XA 1KXCA 1NBME 1SOZA 1K1NA 1SGEE 1MAXA 4IN2A 6GCHF 2BXTH 2BVRH 1ZGIA 3GY6A 2ODYB 1W0KD 1HAYB 1BRUP 1HIAA 4K1TA 2YOLA 2Z3CA 1O37A 1ZYOA 2STAE 1WU1A 1IQFA 2KAIB 4TWYA 1LMWB 1GHWH 3ZVCA 4CH2B 1BBRE 1QL7A 4FUEA 5C2ZA 2OBQA 1NRRH 3Q3YA 4I7YH 3BG4B 2OC1A 2OK5A 2QXIA 2V0BA 3FAOA 1GGDB 1HRTH 3HGNA 5L2YH 4IW4E 4UEHH 3AK5A 1ZHRA 1G32B 1Y3WA 1T8OA 2B5TB 1G30B 3AW1A 1ESBA 3P70B 1TGCA 2Z9JA 3SNCA 1KDQB 4SGAE 4XD7D 1O3GA 1RRKA 4NGAH 4ABBA 3LGYA 1A1RA 3A8CA 1IQHA 1O3EA 2J95A 4A7IB 1SFIA 1BCUH 2QC2A 1C2DA 4F48B 3EA7A 1H4WA 3BF6H 1MKXH 1UTLM 1BMMH 1DSTA 4FOUC 4IGDA 5AF9H 8ESTE 2FYQA 1SGCA 3E90B 5C17A 4FUCA 1NZQH 3CS0A 3KEEA 4X2VA 3TH4H 2A7CA 3T29A 2A1DB 7LPRA 1JIMA 1K22H 1UW7A 4NSYA 4Y10E 5AHGH 1QTFA 3TLOA 3DSOA 1P3CA 4P00A 4LK4A 1ABJH 1V2TT 1AQ7A 3F0PA 1S6FA 4TY7A 1O3OA 3CP7A 3N7OA 3CS7A 1DPOA 1P0SH 1C2KA 2XOKD 1OYTH 1V3XA 1SQAA 3F2FA 4OS6A 4X0WU 4Q7XA 5FPTA 4Z0KA 4KELA 4X8VH 3UNQA 1JWTA 1DWCH 1GMDF 4F49A 5EJ1A 1ANEA 2K1QA 3A86A 1DANH 4DVAU 1Y3YA 1KXFA 2CHAB 1IHTH 1E36B 4JZFH 3TJUA 4AN7A 5JB8S 4NIVA 1LQEA 4DT4A 2ZGCA 5JYIA 3SV7A 3RUOA 3UQOA 1GHBG 1ELEE 1GJCB 3RMLH 2BLVA 7GCHF 2PKSC 1F0SA 1U6QA 3MNXA 1L1NA 2PUXB 1ID5H 1FQ3A 1LPKB 1BTYA 4WXVA 1HCGA 2GX4A 3SU4A 2ZDNA 3ATWA 3DCLA 4I8HA 1QA7A 4E06H 1LDTT 3GYMA 1AD8H 1S6HA 2ESTE 2A4OA 3HGPA 1ELFA 3NRLA 1MQ6A 1OP8A 5TCAA 3SUDA 3KQ5A 1GI4A 1MH0A 4DG4A 2UWPA 1YBWA 1BTUA 4X6NA 3HK3B 1ZOMA 3ZZ6A 1WTHD 4CHAC 1QBOA 5HM2A 4FUGA 4WVPE 4AYVB 1P2NA 2G52A 4UE7H 1SHYA 3ESTA 1V2NT 2ZU3A 1IQIA 2F9NA 1D6WA 4UFEH 1DWEH 1SVPA 1NRPH 2VNTA 2OBOA 1E37B 1LKAA 3RXTA 3SJ9A 1A7SA 1N8OB 1FY5A 1YCPM 3KQEA 5IDKA 5LH8A 2VJ1A 2HWLB 5GIBA 3U8TH 3RLWH 1DXWA 5DP5A 5K0HA 3MOCA 5FPYA 4MNVA 2FS8A 2ZFQH 1SQTA 4H4FA 1T8MA 1TQ7B 1T7CA 2Z9LA 1O3KA 1RTKA 2BQWB 1XVOA 1L4ZA 1SGIB 1FY4A 1ELTA 5GXPA 3VPKA 1PPHE 5CMXH 5DKMA 2AGGX 2EI7A 3DSGA 3MQKC 3N7DA 4K69A 2R0LA 4JZIA 3SUGA 2BMGB 1YYY1 1FONA 3HKIB 3SZEA 2RFKC 2CN0H 5A0BA 3LGWA 3KYGA 1G36A 1TPOA 1B0EA 3RXUA 3ZVDA 2A0QB 1H1BA 4ACBA 1C5QA 4X1RU 4LZ1H 1EP5A 1FUJA 2VIQA 1H8DH 1C5MD 3MFJA 2THFB 3MHWU 1SQOA 2O8MA 2VGCC 6LPRA 4WMEA 2F3CE 1EPTA 1ZSLA 5HKKD 2P59A 2UUJB 2WPHS 2QIQA 1KLIH 3N99A 1O2IA 1GBDA 1AE8H 1LO6A 2Q6DA 3RXVA 1MBMA 1NN6A 1F0RA 3LC5A 4WH6A 1YY3A 5EOKA 1YPEH 1BBRK 2RDLA 1WUNH 2QXGA 3RC4A 1V2OT 4JZEH 1NROH 4I8GA 2P95A 4X8SH 4UDWH 1WV7H 2R3UA 4ASHA 3S7HB 3T27A 4MLFB 3AASA 5J4SA 2AERH 3SU6A 1TNGA 1AKSA 1TQ0B 3U98H 1W10U 3BG8A 3DFLA 3P8GA 2ZTZA 2GCTC 2A5AA 2HALA 1NRSH 1CT4E 1OP0A 3KQBA 4ACAA 2YMSD 1YCPK 2SGPE 1V2KT 4DW2U 1IQGA 5K7RA 1L4DA 1GI0A 1Y3VA 1JBUH 3R0FA 1QCPA 