1K1OA

Bovine trypsin-inhibitor complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Factorising ligand affinity: a combined thermodynamic and crystallographic study of trypsin and thrombin inhibition.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords TRYPSIN
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k1oA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k1oA02
3S7HB 1EJNA 2W5EA 1NO9H 2OTVA 4B2AA 1LVOA 3QTVH 4OS6A 3A84A 1HNEE 2BD5A 4K1EA 1NFXA 1Z6EA 2HNTF 2Z94A 4KELA 5EQRA 5DKMA 1ZSKA 1TX6A 5DG6A 5BRRE 2P3FH 1MTVA 1GJBB 3F9HA 1OPHB 4AOQA 1AE8H 4TPYA 4Y11E 1C1OA 1ORFA 1C5WB 2R3YA 1FUJA 1JBUH 1KLJH 1P10A 3TPIZ 1FN8A 2Y5HA 4KTSA 1EJAA 1TMUH 1Z6JH 2FODA 2HRVA 3RMOH 4MNYA 1TYNA 4U2WA 3RLWH 2VIWA 2XXLA 2JETB 1FLEE 2A5IA 4K1SA 3VB5A 3MU1A 1P01A 1BTHH 1SGFG 2F9OA 5FX5A 1NTPA 3SJ8A 3N7OA 3LIWA 1P12E 2SFAA 1ETSH 1K9OE 1TX8A 1FN6A 1Z8GA 3UREA 1CT4E 3LGUA 1RGQA 1MCVA 1UK3A 2BD4A 3MNXA 1E38B 3QN7A 1Z1IA 2I6SA 1MKXH 1TNIA 2J38A 1GCTB 3L6PA 3Q77A 3RXPA 2Q6DA 1ZMJA 3MI4A 6CHAB 5FHTA 4BTUB 1UMAH 1C5PA 1AFEH 1A61H 1PQ5A 4WH6A 3RXGA 1EAXA 1ZHMA 1TQ7B 4LZ4B 1UVSH 1XVOA 5A09A 4CBOA 1T31A 4ZHAA 3RLYH 3RXKA 2A31A 3FP8E 1PPHE 1J8AA 1J17T 2FOBA 3SGAE 3M3VA 1H9IE 2Y6TA 4FUBA 4FVDA 3M37A 4ABFA 4GSOA 1GCDA 1HAGE 2UUFB 3A8BA 1UJ1A 1XMNB 3ATWA 1NY22 1GI2A 3D62A 1AUJA 1W0ZU 2H5DA 2BDYA 4UFFH 2A32A 3A87A 1RIWC 1XUJA 4Y8YA 1BDAA 2XYAA 4CREA 1O38A 1C5RA 1O34A 1T8OA 2CV3A 1WU1A 2NU1E 3M35A 1QNJA 4MG3A 1UO6A 2HPQH 3PO1B 4LXBH 1G3DA 1IQEA 3A7XA 3M3TA 4XBCA 2TIOA 1ARBA 1KSNA 3TNTA 4ZAEA 2ZDMA 2BY7X 4KTUA 2SGDE 5T6FA 1VZQH 4BANB 1AKSB 4IBLH 1E36B 3RXDA 1TE0A 3SU5A 2J9NA 1C1TA 1TA6A 3A8DA 1CVWH 1P04A 1PPCE 1SGFA 2ZFTA 5EW2H 3PMJA 5DJ7A 1O3BA 1Q31A 1RXPA 1V2UT 3U8RH 1QR3E 2BVSH 3P70B 1PPBH 1FMGA 2BQ7B 1QRXA 1T32A 1GDQA 1QTFA 3E6PH 3T2NA 1UTJA 2WINI 4UD9H 1O32A 1O2VA 3P8FA 8LPRA 3QDZB 1EATA 2Y80A 4E06H 1UCYH 3TGJE 1A1RA 2ZQ2A 1PPZA 2C8ZB 3KIDU 1VITF 3E90B 4D76A 2XBVA 1T8NA 2XW9A 2CN0H 4I8KA 4M7GA 1AWFH 5JBCS 1HGTH 3TJVA 3O8DA 1Y3WA 3RC5A 3RM0H 3TH3H 2ZHWH 2ZG0H 1IHTH 1V2VT 3M7TA 3UIRA 3KQCA 4X8SH 4A7IB 1C5OH 2QXGA 4B75A 2V0BA 2FOFA 3SV6A 1XUIA 3I78A 3A81A 3TVJB 5DP9A 1P2IA 1ANCA 5A0BA 3SN8A 4JZ1A 1GHYH 3RDZA 3CS0A 1QJ6B 2ZGXH 1O3NA 3U1IB 1TOCB 4JMYA 3LGTA 3RXEA 1CHGA 1DXPA 3GCNA 3PLBA 4CBNA 5HGGA 3GOVB 5FPYA 5JBAS 1ZLRA 1IQIA 1W0YH 3BG8A 1GBKA 4DGJA 2ZDVH 1KXAA 2ZP0H 5E8EH 1GJ8B 1F5LA 3ZZ9A 2XWAA 1A5GH 1OWKA 2ZDKA 1UTNA 4UFDH 4O3UA 2BX4A 1MTNB 1ZSLA 2ZFPH 2VWOA 2Z9KA 2ZPRA 2D8WA 1Z8RA 1P3EA 1JXPA 1SOZA 2R0KA 1UTMA 1FY1A 1F0UA 2ZU2A 4CHAC 1S82A 1Q3XA 5FCRA 1EAIA 4ABIA 1E34B 3A7TA 1HFDA 2VWNA 3PTBA 5BPEA 3V12A 5B6OA 6GCHF 1AFQB 1J14A 3ZZBA 2PW8H 1YPHE 1QA7A 1NU7B 1Z71A 2ZGHA 2J4IA 1B0EA 3PWCA 1XUFA 1JOUB 3TK6A 3ZZDA 5GPIB 2Z9JA 2WPKS 2AIQA 1V2ST 3GY7A 1YLCA 2UWOA 5E0HA 1LKAA 1PPEE 1NRNH 2ZFRH 4WXVA 1SSXA 2WPHS 3PWBA 1ESBA 1O5EH 4X2WA 3TGKE 2BMGB 1D4PB 1MU8B 3RC6A 1ZHPA 3URDA 2W3IA 3BTWE 1TAWA 1O2OA 1YCPK 1PFXC 2FOAA 5GCHF 5I46H 2GV6A 2SNVA 3MWIU 2FDAA 1C5VA 3PTNA 1C2FA 2D2DA 4CR9A 4ZKRU 2GZ9A 2SGFE 4NIXA 1VJAU 1GHZA 3LGYA 2QXJA 2P93A 1TONA 1TMTH 3UNRA 1ABJH 4YT6H 1TQ0B 5FPTA 4ZKSU 3UNQA 1QURH 5DK1A 5AFZH 1RTFB 3KNXA 1BBRK 1GI4A 2ZU3A 1N8OB 1MAYA 1OWDA 3VB3A 1TGBA 3SHCH 1X7AC 3A88A 3MHWU 1C9PA 1H8IH 3BG4C 4NG9H 2GMTB 3Q76A 2GCTC 1SMFE 2THFB 4X6PA 3Q3YA 2TBSA 2OD3B 3TITA 5CHAC 1W2KH 3S9CA 1CQQA 3RU4E 3NCLA 2PSXA 1U6QA 1JIMA 4FU9A 3OYPA 1KXEA 1FY8E 1MBQA 2ZC9H 3URCA 2AMDA 3M7QA 2UUYA 2OC1A 4I8LA 4ZXXH 2OC7A 2PUXB 5F03A 1TX7A 3LGVA 4NIVA 3F9GA 4Y7BA 1XXDA 3VFEA 1AWHB 1B0FA 2BLOA 1NM6A 2BVRH 5K7RA 1K2I1 1FAXA 1G32B 1BTUA 3NWUA 2VINA 3HGPA 2YNAA 1HYLA 1WTHD 1CT2E 1LHDH 1T4UH 2HWLB 4X1NU 3SI4H 3BTKE 1O2GH 2OCVB 4INHA 3RC4A 2PTNA 1EUFA 2Y5FA 2XBYA 1Y5AT 2QY0B 3IG6B 1LVYA 3JZ2B 5L2YH 4AZ2B 1T8MA 3ODDA 1BRCE 2W3KA 3ZVFA 4U30A 1S6HA 1GGDB 3C27B 4I8JA 1F0RA 1L4DA 3TJUA 1YC0A 1BITA 1SI5H 4IGDA 3KCGH 2RA3A 1OWEA 1E35B 3A7WA 3BEIB 3GCTF 1Y5UT 1KIGH 5GIBA 5JDUB 1P2KA 5FXLA 3KQBA 3JZ1B 3Q3XA 4MVNA 3H7TA 2ZDLA 4O9VA 1C2KA 1EXFA 1V2RT 1GBJA 2EEKA 1ELDE 1YPMH 4YOJA 4BNRA 3LC5A 1SOTA 3E3TA 1BTPA 2LNCA 7KMEH 3RU4T 1K1LA 1C2HA 4MPWA 4K60A 1L4ZA 3BTTE 3BIUH 3MMGA 2ZDAH 1G36A 3M36A 1HJ8A 3BTEE 2HOBA 2AMPA 2JKHA 4I7YH 1WUNH 1XVMA 2EC9H 5JBTA 1L2EA 5LGOA 1WCZA 3A7ZA 3HK6B 5C3NA 1UK4A 1O2SA 4NZLA 1HUTH 2B5TB 3SU1A 2FWWA 3SGBE 4BOHA 4GAWA 3M5NA 1G37A 3MH6A 1WBGB 4UDWH 1HXEH 1SR5C 1C4Y2 4CRGA 5ABWA 1ABIH 3QLPH 1O3PB 1ZTJA 2IOTA 1TGNA 1QBOA 1ZPBA 1GG6C 2XC5A 2FOGA 4U01A 4O3TA 3UR9A 1SLVB 1CO7E 3RXSA 2P8OC 5HM2A 1IQLA 4MDSA 1DWBH 2HGTH 1P09A 1SGCA 4HFPB 2BD7A 3UOPA 1ZMLA 2FMJA 1NC6A 2HVXA 1ZJDA 4FUEA 1A3EH 4I8HA 2PSYA 2AMQA 1LO6A 3P92A 3OTJE 2BB4A 4X1QU 2RA0A 1TBQH 3T28A 2W7SA 3VGCC 3ZV8A 1O2PA 1EX3A 4ABEA 2VIVA 1ELVA 2BD9A 4X2YA 2FZZA 1IOEA 1HDTH 1LPGB 1ZPZA 5EGMA 1PYTD 2BY6X 