1EAUA

Nonpeptidic inhibitors of human leukocyte elastase. 6. design of a potent, intratracheally active, pyridone-based trifluoromethyl ketone
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PORCINE PANCREATIC ELASTASE
publication title Nonpeptidic inhibitors of human leukocyte elastase. 6. Design of a potent, intratracheally active, pyridone-based trifluoromethyl ketone.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase (serine protease)
total genus 57
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1994-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1eauA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1eauA01
4FVBA 1YC0A 4K1EA 1HAGE 3M5LA 1B0EA 1O33A 3GOVB 2P16A 3RXIA 4ABJA 1C2KA 1YKTA 1IQMA 1NM6A 1FIZA 2OQ5A 4K1SA 1B5GH 2JH0D 2ZGXH 4WMDA 1MBMA 1WTHD 1TOMH 4WMFA 2XRCA 3M35A 3JZ2B 1EATA 1LPGB 5DP4A 1F92A 1LVOA 1XUKA 1V2OT 1Z6JH 1TX8A 1FMGA 1MTSA 1WSSH 2W7SA 4E06H 2OTVA 3BTEE 2A7HA 2BD7A 2ODPA 3ZVDA 3URCA 1XXDA 4B2AA 4AZ2B 2G8TA 2BDYA 2BYAX 1FLEE 3GCNA 3SGBE 1WQSA 1Z7KA 1QA7A 2FDAA 3ATIA 1OXGA 2FLRH 3RXJA 5GXPA 1A3BH 4WWYA 1WAYB 1XVOA 2BDIA 1HV7A 1O2MA 1UCYE 1F0SA 1ZR0A 1C5XB 3TU7H 1S5SA 1W2KH 4U2WA 1P11E 4HGCA 5TCAA 1NFYA 1GBJA 1P03A 5EGMA 5SGAE 1ZTLA 3UR6A 1O5GH 1Q3XA 1V2MT 1OP0A 1A1RA 3TH4H 2XNIA 1BOQA 1W7XH 3VXEH 1O36A 2QCYA 4CREA 1MCTA 4ABBA 3SHCH 1O3AA 1ZTKA 4GCHF 2GMTB 1RIWB 3MU0A 3STJA 2FIRH 4B71A 1ZPZA 1QRXA 1C2IA 4B73A 2P3UB 4GHQA 1FIWA 1WCZA 4HI3A 1FPHH 2YNAA 1BZXE 2R9PA 2GP9B 3ZZ9A 1O3KA 1SGEE 1TRYA 1QJ1B 4FXGH 3EA8A 2TRMA 2IJOB 1ZSLA 4B2BA 1GJAB 3ZZ6A 1ARCA 2I6SA 2XWAA 3EAJA 1LHGH 1PJPA 2PKSC 1CQQA 3DT0H 1GI7B 3UUZA 2YOLA 4XBBA 1JRTA 1LKAA 2ZDVH 1AZZA 2J38A 4BTTB 3ZZ4A 2TIOA 2NU1E 1SFQB 4INLA 2ILNA 2BVSH 1QR3E 2JETC 3EGKH 2F9UA 1CA0B 1NZQH 2CHAC 5FBEA 1C1NA 2A32A 2BX4A 4BXSA 1XM1A 1FN6A 3HGNA 3R0FA 1A3EH 2ZTXA 4A7IB 3RC5A 2XC0A 1ZHPA 2FI5E 3H5CB 2WUCA 1XKAC 1GI5A 3BN9A 2C93B 2K1QA 1DFPA 4INKA 1BTUA 1BRCE 2ALPA 3RXQA 2BQWB 5A0BA 1UVUH 4AN7A 1GJCB 3S69A 4TWWA 1GCTC 1O32A 1K1LA 1F2SE 2ZU5A 3ZZBA 1BB0B 1IQNA 1Q31A 6ESTA 4BAQB 1Y3YA 2HNTE 5L30H 2ZU4A 1O2XA 1TX7A 4UFFH 1GBTA 1ELTA 2PKAA 4WMEA 2AS9A 3SV9A 4MDSA 4GLYA 4D7GA 4MVNA 4MNVA 2R3UA 3F68H 3M36A 1MKWK 5T6FA 3TK6A 1W10U 2F9OA 4HFPB 2QXIA 3EA9A 1IOEA 9ESTA 5EQQA 5A09A 1FI8A 1YYY1 1QGFA 4BAOB 1GI3A 5AFZH 2WPIS 2Y6TA 1FAXA 3VEQB 3V0XA 1AD8H 1BUIA 1AVXA 3K6YA 1V2KT 2BQ7B 4A1VA 3BIUH 4H4FA 3STIA 2PUXB 1GHZA 1TNLA 1GGDC 4ISIH 1EQ9A 5JDUB 1LVYA 1HAYB 1M9UA 3M37A 3E90B 1ELGA 2GZ8A 4FUBA 1HAOH 1YCPK 1AVWA 1GBIA 3PROA 1AO5A 1D6WA 1BBRH 1O2UA 2NU0E 1AFQB 3SORA 2FTLE 1VCQA 4CRCA 1UTQA 3A85A 2ZFQH 1TNGA 5CMXH 4YOJA 3U1IB 3LU9B 1NFWA 1QL9A 1NU7B 2ZFRH 3SU4A 4GAWA 1TONA 2GVFA 3W95A 1LVBA 3SV2H 1NT1A 3UWJH 1DY8A 1CGJE 3ELAH 1J16A 3Q76A 1SPJA 5T6GA 3SGAE 1PYTD 1O3BA 3T28A 3UNQA 3UTUH 1NO9H 2BVRH 3R3GB 1O5AB 4YTAA 3PTBA 3QO6A 4INHA 1O3NA 1K1PA 3VPKA 1L1NA 4BAHB 5G4BA 1QHRB 3ZZDA 4K8BA 4AFUA 4I8JA 1KYNA 2PKSB 4IC5A 4X8UH 3ZZ7A 4KP0A 2DE8A 1W12U 3MHWU 1GMHF 1GI9B 1SLWB 2TGAA 2JETB 4Y79A 2WPMS 1W8BH 1IQHA 2VINA 5HYOA 2CHAB 2SFAA 3M5MA 4J1YA 4E05H 2ZFPH 2F9BH 2P3TB 1HXEH 5C1YA 1O3CA 1HRTH 1BTXA 4Y0YE 1WV7H 1DLEA 2WPLS 1A5IA 3FZDA 1BRBE 5EODA 5TCCA 1PPZA 5EXLA 4MPXA 1DM4B 1EJAA 3AW0A 1AWFH 1O3DA 2AH4X 1MAXA 3TNTA 1QFKH 1O5DH 4IS5A 4Z6AH 1UO6A 4A1TA 1TMBH 3N7OA 1GCTB 1LCYA 4XFQA 2AIPA 1QQ4A 2QYIA 2C4FH 1S83A 3BTDE 1V2JT 3GCOA 3GCHC 1Z8RA 5FCKA 4O3UA 1Z6EA 3BTHE 4AYVB 4FUDA 3RU4T 2H9EH 3ATWA 3MMGA 5ETXA 1SLUB 4NIVA 3F9GA 4MNYA 2CF8H 2BHGA 1JMOH 2HPPH 2PUQH 2JKHA 1O5CB 4OS5A 3PLBA 1GPZA 1OWHA 2PFEA 4CR5A 3O8RA 1LKBA 1XUJA 2Z6BD 1WOFA 2AFQB 4LK4A 1O2LA 1IHSH 4X1NU 1C9PA 3TNSA 1K22H 1RS0A 2EC9H 1DSUA 1O2HA 5EPNA 2XBYA 2XXLA 3VB7A 4JZDH 1SGFG 5A2MH 2OP9A 1NROH 1FY3A 1P3EA 3SJOA 1LQDB 3LGVA 4JYTA 3C27B 1GGDB 4CHAB 4MPVA 1RXPA 5ESBA 3IWMA 2G5VA 2F9NA 5IDKA 2GT8A 4OS6A 2BY5X 2VWNA 1CHOG 3AASA 1MQ6A 2PSXA 1T8NA 1O38A 3GY8A 4FUGA 1ELEE 2ZGHA 5LPRA 4IW4E 2R0KA 2JH5D 4IGDA 4ZHLU 2VIWA 5GPIB 4FVDA 1TWXB 2ZDNA 2WV4A 2ZDLA 1O3LA 1GJ8B 4FU9A 3SO3A 3TH2H 1JXPA 1HFDA 2GZ7A 1AQ7A 1VCWA 1FNIA 4IN1A 1P06A 1OWIA 1O2OA 2XTTB 3GDSA 4ZHAA 1OKXA 1P2IA 1SFIA 1DWDH 1O2QA 3OY5U 4GSOA 2OLGA 2VWOA 4XBCA 1TPOA 2IN2A 1WBGB 1A0JA 2W7UA 3ATMA 3RC4A 1Y59T 3M3VA 2SGQE 3MU1A 2F83A 1O2RA 2V3OH 3E1XB 1AU8A 5HM9A 1DY9A 2ZQ1A 1DT2A 3A8CA 1WYKA 2HRVA 3ZZ3A 1GDQA 1G36A 4ABDA 1Y3VA 5FX6A 3RMNH 2XBXA 5CHAB 4ABFA 3H7OA 4ABEA 1OPHB 2Z3DA 4ABAA 1BHXB 1C5WB 1OWJA 4NCYA 1YPLH 2JH6D 2Z7FE 3T25A 1EB1H 2XW9A 4CRGA 3GY3A 3RXOA 1YCPM 1ZRBA 8ESTE 1THSH 3D49H 1DUEA 1ELVA 4Y8ZA 1KY9A 1TRMA 2Q1JA 4WH6A 1A4WH 2QF0A 1FXYA 5DKMA 4U01A 1C5SA 3PWBA 1SQTA 1EZSC 1SMFE 1UVOA 3ITIA 1O35A 1FUJA 1SVPA 1A2CH 3MNCA 1YLDA 3LT3A 3NZIA 3FVFB 4CRBA 1TMTH 3RXSA 2BY6X 1W3CA 2QC2A 1C2LA 1QY6A 2VGCC 2G55A 2H2ZA 2QA9E 3A8AA 3GISB 2ZTYA 4Y76A 1UK2A 2ZHWH 3RU4E 1W7GH 4CH8B 7ESTE 4SGBE 3RUOA 1AI8H 1AE5A 4AORA 4NSVA 3TGKE 2QXGA 1IQIA 4RKOB 3SUGA 1ZMJA 1CGIE 3U8TH 2HPQH 2WPJS 1HCGA 3BTWE 1QQUA 1AHTH 2A2QH 2FYQA 3GCHB 1GL1A 1OWDA 3EYDA 1GBLA 2BD8A 4D8NA 2HNTC 5K7RA 