1EAUA

Nonpeptidic inhibitors of human leukocyte elastase. 6. design of a potent, intratracheally active, pyridone-based trifluoromethyl ketone
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (serine protease)
molecule keywords PORCINE PANCREATIC ELASTASE
publication title Nonpeptidic inhibitors of human leukocyte elastase. 6. Design of a potent, intratracheally active, pyridone-based trifluoromethyl ketone.
pubmed doi rcsb
source organism Sus scrofa
total genus 57
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1994-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1eauA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1eauA01
2W7UA 1VCPA 1UCYE 5EXMA 1O2NA 2ZHWH 3AASA 1XUHA 3FP8E 3SNCA 5C1YA 1XKAC 4ZAEA 3RXRA 1W12U 1C5UA 4HFPB 1ELTA 4AG1A 4CH2B 1DE7H 1UCYH 1GI1A 3T62A 1IQIA 2XW9A 4DIHH 5C5NA 1SGRE 1SQOA 1FNIA 1YLDA 1SHHB 2OBOA 1RRKA 1T8NA 2FYRA 1PYTC 2XBXA 1EAUA 3TIUA 1QJ7B 2V3HH 1AUJA 1GI2A 1OWIA 1GBEA 3GCHB 3A89A 1SGDE 1T8LA 1TIOA 2CHAB 5E2PA 1SSXA 2F9VA 1ZTLA 2Y5HA 3ZZ3A 3E16B 2UUKB 1GDQA 4PROA 2P59A 1FLEE 2WYJA 1OWKA 1AZZA 1G3DA 1UVPA 2GCHF 1JWTA 1W7GH 2JH0D 3SV6A 2Y6TA 1BT7A 1P02A 2FI4E 2Y82A 4E05H 3RXCA 5LH8A 2QGRA 3RM0H 2XC4A 1C5LH 1L1GA 3M5LA 1TMTH 1O38A 3SI4H 3MI4A 2QY0B 1ZHRA 1O2WA 3SJ8A 3RXFA 1MAYA 4X2VA 2BMGB 1SGCA 2G00A 5ETXA 3RXMA 3T26A 1O3GA 1HPGA 1HAHH 1H1BA 2OD3B 1GJ4H 4NZQA 2BY6X 4CBNA 2A45B 1V2PT 1J8AA 1BBRE 3TU7H 2OUAA 1HBTH 2XBVA 1GJAB 1DT2A 1IQLA 1ELAA 1MH0A 5AF9H 4IGDA 1DVAH 3HK3B 1THPB 1HAVB 3MO9A 1P2MA 1NTPA 1G37A 3LH3A 1HUTH 2BDBA 1EAIA 3ODDA 1A4WH 1AKSA 1BBRH 1DX5M 1O2IA 1C2MA 2Z9IA 1HFDA 4X6OA 2OCVB 3UUZA 1GJBB 4TY6A 1S81A 1C1RA 3JZ1B 1QQUA 2ANYA 3PYHA 3RMNH 2TBSA 4K1EA 2A4OA 2BY8X 2F9OA 4A92A 4A5TS 3KEEA 9LPRA 1AWFH 1O3EA 1SGQE 1GJ7B 1GBIA 1AHTH 3K2UA 1FY4A 2I6SA 4NA7A 4I7YH 1SMFE 1EPTB 2NU0E 3OY5U 1GGDB 1TOMH 1AMHA 3AW1A 2ZDLA 1AVXA 3PWBA 2Y5GA 2ZP0H 2GCHG 1A5GH 1HAYB 1O2XA 1WQSA 1FPCH 4INHA 1LVYA 3MU4A 3TGKE 2A2XH 2AFQB 3QUMP 3SHAH 2G51A 3UREA 1SHYA 2SGDE 2PHBA 1TGSZ 2DE8A 1CA0C 2G8TA 4OS6A 4F4OC 2PSXA 4YT6H 2C8YB 3MH7A 3A7YA 1UHBB 2BD5A 2Q6DA 1EZSC 1ABJH 1FAKH 3UY9A 1FDPA 2ZNKH 2Z94A 1VGCB 4X6NA 5JBCS 4I8KA 4Y8ZA 1F0UA 4NIWA 2JKHA 2BD2A 3ZVCA 2D8WA 1EUFA 2WYGA 3C27B 2ZFRH 3LC3A 5DP5A 4Q7XA 1Y5AT 3KCGH 4BTUB 1EZXC 1QCPA 4DCDA 2J2UA 1QHRB 3RLYH 1ZTKA 1TX6A 5FX6A 2ZPQA 4JZDH 1F5KU 1OP2A 2PUQH 4CHAC 1MCVA 2D2DA 5GXPA 5EPYA 2GKVE 5LPFA 5SGAE 3KGPA 4E7NA 1AE5A 1EJMA 4TPYA 1HCGA 1YF4A 1ZMJA 1T32A 3RC4A 5E2OA 2GTBA 1V2JT 1KSNA 3EAJA 1W13U 4H4FA 3S7KB 1TB6H 3SW2B 3BTDE 2RG3A 1SGIB 1AI8H 1GCDA 3RXSA 2TGPZ 3PWCA 3S69A 2C8ZB 1A0HB 4A6LA 3BEFB 3URDA 4KELA 4GCHF 3UQOA 1JMOH 2VVVA 1O3HA 1SGEE 1W10U 1TQ0B 5HGGA 3NK8A 4UFFH 1F2SE 4JCNA 3ZVGA 1JIMA 1T8OA 5C1XA 1TWXB 3IITA 3I78A 3ENSB 2BDIA 1HYLA 3SUFA 2Z9JA 2PR3A 1BZXE 3E8LA 1D6RA 3EE0B 1IQEA 1MKXH 1S82A 4CR5A 3H5CB 1B7XB 1ARBA 3GY4A 1BTYA 1T4UH 3TGJE 1GHBF 5K0HA 1C1PA 1LHCH 2BLVA 2ZG0H 3M3VA 1WBGB 1NRSH 3BG8A 1GBHA 1XMNB 1PQ5A 4VGCC 1D9IA 1TQ7B 1Z1IA 4RKJB 4O3TA 1TBQH 1C1OA 2GZ9A 3STIA 4DOQA 1DFPA 2XBWA 4YO9A 2GT8A 4DT7B 2F3CE 1O2QA 1C5WB 1GMCF 1MZDA 1XXDA 1BCUH 1L1NA 1ORFA 2IJOB 3L33A 1LKAA 1CGHA 1V3XA 2B7DH 2A7JA 1YBWA 3ZVBA 4JMYA 1P8VC 5DJ7A 1YPKH 3U8TH 1NN6A 3SV9A 4NZLA 2FX6A 3M5OA 1YKTA 2H6MA 2PTNA 2HNTE 4WWYA 4AX9H 1C2GA 1FJSA 2FX4A 2Z9LA 1GBDA 3N7OA 1MTVA 3NPSA 1E34B 1HRTH 1Y5UT 1CQQA 2Z6BD 2PKSB 8LPRA 2ZGCA 2Y5FA 3T29A 2BXUH 1HJAB 2ZF0H 1DLKB 1HJ8A 2ZU3A 3F9EA 1N6XA 1WV7H 3LGTA 1W3CA 4GCHG 3T5FH 4U2WA 4IS5A 4SGAE 3K6YA 4YLQH 2OC7A 1LCYA 3K9XB 3MWIU 1DUAA 1ZTJA 3ODFA 2BDAA 1SLXB 3MNXA 1GG6C 5C20A 2ZU4A 4ZXXH 1CT4E 3PMAB 3GOVB 5ABWA 1EOJA 3RMMH 1DY8A 1GBCA 4CREA 4A1VA 1NZQH 1N8OC 2R3YA 2CF8H 5F8ZA 1VITH 5A0BA 2B5TB 1SGFG 4B2CA 2GCTB 4NSVA 4ZHLU 1ID5H 4OGXA 4NGAH 2BZAA 2VIVA 3H7OA 1CU1A 1RGQA 1MUEB 1EQ9A 1MQ6A 2OC0A 1GHBG 1A5HA 1K9OE 3GDUA 2UUYA 2TPIZ 1PPGE 1OYTH 2XC5A 4MTBA 1BOQA 3MU1A 4FVBA 3P8OA 4XFQA 1GBJA 2ZC9H 3ZZ7A 1QJ6B 3QWCH 1WTGH 1BTWA 4ASHA 1GMCG 1CBWC 3PTNA 3PB1E 3SU4A 1BB0B 1RXPA 3SOSA 1JOUB 2G4UA 1SGNE 2R3UA 3GY8A 3Q3KA 2GZ8A 3PMJA 1ZJDA 3TLOA 3LOXA 2XC0A 3RXLA 1UVOA 2NWNA 2B0FA 4CRBA 3BTTE 1EATA 4B71A 1O2LA 1LQEA 3V7TA 1O32A 4UONA 3ZYEA 2TRMA 1V2UT 1DXWA 3RXJA 3SJKA 1RTLA 4X8VH 3UNRA 4XDEA 1C1WH 1LQDB 2GT7A 2FM2A 2Z3DA 1C1MA 1O34A 3A85A 4OS4A 1AGJA 1O33A 1NC6A 4KKDA 1O5GH 3SUDA 1QRXA 1XUIA 2ZO3H 1MAXA 1HJ9A 2ZFSA 1SGTA 4NIVA 1O2UA 3R3GB 4FUFA 3A8DA 5EG4A 3TPIZ 4IN2A 2QXHA 2G5NA 1DSUA 1KXCA 4OS1A 4DY7B 1P04A 1BRUP 1HDTH 4D7FA 1UK2A 4X6PA 3F9HA 3AVZA 1IHSH 5J4SA 1O39A 2BOHB 3S0NA 3GY5A 2FDAA 2C90B 2ZQ2A 3PO1B 1BA8B 3BTME 4WVPE 5FXLA 4O9VA 4ISOA 2P3FH 3S9BA 2OINA 1BDAA 2STBE 5GDSH 1ZOMA 2SNWA 1O35A 4YOGA 1E36B 3SNAA 1TA2A 2ODYB 1O2MA 1C5ZB 3SGAE 3CENA 3ATMA 1HB0B 2ZHDA 2Q1JA 2P3TB 4CRCA 4HGCA 1GBAA 2GVFA 3GISB 2XCNA 3SU1A 2ESTE 1KIGH 1HAVA 1UVUH 1BTXA 4MG3A 2J95A 1SGFA 1O3BA 2O8UA 1KXAA 3MHWU 3RP2A 1A3EH 1V2NT 1Q3XA 3D49H 2SGPE 5FX5A 6CHAC 3ZVAA 2BDYA 5GWZA 1ZZZA 2FP7B 1D4PB 1RTKA 2P93A 2XRCA 1D3QB 5E0GA 1FXYA 2QYIA 1VJ9U 1EASA 2CJIA 1BTHH 1E38B 