5C67A 3P8NA 1TRNA 3PROA 1V2OT 7GCHF 2DE9A 5JPMH 1NT1A 4DURA 1DITH 3AVZA 3SNEA 1GJCB 4XBBA 2XC4A 3MH7A 1AMHA 1GI3A 1GBIA 1KXCA 2GP9B 1P2QA 1LVBA 1AB9C 1K1NA 4Y76A 1UTLM 1AIXH 4Y10E 4NIWA 1XM1A 1JMOH 1ZYOA 1LHFH 2A7HA 3UUZA 4WMDA 3KF2A 2FM2A 1SGIB 5EOKA 1D3TB 4B71A 1SG8B 1GBHA 1CHOG 1UCYE 1CE5A 1GJAB 1SHYA 3LC3A 4JZDH 2FS9A 1P05A 5AVDA 1ZJKA 1F0SA 1HLTH 2BDIA 1C5ZB 1MZDA 2EA3A 1AN1E 4NA9H 1GVKB 2PUQH 1C5TA 2NU0E 3KN2A 2GZ8A 3K9XB 4O97A 3LH3A 1SGYE 1GG6B 7GCHG 1V2LT 4TY6A 2OC8A 5TJXA 4D8NA 3ENSB 1K1IA 1HJAB 3TU7H 1VCWA 2G55A 4IC5A 1EB1H 3SQEE 1GBDA 3HKJB 2ZA5A 4A6LA 2GCHF 2G5NA 3S9AA 2BD8A 1YGCH 2ODYB 1S0RA 4X1RU 3P8OA 5EODA 1P2OA 1EOLA 1QA0A 5HM9A 1SGDE 3PMHB 3MU8A 2Z9IA 1FZZA 1GI1A 4DVAU 4K1TA 3SU6A 2M5TA 1GCTC 1F5RA 1K1JA 2VIPA 2PR3A 4X8UH 2A4GA 2BXTH 4FUGA 3BEFB 3MNCA 1UTQA 2CXVA 5F8ZA 4OS5A 3BSQA 2F9BH 1DX5M 4AB9A 1O3MA 1HXFH 4ABAA 3SV8A 2FTMA 1ESAA 1Z8IB 1C2MA 1EAUA 1YPJH 3TGIE 3BG4B 2A7CA 4IC6A 3QUMP 3BTHE 3Q00A 4Q7ZA 1KXFA 1ESTA 4DJZB 1V2TT 4GHTA 3A7VA 2QF0A 4MPUA 3A85A 2OLGA 4IS5A 2CHAC 2BM2A 1DVAH 2GVFA 3MTYA 1AY6H 1BJVA 5ESTE 3SV2H 2C93B 2QXIA 1HAVB 3KL6A 4Q7XA 1EPTC 4MTBA 3SNBA 1FI8A 3MH4A 2H9HA 1NRQH 3DD2H 1OXGA 1ELGA 1AU8A 4RKOB 3SI3H 3UWIA 4E7RG 1QRZA 9ESTA 2QF3A 1DANH 4CRFA 3SJOA 1ANBA 2BHGA 3GDVA 2CF8H 3I29A 3SU2A 1O2JA 3EDXB 3GDUA 2KAIB 4I8GA 1GGDC 1A0HB 4CH2B 5C5NA 1MTSA 3HKIB 2BY5X 4OS7A 1TNGA 3SNCA 3BTDE 1T4VH 4XE4A 1ELEE 2WYGA 1T7CA 1FY3A 1OSSA 4B74A 2Y5GA 3A8CA 4XFQA 4OS2A 2C8WB 5HYOA 3F1SB 5DP4A 1GHXH 1MD8A 3GICB 2OQ5A 5L6NH 2FOHA 1O2ZA 1GI6A 3NKKA 4R8TB 1ZMNA 2K1QA 2VJ1A 1UTKA 4J1YA 1ZRKA 5E2PA 1O3JA 1DS2E 2A0QB 1KTSB 3B9FH 1HIAA 1DUEA 1G3CA 2ULLA 1O3GA 5F8TA 4ABBA 2VVCA 1N8OC 2AIPA 5ESBA 3PLKA 2G00A 1TNJA 2ANKH 1J9CH 3ATMA 4J2YB 1QIXB 1ZZZA 3RXBA 5AFYH 1ZR0A 2BOKA 4AORA 3LGWA 5CHAB 4ZKOU 1P11E 4FUCA 2XCFA 2HALA 3RXMA 5AF9H 5FBIA 1C4V2 1P2MA 4Q2KA 3ATLA 1GVLA 5J4QA 2FOMB 4YO9A 1G30B 1FV9A 1ANEA 4ZKNU 1CT0E 1ELCA 1TPPA 3G01A 5G4BA 4Y8XA 3TJOA 1VITH 4UE7H 3ZZ7A 2BLWA 2ZQ1A 1F0TA 9LPRA 1VJ9U 1SC8U 2ZKSA 4NCYA 3UFAA 1V2WT 3NZIA 4ESTE 3QZQA 2A2QH 3MU0A 5FCKA 1DXWA 1L1JA 3PB1E 1N6XA 2WUCA 1ELBA 1F5KU 2BDBA 1ETRH 5JYIA 1IQFA 1C2IA 3RXLA 4GLYA 4D7FA 1MKWK 4YOGA 2UWLA 1GL0E 1F7ZA 1YPGH 3PM3A 3VXEH 5C5OA 3A80A 4U32A 3U98H 3RXTA 1KY9A 3UOUA 5T6DA 1AVWA 5EXNA 1AI8H 4BAMB 3GY3A 1OWJA 3CP7A 3B8JA 4Y0ZE 1KXBA 4YT7H 1RJXB 4AB8A 3MU5A 2QV1A 2SNWA 2VIOA 1O39A 4Q7YA 1DFPA 1G3BA 2ZWLH 1QB1A 1NFYA 3U69H 2FI3E 1JWTA 1C5NH 1ZTLA 2BZAA 3GCOA 1YM0A 1E0FD 4NA7A 5JBBS 2OQUA 1H8DH 2VIQA 3PYHA 1INCA 3E0PB 1EQ9A 3FP7E 1GJ5H 1P02A 4AYVB 2OBOA 4ISHH 1O5DH 1OWHA 2ZECA 1BBRE 1CBWC 2BVXH 1H9LB 5AHGH 4D9QA 5C2ZA 4X6NA 1O3EA 1UHBA 3LOXA 2EI6A 1BB0B 2CF9H 1MBMA 3E0NB 4FU7A 4BAKB 1HRTH 3ZVEA 1BA8B 1B5GH 1DLKB 1EASA 1O3KA 3BTGE 3LDXH 4R0IA 1HIAB 1K21H 4NWLA 3M5OA 2G51A 2ZU1A 4JK5A 1O35A 3UTUH 1C1UH 2Q6GA 1SGEE 2TGDA 2GD4B 4Y8ZA 3P8GA 4AG1A 2A5KA 1GBCA 1F2SE 1CGJE 8GCHF 5LPEA 2F9UA 4ABJA 3TH4H 5C1UA 2P8OB 4MPVA 3UNSA 2TGTA 1QJ1B 1O3CA 3SUDA 4DY7B 4X1SU 1AQ7A 2PTCE 1DICA 3A83A 1HPGA 1YP9A 1QB6A 3K6ZA 3T25A 1O3AA 1TPAE 3T5FH 1QFKH 2A7JA 1SGNE 1OKXA 4K5ZA 1W14U 1GMDF 3P95A 3A86A 1C5SA 1HAVA 2Q6FA 2FPZA 1SGRE 2H5CA 3ZZAA 1P9SA 3DFLA 1BMLA 1O3FA 1A5IA 3SBKA 1Z8JB 2ZCHP 3KHVA 1TNLA 1TB6H 4ZHLU 1BTXA 3EQ0H 1YPEH 2FOEA 2QAAA 2GKVE 4BTIB 5A0CA 3SGQE 2AGGX 3RXUA 1ZSJA 1G2MA 2B8OH 4LOYH 1TALA 1LQDB 3ZYEA 3SJ9A 1O5AB 5E0JA 1G3EA 1RIWB 1FAKH 3D23A 1K1PA 3ZVGA 1NPMA 4DIIH 3F9FA 1IQKA 3C1KA 1P2NA 3MNBA 2JETC 3RXAA 4D7GA 1AVGH 2PWXA 2ZGBH 1BBRH 1ELFA 3GY6A 4JYUH 5C1XA 4WVPE 1OP2A 4DW2U 1DM4B 1KLIH 3GY5A 3UQVA 1SQTA 5GCHG 3SNDA 3VGCB 1A3BH 4X6OA 1OYTH 3MO3A 1O2QA 2FXRA 1BMAA 5F6MA 1O2TA 1TGTA 2P94A 1Y3UA 1QL8A 1MUEB 2P59A 3SUEA 1QQ4A 3M5LA 2OXSA 1YF4A 1EP5A 1IQMA 2FESH 3GCHB 1DY8A 1O2WA 2ZNKH 2D26C 1SGQE 3SUGA 1AVXA 4NWKA 5JB9S 5DP8A 2ODPA 3E1XB 1AB9B 2BY8X 1BRUP 1LCYA 1QB9A 1QL9A 2YOLA 3P17H 2Z3EA 3TK9A 5EG4A 4DT7B 1NRSH 1AE5A 5I25A 3M61U 1QRWA 1G9IE 5CE1A 4YLQH 1NZQH 2NU4E 5TCAA 3ZYDA 6LPRA 1GI8B 5ETXA 1Y5BT 2A1DB 1C5LH 1S85A 2FI5E 4DOQA 1SLUB 2QN5T 1S6FA 2F91A 1BUIA 2J94A 2EI7A 2BZ6H 4A1TA 3SJKA 1SQOA 1GWAA 3LPRA 1C1SA 5K0HA 5C1YA 2HPPH 2O8WA 4JZEH 3T62A 1HAZB 1L1NA 1IQHA 2ZTZA 4NFEA 1TMBH 2FTLE 2ALVA 2FYQA 4YLUA 2GDDA 4DCDA 2VIDA 3GY2A 1W12U 3GCHC 1KXDA 4K3JA 2VVUA 1P3CA 4OS1A 1ID5H 1LKBA 1BMNH 2BD3A 1GBMA 2FIRH 3MOCA 4NZQA 1NS3A 1TIOA 2PFEA 3FZZA 3WY8A 3ZZ8A 1VGCC 1TRYA 1UCYK 3AAUA 1Y3XA 2ANWA 4TY7A 2FX6A 2OUAA 2ZI2H 3U8OH 3RU4D 1PQ7A 1CA8B 4GHQA 3PMAB 3QTOH 2C4FH 1UVOA 7LPRA 7ESTE 3V7TA 1Y8TA 1FY4A 3V0XA 4CRCA 3GDSA 6CHAC 3EA8A 1QJ7B 1YPKH 3DHKH 4YTAA 4LK4A 4D9RA 1YLDA 5GXPA 1DY9A 4YZUA 5IYTA 1C1VH 1GHAF 1M9UA 2ESTE 2O9QA 2Y81A 1MKXK 1BZXE 3VPKA 3O8RA 1GBLA 3T26A 1B7XB 3EE0B 2FI4E 5DPAA 1Y59T 2B7DH 2ZHQH 1TPOA 1VR1H 4B1TA 2GMTC 2ANMH 1A0JA 2ZU4A 2C3SA 5DP6A 