2Y81A 4IN2A 1ZPCA 1SGQE 1EZUC 1BMNH 4JYVH 2BD2A 3MWIU 3RXKA 1KDQA 3HKIB 3CENA 3LC5A 1CHOF 2FOCA 1A5GH 1V2ST 4GCHG 2AIQA 4Q7ZA 5JBBS 2P95A 1TA2A 2G51A 4Y0ZE 5DPAA 3P95A 3MH6A 2Y82A 4CRFA 4I32A 2QF3A 1QJ6B 2ANWA 3ENSB 1K21H 1GJBB 4K8YA 3VB4A 1HUTH 3M61U 1RRKA 1TAWA 1YF4A 3HKJB 5FBIA 1OOKB 3TH3H 3ZYEA 2OC8A 3MNSA 1JWTA 1KDQB 2NU4E 2VIQA 2A4OA 4NFFA 9LPRA 1NC6A 2AMPA 2QIQA 1UHBA 4B2CA 1GJ9B 2ZZUH 3TJOA 3NK8A 1NY22 1SQAA 4ISNA 1GVZA 1FPCH 1Y5AT 2A45B 4D76A 5BRRE 1FY5A 1Y8TA 5FPTA 1ANDA 2EA3A 4NZQA 3G01A 5CE1A 3S9CA 5AHGH 1UCYH 2QAAA 1V2UT 1VJ9U 2ZEBA 4MPWA 1MU8B 2FOEA 1YGCH 3ZZCA 1K1JA 3E3TA 4F49A 2RA0A 3QN7A 5F8XA 2QY0B 4CBNA 1P57B 4AOQA 1O39A 1G3BA 1EX3A 3RLWH 3U98H 4YT7H 2KAIB 4ZKNU 2XC4A 3CP7A 5E2OA 1UHBB 2A1DB 2VJ1A 4CR9A 1GWAA 2ZFTA 1C5TA 1HBTH 1YPHE 3DUXH 1Y3XA 1MAYA 4K3JA 4AG2A 2J92A 2P3FH 2OCVB 1IQJA 1ZHRA 2VWLA 1SB1H 1A46H 3QDZB 2P93A 2FODA 4MTBA 5EQRA 2BZAA 1V6DA 4YZUA 3VGCB 2OINA 3LC3A 5ESTE 4YESB 1LQEA 2Z9KA 1V3XA 2QGRA 3P92A 3P8FA 1C5YB 2A5AA 5LPFA 2D2DA 3Q3YA 1EAWA 3FFGA 5EG4A 1PPCE 2BOKA 1SOTA 1XKBC 4X6MA 3F6UH 2R2MB 1DDJA 3QX5H 1UTMA 1GI0A 4ESTE 3S9AA 1QIXB 1AFQC 2CN0H 4WF8A 4R0IA 1BRUP 4YM9A 4ZHMU 5DGJA 2VGCB 1HPGA 1U6QA 2OC1A 3TJNA 2PTNA 2BB4A 2EI8A 1DWBH 5HM2A 4CBOA 3MTYA 2P59A 2TPIZ 3LGUA 2P94A 1C5RA 4CH2B 4TPYA 1C2GA 2BX3A 3SJ9A 4NG9H 3K2UA 2ZNKH 1J8AA 1C5UA 4ABIA 3VB3A 2F9VA 1F5RA 1E35B 1MH0A 4X2XA 4X6NA 3M5NA 3LKWA 1GMCF 1V2NT 1ETRH 2BVXH 3T27A 2SNWA 2FOFA 1BHXF 2FOGA 2ZTZA 1LPZB 3NWUA 2GCHG 1HLTH 2AGGX 3GY5A 3I29A 2VB0A 3SQEE 3NKKA 3TJUA 4AG1A 4FUCA 1NU9A 1SL3A 1C1QA 3LGYA 4DW2U 1P2OA 1EB2A 4Y8YA 3LIWA 1D3QB 1HAVA 2IOTA 1E37B 1GHXH 1KXBA 3SGQE 5C1XA 1PQ5A 2FO9A 1NESE 1XUIA 3E91A 1O3JA 3SNBA 1ZSKA 1O3IA 5FPYA 2A5IA 3H7TA 3MYWA 1MBQA 3PLKA 2TGDA 1P3CA 4GUXA 2WYGA 4I8GA 1O5BB 5F8TA 1AVGH 4R8TB 1ETSH 4M7GA 3VB6A 2NU2E 2G00A 2ZKSA 1O3OA 1ELDE 2UUKB 2FX6A 2C8XB 5T3HA 1BIOA 2A4GA 5GJ4B 3O8DA 6LPRA 4XDEA 1SBWA 3AAVA 4JK6A 4ABHA 4DOQA 1TE0A 1GMHG 1TBRH 1GBCA 1OP8A 1FAKH 1BTHH 3A86A 1P2NA 1HAHH 2FOMB 3OYPA 4K1TA 1C4V2 5E0JA 2G81E 1ZTJA 1XX9A 3UY9A 3M3TA 1O2KA 1BTZA 2BM2A 3RXBA 4X2YA 2AGIX 2G4TA 2VNTA 1VCPA 4J2YB 1W0ZU 1NS3A 2VVUA 3SV8A 4WXVA 4JMYA 2GD4B 2AMDA 3E0PB 1D3TB 3V12A 4Y11E 1TNIA 3E16B 3RMMH 4AB8A 3EA7A 4F4OC 5AF9H 1MCVA 1JRSA 1MD8A 4AFSA 2D1JA 3BIVH 1VITH 2ANKH 1C1RA 3BTFE 1MQ5A 1DICA 1KXFA 3JZ1B 1ZGIA 2ZDAH 4X1PU 2BY9X 2Y5FA 3SV7A 2ZQ2A 2J94A 1ELFA 5L2YH 2BOHB 3PMHB 4CRDA 4DGJA 3K6ZA 3S0NA 1K1IA 1QB6A 1V2TT 5C3NA 2BD9A 1QBVH 1SC8U 5HMAA 2PKAB 1LHDH 1X7AC 4BXWA 1UJ1A 4CHAC 2J95A 4UFEH 3QTOH 1O2IA 1SSXA 4UEHH 1TQ0B 5AVDA 3UIRA 1NRRH 2PTCE 2ULLA 5DG6A 2DE9A 1GI4A 1S0RA 3MU5A 1FY8E 1SOZA 2J34A 2Y5GA 3LDXH 5HXFA 1E38B 2XBWA 1G2MA 3SU0A 2ODQA 4A6LA 1HGTH 1TA6A 1D9IA 2FOHA 5A0CA 1H9LB 1OP2A 1C1OA 4LZ1H 2GCHF 2FOBA 5BPEA 3LH3A 1AY6H 1XUFA 1EAXA 1AUJA 1RJXB 1O2YA 4HZHA 5E0GA 2ZHEH 2FTMA 1P8VC 1QBOA 2AYWA 1C1MA 1MTNB 2B9LA 4X1SU 3ZVBA 5FX5A 3AVZA 3KIDU 4THNH 3E6PH 2BLVA 1S81A 1SGFA 1VJAU 1EP5A 4OS7A 3M3SA 1SGYE 3ZV9A 1O2TA 1G3DA 4GHTA 1VITG 1N8OB 5CHAC 5GWZA 2BDAA 1EJNA 1NFXA 1OYTH 2UUFB 4I31A 3RM0H 4AGKA 4Y6DA 4ASHA 1J14A 1T7CA 4AGJA 5TJXA 2FEQH 3U8RH 3ZVEA 3IG6B 2OD3B 2FLBH 3BTGE 2Z3CA 3PV4A 2BD5A 1O2NA 1GBBA 2BD4A 2W26A 1Y5BT 2V6NA 1Y5UT 1C5LH 3A84A 3CS0A 1AZ8A 4UONA 2FWWA 1KTSB 4UFDH 2CF9H 1D3PB 3RXHA 1O2PA 2VIDA 1GDUA 1LTOA 1S84A 1GI1A 3RXAA 1UVSH 3RXEA 3P6ZB 1QB1A 2A7CA 3MOCA 3UNRA 1B7XB 1CT0E 4FU7A 1KIGH 3ZYDA 5A8ZA 1UTNA 1TYNA 2SGPE 1LO6A 1H8IH 1T31A 2D8WA 2ESTE 2PW8H 2Q6DA 1G3EA 1O30A 2FX4A 2D26C 1AKSA 1HAZB 1Z1IA 3PO1C 2W3IA 6CHAC 3SU6A 1AUTC 1K1MA 4ZKSU 1WU1A 2V35A 3ESTA 4TWYA 1F0RA 2NWNA 3SN8A 4TY6A 1YPKH 2G52A 1O37A 2B7DH 1C2JA 1ZSJA 2Y7ZA 1DANH 3SJIA 1NFUA 3QWCH 1GJDB 1SGCA 1D4PB 1UTLM 3I78A 4FUHA 3T2NA 1YPHC 2Y7XA 5EXNA 2BLQA 5GCHF 2OBQA 1LDTT 5F6MA 5JB9S 2ZGBH 1C5PA 5C20A 1AKSB 3Q3KA 3S9BA 2Z9IA 4DJZB 3MU4A 2A4RA 2QXJA 1T4UH 1O0DH 4B1TA 1JIRA 1BJUA 4I8HA 4DT7B 2BLOA 3NUMA 4B74A 1K2I1 1ELCA 1SLXB 1PPFE 2BDCA 5EU8A 3RP2A 1MUEB 3F9FA 3PWCA 2B0FA 4X6PA 3FAOA 4X2WA 3SUFA 1HJ9A 2ZU2A 4LZ4B 2EEKA 2J9NA 8LPRA 1O2VA 4UD9H 3A8DA 1GG6B 1TB6H 1AN1E 4Y7AA 3SI3H 1ORFA 5EOKA 3NPSA 1NRSH 1TOCB 1VITF 4NSYA 3LJJA 3TGJE 1A5HA 1LHEH 3U1JB 1WTGH 2FPZA 1DE7H 3UR9A 3A82A 1PPBH 3D65E 4MNXA 1P2MA 2QV1A 2WINI 3RXGA 1EZQA 1F0UA 2CGAA 1EZXC 3F9EA 2I6QA 3K9XB 3F9HA 2XCNA 2FI4E 2VIPA 2C8YB 2ZPSA 1C2HA 1GI2A 5DP9A 1ZJKA 4H6TA 1P2JA 1O2ZA 1MTVA 1QB9A 1L0ZA 3PLPA 1W13U 5L2ZH 1BITA 1DSTA 3EE0B 1A61H 2O8TA 2XC5A 1TGCA 2RG3A 1MZDA 3KGPA 3VGCC 1QRZA 4ISHH 2FM2A 1GI8B 1MTUA 1TLDA 4YOIA 1CU1A 1HAXB 1MKWH 3FP6E 1BJVA 1AB9C 5FCRA 2BXTH 3RM2H 2Z94A 3RXDA 1QL7A 1IHTH 1ZYOA 4VGCB 1BA8B 3MNBA 1A0LA 2B5TB 3RXFA 2UWLA 1C1TA 1YBWA 3P8OA 3RXTA 1T8OA 4H6SB 4H42U 5DO4H 3U8OH 4DIHH 3FP7E 5C5OA 2J2UA 1PFXC 7LPRA 2A7JA 2LPRA 4NGAH 1GBAA 2A4QA 2A31A 5LH8A 3TLOA 3HATH 4RN6A 1C5MD 1GBFA 1O2WA 1BRAA 2CMYA 4WVPE 1TMUH 2NU3E 5T6DA 5EPYA 3KQCA 3BTTE 3D62A 3PO1B 1P2KA 3RXLA 3TK9A 5GDSH 6CHAB 2ZIQH 1J17T 1P0SH 3VB5A 4LXBH 4O9VA 2ZU1A 1JOUB 1GVLA 1QTFA 1DVAH 1GJ7B 1E34B 1J9CH 4MPUA 