1EAUA

Nonpeptidic inhibitors of human leukocyte elastase. 6. design of a potent, intratracheally active, pyridone-based trifluoromethyl ketone
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PORCINE PANCREATIC ELASTASE
publication title Nonpeptidic inhibitors of human leukocyte elastase. 6. Design of a potent, intratracheally active, pyridone-based trifluoromethyl ketone.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase (serine protease)
total genus 57
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1994-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1eauA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1eauA01
3QN7A 1TX7A 1VZQH 3E1XB 1DWBH 1TNHA 2ZP0H 1RRKA 2SGFE 4YTAA 3MFJA 1SGNE 2CF9H 1AVXA 3TK5A 2B5TB 3LJJA 4IMZA 3SV2H 3O8DA 4BTIB 1T8OA 2BY7X 2VH0A 4IN1A 4DT7B 2WPMS 2BOKA 1GDUA 4ESTE 3Q3YA 2YNBA 3S9AA 2ZDNA 4DCDA 4DURA 1AVGH 1OWDA 3GY3A 1G37A 4TY7A 1MKWH 3K9XB 2LPRA 1OXGA 1L0ZA 1Q31A 1HXEH 2Y81A 3TK9A 5L30H 1CHGA 5H4IB 2PFEA 1AIXH 3LGVA 1FNIA 1O2QA 1P02A 1MKXK 2JETB 1BMLA 2UUFB 5AHGH 3ZV9A 2B8OH 3DA9B 5BRRE 2XC4A 4BAQB 2PV9B 1MAXA 1VITG 2ZKSA 2QGRA 2ZGJA 1NROH 1TPSA 1ANDA 3SUGA 4Y8ZA 4Q7XA 8KME2 3ZZ9A 2Z3CA 4OS2A 1C5QA 3ZYEA 5LPFA 2JH6D 2F9BH 3LKWA 4M7GA 2ZPSA 3NCLA 3QLPH 3L6PA 1XX9A 4X2YA 3ZZAA 2GMTB 3UWIA 1VITF 1EZSC 4UD9H 1N6YA 2GV6A 3MU4A 3SU4A 2AERH 3RXMA 4O3UA 1O2NA 1YKTA 4YM9A 1XVOA 1GMHG 3MNBA 2YNAA 1H9LB 1MTNB 2BLWA 3BTGE 3K2UA 4CH8B 1D9IA 3RXLA 1OWIA 3NUMA 1OWHA 3ZV8A 1LHDH 4WY3A 5JBCS 4SGAE 3QUMP 1FUJA 1JIRA 2GT8A 2GZ8A 1LPKB 2F83A 5GJ4B 1UJ1A 1BTWA 3A8BA 1O2VA 1AMHA 4JZIA 3SJKA 2C90B 3LC3A 3KN2A 1ZRBA 1GBKA 1L1JA 1QA7A 2Z9IA 5GDSH 1V3XA 3U98H 2ODYB 3CENA 1C5MD 1FPHH 5EXLA 2OLGA 1OP0A 3ZVDA 5DP9A 1HIAB 3U1JB 1EXFA 2PKSC 5CE1A 2PUQH 4ZKRU 2ZZUH 4B76A 1SGRE 3S0NA 5B6OA 1NU7B 4ABDA 1P2KA 1BB0B 3MNCA 1ZMNA 1LQEA 1KLTA 1EAIA 1GHXH 1KXCA 3M35A 4Q7ZA 1EJMA 3KQDA 1GG6C 1HPGA 4I33A 2XW9A 2HRVA 3URCA 1DM4B 3D49H 4IBLH 3ZZCA 1J16A 1OYQA 1PPFE 1ELDE 4YESB 1ZTLA 1HAPH 2ZWLH 3EGKH 1AN1E 1GHBG 1C5ZB 3SUDA 4E05H 4ABGA 1BUIA 2W3IA 1O38A 4RSPA 4AG2A 2QXHA 1GJ4H 2W7UA 1K1MA 1TGTA 1KDQA 2ZDKA 1RIWC 3URDA 5A0BA 1G30B 1V2LT 1SLUB 3V3MA 1WTGH 1GL0E 3PWBA 4IS5A 1CBWB 5DPAA 1YBWA 2VIDA 5JYIA 1BHXB 1EPTC 2F3CE 3N7OA 1HGTH 1A2CH 4MPWA 1W13U 1IQJA 2Y6TA 1GHBF 2V0BA 1ETSH 1W14U 2J38A 3TH3H 2BY9X 3TJVA 5IYTA 3A84A 3GICB 3QO6A 4X8VH 1CQQA 1QTFA 2ILNA 6GCHG 1TX8A 4AN7A 1QBVH 4WH8A 1CGHA 2NU4E 1W10U 5CHAC 1OX1A 3PYHA 3TPIZ 4U32A 4X8UH 4DG4A 5C1UA 1YPMH 1Z1IA 3NK8A 1BMAA 1ANEA 2ULLA 2UUKB 1L4DA 2BDHA 2FS8A 1K1IA 3E0PB 2F9PA 4IGDA 2A45B 2PKAB 2XRCA 1O3EA 4AGJA 3TNSA 2ZPRA 1MCVA 1C5OH 6GCHF 5ABWA 4AORA 1YYY1 1QY6A 1FAKH 1P05A 5PTPA 3UY9A 1NFWA 1EB2A 1FI8A 1FXYA 4WH6A 3OY5U 1O3NA 1O5EH 3SHCH 1T8NA 2VIOA 3BEUA 3U1IB 5HXFA 1GBFA 2FOMB 1P11E 1C5NH 1V2NT 2CXVA 4KTSA 1L2EA 4RKJB 1P10A 3PWCA 1AUTC 4TPIZ 9ESTA 1QIXB 2XTTB 2AIPA 1V2RT 1SG8B 2SGAA 1EUFA 1K2I1 3MI4A 1GI7B 4E7RG 1BA8B 1CSOE 4X2WA 3RXDA 3EA9A 1F0SA 1YCPH 1Z6JH 2ALVA 1GBLA 4X2XA 1CO7E 2QYIA 1C1TA 1GDQA 2UWPA 1GI3A 4NWLA 1E0FD 1KIGH 3MU5A 1QQ4A 1PQAA 1IHTH 4ZHMU 1TLDA 1LKAA 3BTKE 2GDEH 3T29A 1BOQA 3GYLB 3BV9B 3RXBA 5T6GA 1ZPCA 2D2DA 3M5LA 1GHAF 5LH8A 2R2WU 5E0HA 2A4RA 3FANA 1GI8B 4B75A 1ZGIA 3FVFB 1V2VT 3MNXA 4NSYA 3MH4A 1DXPA 4I8LA 1GBJA 1P2QA 1SLVB 2BZAA 1TGSZ 3EA7A 4MPVA 4ISOA 1Z1JA 1HAIH 4KELA 4CHAC 3ODFA 2P95A 3PTBA 3FP6E 1YPLH 1V2OT 3ZVGA 1O2ZA 7GCHG 1ETTH 1D6WA 5T3HA 4RN6A 1O37A 1DICA 3F6UH 4QT8C 1V2WT 3U8RH 3KGPA 2ZFQH 3A86A 3E0NB 2OC1A 4JK6A 1MQ5A 2BDIA 2ZQ2A 2XBVA 1QJ1B 3IITA 4INLA 4K8YA 1WU1A 4VGCB 2BQ7B 1C5LH 1D3PB 2XC5A 1P3EA 5EW2H 4FUFA 1JWTA 2QXGA 7GCHF 2FI5E 1NT1A 1FN8A 3UQOA 1DXWA 2J4IA 1T8LA 1P2JA 2G81E 1QQUA 3SGQE 2FYRA 3GOVB 1ABIH 4A92A 2XC0A 4KGAA 1N8OB 2Z9GA 1BBRE 3SQEE 2CF8H 1DSTA 1HJ8A 1HFDA 5C67A 3KEEA 5AF9H 1O3MA 2F91A 5GCHG 1BTPA 1FQ3A 1ZTJA 4ZHAA 5DP6A 1Z8GA 5HYOA 3EE0B 4ZAEA 1FDPA 4BOHA 3NWUA 1BJUA 2A7JA 4JMYA 5JB8S 1EZUC 2CN0H 1J8AA 2XBXA 2ZI2H 3ZVEA 4R8TB 4INKA 1Y3UA 4X8SH 1QRWA 4K1TA 2DE8A 2GVFA 2UUYA 3QX5H 1S85A 2BY8X 4IC6A 2I6SA 5GCHF 2O8TA 4NGAH 3TJNA 1C1MA 1RD3B 1VCWA 2ZU1A 1HJAC 4I32A 1NRNH 2HLCA 1HCGA 1JRSA 5EXNA 3FZDA 1W8BH 4H6TA 1WSSH 2AYWA 3RMLH 2JH0D 3RXCA 5BPEA 2W26A 1VCQA 1J9CH 1UVSH 3RXTA 5JBBS 4OS7A 3PLPA 4K2YA 6CHAC 1GI4A 2G00A 2OC7A 1O30A 2OC0A 3LGYA 2Y82A 4ABEA 2H5CA 1P03A 2Z3EA 4A5TS 2ZECA 4IC5A 1W11U 2BDCA 1AZ8A 3PLBA 2Y80A 1IAUA 1DE7H 3IG6B 1B7XB 3P17H 3GDUA 2BLQA 3SOSA 1ZHRA 1MTVA 3STJA 2RCEA 3BN9A 1S6HA 1GI5A 3E90B 2ZU2A 3SNEA 1ZSJA 3ZZ3A 1DLKB 2YOLA 3TLOA 2FOCA 1TGBA 4NA8A 3SHAH 1P2MA 2PSYA 4O03A 5CMXH 2GD4B 1LHCH 4HFPB 3GCHB 2NU0E 1ELTA 2VGCC 3A7TA 4LXBH 1EOJA 2ZHEH 1GBEA 2O8UA 2D26C 1GJ5H 5J4QA 1DUEA 1YCPK 3B8JA 1MU8B 1BRAA 3BEFB 3C1KA 2RA3A 2BD4A 4HZHA 1Y3XA 1F2SE 1UHBA 1C2DA 3RXSA 1ELCA 2A1DB 3M61U 1THSH 3RLWH 3PV4A 1IQMA 4WVPE 3IWMA 3RXHA 2ZFRH 3U9AH 1BTZA 3LONA 1GVKB 1KXFA 3HK6B 4K8BA 2AMQA 2G52A 1O3OA 1E38B 4Y7AA 3QZQA 2H5DA 2Q6GA 1Z8IB 1AFQC 1O2GH 3R3GB 4ABBA 3QK1A 1AB9C 1U6QA 2ZG0H 1OP2A 2AGIX 1AI8H 1S82A 5F03A 1Z71A 2ANWA 