1WAYB 2ZHEH 2VGCC 4HGCA 5GJ4B 3OY6U 2JH5D 1P06A 1A2CH 2VVVA 1NU9A 1P8VC 3KQDA 4X8TH 1FIZA 2G8TA 4JYTA 1VITG 2I6QA 4A5TS 3UPEA 3EA7A 4TWWA 5SGAE 1N1LA 1BCUH 1TOMH 3GYMA 4ZROA 3UY9A 4HZHA 1ZHRA 2BLVA 3MO6A 4ISOA 1MH0A 4BAHB 3K65B 4MQAA 5A2MH 4H6TA 1DLEA 3KQEA 4F4OC 1GJ7B 5LPRA 4ISNA 1GI7B 4ZXYH 3FP6E 2VH6A 1DSUA 3GYLB 1EZXC 1TA2A 3ZVBA 1C1RA 1S0QA 2XBXA 3OX7U 2EI8A 1OYQA 3MFJA 2XNIA 1TLDA 2BYAX 4AGJA 1GHWH 4UFEH 2R9PA 1W3CA 4KP0A 1O2LA 4KGAA 2QCYA 4XDEA 2BQ6B 5L30H 1C5QA 1QBNA 1GI5A 3QGJA 3T29A 1O36A 1PPGE 2ZHDA 4TYDA 4JK6A 3CENA 2O8UA 3ZZCA 4ISLA 2R3UA 1A46H 4A1VA 2VH0A 4CR5A 2PKAB 1QCPA 1TGSZ 3LJOA 1V6DA 1TPSA 1C5XB 3ZZ4A 1P57B 1V3XA 1YCPM 1MQ5A 4IN2A 4ZH8A 3ZZ3A 2QGRA 1GHAG 3KEEA 4H42U 1YYY1 1HBTH 3E16B 1MZAA 1AKSA 1N6YA 1C1NA 1SPJA 1P0SH 1LQEA 2BDHA 3VB6A 1SFIA 2R0LA 2OC0A 2Z7FE 3GCTG 1Q2WA 5EW1H 4INKA 4X1PU 1GI0A 2Z3CA 1IAUA 3SQHE 2Z6BD 2F9PA 2LPRA 4XOJA 2D1JA 2AYWA 2ZFSA 2AH4X 1W11U 1O2IA 3TLOA 4ZMAH 1BMMH 3ZZ5A 4XBDA 4WXIA 1V2JT 1GHBG 1XKAC 1BHXB 5A8ZA 1LTOA 5A0AE 4NA8A 3SO3A 2P16A 2GV7A 3QK1A 2VNTA 3ODFA 1F92A 3RXFA 4MNVA 3A8AA 1AO5A 3AASA 2GCHG 1FNIA 1S83A 4AFUA 1VGCB 1TNHA 1DUAA 1AFQC 1KYNA 2PHBA 5T3HA 3LU9B 1AUTC 1L1GA 2NU3E 3SV7A 1ETTH 1BT7A 1O3LA 1THPB 3RXCA 3M3SA 1TABE 4KKDA 3SV9A 1UTPA 2JH0D 3BEUA 5PTPA 4WMFA 1G2LA 4UEHH 3NK8A 3U1JB 1XUKA 2J2UA 1TRMA 2Z9GA 3PMBB 3SOSA 2GCTB 2C90B 2CMYA 3LKWA 4FUJA 3UR6A 2SGQE 4K2YA 3OU0A 1HCGA 1K28D 2V3OH 4QT8C 2ZDNA 3IITA 1EZSC 3PLPA 1HV7A 1H9HE 4ABGA 2OP9A 3L33A 2AEIH 4VGCB 1QBVH 3H7OA 2H9TH 2G52A 1V2NT 2RDLA 1YPLH 1RTKA 2P95A 1LVMA 3QO6A 5J4SA 5LPFA 1JRTA 5FBEA 3NXPA 1TGCA 3GISB 1UVTH 3R0FA 2SGPE 2ZO3H 1ELAA 3BTQE 2TGPZ 5C20A 1BRAA 4BTTB 4RKJB 2SGAA 1CGIE 4Y7AA 1O3HA 3QWCH 1DDJA 1ELTA 1BTYA 1DE7H 1TNKA 1PQAA 1RRKA 2Y7XA 4AYYB 2JH6D 1Z7KA 1WV7H 1D6RA 1JRSA 2OBQA 3W95A 1OS8A 4X0WU 3BTFE 2CGAA 1HJAC 2PGQB 3DUXH 4FUDA 1ACBE 3FAOA 1RTLA 2WPJS 3SORA 1O2RA 4Y79A 1C2JA 5IDKA 4I32A 2SGEE 3TK5A 3M7UA 1RFNA 3RXOA 2A4RA 1S81A 2Z3DA 3L3TA 1O5CB 1D3PB 1PQ8A 2HNTC 2BQWB 2GT7A 3VXFH 3SW2B 5EQSA 1KDQA 3LT3A 1WSSH 2A4QA 4NGAH 1ARCA 2FOCA 1O33A 2P3TB 5GWZA 1NFUA 1W10U 1GBBA 1O2MA 1W8BH 4ISIH 4ASHA 1BRBE 6ESTA 3FANA 2V35A 1XKBC 5H4IB 2ZPSA 1GL1A 1EJMA 1PPFE 2HLCA 2HNTE 4AGKA 2IN2A 4OGYA 4YM9A 2FX4A 1MMJN 2J92A 4NIYA 4MNWA 2A5AA 3SU3A 1CA0B 3DFJA 1FONA 4K8YA 5HMAA 3LONA 4CH8B 1TWXB 3RM2H 2GX4A 5L2ZH 1A7SA 3STIA 1PYTC 1GBAA 1MD7A 1QGFA 5FAHA 1O5BB 2ZGJA 4TPIZ 1C4U2 1A4WH 3ZVAA 1GMCG 1HAHH 4MPXA 4UFGH 4WY3A 1GDUA 2XC0A 1DPOA 1XUGA 2G81E 2ZGCA 4ABHA 2O8LA 5DO4H 3E8LA 1AZZA 4OS4A 2Y82A 3UWJH 3ELAH 3RXQA 4I33A 2A2XH 1H4WA 4JYVH 1IQNA 2BXUH 2FEQH 2F3CE 1O31A 1DT2A 1XUHA 4AFZA 1GHVH 1ZPCA 2QC2A 2ZCLP 1LPKB 1MU6B 4Y6DA 4CRAA 2BDAA 5DP3A 2ZHFH 1EPTA 3U8TH 1D9IA 1AD8H 5DP5A 1UVPA 4BAQB 1EZUC 4JZIA 3F6UH 4SGBE 1SVPA 3EGKH 4UONA 5EPNA 3S0NA 4BXWA 1VCPA 5E2OA 3V13A 1MCTA 1BOQA 1BTZA 5FPSA 1KLTA 5LH8A 1NN6A 4OGXA 1GPZA 1D6WA 3RUOA 1CA0C 2A45B 3W94A 1SHHB 4DIHH 3R3GB 2DE8A 3H5CB 2GT8A 1SQAA 1MAXA 1GMDG 1OOKB 1NRPH 3Q3KA 1J15A 2TGAA 2J34A 4FUHA 3SHAH 3SZNA 2ZTYA 1SGPE 1LMWB 4IN1A 3RMLH 1V2QT 2Y7ZA 2WPLS 4WH8A 2B9LA 1HAOH 4INLA 2H2ZA 3O8CA 3B23B 4JZFH 5EXLA 1TBRH 1TBZH 3RXRA 2TRMA 4ZHMU 1C5YB 2GTBA 1KDQB 1QHRB 2VWMA 1OX1A 2WV4A 2J95A 1S84A 3IWMA 1TFXA 1C5MD 5EXMA 3SU0A 3I77A 1WYKA 1O2KA 1FY5A 1FIWA 1DWDH 2BD2A 2V3HH 1Y3VA 3HK3B 3D49H 1UTOA 3AW0A 1A0LA 3BN9A 2ZF0H 2QYIA 3MYWA 5A8XA 1ZTKA 4FXGH 3TH2H 2VU8E 3V3MA 2NU2E 5T6GA 1BTWA 2C8YB 1HB0B 1C1WH 3FFGA 1AHTH 3KGPA 4HI3A 1QL7A 1DWCH 3MO9A 3RMMH 8ESTE 3ZVCA 4I31A 3VB7A 1EB2A 1LDTT 1E37B 1W13U 2BDGA 1V2KT 4H4FA 4XSKU 3VEQB 1GMHF 1XXFA 5FX6A 3CS7A 4A92A 4Y71A 1O3OA 1LHGH 3P6ZB 1OP0A 4GPGA 4K8BA 2FS8A 1FPHH 1ANDA 1HAXB 2PKAA 1YPHC 2UUJB 4GVUA 4CHAB 4DG4A 1GBTA 1Z1JA 1FDPA 3FZDA 2PKSB 1UK2A 2AFQB 1YCPH 2ZIQH 2ZCKP 2XBWA 1CBWB 2Q1JA 4THNH 3T27A 3TJNA 4AFSA 1V2MT 3EYDA 1O2XA 1VCQA 1J16A 3STJA 2O8MA 2STBE 2VB0A 3SJIA 1PJPA 1C1QA 1GBEA 2GGVB 2F83A 4LZ1H 1P2JA 2YNBA 2DUCA 4CRBA 2KAIA 3MNSA 2AGIX 4GCHF 1O2YA 1GVZA 1EAWA 1HAPH 5F8XA 2ANYA 4Y0YE 4WWYA 2BOHB 3ZVDA 3S7KB 4GUXA 1C2DA 3DA9B 4HTCH 1UHBB 4NSYA 2FP7B 4X2VA 1QQUA 1AGJA 4X2XA 1WQVH 1C1MA 1L0ZA 1HAIH 5DGJA 3ESTA 2IJOB 4FUFA 2PV9B 1C2GA 1GHBF 1FPCH 5CMXH 2FLBH 1OWIA 5GDSH 2R2MB 2R2WU 2ODQA 4JCNA 3UQOA 2ALPA 2XTTB 1IQJA 1GI9B 2AERH 1WTGH 3BTME 2BLQA 1CSOE 1NFWA 1GDNA 4F49A 4RN6A 3VB4A 1V2PT 2ZPQA 3S9BA 2FO9A 3HATH 1THSH 2UUKB 1EKBB 1T8LA 5TCCA 3K6YA 3GY4A 3A82A 4B73A 3AW1A 3O8BA 4CRDA 2ZZUH 1GBFA 3LJJA 5EPYA 4ZUHA 4NFFA 2STAE 1GJ9B 3ZV9A 3RMNH 1D3DB 3HPTB 4E7NA 2VWLA 1O3DA 3MH5A 1AZ8A 1ZOMA 2ZTXA 1NRRH 4RSPA 4GCHG 3TIUA 2WUBA 3RP2A 1C2LA 2O8TA 3RXHA 4O03A 5A8YA 2W26A 3U9AH 1RS0A 4A1XA 2ZU5A 1DSTA 5EQQA 3MU4A 2BX3A 1O3IA 1SL3A 1IHSH 4MNXA 1MTWA 2G5VA 1THRH 2BY9X 1GJ6A 1LHCH 4NSVA 3NPSA 2QXHA 2A4OA 1SB1H 1GJDB 2BDCA 1ZGIA 2F9VA 4SGAE 