1UTKA 1TGTA 1TNJA 1P9UA 2O9QA 4Y10E 1P12E 3ZZ5A 4NFEA 2DUCA 2WPKS 3GDVA 4DCDA 1O3PB 1A7SA 2ZDMA 3TPIZ 4Y7BA 2AEIH 2ANYA 3BTQE 4NZLA 2V0BA 2G4UA 1QNJA 2HGTH 2ZPRA 5LGOA 3MNXA 3FZZA 2SGDE 3V7TA 2EI7A 1GCDA 3MFJA 1GBHA 1GMCG 8GCHG 3P8NA 5FPSA 4TYDA 1DPOA 2H5CA 1THRH 3LGTA 3Q77A 3VXFH 2ZPQA 5A0AE 1SHYA 1P09A 4WH8A 4ZUHA 1Z8JB 1E36B 4O97A 2ZU3A 1KXCA 4IMZA 1ESAA 1GMDF 2AGEX 2A0QB 2R0LA 3SOSA 1INCA 3OU0A 3KL6A 1C2EA 3ODDA 1BBRK 4FUFA 1O3HA 1C5NH 4X8VH 1PYTC 5E2PA 3ZV8A 3A80A 5F8ZA 1TBZH 3SJ8A 1HJAC 1SHHB 1SG8B 1GBDA 1H9HE 4B76A 1TGNA 1GL0E 1BDAA 3RC6A 4WY3A 3TK5A 2CV3A 3DFLA 5IYTA 1FV9A 2Y5HA 1HB0B 2FS8A 1AE8H 1OS8A 4NIWA 3ZVAA 3ZVFA 4YLQH 5C1UA 2STBE 1MD7A 3GYLB 4A92A 2VVCA 2ZP0H 5PTPA 5FAHA 4YOGA 2ZCHP 3KHVA 1IQFA 4U32A 2RA3A 3RXMA 1FY4A 2WYJA 1O3FA 3PB1E 3B23B 2AMQA 1CE5A 1TRNA 3IITA 3QZQA 1DITH 4BOHA 1RGQA 5LPEA 1O2JA 2A5KA 1KXDA 3OX7U 2Z3EA 2ZDKA 3P17H 1P05A 4UFGH 1ESTA 4I33A 3FP8E 1F5LA 3PMAB 4OGXA 4U30A 1DOJA 1EP6A 3M7TA 1BMMH 4FUEA 4GVUA 3A87A 4JZEH 2F9PA 1DWEH 2P8OC 2XCFA 1C5OH 1KLIH 4MNWA 1SGPE 1TPAE 4K5ZA 2BDGA 3TGIE 1PPGE 3MH7A 1AB9B 3A7XA 1NRQH 3GICB 1CT4E 4FU8A 1CO7E 2QN5T 2Z9GA 1A0HB 3V3MA 1G37A 1SGDE 3T5FH 2OC0A 3A7ZA 8KME2 1O2SA 1N6XA 1IQKA 1GBEA 1GDNA 1TX6A 3SU5A 1W14U 3TJVA 3AAUA 1JIMA 1UVPA 3BEFB 3Q3XA 5H4IB 3GY6A 3KF2A 2FS9A 3A83A 1O31A 1BMAA 4WXIA 1S0QA 1C2DA 3SNEA 3ATKA 2PV9B 1FJSA 1BCUH 2ZA5A 4SGAE 4ISOA 3OSYA 5EXMA 1LHCH 1MTNC 2XYAA 3SU2A 1V2WT 2TGTA 8GCHF 1RFNA 1NPMA 4MLFB 1TGSZ 1PPEE 3RLYH 3BEUA 1V2LT 3SU1A 1P01A 2BDHA 1ELAA 5J4SA 4CRAA 4X8TH 1YPGH 4Z0KA 4AYYB 1F0TA 3SUEA 3SV6A 3DFJA 3A7TA 4JCNA 4AFZA 1AGJA 1QA0A 1THPB 2C8ZB 1GHVH 1N8OC 5JBCS 3SNAA 3ZVCA 3SUDA 3T29A 4ZROA 3DHKH 1RTFB 3UOPA 2FYRA 1EASA 2PLXA 4ZKRU 3SJKA 3ZZAA 4A5TS 5DP3A 3PMJA 3MU8A 2SGFE 1TALA 4UE7H 1FN8A 5HGGA 3U9AH 1LVMA 2BY7X 3UQVA 1CHGA 3TVJB 3B9FH 3SNCA 2WUBA 7GCHG 2AERH 1EPTA 1C9TA 2GDDA 1EUFA 1HIAA 3E0NB 2SGAA 3QK1A 1P9SA 3DD2H 4KTUA 2ZWLH 1C1WH 1NN6A 1XXFA 2Y80A 3ATLA 2RDLA 3QUMP 2FMJA 1EAIA 2QXHA 1HJAB 3P8GA 2THFB 1HAIH 1HAVB 1GHBG 3AW1A 3BF6H 3GYMA 1W0YH 4O03A 1TBQH 3UQOA 1UTJA 3A88A 4AB9A 2R3YA 2ZCKP 4UDWH 3TITA 2TGPZ 5JYIA 2GCTC 1ACBE 3MO6A 5FXLA 1S6HA 2VH0A 1CA8B 1TPSA 3GCTG 1EPTB 3LGIA 1Z1JA 2C90B 1Z8IB 1HIAB 1EJMA 1L4DA 2F91A 2IPHA 3A89A 3I77A 1ZLRA 1ZRKA 2BD3A 4DG4A 3UOUA 3LGWA 1C5VA 6GCHG 1ANCA 1ABJH 3RXRA 1C1UH 2C8WB 2STAE 3C1KA 4Q7XA 4RSPA 2Q6GA 1KLJH 2H9TH 4K60A 1S82A 5EQSA 1GI6A 3S7KB 4BAMB 2FZZA 1BTYA 2WV5A 1BQYA 1H4WA 1T32A 1IQGA 1BTWA 2P8OB 2O8MA 3BEIB 1G3CA 2GV6A 1DXWA 4X8SH 1G2LA 1H9IE 4AFQA 3P70B 1QBNA 2V3HH 3LH1A 2O8WA 1MKXH 4BAKB 2BXUH 1SLVB 1TABE 5GCHG 4JK5A 4X2VA 3MO3A 1GJ5H 1FY1A 3A7WA 1ZOMA 1L1JA 1TPPA 1ABIH 2OBOA 2M5TA 2Q6FA 4DVAU 1F5KU 1K1OA 2O8LA 2ZECA 5L6NH 3BG4C 4Y71A 1GG6C 1MTWA 3B8JA 4LOYH 3RXCA 3U69H 1YM0A 2TBSA 2GZ9A 4YO9A 4ZMAH 3RDZA 1V2RT 1C2MA 4YT6H 1TGBA 4X0WU 1XUHA 3FANA 5J4QA 1YPMH 1O3MA 2C3SA 1HNEE 2HWLB 2PHBA 1YPJH 2UUYA 1D6RA 1Y3UA 2VVVA 3HPTB 4OS1A 3L33A 3RXUA 2R2WU 1SGTA 5C67A 3O8CA 5K0HA 1O3GA 4JZIA 2BZ6H 7GCHF 1CBWC 2B8OH 3GY7A 2OUAA 4XE4A 3BTKE 3BTME 3GY2A 1AFEH 1OX1A 3L6PA 3T26A 3SW2B 1O34A 1QRWA 2ZGJA 1T8MA 3A7VA 4Q2KA 4BTIB 4KTSA 5A8YA 1J15A 1GBMA 1UK4A 3BG8A 2FOAA 1L2EA 2ZC9H 4E7NA 3UPEA 1YLCA 1GHAG 1FDPA 1GHBF 4B75A 1UK3A 4JZ1A 1UVTH 1QJ7B 2GX4A 3EQ0H 2BTCE 4Q7YA 1IQLA 1DX5M 1MMJN 1BBRE 4O3TA 1CGHA 1Y3WA 2HLCA 4NWKA 5DJ7A 1L4ZA 5FHTA 1T8LA 4VGCC 3GCTF 3ODFA 1QCPA 1KXEA 4NIXA 2W5EA 2BY8X 4I8KA 4OS2A 2VH6A 1JBUH 2GGVB 5GIBA 5I25A 3ZVGA 4KKDA 3KEEA 5JBAS 3KQBA 1TNHA 4OS4A 3DA9B 6GCHF 2ZCLP 4BNRA 2GV7A 4DURA 2GDEH 2YNBA 5DP5A 4I7YH 3GDUA 1ZMLA 2FI3E 1ID5H 4MQAA 3RMLH 1PPHE 1Q2WA 2HNTF 4IC6A 1FONA 2ZHDA 4NIYA 2GCTB 4JZFH 4A1XA 5A8XA 3O8BA 1UCYK 1C5ZB 1S6FA 1FQ3A 2FESH 1G9IE 1KLTA 3HK6B 2ODYB 3UWIA 3UNSA 4K69A 3MH5A 4D9QA 1DXPA 3RMOH 2ZI2H 3V13A 2VIVA 2RCEA 3OTJE 1S85A 1O3EA 4QT8C 2FP7B 4IMQA 5JB8S 3CS7A 1QURH 1RTLA 4OGYA 1DWCH 5JPMH 1OSSA 3LJOA 1GHWH 1PQ7A 3SHAH 3KCGH 3QZRA 1SR5C 1P04A 4K2YA 4NA8A 3BSQA 2PWXA 3HGPA 2GT7A 1Z8GA 1B0FA 1OYQA 4TY7A 1BT7A 4AX9H 2PGBB 4IBLH 1AWHB 1XMNB 2UUJB 2LNCA 2SNVA 1SGIB 3SBKA 4NWLA 4Y8XA 4ZAEA 2ZO3H 2GKVE 3RXVA 1EXFA 1L1GA 3W94A 1LHFH 1ZPBA 1DS2E 1O2GH 2W3KA 2UWOA 1BMLA 1VGCC 3EDXB 3MH4A 3BG4B 1QL8A 2HOBA 2A2XH 1GVKB 2ZFFH 5ABWA 1C1SA 1ESBA 2O8UA 1SGNE 3ZZ8A 4XBDA 4DY7B 2VIOA 4E7RG 4KTCA 4X1QU 1V2QT 1GMDG 1TNKA 2ZGCA 2F3CE 4X6OA 1GHAF 1BTPA 3SNDA 1P10A 2ZG0H 2VWMA 1HAPH 3L3TA 1ARBA 3M7UA 2BDBA 1LMWB 1UMAH 1Z71A 1CBWB 1E0FD 1EAUA 2SGEE 5E8EH 1C4U2 1H8DH 3UREA 3KQEA 1NTPA 3WY8A 2H6MA 4MG3A 3Q00A 4ZXYH 1IAUA 3QGNB 4YLUA 1UTOA 2ZFSA 1SGRE 1YPEH 1EOJA 3BV9B 4FUIA 1T4VH 3A7YA 1G32B 3S7HB 1UTPA 1VR1H 5E0HA 1NRPH 2H5DA 1RD3B 5DP7A 1YP9A 1FZZA 4FUJA 2ASUB 1CSOE 1TFXA 4NA9H 1C4Y2 1AIXH 1EKBB 1KXAA 1SI5H 1K1NA 3SI4H 4Q80A 2VU8E 3LOXA 5DP6A 3LONA 1YCPH 1AMHA 4ZH8A 3UFAA 5DK1A 3PMBB 3GY4A 2FXRA 4TPIZ 1GJ6A 1HDTH 3LPRA 4BTUB 2XBVA 2WPHS 4JYUH 1ZGVA 2GTBA 5JBTA 3M7QA 3OY6U 4I8LA 4X1RU 7KMEH 2PGQB 3MI4A 4XOJA 2H9HA 4XSKU 3T62A 1H1BA 3PYHA 5B6OA 5AFYH 3KN2A 4NA7A 1OWKA 1RTKA 2ZHFH 