2AH4X 2STAE 2BDHA 3QGNB 3GICB 1V6DA 2GX4A 1QNJA 1YPHE 1TYNA 3QDZB 1J17T 3VPKA 3GYMA 5EQRA 2A1DB 2JETC 3UPEA 3ITIA 4A7IB 5JYIA 1IOEA 3VB6A 1C1VH 3VB7A 1GJ9B 2J9NA 2OBQA 3GY3A 4JYVH 5GJ4B 2ZTXA 3EA9A 1A5IA 1DUEA 2WPHS 1MTNC 4IMQA 4JZIA 1O3DA 1EZQA 4K1SA 3RXOA 3WY8A 1XUFA 4ABFA 2P8OB 2WINI 5EW2H 1KTSB 5CHAB 2V35A 2A5IA 2AGGX 1D3DB 1QFKH 4GPGA 1YPGH 1GJ6A 1EX3A 1EOLA 2HOBA 2ZDNA 4WJG2 1OWHA 1UHBA 2VINA 3FP7E 4NA9H 4IC5A 1Y3UA 4H6SB 3SQEE 4FUEA 4FUCA 3SJ9A 2CV3A 1C5MD 5JBAS 2FZZA 3SBKA 1FIZA 4KTSA 1UTKA 3M37A 1CT2E 3ATKA 4NIYA 5A0CA 2J38A 4JK5A 1DWBH 1RD3B 3OTJE 1W14U 2ZFQH 3OU0A 5ESBA 5JBTA 3FFGA 2WPIS 3RU4E 2ANKH 2ZQ1A 4WH6A 3A7ZA 3LGVA 3RXAA 3PMBB 3M3SA 2WUCA 4ABGA 4UFDH 3UIRA 1AUTC 3A7WA 1B5GH 1S0RA 1BITA 1W7XH 2ZTYA 3F1SB 5L30H 1HNEE 1ANEA 5FCRA 1ZHMA 2F9BH 2BLOA 1QL8A 2SGQE 1GHYH 2BQ7B 2ZDKA 1XUGA 1P2IA 1ANBA 7GCHF 4I8GA 5HMAA 1C5QA 1VCWA 5F6MA 1ZSJA 2ILNA 1ETSH 4FU9A 3O8BA 1QL9A 4K69A 4X1RU 2OC8A 4H42U 5L2YH 1PQ8A 1Q31A 2FYQA 2QN5T 3MOCA 5IYTA 1G3BA 1FN8A 1WAYB 4F49A 5DKMA 2FODA 2V0BA 1G3CA 1V2VT 1KXDA 1FY8E 2A2QH 2FOEA 1GVKB 2HRVA 2A7HA 2EA3A 4JYTA 4BOHA 1IQGA 1ELGA 1O2JA 4K1TA 4MPXA 3BTGE 1NRNH 1UTPA 3BEIB 1V2LT 3ZVFA 2VWNA 1NFYA 1QIXB 1B0EA 2VIQA 5EPNA 1O5BB 3AW0A 1KLIH 1C4V2 2AMQA 4UEHH 5FBEA 3NKKA 3PV4A 5AFYH 2ZI2H 4MLFB 1SR5C 3RXIA 2ZHQH 3D62A 1EB1H 2BVSH 1LDTT 3QZQA 1TGCA 4YOIA 9ESTA 3RXTA 4BAQB 2BD4A 2BX3A 2GGVB 3BSQA 2R2WU 5JDUB 4FUJA 1SL3A 4Z6AH 1OSSA 1YLCA 3F6UH 4Y11E 2WV5A 2GDDA 4H6TA 2GMTC 4BAMB 1WTHD 3T27A 3TK9A 1ESAA 4BAHB 1SLVB 3ATIA 2HPQH 2ASUB 3Q00A 1MD7A 1J9CH 1CSOE 2Q6FA 1O2GH 2W26A 2SGFE 2ZHFH 3D65E 1TRYA 2A4GA 4I8HA 4X2XA 3ELAH 2QAAA 1BMMH 1GI8B 3G01A 1PQAA 4INKA 1TGTA 4YM9A 1O3IA 7GCHG 1FY3A 1A46H 2PTCE 4BXWA 4HTCH 1ZLRA 4DW2U 1GL0E 3GCNA 4UFGH 2WPJS 1WYKA 4AB9A 3MTYA 1ZGIA 3JZ2B 1TX7A 3A8CA 2ZCKP 1KYNA 5G4BA 3SU2A 1QY6A 2VU8E 1O2HA 4WH8A 1DLEA 2D1JA 5AVDA 1O3JA 1LKBA 1Y8TA 4MPVA 1V2ST 1Z8GA 2UUJB 4NG9H 1L2EA 1CE5A 1PPEE 4JYUH 1DPOA 1AVWA 3BIUH 3AAUA 1A7SA 1T8MA 2HNTC 3DFLA 2PLXA 3KQDA 1IQKA 4FUGA 3TGIE 1TPPA 3SNEA 1G3EA 4D76A 1XVOA 4Q80A 1DWEH 1O31A 4LOYH 1VJAU 1G9IE 2XBYA 4XE4A 3KIDU 3ZZ9A 5LPEA 5DO4H 3H7TA 3SI3H 3TH3H 7ESTE 1H8IH 1KLJH 2UWPA 4JK6A 2FOMB 3SU6A 1GBTA 2H5DA 1P11E 3RU4T 2BD7A 3B9FH 4NWKA 1C9PA 1T31A 2JH5D 1VR1H 4X8SH 5E0HA 3F9FA 4MNYA 1NT1A 1O2TA 1OS8A 3TNTA 2BOKA 5JBBS 3RU4D 1K22H 1RJXB 1FY5A 1IQMA 1MKWK 1A0JA 1HAXB 3SO3A 3DUXH 1LPKB 1F0SA 1O3LA 1OX1A 5C2ZA 3L6PA 1G30B 4GUXA 1P2NA 3TITA 2Y7ZA 3KNXA 4MQAA 2G52A 1C5YB 1BUIA 3PM3A 4U30A 1HAIH 1ELFA 1QA0A 2QXIA 2P94A 5EXLA 2W3KA 4D9QA 1GBKA 3E90B 5IDKA 3OY6U 4K60A 2R0KA 1KXFA 2ZU5A 2Z7FE 1QBVH 3SU3A 2BX4A 3D23A 4Q2KA 3S9AA 3UOUA 1UJ1A 2ZU1A 4IC6A 4R0IA 3TH2H 1NFXA 3NUMA 1BMLA 2BD3A 3M35A 4NCYA 1DS2E 3O8RA 5FPSA 3PROA 4U32A 4YOJA 1KDQA 2R9PA 3LKWA 2PSYA 1EXFA 2VIPA 3BG4C 3OYPA 1CA0B 4B73A 1K2I1 2ULLA 2FI5E 2VIDA 3M61U 1NRPH 4D9RA 2H9TH 2NU2E 4SGBE 1P09A 3LU9B 3SUEA 4AFSA 1WCZA 1BQYA 2IN2A 4I8LA 4XSKU 1NU9A 3P8NA 4O97A 4DGJA 2FOBA 2QC2A 3ZVDA 5DGJA 2BQWB 2FTLE 2XWAA 4Y6DA 5E8EH 3W95A 1C5XB 3Q76A 1OKXA 4TYDA 1QBOA 3QK1A 4BANB 2VGCC 3FVFB 3PLPA 2BM2A 2G55A 3LGIA 3DT0H 1DICA 4GLYA 4LZ1H 3HGNA 4CHAB 3U8OH 2ZPSA 2XXLA 2H5CA 1LHFH 3QLPH 1BRBE 1YCPK 1XKBC 4OGYA 3RDZA 1SG8B 3OX7U 2W5EA 1H9HE 1PPHE 4K8BA 5HM2A 4B75A 4RSPA 1AQ7A 1YCPM 5C3NA 5K7RA 1F7ZA 1NU7B 3MU5A 4AGKA 1AIXH 3SNDA 3NCLA 1P05A 1OWDA 2BB4A 2FO9A 4Y8XA 2F83A 3F9GA 3LONA 1AN1E 2Z3CA 2BDGA 2ALVA 3VB4A 2WPLS 1BHXB 3KQEA 3BG4B 2TGTA 1PPFE 1UMAH 4LXBH 3M7TA 3EDXB 1GDNA 1MMJN 2EI7A 3KN2A 1GMHF 2FLBH 2ZFPH 2BY9X 3RXPA 3SJIA 2FS9A 1O5DH 3MH6A 2A31A 3UNQA 3GCOA 1S6HA 1P2QA 1ELCA 5EOKA 2NU3E 4E7RG 2G81E 4K3JA 2J92A 2AIQA 2ZKSA 1YPHC 2J4IA 3E6PH 3U8RH 4VGCB 2WUBA 1A1RA 1XX9A 2J94A 1P2OA 3SU0A 5C67A 1DANH 1C2JA 2ANMH 4AOQA 2VGCB 1C5RA 1DDJA 4YZUA 1RS0A 1V2OT 5TCCA 3SGQE 5A0AE 5ESTE 3MU0A 4YESB 2PV9B 3ZZDA 1MU6B 1Y3YA 2TGAA 3ZZCA 4X1SU 4Y7AA 1C5NH 1AFQC 1JRTA 3FANA 2WPKS 1AD8H 1K28D 2ZU2A 1TFXA 3E0NB 1AO5A 3STJA 1WU1A 4AN7A 3PLBA 1WQVH 5EQQA 4WXIA 1L4ZA 1Y3XA 1P3CA 1GCTC 2ZGXH 2H9EH 2A5KA 2QF0A 3RXDA 1CHGA 1P12E 1TNGA 4OS2A 1ZSKA 1BJUA 4OS7A 3FP6E 1FIWA 3K6ZA 6LPRA 3MFJA 1TALA 1LVOA 4YT7H 3SORA 1C2FA 1CHOF 4NFFA 4K5ZA 3VB3A 3ZZ6A 4J1YA 3BIVH 3A8BA 4MPWA 5T6FA 4WY3A 1AZ8A 2AGIX 3BEUA 1GG6B 1O3FA 1YPJH 5PTPA 1DSTA 2ZGBH 1K1MA 4U01A 1EP5A 1CA8B 2GV6A 1QBNA 4UE7H 2BLQA 3A80A 4UD9H 3U1JB 2C3SA 1N8OB 1C1NA 1KDQB 1MZAA 5AFZH 1BTUA 1KY9A 1AY6H 3QGJA 4AFZA 2SNVA 4K8YA 4X2WA 3UTUH 4AFUA 1INCA 1G2MA 1C2IA 4KTCA 1M9UA 1O5FH 1AB9C 1DOJA 2ZZUH 3GYLB 3Q77A 1GHZA 1LHGH 1MQ5A 3FZDA 1DITH 2V3OH 2AIPA 1TPAE 1C5SA 1TGNA 5A2MH 1SGPE 2Z9KA 4Q7ZA 1CBWB 4JZ1A 1P2KA 5I46H 2WV4A 3IWMA 3A88A 1YP9A 3TJUA 1LPGB 1OXGA 1FPHH 2YOLA 1K1IA 2VJ1A 1TPSA 1E0FD 1ZPBA 5DP7A 2AYWA 5LGOA 2M5TA 2ZGHA 3E1XB 3TJVA 5DP6A 1TE0A 1ACBE 2HPPH 1YGCH 5GCHF 1X7AC 1NRRH 2F9UA 1LVMA 1BHXF 3MO3A 1K1OA 2PKAB 1K1PA 1EAWA 1F5LA 7LPRA 1GCTB 1FMGA 4I32A 1TRNA 3UWIA 1EJAA 3GDSA 3M7QA 4X1PU 1LHDH 4O3UA 2R0LA 1C4Y2 3HKJB 2SGAA 3A81A 1TOCB 1EZUC 1Z6JH 4GAWA 1ANCA 1ZHPA 3M3TA 1O2SA 