2GDEH 1O2HA 1A5HA 2ZFFH 1C2EA 1MTUA 8KME2 3SUFA 4X8VH 1UVUH 3ITIA 2QA9E 2B0FA 1YKTA 3FVFB 1DOJA 3A7YA 2G4TA 2XRCA 2C8XB 1LPZB 2FLRH 1K1OA 1W7GH 1CU1A 1O2NA 2OINA 4AN7A 1SFQB 2H6MA 3LGIA 4ABDA 3LH1A 1O37A 4X6MA 1D3QB 2AGEX 4IW4E 3DT0H 4K69A 4VGCC 3HGNA 1EZQA 3F68H 2FYRA 5DP7A 2GZ7A 1KTTB 1SGTA 4E05H 3D65E 4B76A 2VGCB 4WF8A 2Z9LA 1QY6A 1MQ6A 1P9UA 1YBWA 1EOJA 4FVBA 1BQYA 1BHXF 4MLFB 4AX9H 3QX5H 4AFQA 2ASUB 1FQ3A 1NESE 1SBWA 4H6SB 8GCHG 4FU8A 4Q80A 4B2CA 2XWBI 1MTNC 1C5UA 5JB8S 2RG3A 5HXFA 2H9EH 3GY8A 4YOIA 4AG2A 2P3UB 3OY5U 3BF6H 2WPMS 1C1PA 1JIRA 1O0DH 1BJUA 1CHOF 1W7XH 2BTCE 1C9TA 4Z6AH 3AAVA 3SNAA 1SLXB 4IMQA 3S69A 2V6NA 3PO1C 2WV5A 2UWPA 1GMHG 1WQSA 2QIQA 3ATKA 2ZFQH 1EP6A 1O2UA 1SLWB 1ZRBA 3RXIA 1FXYA 2ZEBA 4BXSA 1RD3B 1Y3YA 1S5SA 3RXVA 1H1BA 2CHAB 2H1UA 3BV9B 2ILNA 1XX9A 4WJG2 4PROA 1MKWH 2CJIA 1GMCF 2G4UA 4B2BA 5E0GA 4WMEA 3EAJA 1OP8A 2NWNA 1IQGA 1P03A 3ZZ6A 1DWEH 3QZRA 4KTCA 3NUMA 3E91A 1HJ9A 3RXJA 3TNSA 1EPTB 2TPIZ 4TWYA 2RCEA 2PLXA 6GCHG 1K22H 5EU8A 1ZGVA 1CGHA 1FJSA 1WOFA 3F9EA 3K2UA 2F9NA 3SU4A 2WPIS 1LHEH 2PKSC 3EA9A 1HAYB 1NROH 3OSYA 4IMZA 1O5FH 2AS9A 2XCNA 3M5MA 4FUIA 3ATIA 3BIVH 1GJ4H 1O30A 2WYJA 1BIOA 2PGBB 1K1MA 3A89A 4BAOB 3QGNB 2IPHA 4Z0KA 4YESB 2W7UA 3PV4A 1O5GH
chains in the Genus database with same CATH superfamily
3S7HB 1EJNA 2W5EA 2LELA 1NO9H 2OTVA 4B2AA 1LVOA 3QTVH 4OS6A 3A84A 1HNEE 2BD5A 4B6FA 4K1EA 1NFXA 1Z6EA 2HNTF 2Z94A 4KELA 5EQRA 5DKMA 1ZSKA 1TX6A 5DG6A 5BRRE 2P3FH 1MTVA 1GJBB 3F9HA 1OPHB 4AOQA 1AE8H 4TPYA 5DSFA 4Y11E 1C1OA 1ORFA 1C5WB 2R3YA 1FUJA 3KQ5A 3WWFA 1JBUH 1KLJH 1P10A 3TPIZ 1FN8A 2Y5HA 4KTSA 1EJAA 1TMUH 1Z6JH 2FODA 2HRVA 3RMOH 4MNYA 1TYNA 4U2WA 3RLWH 2VIWA 2XXLA 2JETB 1FLEE 2A5IA 5B6LA 4K1SA 3VB5A 3MU1A 1P01A 5C17A 1BTHH 1SGFG 2F9OA 5FX5A 1NTPA 3SJ8A 3N7OA 3LIWA 1P12E 2SFAA 1ETSH 1K9OE 1EFRD 1TX8A 1FN6A 1Z8GA 3UREA 1CT4E 3LGUA 1RGQA 1MCVA 1UK3A 2BD4A 3MNXA 1E38B 3QN7A 1Z1IA 2I6SA 1MKXH 1TNIA 2J38A 1GCTB 3L6PA 3Q77A 3RXPA 2Q6DA 1ZMJA 3MI4A 6CHAB 5FHTA 4BTUB 1UMAH 1C5PA 4HG6A 1AFEH 1A61H 1PQ5A 4WH6A 3RXGA 1EAXA 1ZHMA 1TQ7B 4LZ4B 1UVSH 1XVOA 5A09A 4CBOA 1T31A 4ZHAA 3RLYH 3RXKA 2A31A 3FP8E 1PPHE 1J8AA 1J17T 2FOBA 3SGAE 3M3VA 3ZIAD 1H9IE 2Y6TA 4FUBA 4FVDA 3M37A 4ABFA 4GSOA 1GCDA 1HAGE 2UUFB 3A8BA 1UJ1A 1XMNB 3ATWA 1NY22 1GI2A 3D62A 2CK3D 1AUJA 1W0ZU 2H5DA 2L6OA 2BDYA 4UFFH 2A32A 3A87A 1RIWC 1XUJA 4Y8YA 1BDAA 2XYAA 4OM9A 4CREA 1O38A 1C5RA 1O34A 1T8OA 2CV3A 1WU1A 2NU1E 3M35A 1QNJA 2L74A 4MG3A 1UO6A 2HPQH 3PO1B 4LXBH 1G3DA 1IQEA 3A7XA 3M3TA 4XBCA 2EY4C 2TIOA 1ARBA 1KSNA 3TNTA 4ZAEA 2JDID 2ZDMA 2BY7X 4KTUA 2SGDE 5T6FA 1VZQH 4BANB 1AKSB 4IBLH 1E36B 3RXDA 1TE0A 4P02A 3SU5A 2J9NA 1C1TA 1TA6A 3A8DA 1CVWH 1P04A 1PPCE 1SGFA 2ZFTA 5EW2H 3PMJA 5DJ7A 1O3BA 1Q31A 1RXPA 1V2UT 3U8RH 1QR3E 2BVSH 3P70B 1PPBH 1FMGA 2BQ7B 1QRXA 1T32A 1GDQA 1QTFA 3E6PH 3T2NA 1UTJA 4RT0A 2WINI 4UD9H 1O32A 1O2VA 3P8FA 8LPRA 1COWD 3QDZB 1EATA 4AC9A 2Y80A 4E06H 1UCYH 3TGJE 1A1RA 2ZQ2A 3PV2A 1PPZA 2C8ZB 3KIDU 1VITF 3E90B 4D76A 2XBVA 1T8NA 2XW9A 2CN0H 4I8KA 4M7GA 1AWFH 5JBCS 1HGTH 3TJVA 3O8DA 1Y3WA 3RC5A 3RM0H 3CNRA 3TH3H 2ZHWH 2ZG0H 1IHTH 1V2VT 3M7TA 3UIRA 3KQCA 4X8SH 4A7IB 1C5OH 2QXGA 4B75A 2V0BA 2FOFA 3SV6A 1XUIA 2GJGA 3I78A 3A81A 3TVJB 5DP9A 1P2IA 1ANCA 5A0BA 3SN8A 4JZ1A 1GHYH 3RDZA 3CS0A 1QJ6B 2RDEA 2ZGXH 1O3NA 3U1IB 1TOCB 4JMYA 3LGTA 3RXEA 1CHGA 1DXPA 3GCNA 3PLBA 4CBNA 5HGGA 3GOVB 5FPYA 5JBAS 1ZLRA 1IQIA 1W0YH 3BG8A 1GBKA 4DGJA 2ZDVH 1KXAA 2ZP0H 5E8EH 1GJ8B 1F5LA 3ZZ9A 2XWAA 3F2HA 5T1VA 3VG8A 1A5GH 1OWKA 2ZDKA 1UTNA 4UFDH 4O3UA 2BX4A 1MTNB 1ZSLA 2ZFPH 2VWOA 2Z9KA 2ZPRA 2D8WA 1Z8RA 1P3EA 1JXPA 1SOZA 2R0KA 1UTMA 1FY1A 1F0UA 2ZU2A 4CHAC 1S82A 1Q3XA 2RFKC 5FCRA 1EAIA 4ABIA 1E34B 3A7TA 1HFDA 2VWNA 3PTBA 5BPEA 3V12A 5B6OA 6GCHF 1AFQB 1J14A 3ZZBA 2PW8H 1YPHE 1QA7A 1NU7B 1Z71A 2ZGHA 2J4IA 1B0EA 3PWCA 1XUFA 1JOUB 3TK6A 3ZZDA 5GPIB 2Z9JA 2WPKS 2AIQA 1V2ST 3GY7A 1YLCA 2UWOA 5E0HA 1LKAA 1PPEE 1NRNH 2ZFRH 4WXVA 1SSXA 2WPHS 3PWBA 1ESBA 1O5EH 4X2WA 5CHBA 3TGKE 2YMSD 2BMGB 1D4PB 1MU8B 3RC6A 1ZHPA 3URDA 2W3IA 3BTWE 1TAWA 5IK2D 1O2OA 1YCPK 1PFXC 2FOAA 5GCHF 5I46H 2GV6A 2SNVA 3MWIU 2FDAA 1C5VA 3PTNA 1C2FA 2D2DA 4CR9A 5EIYA 4ZKRU 2GZ9A 2SGFE 4NIXA 1VJAU 1GHZA 3LGYA 2QXJA 2P93A 1TONA 1TMTH 3UNRA 3DCLA 1ABJH 4YT6H 1TQ0B 5FPTA 2EQNA 4ZKSU 3UNQA 1QURH 5DK1A 5AFZH 1RTFB 3KNXA 1BBRK 1GI4A 2ZU3A 1N8OB 1MAYA 1OWDA 3VB3A 1TGBA 3SHCH 1X7AC 3A88A 3MHWU 2HVYB 1C9PA 1H8IH 3BG4C 4NG9H 2GMTB 3Q76A 2GCTC 1SMFE 2THFB 4X6PA 3Q3YA 2TBSA 2OD3B 3TITA 5CHAC 1W2KH 3S9CA 1CQQA 3RU4E 3NCLA 2PSXA 1U6QA 1JIMA 4FU9A 3OYPA 1KXEA 1FY8E 1MBQA 2ZC9H 3URCA 2AMDA 3M7QA 2UUYA 2OC1A 4I8LA 4ZXXH 2OC7A 2PUXB 5F03A 5C0TA 1TX7A 3LGVA 4NIVA 3F9GA 4Y7BA 1XXDA 3VFEA 1AWHB 1B0FA 2BLOA 1NM6A 2BVRH 5K7RA 1K2I1 1FAXA 1G32B 1BTUA 5EJ1A 3NWUA 2VINA 3HGPA 5F53A 2YNAA 1HYLA 1WTHD 1CT2E 1LHDH 1T4UH 