2BQ6B 3SU3A 1IQEA 1F7ZA 1ETTH 5C5NA 1ZJDA 2GMTC 1RIWC 2PSYA 3PM3A 2J4IA 4KGAA 3M5OA 1EOLA 2CXVA 4GPGA 4ISLA 4KELA 4WJG2 1WQVH 1VZQH 2HVXA 2EI6A 2BLWA 1ANBA 1O5FH 1TIOA 1ELBA 5DP8A 3SZNA 3NXPA 3RU4D 2ALVA 1HXFH 1ZMNA 1C2FA 1N6YA 3HK3B 3D23A 3RXPA 4D9RA 2OXSA 1XUGA 4DIIH 1G30B 3A81A 4PROA 1ZHMA 1PQAA 2ZF0H 2XWBI 3VFEA 1GBKA 1ANEA 3MO9A 1PQ8A 2Z9JA 1TQ7B 1HJ8A 5C2ZA 1NRNH 1C5QA 1OWEA 2OQUA 1HYLA 1MKXK 2CJIA 3K65B 5F03A 2ZHQH 2UWPA 1C1VH 2G5NA 1MZAA 1V2PT 1ZZZA 2HALA 1XVMA 1DUAA 1O5EH 3PTNA 1V2VT 3KNXA 1CA0C 1VGCB 1K9OE 1W11U 3TIUA 5EW2H 1WUNH 4HTCH 3QGJA 1DLKB 4D7FA 3QLPH 4RKJB 3QTVH 2KAIA 1CT2E 1K28D 3URDA 5I46H 3A8BA 3KQDA 1GHYH 1GJ4H 2BMGB 1LPKB 3SQHE 2H1UA 1P02A 1SQOA 1D3DB 1KTTB 1KSNA 3NCLA 1C1PA 4BANB 1N1LA 1EPTC 1P2QA 2ANMH 4ZXXH 3E8LA 4ZKOU 4ABGA 2Z9LA 1CVWH 3F1SB 2PR3A 1MU6B 2OC7A 5EW1H
chains in the Genus database with same CATH superfamily
4FVBA 1YC0A 4K1EA 1HAGE 3M5LA 1B0EA 1O33A 3GOVB 2P16A 3RXIA 4ABJA 1C2KA 1YKTA 1IQMA 1NM6A 1FIZA 2OQ5A 4K1SA 1B5GH 2JH0D 2ZGXH 4WMDA 1MBMA 1WTHD 1TOMH 4WMFA 2XRCA 3M35A 3JZ2B 1EATA 1LPGB 5DP4A 1F92A 1LVOA 1XUKA 1V2OT 1Z6JH 1TX8A 1FMGA 1MTSA 1WSSH 3OTPA 2W7SA 4E06H 2OTVA 3BTEE 2A7HA 2BD7A 2ODPA 3ZVDA 3URCA 1XXDA 4B2AA 4AZ2B 2G8TA 2BDYA 2BYAX 1FLEE 3GCNA 3SGBE 1WQSA 1Z7KA 1QA7A 2FDAA 3ATIA 5KGOA 2EY4C 1OXGA 2FLRH 3RXJA 5GXPA 1A3BH 4WWYA 3SZEA 1WAYB 1XVOA 2BDIA 1HV7A 1O2MA 1UCYE 1F0SA 1ZR0A 1C5XB 3TU7H 1S5SA 1W2KH 4U2WA 1P11E 4HGCA 5TCAA 1NFYA 1GBJA 1P03A 5EGMA 5SGAE 1ZTLA 3UR6A 1O5GH 1Q3XA 1V2MT 1OP0A 1A1RA 3TH4H 2XNIA 1BOQA 2KM0A 1W7XH 3VXEH 1O36A 2QCYA 4CREA 1MCTA 4ABBA 3SHCH 1O3AA 1ZTKA 4GCHF 2GMTB 1RIWB 3MU0A 3STJA 2FIRH 4B71A 1ZPZA 1QRXA 1C2IA 4B73A 2P3UB 4GHQA 1FIWA 3W1EA 1WCZA 4HI3A 1FPHH 2YNAA 1K0HA 1BZXE 2F4LA 2R9PA 2GP9B 3ZZ9A 1O3KA 1SGEE 1TRYA 1QJ1B 4FXGH 3EA8A 2TRMA 2IJOB 1ZSLA 4B2BA 1GJAB 3ZZ6A 1ARCA 2I6SA 2XWAA 3EAJA 1LHGH 1PJPA 1H8ED 1CQQA 2PKSC 1GI7B 3DT0H 3UUZA 2YOLA 4XBBA 1JRTA 2KX4A 1LKAA 2ZDVH 1AZZA 2J38A 4BTTB 3ZZ4A 2TIOA 2NU1E 1SFQB 4INLA 2ILNA 3DSGA 2BVSH 1QR3E 2JETC 3EGKH 5T1VA 2F9UA 1CA0B 1NZQH 2CHAC 5FBEA 1C1NA 2A32A 4I86A 2BX4A 4BXSA 1XM1A 1FN6A 3HGNA 3R0FA 1A3EH 5C0UA 2ZTXA 4A7IB 3RC5A 2XC0A 2YMSB 3ZIAD 3OEED 1ZHPA 2FI5E 3H5CB 2WUCA 1XKAC 1GI5A 3BN9A 2C93B 2K1QA 1DFPA 4INKA 2JDID 1BTUA 1BRCE 2ALPA 3RXQA 2BQWB 5A0BA 1UVUH 4AN7A 1GJCB 3S69A 4TWWA 1GCTC 1O32A 1K1LA 1F2SE 2ZU5A 3ZZBA 1BB0B 1IQNA 1Q31A 6ESTA 4BAQB 1Y3YA 2HNTE 5IK2D 5L30H 2W6JD 2ZU4A 1O2XA 1TX7A 4UFFH 1GBTA 1ELTA 2PKAA 4WMEA 2AS9A 3SV9A 4MDSA 4GLYA 4D7GA 5C17A 4MVNA 4MNVA 2R3UA 3F68H 3M36A 1MKWK 5T6FA 3WW7A 3TK6A 1W10U 2F9OA 4HFPB 2QXIA 3EA9A 1IOEA 9ESTA 5EQQA 5A09A 1FI8A 1YYY1 1QGFA 4BAOB 1GI3A 5AFZH 2WPIS 2Y6TA 1FAXA 3VEQB 3V0XA 1AD8H 1BUIA 1AVXA 3K6YA 1V2KT 2BQ7B 4A1VA 3BIUH 4H4FA 3STIA 2PUXB 1GHZA 1TNLA 1GGDC 4ISIH 1EQ9A 5JDUB 1LVYA 1HAYB 1M9UA 3M37A 3E90B 1ELGA 2GZ8A 4FUBA 1HAOH 1YCPK 1AVWA 1GBIA 3PROA 1AO5A 1D6WA 1BBRH 1O2UA 2NU0E 1AFQB 3SORA 2FTLE 1VCQA 4CRCA 1UTQA 3A85A 2ZFQH 1TNGA 5CMXH 4YOJA 3FOAA 3U1IB 3LU9B 1NFWA 1QL9A 1NU7B 2ZFRH 3SU4A 4GAWA 1TONA 2GVFA 3W95A 2F43B 3OE7D 1LVBA 3SV2H 1NT1A 3UWJH 1DY8A 2K0QA 1CGJE 3ELAH 1J16A 3Q76A 1SPJA 5T6GA 3SGAE 1PYTD 1O3BA 3T28A 3UNQA 3UTUH 1NO9H 2BVRH 3R3GB 1O5AB 4YTAA 3PTBA 3QO6A 2WV9A 4INHA 1O3NA 1K1PA 3VPKA 1L1NA 4BAHB 5G4BA 1QHRB 1NBMD 3ZZDA 4K8BA 4AFUA 1YY3A 4I8JA 1KYNA 2PKSB 4IC5A 4X8UH 3ZZ7A 4KP0A 2DE8A 1W12U 3MHWU 1FX0B 1GMHF 4F48B 1GI9B 1SLWB 2TGAA 2JETB 4Y79A 2WPMS 1W8BH 1IQHA 2VINA 3PV2A 1EFRD 5HYOA 2CHAB 2SFAA 3M5MA 3U28C 4J1YA 4E05H 2ZFPH 2F9BH 2P3TB 1HXEH 5C1YA 3VG8A 1O3CA 3UB0A 1HRTH 1BTXA 4Y0YE 1WV7H 1DLEA 2WPLS 1A5IA 3FZDA 1BRBE 5EODA 5TCCA 1PPZA 5DN6D 5EXLA 4MPXA 1DM4B 1EJAA 3AW0A 1AWFH 1O3DA 2AH4X 2PP6A 1MAXA 3TNTA 1QFKH 1O5DH 4IS5A 4Z6AH 1UO6A 4A1TA 1TMBH 3N7OA 1GCTB 1LCYA 4XFQA 2AIPA 1QQ4A 2QYIA 2C4FH 1S83A 3BTDE 1V2JT 3GCOA 3GCHC 1Z8RA 5FCKA 4O3UA 1Z6EA 3BTHE 4AYVB 4FUDA 3RU4T 2H9EH 3ATWA 3MMGA 5ETXA 1SLUB 4NIVA 3F9GA 4MNYA 2CF8H 2BHGA 1JMOH 2HPPH 2PUQH 2JKHA 1O5CB 4OS5A 3PLBA 1GPZA 1OWHA 5C94A 2PFEA 4CR5A 3O8RA 2IJD1 1LKBA 1XUJA 2Z6BD 1WOFA 2AFQB 4LK4A 1O2LA 1IHSH 4X1NU 1C9PA 3TNSA 1K22H 1RS0A 4DT4A 2EC9H 1DSUA 1O2HA 5EPNA 2XBYA 2XXLA 3VB7A 4JZDH 1SGFG 5A2MH 2OP9A 1NROH 1FY3A 1P3EA 3SJOA 1LQDB 3LGVA 4JYTA 3C27B 1GGDB 4CHAB 4MPVA 1RXPA 5ESBA 3IWMA 2G5VA 2F9NA 5IDKA 4M9FA 2GT8A 4OS6A 2BY5X 2VWNA 1CHOG 3AASA 3DSOA 1MQ6A 2PSXA 1T8NA 1O38A 3GY8A 4FUGA 1ELEE 2ZGHA 4FETA 5LPRA 4IW4E 2R0KA 2JH5D 4IGDA 4ZHLU 4Q4LA 2VIWA 5GPIB 4FVDA 2V3MA 1TWXB 2ZDNA 2WV4A 2ZDLA 1O3LA 1GJ8B 4FU9A 3SO3A 1YLNA 3TH2H 1JXPA 1HFDA 2GZ7A 1AQ7A 1VCWA 1FNIA 4IN1A 1P06A 1OWIA 1O2OA 2XTTB 3GDSA 4ZHAA 1OKXA 1P2IA 1SFIA 1DWDH 1O2QA 3OY5U 4GSOA 2RFKC 2OLGA 2VWOA 4XBCA 1TPOA 2IN2A 1WBGB 4RT0A 1A0JA 2W7UA 3ATMA 3RC4A 1Y59T 3M3VA 2SGQE 3MU1A 2F83A 1O2RA 2V3OH 3E1XB 1AU8A 5HM9A 1DY9A 2ZQ1A 1DT2A 3A8CA 1WYKA 2HRVA 3ZZ3A 1GDQA 1G36A 4ABDA 1VKYA 1Y3VA 5FX6A 3RMNH 2XBXA 5CHAB 4ABFA 3H7OA 4ABEA 2EQNA 1OPHB 2Z3DA 4ABAA 1BHXB 1C5WB 1OWJA 4NCYA 1YPLH 2JH6D 2Z7FE 3T25A 1EB1H 2XW9A 4CRGA 3GY3A 3RXOA 