1E38B 1O2GH 1TGTA 1K1PA 3GCHB 2TGAA 3KQCA 5EGMA 1O2PA 1GHBF 2BYAX 3NPSA 2GMTC 1C1MA 1MTVA 3FVFB 1RFNA 1G3EA 4GHQA 3RDZA 1YPGH 2BB4A 2G4TA 2W7SA 3OY5U 3AAVA 1VITG 1FN6A 1QA0A 1P04A 1XUHA 4X6PA 2GZ7A 3ATMA 2NU3E 2SNWA 3HATH 1LPZB 5EG4A 3SNDA 4P02A 3GY3A 4BAMB 4A6LA 4KTCA 2PV9B 2HGTH 1MTSA 1AO5A 2XW9A 1QQUA 2DE9A 5C0TA 3Q77A 2WV5A 8KME2 1TA6A 4FU8A 1NU9A 1BZXE 4NG9H 2VIWA 2OCVB 1P02A 4WWYA 2JH5D 1JOUB 2ZI2H 4JZDH 3SW2B 1C4V2 2NU2E 2ZU2A 1P9UA 1AB9C 1F2SE 2YMSB 1CBWC 3TH2H 4JZ1A 5ESBA 1TBQH 5DPAA 1ZGVA 4FVDA 3JZ2B 3EA9A 2QGRA 5B6LA 5DJ7A 2GCHG 1SC8U 1EPTB 1PPBH 3ZZ5A 1DITH 3RXCA 1KY9A 3U28C 1Q31A 1T8LA 1NPMA 1G3BA 3SORA 2PWXA 1Z8JB 2B8OH 2BD9A 3ATKA 2EA3A 1HJ8A 4XFQA 3RXAA 2GDDA 1C1TA 1UVUH 3GDUA 2CF8H 5DG6A 3RXJA 3F9GA 1C2GA 1S84A 4DURA 1P2OA 1RS0A 1O2OA 4YOIA 1ZSKA 1GBHA 2UWOA 3N7EA 1AKSB 1PQ7A 3QTVH 2ZF0H 2D2DA 3OYPA 3M61U 1DM4B 1C4U2 1C9PA 4PROA 4X2YA 1QB1A 3NK8A 1AVGH 1PQAA 2J92A 1J17T 2Z6BD 3PYHA 1ZRBA 3V3MA 2CGAA 4MPXA 1D4PB 1SR5C 4FUFA 2WYGA 4GHTA 1RTLA 3RMOH 3GISB 3SJIA 2FLRH 1C5TA 2IJOB 3H7TA 2H6MA 1G2MA 4ASUD 2ZU4A 3Q3KA 2A2XH 4OM9A 3RXLA 1TPAE 2J98A 1YGCH 2W3IA 2A2QH 4YT6H 5T6DA 1VJAU 1QL9A 1MTNB 4MPVA 1GBKA 1YPJH 1O5EH 4ZH8A 2BD7A 2PSXA 5EIYA 3U8OH 2WPIS 3SU0A 1TMBH 1ZPZA 1RJXB 4YTAA 2FWWA 3LT3A 2NU0E 4E7RG 4XBCA 4YESB 2PHBA 1UMAH 3QX5H 4BAHB 2OP9A 1PPCE 1LHFH 1XUJA 1Z8IB 1ESAA 1ELAA 1BIOA 3TK5A 1O2XA 4Z1MD 2FMJA 1BMAA 3UFAA 1TNLA 1ZTJA 1WQVH 3BTQE 2SNVA 3T25A 3BTKE 2LNCA 3UTUH 4UONA 4ZAEA 4D7FA 3DSPA 1BHXB 1HAOH 2Z9GA 3BTEE 1O2VA 4WF8A 1V2PT 1GGDC 3SGAE 1THSH 1C5WB 4BTUB 3DFJA 3FZDA 1FLEE 2BLQA 1VITF 1LHEH 3LDXH 1H9HE 1ZHMA 2RA3A 3F6UH 1ZZZA 3GOVB 1AZZA 2J94A 1OSSA 1PYTC 1C5XB 4UD9H 4D76A 1NRQH 1P2JA 4ZMAH 5EXLA 2BVXH 1TWXB 1ETSH 2P8OB 2FODA 1PPEE 3E0PB 1PQ8A 1O3FA 3E0NB 1C1PA 1GPZA 4XE4A 2WPJS 1LVMA 1GCTB 1ZMJA 2QV1A 4ZCNA 1BMNH 1JRSA 1V2UT 3Q76A 2A7JA 1GJAB 3VB3A 1ZPBA 4NSVA 1C5LH 3F9FA 2ZCHP 1ZHPA 1SKYE 1EOLA 3EE7A 1SQRA 1W0JD 2Z9KA 3W1EA 1W13U 4WJG2 1CGIE 1GBJA 2SGEE 4YLUA 5F6MA 3VGCB 4YZUA 1A5HA 5C94A 4RKOB 2FOBA 3M7UA 1HAVA 1Y59T 1S0QA 2GCHF 5AFYH 2F9PA 1DX5M 2PUQH 5E0HA 1GJDB 3FN8A 2ZDVH 1C5RA 2A4QA 2AYWA 3SU5A 1AU8A 2JH0D 2ZHDA 2FEQH 4FVBA 2BY5X 5F8ZA 3OFND 3TIUA 1QIXB 1QZ8A 1SGTA 2QYIA 5C67A 3ZZ9A 1C2IA 3PWBA 2CHAC 1GHAG 5F8TA 5GCHG 3MH5A 5EXMA 4Q7YA 3KNXA 1KTTB 3HK6B 1NU7B 3P17H 3I77A 2TIOA 1PYTD 1Y5BT 2GKVE 2XCFA 3ZVGA 1O2JA 2FDAA 1NFYA 2FX4A 2L6OA 3GY8A 3S9AA 1BRBE 3BTFE 2J98B 4K8YA 1WYKA 5DSFA 4ABAA 1HB0B 1KIGH 1K9OE 4HZHA 1IQJA 4B71A 2AHME 1D9IA 3VB4A 2BOKA 2PTNA 4NFFA 1PPZA 1ELVA 