1GVZA 3SV2H 1P2JA 4BAOB 4FUHA 4GHQA 2BQ6B 1CHOG 6GCHF 1ELVA 3LDXH 3HATH 3HPTB 1TAWA 1UVSH 2O8LA 4Y71A 3LGUA 1TLDA 4FXGH 2W3IA 1TPOA 1TNLA 4AFQA 1C1QA 5F03A 4WMDA 4BAKB 1SOZA 1GI0A 2P16A 1JBUH 2FOGA 1F92A 2KAIA 4X1QU 2HGTH 2QCYA 1D3TB 1LO6A 2OC1A 4B76A 2C93B 4Y7BA 2GV7A 3EYDA 4NA8A 1Z1JA 3PTBA 1FV9A 1H4WA 1UTJA 1LMWB 3SZNA 1ESTA 1Z71A 1C4U2 1QURH 1OP8A 2ANWA 3A8AA 3IG6B 3GCHC 2CHAC 2ZIQH 1ZRBA 3A86A 3OSYA 1KXEA 1BRCE 4ABAA 2QV1A 3A82A 4K2YA 5HYOA 2F9PA 1UTOA 3A87A 4AZ2B 1T4VH 2HVXA 2O9QA 2P3UB 3NZIA 5B6OA 3QX5H 4WXVA 3QZRA 1UTNA 6CHAB 4GSOA 1B0FA 2VB0A 1P01A 3HGPA 5GCHG 4BTIB 2J34A 5DP9A 6ESTA 4ZROA 2G4TA 2VH6A 1SC8U 1J15A 5L6NH 5FCKA 3CS7A 3V0XA 5DP3A 5EQSA 5J4QA 1PPBH 1FUJA 1G36A 4AYYB 2AGEX 1OYQA 2FI3E 1O30A 3P92A 2DE9A 1TBZH 2FOHA 2GP9B 3NXPA 2XNIA 4Y0ZE 1A61H 2JETB 1V2TT 4CR9A 6GCHG 3RLWH 2OTVA 4X8TH 5I25A 1RTFB 1C2LA 3SUGA 2F91A 2EI8A 2VWLA 1U6QA 3EGKH 4NIXA 1AU8A 5T6DA 1Q2WA 3K65B 1TNKA 1K1NA 1LTOA 1MTNB 4NWLA 2I6QA 4DURA 3S7HB 1H9LB 4E06H 1TMBH 1XXFA 3P6ZB 1TRMA 1QR3E 2W7SA 2H1UA 4MNVA 5FAHA 1ABIH 1C2EA 3MU8A 2C8WB 4GVUA 2FOFA 4XOJA 4LZ4B 1GI5A 1PFXC 4I8JA 3U69H 1NPMA 1XUKA 1S85A 2CMYA 5DP8A 4I31A 7KMEH 4MPUA 1CGIE 3M5NA 1O2KA 3EQ0H 2VWOA 1ZMNA 4Y76A 3RUOA 1C2DA 4FUBA 3RXKA 1EPTC 2AMPA 1V2MT 4Y10E 1GGDC 1O2OA 3PMHB 1WSSH 3A7VA 1DWCH 1N6YA 1PJPA 3BF6H 4MDSA 3LT3A 2IPHA 2FESH 1WOFA 1E37B 2NU1E 5EU8A 2EEKA 1PPZA 1SFIA 3BN9A 1SQAA 3TJOA 1IQNA 5HXFA 1J14A 2PGQB 5GPIB 5FPYA 5A8ZA 1MKWH 4M7GA 1CVWH 1PQ7A 1VGCC 5EGMA 1W11U 4KGAA 1QL7A 1YPMH 3KL6A 4Q7YA 2AEIH 1P03A 3I77A 4Y0YE 5A8YA 1OOKB 4TY7A 2ZDVH 1BMAA 5BPEA 1SGYE 2VVUA 2O8WA 2ZA5A 3RXVA 1GMDF 2BD9A 2BVRH 3SJOA 1JRSA 2WPMS 1Y3WA 4JZEH 4I33A 2QIQA 1JXPA 1UTMA 1SFQB 4TPIZ 2A7CA 4QT8C 4DJZB 3F68H 1TNIA 3MYWA 1E35B 1NS3A 2PWXA 3GCTF 1UCYK 2PFEA 1PPCE 1GBBA 1QQ4A 1GDUA 1L0ZA 4YLUA 2Z3EA 1IHTH 2Q6GA 1Z8JB 1MBQA 2PGBB 1TONA 4D7GA 2ZCLP 3A7TA 1S84A 3Q3YA 2KAIB 1VZQH 1O37A 2ZDMA 2FXRA 1RIWC 2C8XB 3LJOA 4B2AA 2VIOA 3RXEA 3DD2H 1OWJA 3QO6A 3ZV8A 1QB1A 4ABDA 4ABBA 2GMTB 1YM0A 1P10A 1K1LA 1W0ZU 2RDLA 4ABHA 3RXHA 3O8DA 3VXEH 3MNSA 2AERH 3GY2A 4B2BA 3ATLA 5CMXH 3ESTA 1GBLA 1W2KH 1NROH 1TGBA 3BTQE 2XCFA 1NO9H 1THRH 1UTQA 1ZRKA 3LH1A 4AB8A 3BTEE 2YNAA 1YYY1 4LK4A 1W0YH 4RKOB 3QN7A 1GBMA 1ELBA 4ZHAA 1OPHB 1C5OH 3RXGA 1O5EH 5AHGH 1FQ3A 1GI9B 1GI4A 3P70B 2QXGA 2RCEA 3A84A 1EKBB 1K1JA 1YCPH 1GJDB 4TWWA 3ATWA 2A0QB 3SGBE 1C9TA 1AVGH 3FAOA 1J16A 4IBLH 2FPZA 1P9UA 3R0FA 1EB2A 4O03A 5A8XA 1QGFA 1Z8RA 1GL1A 4ABEA 3V13A 3ZZ4A 2UUFB 1GMDG 4INLA 2HWLB 1BBRK 1C5PA 2CGAA 2CN0H 4TWYA 1RFNA 2Y80A 2Y81A 3CP7A 1HIAB 4CRFA 4WMFA 1TNHA 1A0LA 3ZZ8A 3KF2A 1P3EA 1AFEH 3GCTG 4XBDA 4UDWH 5JB9S 1ELEE 4ISNA 1O3MA 2BDCA 1FZZA 3LIWA 4Y79A 4YTAA 3SU5A 4KTUA 1HLTH 2A5AA 1ETRH 4ISHH 1RIWB 1Z8IB 4X8UH 2PKSC 2VWMA 2B9LA 3RC6A 1S5SA 1GJCB 1HJAC 2QF3A 2SGEE 2GD4B 3BTFE 1VCQA 3TH4H 2EC9H 3SN8A 1ZJKA 5DP4A 2FOCA 1P57B 4DG4A 4ZKNU 3VGCC 3TVJB 5TCAA 4XBCA 3PLKA 4MVNA 2FIRH 1GHAF 2ZGJA 1KTTB 2ZHEH 1TA6A 2OLGA 2Y7XA 3QTOH 2ALPA 1GBFA 3ZVEA 4WF8A 2YNBA 3P8FA 5LPRA 1YC0A 4J2YB 2FEQH 4Z0KA 5A09A 1O36A 2CF9H 1HV7A 3HK6B 1F0TA 2PKAA 2GCTC 4ZKSU 1HAZB 3L3TA 3TK5A 1C5VA 3SV7A 4JZFH 5DPAA 1BTZA 2D26C 2QXJA 1THSH 1TMUH 1ZSLA 4BTTB 1SPJA 1HAPH 3B23B 3M36A 2EI6A 5T3HA 4NFEA 3UR9A 1MBMA 4BXSA 4CBOA 1MTWA 4ISIH 3NWUA 1O2YA 1YPLH 2UWLA 2PUXB 1Y59T 2AS9A 3V12A 4X1NU 3DHKH 1O3OA 3E91A 4BNRA 1W8BH 1AKSB 1O2ZA 2H9HA 1NFWA 4KP0A 2OQ5A 4GHTA 3ZZ5A 4CRDA 1FI8A 3W94A 1C2KA 2TIOA 1GI3A 1GPZA 2UWOA 4R8TB 2XYAA 3M5MA 5TJXA 5HM9A 1KLTA 1GJ8B 4FU8A 2B8OH 1O2VA 4CH8B 4ABIA 1TBRH 3MNCA 4UFEH 3LC5A 3LPRA 3T25A 2ZWLH 2TGDA 4ZHMU 5C1UA 3MO6A 1SLUB 1BTPA 3VGCB 2BY5X 4WMEA 2BHGA 2O8TA 1QJ1B 4X6MA 3UNSA 4ZKRU 3ZZAA 5CE1A 1O2RA 3C1KA 1O3CA 3EA8A 4ABJA 3BTWE 4ESTE 3BTHE 1SI5H 1GI7B 3UOPA 2R2MB 2FWWA 3S9CA 4X2YA 1AWHB 1GHAG 3VEQB 1HAOH 4AGJA 1D3PB 5C5OA 5JB8S 4HZHA 1F0RA 1SOTA 1HXFH 2C4FH 1ZR0A 3M7UA 4B74A 1MKXK 1S0QA 1SB1H 3TJNA 3PO1C 3E3TA 2AMDA 1D6WA 4FU7A 1OP0A 4ZH8A 1QRZA 2GDEH 1QA7A 2FMJA 2O8MA 3CS0A 8ESTE 1UTLM 3P17H 1H9IE 1L1JA 1NM6A 3VB5A 3A7XA 1IAUA 4DVAU 3LGWA 3P8GA 4ISLA 2HNTF 1BJVA 4FVDA 2BLWA 1PYTD 1GWAA 2NU4E 2THFB 4MNWA 4ZXYH 3AAVA 5DK1A 1P0SH 1EAXA 3RXUA 1ETTH 5H4IB 1GI6A 2A4QA 1G32B 1O3PB 4AORA 4AYVB 1MCTA 3U98H 3RMOH 2LNCA 1V2KT 1XVMA 1C1SA 1C5TA 2GZ7A 3GY6A 3RXBA 1DM4B 1CT0E 2ODPA 1MU8B 3KQCA 1GMHG 1DXPA 1VITF 2FLRH 5DG6A 1T7CA 1TABE 2A4RA 1NFUA 1LPZB 1Y5BT 1OWEA 3UR6A 1DY9A 5EODA 1O2PA 2ZECA 1QTFA 5EW1H 4NSYA 1O0DH 4XBBA 5BRRE 5L2ZH 2ZCHP 3DA9B 5EXNA 2VIWA 1YPEH 3QTVH 2ODQA 4THNH 1CGJE 3T2NA 3ZV9A 2ZFFH 1HGTH 5JPMH 2H2ZA 2XTTB 3Q3XA 4ZUHA 1MTSA 2RA3A 3RC5A 1HXEH 4MNXA 1QB6A 5FHTA 1N1LA 1A3BH 1NESE 3VFEA 3FZZA 2OP9A 1V2QT 2QA9E 3MH4A 3SHCH 2SFAA 3SQHE 2P8OC 3TNSA 1G2LA 1SLWB 5CHAC 5E0JA 5GIBA 3SV8A 1IQJA 2BZ6H 1AFQB 1ESBA 1GHXH 4ZKOU 2VH0A 1P06A 3MMGA 1GVLA 1FONA 4AG2A 1K21H 3GDVA 1O5CB 2BTCE 1ANDA 1CO7E 3VXFH 2CXVA 2BVXH 3KHVA 2PW8H 1ZGVA 1NRQH 2BY7X 3I29A 4HI3A 2HLCA 4CRAA 2ZPRA 3ZYDA 1GHVH 3MH5A 4D8NA 8GCHF 2XWBI 1C2HA 2P95A 1O5AB 4DIIH 1BRAA 1ARCA 3RMLH 1TNJA 