2HWLB 4X1NU 3SI4H 3BTKE 1O2GH 2OCVB 4INHA 3RC4A 2PTNA 1EUFA 2Y5FA 2XBYA 1Y5AT 2QY0B 3IG6B 1LVYA 3JZ2B 5L2YH 4AZ2B 1T8MA 3OE7D 3ODDA 1BRCE 2W3KA 3ZVFA 4U30A 1S6HA 1GGDB 3C27B 4I8JA 1F0RA 4TT3D 1L4DA 3TJUA 1YC0A 1BITA 1SI5H 4IGDA 3KCGH 2K8IA 2RA3A 1OWEA 1E35B 3A7WA 3BEIB 3GCTF 1Y5UT 1KIGH 5GIBA 5JDUB 1P2KA 5FXLA 3KQBA 3JZ1B 3Q3XA 4MVNA 3H7TA 2ZDLA 4O9VA 1C2KA 1EXFA 1V2RT 1GBJA 2EEKA 1ELDE 1YPMH 4YOJA 4BNRA 3LC5A 1SOTA 3E3TA 1BTPA 2LNCA 7KMEH 3RU4T 1K1LA 1SKYE 1C2HA 4MPWA 4K60A 1L4ZA 3BTTE 3BIUH 3MMGA 2ZDAH 1G36A 3M36A 1HJ8A 3BTEE 2HOBA 2AMPA 2JKHA 4I7YH 1WUNH 1XVMA 2EC9H 3N7EA 1L2EA 5JBTA 5LGOA 1WCZA 3A7ZA 3HK6B 5C3NA 1UK4A 4P00A 1O2SA 4NZLA 1HUTH 2B5TB 3SU1A 2FWWA 3SGBE 4BOHA 4GAWA 3M5NA 1G37A 3MH6A 1WBGB 4UDWH 1HXEH 1SR5C 1C4Y2 4CRGA 5ABWA 1ABIH 3QLPH 1O3PB 1ZTJA 2IOTA 1TGNA 1QBOA 1ZPBA 1GG6C 2XC5A 2FOGA 4U01A 4O3TA 3UR9A 1SLVB 1CO7E 3RXSA 2P8OC 5HM2A 1IQLA 4MDSA 1DWBH 2HGTH 1P09A 1SGCA 4HFPB 2BD7A 3UOPA 1ZMLA 2FMJA 1NC6A 2HVXA 1ZJDA 4FUEA 5HIZA 1A3EH 4I8HA 2PSYA 2AMQA 1LO6A 3P92A 3OTJE 2BB4A 4X1QU 2RA0A 1TBQH 3T28A 2W7SA 3VGCC 3ZV8A 1O2PA 1EX3A 4ABEA 2VIVA 1ELVA 2BD9A 4X2YA 2FZZA 3W1EA 1IOEA 1HDTH 1LPGB 1ZPZA 5EGMA 1PYTD 2BY6X 5C67A 3P8NA 1TRNA 3PROA 1V2OT 7GCHF 2DE9A 5JPMH 1NT1A 4DURA 1DITH 3AVZA 3SNEA 1GJCB 4XBBA 2XC4A 3MH7A 1AMHA 1GI3A 1GBIA 1KXCA 2GP9B 1P2QA 1LVBA 1AB9C 1K1NA 4Y76A 1UTLM 1AIXH 4Y10E 4NIWA 1XM1A 1JMOH 1ZYOA 1LHFH 2A7HA 3UUZA 1E1QD 4WMDA 3KF2A 2FM2A 1SGIB 2KCOA 5EOKA 1D3TB 4B71A 2IJD1 1SG8B 1GBHA 1CHOG 1UCYE 1CE5A 1GJAB 1SHYA 3LC3A 2K0QA 4JZDH 2FS9A 1P05A 2V3MA 5AVDA 1ZJKA 1F0SA 1HLTH 2BDIA 1C5ZB 1MZDA 2EA3A 1AN1E 4NA9H 4F55A 1GVKB 2PUQH 1C5TA 2NU0E 3KN2A 2GZ8A 3K9XB 4O97A 3LH3A 1SGYE 1GG6B 7GCHG 1V2LT 4TY6A 2OC8A 5TJXA 4D8NA 3ENSB 1K1IA 1HJAB 3TU7H 1VCWA 2G55A 4IC5A 1EB1H 3SQEE 1GBDA 3HKJB 2ZA5A 4A6LA 2GCHF 2G5NA 3S9AA 2BD8A 1YGCH 2ODYB 1S0RA 4X1RU 3P8OA 5EODA 1P2OA 1EOLA 1QA0A 5HM9A 1SGDE 2F4LA 3PMHB 3MU8A 2Z9IA 1FZZA 1GI1A 4DVAU 4K1TA 3SU6A 2M5TA 1GCTC 1F5RA 1K1JA 2VIPA 2PR3A 4X8UH 2A4GA 2BXTH 4FUGA 2KX4A 1KMHB 3BEFB 3MNCA 1UTQA 2CXVA 5F8ZA 4OS5A 3BSQA 2F9BH 1DX5M 4AB9A 1O3MA 1HXFH 4ABAA 3SV8A 4ACAA 2FTMA 1ESAA 1W0KD 1Z8IB 1C2MA 1EAUA 1YPJH 3TGIE 3BG4B 2A7CA 4IC6A 3QUMP 3BTHE 3Q00A 4Q7ZA 1KXFA 1ESTA 4DJZB 1V2TT 4GHTA 3A7VA 2QF0A 4MPUA 3A85A 2OLGA 4IS5A 2CHAC 2BM2A 1DVAH 2GVFA 3MTYA 1AY6H 1BJVA 5ESTE 3SV2H 2C93B 2QXIA 1HAVB 3KL6A 4Q7XA 1EPTC 2KM0A 4MTBA 3SNBA 1NBMD 1FI8A 3MH4A 2H9HA 1NRQH 3DD2H 1OXGA 1ELGA 1AU8A 1SQRA 4RKOB 3SI3H 3UWIA 4E7RG 1QRZA 9ESTA 2QF3A 1DANH 4CRFA 3SJOA 1ANBA 2BHGA 3GDVA 2CF8H 3I29A 3SU2A 1O2JA 3EDXB 3FKSD 3GDUA 4Q63A 2KAIB 4I8GA 1GGDC 1A0HB 2J98B 4CH2B 5C5NA 1MTSA 3HKIB 2BY5X 4OS7A 1TNGA 3SNCA 3BTDE 1T4VH 1WDIA 4XE4A 1ELEE 2WYGA 3F0OA 1T7CA 1FY3A 1OSSA 4B74A 2Y5GA 3A8CA 4XFQA 4OS2A 2C8WB 5HYOA 3F1SB 5DP4A 1GHXH 1MD8A 3GICB 2OQ5A 5L6NH 2FOHA 1O2ZA 1GI6A 3NKKA 4R8TB 2W7UA 1ZMNA 2K1QA 2VJ1A 1UTKA 4J1YA 1ZRKA 5E2PA 1O3JA 1DS2E 2A0QB 1KTSB 3B9FH 1HIAA 1DUEA 1G3CA 2ULLA 1O3GA 5F8TA 4ABBA 2VVCA 1N8OC 2AIPA 5ESBA 3PLKA 2G00A 1TNJA 2ANKH 1J9CH 3ATMA 4J2YB 1QIXB 1ZZZA 3RXBA 5AFYH 1ZR0A 2BOKA 4AORA 3LGWA 5CHAB 4ZKOU 1P11E 4FUCA 2XCFA 2HALA 3RXMA 5AF9H 5FBIA 1C4V2 1P2MA 4Q2KA 3ATLA 1GVLA 5J4QA 2FOMB 4YO9A 1G30B 1FV9A 1ANEA 4ZKNU 1CT0E 1ELCA 1TPPA 3G01A 5EJLA 5G4BA 4Y8XA 4ZCNA 3TJOA 1VITH 4UE7H 3ZZ7A 2BLWA 2ZQ1A 1F0TA 9LPRA 1VJ9U 1SC8U 2ZKSA 4NCYA 3UFAA 1V2WT 3NZIA 3PRBA 4ESTE 3QZQA 2WV9A 2A2QH 3MU0A 5FCKA 1DXWA 1L1JA 3PB1E 1N6XA 2WUCA 1ELBA 1F5KU 2BDBA 1ETRH 5JYIA 1IQFA 1C2IA 3RXLA 4GLYA 4D7FA 1MKWK 4YOGA 2UWLA 1GL0E 1F7ZA 1YPGH 3PM3A 3VXEH 5C5OA 3A80A 4U32A 3OEHD 3U98H 3RXTA 1KY9A 3UOUA 5T6DA 1AVWA 5EXNA 1AI8H 4BAMB 3GY3A 1OWJA 3CP7A 3B8JA 4Y0ZE 1KXBA 4YT7H 1RJXB 3SYJA 4AB8A 3MU5A 2QV1A 2SNWA 2VIOA 3N99A 1O39A 4Q7YA 1DFPA 1G3BA 2ZWLH 1QB1A 1NFYA 3U69H 2FI3E 2J97A 1JWTA 1C5NH 1ZTLA 2BZAA 3GCOA 1WXRA 1YM0A 1E0FD 4NA7A 5JBBS 2OQUA 1H8DH 2VIQA 3PYHA 1INCA 3E0PB 1EQ9A 3FP7E 1GJ5H 1P02A 4AYVB 2OBOA 1YLNA 4ISHH 1O5DH 1OWHA 2ZECA 1BBRE 1CBWC 2BVXH 1H9LB 5AHGH 4D9QA 5C2ZA 4X6NA 1O3EA 1UHBA 2W6ID 3LOXA 2EI6A 1BB0B 2CF9H 1MBMA 3E0NB 4FU7A 4BAKB 1HRTH 1W0JD 3ZVEA 1BA8B 1B5GH 1DLKB 1EASA 1O3KA 3BTGE 3LDXH 4R0IA 1HIAB 1K21H 4NWLA 3M5OA 2G51A 2ZU1A 4JK5A 1O35A 3UTUH 1C1UH 2KFWA 3F0PA 2Q6GA 1SGEE 2TGDA 2GD4B 2QF4A 4Y8ZA 4FOUC 4Q4LA 3P8GA 4AG1A 2A5KA 1GBCA 1F2SE 1CGJE 8GCHF 5LPEA 2F9UA 4ABJA 3TH4H 5C1UA 2P8OB 4MPVA 3UNSA 2TGTA 1QJ1B 1O3CA 3SUDA 4DY7B 4X1SU 1AQ7A 2PTCE 1DICA 3A83A 1HPGA 1YP9A 1QB6A 3K6ZA 4RI0A 3T25A 1O3AA 1TPAE 3T5FH 4XD7D 1QFKH 2A7JA 1SGNE 1OKXA 4K5ZA 1W14U 1GMDF 3P95A 3A86A 2LP6A 1C5SA 1HAVA 5KGOA 2Q6FA 2FPZA 1SGRE 2H5CA 3ZZAA 1P9SA 3DFLA 1BMLA 1O3FA 1A5IA 3SBKA 1Z8JB 2ZCHP 3KHVA 3WWBA 1TNLA 1TB6H 4ZHLU 1BTXA 3EQ0H 1YPEH 2FOEA 2QAAA 2GKVE 4BTIB 5A0CA 3SGQE 2AGGX 3RXUA 1ZSJA 1G2MA 2B8OH 4LOYH 1TALA 