1O36A 4K60A 4NZQA 3RXFA 2TPIZ 2W7UA 2QF0A 3QWCH 3TITA 1J14A 4MQAA 1KXAA 3QTOH 5A8ZA 4H6SB 3S7KB 3RXQA 5A2MH 1J9CH 1O3AA 2J38A 1OXGA 2OC8A 2PP6A 2WPLS 1ETRH 2W6JD 2TGTA 5KECA 1GJ5H 1NFWA 1CA0B 2SGQE 4ZROA 3QGNB 4X1PU 1GJ7B 3MNSA 1BQYA 3S0NA 2F9VA 1DVAH 4YT7H 5A8XA 3SNAA 4YOJA 4K1SA 1PJPA 5EJZA 1A46H 4DGJA 4NCYA 4X2XA 2DE8A 3PO1B 3K2UA 2WPKS 1MAYA 1QBNA 1TPSA 2VWNA 3TPIZ 5FAHA 1WOFA 3RMNH 2SGFE 1LVBA 1E1RD 2O8WA 4B2BA 5LPFA 3TK9A 5ABWA 3EYDA 1GI9B 1LKBA 1UHBA 1ZR0A 2HNTE 3EQ0H 4VGCB 3L33A 3SNEA 4OS7A 2OQ5A 5JDUB 5FX6A 4Y8ZA 1O2ZA 4NIWA 4Y71A 4B75A 4Z6AH 1C1UH 4CRDA 3BTGE 4AFQA 1J15A 4BANB 1NO9H 1J8AA 1UCYH 4RSPA 2O8UA 1BRAA 1OWEA 4YXWD 1HAVB 3OAAD 1A5GH 3MU4A 3NCLA 4M7GA 1VKYA 4BTTB 3PRBA 3A7VA 1MU8B 3FFGA 1WSSH 2BLWA 3SBKA 3SU1A 1TA2A 3SO3A 1YF4A 1C1QA 5HMAA 2J34A 1MZDA 3MI4A 1WTGH 3LOXA 3VFEA 2RA0A 1YPKH 4NWKA 1QR3E 5FBEA 1Z1IA 1FDPA 2EI6A 1XXDA 4IC5A 1WCZA 5E0GA 4F4OC 4IC6A 3TGIE 1C9TA 1XXFA 3BIUH 1ABIH 1HDTH 1KMHB 4U01A 4GSOA 4LOYH 2OINA 4AGKA 2L74A 3M3TA 2Q6FA 3CNRA 3QUMP 2PW8H 1ACBE 2ODPA 4R0IA 1EAIA 4ZUHA 2Z9IA 3F2GA 2ZU1A 3ZZ7A 2ZPRA 1QFKH 1THPB 1B7XB 2R2MB 4D8NA 4A5TS 1C5SA 1SSXA 4QT8C 3GICB 2ZTYA 1IOEA 1DLEA 2G81E 1O0DH 2QF4A 1GHAF 1HJ9A 3I78A 5GCHF 2C8XB 3GCHC 4DIIH 1O3BA 4I8KA 4INLA 1A0LA 3E16B 3UOPA 1S0RA 2XCNA 2BDAA 2Y7XA 2VH0A 2AS9A 4ZKOU 4ABDA 1HIAB 1W12U 3PLBA 2H9TH 2ZGBH 2ZHFH 4FUHA 4INHA 3HPTB 1P57B 4Y7AA 1LPGB 3KF2A 1QB6A 4YOGA 5GDSH 1GDQA 1N6XA 3ZZCA 1CU1A 5EQSA 3O8BA 3TNTA 3STJA 1PPGE 3M7QA 1OX1A 1Z6EA 4Y8YA 4E05H 3EA8A 3ATLA 4CREA 3SHCH 3KCGH 2BLOA 3QZQA 1ANCA 1V2MT 4AG2A 1EJAA 2FOAA 5ETXA 1FPCH 4OS1A 3URDA 3H5CB 3RXIA 3PRDA 2NWNA 2QF3A 3VB6A 3KL6A 1UHBB 1XX9A 3I29A 3V7TA 2GT7A 3RXBA 2XRCA 5HIYA 1HAXB 1AUJA 5GJ4B 3A8BA 1BTPA 2QXHA 2A31A 2AEIH 2YMSC 4XRNA 3K65B 1UTKA 2AGIX 1QJ7B 1TX8A 3P92A 1C1VH 3RXOA 1H8HD 1FN8A 2FIRH 1RIWB 1RD3B 1EPTC 1FAKH 4TYDA 1CSOE 1OWHA 1AI8H 1GHVH 1YKTA 3QZRA 2UUYA 2XBVA 1AUTC 1MKWH 4OS5A 3TNSA 1XVMA 2M5TA 2TGPZ 3AVZA 1EASA 3GS9A 1EOJA 1Z8RA 3PM3A 4DCDA 1ZTKA 1JMOH 1HAHH 4JMYA 3MNCA 3P8FA 1XUKA 2OD3B 2HNTC 2ALVA 2XXLA 3DT0H 5H4IB 3RXSA 3E8LA 3QGJA 4ISLA 3SUEA 3ZV8A 1O2LA 1DUAA 3TJNA 2BOHB 2SFAA 1AY6H 2IN2A 3A83A 1UTJA 1QURH 2GV7A 2STBE 4X1SU 3TK6A 1EKBB 3FP6E 4RN6A 2D1JA 1DICA 1C1RA 1A61H 2ZPQA 2ZPSA 2CXVA 2KM0A 1AE5A 1GG6B 2V7QD 3NUMA 5EW1H 3M5NA 3V0XA 2FS9A 1SGNE 4U30A 3D62A 1W8BH 3ZIAD 1QGFA 2ODQA 1O3JA 5FCKA 1RXPA 4WMDA 1FY3A 2Y5GA 5EODA 1KLJH 3V12A 2BD5A 1SI5H 1GI8B 2KR7A 4RT0A 2UUFB 2GZ9A 3HKJB 4Y76A 1CHOG 2CJIA 1QL8A 3WY8A 3SJOA 4NFEA 3UAIC 3UY9A 4K5ZA 