3RXFA 1ZR0A 2B9LA 4NIVA 2FPZA 3BG4B 1MUEB 4Q80A 4I8GA 1TPOA 2ZGBH 4GCHG 1DWDH 3TGKE 1E36B 4UDWH 3RM2H 4A1XA 1N6XA 1XXFA 2WPJS 2G51A 4OS4A 1Q3XA 4NFFA 3A83A 3A7ZA 4WJG2 3V13A 1LHEH 1C5WB 2F9VA 3UR9A 2D8WA 5A8XA 1NZQH 1SGFA 3GDVA 2PWXA 1LPZB 1EZQA 1G3BA 2BB4A 2ZDAH 4ZKNU 3QGJA 4GCHF 2O8MA 3PM3A 1MAYA 5AFYH 2GTBA 1EOLA 1AGJA 2HPQH 2BDAA 3QDZB 2ZDLA 3NKKA 1QGFA 1XUIA 5FAHA 5HGGA 1HV7A 2OCVB 1DT2A 1C4V2 1EZXC 3FZZA 1A7SA 4YO9A 4JYTA 1SGQE 1AE5A 1L1GA 3B9FH 1HJAB 1CHOF 3T5FH 1CT0E 2FX6A 4BXSA 1FONA 3F9HA 3CS0A 1SLXB 3SNAA 1AVWA 1C5RA 2JH5D 4ABHA 1UTLM 1LHFH 4NZLA 4KTCA 1SQAA 6LPRA 3ELAH 3O8RA 3RXEA 1ESTA 1G2MA 1QJ7B 2IN2A 1RXPA 4H42U 4A7IB 5GWZA 1XUFA 3S9BA 2BVRH 1M9UA 2A7HA 4WMEA 1CT4E 1Y5AT 6CHAB 2GGVB 2QIQA 4B73A 1PQ5A 3GY8A 2FIRH 2PLXA 3ESTA 2RG3A 3ZZ6A 5SGAE 3UNRA 2CHAC 1THPB 1DX5M 3FFGA 2OXSA 2SNVA 4BTTB 1ELGA 1SGYE 3MH7A 1BTUA 5EPNA 2PHBA 4A1VA 5FBEA 3QGNB 1SBWA 1PPGE 2R2MB 1O5DH 4BAOB 5JB9S 3MMGA 3MU0A 3V0XA 3NPSA 3A89A 1FIWA 1MZAA 2K1QA 1HLTH 1WYKA 2C8WB 2HNTF 4BAMB 4MLFB 5FPTA 1X7AC 1A5GH 1H8IH 1Z8JB 2F9NA 2G4TA 5E2PA 2NU3E 2VGCB 4B74A 1PFXC 3T62A 2ZHFH 3OTJE 3ENSB 1WQSA 3E3TA 1MZDA 4AX9H 4LZ4B 4I7YH 8GCHG 2VJ1A 1A5IA 2C4FH 3LT3A 2H9EH 2FZZA 3U69H 4K69A 2WPIS 1S0QA 3TIUA 1T8MA 2FTLE 1EQ9A 4Y6DA 3VXFH 1O2KA 1ZTKA 3O8BA 1YCPM 2ANYA 1LVYA 2G55A 3KIDU 1UTKA 3ZVFA 3UNSA 1NY22 2FTMA 2P94A 3E6PH 3ZVCA 1GJ6A 1AQ7A 1RGQA 1P2NA 3AASA 2BMGB 1AFQB 2HNTE 1MCTA 1UVPA 1ELVA 1AB9B 3RXIA 2WPLS 1CGJE 1K21H 4KTUA 4YOJA 3SJOA 1Y59T 1GMHF 3KNXA 1O5GH 1QRXA 3KQCA 3P8GA 1TRYA 3M5OA 3VEQB 1QL7A 2R0LA 1TNKA 4BAKB 1GBHA 3S7HB 3MHWU 1ELEE 3GYMA 1KXBA 3SU0A 1O35A 1O5AB 3PMBB 1TPPA 5A0CA 2BQ6B 4CR5A 2GX4A 1RS0A 5FXLA 3LGIA 2ODQA 4O9VA 4ABIA 4XFQA 1OKXA 3PMAB 2PGQB 4U2WA 2AGGX 5JBAS 2CGAA 5E2OA 1CVWH 2XCFA 4IN2A 1HAZB 4CREA 3AVZA 2BX3A 1TNLA 3TITA 1W12U 4LZ1H 2V6NA 1S5SA 5ESBA 3RXKA 2FXRA 2HOBA 1WV7H 4FUIA 4KP0A 4Y76A 3TVJB 4K1EA 3TJOA 2FI3E 1UK2A 2QN5T 4U01A 1AWHB 3OU0A 3EAJA 1DDJA 2FM2A 1FV9A 1O2PA 1YLDA 1FY8E 3M5MA 1C1UH 2CJIA 4DVAU 3T2NA 1MBMA 2G8TA 3SI4H 1SGPE 3KCGH 3RMNH 1GJ7B 1GBBA 1TA6A 1TB6H 4X1NU 3SU1A 3SUEA 2OP9A 2ZDMA 1AKSB 1P9UA 1MH0A 1ZMLA 1V2PT 1XUGA 3RC4A 2BD9A 4PROA 4A6LA 1P3CA 4K5ZA 4OGYA 1C2GA 3EQ0H 4YT7H 1TNIA 1EKBB 3TNTA 1O3GA 1C5SA 3ITIA 4ZMAH 1HUTH 2P16A 2H2ZA 1NPMA 1C9PA 1B0EA 2HPPH 3GY5A 2EEKA 1L4ZA 1TMBH 1VITH 1O36A 4LOYH 3OX7U 4YOGA 1UCYE 4O3TA 1SGCA 3ATLA 4X1QU 3V12A 2KAIB 1O3HA 2HWLB 1W0YH 2SGPE 2ZFSA 1PPZA 5G4BA 5FBIA 3RXGA 1MTSA 1GGDC 1TMTH 1YPEH 2ZHDA 2GT7A 3VXEH 2TGPZ 5TCCA 1C1WH 2IPHA 1A3BH 4HTCH 3S9CA 3DD2H 2QF3A 3MOCA 3I78A 1CA0C 1JBUH 2DE9A 1OWJA 1TAWA 1VGCC 5A2MH 1KLJH 4FU7A 1UVOA 1HIAA 2J9NA 1GJAB 1GBAA 1T4UH 1BRCE 3MO9A 1F5RA 1ZOMA 2BQWB 1EP5A 3BSQA 2QF0A 1TNGA 3HPTB 4NFEA 4X6MA 4FU9A 1DFPA 3E91A 4NCYA 1YM0A 2A31A 1TGNA 1LVBA 3NXPA 1C4U2 1YF4A 4D9QA 5DG6A 1Q2WA 1NM6A 2C8YB 3VFEA 2A5KA 2VB0A 1RTKA 1F0TA 2OTVA 5TJXA 5EQSA 2P8OC 3PMJA 3EYDA 4XDEA 1C5UA 1LCYA 2HNTC 1XUJA 2QA9E 1FMGA 3UR6A 2C3SA 3LGTA 4DOQA 5I25A 1NO9H 1D6RA 4GSOA 2WV4A 4X8TH 1HBTH 1O2SA 1HAVB 3BEIB 1ACBE 1TRNA 1ARBA 2WPHS 4Y0ZE 1BTXA 1ANCA 2PKSB 4GHTA 4JYUH 3PB1E 1O2RA 2BHGA 3VGCC 1IQHA 1TX6A 4B2AA 5J4SA 3HKIB 3W95A 2VVUA 5C1YA 5L2YH 5EXMA 1WCZA 1GJ8B 3P92A 1C5TA 4NIXA 1XKBC 1AO5A 5E0JA 4HGCA 4KKDA 4UFDH 4Y0YE 1O2YA 1GG6B 2BLVA 1B0FA 4FVBA 1H4WA 1K9OE 4Y10E 2BY5X 1SL3A 2C93B 2H1UA 3Q77A 1UK3A 4OS1A 2PW8H 4AFUA 1C2JA 2Z94A 1HYLA 3HK3B 3OSYA 3M5NA 5DK1A 1F5KU 1AHTH 1C9TA 2Q6DA 3MNSA 1UTOA 1H8DH 3KHVA 1CT2E 1GHZA 5EPYA 4YLQH 2FOFA 2PKAA 1BTYA 1LHGH 2XCNA 5I46H 3HGPA 1FIZA 2O9QA 2ZGCA 1YC0A 3BTWE 1K1JA 1RIWB 2TRMA 3F68H 2RDLA 2XWAA 2ZFFH 5F6MA 4B2CA 3HKJB 3ZVBA 2BD5A 5GIBA 4ZKSU 2FS9A 1EPTB 2AFQB 2ZFTA 3S69A 1OYTH 1GVZA 3BTEE 3A87A 3L33A 4RKOB 2OQUA 4E7NA 4JZFH 4TWYA 5DJ7A 1QCPA 4ZKOU 1SFQB 2THFB 3OYPA 8ESTE 1SFIA 2J2UA 3F9FA 3VB7A 1V2MT 1WBGB 1WTHD 5A8ZA 4OS5A 2WPKS 1LMWB 2BVSH 1LKBA 5LPRA 1SVPA 3SGBE 4CR9A 1BQYA 2A4QA 1P57B 2Y7ZA 4TY6A 5CHAB 4JZDH 1QB1A 3B23B 3ZZDA 1LPGB 4J2YB 2EI7A 1ETRH 1XKAC 1G2LA 3BTTE 1O33A 2ZTYA 3ATIA 1UK4A 2BD7A 1AZZA 1DANH 2OD3B 1THRH 1LTOA 1HAHH 1CE5A 1K22H 1BHXF 2J92A 1GI0A 1O2TA 3NZIA 2B7DH 5A8YA 7KMEH 1AE8H 1KXAA 1IQIA 1G3EA 1GBMA 1RTLA 1J15A 1Y3WA 1YLCA 1SSXA 4AB9A 1SOTA 3MU8A 3ZZ4A 5E8EH 1GBTA 1C1SA 1NN6A 2ZQ1A 3PMHB 4ABAA 2VH6A 2F9UA 4YZUA 1SGIB 2PGBB 1QJ6B 4OGXA 2VIWA 3P95A 2VIPA 1Y3YA 2ZC9H 2P8OB 3Q3KA 3P8OA 2CV3A 3A8AA 3LPRA 1VJ9U 2Z6BD 1ZJDA 1GJDB 1KXEA 1L1NA 2H9HA 1O32A 1NRRH 1O2HA 2BDGA 1ZSKA 1DSUA 4UFEH 1OP8A 2OBQA 3M36A 4CRCA 2ZDVH 5L2ZH 2FESH 2XXLA 3D62A 1BBRH 1GVLA 4GAWA 2O8WA 2EI8A 2WUCA 4Y71A 1O3PB 2GCTC 4AFQA 2J95A 2STAE 3SJIA 1ZSLA 2JETC 4UEHH 4CRDA 5FPYA 1HAOH 1EPTA 3FP8E 3VGCB 3A8DA 1UTMA 1TGCA 4I8HA 2BDYA 1D3QB 1FN6A 2ESTE 2VIVA 3A80A 1IQKA 1JRTA 4Y8YA 3A7XA 4FUEA 3ZZ8A 4CHAB 5L6NH 2TGAA 3QWCH 1NFYA 3SV8A 1BMNH 3DFJA 1C2MA 4GHQA 4WXVA 4AOQA 4CRGA 1NTPA 4A1TA 1YPJH 2Z9KA 2G4UA 2PTCE 1HAXB 3CP7A 2O8LA 1NRSH 1HJ9A 4X1SU 1VJAU 3KF2A 1GWAA 2FP7B 3LDXH 3RU4E 1PJPA 2QXIA 3LC5A 3LIWA 3KL6A 1UO6A 2P93A 1AUJA 2TBSA 3W94A 3H5CB 1BDAA 