4FUIA 1P9SA 1AE8H 1Z6EA 2F9NA 3SNBA 2RA0A 1FY1A 4A1TA 5T6GA 2BD8A 1O3AA 1EJNA 2OQUA 1VITG 4OS5A 1Z7KA 3V3MA 3LJJA 2LPRA 1ELDE 1A2CH 4Y8YA 1UVTH 2A32A 2BYAX 1MTUA 1H8DH 2Z9GA 4FUDA 4B1TA 1EPTA 3RXQA 1TX8A 1O3NA 4IMZA 1WUNH 2K1QA 1BIOA 1O3KA 2VNTA 2ZTZA 5F8TA 3MNBA 1NY22 1AB9B 2G5VA 3E0PB 1V2RT 1C1UH 1IQFA 1JIRA 1FAXA 2OXSA 4RN6A 1S6FA 4CRGA 2ZFTA 4IW4E 3GY7A 1XM1A 2VVCA 1ZMLA 1ZPCA 3TK6A 3BV9B 2BXTH 4A1XA 1UO6A 1V2WT 8KME2 3B8JA 1L4DA 3U1IB 2FTMA 3URCA 1XUJA 5F8XA 2FS8A 4ZMAH 3KQBA 3RM2H 3BTKE 1C1TA 1GHWH 2FOAA 3UWJH 1UK4A 1HAGE 2V6NA 3EA7A 3HKIB 1LHEH 1UK3A 1EP6A 1SQTA 1LVBA 4X0WU 1SVPA 1S83A 1KXBA 3T28A 3UFAA 3ZZBA 1DWDH 3U9AH 3UQVA 1QRWA 2ZEBA 5FBIA 3O8CA 1Y3VA 1SBWA 1ZYOA 1BMNH 1GJ5H 3DFJA 1F5RA 8GCHG 3P95A 1ZPZA 2HALA 3LGYA 2IOTA 5FPTA 3A83A 2ZDAH 2DUCA 1MD8A 4IN1A 1QB9A 1FN6A 1HIAA 1IQHA 2JH6D
chains in the Genus database with same CATH superfamily
2W7UA 1VCPA 1UCYE 5EXMA 1O2NA 4Q63A 2ZHWH 3AASA 1XUHA 3FP8E 3SNCA 5C1YA 1XKAC 4ZAEA 3RXRA 1W12U 1C5UA 4HFPB 1ELTA 4AG1A 4CH2B 1DE7H 1UCYH 1GI1A 3T62A 1IQIA 2XW9A 3KYFA 4DIHH 5C5NA 4ACAA 1SGRE 1SQOA 1FNIA 1YLDA 1SHHB 2OBOA 1RRKA 1T8NA 2FYRA 1PYTC 2XBXA 1EAUA 3TIUA 1QJ7B 2V3HH 1AUJA 1GI2A 1OWIA 1GBEA 3GCHB 3A89A 1SGDE 1T8LA 1TIOA 2CHAB 5E2PA 1SSXA 3F2HA 2F9VA 4Q4LA 1ZTLA 2Y5HA 3ZZ3A 3E16B 2UUKB 1GDQA 4PROA 2P59A 1FLEE 2WYJA 1OWKA 1AZZA 1G3DA 1UVPA 2GCHF 1JWTA 1W7GH 2JH0D 3SV6A 2Y6TA 1BT7A 1P02A 2FI4E 2Y82A 4E05H 3RXCA 5LH8A 2QGRA 3RM0H 2XC4A 1C5LH 1L1GA 3M5LA 1TMTH 1O38A 3SI4H 3MI4A 2QY0B 1ZHRA 1O2WA 3SJ8A 3RXFA 1MAYA 4X2VA 2BMGB 1SGCA 2G00A 5ETXA 3RXMA 3T26A 1O3GA 1HPGA 1HAHH 1H1BA 2OD3B 1GJ4H 4NZQA 2BY6X 4CBNA 2A45B 2RFKC 1V2PT 1J8AA 1BBRE 3TU7H 2OUAA 1HBTH 2XBVA 1GJAB 1DT2A 1IQLA 1ELAA 1MH0A 5AF9H 3DSOA 4IGDA 1DVAH 3HK3B 1THPB 1HAVB 3MO9A 1P2MA 1NTPA 1G37A 3LH3A 4P02A 5FL7D 1HUTH 2BDBA 1EAIA 3ODDA 1A4WH 1AKSA 1BBRH 1DX5M 1O2IA 1BMFD 1C2MA 2Z9IA 1HFDA 4X6OA 2OCVB 3UUZA 1GJBB 4TY6A 1S81A 4Z1MD 4YXWD 1C1RA 3JZ1B 1QQUA 2ANYA 3PYHA 3RMNH 2TBSA 1FX0B 4K1EA 2A4OA 2BY8X 2F9OA 4A92A 4A5TS 3KEEA 9LPRA 1QZ8A 1AWFH 1O3EA 1W0JD 1SGQE 1GJ7B 1GBIA 1AHTH 3K2UA 1FY4A 2I6SA 4NA7A 4I7YH 1SMFE 1EPTB 2NU0E 3OY5U 1GGDB 1TOMH 1AMHA 3AW1A 2ZDLA 1AVXA 3PWBA 2Y5GA 2ZP0H 2GCHG 1A5GH 1HAYB 1O2XA 1WQSA 1FPCH 4INHA 1LVYA 3MU4A 3TGKE 2A2XH 2AFQB 3QUMP 3SHAH 2G51A 3UREA 3F2FA 1SHYA 2SGDE 2PHBA 1TGSZ 2DE8A 1CA0C 2G8TA 4OS6A 4F4OC 2PSXA 4YT6H 2C8YB 3MH7A 3A7YA 1UHBB 2BD5A 2Q6DA 1EZSC 1ABJH 1FAKH 3UY9A 1FDPA 2ZNKH 2Z94A 1VGCB 4X6NA 5JBCS 4I8KA 4Y8ZA 1F0UA 4NIWA 2JKHA 2BD2A 1NBME 3ZVCA 2D8WA 1EUFA 2WYGA 4OM9A 3C27B 2ZFRH 3LC3A 5DP5A 4Q7XA 1Y5AT 3KCGH 4BTUB 1EZXC 1QCPA 4DCDA 2J2UA 1QHRB 3RLYH 1ZTKA 1TX6A 5FX6A 5EIYA 2ZPQA 4JZDH 1F5KU 1OP2A 2PUQH 3CNRA 4CHAC 1MCVA 2D2DA 5GXPA 5EPYA 2GKVE 5LPFA 5SGAE 3KGPA 4E7NA 1AE5A 1EJMA 4TPYA 1HCGA 1YF4A 1ZMJA 1T32A 3RC4A 5E2OA 2GTBA 1V2JT 4F48B 1KSNA 3EAJA 1W13U 4H4FA 3S7KB 1TB6H 3SW2B 3BTDE 2RG3A 1SGIB 4B6EA 1AI8H 1GCDA 3RXSA 2TGPZ 3PWCA 3S69A 2C8ZB 1A0HB 4A6LA 3BEFB 3URDA 4KELA 4GCHF 3UQOA 1JMOH 2VVVA 1O3HA 1SGEE 1W10U 1TQ0B 2PP6A 5HGGA 3EE7A 3NK8A 4UFFH 1F2SE 4JCNA 3ZVGA 1JIMA 1T8OA 5C1XA 1TWXB 3DCLA 3IITA 3I78A 4FOUC 3ENSB 2BDIA 1HYLA 3SUFA 2Z9JA 2PR3A 1BZXE 2K0QA 3E8LA 1D6RA 4ASUD 3EE0B 1IQEA 2HVYB 1MKXH 1S82A 4CR5A 3H5CB 3KYGA 1B7XB 1ARBA 3GY4A 1BTYA 1T4UH 3TGJE 1GHBF 5K0HA 1C1PA 1LHCH 2BLVA 2ZG0H 3M3VA 1WBGB 1NRSH 3BG8A 1GBHA 1XMNB 1PQ5A 4VGCC 1D9IA 1TQ7B 1Z1IA 4RKJB 4O3TA 1TBQH 1C1OA 2YMSD 2GZ9A 3STIA 4DOQA 1DFPA 2XBWA 4YO9A 2GT8A 4DT7B 2F3CE 1O2QA 1C5WB 1GMCF 2EQNA 1MZDA 1XXDA 1BCUH 1L1NA 1ORFA 2IJOB 3L33A 1LKAA 1CGHA 1V3XA 2QF4A 2B7DH 2A7JA 2K8IA 1YBWA 3ZVBA 4JMYA 1P8VC 5DJ7A 5EJZA 1YPKH 3U8TH 1NN6A 3SV9A 4NZLA 2FX6A 3M5OA 1YKTA 2H6MA 2PTNA 2HNTE 4WWYA 4AX9H 3OTPA 1C2GA 1FJSA 2FX4A 2Z9LA 1GBDA 3N7OA 1MTVA 3NPSA 1E34B 1HRTH 1Y5UT 1CQQA 2Z6BD 2PKSB 5GNDA 8LPRA 3F3BA 2ZGCA 2Y5FA 3T29A 2BXUH 1HJAB 2KR7A 2ZF0H 3KQ5A 1DLKB 1HJ8A 2ZU3A 3F9EA 1N6XA 1WV7H 3LGTA 1W3CA 4GCHG 3T5FH 4U2WA 4IS5A 4SGAE 3K6YA 4YLQH 2OC7A 1LCYA 5IK2D 3K9XB 3MWIU 1DUAA 1ZTJA 3ODFA 2BDAA 1SLXB 3MNXA 1GG6C 3UB0A 5C20A 2ZU4A 4ZXXH 1CT4E 3PMAB 4P00A 3GOVB 5ABWA 1EOJA 3RMMH 1DY8A 1GBCA 4CREA 4A1VA 1NZQH 1N8OC 2R3YA 2CF8H 5F8ZA 1VITH 5A0BA 2B5TB 1SGFG 4B2CA 2GCTB 4NSVA 4ZHLU 1ID5H 4OGXA 4NGAH 2BZAA 2VIVA 3H7OA 1CU1A 1RGQA 1MUEB 1EQ9A 1MQ6A 2OC0A 1GHBG 1A5HA 1K9OE 3F0OA 3GDUA 2UUYA 2TPIZ 1PPGE 1OYTH 2XC5A 4MTBA 1WXRA 1BOQA 3MU1A 4FVBA 3P8OA 4XFQA 1GBJA 2ZC9H 3ZZ7A 1QJ6B 3QWCH 1WTGH 1NBMD 1BTWA 4ASHA 1GMCG 1CBWC 2F4LA 3WW7A 3PTNA 3PB1E 3SU4A 1BB0B 1RXPA 3SOSA 1JOUB 2G4UA 1SGNE 2R3UA 3GY8A 3Q3KA 2GZ8A 3PMJA 1ZJDA 3TLOA 3LOXA 2XC0A 3RXLA 1UVOA 2NWNA 2B0FA 4CRBA 3BTTE 1EATA 5DSFA 4B71A 1O2LA 1LQEA 3V7TA 1O32A 4UONA 3ZYEA 2TRMA 1V2UT 1DXWA 3RXJA 3SJKA 1RTLA 4X8VH 3UNRA 4XDEA 1C1WH 1LQDB 2GT7A 2FM2A 2Z3DA 3F2GA 1C1MA 1O34A 3A85A 4OS4A 1AGJA 1O33A 1NC6A 4KKDA 1O5GH 3SUDA 1QRXA 1XUIA 2ZO3H 1MAXA 1HJ9A 2ZFSA 1SGTA 4NIVA 5EJLA 1O2UA 3R3GB 4FUFA 3A8DA 5EG4A 3TPIZ 4IN2A 2QXHA 2G5NA 1DSUA 1KXCA 4OS1A 4DY7B 1P04A 4TT3D 1BRUP 1HDTH 4D7FA 1UK2A 