4Y6DA 4FETA 1DOJA 1EAXA 2HRVA 3P8OA 2XWAA 1C5NH 2XTTB 3GCOA 4GUXA 2VBCA 3H09A 3LU9B 1GJ4H 1C5ZB 1E0FD 4ABIA 1BRCE 1EJNA 4I8LA 1DLKB 2OC0A 5J4QA 1GBCA 4AX9H 1FV9A 1V2RT 5FBIA 5PTPA 3S9CA 1SLWB 4H42U 1KTSB 3T28A 1CA8B 2AH4X 3L6PA 3OE7D 2FOMB 1D3QB 1GL0E 4Q4LA 5EW2H 1P12E 1BDAA 1QBVH 3ZZ3A 1UTNA 3OTPA 4F55A 3ZVBA 4CHAB 3OSYA 4D9QA 2EQNA 1P2KA 2ZFPH 4MPWA 2Z3DA 3P8NA 4Y0ZE 4A1TA 1D6RA 2CF9H 1ZLRA 1ELDE 1THRH 1DDJA 4CBOA 2VU8E 4MDSA 3K6YA 3RMMH 3LH1A 3ZZAA 2PR3A 1SBWA 1G3DA 2ZFTA 1V2LT 1O33A 1ELBA 1Z6JH 2I6SA 2AGEX 1C1NA 1ANBA 1D3PB 1GI2A 2QN5T 2YNAA 1VJ9U 2VIOA 1A3BH 1HNEE 3BEUA 1HLTH 1E35B 1L2EA 2WPDD 1ELCA 1EAWA 1TONA 1C4Y2 1A3EH 1W0YH 1B0FA 4NA9H 2F4LA 3RXPA 1TX6A 5FPSA 5A0CA 1ELGA 4MPUA 1QHRB 2JJ1D 2P8OC 1SG8B 1GI1A 1NFXA 2FP7B 1B5GH 1SMFE 1TPPA 1MKXK 3TH3H 1DY9A 2A5IA 2HPPH 2WZQA 2VVUA 6CHAB 4HI3A 1GCTC 2FXRA 1UCYK 1E79D 1YC0A 3E3TA 3P6ZB 1NC6A 1QJ6B 3F9EA 1F0TA 4ABGA 2VWLA 4KGAA 5EQQA 3FKSD 1GMCG 1QJ1B 2ULLA 1GHYH 1O38A 2BD2A 4KP0A 3T2NA 1YPHE 1EAUA 2V6NA 1AN1E 3TVJB 1VCPA 4YLQH 5EXNA 1VGCC 2VH6A 3MU5A 3VGCC 5TCCA 2ZQ1A 4TPIZ 4X8UH 3UQVA 1O5FH 2H5CA 4HFPB 3UWIA 1AIXH 4ISHH 3GCNA 3LPRA 1Z1JA 2ZC9H 1EX3A 2HVXA 3F9HA 2VGCB 1QRZA 1D3DB 1GHZA 1TABE 5E2OA 3V13A 4AC9A 1CGJE 1SGFA 1T8NA 2CK3D 3IG6B 1OP2A 2QA9E 1GVLA 3BTHE 1UTOA 2OXSA 2PFEA 3LGTA 1GI7B 4NA7A 3PMAB 3OX7U 2A4GA 2VVCA 4ISIH 1TAWA 2OQUA 1UVTH 4AG1A 1EZXC 1V2VT 1GBLA 3RXKA 4I8JA 2H9EH 2XBWA 2FM2A 2WHXA 5LGOA 5CE1A 3ZVEA 4E7NA 1BUIA 5FX5A 3RU4D 1GHXH 1H9LB 2FYRA 2FI5E 1TOCB 1NTPA 1GJ9B 3IWMA 2JDID 1TMUH 1DT2A 1XMNB 4HGCA 2ZIQH 1AVWA 6ESTA 2PSYA 5LPEA 1GBEA 4O97A 2FESH 3U9AH 1YLCA 3LONA 2AMDA 5L30H 2FOCA 2G51A 3MO6A 1K0HA 2XC5A 5EPYA 2BDHA 5C1YA 2H9HA 3A7WA 1O39A 1YM0A 3PV4A 1C2HA 1K1IA 3RXMA 1CHOF 3PV2A 4B1TA 2A32A 2EI8A 4FUDA 1INCA 1FY8E 1UJ1A 2ZGXH 1KYNA 3GDSA 4A92A 1LVYA 1KXDA 1SHHB 4CRFA 2JETB 2GMTB 3IITA 1FNIA 2GVFA 4B2AA 1MQ5A 2LELA 2HPQH 1ZPCA 3PB1E 2G4UA 3BG4C 2Z3EA 2QCYA 1VITH 1EATA 3A8AA 2VB0A 1G37A 3PO1C 3SI3H 2ZFFH 1OWDA 1HJAB 4CBNA 5HXFA 3UREA 1GWAA 1P9SA 5LPRA 1IHSH 1OHHD 1O30A 4CH8B 1O2HA 1TRYA 1C5VA 2GJGA 3B9FH 3KIDU 2XC4A 4INKA 1O3PB 3MMGA 4X1NU 1IAUA 1O5DH 3MH4A 4VGCC 4OS2A 2BD8A 1EP6A 1K1OA 3SJ8A 2Y7ZA 2EY4C 3A88A 4FUBA 1MTWA 2ZEBA 1H8IH 3FO8D 1PFXC 2R3YA 3UNRA 5FCRA 1OWJA 1ESTA 4NA8A 1OYQA 1AB9B 1O2SA 4TT3D 3A81A 2BX4A 2QE7D 3PROA 1O5GH 4Q63A 2C93B 2RG3A 3LJOA 2FTMA 4R8TB 1Z7KA 1K21H 3VEQB 1GMDG 2WV4A 2C8ZB 2BM2A 3NXPA 3FZZA 4MVNA 3URCA 1GMCF 1K1LA 4O9VA 4WH8A 7KMEH 1S82A 3ZV9A 2F9UA 2XNIA 1YPHC 3R3GB 3UB0A 1KXBA 3VXFH 1AMHA 1WQSA 