1YCPM 1ZRBA 8ESTE 1THSH 3D49H 1DUEA 1ELVA 4Y8ZA 2XOKD 1KY9A 1TRMA 2Q1JA 2JJ1D 1A4WH 4WH6A 2QF0A 1FXYA 5DKMA 4U01A 1C5SA 3PWBA 1SQTA 1EZSC 1SMFE 1UVOA 3ITIA 1O35A 1FUJA 1SVPA 2QF5A 1A2CH 3MNCA 2J97A 1YLDA 3LT3A 3NZIA 3FVFB 4CRBA 1TMTH 3RXSA 4YXWD 2BY6X 1W3CA 2QC2A 1C2LA 1QY6A 2VGCC 2G55A 2H2ZA 2QA9E 3A8AA 3GISB 2ZTYA 4Y76A 1UK2A 2ZHWH 3RU4E 1W7GH 4CH8B 7ESTE 4SGBE 3RUOA 1AI8H 1AE5A 4XD7D 4AORA 4NSVA 3TGKE 2QXGA 1IQIA 4RKOB 3SUGA 1ZMJA 1CGIE 3U8TH 2HPQH 2WPJS 1HCGA 5KEDA 3BTWE 1QQUA 1AHTH 2A2QH 2FYQA 3GCHB 1GL1A 1OWDA 3EYDA 1GBLA 2BD8A 4D8NA 2HNTC 5K7RA 2Y81A 4IN2A 1ZPCA 1SGQE 1EZUC 1BMNH 4JYVH 2BD2A 3MWIU 3RXKA 1KDQA 3HKIB 3CENA 3LC5A 4HG6A 1CHOF 2FOCA 1A5GH 1V2ST 3F3BA 4GCHG 2AIQA 4Q7ZA 5JBBS 2P95A 1TA2A 2G51A 4Y0ZE 5DPAA 3P95A 3MH6A 2Y82A 4CRFA 4I32A 2QF3A 1QJ6B 2ANWA 3ENSB 1K21H 1GJBB 4K8YA 3VB4A 1HUTH 3M61U 1RRKA 1TAWA 1YF4A 3HKJB 5FBIA 1OOKB 3TH3H 3ZYEA 2OC8A 3MNSA 1JWTA 1KDQB 2NU4E 2VIQA 2A4OA 4NFFA 9LPRA 1NC6A 2AMPA 2QIQA 1UHBA 4B2CA 1GJ9B 2ZZUH 3TJOA 3NK8A 1NY22 1SQAA 4ISNA 1GVZA 1FPCH 5EJ1A 1Y5AT 2A45B 4D76A 5BRRE 1FY5A 1Y8TA 5FPTA 1ANDA 2EA3A 4NZQA 3G01A 5CE1A 3S9CA 5AHGH 1UCYH 2QAAA 1V2UT 1VJ9U 2ZEBA 4MPWA 1MU8B 2FOEA 1YGCH 3ZZCA 1K1JA 3E3TA 4F49A 2RA0A 3KYFA 3QN7A 5F8XA 2QY0B 4CBNA 1P57B 4AOQA 1O39A 1G3BA 1EX3A 3RLWH 3U98H 4YT7H 2KAIB 4ZKNU 2XC4A 3CP7A 5E2OA 2L6OA 1UHBB 2A1DB 2VJ1A 4CR9A 1GWAA 2ZFTA 1C5TA 1HBTH 1YPHE 3DUXH 1Y3XA 1MAYA 4K3JA 5EIYA 4AG2A 2J92A 2P3FH 2OCVB 1IQJA 1ZHRA 2VWLA 1SB1H 1A46H 3QDZB 2P93A 2FODA 4MTBA 3H09A 2BZAA 5EQRA 1V6DA 3F2HA 4YZUA 3VGCB 2OINA 3LC3A 5ESTE 4YESB 1LQEA 2Z9KA 1V3XA 2QGRA 3P92A 3P8FA 1C5YB 2A5AA 5LPFA 2D2DA 3Q3YA 1EAWA 3FFGA 5EG4A 1PPCE 2BOKA 1SOTA 1XKBC 4X6MA 3N99A 3F6UH 2R2MB 1DDJA 3QX5H 1UTMA 3AK5A 1GI0A 4ESTE 3S9AA 1QIXB 1AFQC 3UAIC 2CN0H 4WF8A 4R0IA 1BRUP 4YM9A 4ZHMU 5DGJA 2VGCB 1HPGA 1U6QA 2OC1A 3TJNA 2PTNA 2BB4A 2EI8A 1DWBH 5HM2A 4CBOA 3MTYA 2P59A 2TPIZ 3LGUA 2P94A 1C5RA 4CH2B 4TPYA 1C2GA 2BX3A 3SJ9A 4NG9H 3K2UA 2ZNKH 1J8AA 1C5UA 4ABIA 3VB3A 2F9VA 1F5RA 1E35B 1MH0A 4FOUC 4X2XA 4X6NA 3M5NA 3LKWA 1GMCF 1V2NT 1ETRH 2BVXH 3T27A 2SNWA 2FOFA 1BHXF 2FOGA 2ZTZA 1LPZB 3NWUA 2GCHG 1HLTH 2AGGX 3GY5A 3I29A 2VB0A 3SQEE 4OM9A 3NKKA 3TJUA 5DSFA 4AG1A 4FUCA 5KECA 1NU9A 1SL3A 1C1QA 2KCYA 3LGYA 1P2OA 4DW2U 1EB2A 4Y8YA 3LIWA 1D3QB 1HAVA 2IOTA 1E37B 1GHXH 1KXBA 3SGQE 5C1XA 1PQ5A 2FO9A 5GNDA 1NESE 1XUIA 1H8HD 1O3JA 3E91A 3SNBA 1ZSKA 1O3IA 5FPYA 2A5IA 3H7TA 3MYWA 1MBQA 3PLKA 2TGDA 1P3CA 4GUXA 1YWUA 2WYGA 4I8GA 1O5BB 5F8TA 1AVGH 4R8TB 1ETSH 4M7GA 3VB6A 2NU2E 2G00A 2ZKSA 1O3OA 1ELDE 2UUKB 2FX6A 2C8XB 5T3HA 1BIOA 2A4GA 5GJ4B 3O8DA 6LPRA 4XDEA 1SBWA 3AAVA 4JK6A 3SQHE 4ABHA 4DOQA 1TE0A 1GMHG 1TBRH 1GBCA 1OP8A 1FAKH 3N7EA 1BTHH 2IPQX 3A86A 1P2NA 5CDFE 1HAHH 2FOMB 3OYPA 4K1TA 1C4V2 5HIYA 5E0JA 2G81E 1ZTJA 1XX9A 3UY9A 3M3TA 1O2KA 1BTZA 2BM2A 3RXBA 4X2YA 2AGIX 2G4TA 2VNTA 1VCPA 4J2YB 2M2AA 1W0ZU 1NS3A 2VVUA 3FKSD 3SV8A 4WXVA 4JMYA 2GD4B 2AMDA 3E0PB 1D3TB 3V12A 1UW7A 4Y11E 1TNIA 3E16B 3RMMH 4AB8A 3CNRA 3EA7A 4F4OC 5AF9H 1MCVA 1JRSA 1MD8A 4AFSA 2D1JA 3BIVH 1VITH 2ANKH 1C1RA 3BTFE 1MQ5A 1DICA 1KXFA 3JZ1B 1ZGIA 2ZDAH 4X1PU 2BY9X 2Y5FA 3SV7A 2ZQ2A 2J94A 1ELFA 5L2YH 2BOHB 3PMHB 4CRDA 4DGJA 3K6ZA 3S0NA 1K1IA 1QB6A 1V2TT 5C3NA 2BD9A 1QBVH 1SC8U 5HMAA 2PKAB 1LHDH 1X7AC 4BXWA 1UJ1A 4CHAC 2J95A 4UFEH 3QTOH 1O2IA 1SSXA 4UEHH 1TQ0B 5AVDA 3UIRA 1NRRH 2PTCE 2ULLA 5DG6A 2DE9A 1GI4A 1S0RA 3MU5A 1FY8E 1SOZA 2J34A 2KR7A 2Y5GA 3LDXH 5HXFA 1E38B 2XBWA 2OK5A 1G2MA 3SU0A 2ODQA 2KCOA 4A6LA 1HGTH 1TA6A 1D9IA 2FOHA 5A0CA 1H9LB 4ACBA 1OP2A 1C1OA 4LZ1H 2GCHF 2FOBA 5BPEA 3LH3A 3OEHD 1AY6H 3NRLA 1NBME 1XUFA 1EAXA 1AUJA 1RJXB 1O2YA 4HZHA 5E0GA 2ZHEH 2FTMA 1P8VC 1QBOA 2AYWA 1C1MA 1MTNB 2B9LA 4X1SU 3ZVBA 5C0TA 5FX5A 3AVZA 3KIDU 4THNH 3E6PH 2BLVA 1S81A 1SGFA 5CHBA 1VJAU 1EP5A 4OS7A 3M3SA 1SGYE 3ZV9A 1O2TA 1G3DA 2YMSD 4GHTA 1WDIA 1VITG 1N8OB 5CHAC 5GWZA 2BDAA 1EJNA 1NFXA 1OYTH 2UUFB 3GS9A 4I31A 3KQ5A 3RM0H 4AGKA 4Y6DA 4ASHA 1J14A 1T7CA 4AGJA 5TJXA 2FEQH 3U8RH 3ZVEA 3IG6B 2OD3B 2FLBH 3BTGE 2Z3CA 3PV4A 2BD5A 1O2NA 1GBBA 2BD4A 2W26A 1Y5BT 2V6NA 1Y5UT 1C5LH 3A84A 3CS0A 1AZ8A 4UONA 2FWWA 1KTSB 3F2FA 4UFDH 1SKYE 2CF9H 1D3PB 3RXHA 1O2PA 2VIDA 1GDUA 1LTOA 1S84A 1GI1A 3RXAA 1UVSH 1KMHB 3RXEA 3P6ZB 1QB1A 2A7CA 3MOCA 3UNRA 1B7XB 1CT0E 4FU7A 1KIGH 3ZYDA 5A8ZA 1UTNA 1TYNA 2SGPE 1LO6A 1H8IH 1T31A 2D8WA 2ESTE 2PW8H 2Q6DA 1G3EA 1O30A 1E79D 2FX4A 2D26C 4XRNA 1AKSA 1HAZB 1Z1IA 3PO1C 2W3IA 6CHAC 3SU6A 1AUTC 1K1MA 4ZKSU 1WU1A 2V35A 3ESTA 4TWYA 1F0RA 2NWNA 3SN8A 4TY6A 1YPKH 2G52A 3PV5A 1O37A 2B7DH 1C2JA 1ZSJA 2Y7ZA 1DANH 3SJIA 1NFUA 3QWCH 1GJDB 1SGCA 1D4PB 1UTLM 3I78A 4FUHA 3T2NA 3DSPA 5F53A 1YPHC 2Y7XA 5EXNA 2BLQA 5GCHF 2OBQA 1LDTT 5F6MA 5JB9S 2ZGBH 1C5PA 5C20A 1AKSB 3Q3KA 3S9BA 2Z9IA 4DJZB 3MU4A 2A4RA 2QXJA 1T4UH 1O0DH 4B1TA 1JIRA 5B6LA 1BJUA 4I8HA 4DT7B 2BLOA 3NUMA 4B74A 1K2I1 1ELCA 1SLXB 1PPFE 2BDCA 4Q63A 5EU8A 3RP2A 1MUEB 3F9FA 3PWCA 2B0FA 4X6PA 3FAOA 4X2WA 3SUFA 4AC9A 1HJ9A 2ZU2A 4LZ4B 2EEKA 2J9NA 8LPRA 5HIZA 1O2VA 4UD9H 2J98A 3A8DA 1GG6B 1TB6H 1AN1E 4Y7AA 3SI3H 