1QHRB 4NA7A 4NG9H 1BZXE 3SO3A 2QY0B 4H6SB 3HGNA 3M37A 3TH2H 2WINI 4X2VA 1VR1H 1O0DH 3ODDA 2BD8A 3PROA 1W7GH 1SGTA 1XUKA 1Z6EA 3MH6A 1C2HA 2AMDA 3SU2A 4LK4A 4K3JA 1K1OA 2NU1E 1XXDA 1XUHA 3SNDA 2Y5HA 1WOFA 4X1RU 2F9OA 5AVDA 2OUAA 3GDSA 4JZ1A 4ISLA 4UONA 1J17T 1TQ7B 1EX3A 1C5VA 4NWKA 1KY9A 3DUXH 1C5PA 1HAGE 2IOTA 3AW0A 1TBRH 4BTUB 1P8VC 1HNEE 4D76A 4AFZA 1JOUB 1SQOA 4GLYA 2ASUB 3RC5A 1TOMH 4MVNA 2XBYA 4CBNA 4Z6AH 4YLUA 3SJ9A 1GL1A 2EC9H 2A4GA 5A0AE 1C2IA 4JZEH 4ZROA 4H4FA 3MO6A 1NFUA 1A3EH 2WYJA 1D4PB 2ALPA 3JZ2B 2XNIA 1TOCB 2ZEBA 3RM0H 5HM9A 1K1PA 1TNJA 4ZH8A 1LDTT 4CBOA 2W3KA 3RXOA 2I6QA 1Y5BT 1ZLRA 2BXUH 1MQ6A 3K6ZA 1ABJH 3M7QA 1O2LA 5E0GA 2ODPA 1IQNA 1C1VH 4X6NA 5EW1H 2P3FH 5DKMA 3TGIE 1F7ZA 1A0HB 2Q6FA 4Q2KA 2G5NA 1OPHB 4ASHA 5FCRA 4B1TA 2HALA 1V2UT 1O3DA 4MNYA 4I8JA 2UWOA 1SQTA 1DUAA 2FWWA 1ELBA 1MD7A 1C1NA 1CBWC 3F9EA 1TPAE 1MTUA 1IHSH 3RP2A 1O5CB 3TH4H 1RTFB 1PPCE 1KTSB 1SB1H 1Y3VA 2FLBH 5EQRA 1SGFG 5EODA 4CH2B 1BRUP 3M3VA 5C5NA 5FX5A 2P3TB 1GMDG 1ZJKA 1FLEE 3P8FA 5FHTA 2GCTB 1BRBE 2ZFPH 3TJUA 2LNCA 2VWMA 1J14A 1ELFA 3EDXB 1E37B 1UVUH 1GBIA 3RXVA 1OWEA 1WQVH 1O31A 2A5AA 2GV7A 4CRFA 1G32B 4MNVA 2OINA 2XBWA 1FAXA 1GDNA 1O2XA 1T32A 1ID5H 1V2JT 3GISB 2DUCA 3Q00A 3A7VA 4BAHB 3A85A 3MTYA 4AFSA 1NRQH 4NSVA 1GJCB 1GMDF 4BANB 1O34A 3RXAA 3F9GA 5C3NA 3G01A 2VVCA 1KDQB 2FLRH 3S7KB 1TALA 3SV9A 2ZCHP 4FUCA 4TYDA 1AD8H 1GCTC 4XBDA 1F92A 2D1JA 1MU6B 1HRTH 3SUFA 4DW2U 1EP6A 3K6YA 5ETXA 1KSNA 1YPGH 3ATWA 4GVUA 1BBRK 2HVXA 4DIIH 2BX4A 2Y7XA 2VNTA 2UUJB 8GCHF 5FCKA 1LO6A 1WAYB 1P2OA 2FOGA 3RMMH 3RUOA 3SNBA 3STIA 1EJNA 1ESAA 1TQ0B 1FY4A 2V35A 1T31A 4B2BA 4DY7B 1GBDA 5DP3A 1GI6A 2XWBI 1YPHE 2PUXB 1HAYB 3WY8A 3BG8A 3GCNA 1H9HE 3ATKA 3GCTG 1ORFA 2H9TH 3BTDE 4UFFH 1TIOA 2Z9LA 1IOEA 2A0QB 3I77A 5EOKA 1EB1H 3UWJH 2GDDA 1T7CA 3DFLA 1BT7A 3RXQA 3BTHE 1NU9A 1Y8TA 1Z8RA 4Q7YA 2VWOA 4X0WU 5GXPA 1C1OA 3DHKH 1P2IA 2Z7FE 4MTBA 1ZGVA 3QZRA 2R3YA 3GCTF 2SGQE 1P06A 1LQDB 1OSSA 2FOEA 2B0FA 1JMOH 4UFGH 3ZVAA 2ZGHA 3SV6A 1A1RA 1HB0B 1GI1A 2QV1A 3M3TA 2ZTXA 2Q1JA 1QL8A 1TBZH 3RXRA 1TRMA 4UE7H 3VB3A 1BIOA 1W3CA 3P70B 1MMJN 3RXJA 3SV7A 4Y79A 4ISNA 1AFEH 1TFXA 4TPYA 2EI6A 4DIHH 1O2JA 2VINA 2OBOA 1QB6A 3RLYH 1BCUH 5LGOA 1K1NA 1UTPA 3JZ1B 1C5YB 1QBOA 2FMJA 2ZCKP 3LH1A 3UREA 1O2IA 1SR5C 1ELAA 2XYAA 3ATMA 2ZTZA 2FEQH 1W2KH 2BDBA 2P3UB 1QR3E 1V2TT 2BY6X 3A82A 1SGDE 1PPHE 2QXJA 2WYGA 1NC6A 3PLKA 1OOKB 2FODA 1O3KA 3ZZBA 5HMAA 5K7RA 1QBNA 1AY6H 4VGCC 4CRBA 3Q76A 1K1LA 3SBKA 1S6FA 4HI3A 3T25A 2SNWA 1O3FA 2CHAB 4FU8A 1PPBH 1CA8B 2ZGXH 3BTQE 5JBTA 3SI3H 1O3LA 5C5OA 4WMFA 1T4VH 1EAWA 4ZHLU 3RU4D 2ZCLP 3P8NA 1LVOA 2ANMH 7ESTE 1N8OC 2AS9A 2BTCE 3AAUA 4MQAA 5T6DA 4FUJA 1ZYOA 4MNWA 1GHVH 1Z7KA 1XM1A 3AAVA 1K28D 5C20A 5LPEA 5IDKA 1TBQH 2P59A 2VWLA 2R3UA 3SU5A 3E16B 1TWXB 1ZZZA 1DS2E 2PTNA 1A5HA 3A7YA 2W7SA 1SMFE 1IQEA 3UNQA 1TABE 2BD2A 4ZUHA 1EAUA 3C27B 2ANKH 2QC2A 2BYAX 4JK5A 2GCHG 1O3IA 3P6ZB 1YP9A 2WV5A 5K0HA 3DT0H 1GCTB 3RMOH 3SU6A 3QTVH 3MU1A 1MKWK 1PYTC 2ZHWH 2NU2E 1UTJA 1S0RA 2Y5FA 5DO4H 1FY3A 4O97A 3GY6A 2AH4X 2AMPA 1FPCH 2GP9B 3L3TA 3LGWA 4MG3A 1FZZA 4Y11E 1V6DA 3RXUA 1H9IE 1IQLA 2RA0A 3T28A 1WUNH 2UWLA 4MPXA 2GCHF 3BTME 1YPHC 1GHAG 2FI4E 4AYVB 1DY8A 1C2LA 8LPRA 2ZU5A 3HATH 1SGEE 3M7UA 1V2ST 4U30A 5DP7A 1BITA 5T6FA 3SORA 4THNH 1P0SH 4Y8XA 1UCYH 1AKSA 2IJOB 4D8NA 7LPRA 5TCAA 1O3AA 3ZZ7A 2A5IA 3M3SA 3O8CA 1B5GH 1IQFA 2JKHA 1N1LA 2J34A 3OY6U 2A32A 4WXIA 3UOPA 4NZQA 1D3TB 1O3JA 1C5XB 2QCYA 3SW2B 2TPIZ 1ANBA 3SZNA 3RU4T 3D65E 1QA0A 5F8TA 2VWNA 5DP4A 2ZU3A 2WUBA 1AU8A 4ZXYH 1P9SA 4XBBA 1QL9A 3CS7A 1DITH 3SN8A 4TWWA 1OS8A 5A09A 3GCHC 2TGDA 1E35B 4XBCA 1XMNB 1C1PA 2KAIA 3SJ8A 2VU8E 1FJSA 1ZRKA 4F4OC 2QAAA 3U8OH 4WMDA 5ESTE 1G9IE 1GI9B 1BJVA 2GZ9A 4MPUA 4AZ2B 4CRAA 3BIVH 3RDZA 1UMAH 1ZPBA 1MD8A 1SHYA 1O3BA 3RXPA 3TU7H 1GHYH 1S83A 3TK6A 1IQGA 5C1XA 2SGDE 3I29A 1JIMA 1ARCA 3GY2A 1EASA 4MNXA 5JDUB 1SC8U 1SPJA 5FPSA 3KQEA 4IW4E 3PO1C 3LH3A 5HM2A 2A2QH 3M7TA 5EQQA 2V3HH 1C4Y2 2VIQA 3F1SB 3UUZA 3RC6A 2PSXA 1ZMJA 1GJ9B 4YOIA 2ZU4A 4GUXA 1LVMA 1UTNA 3UOUA 4AB8A 4MDSA 3T27A 3BG4C 2H6MA 3U8TH 3FAOA 1PYTD 1F5LA 3VB4A 4R0IA 3MWIU 3SGAE 4WF8A 6ESTA 1GGDB 3SNCA 1UHBB 4K60A 1S81A 2ZIQH 3H7TA 1QFKH 4D7GA 5DP5A 5F8ZA 1CA0B 1P12E 2STBE 1VGCB 1V2KT 1HAVA 1DOJA 1V2QT 3PTNA 1DPOA 1O3CA 3SQHE 3LJOA 2J94A 3UIRA 4FUDA 2ZNKH 4FXGH 1MKXH 1PQ8A 5EGMA 1INCA 1QNJA 1VCPA 3SU3A 1E34B 1A61H 3GY7A 1Y5UT 1GCDA 3A81A 3E8LA 4Z0KA 1CU1A 3UPEA 4D7FA 1DVAH 1ZPZA 1H1BA 1PPEE 4ISIH 4I31A 3VB5A 2BVXH 3ZZ5A 2V3OH 4BXWA 3UTUH 9LPRA 2ZO3H 4FVDA 1GBCA 3TGJE 2FO9A 1O5FH 1HDTH 1OWKA 1O39A 1NESE 2ZPQA 2Y5GA 2BM2A 2FYQA 1EAXA 1XVMA 3A88A 2ZHQH 2FOBA 4I8KA 2A7CA 3A8CA 2GKVE 3GCOA 4XE4A 4SGBE 1ZHPA 2ZA5A 3LOXA 4ZXXH 2BXTH 2FOAA 1BMMH 3K65B 1C2KA 5F8XA 1GHWH 1DWEH 2R9PA 3FP7E 2SFAA 1TE0A 4FUBA 1RJXB 1MBQA 5DGJA 1EATA 5DP8A 3KQBA 4DJZB 2BD3A 1DY9A 3EA8A 3LU9B 1P01A 2EA3A 1HXFH 1QB9A 2SGEE 1A0LA 1A0JA 1ZHMA 1TMUH 2TGTA 1W0ZU 4ISHH 4F49A 3V7TA 1G3CA 1F0RA 1P04A 1KYNA 1TYNA 1S84A 1C1QA 1O2WA 1UTQA 1C1RA 1GI2A 1P09A 2NWNA 4NIWA 2HGTH 3MO3A 1KLIH 1FY1A 