2IOTA 3MH6A 3MH7A 1P03A 4FXGH 2BDGA 2FO9A 1TBZH 1KSNA 1F5LA 5AVDA 3A7YA 1OWKA 3ITIA 1VZQH 2RCEA 3LGUA 3U8RH 4DJZB 1YWUA 4MNXA 1W11U 1BBRH 3LJJA 1AFQB 2C3SA 1K2I1 1J16A 3BEFB 4RI0A 1DSUA 1AVXA 1C2JA 1V2QT 1QQ4A 5T6GA 1T32A 4LXBH 5C5NA 1JRTA 1F0UA 5BPEA 1P3EA 3E6PH 2EC9H 3U1IB 3ZZBA 1E34B 4Q7ZA 2ZHWH 1Y3UA 1O3LA 3LKWA 4OS4A 3M5MA 3L3TA 1ETTH 2W6ID 3M3SA 1GVZA 3ELAH 1FPHH 4K2YA 2IPQX 1ZMLA 1Y3XA 2ZO3H 3GY5A 4JCNA 4JYTA 3TU7H 1YCPH 1ZTLA 1SGRE 5EQRA 2HNTF 2JIZD 3F2HA 4TPYA 1N8OC 4YM9A 1EQ9A 2J4IA 4AFUA 3BN9A 2C8YB 1FIZA 5EJLA 4Q80A 3RXEA 2HOBA 1NESE 3PTBA 2HVYB 4JK5A 1DE7H 2F9OA 1C2FA 2ZA5A 2Q1JA 1O34A 1EXFA 5CHAB 4KTSA 1W14U 1W0ZU 3A8DA 1LCYA 3UUZA 2SGAA 4ZKSU 3VB5A 4DT7B 1BTZA 5I46H 1A2CH 1MCVA 2P3FH 4AZ2B 2D8WA 1O2WA 1NRNH 1O32A 1Y8TA 4GVUA 1C2LA 3C27B 2R9PA 2ZDLA 1N1LA 1V6DA 3SV2H 1S85A 2ZZUH 3SGQE 2ANYA 3QLPH 1AFEH 3BIVH 1RIWC 3BTWE 1D3TB 1ZJDA 2ZTXA 1O2QA 1NM6A 2ZDAH 2I6QA 1FAXA 1M9UA 4NWLA 9ESTA 4XBDA 3D49H 1SLXB 2BQ7B 4DOQA 1CE5A 1LHDH 1TGBA 5AFZH 4BAKB 1MBQA 3RC5A 2ZFSA 3P95A 2PGBB 2Y5FA 1Z8GA 3E91A 3M3VA 2NU4E 3MNBA 2IJD1 1ZSJA 1P06A 1GBFA 4B76A 2ZDKA 4Y11E 1WAYB 2VWMA 3SHAH 1GDUA 1TB6H 1UVSH 1ARBA 1YPMH 2KX4A 3PMJA 4FU9A 1QRWA 1TNJA 3W94A 2OUAA 1QB9A 5HM9A 1GBIA 4MTBA 2ALPA 1BMFD 5KEDA 1C5PA 4THNH 2V3HH 1UO6A 1C1SA 4H6TA 1C1WH 3EE0B 2BXUH 5FHTA 1IQMA 3ATIA 2FI3E 2BDIA 1BHXF 5DK1A 1O2KA 2XBXA 1SB1H 3VXEH 2G5NA 1DWDH 1HXEH 1SFQB 1GG6C 1HXFH 1FJSA 1HBTH 1FMGA 1T31A 1TLDA 1P05A 4SGBE 3OU0A 2LPRA 1O3IA 2V35A 3GY2A 3W95A 3C1KA 1OS8A 4ZXYH 1TOMH 3FP7E 1PQ5A 3A7ZA 2WUCA 1TNHA 1TYNA 1GBTA 1A0JA 1C1OA 1O2MA 3OTJE 3F1SB 5DP6A 4FUIA 5EU8A 3VB7A 5IK2D 2FZZA 1C2EA 1L1GA 1CQQA 3SNBA 1A0HB 1SGPE 3DHKH 1TX7A 1C2MA 2JKHA 2Z94A 4J2YB 4ZHLU 5DP7A 4BXSA 1ZMNA 2WSSD 3RXDA 1IQNA 3QN7A 1G3CA 2GP9B 2ZHEH 4D7GA 1UCYE 2ILNA 3SN8A 2GV6A 1GJ8B 4O3TA 2B7DH 4CRCA 4X6MA 4X6OA 3RM0H 5I25A 2ASUB 4OGXA 1O2YA 3UIRA 3A84A 4IMZA 4ABEA 1K28D 1NFUA 4BTIB 1TFXA 4AFSA 3UR6A 2XNDD 5GPIB 4ABFA 1BTXA 1UVPA 4K3JA 4Y8XA 2F91A 3M35A 5E0JA 1FXYA 5DGJA 2KCAA 2WUBA 3BEIB 3SGBE 1FI8A 3GCTG 2VIDA 1FZZA 3RLYH 2SGDE 2QAAA 1GI3A 2CMYA 3B23B 3RU4E 2G55A 2Y6TA 4I86A 2P94A 5C0UA 3NKKA 4Y79A 4IMQA 2NU1E 2ZGJA 2Y5HA 3OEHD 3CENA 2W26A 3F0OA 3KGPA 2ZGHA 1HAGE 2BZAA 1C5YB 1SOTA 3D65E 2BZ6H 3GY7A 2A45B 3PV5A 2RDEA 1K1MA 1F5RA 1COWD 6CHAC 3MU0A 5JBCS 4J1YA 1ANDA
chains in the Genus database with same CATH topology