1ORFA 5EOKA 3NPSA 1NRSH 1TOCB 1VITF 4NSYA 3LJJA 3TGJE 1A5HA 1LHEH 3U1JB 1WTGH 2FPZA 1DE7H 3DCLA 3UR9A 3A82A 1PPBH 2J5UA 3D65E 4MNXA 1P2MA 2QV1A 2WINI 3RXGA 1EZQA 1F0UA 2CGAA 1EZXC 3F9EA 2I6QA 3K9XB 3F9HA 2XCNA 2FI4E 2VIPA 2C8YB 1S6LA 2ZPSA 1C2HA 1GI2A 5DP9A 1ZJKA 4H6TA 1P2JA 1O2ZA 1MTVA 1QB9A 2J98B 1L0ZA 3PLPA 1W13U 3OAAD 5L2ZH 1BITA 1DSTA 3EE0B 1A61H 2O8TA 2XC5A 1TGCA 2WHXA 2RG3A 1MZDA 3KGPA 3VGCC 1QRZA 4ISHH 2FM2A 1GI8B 1MTUA 1TLDA 4YOIA 1CU1A 1HAXB 1MKWH 2W6ID 3FP6E 1BJVA 1AB9C 2KFWA 5FCRA 2BXTH 3RM2H 2Z94A 3RXDA 1QL7A 1IHTH 1ZYOA 4VGCB 1BA8B 3MNBA 1A0LA 2B5TB 3RXFA 2UWLA 1C1TA 1YBWA 3P8OA 3RXTA 1T8OA 4H6SB 4H42U 5DO4H 3U8OH 4DIHH 3FP7E 5C5OA 2J2UA 1PFXC 7LPRA 2A7JA 2LPRA 4NGAH 1GBAA 2A4QA 2A31A 5LH8A 3TLOA 3HATH 4RN6A 1C5MD 1GBFA 1O2WA 1BRAA 2CMYA 4WVPE 1TMUH 2NU3E 5T6DA 5EPYA 3KQCA 3BTTE 3D62A 3PO1B 1P2KA 3RXLA 3TK9A 5GDSH 6CHAB 2ZIQH 1J17T 1P0SH 3VB5A 4LXBH 4O9VA 2ZU1A 1JOUB 1GVLA 1QTFA 1DVAH 3F0OA 1GJ7B 1E34B 1J9CH 4MPUA 1UTKA 1TGTA 1TNJA 1P9UA 2O9QA 4Y10E 1P12E 3ZZ5A 4NFEA 2DUCA 2WPKS 3GDVA 4DCDA 1O3PB 1A7SA 2ZDMA 3TPIZ 4Y7BA 2AEIH 2ANYA 3BTQE 4NZLA 2V0BA 2G4UA 1QNJA 2HGTH 2KCAA 2ZPRA 5LGOA 2HVYB 2RDEA 3MNXA 3FZZA 2SGDE 3V7TA 2EI7A 1GCDA 3MFJA 1GBHA 1GMCG 8GCHG 3P8NA 5FPSA 4TYDA 1DPOA 2H5CA 1THRH 3LGTA 3Q77A 3VXFH 2ZPQA 5A0AE 1SHYA 1P09A 4WH8A 4ZUHA 1Z8JB 1E36B 4O97A 2ZU3A 1KXCA 4IMZA 1ESAA 1GMDF 2AGEX 2A0QB 2R0LA 3SOSA 1INCA 3OU0A 3KL6A 1C2EA 3ODDA 1BBRK 4FUFA 1O3HA 1C5NH 4X8VH 1PYTC 5E2PA 3ZV8A 3A80A 5F8ZA 1TBZH 3SJ8A 1HJAC 1SHHB 1SG8B 1GBDA 1H9HE 4B76A 1TGNA 4TSFD 1GL0E 5HKKD 1BDAA 3RC6A 4WY3A 3TK5A 2CV3A 3DFLA 5IYTA 1FV9A 2Y5HA 1HB0B 2FS8A 1AE8H 1OS8A 4NIWA 3ZVAA 3ZVFA 4YLQH 1BMFD 5C1UA 2STBE 1MD7A 3F2GA 3GYLB 4A92A 2VVCA 2ZP0H 5PTPA 5FAHA 5EJZA 4YOGA 2ZCHP 3KHVA 1IQFA 4U32A 2RA3A 3RXMA 1FY4A 2WYJA 1O3FA 3PB1E 3B23B 2AMQA 1CE5A 1TRNA 3IITA 3QZQA 1DITH 4BOHA 1RGQA 5LPEA 1O2JA 2A5KA 1KXDA 3OX7U 2Z3EA 2ZDKA 3P17H 1P05A 4UFGH 1ESTA 4I33A 3FP8E 1F5LA 3PMAB 4OGXA 4U30A 1DOJA 1EP6A 3M7TA 1BMMH 4FUEA 4GVUA 3A87A 4JZEH 2F9PA 1DWEH 2P8OC 2XCFA 1C5OH 1KLIH 4MNWA 1SGPE 1TPAE 4K5ZA 2BDGA 3TGIE 1PPGE 3MH7A 1AB9B 3A7XA 1NRQH 3GICB 1CT4E 4FU8A 1CO7E 2QN5T 2KZ4A 2Z9GA 1A0HB 3V3MA 1G37A 1SGDE 3T5FH 2OC0A 1OHHD 3A7ZA 8KME2 1O2SA 1N6XA 1IQKA 1GBEA 1GDNA 1TX6A 3SU5A 1W14U 3TJVA 3AAUA 4P02A 1JIMA 1UVPA 2HLDD 3BEFB 3Q3XA 5H4IB 3GY6A 3KF2A 2FS9A 3A83A 1O31A 1BMAA 4WXIA 1S0QA 1C2DA 3SNEA 3ATKA 2PV9B 1FJSA 1BCUH 2ZA5A 4SGAE 4ISOA 3OSYA 5EXMA 1LHCH 1MTNC 1WXRA 2XYAA 3SU2A 3KYGA 1V2WT 2TGTA 8GCHF 1RFNA 1NPMA 4MLFB 1TGSZ 4ACAA 1PPEE 3RLYH 3BEUA 1V2LT 3SU1A 1P01A 2BDHA 1ELAA 5J4SA 4CRAA 4X8TH 1YPGH 4Z0KA 4AYYB 1F0TA 3SUEA 3SV6A 3DFJA 3A7TA 4JCNA 4AFZA 1AGJA 1QA0A 1THPB 2C8ZB 1GHVH 2XNDD 1N8OC 5JBCS 3SNAA 3ZVCA 2QE7D 3SUDA 3T29A 4ZROA 3DHKH 1RTFB 3UOPA 2FYRA 1EASA 2PLXA 4ZKRU 3SJKA 3ZZAA 4A5TS 5DP3A 3PMJA 3MU8A 2SGFE 1TALA 4UE7H 1FN8A 5HGGA 3U9AH 1MABB 1LVMA 4B6FA 2BY7X 3UQVA 1CHGA 3TVJB 3B9FH 3SNCA 2WUBA 7GCHG 2AERH 1EPTA 1C9TA 2GDDA 1EUFA 1HIAA 3E0NB 2SGAA 3QK1A 1P9SA 3DD2H 4KTUA 2ZWLH 1C1WH 1NN6A 1XXFA 2Y80A 3ATLA 2RDLA 3QUMP 2FMJA 1EAIA 2QXHA 1HJAB 3P8GA 2THFB 1HAIH 4B6EA 1HAVB 1GHBG 3AW1A 3BF6H 1QZ8A 3GYMA 1W0YH 4O03A 1TBQH 3UQOA 1UTJA 3A88A 4AB9A 2R3YA 1COWD 2ZCKP 4UDWH 3TITA 2TGPZ 5JYIA 2GCTC 1ACBE 3PRBA 3MO6A 5FXLA 1S6HA 2VH0A 1CA8B 1TPSA 3GCTG 1EPTB 3LGIA 1Z1JA 2C90B 1Z8IB 1HIAB 1EJMA 1L4DA 2F91A 2IPHA 3A89A 3I77A 1ZLRA 1ZRKA 2BD3A 4DG4A 3UOUA 3LGWA 1C5VA 6GCHG 1ANCA 1ABJH 2VBCA 3RXRA 1C1UH 2C8WB 2STAE 3C1KA 4Q7XA 4RSPA 2Q6GA 1KLJH 2H9TH 4K60A 1S82A 5EQSA 1GI6A 3S7KB 4BAMB 2FZZA 1BTYA 2WV5A 1BQYA 1H4WA 1T32A 1IQGA 1BTWA 2P8OB 2O8MA 3BEIB 1G3CA 2GV6A 1DXWA 4X8SH 4RT1A 1E1QD 1G2LA 1H9IE 2QF4A 4AFQA 3P70B 1QBNA 2V3HH 3LH1A 2O8WA 1MKXH 4BAKB 2BXUH 1SLVB 1TABE 5GCHG 4JK5A 4X2VA 3MO3A 1GJ5H 1FY1A 3A7WA 1ZOMA 1L1JA 1TPPA 1ABIH 2OBOA 2M5TA 2Q6FA 4DVAU 1F5KU 1K1OA 3SYJA 2O8LA 2ZECA 5L6NH 3BG4C 4Y71A 1GG6C 1MTWA 3B8JA 4LOYH 3RXCA 3U69H 1YM0A 2TBSA 2GZ9A 4YO9A 4ZMAH 3RDZA 1V2RT 1C2MA 4YT6H 1TGBA 4X0WU 1XUHA 3FANA 5J4QA 1YPMH 1O3MA 2C3SA 1HNEE 2HWLB 2PHBA 1YPJH 2UUYA 1D6RA 1Y3UA 2VVVA 3HPTB 4OS1A 3L33A 3RXUA 2R2WU 1SGTA 5C67A 3O8CA 5K0HA 1O3GA 4JZIA 2BZ6H 7GCHF 1CBWC 2B8OH 3GY7A 2LELA 2OUAA 4XE4A 3BTKE 3BTME 3GY2A 1AFEH 1OX1A 3L6PA 3T26A 3SW2B 1O34A 1QRWA 2ZGJA 1T8MA 3A7VA 4Q2KA 4BTIB 4KTSA 5A8YA 1J15A 1GBMA 1UK4A 3BG8A 2FOAA 1L2EA 2ZC9H 4E7NA 3UPEA 1YLCA 1GHAG 2JJ2D 1FDPA 1GHBF 4B75A 1UK3A 4JZ1A 1UVTH 1QJ7B 2GX4A 3EQ0H 2BTCE 4Q7YA 1IQLA 1DX5M 1MMJN 1BBRE 2V7QD 4O3TA 1CGHA 1Y3WA 2HLCA 4NWKA 5DJ7A 1L4ZA 5FHTA 1T8LA 4VGCC 3GCTF 3ODFA 1QCPA 1KXEA 4NIXA 2CK3D 2W5EA 2WZQA 2BY8X 4I8KA 4OS2A 2VH6A 1JBUH 2GGVB 5GIBA 5I25A 3ZVGA 4KKDA 3KEEA 2L74A 5JBAS 3KQBA 4Z1MD 1TNHA 4OS4A 3DA9B 6GCHF 2ZCLP 4BNRA 2GV7A 4DURA 2GDEH 2YNBA 5DP5A 4I7YH 3GDUA 1ZMLA 2FI3E 1ID5H 4MQAA 3RMLH 1PPHE 1Q2WA 2HNTF 4IC6A 1FONA 2ZHDA 4NIYA 2GCTB 4JZFH 4A1XA 5A8XA 3O8BA 1UCYK 1C5ZB 1S6FA 1FQ3A 2FESH 1G9IE 1KLTA 3HK6B 2ODYB 1W0KD 3UWIA 3UNSA 4F55A 4K69A 3MH5A 4D9QA 1DXPA 3RMOH 2ZI2H 3V13A 2VIVA 2RCEA 3OTJE 