1LQDB 3ZYEA 3SJ9A 1O5AB 5E0JA 1G3EA 1RIWB 1FAKH 3D23A 1K1PA 3ZVGA 1NPMA 4DIIH 3F9FA 1IQKA 3C1KA 3H09A 3MNBA 2JETC 3RXAA 4D7GA 1AVGH 2PWXA 2ZGBH 1BBRH 4RT1A 1ELFA 3GY6A 4JYUH 5C1XA 2KCAA 4WVPE 1OP2A 1UW7A 4DW2U 1DM4B 1KLIH 3GY5A 3UQVA 1SQTA 5GCHG 3SNDA 3VGCB 1A3BH 4X6OA 1OYTH 3MO3A 1O2QA 2FXRA 1BMAA 5F6MA 3FOAA 1O2TA 1TGTA 2P94A 1Y3UA 1QL8A 1MUEB 2P59A 3SUEA 1QQ4A 3M5LA 2OXSA 2XOKD 1YF4A 1EP5A 1IQMA 2FESH 3GCHB 1DY8A 1O2WA 2ZNKH 2D26C 1SGQE 3SUGA 1AVXA 3OEED 4NWKA 5JB9S 5DP8A 2ODPA 3E1XB 4M9FA 1AB9B 2BY8X 1FX0B 1MABB 1BRUP 1LCYA 1QB9A 1QL9A 1YY3A 2YOLA 3P17H 2Z3EA 3TK9A 5EG4A 4DT7B 1NRSH 1AE5A 5I25A 3M61U 1QRWA 1G9IE 5CE1A 4YLQH 1NZQH 2NU4E 5TCAA 3ZYDA 6LPRA 1GI8B 5ETXA 1Y5BT 2A1DB 1C5LH 1S85A 2FI5E 4DOQA 1SLUB 2QN5T 1S6FA 2F91A 1BUIA 2J94A 2EI7A 2BZ6H 4A1TA 3SJKA 1SQOA 1GWAA 3LPRA 1C1SA 5K0HA 5C1YA 2HPPH 2O8WA 4JZEH 3T62A 1HAZB 1L1NA 1IQHA 2ZTZA 4NFEA 1TMBH 2FTLE 2ALVA 2FYQA 4YLUA 2GDDA 4DCDA 2VIDA 3GY2A 1W12U 3GCHC 1KXDA 4K3JA 2VVUA 1P3CA 4OS1A 3PRDA 1ID5H 4TSFD 1LKBA 1BMNH 2BD3A 1GBMA 2FIRH 3MOCA 4NZQA 1NS3A 1TIOA 2PFEA 3FZZA 3WY8A 3ZZ8A 1VGCC 1TRYA 1UCYK 3AAUA 1Y3XA 2ANWA 4TY7A 2FX6A 2OUAA 2ZI2H 3F2GA 3U8OH 3RU4D 1PQ7A 1CA8B 4GHQA 3PMAB 3QTOH 2C4FH 1UVOA 7LPRA 7ESTE 3V7TA 2WPDD 1Y8TA 1FY4A 3V0XA 4Z1MD 4CRCA 3GDSA 6CHAC 3EA8A 1QJ7B 1YPKH 3DHKH 4YTAA 2WHXA 4LK4A 4D9RA 1YLDA 5GXPA 1DY9A 4YZUA 5IYTA 1C1VH 1GHAF 1M9UA 2ESTE 2O9QA 4DT4A 2Y81A 1MKXK 1BZXE 3VPKA 3O8RA 1GBLA 3T26A 1B7XB 3EE0B 2FI4E 5DPAA 1Y59T 2B7DH 2ZHQH 1TPOA 1VR1H 4B1TA 5CDFE 2GMTC 2ANMH 1A0JA 2ZU4A 2C3SA 5DP6A 1WAYB 2ZHEH 2VGCC 4HGCA 5GJ4B 3OY6U 2JH5D 1P06A 1E1RD 1A2CH 2KCPA 1NU9A 2VVVA 1P8VC 3KQDA 4X8TH 1FIZA 2G8TA 4JYTA 1VITG 2I6QA 4A5TS 3UPEA 3EA7A 4TWWA 5SGAE 1N1LA 1BCUH 1TOMH 3GYMA 4ZROA 3UY9A 4HZHA 1ZHRA 2BLVA 3MO6A 4ISOA 1MH0A 4BAHB 3K65B 4MQAA 5A2MH 4H6TA 1DLEA 3KQEA 4B6EA 4F4OC 1GJ7B 5LPRA 4ISNA 1GI7B 4ZXYH 3FP6E 2WSSD 2VH6A 1DSUA 3GYLB 1EZXC 1TA2A 3ZVBA 1C1RA 5HKKD 1S0QA 2XBXA 3OX7U 2EI8A 1OYQA 3MFJA 2XNIA 1TLDA 2BYAX 4AGJA 1GHWH 4UFEH 2R9PA 1W3CA 2AHME 4KP0A 1O2LA 4KGAA 2QCYA 4XDEA 2BQ6B 5L30H 1C5QA 1QBNA 1GI5A 3QGJA 3T29A 1O36A 1PPGE 5C0UA 2ZHDA 4TYDA 4JK6A 3CENA 2O8UA 3ZZCA 4ISLA 2R3UA 1A46H 4A1VA 2VH0A 4CR5A 2PKAB 1QCPA 1TGSZ 2J5UA 3LJOA 1V6DA 1TPSA 1C5XB 3ZZ4A 5DN6D 1P57B 1V3XA 1YCPM 1MQ5A 4IN2A 4ZH8A 3ZZ3A 2QGRA 3OFND 1GHAG 3KEEA 4H42U 2XNDD 1YYY1 1HBTH 3E16B 1MZAA 1AKSA 1N6YA 2JIZD 1C1NA 1SPJA 1P0SH 1LQEA 2BDHA 3VB6A 1SFIA 2R0LA 2OC0A 2Z7FE 3GCTG 1Q2WA 5EW1H 4INKA 4X1PU 1GI0A 2Z3CA 1IAUA 3SQHE 2Z6BD 2F9PA 2LPRA 4XOJA 2D1JA 2AYWA 2ZFSA 2AH4X 1W11U 1O2IA 3TLOA 2JJ2D 4ZMAH 1BMMH 3ZZ5A 4XBDA 4WXIA 1V2JT 1GHBG 1XKAC 1BHXB 5A8ZA 4XRNA 1LTOA 5A0AE 4NA8A 3SO3A 2P16A 2GV7A 3QK1A 3UAIC 2VNTA 3ODFA 1F92A 3RXFA 4MNVA 3A8AA 1AO5A 3AASA 2GCHG 1FNIA 3KYFA 1S83A 4AFUA 1VGCB 1TNHA 1DUAA 4FETA 1AFQC 1KYNA 2PHBA 5T3HA 3LU9B 1AUTC 1L1GA 2NU3E 3SV7A 1ETTH 1BT7A 1O3LA 1THPB 1YWUA 3RXCA 3M3SA 1TABE 4KKDA 3SV9A 1UTPA 2OK5A 2JH0D 3BEUA 5PTPA 4WMFA 1G2LA 4UEHH 3NK8A 3U1JB 1XUKA 2J2UA 1TRMA 2Z9GA 3PMBB 3SOSA 2GCTB 2C90B 2CMYA 3LKWA 4FUJA 3UR6A 2SGQE 4K2YA 3OU0A 4YXWD 1OHHD 1HCGA 1K28D 3F3BA 2V3OH 4QT8C 2ZDNA 3IITA 1EZSC 3PLPA 3WW7A 1HV7A 1H9HE 4ABGA 2OP9A 1H8HD 3L33A 2AEIH 4VGCB 1QBVH 3H7OA 2H9TH 2G52A 1V2NT 2RDLA 1YPLH 1RTKA 2P95A 1LVMA 3QO6A 5J4SA 5LPFA 1JRTA 5FBEA 3NXPA 1TGCA 3GISB 1UVTH 3R0FA 2SGPE 2ZO3H 1ELAA 3BTQE 2TGPZ 5C20A 1BRAA 4BTTB 4RKJB 2SGAA 1CGIE 4Y7AA 1O3HA 3QWCH 2J98A 1DDJA 1ELTA 1BTYA 1DE7H 1TNKA 2KZ4A 1PQAA 1RRKA 2Y7XA 4AYYB 2JH6D 1Z7KA 1WV7H 1D6RA 1JRSA 2OBQA 3W95A 1OS8A 4X0WU 3BTFE 2CGAA 1HJAC 2PGQB 3DUXH 4FUDA 1ACBE 3FAOA 1RTLA 2WPJS 5EJZA 3SORA 1O2RA 4Y79A 1C2JA 5IDKA 4I32A 2SGEE 3TK5A 3M7UA 1RFNA 3RXOA 2A4RA 1S81A 2Z3DA 3L3TA 1O5CB 1D3PB 1PQ8A 2HNTC 2BQWB 2GT7A 3VXFH 3SW2B 5EQSA 1KDQA 3LT3A 1WSSH 2A4QA 4NGAH 1ARCA 2FOCA 1O33A 2P3TB 1QZ8A 5GWZA 1NFUA 1W10U 1GBBA 3EE7A 1O2MA 1W8BH 4ISIH 4ASHA 1K0HA 1BRBE 6ESTA 3FANA 2V35A 1XKBC 5H4IB 2VBCA 2ZPSA 1GL1A 5GNDA 1BMFD 1EJMA 1PPFE 2HLCA 2HNTE 4AGKA 2IN2A 4OGYA 4YM9A 2M2AA 2FX4A 1MMJN 2J92A 4NIYA 3U28C 4MNWA 2A5AA 3SU3A 1CA0B 3DFJA 1FONA 4K8YA 5HMAA 3LONA 4CH8B 1TWXB 3RM2H 2GX4A 5L2ZH 1A7SA 3STIA 1PYTC 1GBAA 1MD7A 1QGFA 5FAHA 1O5BB 2ZGJA 4TPIZ 4F48B 1C4U2 1A4WH 3ZVAA 1GMCG 1HAHH 4MPXA 4UFGH 4WY3A 1GDUA 2XC0A 1DPOA 1XUGA 2G81E 2ZGCA 4ABHA 2O8LA 5DO4H 3E8LA 1AZZA 4OS4A 2Y82A 3UWJH 3ELAH 3RXQA 4I33A 2A2XH 1H4WA 4JYVH 1IQNA 2BXUH 3DSOA 2FEQH 2F3CE 1O31A 1DT2A 1XUHA 4AFZA 2KR7A 1GHVH 1ZPCA 2QC2A 2ZCLP 1LPKB 1MU6B 4Y6DA 3UB0A 4CRAA 2BDAA 5DP3A 2ZHFH 1EPTA 3U8TH 1D9IA 1AD8H 5DP5A 1UVPA 5HIYA 4BAQB 3OAAD 1EZUC 4JZIA 3SZEA 3F6UH 4SGBE 2KCYA 1SVPA 3EGKH 4UONA 5EPNA 3S0NA 4BXWA 1VCPA 2YMSC 5E2OA 3V13A 1MCTA 1BOQA 1BTZA 5FPSA 1KLTA 5LH8A 1NN6A 4OGXA 1GPZA 1D6WA 3RUOA 1CA0C 2A45B 3W94A 1SHHB 4DIHH 3R3GB 2DE8A 3H5CB 2GT8A 