1ZRKA 2W5EA 4ZHMU 3ZYDA 1OKXA 1GBAA 1L1JA 2P16A 2WPMS 1OOKB 3SQHE 3RC6A 3T5FH 4CRAA 1O3HA 4AORA 2Z7FE 3GDVA 5DP8A 5HYOA 2GGVB 1GJ6A 2ZU5A 4IN1A 2PLXA 2BQ6B 2R0KA 2ZCLP 3A82A 1HAZB 1TRNA 1UK2A 3GYLB 1AZ8A 3T26A 3UOUA 2WINI 1MZAA 5JB9S 1EZQA 3UR9A 4ZHAA 2GD4B 1P11E 4NZLA 1EZUC 2O8TA 5SGAE 1TNIA 1TIOA 1TMTH 5TJXA 1XKAC 5T6FA 2BY8X 4AOQA 1XUFA 3BSQA 1SGYE 3RU4T 2IPHA 3FP8E 1GMHG 2TBSA 1Y5AT 3TGKE 1LQDB 5BRRE 1S83A 1JXPA 1W7GH 4X8TH 1S5SA 5G4BA 3K9XB 2G00A 4XSKU 1YPLH 1V2ST 3G01A 4GAWA 3U1JB 1MCTA 3H7OA 3UPEA 5B6OA 5L2ZH 2VWOA 3B8JA 4I33A 4ZKNU 3O8RA 3FANA 1O3CA 3KN2A 2GT8A 4CRGA 4XOJA 1WBGB 3SU2A 4I32A 2D26C 1VCWA 3D23A 3BTDE 1GL1A 4OGYA 1MTNC 2PKSB 5C1UA 3SUFA 4O03A 2GTBA 2C90B 1O2NA 1NS3A 3AW0A 2UWLA 2TRMA 3LGVA 3STIA 2QXJA 1T4UH 2GZ8A 4ISOA 4YO9A 1XUGA 3MU8A 1F7ZA 1NT1A 2BDYA 1G2LA 3Q3XA 2Q6GA 1UK3A 1MD7A 2Y81A 3M5OA 4Q2KA 2Y82A 1AWFH 1BITA 4UFGH 4BAOB 4KTUA 1GCDA 5IYTA 2ZP0H 2HLCA 3TJOA 2JETC 2FI4E 3NZIA 1BT7A 4IS5A 3SJKA 3ENSB 4GCHG 1AWHB 4X2WA 2BY7X 4CR5A 4AYYB 4AFZA 1GVKB 1EUFA 3ZZDA 4A1XA 1X7AC 5DP9A 5E2PA 1RGQA 4B74A 1QRXA 3A7TA 2BY9X 3M36A 1HJAC 1Q3XA 1RTFB 4K1EA 3BTTE 3ZVAA 2WYJA 1YLDA 1O2TA 3M5LA 3PLKA 1O31A 4NIXA 1EB2A 2C8WB 4FUJA 3Q00A 4Y0YE 3ZZ4A 1HGTH 1OWIA 1EJMA 1MD8A 2F83A 2W3KA 5JBTA 1C5OH 1MTUA 2P93A 1FY1A 1YP9A 1CHGA 3GCTF 2Y80A 2ANKH 2OC7A 2XWBI 3K6ZA 1NY22 2BX3A 2R2WU 4BAQB 1O3DA 4NIYA 3ZZ8A 1DWBH 3O8DA 2F9BH 4TY6A 4ABHA 2ZDMA 1V2WT 1UVOA 1LHCH 1XUIA 1P2QA 1P8VC 3SV6A 2ZWLH 2FOGA 2PKAA 2V3OH 4D9RA 4RKJB 2FPZA 1G9IE 2ZECA 2XC0A 5GWZA 2AIQA 1XKBC 2EEKA 1O5BB 4XDEA 1F5KU 3PLPA 4FU7A 2ZFRH 2FOHA 3GY4A 1DY8A 1BMLA 4K8BA 1CO7E 2GDEH 3MO3A 1SL3A 7ESTE 2AMPA 3UWJH 5DP4A 2BDCA 3U69H 4JK6A 3F68H 5F8XA 4ZXXH 3LH3A 4B2CA 1UK4A 1AHTH 2BDBA 3QO6A 2CV3A 1DFPA 1PPFE 2BY6X 1SLVB 3MU1A 3EDXB 5C1XA 1OPHB 4AB9A 5E8EH 1AFQC 5HGGA 4A1VA 5DO4H 1HAIH 1O3NA 4UFDH 1HUTH 2O9QA 3KHVA 1A5IA 2AMQA 3BTME 5C5OA 3UNSA 1GMHF 2BVSH 1UTQA 4XBBA 1W2KH 1O35A 3KQDA 2GCTB 3LGIA 2ZNKH 2DUCA 4U32A 1P10A 2YNBA 3E1XB 3ODDA 1VR1H 5A8YA 1CT2E 8GCHG 1LTOA 4ZKRU 3MYWA 2FLBH 4CRBA 1BTWA 5DP3A 3ZYEA 2VVVA 6GCHG 1BJVA 1GDNA 4WY3A 1CA0C 1LHGH 2ZHQH 1TGNA 2H5DA 3ODFA 3DA9B 4HTCH 3SQEE 8LPRA 1QY6A 3NWUA 2A7HA 3PMBB 1SLUB 2G8TA 1A4WH 4IBLH 2FOEA 5JBAS 2A4RA 1O3MA 1BTHH 5A09A 5CHAC 4I31A 2BTCE 5JBBS 1TALA 1UTPA 2BHGA 2QY0B 5ESTE 2VIPA 2PTCE 1TE0A 1GI5A 2VINA 2A5KA 1P09A 4WXIA 1IQLA 3EGKH 3OY6U 4AGJA 1FIWA 4DIHH 1CT0E 2B9LA 1BJUA 1DS2E 3SI4H 1SPJA 1TGSZ 4GCHF 2P3UB 1W7XH 4TWWA 3SU3A 2KAIA 1IQEA 1GBMA 1TRMA 3PTNA 2AFQB 2OLGA 1MKWK 5FXLA 4CR9A 1TNKA 3RP2A 1GJBB 4ABJA 2PKAB 3T62A 9LPRA 1HV7A 3DD2H 3PWCA 2FOFA 1KLTA 4GPGA 1GBBA 1EB1H 2FTLE 4X1QU 1HPGA 4MNYA 5L6NH 1GI6A 5C3NA 1P01A 3JZ1B 1CBWB 4BOHA 