1S85A 3WWBA 1O3EA 4QT8C 2FP7B 4IMQA 5JB8S 3CS7A 1QURH 1RTLA 4OGYA 1DWCH 5JPMH 2KCPA 1OSSA 3LJOA 4P00A 1GHWH 1PQ7A 3SHAH 3KCGH 3QZRA 3PRDA 1SR5C 1P04A 4K2YA 4NA8A 3FN8A 3BSQA 2PWXA 3HGPA 2GT7A 1Z8GA 1B0FA 1OYQA 4TY7A 1BT7A 4AX9H 2PGBB 4IBLH 1AWHB 1XMNB 2UUJB 2LNCA 2SNVA 1SGIB 3SBKA 4NWLA 2LP6A 4Y8XA 4ZAEA 2ZO3H 2GKVE 3RXVA 1EXFA 1L1GA 3W94A 1LHFH 1ZPBA 1DS2E 1O2GH 2W3KA 2UWOA 1BMLA 1VGCC 3EDXB 3MH4A 3BG4B 1QL8A 2GJGA 2HOBA 2A2XH 1GVKB 2ZFFH 5ABWA 1C1SA 1ESBA 2O8UA 1SGNE 3ZZ8A 4XBDA 4DY7B 2VIOA 4E7RG 4KTCA 4X1QU 1V2QT 1GMDG 1TNKA 2ZGCA 2WPDD 3EE7A 2F3CE 4X6OA 1GHAF 1BTPA 3SNDA 1P10A 2ZG0H 2VWMA 1HAPH 3L3TA 1ARBA 3M7UA 2BDBA 1LMWB 1UMAH 1Z71A 1CBWB 1E0FD 1EAUA 2SGEE 5E8EH 4TT3D 1C4U2 1H8DH 3UREA 3KQEA 1NTPA 3F0PA 3WY8A 2H6MA 4MG3A 3Q00A 4ZXYH 1IAUA 3QGNB 4YLUA 1UTOA 2ZFSA 1SGRE 1YPEH 1EOJA 3BV9B 4FUIA 1T4VH 3A7YA 3WWFA 1G32B 1E1RD 3S7HB 1UTPA 1VR1H 5E0HA 1NRPH 2H5DA 1RD3B 5DP7A 1YP9A 1FZZA 4FUJA 2ASUB 1CSOE 1TFXA 4NA9H 1C4Y2 1AIXH 1EKBB 1KXAA 1SI5H 1K1NA 3SI4H 4Q80A 2VU8E 3LOXA 5DP6A 3LONA 1YCPH 1AMHA 4ZH8A 3UFAA 5DK1A 3PMBB 3GY4A 2FXRA 4TPIZ 1GJ6A 1HDTH 3LPRA 4BTUB 2XBVA 2WPHS 4JYUH 1ZGVA 2GTBA 5JBTA 3M7QA 3OY6U 4I8LA 4ZCNA 4X1RU 7KMEH 2PGQB 3MI4A 4XOJA 2H9HA 4XSKU 3T62A 1H1BA 3PYHA 5B6OA 5AFYH 3KN2A 4NA7A 1OWKA 1RTKA 2ZHFH 2BQ6B 3SU3A 1IQEA 1F7ZA 1ETTH 5C5NA 1ZJDA 2GMTC 1RIWC 2PSYA 3PM3A 2J4IA 4KGAA 3M5OA 1EOLA 2CXVA 4GPGA 4ISLA 4KELA 3OFND 4WJG2 1WQVH 1VZQH 2HVXA 2EI6A 2BLWA 1ANBA 1O5FH 3MQKC 1TIOA 1ELBA 5DP8A 3SZNA 3NXPA 3N7DA 3RU4D 2ALVA 1HXFH 1ZMNA 1C2FA 1N6YA 3HK3B 3D23A 3RXPA 4D9RA 2OXSA 1XUGA 2AHME 4DIIH 1G30B 3A81A 4PROA 1ZHMA 1PQAA 2ZF0H 2XWBI 3VFEA 1GBKA 1ANEA 1W0JD 3MO9A 1PQ8A 2Z9JA 5EJLA 1TQ7B 1HJ8A 5C2ZA 3FO8D 1NRNH 1C5QA 1OWEA 2OQUA 1HYLA 1MKXK 1SQRA 5FL7D 2CJIA 3K65B 5F03A 2ZHQH 2UWPA 1C1VH 2G5NA 1MZAA 1V2PT 1ZZZA 2HALA 4RI0A 1XVMA 1DUAA 1O5EH 3PTNA 1V2VT 3KNXA 1CA0C 1VGCB 1K9OE 1W11U 3TIUA 5EW2H 1WUNH 4HTCH 4ASUD 2JIZD 3QGJA 1DLKB 4D7FA 3QLPH 4RKJB 3QTVH 2KAIA 1CT2E 1K28D 3URDA 5I46H 3A8BA 2WSSD 1GHYH 1GJ4H 2BMGB 1LPKB 3KQDA 2H1UA 1P02A 1SQOA 1D3DB 1KTTB 1KSNA 2YMSC 2K8IA 3NCLA 1C1PA 4BANB 1N1LA 1EPTC 1P2QA 2ANMH 4ZXXH 3E8LA 4ZKOU 4ABGA 2Z9LA 1CVWH 3F1SB 2PR3A 1MU6B 2OC7A 5EW1H
chains in the Genus database with same CATH topology
4FVBA 1YC0A 4K1EA 1HAGE 3M5LA 1B0EA 1O33A 3GOVB 2P16A 3RXIA 4ABJA 1C2KA 1YKTA 1IQMA 1NM6A 1FIZA 2OQ5A 4K1SA 1B5GH 2JH0D 2ZGXH 4WMDA 1MBMA 1WTHD 1TOMH 4WMFA 2XRCA 3M35A 3JZ2B 1EATA 1LPGB 5DP4A 1F92A 1LVOA 1XUKA 1V2OT 1Z6JH 1TX8A 1FMGA 1MTSA 1WSSH 2W7SA 4E06H 2OTVA 3BTEE 2A7HA 2BD7A 2ODPA 3ZVDA 3URCA 1XXDA 4B2AA 4AZ2B 2G8TA 2BDYA 2BYAX 1FLEE 3GCNA 3SGBE 1WQSA 1Z7KA 1QA7A 2FDAA 3ATIA 1OXGA 2FLRH 3RXJA 5GXPA 1A3BH 4WWYA 1WAYB 1XVOA 2BDIA 1HV7A 1O2MA 1UCYE 1F0SA 1ZR0A 1C5XB 3TU7H 1S5SA 1W2KH 4U2WA 1P11E 4HGCA 5TCAA 1NFYA 1GBJA 1P03A 5EGMA 5SGAE 1ZTLA 3UR6A 1O5GH 1Q3XA 1V2MT 1OP0A 1A1RA 3TH4H 2XNIA 1BOQA 1W7XH 3VXEH 1O36A 2QCYA 4CREA 1MCTA 4ABBA 3SHCH 1O3AA 1ZTKA 4GCHF 2GMTB 1RIWB 3MU0A 3STJA 2FIRH 4B71A 1ZPZA 1QRXA 1C2IA 4B73A 2P3UB 4GHQA 1FIWA 1WCZA 4HI3A 1FPHH 2YNAA 1BZXE 2R9PA 2GP9B 3ZZ9A 1O3KA 1SGEE 1TRYA 1QJ1B 4FXGH 3EA8A 2TRMA 2IJOB 1ZSLA 4B2BA 1GJAB 3ZZ6A 1ARCA 2I6SA 2XWAA 3EAJA 1LHGH 1PJPA 2PKSC 1CQQA 3DT0H 1GI7B 3UUZA 2YOLA 4XBBA 1JRTA 1LKAA 2ZDVH 1AZZA 2J38A 4BTTB 3ZZ4A 2TIOA 2NU1E 1SFQB 4INLA 2ILNA 2BVSH 1QR3E 2JETC 3EGKH 2F9UA 1CA0B 1NZQH 2CHAC 5FBEA 1C1NA 2A32A 2BX4A 4BXSA 1XM1A 1FN6A 3HGNA 3R0FA 1A3EH 2ZTXA 4A7IB 3RC5A 2XC0A 1ZHPA 2FI5E 3H5CB 2WUCA 1XKAC 1GI5A 3BN9A 2C93B 2K1QA 1DFPA 4INKA 1BTUA 1BRCE 2ALPA 3RXQA 2BQWB 5A0BA 1UVUH 4AN7A 1GJCB 3S69A 4TWWA 1GCTC 1O32A 1K1LA 1F2SE 2ZU5A 3ZZBA 1BB0B 1IQNA 1Q31A 6ESTA 4BAQB 1Y3YA 2HNTE 5L30H 2ZU4A 1O2XA 1TX7A 4UFFH 1GBTA 1ELTA 2PKAA 4WMEA 2AS9A 3SV9A 4MDSA 4GLYA 4D7GA 4MVNA 4MNVA 2R3UA 3F68H 3M36A 1MKWK 5T6FA 3TK6A 1W10U 2F9OA 4HFPB 2QXIA 3EA9A 1IOEA 9ESTA 5EQQA 5A09A 1FI8A 1YYY1 1QGFA 4BAOB 1GI3A 5AFZH 2WPIS 2Y6TA 1FAXA 3VEQB 3V0XA 1AD8H 1BUIA 1AVXA 3K6YA 1V2KT 2BQ7B 4A1VA 3BIUH 4H4FA 3STIA 2PUXB 1GHZA 1TNLA 1GGDC 4ISIH 1EQ9A 5JDUB 1LVYA 1HAYB 1M9UA 3M37A 3E90B 1ELGA 2GZ8A 4FUBA 1HAOH 1YCPK 1AVWA 1GBIA 3PROA 1AO5A 1D6WA 1BBRH 1O2UA 2NU0E 1AFQB 3SORA 2FTLE 1VCQA 4CRCA 1UTQA 3A85A 2ZFQH 1TNGA 5CMXH 4YOJA 3U1IB 3LU9B 1NFWA 1QL9A 1NU7B 2ZFRH 3SU4A 4GAWA 1TONA 2GVFA 3W95A 1LVBA 3SV2H 1NT1A 3UWJH 1DY8A 1CGJE 3ELAH 1J16A 3Q76A 1SPJA 5T6GA 3SGAE 1PYTD 1O3BA 3T28A 3UNQA 3UTUH 1NO9H 2BVRH 3R3GB 1O5AB 4YTAA 3PTBA 3QO6A 4INHA 1O3NA 1K1PA 3VPKA 1L1NA 4BAHB 5G4BA 1QHRB 3ZZDA 4K8BA 4AFUA 4I8JA 1KYNA 2PKSB 4IC5A 4X8UH 3ZZ7A 4KP0A 2DE8A 1W12U 3MHWU 1GMHF 1GI9B 1SLWB 2TGAA 2JETB 4Y79A 2WPMS 1W8BH 1IQHA 2VINA 5HYOA 2CHAB 2SFAA 3M5MA 4J1YA 4E05H 2ZFPH 2F9BH 2P3TB 1HXEH 5C1YA 1O3CA 1HRTH 1BTXA 4Y0YE 1WV7H 1DLEA 2WPLS 1A5IA 3FZDA 1BRBE 5EODA 5TCCA 1PPZA 5EXLA 4MPXA 1DM4B 1EJAA 3AW0A 1AWFH 1O3DA 2AH4X 1MAXA 3TNTA 1QFKH 1O5DH 4IS5A 4Z6AH 1UO6A 4A1TA 1TMBH 3N7OA 1GCTB 1LCYA 4XFQA 2AIPA 1QQ4A 2QYIA 2C4FH 1S83A 3BTDE 1V2JT 3GCOA 3GCHC 1Z8RA 5FCKA 4O3UA 1Z6EA 3BTHE 4AYVB 4FUDA 