1SQAA 1MAXA 1GMDG 1OOKB 1NRPH 3Q3KA 1J15A 2TGAA 2J34A 4FUHA 3SHAH 3SZNA 2ZTYA 1SGPE 1LMWB 4IN1A 3RMLH 1V2QT 2Y7ZA 2WPLS 4WH8A 2B9LA 1HAOH 4INLA 2H2ZA 3O8CA 3B23B 4JZFH 5EXLA 1TBRH 3KYGA 1TBZH 3RXRA 2TRMA 4ZHMU 1C5YB 2GTBA 1KDQB 1QHRB 2VWMA 1OX1A 2WV4A 2J95A 1S84A 3IWMA 1TFXA 1C5MD 5EXMA 3SU0A 3I77A 1WYKA 1O2KA 1FY5A 1FIWA 1DWDH 2BD2A 2V3HH 1Y3VA 3HK3B 3D49H 1UTOA 3AW0A 1A0LA 3BN9A 2ZF0H 2QYIA 3MYWA 5A8XA 1ZTKA 4FXGH 3TH2H 2VU8E 3V3MA 2NU2E 5T6GA 2F43B 1BTWA 2C8YB 1HB0B 1C1WH 3FFGA 1AHTH 3KGPA 4HI3A 1QL7A 1DWCH 3MO9A 3RMMH 8ESTE 3ZVCA 4I31A 3NRLA 1EB2A 3VB7A 1LDTT 1E37B 1W13U 2BDGA 1V2KT 3OTPA 4H4FA 4XSKU 2JJ1D 3VEQB 1GMHF 1XXFA 5FX6A 3CS7A 4A92A 4Y71A 1O3OA 1LHGH 3P6ZB 1OP0A 4GPGA 4K8BA 2FS8A 1VKYA 3FO8D 1FPHH 1ANDA 1HAXB 2PKAA 1YPHC 2UUJB 4GVUA 4CHAB 4DG4A 1GBTA 1Z1JA 1FDPA 3FZDA 2PKSB 1UK2A 2AFQB 1YCPH 2ZIQH 2ZCKP 2XBWA 1CBWB 2Q1JA 2V7QD 4THNH 3T27A 3TJNA 4AFSA 1V2MT 3EYDA 1O2XA 1VCQA 3PV5A 1J16A 3STJA 2O8MA 2STBE 2VB0A 3SJIA 1PJPA 1C1QA 1GBEA 2GGVB 2F83A 4LZ1H 1P2JA 2YNBA 2DUCA 4CRBA 1S6LA 2KAIA 3MNSA 2AGIX 4GCHF 1O2YA 1GVZA 1EAWA 1HAPH 5F8XA 2ANYA 4Y0YE 4WWYA 2BOHB 3ZVDA 3S7KB 4GUXA 1C2DA 3DA9B 4HTCH 1UHBB 4NSYA 3DSGA 2FP7B 4X2VA 1QQUA 1AGJA 4X2XA 1WQVH 1C1MA 1L0ZA 1HAIH 5DGJA 3ESTA 2IJOB 4FUFA 2PV9B 1C2GA 1GHBF 1FPCH 5CMXH 2FLBH 1OWIA 5GDSH 2R2MB 2R2WU 2ODQA 4JCNA 3UQOA 2ALPA 2XTTB 1IQJA 1GI9B 2HLDD 2AERH 1WTGH 3BTME 2BLQA 2W6JD 3FN8A 1CSOE 1NFWA 1GDNA 4F49A 4RN6A 3VB4A 1V2PT 2ZPQA 3S9BA 2FO9A 3HATH 1THSH 2UUKB 1EKBB 1T8LA 5TCCA 3K6YA 3GY4A 3A82A 4B73A 3AW1A 3F2FA 3O8BA 2QE7D 4CRDA 2ZZUH 1GBFA 3LJJA 5EPYA 4ZUHA 4NFFA 2STAE 1GJ9B 3ZV9A 3RMNH 1D3DB 3HPTB 4E7NA 2VWLA 1O3DA 3MH5A 1AZ8A 1ZOMA 2ZTXA 1NRRH 4RSPA 4GCHG 3TIUA 2WUBA 3RP2A 1C2LA 2O8TA 3RXHA 4O03A 5A8YA 2W26A 3U9AH 1RS0A 4A1XA 2ZU5A 1DSTA 5EQQA 3MU4A 2BX3A 1O3IA 1SL3A 1IHSH 4MNXA 1MTWA 2G5VA 1THRH 2BY9X 1GJ6A 1LHCH 4NSVA 3NPSA 2QXHA 2A4OA 1SB1H 1GJDB 2BDCA 1ZGIA 2PP6A 2F9VA 4SGAE 2GDEH 1O2HA 1A5HA 2ZFFH 1C2EA 1MTUA 8KME2 3SUFA 4X8VH 1UVUH 3ITIA 2QA9E 2B0FA 1YKTA 3FVFB 1DOJA 5C94A 3A7YA 5KECA 2G4TA 2XRCA 3MQKC 2C8XB 1LPZB 2FLRH 1K1OA 1W7GH 1CU1A 1O2NA 2OINA 4AN7A 1SFQB 2H6MA 3LGIA 4ABDA 3LH1A 1O37A 4X6MA 1D3QB 2AGEX 4IW4E 3DT0H 4K69A 4VGCC 3HGNA 1EZQA 3F68H 2FYRA 1NBME 2GZ7A 5DP7A 1KTTB 3N7DA 1SGTA 4E05H 3D65E 4B76A 2VGCB 1H8ED 4WF8A 2Z9LA 1QY6A 1MQ6A 1P9UA 1YBWA 1EOJA 4FVBA 4ASUD 1BQYA 1BHXF 4MLFB 4AX9H 3QX5H 4AFQA 3AK5A 2ASUB 1FQ3A 1NESE 1SBWA 4H6SB 8GCHG 4FU8A 4Q80A 4B2CA 2IPQX 2WZQA 1MTNC 1C5UA 2XWBI 5JB8S 2RG3A 5HXFA 1E79D 2H9EH 3GY8A 4YOIA 4AG2A 2P3UB 3OY5U 3BF6H 2WPMS 1C1PA 1JIRA 1O0DH 1BJUA 5FL7D 1CHOF 1W7XH 2BTCE 1C9TA 4Z6AH 3AAVA 3SNAA 1SLXB 4IMQA 3S69A 2V6NA 3PO1C 2WV5A 2UWPA 1GMHG 1WQSA 2QIQA 3ATKA 2ZFQH 1EP6A 1O2UA 1SLWB 1ZRBA 3RXIA 1FXYA 2ZEBA 4BXSA 1RD3B 1Y3YA 1S5SA 3RXVA 1H1BA 2CHAB 5KEDA 2H1UA 3BV9B 2ILNA 4ACBA 3DSPA 1XX9A 4WJG2 4PROA 1MKWH 2CJIA 1GMCF 2G4UA 4B2BA 5E0GA 4WMEA 3EAJA 1OP8A 2NWNA 1IQGA 1P03A 3ZZ6A 1DWEH 3QZRA 4KTCA 3NUMA 3E91A 1HJ9A 3RXJA 3TNSA 2YMSB 1EPTB 2TPIZ 4TWYA 2RCEA 2PLXA 6GCHG 2QF5A 1K22H 5EU8A 1ZGVA 1CGHA 1FJSA 1WOFA 3F9EA 3K2UA 2F9NA 3SU4A 2WPIS 1LHEH 2PKSC 3EA9A 1HAYB 1NROH 3OSYA 4IMZA 1O5FH 2AS9A 2XCNA 3M5MA 4FUIA 3GS9A 3ATIA 3BIVH 1GJ4H 1O30A 4I86A 2WYJA 1BIOA 2PGBB 1K1MA 3A89A 4BAOB 3QGNB 2IPHA 4Z0KA 4YESB 1P2NA 3PV4A 1O5GH
chains in the Genus database with same CATH topology
3S7HB 1EJNA 2W5EA 1NO9H 2OTVA 4B2AA 1LVOA 3QTVH 4OS6A 3A84A 1HNEE 2BD5A 4K1EA 1NFXA 1Z6EA 2HNTF 2Z94A 4KELA 5EQRA 5DKMA 1ZSKA 1TX6A 5DG6A 5BRRE 2P3FH 1MTVA 1GJBB 3F9HA 1OPHB 4AOQA 1AE8H 4TPYA 4Y11E 1C1OA 1ORFA 1C5WB 2R3YA 1FUJA 1JBUH 1KLJH 1P10A 3TPIZ 1FN8A 2Y5HA 4KTSA 1EJAA 1TMUH 1Z6JH 2FODA 2HRVA 3RMOH 4MNYA 1TYNA 4U2WA 3RLWH 2VIWA 2XXLA 2JETB 1FLEE 2A5IA 4K1SA 3VB5A 3MU1A 1P01A 1BTHH 1SGFG 2F9OA 5FX5A 1NTPA 3SJ8A 3N7OA 3LIWA 1P12E 2SFAA 1ETSH 1K9OE 1TX8A 1FN6A 1Z8GA 3UREA 1CT4E 3LGUA 1RGQA 1MCVA 1UK3A 2BD4A 3MNXA 1E38B 3QN7A 1Z1IA 2I6SA 1MKXH 1TNIA 2J38A 1GCTB 3L6PA 3Q77A 3RXPA 2Q6DA 1ZMJA 3MI4A 6CHAB 5FHTA 4BTUB 1UMAH 1C5PA 1AFEH 1A61H 1PQ5A 4WH6A 3RXGA 1EAXA 1ZHMA 1TQ7B 4LZ4B 1UVSH 1XVOA 5A09A 4CBOA 1T31A 4ZHAA 3RLYH 3RXKA 2A31A 3FP8E 1PPHE 1J8AA 1J17T 2FOBA 3SGAE 3M3VA 1H9IE 2Y6TA 4FUBA 4FVDA 3M37A 4ABFA 4GSOA 1GCDA 1HAGE 2UUFB 3A8BA 1UJ1A 1XMNB 3ATWA 1NY22 1GI2A 3D62A 1AUJA 1W0ZU 2H5DA 2BDYA 4UFFH 2A32A 3A87A 1RIWC 1XUJA 4Y8YA 1BDAA 2XYAA 4CREA 1O38A 1C5RA 1O34A 1T8OA 2CV3A 1WU1A 2NU1E 3M35A 1QNJA 4MG3A 1UO6A 2HPQH 3PO1B 4LXBH 1G3DA 1IQEA 3A7XA 3M3TA 4XBCA 2TIOA 1ARBA 1KSNA 3TNTA 4ZAEA 2ZDMA 2BY7X 4KTUA 2SGDE 5T6FA 1VZQH 4BANB 1AKSB 4IBLH 1E36B 3RXDA 1TE0A 3SU5A 2J9NA 1C1TA 1TA6A 3A8DA 1CVWH 1P04A 1PPCE 1SGFA 2ZFTA 5EW2H 3PMJA 5DJ7A 1O3BA 1Q31A 1RXPA 1V2UT 3U8RH 1QR3E 2BVSH 3P70B 1PPBH 1FMGA 2BQ7B 1QRXA 1T32A 1GDQA 1QTFA 3E6PH 3T2NA 1UTJA 2WINI 