4X6PA 3F9HA 3AVZA 1IHSH 5J4SA 1O39A 2BOHB 3S0NA 3GY5A 2FDAA 2C90B 2ZQ2A 2F43B 3PO1B 1BA8B 3BTME 4WVPE 5FXLA 4O9VA 4ISOA 3PRBA 2P3FH 3S9BA 2KCPA 2OINA 1BDAA 2STBE 5GDSH 1ZOMA 2SNWA 1O35A 4YOGA 1E36B 3SNAA 1TA2A 2ODYB 1O2MA 1C5ZB 3SGAE 3CENA 3N7DA 3ATMA 1HB0B 2ZHDA 2Q1JA 2P3TB 4CRCA 4HGCA 1GBAA 2GVFA 3GISB 2XCNA 3SU1A 2ESTE 1KIGH 1HAVA 1UVUH 1BTXA 4MG3A 2J95A 3WWFA 1SGFA 1O3BA 2O8UA 1KXAA 3MHWU 3RP2A 1A3EH 1V2NT 1Q3XA 3D49H 2SGPE 5FX5A 6CHAC 3ZVAA 2BDYA 5GWZA 1ZZZA 2FP7B 1D4PB 1RTKA 2P93A 2XRCA 1D3QB 5E0GA 1FXYA 2QYIA 4B6FA 1VJ9U 1EASA 2CJIA 1BTHH 1E38B 2AH4X 2STAE 2BDHA 3QGNB 3GICB 1V6DA 2GX4A 1QNJA 2RDEA 1YPHE 2YMSC 1TYNA 3QDZB 1J17T 3VPKA 3GYMA 5EQRA 2A1DB 2JETC 3UPEA 3ITIA 4A7IB 5JYIA 4AC9A 1IOEA 3VB6A 1C1VH 3VB7A 1GJ9B 2J9NA 2OBQA 3GY3A 4JYVH 5GJ4B 2ZTXA 3EA9A 1A5IA 1DUEA 2WPHS 1MTNC 1VKYA 4IMQA 4JZIA 1O3DA 1EZQA 4K1SA 3RXOA 3WY8A 1XUFA 4ABFA 2P8OB 2VBCA 2WINI 5EW2H 1KTSB 5CHAB 2V35A 2A5IA 2AGGX 1D3DB 1QFKH 4GPGA 1YPGH 1GJ6A 1EX3A 1EOLA 2HOBA 2ZDNA 4WJG2 1OWHA 1UHBA 2VINA 3FP7E 4NA9H 5HKKD 4IC5A 1Y3UA 4H6SB 3SQEE 4FUEA 4FUCA 3SJ9A 2CV3A 1C5MD 5JBAS 2FZZA 3SBKA 1FIZA 4KTSA 1UTKA 3M37A 1CT2E 3ATKA 4NIYA 5A0CA 2J38A 4JK5A 1DWBH 1RD3B 3OTJE 1W14U 2ZFQH 3OU0A 5ESBA 5JBTA 3FFGA 2J5UA 2WPIS 3RU4E 2ANKH 2ZQ1A 4WH6A 3A7ZA 3LGVA 3RXAA 3PMBB 3M3SA 2WUCA 4ABGA 4UFDH 3UIRA 1AUTC 3A7WA 1B5GH 1S0RA 1BITA 1W7XH 2ZTYA 3F1SB 5L30H 1HNEE 1ANEA 5FCRA 1ZHMA 2F9BH 2BLOA 1QL8A 2SGQE 1GHYH 2YMSB 2BQ7B 2ZDKA 1XUGA 1P2IA 1ANBA 7GCHF 4I8GA 5HMAA 1C5QA 1VCWA 5F6MA 1ZSJA 2ILNA 1ETSH 4FU9A 3O8BA 1QL9A 4K69A 3H09A 4X1RU 2OC8A 4H42U 5L2YH 1PQ8A 1Q31A 2FYQA 2QN5T 3MOCA 5IYTA 1G3BA 1FN8A 1WAYB 4F49A 5DKMA 2FODA 2V0BA 1G3CA 1V2VT 1KXDA 1FY8E 2A2QH 2FOEA 1GVKB 3UAIC 2HRVA 2A7HA 2EA3A 4JYTA 4BOHA 1IQGA 1ELGA 1O2JA 4K1TA 4MPXA 3BTGE 1NRNH 1UTPA 3BEIB 1V2LT 3ZVFA 2VWNA 1NFYA 1QIXB 1B0EA 2VIQA 5EPNA 1O5BB 3AW0A 1KLIH 1C4V2 2AMQA 4UEHH 5FBEA 3NKKA 3PV4A 5AFYH 5KEDA 2ZI2H 4MLFB 1SR5C 3RXIA 2ZHQH 3D62A 1EB1H 2BVSH 1LDTT 3QZQA 1TGCA 4YOIA 9ESTA 3RXTA 4BAQB 2BD4A 2BX3A 2GGVB 2QF5A 3BSQA 2R2WU 5JDUB 4FUJA 1SL3A 4Z6AH 1OSSA 1YLCA 3F6UH 4Y11E 2WV5A 2GDDA 4H6TA 2GMTC 4BAMB 1E1QD 1WTHD 3T27A 3TK9A 2XNDD 1ESAA 4BAHB 1SLVB 3ATIA 2HPQH 2ASUB 3Q00A 1MD7A 1J9CH 1CSOE 2Q6FA 1O2GH 2W26A 2SGFE 2ZHFH 3D65E 2KCOA 1TRYA 2A4GA 4I8HA 4X2XA 3ELAH 2QAAA 1BMMH 1GI8B 2JJ2D 3G01A 1PQAA 4INKA 2KZ4A 1TGTA 4YM9A 1O3IA 7GCHG 1FY3A 1A46H 2PTCE 4BXWA 4HTCH 1ZLRA 4DW2U 1GL0E 3GCNA 4UFGH 2WPJS 1WYKA 4AB9A 3MTYA 1ZGIA 3JZ2B 1TX7A 3A8CA 3VG8A 2ZCKP 1KYNA 5G4BA 3SU2A 1QY6A 2VU8E 2WHXA 1EFRD 1O2HA 4WH8A 1DLEA 2D1JA 5AVDA 1O3JA 1LKBA 1Y8TA 4MPVA 1V2ST 2JIZD 1Z8GA 2UUJB 4NG9H 1L2EA 1CE5A 1PPEE 3F0PA 4JYUH 1DPOA 1AVWA 3BIUH 3AAUA 1A7SA 1T8MA 2HNTC 3DFLA 2PLXA 3KQDA 1IQKA 4FUGA 3TGIE 1TPPA 3SNEA 1G3EA 4D76A 1XVOA 4Q80A 1DWEH 1O31A 4LOYH 1VJAU 1G9IE 2XBYA 5KGOA 4XE4A 3KIDU 3ZZ9A 3SYJA 5LPEA 5DO4H 3H7TA 3SI3H 5F53A 3TH3H 7ESTE 1H8IH 1KLJH 2UWPA 4JK6A 2FOMB 1SKYE 3SU6A 1GBTA 2H5DA 1P11E 3RU4T 2BD7A 4I86A 3B9FH 4NWKA 1C9PA 1T31A 2JH5D 1VR1H 4X8SH 5E0HA 3F9FA 4MNYA 1NT1A 1O2TA 1OS8A 3TNTA 2BOKA 5JBBS 3RU4D 1K22H 1RJXB 1FY5A 1IQMA 1MKWK 1A0JA 1HAXB 3SO3A 1S6LA 3DUXH 1LPKB 1F0SA 1O3LA 1OX1A 5C2ZA 3L6PA 1G30B 4GUXA 1YLNA 2WZQA 1P2NA 3TITA 2Y7ZA 3KNXA 4MQAA 2G52A 1C5YB 1BUIA 3PM3A 4U30A 1HAIH 1ELFA 1QA0A 2QXIA 2P94A 5EXLA 2W3KA 4D9QA 1GBKA 3E90B 5IDKA 3OY6U 4K60A 2R0KA 1KXFA 2ZU5A 2Z7FE 1QBVH 3SU3A 2BX4A 3D23A 4Q2KA 2JDID 3S9AA 3UOUA 1UJ1A 2ZU1A 4IC6A 4R0IA 3TH2H 1NFXA 3NUMA 1BMLA 2BD3A 3M35A 4NCYA 1DS2E 3O8RA 5FPSA 3PROA 4U32A 4YOJA 1KDQA 2R9PA 3LKWA 2PSYA 1EXFA 2VIPA 3BG4C 3OYPA 1CA0B 4B73A 1K2I1 2ULLA 2FI5E 2VIDA 3NRLA 3M61U 1NRPH 4D9RA 2H9TH 2NU2E 4SGBE 1P09A 3LU9B 3SUEA 4AFSA 1WCZA 1BQYA 2IN2A 4I8LA 4XSKU 1NU9A 3P8NA 4O97A 4DGJA 2FOBA 2QC2A 3ZVDA 5DGJA 2BQWB 2FTLE 2XWAA 4Y6DA 5E8EH 3W95A 1C5XB 3Q76A 1OKXA 4TYDA 1QBOA 3QK1A 4BANB 2VGCC 3FVFB 3PLPA 2BM2A 2G55A 3LGIA 3DT0H 1DICA 4GLYA 4LZ1H 2L6OA 3HGNA 4CHAB 3U8OH 2ZPSA 2XXLA 2H5CA 1LHFH 3QLPH 1BRBE 1YCPK 1XKBC 4OGYA 3RDZA 1SG8B 3OX7U 2W5EA 1H9HE 1PPHE 4K8BA 5HM2A 4B75A 4RSPA 1AQ7A 1YCPM 4TSFD 5C3NA 5K7RA 1F7ZA 1NU7B 3MU5A 4AGKA 1AIXH 3SNDA 3NCLA 1P05A 1OWDA 2BB4A 2FO9A 4Y8XA 2F83A 3F9GA 3LONA 1AN1E 2Z3CA 1WDIA 2BDGA 2ALVA 3VB4A 2WPLS 1BHXB 3PV2A 3KQEA 3BG4B 2TGTA 1PPFE 1UMAH 2IJD1 4LXBH 3M7TA 3EDXB 1GDNA 1MMJN 2EI7A 3KN2A 1GMHF 5C0UA 2FLBH 2ZFPH 2BY9X 3RXPA 3SJIA 2FS9A 1O5DH 3MH6A 2A31A 3UNQA 1K0HA 3GCOA 1S6HA 1P2QA 1ELCA 5EOKA 2NU3E 4E7RG 3FO8D 2G81E 4K3JA 2J92A 2AIQA 2ZKSA 1YPHC 2J4IA 3E6PH 1W0KD 3U8RH 4VGCB 2WUBA 1A1RA 1XX9A 2J94A 1P2OA 3SU0A 5C67A 1DANH 1C2JA 2ANMH 4AOQA 2VGCB 1C5RA 1DDJA 4YZUA 1RS0A 1V2OT 5TCCA 3SGQE 4ZCNA 5A0AE 5ESTE 3MU0A 4YESB 2PV9B 3ZZDA 1MU6B 1Y3YA 2TGAA 3ZZCA 4X1SU 5HIYA 4Y7AA 1C5NH 1AFQC 2XOKD 1JRTA 3FANA 2WPKS 1AD8H 1K28D 2ZU2A 1TFXA 3E0NB 1AO5A 3STJA 1WU1A 4AN7A 3PLBA 1WQVH 5EQQA 4WXIA 1L4ZA 1Y3XA 1P3CA 1GCTC 2ZGXH 2H9EH 2A5KA 2QF0A 3RXDA 1CHGA 1P12E 1TNGA 4OS2A 1ZSKA 1BJUA 4OS7A 3FP6E 1FIWA 3K6ZA 6LPRA 3MFJA 1TALA 1LVOA 4YT7H 3SORA 1C2FA 1CHOF 4NFFA 