3RU4T 2H9EH 3ATWA 3MMGA 5ETXA 1SLUB 4NIVA 3F9GA 4MNYA 2CF8H 2BHGA 1JMOH 2HPPH 2PUQH 2JKHA 1O5CB 4OS5A 3PLBA 1GPZA 1OWHA 2PFEA 4CR5A 3O8RA 1LKBA 1XUJA 2Z6BD 1WOFA 2AFQB 4LK4A 1O2LA 1IHSH 4X1NU 1C9PA 3TNSA 1K22H 1RS0A 2EC9H 1DSUA 1O2HA 5EPNA 2XBYA 2XXLA 3VB7A 4JZDH 1SGFG 5A2MH 2OP9A 1NROH 1FY3A 1P3EA 3SJOA 1LQDB 3LGVA 4JYTA 3C27B 1GGDB 4CHAB 4MPVA 1RXPA 5ESBA 3IWMA 2G5VA 2F9NA 5IDKA 2GT8A 4OS6A 2BY5X 2VWNA 1CHOG 3AASA 1MQ6A 2PSXA 1T8NA 1O38A 3GY8A 4FUGA 1ELEE 2ZGHA 5LPRA 4IW4E 2R0KA 2JH5D 4IGDA 4ZHLU 2VIWA 5GPIB 4FVDA 1TWXB 2ZDNA 2WV4A 2ZDLA 1O3LA 1GJ8B 4FU9A 3SO3A 3TH2H 1JXPA 1HFDA 2GZ7A 1AQ7A 1VCWA 1FNIA 4IN1A 1P06A 1OWIA 1O2OA 2XTTB 3GDSA 4ZHAA 1OKXA 1P2IA 1SFIA 1DWDH 1O2QA 3OY5U 4GSOA 2OLGA 2VWOA 4XBCA 1TPOA 2IN2A 1WBGB 1A0JA 2W7UA 3ATMA 3RC4A 1Y59T 3M3VA 2SGQE 3MU1A 2F83A 1O2RA 2V3OH 3E1XB 1AU8A 5HM9A 1DY9A 2ZQ1A 1DT2A 3A8CA 1WYKA 2HRVA 3ZZ3A 1GDQA 1G36A 4ABDA 1Y3VA 5FX6A 3RMNH 2XBXA 5CHAB 4ABFA 3H7OA 4ABEA 1OPHB 2Z3DA 4ABAA 1BHXB 1C5WB 1OWJA 4NCYA 1YPLH 2JH6D 2Z7FE 3T25A 1EB1H 2XW9A 4CRGA 3GY3A 3RXOA 1YCPM 1ZRBA 8ESTE 1THSH 3D49H 1DUEA 1ELVA 4Y8ZA 1KY9A 1TRMA 2Q1JA 4WH6A 1A4WH 2QF0A 1FXYA 5DKMA 4U01A 1C5SA 3PWBA 1SQTA 1EZSC 1SMFE 1UVOA 3ITIA 1O35A 1FUJA 1SVPA 1A2CH 3MNCA 1YLDA 3LT3A 3NZIA 3FVFB 4CRBA 1TMTH 3RXSA 2BY6X 1W3CA 2QC2A 1C2LA 1QY6A 2VGCC 2G55A 2H2ZA 2QA9E 3A8AA 3GISB 2ZTYA 4Y76A 1UK2A 2ZHWH 3RU4E 1W7GH 4CH8B 7ESTE 4SGBE 3RUOA 1AI8H 1AE5A 4AORA 4NSVA 3TGKE 2QXGA 1IQIA 4RKOB 3SUGA 1ZMJA 1CGIE 3U8TH 2HPQH 2WPJS 1HCGA 3BTWE 1QQUA 1AHTH 2A2QH 2FYQA 3GCHB 1GL1A 1OWDA 3EYDA 1GBLA 2BD8A 4D8NA 2HNTC 5K7RA 2Y81A 4IN2A 1ZPCA 1SGQE 1EZUC 1BMNH 4JYVH 2BD2A 3MWIU 3RXKA 1KDQA 3HKIB 3CENA 3LC5A 1CHOF 2FOCA 1A5GH 1V2ST 4GCHG 2AIQA 4Q7ZA 5JBBS 2P95A 1TA2A 2G51A 4Y0ZE 5DPAA 3P95A 3MH6A 2Y82A 4CRFA 4I32A 2QF3A 1QJ6B 2ANWA 3ENSB 1K21H 1GJBB 4K8YA 3VB4A 1HUTH 3M61U 1RRKA 1TAWA 1YF4A 3HKJB 5FBIA 1OOKB 3TH3H 3ZYEA 2OC8A 3MNSA 1JWTA 1KDQB 2NU4E 2VIQA 2A4OA 4NFFA 9LPRA 1NC6A 2AMPA 2QIQA 1UHBA 4B2CA 1GJ9B 2ZZUH 3TJOA 3NK8A 1NY22 1SQAA 4ISNA 1GVZA 1FPCH 1Y5AT 2A45B 4D76A 5BRRE 1FY5A 1Y8TA 5FPTA 1ANDA 2EA3A 4NZQA 3G01A 5CE1A 3S9CA 5AHGH 1UCYH 2QAAA 1V2UT 1VJ9U 2ZEBA 4MPWA 1MU8B 2FOEA 1YGCH 3ZZCA 1K1JA 3E3TA 4F49A 2RA0A 3QN7A 5F8XA 2QY0B 4CBNA 1P57B 4AOQA 1O39A 1G3BA 1EX3A 3RLWH 3U98H 4YT7H 2KAIB 4ZKNU 2XC4A 3CP7A 5E2OA 1UHBB 2A1DB 2VJ1A 4CR9A 1GWAA 2ZFTA 1C5TA 1HBTH 1YPHE 3DUXH 1Y3XA 1MAYA 4K3JA 4AG2A 2J92A 2P3FH 2OCVB 1IQJA 1ZHRA 2VWLA 1SB1H 1A46H 3QDZB 2P93A 2FODA 4MTBA 5EQRA 2BZAA 1V6DA 4YZUA 3VGCB 2OINA 3LC3A 5ESTE 4YESB 1LQEA 2Z9KA 1V3XA 2QGRA 3P92A 3P8FA 1C5YB 2A5AA 5LPFA 2D2DA 3Q3YA 1EAWA 3FFGA 5EG4A 1PPCE 2BOKA 1SOTA 1XKBC 4X6MA 3F6UH 2R2MB 1DDJA 3QX5H 1UTMA 1GI0A 4ESTE 3S9AA 1QIXB 1AFQC 2CN0H 4WF8A 4R0IA 1BRUP 4YM9A 4ZHMU 5DGJA 2VGCB 1HPGA 1U6QA 2OC1A 3TJNA 2PTNA 2BB4A 2EI8A 1DWBH 5HM2A 4CBOA 3MTYA 2P59A 2TPIZ 3LGUA 2P94A 1C5RA 4CH2B 4TPYA 1C2GA 2BX3A 3SJ9A 4NG9H 3K2UA 2ZNKH 1J8AA 1C5UA 4ABIA 3VB3A 2F9VA 1F5RA 1E35B 1MH0A 4X2XA 4X6NA 3M5NA 3LKWA 1GMCF 1V2NT 1ETRH 2BVXH 3T27A 2SNWA 2FOFA 1BHXF 2FOGA 2ZTZA 1LPZB 3NWUA 2GCHG 1HLTH 2AGGX 3GY5A 3I29A 2VB0A 3SQEE 3NKKA 3TJUA 4AG1A 4FUCA 1NU9A 1SL3A 1C1QA 3LGYA 4DW2U 1P2OA 1EB2A 4Y8YA 3LIWA 1D3QB 1HAVA 2IOTA 1E37B 1GHXH 1KXBA 3SGQE 5C1XA 1PQ5A 2FO9A 1NESE 1XUIA 3E91A 1O3JA 3SNBA 1ZSKA 1O3IA 5FPYA 2A5IA 3H7TA 3MYWA 1MBQA 3PLKA 2TGDA 1P3CA 4GUXA 2WYGA 4I8GA 1O5BB 5F8TA 1AVGH 4R8TB 1ETSH 4M7GA 3VB6A 2NU2E 2G00A 2ZKSA 1O3OA 1ELDE 2UUKB 2FX6A 2C8XB 5T3HA 1BIOA 2A4GA 5GJ4B 3O8DA 6LPRA 4XDEA 1SBWA 3AAVA 4JK6A 4ABHA 4DOQA 1TE0A 1GMHG 1TBRH 1GBCA 1OP8A 1FAKH 1BTHH 3A86A 1P2NA 1HAHH 2FOMB 3OYPA 4K1TA 1C4V2 5E0JA 2G81E 1ZTJA 1XX9A 3UY9A 3M3TA 1O2KA 1BTZA 2BM2A 3RXBA 4X2YA 2AGIX 2G4TA 2VNTA 1VCPA 4J2YB 1W0ZU 1NS3A 2VVUA 3SV8A 4WXVA 4JMYA 2GD4B 2AMDA 3E0PB 1D3TB 3V12A 4Y11E 1TNIA 3E16B 3RMMH 4AB8A 3EA7A 4F4OC 5AF9H 1MCVA 1JRSA 1MD8A 4AFSA 2D1JA 3BIVH 1VITH 2ANKH 1C1RA 3BTFE 1MQ5A 1DICA 1KXFA 3JZ1B 1ZGIA 2ZDAH 4X1PU 2BY9X 2Y5FA 3SV7A 2ZQ2A 2J94A 1ELFA 5L2YH 2BOHB 3PMHB 4CRDA 4DGJA 3K6ZA 3S0NA 1K1IA 1QB6A 1V2TT 5C3NA 2BD9A 1QBVH 1SC8U 5HMAA 2PKAB 1LHDH 1X7AC 4BXWA 1UJ1A 4CHAC 2J95A 4UFEH 3QTOH 1O2IA 1SSXA 4UEHH 1TQ0B 5AVDA 3UIRA 1NRRH 2PTCE 2ULLA 5DG6A 2DE9A 1GI4A 1S0RA 3MU5A 1FY8E 1SOZA 2J34A 2Y5GA 3LDXH 5HXFA 1E38B 2XBWA 1G2MA 3SU0A 2ODQA 4A6LA 1HGTH 1TA6A 1D9IA 2FOHA 5A0CA 1H9LB 1OP2A 1C1OA 4LZ1H 2GCHF 2FOBA 5BPEA 3LH3A 1AY6H 1XUFA 1EAXA 1AUJA 1RJXB 1O2YA 4HZHA 5E0GA 2ZHEH 2FTMA 1P8VC 1QBOA 2AYWA 1C1MA 1MTNB 2B9LA 4X1SU 3ZVBA 5FX5A 3AVZA 3KIDU 4THNH 3E6PH 2BLVA 1S81A 1SGFA 1VJAU 1EP5A 4OS7A 3M3SA 1SGYE 3ZV9A 1O2TA 1G3DA 4GHTA 1VITG 1N8OB 5CHAC 5GWZA 2BDAA 1EJNA 1NFXA 1OYTH 2UUFB 4I31A 3RM0H 4AGKA 4Y6DA 4ASHA 1J14A 1T7CA 4AGJA 5TJXA 2FEQH 3U8RH 3ZVEA 3IG6B 2OD3B 2FLBH 3BTGE 2Z3CA 3PV4A 2BD5A 1O2NA 1GBBA 2BD4A 2W26A 1Y5BT 2V6NA 1Y5UT 1C5LH 3A84A 3CS0A 1AZ8A 4UONA 2FWWA 1KTSB 4UFDH 2CF9H 1D3PB 3RXHA 1O2PA 2VIDA 1GDUA 1LTOA 1S84A 1GI1A 3RXAA 1UVSH 3RXEA 3P6ZB 1QB1A 2A7CA 3MOCA 3UNRA 1B7XB 1CT0E 4FU7A 1KIGH 3ZYDA 5A8ZA 1UTNA