3LGUA 2M5TA 4AYYB 4B71A 3D23A 1PQ7A 2R0KA 3Q3XA 2PR3A 3VPKA 2W5EA 2GMTC 3AW1A 4D9RA 1AWFH 4GPGA 2CMYA 4AG1A 3BIUH 1GPZA 1KTTB 1UCYK 1O2OA 5GPIB 2ZF0H 3GY4A 3A7WA 1MTNC 4NIYA 2A2XH 3T26A 1QRZA 5EG4A 4FUGA 1A46H 1O5BB 1DLEA 1SI5H 4INHA 3BTFE 3PO1B 4XOJA 2AEIH 3ZYDA 1F0UA 5EU8A 1YPKH 2AIQA 4OS6A 1GMCG 3MYWA 5FX6A 1KXDA 4AGKA 2C8XB 1O2UA 2FDAA 4FUHA 1UVTH 1W7XH 3H7OA 1TONA 1FY5A 3QTOH 1NFXA 3VB6A 1RFNA 4NA9H 4XSKU 2Z3DA 2C8ZB 1A4WH 1C2FA 4ABJA 2VVVA 1YGCH 1GJBB 1ESBA 1SOZA 2FX4A 2TIOA 3BF6H 3R0FA 2AGEX 1EJAA 1NS3A 4K1SA 2A4OA 4IMQA 1GMCF 4X6PA 4J1YA 1D3DB 1O2MA 1JXPA 1C2EA 1MTWA 4JYVH 1NRPH 4BNRA 1CHOG 4Y7BA 4ABFA 1QURH 4YT6H 1CGIE 1SHHB 2BZ6H 1SLWB 2Z9JA 5C2ZA 3UQVA 2FOHA 4X1PU 2OC8A 2OQ5A 4JCNA 1G36A 1TA2A 4DGJA 3MH5A 4X6OA 4E06H 4WWYA 1G3DA 1DWCH 2BOHB 3UFAA 2BLOA 1BTHH 2G5VA 5AFZH 2GZ7A 5JPMH
chains in the Genus database with same CATH superfamily
3QN7A 1TX7A 1VZQH 3E1XB 1DWBH 1TNHA 2ZP0H 1RRKA 2SGFE 4YTAA 3MFJA 1SGNE 2CF9H 1AVXA 3TK5A 2B5TB 3LJJA 4IMZA 3SV2H 3O8DA 4BTIB 1T8OA 2BY7X 2VH0A 4IN1A 4DT7B 2WPMS 2BOKA 1GDUA 4ESTE 3Q3YA 2YNBA 3S9AA 2ZDNA 4DCDA 4DURA 1AVGH 1OWDA 3GY3A 1G37A 4TY7A 1MKWH 3K9XB 2LPRA 1OXGA 1L0ZA 1Q31A 1HXEH 2Y81A 3TK9A 5L30H 1CHGA 5H4IB 2PFEA 1AIXH 3LGVA 1FNIA 1O2QA 1P02A 1MKXK 2JETB 1BMLA 2UUFB 5AHGH 3ZV9A 2B8OH 3DA9B 5BRRE 2XC4A 4BAQB 2PV9B 2KCYA 4OM9A 2JDID 1MAXA 3PV2A 1VITG 2ZKSA 2QGRA 3F0OA 2ZGJA 1NROH 1TPSA 1ANDA 3SUGA 4Y8ZA 4Q7XA 8KME2 3ZZ9A 2Z3CA 4OS2A 1C5QA 3ZYEA 5LPFA 4P02A 2JH6D 2F9BH 3LKWA 4M7GA 2ZPSA 3NCLA 3QLPH 3L6PA 1XX9A 4X2YA 3ZZAA 2GMTB 3UWIA 1VITF 1EZSC 4UD9H 1N6YA 2GV6A 3MU4A 3SU4A 2AERH 3RXMA 4O3UA 1O2NA 1YKTA 4YM9A 1XVOA 1GMHG 3MNBA 2YNAA 1H9LB 1MTNB 2BLWA 3BTGE 3K2UA 4CH8B 1D9IA 3RXLA 1OWIA 3NUMA 1OWHA 3ZV8A 1LHDH 4WY3A 5JBCS 4SGAE 3QUMP 1FUJA 1JIRA 2GT8A 2GZ8A 1LPKB 2F83A 5GJ4B 1UJ1A 1BTWA 3VG8A 3A8BA 1QZ8A 1O2VA 1AMHA 4JZIA 3SJKA 2C90B 3LC3A 3KN2A 1ZRBA 1GBKA 1L1JA 1QA7A 2Z9IA 5GDSH 1V3XA 3U98H 2ODYB 3CENA 1C5MD 1FPHH 5EXLA 2OLGA 1OP0A 3ZVDA 5DP9A 1HIAB 3U1JB 1EXFA 2PKSC 5CE1A 2PUQH 4ZKRU 2ZZUH 4B76A 1SGRE 3S0NA 5B6OA 2J98A 1NU7B 4ABDA 1P2KA 1BB0B 3MNCA 1ZMNA 1LQEA 3OEED 1KLTA 1EAIA 1GHXH 1KXCA 2VBCA 3M35A 4Q7ZA 1EJMA 3KQDA 1GG6C 1HPGA 4I33A 2XW9A 2HRVA 3UB0A 3URCA 1DM4B 3D49H 4IBLH 3ZZCA 1J16A 1OYQA 1PPFE 1ELDE 4YESB 1ZTLA 3DSGA 1HAPH 2ZWLH 3EGKH 3KYGA 1AN1E 1GHBG 1C5ZB 3SUDA 4E05H 4ABGA 1BUIA 2W3IA 1O38A 4RSPA 4AG2A 2QXHA 1GJ4H 2W7UA 1K1MA 1TGTA 1KDQA 2ZDKA 1RIWC 3URDA 5A0BA 1G30B 1V2LT 1SLUB 3V3MA 2WV9A 1WTGH 1GL0E 3PWBA 4IS5A 1CBWB 5DPAA 1YBWA 2XNDD 2VIDA 5JYIA 1BHXB 1EPTC 2F3CE 3N7OA 1HGTH 2W6JD 4FOUC 1A2CH 1MABB 4MPWA 1W13U 1IQJA 2Y6TA 1GHBF 2V0BA 1ETSH 1W14U 2J38A 3TH3H 2BY9X 3TJVA 5IYTA 3A84A 3GICB 3QO6A 4X8VH 1CQQA 1QTFA 2ILNA 6GCHG 1TX8A 4AN7A 1QBVH 4WH8A 1CGHA 2NU4E 1W10U 5CHAC 1OX1A 3PYHA 3TPIZ 4U32A 4X8UH 4DG4A 5C1UA 1YPMH 1Z1IA 3NK8A 1BMAA 1ANEA 2ULLA 2UUKB 1L4DA 2BDHA 2FS8A 1K1IA 3E0PB 2F9PA 4IGDA 2A45B 2PKAB 3FO8D 2XRCA 1O3EA 4AGJA 3TNSA 2ZPRA 1MCVA 1C5OH 6GCHF 5ABWA 4AORA 1YYY1 1QY6A 1FAKH 1P05A 5PTPA 3UY9A 1NFWA 1EB2A 1FI8A 1FXYA 1NBMD 4WH6A 3OY5U 1O3NA 1O5EH 3SHCH 1T8NA 2VIOA 3BEUA 3U1IB 5HXFA 1GBFA 2FOMB 1P11E 1C5NH 1V2NT 2CXVA 4KTSA 1L2EA 4RKJB 1P10A 3PWCA 1AUTC 4TPIZ 9ESTA 1QIXB 2XTTB 2AIPA 1V2RT 1SG8B 2SGAA 1EUFA 1K2I1 3MI4A 3NRLA 1GI7B 4E7RG 1BA8B 1CSOE 1YWUA 4X2WA 3EA9A 3RXDA 1F0SA 5C0TA 1YCPH 1Z6JH 2ALVA 1GBLA 4X2XA 1CO7E 2QYIA 2KM0A 1C1TA 1GDQA 2UWPA 1GI3A 2AHME 4NWLA 1E0FD 1KIGH 3MU5A 1QQ4A 1PQAA 1IHTH 4ZHMU 1TLDA 5C17A 1LKAA 3BTKE 2GDEH 3T29A 1BOQA 3GYLB 3BV9B 3RXBA 5T6GA 1ZPCA 2D2DA 3M5LA 1GHAF 5LH8A 2R2WU 5E0HA 3OAAD 2A4RA 3FANA 1GI8B 3UAIC 4B75A 1ZGIA 3FVFB 1V2VT 3MNXA 4NSYA 3MH4A 1DXPA 4I8LA 1GBJA 1P2QA 1SLVB 2BZAA 1TGSZ 3EA7A 4MPVA 4ISOA 1Z1JA 1HAIH 4KELA 4I86A 4CHAC 2KZ4A 3ODFA 2P95A 3PTBA 3FP6E 1YPLH 1V2OT 3ZVGA 1O2ZA 7GCHG 1ETTH 1D6WA 5T3HA 4RN6A 1O37A 1DICA 3F6UH 4QT8C 1V2WT 3U8RH 3KGPA 2ZFQH 3A86A 3E0NB 2OC1A 4JK6A 1MQ5A 2BDIA 2ZQ2A 2XBVA 1QJ1B 3IITA 4INLA 4K8YA 1WU1A 4VGCB 2BQ7B 1C5LH 5HIYA 3PRBA 1D3PB 2XC5A 1P3EA 5EW2H 4FUFA 1JWTA 2QXGA 7GCHF 2EY4C 2FI5E 1NT1A 1FN8A 3UQOA 1DXWA 2M2AA 2J4IA 1T8LA 1P2JA 2G81E 1QQUA 3SGQE 2JJ1D 2FYRA 3GOVB 3SYJA 1ABIH 2J5UA 4A92A 5KECA 2XC0A 4KGAA 1N8OB 2Z9GA 1BBRE 3SQEE 2CF8H 4ASUD 1DSTA 1HJ8A 1HFDA 5C67A 3KEEA 5AF9H 1O3MA 2F91A 5GCHG 2GJGA 1BTPA 1FQ3A 1ZTJA 4ZHAA 5DP6A 1Z8GA 5HYOA 3EE0B 4ZAEA 1FDPA 4BOHA 3NWUA 2KCOA 1BJUA 2A7JA 4JMYA 5JB8S 1EZUC 2CN0H 1J8AA 2XBXA 2ZI2H 3ZVEA 4R8TB 4TT3D 4INKA 1Y3UA 4X8SH 1QRWA 4K1TA 2DE8A 2GVFA 1VKYA 2UUYA 3QX5H 1S85A 2BY8X 4IC6A 2I6SA 5GCHF 2O8TA 4NGAH 3TJNA 1C1MA 1RD3B 1VCWA 2L6OA 2ZU1A 1HJAC 4I32A 1NRNH 2HLCA 1HCGA 1JRSA 5EXNA 3FZDA 1W8BH 4H6TA 1WSSH 3N7EA 2AYWA 3RMLH 2JH0D 4RT1A 3RXCA 5BPEA 2W26A 1VCQA 1J9CH 1UVSH 3RXTA 5JBBS 4OS7A 3PLPA 4K2YA 6CHAC 1GI4A 2G00A 2OC7A 1O30A 2OC0A 3LGYA 2Y82A 4ABEA 2H5CA 1P03A 2Z3EA 4A5TS 2ZECA 4IC5A 1W11U 2BDCA 1AZ8A 3PLBA 2Y80A 1IAUA 1DE7H 3IG6B 1B7XB 3P17H 3GDUA 2BLQA 3SOSA 1ZHRA 1MTVA 3STJA 2RCEA 3BN9A 1S6HA 1GI5A 3E90B 2ZU2A 3SNEA 1ZSJA 3ZZ3A 1DLKB 2YOLA 