1Y5UT 1N6YA 1HAPH 1BB0B 2C4FH 3ZVFA 3SV9A 1KDQA 4DY7B 4U2WA 5F03A 4ESTE 1VCQA 2O8LA 1ZJKA 3A80A 1SGDE 2H2ZA 4BXWA 1O5AB 3A87A 5EPNA 2ZQ2A 2UUKB 4WMFA 1K1JA 4LZ4B 2G5VA 3RXRA 4GLYA 4JYUH 1Q2WA 1VGCB 5JPMH 1TBRH 1O2RA 2ZCKP 3RXHA 2TGDA 3S9BA 1CVWH 4Y7BA 3LC3A 2J9NA 1MMJN 2ANWA 2XBYA 1H9IE 1UTMA 3LIWA 3SOSA 7GCHG 4UFFH 1Z71A 4ISNA 2BD4A 5A0AE 4KKDA 3M7TA 3S69A 1T4VH 2VIVA 1CGHA 2ZG0H 3QK1A 1SGQE 3BV9B 1S81A 3A85A 1DUEA 1AGJA 3MO9A 2OTVA 3QDZB 3AAUA 1BA8B 2ANMH 1EZSC 2B0FA 5C20A 1IQKA 3TGJE 3EAJA 2XYAA 1MU6B 3A89A 1SGFG 3RXGA 3TJVA 2BD3A 1ORFA 2H1UA 5T3HA 1BOQA 1QNJA 1O5CB 3RM2H 4AB8A 3O8CA 1L0ZA 4MG3A 3MTYA 1MUEB 2PGQB 1P2IA 2FX6A 1HYLA 1LVOA 1HFDA 3SV8A 3PMHB 1DXPA 3DUXH 1P2MA 1V2JT 4MNWA 1XM1A 3M37A 4BNRA 3SZNA 1F92A 2P3TB 3MWIU 1ARCA 4JYVH 4O3UA 1C5UA 2J2UA 1O2UA 1W3CA 2ZKSA 8GCHF 1JIRA 4B73A 1KXEA 2JH6D 2AIPA 3A7XA 1KXCA 1SOZA 1K1NA 1SGEE 1MAXA 4IN2A 6GCHF 2BXTH 2BVRH 1ZGIA 3GY6A 2ODYB 1HAYB 1BRUP 1HIAA 4K1TA 2YOLA 2Z3CA 1O37A 1ZYOA 2STAE 1WU1A 1IQFA 2KAIB 4TWYA 1LMWB 1GHWH 3ZVCA 4CH2B 1BBRE 1QL7A 4FUEA 5C2ZA 2OBQA 1NRRH 3Q3YA 4I7YH 3BG4B 2OC1A 2QXIA 2V0BA 3FAOA 1GGDB 1HRTH 3HGNA 5L2YH 4IW4E 4UEHH 1ZHRA 1G32B 1Y3WA 1T8OA 2B5TB 1G30B 3AW1A 1ESBA 3P70B 1TGCA 2Z9JA 3SNCA 1KDQB 4SGAE 1O3GA 1RRKA 4NGAH 4ABBA 3LGYA 1A1RA 3A8CA 1IQHA 1O3EA 2J95A 4A7IB 1SFIA 1BCUH 2QC2A 1C2DA 3EA7A 1H4WA 3BF6H 1MKXH 1UTLM 1BMMH 1DSTA 4IGDA 5AF9H 8ESTE 2FYQA 1SGCA 3E90B 4FUCA 1NZQH 3CS0A 3KEEA 4X2VA 3TH4H 2A7CA 3T29A 2A1DB 7LPRA 1JIMA 1K22H 4NSYA 4Y10E 5AHGH 1QTFA 3TLOA 1P3CA 4LK4A 1ABJH 1V2TT 1AQ7A 1S6FA 4TY7A 1O3OA 3CP7A 3N7OA 3CS7A 1DPOA 1P0SH 1C2KA 1OYTH 1V3XA 1SQAA 4OS6A 4X0WU 4Q7XA 5FPTA 4Z0KA 4KELA 4X8VH 3UNQA 1JWTA 1DWCH 1GMDF 4F49A 1ANEA 2K1QA 3A86A 1DANH 4DVAU 1Y3YA 1KXFA 2CHAB 1IHTH 1E36B 4JZFH 3TJUA 4AN7A 5JB8S 4NIVA 1LQEA 2ZGCA 5JYIA 3SV7A 3RUOA 3UQOA 1GHBG 1ELEE 1GJCB 3RMLH 2BLVA 7GCHF 2PKSC 1F0SA 1U6QA 3MNXA 1L1NA 2PUXB 1ID5H 1FQ3A 1LPKB 1BTYA 4WXVA 1HCGA 2GX4A 3SU4A 2ZDNA 3ATWA 4I8HA 1QA7A 4E06H 1LDTT 3GYMA 1AD8H 1S6HA 2ESTE 2A4OA 3HGPA 1ELFA 1MQ6A 1OP8A 5TCAA 3SUDA 1GI4A 1MH0A 4DG4A 2UWPA 1YBWA 1BTUA 4X6NA 3HK3B 1ZOMA 3ZZ6A 1WTHD 4CHAC 1QBOA 5HM2A 4FUGA 4WVPE 4AYVB 1P2NA 2G52A 4UE7H 1SHYA 3ESTA 1V2NT 2ZU3A 1IQIA 2F9NA 1D6WA 4UFEH 1DWEH 1SVPA 1NRPH 2VNTA 2OBOA 1E37B 1LKAA 3RXTA 3SJ9A 1A7SA 1N8OB 1FY5A 1YCPM 3KQEA 5IDKA 5LH8A 2VJ1A 2HWLB 5GIBA 3U8TH 3RLWH 1DXWA 5DP5A 5K0HA 3MOCA 5FPYA 4MNVA 2FS8A 2ZFQH 1SQTA 4H4FA 1T8MA 1TQ7B 1T7CA 2Z9LA 1O3KA 1RTKA 2BQWB 1XVOA 1L4ZA 1SGIB 1FY4A 1ELTA 5GXPA 3VPKA 1PPHE 5CMXH 5DKMA 