4K5ZA 3VB3A 3ZZ6A 4J1YA 3BIVH 3A8BA 4MPWA 3PRDA 5T6FA 4WY3A 1AZ8A 2AGIX 3BEUA 1GG6B 1O3FA 1YPJH 5PTPA 1DSTA 2ZGBH 1K1MA 3DSPA 4U01A 1EP5A 1CA8B 2GV6A 1QBNA 4UE7H 2BLQA 3A80A 4UD9H 3U1JB 2C3SA 1N8OB 1C1NA 1KDQB 1MZAA 5AFZH 1BTUA 1KY9A 4RI0A 1AY6H 3QGJA 4AFZA 2SNVA 4K8YA 4X2WA 3UTUH 4AFUA 1INCA 1G2MA 1C2IA 4KTCA 4RT1A 1M9UA 1O5FH 5B6LA 2OK5A 1AB9C 1DOJA 2ZZUH 3GYLB 3Q77A 1GHZA 1LHGH 1MQ5A 3FZDA 1DITH 2V3OH 2AIPA 1TPAE 1C5SA 1TGNA 5A2MH 1SGPE 2KCYA 2Z9KA 4Q7ZA 1CBWB 4JZ1A 1P2KA 5I46H 2WV4A 3IWMA 3FN8A 3A88A 1YP9A 3TJUA 1LPGB 1OXGA 1FPHH 2YOLA 1K1IA 2VJ1A 1TPSA 1E0FD 1ZPBA 5DP7A 2AYWA 5LGOA 2M5TA 2ZGHA 3E1XB 3TJVA 5DP6A 1TE0A 1ACBE 2W6ID 2HPPH 1YGCH 3DSGA 5GCHF 1X7AC 1NRRH 2F9UA 1LVMA 1BHXF 3MO3A 1K1OA 2PKAB 1K1PA 1EAWA 1F5LA 7LPRA 1GCTB 1FMGA 4I32A 1TRNA 3UWIA 1EJAA 3GDSA 2GJGA 3M7QA 4X1PU 1LHDH 4O3UA 2R0LA 1C4Y2 3HKJB 2SGAA 3ZIAD 3A81A 1TOCB 1EZUC 1Z6JH 4GAWA 1ANCA 1ZHPA 3M3TA 1O2SA 1GVZA 3SV2H 1P2JA 4BAOB 4FUHA 4GHQA 2BQ6B 1CHOG 6GCHF 1ELVA 3LDXH 1E1RD 3HATH 3HPTB 1TAWA 1UVSH 2O8LA 4Y71A 3LGUA 1TLDA 4FXGH 2LELA 2W3IA 1TPOA 1TNLA 4AFQA 1C1QA 5F03A 4WMDA 2HLDD 4BAKB 1SOZA 1GI0A 2P16A 1JBUH 2FOGA 1F92A 2KAIA 4X1QU 2HGTH 2J98B 2QCYA 1D3TB 1LO6A 2OC1A 4B76A 2C93B 4Y7BA 2GV7A 3EYDA 4M9FA 4NA8A 1Z1JA 3PTBA 1FV9A 1H4WA 1UTJA 1LMWB 3SZNA 1ESTA 1Z71A 1C4U2 1QURH 1OP8A 2ANWA 3A8AA 3IG6B 2W6JD 3GCHC 2IPQX 2CHAC 2ZIQH 1ZRBA 3A86A 3OSYA 1KXEA 1BRCE 4ABAA 2QV1A 3A82A 4K2YA 5HYOA 3U28C 2F9PA 1UTOA 3A87A 4AZ2B 1T4VH 2HVXA 2O9QA 2P3UB 3NZIA 5B6OA 3QX5H 4WXVA 3QZRA 1UTNA 6CHAB 4GSOA 1B0FA 2VB0A 1P01A 3HGPA 5GCHG 4BTIB 5DN6D 2J34A 5DP9A 6ESTA 4ZROA 2G4TA 2VH6A 1SC8U 1J15A 5L6NH 5FCKA 3CS7A 3V0XA 5DP3A 5EQSA 5J4QA 1PPBH 1FUJA 1G36A 2LP6A 4AYYB 2AGEX 1OYQA 2FI3E 1O30A 3P92A 2DE9A 1TBZH 2FOHA 2GP9B 3NXPA 2XNIA 4Y0ZE 1A61H 2JETB 1V2TT 4CR9A 6GCHG 3RLWH 2OTVA 4X8TH 5I25A 1RTFB 1C2LA 3SUGA 2F91A 2EI8A 2VWLA 1U6QA 3EGKH 4DT4A 4NIXA 1AU8A 5T6DA 1Q2WA 3K65B 1TNKA 1K1NA 1LTOA 1MTNB 4NWLA 2I6QA 4DURA 3S7HB 1H9LB 2L74A 4E06H 1TMBH 1XXFA 3P6ZB 1TRMA 1QR3E 2W7SA 2H1UA 4MNVA 5FAHA 1ABIH 1C2EA 3MU8A 2C8WB 4GVUA 2FOFA 4XOJA 4LZ4B 1GI5A 1PFXC 4I8JA 3U69H 1NPMA 1XUKA 1S85A 1UW7A 2CMYA 5DP8A 4I31A 7KMEH 4MPUA 1CGIE 3M5NA 1O2KA 3EQ0H 2VWOA 1ZMNA 4Y76A 3RUOA 1C2DA 4FUBA 3RXKA 1EPTC 2AMPA 1V2MT 4Y10E 3OFND 1GGDC 1O2OA 3PMHB 1WSSH 3A7VA 1DWCH 1N6YA 1PJPA 3BF6H 4MDSA 3LT3A 2IPHA 2FESH 1WOFA 1E37B 2NU1E 5EU8A 2EEKA 1PPZA 2AHME 1SFIA 3BN9A 1SQAA 3TJOA 1IQNA 5HXFA 1J14A 2PGQB 5GPIB 5FPYA 5A8ZA 1MKWH 4M7GA 1CVWH 1PQ7A 1H8ED 1VGCC 5EGMA 1W11U 4KGAA 1QL7A 1YPMH 3KL6A 4Q7YA 2AEIH 1P03A 3I77A 5KECA 4Y0YE 5A8YA 1OOKB 3W1EA 4TY7A 2ZDVH 1BMAA 5BPEA 1SGYE 2VVUA 2O8WA 2ZA5A 1OHHD 3RXVA 1GMDF 2BD9A 2BVRH 3OEHD 3SJOA 1JRSA 2WPMS 1Y3WA 4JZEH 4I33A 2QIQA 1JXPA 1UTMA 1SFQB 4TPIZ 2A7CA 4QT8C 4DJZB 3F68H 1TNIA 3MYWA 1E35B 1NS3A 2PWXA 3GCTF 1UCYK 2PFEA 1PPCE 1GBBA 1QQ4A 1GDUA 1L0ZA 4YLUA 2Z3EA 1IHTH 2Q6GA 1Z8JB 1MBQA 2PGBB 1TONA 4D7GA 2ZCLP 3A7TA 1S84A 3Q3YA 2KAIB 1VZQH 1O37A 5C17A 2ZDMA 2FXRA 2M2AA 1RIWC 2C8XB 3LJOA 4B2AA 2VIOA 3RXEA 3DD2H 1OWJA 3QO6A 3ZV8A 1QB1A 4ABDA 4ABBA 2GMTB 1YM0A 1P10A 1K1LA 1W0ZU 2RDLA 4ABHA 3RXHA 3O8DA 3VXEH 3MNSA 2AERH 3GY2A 4B2BA 3ATLA 5CMXH 3ESTA 1GBLA 1W2KH 1NROH 1TGBA 3BTQE 2XCFA 1NO9H 1THRH 1UTQA 1ZRKA 3LH1A 4AB8A 3BTEE 2YNAA 1YYY1 4LK4A 1W0YH 3FOAA 3QN7A 4RKOB 1GBMA 1ELBA 4ZHAA 1OPHB 1C5OH 3RXGA 1O5EH 5AHGH 1FQ3A 1GI9B 1GI4A 3P70B 2QXGA 2RCEA 3A84A 1EKBB 1K1JA 1YCPH 1GJDB 4TWWA 3ATWA 2A0QB 3SGBE 1C9TA 1AVGH 3FAOA 1J16A 4IBLH 2FPZA 1P9UA 3R0FA 1EB2A 4O03A 5A8XA 3GS9A 1QGFA 1Z8RA 1GL1A 4ABEA 3V13A 3ZZ4A 2UUFB 1GMDG 3FKSD 2HWLB 1BBRK 1C5PA 2CGAA 2CN0H 4INLA 4TWYA 1COWD 1RFNA 2Y80A 2Y81A 3CP7A 1HIAB 4CRFA 4WMFA 1TNHA 1A0LA 3ZZ8A 3KF2A 1P3EA 1AFEH 3GCTG 4XBDA 4UDWH 2KFWA 5JB9S 1ELEE 4RT0A 4ISNA 1O3MA 3N99A 2BDCA 1FZZA 3LIWA 4Y79A 4YTAA 3SU5A 4KTUA 1HLTH 2A5AA 1ETRH 2JJ1D 4ISHH 1RIWB 1Z8IB 4X8UH 2PKSC 2VWMA 2B9LA 1H8HD 3RC6A 1E79D 1S5SA 1GJCB 1HJAC 2QF3A 2SGEE 2GD4B 3BTFE 1VCQA 3TH4H 2EY4C 2EC9H 3SN8A 1ZJKA 5DP4A 2FOCA 3AK5A 1P57B 4DG4A 4ZKNU 3VGCC 3TVJB 5TCAA 4XBCA 3PLKA 4MVNA 2FIRH 1GHAF 2ZGJA 1KTTB 2ZHEH 1TA6A 2OLGA 2Y7XA 3QTOH 2ALPA 1GBFA 3ZVEA 4WF8A 2YNBA 3P8FA 5LPRA 1YC0A 5HIZA 4J2YB 2FEQH 4Z0KA 5A09A 1O36A 2CF9H 1HV7A 3HK6B 1F0TA 2PKAA 2GCTC 4ZKSU 1HAZB 3L3TA 3TK5A 1C5VA 3SV7A 4JZFH 5DPAA 1BTZA 2D26C 2QXJA 1THSH 2J97A 1TMUH 1ZSLA 4BTTB 1SPJA 1HAPH 3B23B 3M36A 2EI6A 5T3HA 4NFEA 3UR9A 1MBMA 4BXSA 4CBOA 1MTWA 4ISIH 3NWUA 5C94A 1O2YA 1YPLH 2UWLA 2PUXB 1Y59T 2AS9A 3V12A 4X1NU 3DHKH 1O3OA 3E91A 4BNRA 1W8BH 1AKSB 1O2ZA 2H9HA 1NFWA 4KP0A 2OQ5A 4GHTA 5C0TA 2J98A 3ZZ5A 4CRDA 1FI8A 3W94A 1C2KA 2TIOA 1GI3A 1GPZA 2UWOA 4R8TB 2XYAA 3M5MA 5TJXA 5HM9A 1KLTA 1KMHB 1GJ8B 4FU8A 2B8OH 1O2VA 4CH8B 4ABIA 1TBRH 3MNCA 4UFEH 3LC5A 3LPRA 3T25A 2ZWLH 2TGDA 4ZHMU 5C1UA 3MO6A 1SLUB 1BTPA 3VGCB 2BY5X 4WMEA 2BHGA 2O8TA 1QJ1B 4X6MA 1SQRA 3UNSA 4ZKRU 3ZZAA 5CE1A 3PV5A 1O2RA 3C1KA 1O3CA 3EA8A 4ABJA 3BTWE 4FETA 4ESTE 3BTHE 1SI5H 1GI7B 3UOPA 2R2MB 2FWWA 3WWBA 4X2YA 3S9CA 1AWHB 1GHAG 3VEQB 1HAOH 4AGJA 1D3PB 