3TLOA 2FOCA 1TGBA 4NA8A 3SHAH 1P2MA 2PSYA 4O03A 4M9FA 5CMXH 2GD4B 1LHCH 4HFPB 3GCHB 2NU0E 1ELTA 1EFRD 2VGCC 3A7TA 4LXBH 1EOJA 2ZHEH 1GBEA 2O8UA 2D26C 1GJ5H 5J4QA 1DUEA 1YCPK 3FN8A 3B8JA 1MU8B 1BRAA 3BEFB 3C1KA 2RA3A 2BD4A 4HZHA 1Y3XA 1F2SE 1UHBA 1C2DA 3RXSA 1ELCA 2A1DB 3M61U 1THSH 3RLWH 3PV4A 2WSSD 1IQMA 4WVPE 3IWMA 3RXHA 2ZFRH 3U9AH 1BTZA 3LONA 1GVKB 1KXFA 3HK6B 4K8BA 2AMQA 2G52A 1O3OA 1E38B 4Y7AA 3QZQA 2H5DA 2Q6GA 1Z8IB 1AFQC 1O2GH 3R3GB 4ABBA 3QK1A 1AB9C 3PRDA 1K0HA 1U6QA 2ZG0H 1OP2A 2AGIX 1AI8H 1S82A 5F03A 1Z71A 2ANWA 3RXFA 1ZR0A 2B9LA 4NIVA 2J97A 2FPZA 3BG4B 1MUEB 4Q80A 4I8GA 1TPOA 2ZGBH 4GCHG 1DWDH 1UW7A 3TGKE 1E36B 4UDWH 3RM2H 4A1XA 1N6XA 1XXFA 2WPJS 2G51A 5DSFA 4OS4A 1Q3XA 1S6LA 4NFFA 3A83A 3A7ZA 2V3MA 4WJG2 3V13A 1LHEH 1C5WB 2F9VA 3UR9A 2D8WA 5A8XA 1NZQH 1SGFA 3GDVA 2PWXA 1LPZB 1EZQA 1G3BA 2BB4A 2ZDAH 4ZKNU 3QGJA 4GCHF 2O8MA 3PM3A 1MAYA 5AFYH 2GTBA 1EOLA 1AGJA 2HPQH 2BDAA 2WZQA 2ZDLA 3NKKA 3QDZB 1QGFA 1XUIA 5FAHA 5HGGA 1HV7A 2OCVB 1DT2A 1C4V2 1EZXC 3FZZA 1A7SA 4YO9A 2WPDD 4JYTA 1SGQE 1AE5A 1L1GA 2LELA 2KX4A 1OHHD 3B9FH 1W0JD 1HJAB 1CHOF 3T5FH 1CT0E 2FX6A 4BXSA 1FONA 3F9HA 3CS0A 1SLXB 3SNAA 1AVWA 1C5RA 2JH5D 4ABHA 1UTLM 1LHFH 4NZLA 4KTCA 1SQAA 6LPRA 3ELAH 3O8RA 3RXEA 1ESTA 1G2MA 1QJ7B 2IN2A 1RXPA 4H42U 4A7IB 5GWZA 1XUFA 3S9BA 2BVRH 1M9UA 2A7HA 4WMEA 1CT4E 1Y5AT 6CHAB 2GGVB 2QIQA 3KYFA 4B73A 1PQ5A 3GY8A 2FIRH 2PLXA 3ESTA 2RG3A 3ZZ6A 5SGAE 3UNRA 2CHAC 1THPB 1DX5M 3FFGA 2OXSA 3FOAA 2SNVA 4BTTB 1ELGA 1SGYE 3MH7A 1BTUA 5EPNA 2PHBA 4A1VA 5FBEA 3QGNB 1SBWA 1PPGE 2R2MB 1O5DH 4BAOB 5JB9S 3MMGA 3MU0A 3V0XA 3NPSA 3A89A 1FIWA 1MZAA 2K1QA 1HLTH 1WYKA 2C8WB 2HNTF 4BAMB 4MLFB 5FPTA 1X7AC 1A5GH 1H8IH 1Z8JB 2F9NA 4DT4A 2G4TA 5E2PA 2NU3E 2VGCB 4B74A 1PFXC 3T62A 1SQRA 4ACBA 2ZHFH 3OTJE 3ENSB 1WQSA 3E3TA 1MZDA 4AX9H 4LZ4B 4I7YH 8GCHG 2VJ1A 1A5IA 2C4FH 3LT3A 2H9EH 2FZZA 3U69H 4K69A 2WPIS 1S0QA 3TIUA 1T8MA 2FTLE 1EQ9A 4Y6DA 3VXFH 1O2KA 1ZTKA 3O8BA 1YCPM 2ANYA 1LVYA 2G55A 3KIDU 1UTKA 3ZVFA 3UNSA 1NY22 2FTMA 2P94A 3E6PH 5GNDA 3ZVCA 1GJ6A 1AQ7A 1RGQA 1P2NA 3AASA 2BMGB 1AFQB 2HNTE 1MCTA 1UVPA 1ELVA 1AB9B 3RXIA 2WPLS 1CGJE 1K21H 4KTUA 4YOJA 3SJOA 1Y59T 1GMHF 3KNXA 1O5GH 1QRXA 1E79D 3KQCA 3P8GA 1TRYA 3M5OA 3VEQB 1QL7A 2R0LA 1TNKA 4BAKB 1GBHA 3S7HB 3MHWU 1ELEE 3GYMA 1KXBA 3SU0A 1O35A 1O5AB 3PMBB 1TPPA 5A0CA 2BQ6B 4CR5A 2GX4A 1RS0A 5FXLA 4RI0A 3LGIA 2ODQA 4O9VA 4ABIA 4XFQA 1SKYE 1OKXA 3PMAB 3F2GA 2PGQB 4U2WA 2AGGX 5JBAS 2CGAA 5E2OA 1CVWH 2XCFA 3OTPA 4IN2A 1HAZB 4CREA 3AVZA 2BX3A 1TNLA 3TITA 1W12U 4LZ1H 2V6NA 1S5SA 5ESBA 3RXKA 2FXRA 2HOBA 1WV7H 4FUIA 4KP0A 4Y76A 3TVJB 4K1EA 3TJOA 2FI3E 1UK2A 2QN5T 4U01A 1AWHB 3OU0A 3EAJA 1DDJA 2FM2A 1FV9A 1O2PA 1YLDA 1FY8E 3M5MA 1C1UH 2CJIA 4DVAU 3T2NA 1MBMA 2G8TA 3SI4H 1SGPE 3KCGH 3RMNH 1GJ7B 1GBBA 1TA6A 1TB6H 4X1NU 3SU1A 3SUEA 2OP9A 2ZDMA 1E1QD 1AKSB 1P9UA 1MH0A 1ZMLA 1V2PT 1XUGA 3RC4A 2BD9A 4PROA 4A6LA 1P3CA 4K5ZA 4OGYA 1C2GA 3EQ0H 4YT7H 1TNIA 1EKBB 3TNTA 3OFND 1O3GA 1C5SA 3ITIA 4ZMAH 1HUTH 2H2ZA 2P16A 5EJLA 1NPMA 1C9PA 3CNRA 1B0EA 2HPPH 3GY5A 2EEKA 1L4ZA 1TMBH 1YLNA 1VITH 1O36A 4LOYH 3OX7U 4YOGA 1UCYE 4O3TA 1SGCA 3ATLA 4X1QU 3V12A 2KAIB 1O3HA 2HWLB 1W0YH 2SGPE 2ZFSA 1PPZA 5G4BA 4TSFD 5FBIA 3RXGA 1MTSA 1GGDC 1TMTH 1YPEH 2ZHDA 2GT7A 3VXEH 2TGPZ 5TCCA 1C1WH 2IPHA 1A3BH 4HTCH 3S9CA 3DD2H 2QF3A 3MOCA 3I78A 1CA0C 1JBUH 2DE9A 1OWJA 1TAWA 1VGCC 5A2MH 3MQKC 1KLJH 4FU7A 1UVOA 1HIAA 2J9NA 1GJAB 1GBAA 1T4UH 1BRCE 3MO9A 1F5RA 1ZOMA 2BQWB 1EP5A 3BSQA 2QF0A 1TNGA 3HPTB 4NFEA 4X6MA 4FU9A 1DFPA 3E91A 4NCYA 1YM0A 2A31A 1TGNA 1LVBA 3NXPA 1C4U2 1YF4A 4D9QA 5DG6A 1Q2WA 1NM6A 2C8YB 3VFEA 2A5KA 2VB0A 1RTKA 1F0TA 2OTVA 5TJXA 5EQSA 2P8OC 3PMJA 3EYDA 4XDEA 1C5UA 1LCYA 2HNTC 1XUJA 2QA9E 1FMGA 3UR6A 2C3SA 3LGTA 4DOQA 5I25A 2EQNA 1NO9H 1D6RA 4GSOA 2WV4A 4X8TH 1HBTH 1O2SA 1HAVB 3BEIB 1ACBE 1TRNA 1ARBA 2WPHS 4Y0ZE 1BTXA 1ANCA 2PKSB 4GHTA 4JYUH 3PB1E 1O2RA 2BHGA 1COWD 3VGCC 1IQHA 1TX6A 4B2AA 5J4SA 3HKIB 3W95A 2IJD1 2VVUA 5C1YA 5L2YH 1E1RD 5EXMA 1WCZA 1GJ8B 3P92A 1C5TA 4NIXA 1XKBC 1AO5A 5E0JA 4HGCA 4KKDA 4UFDH 4Y0YE 5T1VA 1O2YA 1GG6B 2BLVA 1B0FA 4FVBA 1H4WA 1K9OE 4Y10E 2BY5X 1SL3A 2C93B 2H1UA 3Q77A 1UK3A 4OS1A 2PW8H 4AFUA 1C2JA 2Z94A 1HYLA 3HK3B 2K8IA 2HLDD 3M5NA 3OSYA 5DK1A 1F5KU 1AHTH 1C9TA 2Q6DA 3MNSA 1UTOA 1H8DH 3KHVA 1CT2E 1GHZA 5EPYA 4YLQH 2FOFA 2PKAA 1BTYA 1LHGH 2XCNA 5I46H 3HGPA 1FIZA 2O9QA 2ZGCA 1YC0A 3BTWE 1K1JA 1RIWB 2TRMA 3F68H 2RDLA 2XWAA 2ZFFH 5F6MA 4B2CA 3HKJB 3ZVBA 2BD5A 5GIBA 4ZKSU 2FS9A 1EPTB 2AFQB 2ZFTA 3S69A 1OYTH 1GVZA 3BTEE 3A87A 3L33A 4RKOB 2OQUA 4E7NA 4JZFH 4TWYA 5DJ7A 1QCPA 4ZKOU 1SFQB 2THFB 3OYPA 8ESTE 1SFIA 2J2UA 3F9FA 3ZIAD 3VB7A 5IK2D 1V2MT 1WBGB 1WTHD 5A8ZA 4OS5A 2WPKS 1LMWB 2BVSH 1LKBA 5LPRA 1SVPA 3SGBE 4CR9A 1BQYA 2A4QA 1P57B 2Y7ZA 4TY6A 5CHAB 4JZDH 1QB1A 3B23B 3ZZDA 1LPGB 4J2YB 2EI7A 1ETRH 1XKAC 1G2LA 3BTTE 1O33A 2ZTYA 3ATIA 1UK4A 2BD7A 1AZZA 1DANH 2OD3B 1THRH 1LTOA 1HAHH 1CE5A 1K22H 4HG6A 1BHXF 2J92A 1GI0A 1O2TA 3NZIA 2B7DH 1H8ED 2YMSC 5A8YA 7KMEH 1AE8H 1KXAA 1IQIA 1G3EA 1GBMA 4B6EA 1RTLA 1J15A 1Y3WA 1YLCA 1SSXA 4AB9A 1SOTA 