2AGGX 2EI7A 4K69A 2R0LA 4JZIA 3SUGA 2BMGB 1YYY1 1FONA 3HKIB 2CN0H 5A0BA 3LGWA 1G36A 1TPOA 1B0EA 3RXUA 3ZVDA 2A0QB 1H1BA 4LZ1H 1C5QA 4X1RU 1EP5A 1FUJA 2VIQA 1H8DH 1C5MD 3MFJA 2THFB 3MHWU 1SQOA 2O8MA 2VGCC 6LPRA 4WMEA 2F3CE 1EPTA 1ZSLA 2P59A 2UUJB 2WPHS 2QIQA 1KLIH 1O2IA 1GBDA 1AE8H 1LO6A 2Q6DA 3RXVA 1MBMA 1NN6A 1F0RA 3LC5A 4WH6A 5EOKA 1YPEH 1BBRK 2RDLA 1WUNH 2QXGA 3RC4A 1V2OT 4JZEH 1NROH 4I8GA 2P95A 4X8SH 4UDWH 1WV7H 2R3UA 4ASHA 3S7HB 3T27A 4MLFB 3AASA 5J4SA 2AERH 3SU6A 1TNGA 1AKSA 1TQ0B 3U98H 1W10U 3BG8A 3DFLA 3P8GA 2ZTZA 2GCTC 2A5AA 2HALA 1NRSH 1CT4E 1OP0A 3KQBA 1YCPK 2SGPE 1V2KT 4DW2U 1IQGA 5K7RA 1L4DA 1GI0A 1Y3VA 1JBUH 3R0FA 1QCPA 1E38B 1O2GH 1TGTA 1K1PA 3GCHB 2TGAA 3KQCA 5EGMA 1O2PA 1GHBF 2BYAX 3NPSA 2GMTC 1C1MA 1MTVA 3FVFB 1RFNA 1G3EA 4GHQA 3RDZA 1YPGH 2BB4A 2G4TA 2W7SA 3OY5U 3AAVA 1VITG 1FN6A 1QA0A 1P04A 1XUHA 4X6PA 2GZ7A 3ATMA 2NU3E 2SNWA 3HATH 1LPZB 5EG4A 3SNDA 3GY3A 4BAMB 4A6LA 4KTCA 2PV9B 2HGTH 1MTSA 1AO5A 2XW9A 1QQUA 2DE9A 3Q77A 2WV5A 8KME2 1TA6A 4FU8A 1NU9A 1BZXE 4NG9H 2VIWA 2OCVB 1P02A 4WWYA 2JH5D 1JOUB 2ZI2H 4JZDH 3SW2B 1C4V2 2NU2E 2ZU2A 1P9UA 1AB9C 1F2SE 1CBWC 3TH2H 4JZ1A 5ESBA 1TBQH 5DPAA 1ZGVA 4FVDA 3JZ2B 3EA9A 2QGRA 5DJ7A 2GCHG 1SC8U 1EPTB 1PPBH 3ZZ5A 1DITH 3RXCA 1KY9A 1Q31A 1T8LA 1NPMA 1G3BA 3SORA 2PWXA 1Z8JB 2B8OH 2BD9A 3ATKA 2EA3A 1HJ8A 4XFQA 3RXAA 2GDDA 1C1TA 1UVUH 3GDUA 2CF8H 5DG6A 3RXJA 3F9GA 1C2GA 1S84A 4DURA 1P2OA 1RS0A 1O2OA 4YOIA 1ZSKA 1GBHA 2UWOA 1AKSB 1PQ7A 3QTVH 2ZF0H 2D2DA 3OYPA 3M61U 1DM4B 1C4U2 1C9PA 4PROA 4X2YA 1QB1A 3NK8A 1AVGH 1PQAA 2J92A 1J17T 2Z6BD 3PYHA 1ZRBA 3V3MA 2CGAA 4MPXA 1D4PB 1SR5C 4FUFA 2WYGA 4GHTA 1RTLA 3RMOH 3GISB 3SJIA 2FLRH 1C5TA 2IJOB 3H7TA 2H6MA 1G2MA 2ZU4A 3Q3KA 2A2XH 3RXLA 1TPAE 1YGCH 2W3IA 2A2QH 4YT6H 5T6DA 1VJAU 1QL9A 1MTNB 4MPVA 1GBKA 1YPJH 1O5EH 4ZH8A 2BD7A 2PSXA 3U8OH 2WPIS 3SU0A 1TMBH 1ZPZA 1RJXB 4YTAA 2FWWA 3LT3A 2NU0E 4E7RG 4XBCA 4YESB 2PHBA 1UMAH 3QX5H 4BAHB 2OP9A 1PPCE 1LHFH 1XUJA 1Z8IB 1ESAA 1ELAA 1BIOA 3TK5A 1O2XA 2FMJA 1BMAA 3UFAA 1TNLA 1ZTJA 1WQVH 3BTQE 2SNVA 3T25A 3BTKE 2LNCA 3UTUH 4UONA 4ZAEA 4D7FA 1BHXB 1HAOH 2Z9GA 3BTEE 1O2VA 4WF8A 1V2PT 1GGDC 3SGAE 1THSH 1C5WB 4BTUB 3DFJA 3FZDA 1FLEE 2BLQA 1VITF 1LHEH 3LDXH 1H9HE 1ZHMA 2RA3A 3F6UH 1ZZZA 3GOVB 1AZZA 2J94A 1OSSA 1PYTC 1C5XB 4UD9H 4D76A 1NRQH 1P2JA 4ZMAH 5EXLA 2BVXH 1TWXB 1ETSH 2P8OB 2FODA 1PPEE 3E0PB 1PQ8A 1O3FA 3E0NB 1C1PA 1GPZA 4XE4A 2WPJS 1LVMA 1GCTB 1ZMJA 2QV1A 1BMNH 1JRSA 1V2UT 3Q76A 2A7JA 1GJAB 3VB3A 1ZPBA 4NSVA 1C5LH 3F9FA 2ZCHP 1ZHPA 1EOLA 2Z9KA 1W13U 4WJG2 1CGIE 1GBJA 2SGEE