5C5OA 5JB8S 4HZHA 1F0RA 1SOTA 1HXFH 2C4FH 1ZR0A 3M7UA 4B74A 1MKXK 1S0QA 1SB1H 3TJNA 2QE7D 2V3MA 3PO1C 3E3TA 2AMDA 1D6WA 4FU7A 3OAAD 1OP0A 4ZH8A 1QRZA 2GDEH 1QA7A 2FMJA 2O8MA 3CS0A 8ESTE 1UTLM 3P17H 1H9IE 2WPDD 1L1JA 1NM6A 3VB5A 3A7XA 1IAUA 4DVAU 3LGWA 3P8GA 4ISLA 2HNTF 1BJVA 4FVDA 2BLWA 1PYTD 1GWAA 2NU4E 2THFB 4MNWA 4ZXYH 3AAVA 5DK1A 1P0SH 1EAXA 3RXUA 5T1VA 1ETTH 5H4IB 1GI6A 2A4QA 1G32B 1O3PB 4AORA 4AYVB 4XD7D 1MCTA 3U98H 3RMOH 2LNCA 1V2KT 1XVMA 1C1SA 1C5TA 2GZ7A 3GY6A 3RXBA 1DM4B 1CT0E 2ODPA 1MU8B 3KQCA 1GMHG 1DXPA 1VITF 2FLRH 3OE7D 1T7CA 1TABE 2A4RA 1NFUA 1LPZB 1Y5BT 1OWEA 5DG6A 1DY9A 5EODA 3UR6A 1O2PA 2ZECA 1QTFA 5EW1H 4NSYA 1O0DH 4XBBA 5BRRE 5L2ZH 2ZCHP 3DA9B 5EXNA 2VIWA 1YPEH 3QTVH 2ODQA 4THNH 1CGJE 3T2NA 3ZV9A 2ZFFH 1HGTH 5JPMH 2H2ZA 2XTTB 3Q3XA 4ZUHA 1MTSA 2RA3A 3RC5A 1HXEH 4MNXA 1QB6A 5FHTA 5EJ1A 1N1LA 1A3BH 1NESE 3VFEA 3FZZA 2OP9A 1V2QT 2QA9E 3MH4A 3SHCH 2SFAA 4HG6A 3SQHE 2P8OC 3TNSA 1G2LA 1SLWB 5CHAC 5E0JA 5GIBA 3SV8A 1IQJA 2BZ6H 1AFQB 1ESBA 1GHXH 2KCAA 4ZKOU 2VH0A 3MQKC 1P06A 4F55A 3MMGA 1GVLA 1FONA 4AG2A 1K21H 3GDVA 1O5CB 2BTCE 1ANDA 1CO7E 3VXFH 2CXVA 2BVXH 3KHVA 2PW8H 1ZGVA 1NRQH 2BY7X 3I29A 4HI3A 2HLCA 4CRAA 2ZPRA 3ZYDA 1GHVH 3MH5A 4D8NA 8GCHF 2XWBI 1C2HA 2P95A 1O5AB 1YWUA 3N7EA 4DIIH 1BRAA 1ARCA 3RMLH 1TNJA 4FUIA 1P9SA 1AE8H 2WV9A 1Z6EA 2F9NA 3SNBA 2RA0A 1FY1A 4A1TA 2V7QD 5CDFE 5T6GA 2BD8A 1O3AA 1EJNA 2OQUA 1VITG 4OS5A 1Z7KA 3V3MA 3LJJA 2LPRA 1ELDE 1A2CH 4Y8YA 1UVTH 2A32A 2BYAX 4ACBA 1MTUA 1H8DH 2WSSD 1MABB 2Z9GA 4FUDA 4B1TA 1EPTA 3RXQA 1TX8A 1O3NA 4IMZA 1WUNH 2K1QA 1BIOA 1O3KA 2VNTA 2ZTZA 5F8TA 3MNBA 1NY22 1AB9B 2G5VA 3E0PB 1V2RT 1C1UH 1IQFA 1JIRA 1FAXA 2OXSA 3OEED 4RN6A 1S6FA 4CRGA 2ZFTA 4IW4E 3GY7A 1XM1A 2VVCA 1ZMLA 1ZPCA 3TK6A 1YY3A 2KX4A 2BXTH 3BV9B 4A1XA 1UO6A 1V2WT 8KME2 3B8JA 1L4DA 3U1IB 2FTMA 3URCA 5CHBA 1XUJA 5F8XA 2FS8A 4ZMAH 3KQBA 3RM2H 3BTKE 1C1TA 1GHWH 2FOAA 3UWJH 1UK4A 1HAGE 2V6NA 3EA7A 3HKIB 4XRNA 1LHEH 1UK3A 1EP6A 1SQTA 1LVBA 4X0WU 1SVPA 1S83A 1KXBA 3T28A 3UFAA 2CK3D 3ZZBA 1DWDH 3U9AH 3UQVA 1QRWA 2ZEBA 5FBIA 2KM0A 3O8CA 1Y3VA 1SBWA 1ZYOA 1BMNH 1GJ5H 3DFJA 3SZEA 1F5RA 8GCHG 3P95A 1ZPZA 2HALA 3LGYA 2IOTA 5FPTA 3A83A 2ZDAH 2DUCA 1MD8A 4IN1A 1QB9A 1FN6A 1HIAA 1IQHA 2JH6D
chains in the Genus database with same CATH topology
2W7UA 1VCPA 1UCYE 5EXMA 1O2NA 2ZHWH 3AASA 1XUHA 3FP8E 3SNCA 5C1YA 1XKAC 4ZAEA 3RXRA 1W12U 1C5UA 4HFPB 1ELTA 4AG1A 4CH2B 1DE7H 1UCYH 1GI1A 3T62A 1IQIA 2XW9A 4DIHH 5C5NA 1SGRE 1SQOA 1FNIA 1YLDA 1SHHB 2OBOA 1RRKA 1T8NA 2FYRA 1PYTC 2XBXA 1EAUA 3TIUA 1QJ7B 2V3HH 1AUJA 1GI2A 1OWIA 1GBEA 3GCHB 3A89A 1SGDE 1T8LA 1TIOA 2CHAB 5E2PA 1SSXA 2F9VA 1ZTLA 2Y5HA 3ZZ3A 3E16B 2UUKB 1GDQA 4PROA 2P59A 1FLEE 2WYJA 1OWKA 1AZZA 1G3DA 1UVPA 2GCHF 1JWTA 1W7GH 2JH0D 3SV6A 2Y6TA 1BT7A 1P02A 2FI4E 2Y82A 4E05H 3RXCA 5LH8A 2QGRA 3RM0H 2XC4A 1C5LH 1L1GA 3M5LA 1TMTH 1O38A 3SI4H 3MI4A 2QY0B 1ZHRA 1O2WA 3SJ8A 3RXFA 1MAYA 4X2VA 2BMGB 1SGCA 2G00A 5ETXA 3RXMA 3T26A 1O3GA 1HPGA 1HAHH 1H1BA 2OD3B 1GJ4H 4NZQA 2BY6X 4CBNA 2A45B 1V2PT 1J8AA 1BBRE 3TU7H 2OUAA 1HBTH 2XBVA 1GJAB 1DT2A 1IQLA 1ELAA 1MH0A 5AF9H 4IGDA 1DVAH 3HK3B 1THPB 1HAVB 3MO9A 1P2MA 1NTPA 1G37A 3LH3A 1HUTH 2BDBA 1EAIA 3ODDA 1A4WH 1AKSA 1BBRH 1DX5M 1O2IA 1C2MA 2Z9IA 1HFDA 4X6OA 2OCVB 3UUZA 1GJBB 4TY6A 1S81A 1C1RA 3JZ1B 1QQUA 2ANYA 3PYHA 3RMNH 2TBSA 4K1EA 2A4OA 2BY8X 2F9OA 4A92A 4A5TS 3KEEA 9LPRA 1AWFH 1O3EA 1SGQE 1GJ7B 1GBIA 1AHTH 3K2UA 1FY4A 2I6SA 4NA7A 4I7YH 1SMFE 1EPTB 2NU0E 3OY5U 1GGDB 1TOMH 1AMHA 3AW1A 2ZDLA 1AVXA 3PWBA 2Y5GA 2ZP0H 2GCHG 1A5GH 1HAYB 1O2XA 1WQSA 1FPCH 4INHA 1LVYA 3MU4A 3TGKE 2A2XH 2AFQB 3QUMP 3SHAH 2G51A 3UREA 1SHYA 2SGDE 2PHBA 1TGSZ 2DE8A 1CA0C 2G8TA 4OS6A 4F4OC 2PSXA 4YT6H 2C8YB 3MH7A 3A7YA 1UHBB 2BD5A 2Q6DA 1EZSC 1ABJH 1FAKH 3UY9A 1FDPA 2ZNKH 2Z94A 1VGCB 4X6NA 5JBCS 4I8KA 4Y8ZA 1F0UA 4NIWA 2JKHA 2BD2A 3ZVCA 2D8WA 1EUFA 2WYGA 3C27B 2ZFRH 3LC3A 5DP5A 4Q7XA 1Y5AT 3KCGH 4BTUB 1EZXC 1QCPA 4DCDA 2J2UA 1QHRB 3RLYH 1ZTKA 1TX6A 5FX6A 2ZPQA 4JZDH 1F5KU 1OP2A 2PUQH 4CHAC 1MCVA 2D2DA 5GXPA 5EPYA 2GKVE 5LPFA 5SGAE 3KGPA 4E7NA 1AE5A 1EJMA 4TPYA 1HCGA 1YF4A 1ZMJA 1T32A 3RC4A 5E2OA 2GTBA 1V2JT 1KSNA 3EAJA 1W13U 4H4FA 3S7KB 1TB6H 3SW2B 3BTDE 2RG3A 1SGIB 1AI8H 1GCDA 3RXSA 2TGPZ 3PWCA 3S69A 2C8ZB 1A0HB 4A6LA 3BEFB 3URDA 4KELA 4GCHF 3UQOA 1JMOH 2VVVA 1O3HA 1SGEE 1W10U 1TQ0B 5HGGA 3NK8A 4UFFH 1F2SE 4JCNA 3ZVGA 1JIMA 1T8OA 5C1XA 1TWXB 3IITA 3I78A 3ENSB 2BDIA 1HYLA 3SUFA 2Z9JA 2PR3A 1BZXE 3E8LA 1D6RA 3EE0B 1IQEA 1MKXH 1S82A 4CR5A 3H5CB 1B7XB 1ARBA 3GY4A 1BTYA 1T4UH 3TGJE 1GHBF 5K0HA 1C1PA 1LHCH 2BLVA 2ZG0H 3M3VA 1WBGB 1NRSH 3BG8A 1GBHA 1XMNB 1PQ5A 4VGCC 1D9IA 1TQ7B 1Z1IA 4RKJB 4O3TA 1TBQH 1C1OA 2GZ9A 3STIA 4DOQA 1DFPA 2XBWA 4YO9A 2GT8A 4DT7B 2F3CE 1O2QA 1C5WB 1GMCF 1MZDA 1XXDA 1BCUH 1L1NA 1ORFA 2IJOB 3L33A 1LKAA 1CGHA 1V3XA 2B7DH 2A7JA 1YBWA 3ZVBA 4JMYA 1P8VC 5DJ7A 1YPKH 3U8TH 1NN6A 3SV9A 4NZLA 2FX6A 3M5OA 1YKTA 2H6MA 2PTNA 2HNTE 4WWYA 4AX9H 1C2GA 1FJSA 2FX4A 2Z9LA 1GBDA 3N7OA 1MTVA 3NPSA 1E34B 1HRTH 1Y5UT 1CQQA 2Z6BD 2PKSB 8LPRA 2ZGCA 2Y5FA 3T29A 2BXUH 1HJAB 2ZF0H 1DLKB 1HJ8A 