3MU8A 3ZZ4A 5DN6D 5E8EH 1GBTA 1C1SA 4F55A 1NN6A 2ZQ1A 3PMHB 4ABAA 2VH6A 2F9UA 4YZUA 1SGIB 2PGBB 1QJ6B 4OGXA 2VIWA 3P95A 2VIPA 1Y3YA 2ZC9H 2P8OB 3Q3KA 3P8OA 3EE7A 2F4LA 4XD7D 2CV3A 3A8AA 3LPRA 1VJ9U 2Z6BD 1ZJDA 1GJDB 1KXEA 1L1NA 2H9HA 1O32A 1NRRH 1O2HA 2BDGA 1ZSKA 1DSUA 4UFEH 1OP8A 2OBQA 3M36A 4CRCA 5F53A 2ZDVH 5L2ZH 2FESH 2LP6A 2XXLA 3WWFA 3D62A 1BBRH 1GVLA 4GAWA 2O8WA 2EI8A 2WUCA 4Y71A 1O3PB 2GCTC 4AFQA 2J95A 2STAE 5CDFE 3SJIA 4ACAA 1ZSLA 2JETC 4UEHH 4CRDA 5FPYA 3F2FA 1HAOH 1EPTA 3FP8E 3VGCB 3A8DA 1UTMA 1TGCA 4I8HA 2BDYA 1D3QB 1FN6A 2ESTE 2VIVA 3A80A 1IQKA 1JRTA 4Y8YA 3A7XA 4FUEA 3ZZ8A 4CHAB 5L6NH 2TGAA 3QWCH 1NFYA 3SV8A 1BMNH 3DFJA 1C2MA 4GHQA 4WXVA 4AOQA 4CRGA 1NTPA 4A1TA 1YPJH 2Z9KA 2G4UA 2PTCE 1HAXB 3CP7A 2O8LA 1NRSH 1HJ9A 4X1SU 1VJAU 4B6FA 3KF2A 1GWAA 2FP7B 3LDXH 3F0PA 1PJPA 3RU4E 2QXIA 3LC5A 3LIWA 3KL6A 1UO6A 1AUJA 2P93A 2TBSA 3W94A 3H5CB 1BDAA 1QHRB 4NA7A 4NG9H 1BZXE 3SO3A 2QY0B 4H6SB 3HGNA 3M37A 3TH2H 2YMSD 2WINI 4X2VA 1VR1H 1O0DH 3ODDA 2BD8A 3PROA 1W7GH 1SGTA 1XUKA 1Z6EA 3MH6A 1C2HA 5C0UA 2AMDA 3SU2A 4LK4A 4K3JA 1K1OA 2NU1E 2RDEA 1XXDA 1XUHA 3SNDA 2Y5HA 1WOFA 2XOKD 4X1RU 2F9OA 5AVDA 2OUAA 3GDSA 4JZ1A 4ISLA 5HIZA 4UONA 4ZCNA 1J17T 1TQ7B 1EX3A 1C5VA 4NWKA 1KY9A 3DUXH 3W1EA 1C5PA 1HAGE 5EJ1A 2IOTA 3AW0A 1TBRH 4BTUB 1P8VC 1HNEE 4D76A 4AFZA 1JOUB 1SQOA 4GLYA 2ASUB 3RC5A 1TOMH 4MVNA 2XBYA 4CBNA 4Z6AH 4YLUA 3SJ9A 1GL1A 2EC9H 2A4GA 5A0AE 1C2IA 4JZEH 4ZROA 4H4FA 3MO6A 1NFUA 1A3EH 2WYJA 1D4PB 2ALPA 3JZ2B 2XNIA 1TOCB 2ZEBA 3RM0H 5HM9A 1K1PA 1TNJA 4ZH8A 1LDTT 4CBOA 2W3KA 3RXOA 2I6QA 1Y5BT 1ZLRA 2BXUH 1MQ6A 3K6ZA 1ABJH 3M7QA 1O2LA 3DSOA 5E0GA 2ODPA 1BMFD 1IQNA 1C1VH 4X6NA 5EW1H 2P3FH 5DKMA 3TGIE 1F7ZA 1A0HB 2Q6FA 4Q2KA 5KGOA 2G5NA 1OPHB 4ASHA 5FCRA 4B1TA 2HALA 1V2UT 1O3DA 4MNYA 4I8JA 2UWOA 1SQTA 1DUAA 2FWWA 5EJZA 1YY3A 1ELBA 1MD7A 1C1NA 1CBWC 2JJ2D 1TPAE 3F9EA 1MTUA 1IHSH 3RP2A 1O5CB 3TH4H 1RTFB 2J98B 1PPCE 1KTSB 1SB1H 1Y3VA 2FLBH 5EQRA 1SGFG 5EODA 4CH2B 1BRUP 3M3VA 5C5NA 5FX5A 2P3TB 1GMDG 1ZJKA 1FLEE 3P8FA 5FHTA 2GCTB 1BRBE 2ZFPH 3TJUA 2LNCA 2VWMA 3F2HA 1J14A 1ELFA 3EDXB 1E37B 1UVUH 1GBIA 3RXVA 1OWEA 1WQVH 1O31A 2A5AA 2GV7A 4CRFA 1G32B 4MNVA 2OINA 2XBWA 1FAXA 1GDNA 1O2XA 1T32A 1ID5H 1V2JT 3GISB 2DUCA 3Q00A 3A7VA 4BAHB 3A85A 3MTYA 4AFSA 1NRQH 4NSVA 1GJCB 1GMDF 4BANB 1O34A 3RXAA 3F9GA 5C3NA 3G01A 2VVCA 1KDQB 2FLRH 3S7KB 1TALA 3SV9A 2ZCHP 4FUCA 4TYDA 1AD8H 1GCTC 4XBDA 1F92A 3F3BA 3FKSD 2D1JA 2OK5A 1MU6B 1HRTH 3SUFA 4DW2U 1EP6A 3K6YA 5ETXA 1KSNA 1YPGH 3ATWA 4GVUA 1BBRK 2HVXA 4DIIH 3DSPA 2BX4A 2Y7XA 2VNTA 2UUJB 8GCHF 5FCKA 1LO6A 1WAYB 1P2OA 2FOGA 3RMMH 3RUOA 3SNBA 3STIA 1EJNA 1ESAA 1TQ0B 1FY4A 1H8HD 2V35A 1T31A 4B2BA 4DY7B 1GBDA 5DP3A 2L74A 1GI6A 2XWBI 1YPHE 2PUXB 1HAYB 3WY8A 3BG8A 3GCNA 1H9HE 3ATKA 3GCTG 1ORFA 2KCPA 3KQ5A 2H9TH 3BTDE 4UFFH 1TIOA 2Z9LA 1IOEA 2A0QB 3I77A 5EOKA 1EB1H 3UWJH 2GDDA 1T7CA 3DFLA 1BT7A 3RXQA 3BTHE 1NU9A 1Y8TA 1Z8RA 4Q7YA 2VWOA 4X0WU 5GXPA 1C1OA 3DHKH 1P2IA 2Z7FE 4MTBA 1ZGVA 3QZRA 2R3YA 3GCTF 2SGQE 1P06A 2KCAA 1LQDB 1OSSA 2FOEA 2B0FA 1JMOH 4UFGH 3ZVAA 4FETA 2ZGHA 3SV6A 1A1RA 1HB0B 1GI1A 2QV1A 3M3TA 2ZTXA 2Q1JA 1QL8A 1TBZH 3RXRA 1TRMA 4UE7H 3VB3A 1BIOA 1W3CA 3P70B 1MMJN 3RXJA 3SV7A 4Y79A 4ISNA 1AFEH 1TFXA 4RT0A 4TPYA 2EI6A 4DIHH 1O2JA 2VINA 2OBOA 1QB6A 3RLYH 1BCUH 5LGOA 1K1NA 1UTPA 3JZ1B 1C5YB 1QBOA 2FMJA 2ZCKP 3LH1A 3UREA 1O2IA 1SR5C 1ELAA 2XYAA 3ATMA 2ZTZA 2FEQH 1W2KH 2BDBA 2P3UB 1QR3E 1V2TT 2BY6X 3A82A 1SGDE 1PPHE 2QXJA 2WYGA 1NC6A 3PLKA 1OOKB 2K0QA 2FODA 1O3KA 3ZZBA 5HMAA 5K7RA 1QBNA 1AY6H 4VGCC 4CRBA 3Q76A 1K1LA 3SBKA 1S6FA 4HI3A 3T25A 2SNWA 3GS9A 1O3FA 2CHAB 4FU8A 1PPBH 1FX0B 5FL7D 1CA8B 2ZGXH 3BTQE 5JBTA 3SI3H 1O3LA 5C5OA 4WMFA 1T4VH 1EAWA 1KMHB 4ZHLU 3RU4D 2ZCLP 3P8NA 1LVOA 2ANMH 7ESTE 1N8OC 2AS9A 2BTCE 3AAUA 3N99A 4MQAA 5T6DA 4FUJA 1ZYOA 4MNWA 1GHVH 1Z7KA 1XM1A 3AAVA 1K28D 5C20A 1WXRA 5C94A 5LPEA 5IDKA 1TBQH 2P59A 2VWLA 2JIZD 2R3UA 3SU5A 3E16B 1TWXB 4YXWD 1ZZZA 1DS2E 2PTNA 1A5HA 3A7YA 2W7SA 1SMFE 1IQEA 3UNQA 2F43B 1TABE 2BD2A 4ZUHA 1EAUA 3C27B 2ANKH 2QC2A 2BYAX 4JK5A 2GCHG 1O3IA 3P6ZB 1YP9A 2WV5A 5K0HA 3DT0H 1GCTB 3RMOH 3SU6A 3WWBA 3QTVH 3MU1A 1MKWK 1PYTC 2ZHWH 2NU2E 1UTJA 1S0RA 2Y5FA 5DO4H 1FY3A 4O97A 3GY6A 2AH4X 2AMPA 1FPCH 2GP9B 3L3TA 3LGWA 4MG3A 1FZZA 4Y11E 1V6DA 3RXUA 1H9IE 1IQLA 2RA0A 3T28A 1WUNH 2UWLA 4MPXA 2GCHF 3BTME 1YPHC 1GHAG 2FI4E 4AYVB 1DY8A 1C2LA 8LPRA 2ZU5A 3HATH 1SGEE 3M7UA 1V2ST 4U30A 5DP7A 1BITA 5T6FA 3SORA 4THNH 1P0SH 3OE7D 4Y8XA 1UCYH 1AKSA 2IJOB 4D8NA 7LPRA 5TCAA 5CHBA 1O3AA 3ZZ7A 2A5IA 3M3SA 3O8CA 1B5GH 1IQFA 2JKHA 2PP6A 1N1LA 2WHXA 2J34A 3OY6U 2A32A 4WXIA 3UOPA 4NZQA 1D3TB 1O3JA 1C5XB 2QCYA 3SW2B 2TPIZ 1ANBA 3N7DA 3SZNA 3RU4T 3D65E 1QA0A 5F8TA 2VWNA 3SZEA 5DP4A 2ZU3A 2WUBA 1AU8A 4ZXYH 1P9SA 4XBBA 1QL9A 3CS7A 1DITH 2V7QD 3SN8A 4TWWA 1OS8A 5A09A 3GCHC 2TGDA 1E35B 5HKKD 4XBCA 1XMNB 1C1PA 2KAIA 3SJ8A 2VU8E 1FJSA 1ZRKA 3WW7A 4F4OC 2QAAA 3U8OH 4WMDA 5ESTE 1G9IE 1GI9B 1BJVA 2CK3D 2GZ9A 4MPUA 4AZ2B 4CRAA 3BIVH 3RDZA 1UMAH 1ZPBA 1MD8A 1SHYA 1O3BA 3RXPA 3TU7H 1GHYH 1S83A 3TK6A 1IQGA 5C1XA 2SGDE 2IPQX 3H09A 