2ZU3A 3F9EA 1N6XA 1WV7H 3LGTA 1W3CA 4GCHG 3T5FH 4U2WA 4IS5A 4SGAE 3K6YA 4YLQH 2OC7A 1LCYA 3K9XB 3MWIU 1DUAA 1ZTJA 3ODFA 2BDAA 1SLXB 3MNXA 1GG6C 5C20A 2ZU4A 4ZXXH 1CT4E 3PMAB 3GOVB 5ABWA 1EOJA 3RMMH 1DY8A 1GBCA 4CREA 4A1VA 1NZQH 1N8OC 2R3YA 2CF8H 5F8ZA 1VITH 5A0BA 2B5TB 1SGFG 4B2CA 2GCTB 4NSVA 4ZHLU 1ID5H 4OGXA 4NGAH 2BZAA 2VIVA 3H7OA 1CU1A 1RGQA 1MUEB 1EQ9A 1MQ6A 2OC0A 1GHBG 1A5HA 1K9OE 3GDUA 2UUYA 2TPIZ 1PPGE 1OYTH 2XC5A 4MTBA 1BOQA 3MU1A 4FVBA 3P8OA 4XFQA 1GBJA 2ZC9H 3ZZ7A 1QJ6B 3QWCH 1WTGH 1BTWA 4ASHA 1GMCG 1CBWC 3PTNA 3PB1E 3SU4A 1BB0B 1RXPA 3SOSA 1JOUB 2G4UA 1SGNE 2R3UA 3GY8A 3Q3KA 2GZ8A 3PMJA 1ZJDA 3TLOA 3LOXA 2XC0A 3RXLA 1UVOA 2NWNA 2B0FA 4CRBA 3BTTE 1EATA 4B71A 1O2LA 1LQEA 3V7TA 1O32A 4UONA 3ZYEA 2TRMA 1V2UT 1DXWA 3RXJA 3SJKA 1RTLA 4X8VH 3UNRA 4XDEA 1C1WH 1LQDB 2GT7A 2FM2A 2Z3DA 1C1MA 1O34A 3A85A 4OS4A 1AGJA 1O33A 1NC6A 4KKDA 1O5GH 3SUDA 1QRXA 1XUIA 2ZO3H 1MAXA 1HJ9A 2ZFSA 1SGTA 4NIVA 1O2UA 3R3GB 4FUFA 3A8DA 5EG4A 3TPIZ 4IN2A 2QXHA 2G5NA 1DSUA 1KXCA 4OS1A 4DY7B 1P04A 1BRUP 1HDTH 4D7FA 1UK2A 4X6PA 3F9HA 3AVZA 1IHSH 5J4SA 1O39A 2BOHB 3S0NA 3GY5A 2FDAA 2C90B 2ZQ2A 3PO1B 1BA8B 3BTME 4WVPE 5FXLA 4O9VA 4ISOA 2P3FH 3S9BA 2OINA 1BDAA 2STBE 5GDSH 1ZOMA 2SNWA 1O35A 4YOGA 1E36B 3SNAA 1TA2A 2ODYB 1O2MA 1C5ZB 3SGAE 3CENA 3ATMA 1HB0B 2ZHDA 2Q1JA 2P3TB 4CRCA 4HGCA 1GBAA 2GVFA 3GISB 2XCNA 3SU1A 2ESTE 1KIGH 1HAVA 1UVUH 1BTXA 4MG3A 2J95A 1SGFA 1O3BA 2O8UA 1KXAA 3MHWU 3RP2A 1A3EH 1V2NT 1Q3XA 3D49H 2SGPE 5FX5A 6CHAC 3ZVAA 2BDYA 5GWZA 1ZZZA 2FP7B 1D4PB 1RTKA 2P93A 2XRCA 1D3QB 5E0GA 1FXYA 2QYIA 1VJ9U 1EASA 2CJIA 1BTHH 1E38B 2AH4X 2STAE 2BDHA 3QGNB 3GICB 1V6DA 2GX4A 1QNJA 1YPHE 1TYNA 3QDZB 1J17T 3VPKA 3GYMA 5EQRA 2A1DB 2JETC 3UPEA 3ITIA 4A7IB 5JYIA 1IOEA 3VB6A 1C1VH 3VB7A 1GJ9B 2J9NA 2OBQA 3GY3A 4JYVH 5GJ4B 2ZTXA 3EA9A 1A5IA 1DUEA 2WPHS 1MTNC 4IMQA 4JZIA 1O3DA 1EZQA 4K1SA 3RXOA 3WY8A 1XUFA 4ABFA 2P8OB 2WINI 5EW2H 1KTSB 5CHAB 2V35A 2A5IA 2AGGX 1D3DB 1QFKH 4GPGA 1YPGH 1GJ6A 1EX3A 1EOLA 2HOBA 2ZDNA 4WJG2 1OWHA 1UHBA 2VINA 3FP7E 4NA9H 4IC5A 1Y3UA 4H6SB 3SQEE 4FUEA 4FUCA 3SJ9A 2CV3A 1C5MD 5JBAS 2FZZA 3SBKA 1FIZA 4KTSA 1UTKA 3M37A 1CT2E 3ATKA 4NIYA 5A0CA 2J38A 4JK5A 1DWBH 1RD3B 3OTJE 1W14U 2ZFQH 3OU0A 5ESBA 5JBTA 3FFGA 2WPIS 3RU4E 2ANKH 2ZQ1A 4WH6A 3A7ZA 3LGVA 3RXAA 3PMBB 3M3SA 2WUCA 4ABGA 4UFDH 3UIRA 1AUTC 3A7WA 1B5GH 1S0RA 1BITA 1W7XH 2ZTYA 3F1SB 5L30H 1HNEE 1ANEA 5FCRA 1ZHMA 2F9BH 2BLOA 1QL8A 2SGQE 1GHYH 2BQ7B 2ZDKA 1XUGA 1P2IA 1ANBA 7GCHF 4I8GA 5HMAA 1C5QA 1VCWA 5F6MA 1ZSJA 2ILNA 1ETSH 4FU9A 3O8BA 1QL9A 4K69A 4X1RU 2OC8A 4H42U 5L2YH 1PQ8A 1Q31A 2FYQA 2QN5T 3MOCA 5IYTA 1G3BA 1FN8A 1WAYB 4F49A 5DKMA 2FODA 2V0BA 1G3CA 1V2VT 1KXDA 1FY8E 2A2QH 2FOEA 1GVKB 2HRVA 2A7HA 2EA3A 4JYTA 4BOHA 1IQGA 1ELGA 1O2JA 4K1TA 4MPXA 3BTGE 1NRNH 1UTPA 3BEIB 1V2LT 3ZVFA 2VWNA 1NFYA 1QIXB 1B0EA 2VIQA 5EPNA 1O5BB 3AW0A 1KLIH 1C4V2 2AMQA 4UEHH 5FBEA 3NKKA 3PV4A 5AFYH 2ZI2H 4MLFB 1SR5C 3RXIA 2ZHQH 3D62A 1EB1H 2BVSH 1LDTT 3QZQA 1TGCA 4YOIA 9ESTA 3RXTA 4BAQB 2BD4A 2BX3A 2GGVB 3BSQA 2R2WU 5JDUB 4FUJA 1SL3A 4Z6AH 1OSSA 1YLCA 3F6UH 4Y11E 2WV5A 2GDDA 4H6TA 2GMTC 4BAMB 1WTHD 3T27A 3TK9A 1ESAA 4BAHB 1SLVB 3ATIA 2HPQH 2ASUB 3Q00A 1MD7A 1J9CH 1CSOE 2Q6FA 1O2GH 2W26A 2SGFE 2ZHFH 3D65E 1TRYA 2A4GA 4I8HA 4X2XA 3ELAH 2QAAA 1BMMH 1GI8B 3G01A 1PQAA 4INKA 1TGTA 4YM9A 1O3IA 7GCHG 1FY3A 1A46H 2PTCE 4BXWA 4HTCH 1ZLRA 4DW2U 1GL0E 3GCNA 4UFGH 2WPJS 1WYKA 4AB9A 3MTYA 1ZGIA 3JZ2B 1TX7A 3A8CA 2ZCKP 1KYNA 5G4BA 3SU2A 1QY6A 2VU8E 1O2HA 4WH8A 1DLEA 2D1JA 5AVDA 1O3JA 1LKBA 1Y8TA 4MPVA 1V2ST 1Z8GA 2UUJB 4NG9H 1L2EA 1CE5A 1PPEE 4JYUH 1DPOA 1AVWA 3BIUH 3AAUA 1A7SA 1T8MA 2HNTC 3DFLA 2PLXA 3KQDA 1IQKA 4FUGA 3TGIE 1TPPA 3SNEA 1G3EA 4D76A 1XVOA 4Q80A 1DWEH 1O31A 4LOYH 1VJAU 1G9IE 2XBYA 4XE4A 3KIDU 3ZZ9A 5LPEA 5DO4H 3H7TA 3SI3H 3TH3H 7ESTE 1H8IH 1KLJH 2UWPA 4JK6A 2FOMB 3SU6A 1GBTA 2H5DA 1P11E 3RU4T 2BD7A 3B9FH 4NWKA 1C9PA 1T31A 2JH5D 1VR1H 4X8SH 5E0HA 3F9FA 4MNYA 1NT1A 1O2TA 1OS8A 3TNTA 2BOKA 5JBBS 3RU4D 1K22H 1RJXB 1FY5A 1IQMA 1MKWK 1A0JA 1HAXB 3SO3A 3DUXH 1LPKB 1F0SA 1O3LA 1OX1A 5C2ZA 3L6PA 1G30B 4GUXA 1P2NA 3TITA 2Y7ZA 3KNXA 4MQAA 2G52A 1C5YB 1BUIA 3PM3A 4U30A 1HAIH 1ELFA 1QA0A 2QXIA 2P94A 5EXLA 2W3KA 4D9QA 1GBKA 3E90B 5IDKA 3OY6U 4K60A 2R0KA 1KXFA 2ZU5A 2Z7FE 1QBVH 3SU3A 2BX4A 3D23A 4Q2KA 3S9AA 3UOUA 1UJ1A 2ZU1A 4IC6A 4R0IA 3TH2H 1NFXA 3NUMA 1BMLA 2BD3A 3M35A 4NCYA 1DS2E 3O8RA 5FPSA 3PROA 4U32A 4YOJA 1KDQA 2R9PA 3LKWA 2PSYA 1EXFA 2VIPA 3BG4C 3OYPA 1CA0B 4B73A 1K2I1 2ULLA 2FI5E 2VIDA 3M61U 1NRPH 4D9RA 2H9TH 2NU2E 4SGBE 1P09A 3LU9B 3SUEA 4AFSA 1WCZA 1BQYA 2IN2A 4I8LA 4XSKU 1NU9A 3P8NA 4O97A 4DGJA 2FOBA 2QC2A 3ZVDA 5DGJA 2BQWB 2FTLE 2XWAA 4Y6DA 5E8EH 3W95A 1C5XB 3Q76A 1OKXA 4TYDA 1QBOA 3QK1A 4BANB 2VGCC 3FVFB 3PLPA 2BM2A 2G55A 3LGIA 3DT0H 1DICA 4GLYA 4LZ1H 3HGNA 4CHAB 3U8OH 2ZPSA 2XXLA 2H5CA 1LHFH 3QLPH 1BRBE 1YCPK 1XKBC 4OGYA 3RDZA 1SG8B 3OX7U 2W5EA 1H9HE 1PPHE 4K8BA 5HM2A 4B75A 4RSPA 1AQ7A 1YCPM 5C3NA 5K7RA 1F7ZA 1NU7B 3MU5A 4AGKA 1AIXH 3SNDA 3NCLA 1P05A 1OWDA 2BB4A 2FO9A 4Y8XA 2F83A 3F9GA 3LONA 1AN1E 2Z3CA 2BDGA 2ALVA 3VB4A