3I29A 1JIMA 1ARCA 3GY2A 1EASA 4MNXA 5JDUB 1SC8U 1SPJA 5FPSA 3KQEA 4IW4E 3PO1C 3LH3A 5HM2A 2A2QH 3M7TA 5EQQA 2V3HH 1C4Y2 2VIQA 3F1SB 3UUZA 3RC6A 2PSXA 1ZMJA 1GJ9B 4YOIA 2ZU4A 4GUXA 4AC9A 1LVMA 1UTNA 3UOUA 4AB8A 4MDSA 3T27A 3BG4C 2H6MA 3U8TH 3FAOA 1PYTD 1F5LA 3VB4A 4R0IA 3MWIU 3SGAE 4WF8A 6ESTA 1GGDB 3SNCA 1UHBB 4K60A 1S81A 2ZIQH 3H7TA 1QFKH 4D7GA 5DP5A 5F8ZA 1CA0B 1P12E 2STBE 1VGCB 1V2KT 1HAVA 1DOJA 1V2QT 3PTNA 1DPOA 1O3CA 1WDIA 3SQHE 3LJOA 2J94A 3UIRA 4FUDA 2ZNKH 4FXGH 1MKXH 1PQ8A 2KR7A 1INCA 5EGMA 1QNJA 1VCPA 3SU3A 4Z1MD 1E34B 1A61H 3GY7A 1Y5UT 1GCDA 4P00A 3A81A 3E8LA 4Z0KA 1CU1A 3UPEA 4D7FA 1DVAH 1ZPZA 3PV5A 1H1BA 1PPEE 4Q4LA 4ISIH 4I31A 3VB5A 2BVXH 3ZZ5A 2V3OH 4BXWA 3UTUH 9LPRA 2ZO3H 4FVDA 1GBCA 3TGJE 2FO9A 1O5FH 1HDTH 1OWKA 1O39A 1NESE 2ZPQA 2Y5GA 2BM2A 2FYQA 1EAXA 1XVMA 3A88A 2ZHQH 2FOBA 4I8KA 2A7CA 3A8CA 2GKVE 2QF4A 3GCOA 4XE4A 4SGBE 1ZHPA 2ZA5A 3LOXA 4ZXXH 2BXTH 2FOAA 1BMMH 3K65B 1C2KA 5F8XA 1GHWH 1DWEH 2R9PA 3FP7E 2SFAA 1TE0A 4FUBA 1RJXB 1MBQA 5DGJA 1EATA 5DP8A 3KQBA 4DJZB 2KFWA 2BD3A 1DY9A 3EA8A 3LU9B 1P01A 3OEHD 2EA3A 1HXFH 1QB9A 3U28C 2SGEE 1A0LA 2QF5A 1A0JA 1ZHMA 1TMUH 2TGTA 1W0ZU 4ISHH 4F49A 3V7TA 1G3CA 1F0RA 3AK5A 1P04A 1KYNA 4XRNA 1TYNA 1S84A 1C1QA 1O2WA 1UTQA 1C1RA 1GI2A 1P09A 2NWNA 4NIWA 2HGTH 3MO3A 1KLIH 1FY1A 3LGUA 2M5TA 4AYYB 4B71A 3D23A 2QE7D 1PQ7A 2R0KA 3Q3XA 2PR3A 3VPKA 2W5EA 2GMTC 3AW1A 4D9RA 1AWFH 4GPGA 2CMYA 4AG1A 2RFKC 3BIUH 1GPZA 1KTTB 1UCYK 1O2OA 5GPIB 2ZF0H 3GY4A 3A7WA 1MTNC 4NIYA 2A2XH 3T26A 1QRZA 5EG4A 4FUGA 1A46H 1O5BB 1DLEA 1SI5H 4INHA 3BTFE 3PO1B 4XOJA 2AEIH 3ZYDA 1F0UA 5EU8A 1YPKH 2AIQA 4OS6A 1GMCG 3MYWA 5FX6A 1KXDA 4AGKA 2C8XB 5B6LA 1O2UA 2FDAA 4FUHA 1UVTH 1W7XH 3H7OA 1TONA 1FY5A 3QTOH 1NFXA 3VB6A 1RFNA 4NA9H 4XSKU 2Z3DA 2C8ZB 1A4WH 1NBME 1C2FA 4ABJA 2VVVA 5EIYA 1YGCH 1GJBB 1ESBA 1SOZA 2FX4A 2TIOA 3BF6H 3R0FA 2AGEX 5KEDA 1EJAA 1NS3A 4K1SA 2A4OA 4IMQA 4Q63A 1GMCF 4X6PA 2HVYB 4J1YA 1D3DB 1O2MA 1JXPA 2YMSB 1C2EA 1MTWA 4JYVH 1NRPH 1W0KD 4BNRA 1CHOG 3DCLA 4Y7BA 2W6ID 4ABFA 1QURH 4YT6H 1CGIE 1SHHB 2BZ6H 1SLWB 2Z9JA 5C2ZA 3UQVA 2FOHA 4F48B 4X1PU 2OC8A 2OQ5A 4JCNA 1G36A 1TA2A 4DGJA 3MH5A 4X6OA 4E06H 4WWYA 1G3DA 1DWCH 2BOHB 3UFAA 2BLOA 1BTHH 2G5VA 5AFZH 2GZ7A 5JPMH
chains in the Genus database with same CATH topology
3QN7A 1TX7A 1VZQH 3E1XB 1DWBH 1TNHA 2ZP0H 1RRKA 2SGFE 4YTAA 3MFJA 1SGNE 2CF9H 1AVXA 3TK5A 2B5TB 3LJJA 4IMZA 3SV2H 3O8DA 4BTIB 1T8OA 2BY7X 2VH0A 4IN1A 4DT7B 2WPMS 2BOKA 1GDUA 4ESTE 3Q3YA 2YNBA 3S9AA 2ZDNA 4DCDA 4DURA 1AVGH 1OWDA 3GY3A 1G37A 4TY7A 1MKWH 3K9XB 2LPRA 1OXGA 1L0ZA 1Q31A 1HXEH 2Y81A 3TK9A 5L30H 1CHGA 5H4IB 2PFEA 1AIXH 3LGVA 1FNIA 1O2QA 1P02A 1MKXK 2JETB 1BMLA 2UUFB 5AHGH 3ZV9A 2B8OH 3DA9B 5BRRE 2XC4A 4BAQB 2PV9B 1MAXA 1VITG 2ZKSA 2QGRA 2ZGJA 1NROH 1TPSA 1ANDA 3SUGA 4Y8ZA 4Q7XA 8KME2 3ZZ9A 2Z3CA 4OS2A 1C5QA 3ZYEA 5LPFA 2JH6D 2F9BH 3LKWA 4M7GA 2ZPSA 3NCLA 3QLPH 3L6PA 1XX9A 4X2YA 3ZZAA 2GMTB 3UWIA 1VITF 1EZSC 4UD9H 1N6YA 2GV6A 3MU4A 3SU4A 2AERH 3RXMA 4O3UA 1O2NA 1YKTA 4YM9A 1XVOA 1GMHG 3MNBA 2YNAA 1H9LB 1MTNB 2BLWA 3BTGE 3K2UA 4CH8B 1D9IA 3RXLA 1OWIA 3NUMA 1OWHA 3ZV8A 1LHDH 4WY3A 5JBCS 4SGAE 3QUMP 1FUJA 1JIRA 2GT8A 2GZ8A 1LPKB 2F83A 5GJ4B 1UJ1A 1BTWA 3A8BA 1O2VA 1AMHA 4JZIA 3SJKA 2C90B 3LC3A 3KN2A 1ZRBA 1GBKA 1L1JA 1QA7A 2Z9IA 5GDSH 1V3XA 3U98H 2ODYB 3CENA 1C5MD 1FPHH 5EXLA 2OLGA 1OP0A 3ZVDA 5DP9A 1HIAB 3U1JB 1EXFA 2PKSC 5CE1A 2PUQH 4ZKRU 2ZZUH 4B76A 1SGRE 3S0NA 5B6OA 1NU7B 4ABDA 1P2KA 1BB0B 3MNCA 1ZMNA 1LQEA 1KLTA 1EAIA 1GHXH 1KXCA 3M35A 4Q7ZA 1EJMA 3KQDA 1GG6C 1HPGA 4I33A 2XW9A 2HRVA 3URCA 1DM4B 3D49H 4IBLH 3ZZCA 1J16A 1OYQA 1PPFE 1ELDE 4YESB 1ZTLA 1HAPH 2ZWLH 3EGKH 1AN1E 1GHBG 1C5ZB 3SUDA 4E05H 4ABGA 1BUIA 2W3IA 1O38A 4RSPA 4AG2A 2QXHA 1GJ4H 2W7UA 1K1MA 1TGTA 1KDQA 2ZDKA 1RIWC 3URDA 5A0BA 1G30B 1V2LT 1SLUB 3V3MA 1WTGH 1GL0E 3PWBA 4IS5A 1CBWB 5DPAA 1YBWA 2VIDA 5JYIA 1BHXB 1EPTC 2F3CE 3N7OA 1HGTH 1A2CH 4MPWA 1W13U 1IQJA 2Y6TA 1GHBF 2V0BA 1ETSH 1W14U 2J38A 3TH3H 2BY9X 3TJVA 5IYTA 3A84A 3GICB 3QO6A 4X8VH 1CQQA 1QTFA 2ILNA 6GCHG 1TX8A 4AN7A 1QBVH 4WH8A 1CGHA 2NU4E 1W10U 5CHAC 1OX1A 3PYHA 3TPIZ 4U32A 4X8UH 4DG4A 5C1UA 1YPMH 1Z1IA 3NK8A 1BMAA 1ANEA 2ULLA 2UUKB 1L4DA 2BDHA 2FS8A 1K1IA 3E0PB 2F9PA 4IGDA 2A45B 2PKAB 2XRCA 1O3EA 4AGJA 3TNSA 2ZPRA 1MCVA 1C5OH 6GCHF 5ABWA 4AORA 1YYY1 1QY6A 1FAKH 1P05A 5PTPA 3UY9A 1NFWA 1EB2A 1FI8A 1FXYA 4WH6A 3OY5U 1O3NA 1O5EH 3SHCH 1T8NA 2VIOA 3BEUA 3U1IB 5HXFA 1GBFA 2FOMB 1P11E 1C5NH 1V2NT 2CXVA 4KTSA 1L2EA 4RKJB 1P10A 3PWCA 1AUTC 4TPIZ 9ESTA 1QIXB 2XTTB 2AIPA 1V2RT 1SG8B 2SGAA 1EUFA 1K2I1 3MI4A 1GI7B 4E7RG 1BA8B 1CSOE 4X2WA 3RXDA 3EA9A 1F0SA 1YCPH 1Z6JH 2ALVA 1GBLA 4X2XA 1CO7E 2QYIA 1C1TA 1GDQA 2UWPA 1GI3A 4NWLA 1E0FD 1KIGH 3MU5A 1QQ4A 1PQAA 1IHTH 4ZHMU 1TLDA 1LKAA 3BTKE 2GDEH 3T29A 1BOQA 3GYLB 3BV9B 3RXBA 5T6GA 1ZPCA 2D2DA 3M5LA 1GHAF 5LH8A 2R2WU 5E0HA 2A4RA 3FANA 1GI8B 4B75A 1ZGIA 3FVFB 1V2VT 3MNXA 4NSYA 3MH4A 1DXPA 4I8LA 1GBJA 1P2QA 1SLVB 2BZAA 1TGSZ 3EA7A 4MPVA 4ISOA 1Z1JA 1HAIH 4KELA 4CHAC 3ODFA 2P95A 3PTBA 3FP6E 1YPLH 1V2OT 3ZVGA 1O2ZA 7GCHG 1ETTH 1D6WA 5T3HA 4RN6A 1O37A 1DICA 3F6UH 4QT8C 1V2WT 3U8RH 3KGPA 2ZFQH 3A86A 3E0NB 2OC1A 4JK6A 1MQ5A 2BDIA 2ZQ2A 2XBVA 1QJ1B 3IITA 4INLA 4K8YA 1WU1A 4VGCB 2BQ7B 1C5LH 1D3PB 2XC5A 1P3EA 5EW2H 4FUFA 1JWTA 2QXGA 7GCHF 2FI5E 1NT1A 1FN8A 3UQOA 1DXWA 2J4IA 1T8LA 1P2JA 2G81E 1QQUA 3SGQE 2FYRA 3GOVB 1ABIH 4A92A 2XC0A 4KGAA 1N8OB 2Z9GA 1BBRE 3SQEE 2CF8H 1DSTA 1HJ8A 1HFDA 5C67A 3KEEA 5AF9H 1O3MA 2F91A 5GCHG 1BTPA 1FQ3A 1ZTJA 4ZHAA 5DP6A 1Z8GA 5HYOA 3EE0B 4ZAEA 1FDPA 4BOHA 3NWUA 1BJUA 2A7JA 4JMYA 5JB8S 1EZUC 2CN0H 1J8AA 2XBXA 2ZI2H 3ZVEA 4R8TB 4INKA 1Y3UA 4X8SH 1QRWA 4K1TA 2DE8A 2GVFA 2UUYA 3QX5H 1S85A 2BY8X 4IC6A 2I6SA 5GCHF 2O8TA 4NGAH 3TJNA 1C1MA 1RD3B 1VCWA 2ZU1A 1HJAC 4I32A 1NRNH 2HLCA 1HCGA 1JRSA 5EXNA 3FZDA 1W8BH 4H6TA 1WSSH 2AYWA 3RMLH 2JH0D 3RXCA 5BPEA 2W26A 1VCQA 1J9CH 1UVSH 3RXTA 5JBBS 4OS7A 3PLPA 4K2YA 6CHAC 1GI4A 2G00A 2OC7A 1O30A 2OC0A 3LGYA 2Y82A 4ABEA 2H5CA 1P03A 2Z3EA 4A5TS 2ZECA 4IC5A 1W11U 2BDCA 1AZ8A 3PLBA 2Y80A 1IAUA 1DE7H 3IG6B 1B7XB 3P17H 3GDUA 2BLQA 3SOSA 1ZHRA 1MTVA 3STJA 2RCEA 3BN9A 1S6HA 1GI5A 3E90B 2ZU2A 3SNEA 1ZSJA 3ZZ3A 1DLKB 2YOLA 3TLOA 2FOCA 1TGBA 4NA8A 3SHAH 1P2MA 2PSYA 4O03A 5CMXH 2GD4B 1LHCH 4HFPB 3GCHB 2NU0E 1ELTA 2VGCC 3A7TA 4LXBH 1EOJA 2ZHEH 1GBEA 2O8UA 2D26C 1GJ5H 5J4QA 1DUEA 1YCPK 3B8JA 1MU8B 1BRAA 3BEFB 3C1KA 2RA3A 2BD4A 4HZHA 1Y3XA 1F2SE 1UHBA 1C2DA 3RXSA 1ELCA 2A1DB 3M61U 1THSH 3RLWH 3PV4A 1IQMA 4WVPE 3IWMA 3RXHA 2ZFRH 3U9AH 1BTZA 3LONA 1GVKB 1KXFA 3HK6B 4K8BA 2AMQA 2G52A 1O3OA 1E38B 4Y7AA 3QZQA 2H5DA 2Q6GA 1Z8IB 1AFQC 1O2GH 3R3GB 4ABBA 3QK1A 1AB9C 1U6QA 2ZG0H 1OP2A 2AGIX 1AI8H 1S82A 5F03A 1Z71A 2ANWA 3RXFA 1ZR0A 2B9LA 4NIVA 2FPZA 3BG4B 1MUEB 4Q80A 4I8GA 1TPOA 2ZGBH 4GCHG 1DWDH 3TGKE 1E36B 4UDWH 3RM2H 4A1XA 1N6XA 1XXFA 2WPJS 2G51A 4OS4A 1Q3XA 4NFFA 3A83A 3A7ZA 4WJG2 3V13A 1LHEH 1C5WB 2F9VA 3UR9A 2D8WA 5A8XA 1NZQH 1SGFA 3GDVA 2PWXA 1LPZB 1EZQA 1G3BA 2BB4A 2ZDAH 4ZKNU 3QGJA 4GCHF 2O8MA 3PM3A 1MAYA 5AFYH 2GTBA 1EOLA 1AGJA 2HPQH 2BDAA 3QDZB 2ZDLA 3NKKA 1QGFA 1XUIA 5FAHA 5HGGA 1HV7A 2OCVB 1DT2A 1C4V2 1EZXC 3FZZA 1A7SA 4YO9A 4JYTA 1SGQE 1AE5A 1L1GA 3B9FH 1HJAB 1CHOF 3T5FH 1CT0E 2FX6A 4BXSA 1FONA 3F9HA 3CS0A 1SLXB 3SNAA 1AVWA 1C5RA 2JH5D 4ABHA 1UTLM 1LHFH 4NZLA 4KTCA 1SQAA 6LPRA 3ELAH 3O8RA 3RXEA 1ESTA 1G2MA 1QJ7B 2IN2A 1RXPA 4H42U 4A7IB 5GWZA 1XUFA 3S9BA 2BVRH 1M9UA 2A7HA 4WMEA 1CT4E 1Y5AT 6CHAB 2GGVB 2QIQA 4B73A 1PQ5A 3GY8A 2FIRH 2PLXA 3ESTA 2RG3A 3ZZ6A 5SGAE 3UNRA 2CHAC 1THPB 1DX5M 3FFGA 2OXSA 2SNVA 4BTTB 1ELGA 1SGYE 3MH7A 1BTUA 5EPNA 2PHBA 4A1VA 5FBEA 3QGNB 1SBWA 1PPGE 2R2MB 1O5DH 4BAOB 5JB9S 3MMGA 3MU0A 3V0XA 3NPSA 3A89A 1FIWA 1MZAA 2K1QA 1HLTH 1WYKA 2C8WB 2HNTF 4BAMB 4MLFB 5FPTA 1X7AC 1A5GH 1H8IH 1Z8JB 2F9NA 2G4TA 5E2PA 2NU3E 2VGCB 4B74A 1PFXC 3T62A 2ZHFH 3OTJE 3ENSB 1WQSA 3E3TA 1MZDA 4AX9H 4LZ4B 4I7YH 8GCHG 2VJ1A 1A5IA 2C4FH 3LT3A 2H9EH 2FZZA 3U69H 4K69A 2WPIS 1S0QA 3TIUA 1T8MA 2FTLE 1EQ9A 4Y6DA 3VXFH 1O2KA 1ZTKA 3O8BA 1YCPM 2ANYA 1LVYA 2G55A 3KIDU 1UTKA 3ZVFA 3UNSA 1NY22 2FTMA 2P94A 3E6PH 3ZVCA 1GJ6A 1AQ7A 1RGQA 1P2NA 3AASA 2BMGB 1AFQB 2HNTE 1MCTA 1UVPA 1ELVA 1AB9B 3RXIA 2WPLS 1CGJE 1K21H 4KTUA 4YOJA 3SJOA 1Y59T 1GMHF 3KNXA 1O5GH 1QRXA 3KQCA 3P8GA 1TRYA 3M5OA 3VEQB 1QL7A 2R0LA 1TNKA 4BAKB 1GBHA 3S7HB 3MHWU 1ELEE 3GYMA 1KXBA 3SU0A 1O35A 1O5AB 3PMBB 1TPPA 5A0CA 2BQ6B 4CR5A 2GX4A 1RS0A 5FXLA 3LGIA 2ODQA 4O9VA 4ABIA 4XFQA 1OKXA 3PMAB 2PGQB 4U2WA 2AGGX 5JBAS 2CGAA 5E2OA 1CVWH 2XCFA 4IN2A 1HAZB 4CREA 3AVZA 2BX3A 1TNLA 3TITA 1W12U 4LZ1H 2V6NA 1S5SA 5ESBA 3RXKA 2FXRA 2HOBA 1WV7H 4FUIA 4KP0A 4Y76A 3TVJB 4K1EA 3TJOA 2FI3E 1UK2A 2QN5T 4U01A 1AWHB 3OU0A 3EAJA 1DDJA 2FM2A 1FV9A 1O2PA 1YLDA 1FY8E 3M5MA 1C1UH 2CJIA 4DVAU 3T2NA 1MBMA 2G8TA 3SI4H 1SGPE 3KCGH 3RMNH 1GJ7B 1GBBA 1TA6A 1TB6H 4X1NU 3SU1A 3SUEA 2OP9A 2ZDMA 1AKSB 1P9UA 1MH0A 1ZMLA 1V2PT 1XUGA 3RC4A 2BD9A 4PROA 4A6LA 1P3CA 4K5ZA 4OGYA 1C2GA 3EQ0H 4YT7H 1TNIA 1EKBB 3TNTA 1O3GA 1C5SA 3ITIA 4ZMAH 1HUTH 2P16A 2H2ZA 1NPMA 1C9PA 1B0EA 2HPPH 3GY5A 2EEKA 1L4ZA 1TMBH 1VITH 1O36A 4LOYH 3OX7U 4YOGA 1UCYE 4O3TA 1SGCA 3ATLA 4X1QU 3V12A 2KAIB 1O3HA 2HWLB 1W0YH 2SGPE 2ZFSA 1PPZA 5G4BA 5FBIA 3RXGA 1MTSA 1GGDC 1TMTH 1YPEH 2ZHDA 2GT7A 3VXEH 2TGPZ 5TCCA 1C1WH 2IPHA 1A3BH 4HTCH 3S9CA 3DD2H 2QF3A 3MOCA 3I78A 1CA0C 1JBUH 2DE9A 1OWJA 1TAWA 1VGCC 5A2MH 1KLJH 4FU7A 1UVOA 1HIAA 2J9NA 1GJAB 1GBAA 1T4UH 1BRCE 3MO9A 1F5RA 1ZOMA 2BQWB 1EP5A 3BSQA 2QF0A 1TNGA 3HPTB 4NFEA 4X6MA 4FU9A 1DFPA 3E91A 4NCYA 1YM0A 2A31A 1TGNA 1LVBA 3NXPA 1C4U2 1YF4A 4D9QA 5DG6A 1Q2WA 1NM6A 2C8YB 3VFEA 2A5KA 2VB0A 1RTKA 1F0TA 2OTVA 5TJXA 5EQSA 2P8OC 3PMJA 3EYDA 4XDEA 1C5UA 1LCYA 2HNTC 1XUJA 2QA9E 1FMGA 3UR6A 2C3SA 3LGTA 4DOQA 5I25A 1NO9H 1D6RA 4GSOA 2WV4A 4X8TH 1HBTH 1O2SA 1HAVB 3BEIB 1ACBE 1TRNA 1ARBA 2WPHS 4Y0ZE 1BTXA 1ANCA 2PKSB 4GHTA 4JYUH 3PB1E 1O2RA 2BHGA 3VGCC 1IQHA 1TX6A 4B2AA 5J4SA 3HKIB 3W95A 2VVUA 5C1YA 5L2YH 5EXMA 1WCZA 1GJ8B 3P92A 1C5TA 4NIXA 1XKBC 1AO5A 5E0JA 4HGCA 4KKDA 4UFDH 4Y0YE 1O2YA 1GG6B 2BLVA 1B0FA 4FVBA 1H4WA 1K9OE 4Y10E 2BY5X 1SL3A 2C93B 2H1UA 3Q77A 1UK3A 4OS1A 2PW8H 4AFUA 1C2JA 2Z94A 1HYLA 3HK3B 3OSYA 3M5NA 5DK1A 1F5KU 1AHTH