4UD9H 1O32A 1O2VA 3P8FA 8LPRA 3QDZB 1EATA 2Y80A 4E06H 1UCYH 3TGJE 1A1RA 2ZQ2A 1PPZA 2C8ZB 3KIDU 1VITF 3E90B 4D76A 2XBVA 1T8NA 2XW9A 2CN0H 4I8KA 4M7GA 1AWFH 5JBCS 1HGTH 3TJVA 3O8DA 1Y3WA 3RC5A 3RM0H 3TH3H 2ZHWH 2ZG0H 1IHTH 1V2VT 3M7TA 3UIRA 3KQCA 4X8SH 4A7IB 1C5OH 2QXGA 4B75A 2V0BA 2FOFA 3SV6A 1XUIA 3I78A 3A81A 3TVJB 5DP9A 1P2IA 1ANCA 5A0BA 3SN8A 4JZ1A 1GHYH 3RDZA 3CS0A 1QJ6B 2ZGXH 1O3NA 3U1IB 1TOCB 4JMYA 3LGTA 3RXEA 1CHGA 1DXPA 3GCNA 3PLBA 4CBNA 5HGGA 3GOVB 5FPYA 5JBAS 1ZLRA 1IQIA 1W0YH 3BG8A 1GBKA 4DGJA 2ZDVH 1KXAA 2ZP0H 5E8EH 1GJ8B 1F5LA 3ZZ9A 2XWAA 1A5GH 1OWKA 2ZDKA 1UTNA 4UFDH 4O3UA 2BX4A 1MTNB 1ZSLA 2ZFPH 2VWOA 2Z9KA 2ZPRA 2D8WA 1Z8RA 1P3EA 1JXPA 1SOZA 2R0KA 1UTMA 1FY1A 1F0UA 2ZU2A 4CHAC 1S82A 1Q3XA 5FCRA 1EAIA 4ABIA 1E34B 3A7TA 1HFDA 2VWNA 3PTBA 5BPEA 3V12A 5B6OA 6GCHF 1AFQB 1J14A 3ZZBA 2PW8H 1YPHE 1QA7A 1NU7B 1Z71A 2ZGHA 2J4IA 1B0EA 3PWCA 1XUFA 1JOUB 3TK6A 3ZZDA 5GPIB 2Z9JA 2WPKS 2AIQA 1V2ST 3GY7A 1YLCA 2UWOA 5E0HA 1LKAA 1PPEE 1NRNH 2ZFRH 4WXVA 1SSXA 2WPHS 3PWBA 1ESBA 1O5EH 4X2WA 3TGKE 2BMGB 1D4PB 1MU8B 3RC6A 1ZHPA 3URDA 2W3IA 3BTWE 1TAWA 1O2OA 1YCPK 1PFXC 2FOAA 5GCHF 5I46H 2GV6A 2SNVA 3MWIU 2FDAA 1C5VA 3PTNA 1C2FA 2D2DA 4CR9A 4ZKRU 2GZ9A 2SGFE 4NIXA 1VJAU 1GHZA 3LGYA 2QXJA 2P93A 1TONA 1TMTH 3UNRA 1ABJH 4YT6H 1TQ0B 5FPTA 4ZKSU 3UNQA 1QURH 5DK1A 5AFZH 1RTFB 3KNXA 1BBRK 1GI4A 2ZU3A 1N8OB 1MAYA 1OWDA 3VB3A 1TGBA 3SHCH 1X7AC 3A88A 3MHWU 1C9PA 1H8IH 3BG4C 4NG9H 2GMTB 3Q76A 2GCTC 1SMFE 2THFB 4X6PA 3Q3YA 2TBSA 2OD3B 3TITA 5CHAC 1W2KH 3S9CA 1CQQA 3RU4E 3NCLA 2PSXA 1U6QA 1JIMA 4FU9A 3OYPA 1KXEA 1FY8E 1MBQA 2ZC9H 3URCA 2AMDA 3M7QA 2UUYA 2OC1A 4I8LA 4ZXXH 2OC7A 2PUXB 5F03A 1TX7A 3LGVA 4NIVA 3F9GA 4Y7BA 1XXDA 3VFEA 1AWHB 1B0FA 2BLOA 1NM6A 2BVRH 5K7RA 1K2I1 1FAXA 1G32B 1BTUA 3NWUA 2VINA 3HGPA 2YNAA 1HYLA 1WTHD 1CT2E 1LHDH 1T4UH 2HWLB 4X1NU 3SI4H 3BTKE 1O2GH 2OCVB 4INHA 3RC4A 2PTNA 1EUFA 2Y5FA 2XBYA 1Y5AT 2QY0B 3IG6B 1LVYA 3JZ2B 5L2YH 4AZ2B 1T8MA 3ODDA 1BRCE 2W3KA 3ZVFA 4U30A 1S6HA 1GGDB 3C27B 4I8JA 1F0RA 1L4DA 3TJUA 1YC0A 1BITA 1SI5H 4IGDA 3KCGH 2RA3A 1OWEA 1E35B 3A7WA 3BEIB 3GCTF 1Y5UT 1KIGH 5GIBA 5JDUB 1P2KA 5FXLA 3KQBA 3JZ1B 3Q3XA 4MVNA 3H7TA 2ZDLA 4O9VA 1C2KA 1EXFA 1V2RT 1GBJA 2EEKA 1ELDE 1YPMH 4YOJA 4BNRA 3LC5A 1SOTA 3E3TA 1BTPA 2LNCA 7KMEH 3RU4T 1K1LA 1C2HA 4MPWA 4K60A 1L4ZA 3BTTE 3BIUH 3MMGA 2ZDAH 1G36A 3M36A 1HJ8A 3BTEE 2HOBA 2AMPA 2JKHA 4I7YH 1WUNH 1XVMA 2EC9H 5JBTA 1L2EA 5LGOA 1WCZA 3A7ZA 3HK6B 5C3NA 1UK4A 1O2SA 4NZLA 1HUTH 2B5TB 3SU1A 2FWWA 3SGBE 4BOHA 4GAWA 3M5NA 1G37A 3MH6A 1WBGB 4UDWH 1HXEH 1SR5C 1C4Y2 4CRGA 5ABWA 1ABIH 3QLPH 1O3PB 1ZTJA 2IOTA 1TGNA 1QBOA 1ZPBA 1GG6C 2XC5A 2FOGA 4U01A 4O3TA 3UR9A 1SLVB 1CO7E 3RXSA 2P8OC 5HM2A 1IQLA 4MDSA 1DWBH 2HGTH 1P09A 1SGCA 4HFPB 2BD7A 3UOPA 1ZMLA 2FMJA 1NC6A 2HVXA 1ZJDA 4FUEA 1A3EH 4I8HA 2PSYA 2AMQA 1LO6A 3P92A 3OTJE 2BB4A 4X1QU 2RA0A 1TBQH 3T28A 2W7SA 3VGCC 3ZV8A 1O2PA 1EX3A 4ABEA 2VIVA 1ELVA 2BD9A 4X2YA 2FZZA 1IOEA 1HDTH 1LPGB 1ZPZA 5EGMA 1PYTD 2BY6X 5C67A 3P8NA 1TRNA 3PROA 1V2OT 7GCHF 2DE9A 5JPMH 1NT1A 4DURA 1DITH 3AVZA 3SNEA 1GJCB 4XBBA 2XC4A 3MH7A 1AMHA 1GI3A 1GBIA 1KXCA 2GP9B 1P2QA 1LVBA 1AB9C 1K1NA 4Y76A 1UTLM 1AIXH 4Y10E 4NIWA 1XM1A 1JMOH 1ZYOA 1LHFH 2A7HA 3UUZA 4WMDA 3KF2A 2FM2A 1SGIB 5EOKA 1D3TB 4B71A 1SG8B 1GBHA 1CHOG 1UCYE 1CE5A 1GJAB 1SHYA 3LC3A 4JZDH 2FS9A 1P05A 5AVDA 1ZJKA 1F0SA 1HLTH 2BDIA 1C5ZB 1MZDA 2EA3A 1AN1E 4NA9H 1GVKB 2PUQH 1C5TA 2NU0E 3KN2A 2GZ8A 3K9XB 4O97A 3LH3A 1SGYE 1GG6B 7GCHG 1V2LT 4TY6A 2OC8A 5TJXA 4D8NA 3ENSB 1K1IA 1HJAB 3TU7H 1VCWA 2G55A 4IC5A 1EB1H 3SQEE 1GBDA 3HKJB 2ZA5A 4A6LA 2GCHF 2G5NA 3S9AA 2BD8A 1YGCH 2ODYB 1S0RA 4X1RU 3P8OA 5EODA 1P2OA 1EOLA 1QA0A 5HM9A 1SGDE 3PMHB 3MU8A 2Z9IA 1FZZA 1GI1A 4DVAU 4K1TA 3SU6A 2M5TA 1GCTC 1F5RA 1K1JA 2VIPA 2PR3A 4X8UH 2A4GA 2BXTH 4FUGA 3BEFB 3MNCA 1UTQA 2CXVA 5F8ZA 4OS5A 3BSQA 2F9BH 1DX5M 4AB9A 1O3MA 1HXFH 4ABAA 3SV8A 2FTMA 1ESAA 1Z8IB 1C2MA 1EAUA 1YPJH 3TGIE 3BG4B 2A7CA 4IC6A 3QUMP 3BTHE 3Q00A 4Q7ZA 1KXFA 1ESTA 4DJZB 1V2TT 4GHTA 3A7VA 2QF0A 4MPUA 3A85A 2OLGA 4IS5A 2CHAC 2BM2A 1DVAH 2GVFA 3MTYA 1AY6H 1BJVA 5ESTE 3SV2H 2C93B 2QXIA 1HAVB 3KL6A 4Q7XA 1EPTC 4MTBA 3SNBA 1FI8A 3MH4A 2H9HA 1NRQH 3DD2H 1OXGA 1ELGA 1AU8A 4RKOB 3SI3H 3UWIA 4E7RG 1QRZA 9ESTA 2QF3A 1DANH 4CRFA 3SJOA 1ANBA 2BHGA 3GDVA 2CF8H 3I29A 3SU2A 1O2JA 3EDXB 3GDUA 2KAIB 4I8GA 1GGDC 1A0HB 4CH2B 5C5NA 1MTSA 3HKIB 2BY5X 4OS7A 1TNGA 3SNCA 3BTDE 1T4VH 4XE4A 1ELEE 2WYGA 1T7CA 1FY3A 1OSSA 4B74A 2Y5GA 3A8CA 4XFQA 4OS2A 2C8WB 5HYOA 3F1SB 5DP4A 1GHXH 1MD8A 3GICB 2OQ5A 5L6NH 2FOHA 1O2ZA 1GI6A 3NKKA 4R8TB 1ZMNA 2K1QA 2VJ1A 1UTKA 4J1YA 1ZRKA 5E2PA 1O3JA 1DS2E 2A0QB 1KTSB 3B9FH 1HIAA 1DUEA 1G3CA 2ULLA 1O3GA 5F8TA 4ABBA 2VVCA 1N8OC 2AIPA 5ESBA 3PLKA 2G00A 1TNJA 2ANKH 1J9CH 3ATMA 4J2YB 1QIXB 1ZZZA 3RXBA 5AFYH 1ZR0A 2BOKA 4AORA 3LGWA 5CHAB 4ZKOU 1P11E 4FUCA 2XCFA 2HALA 3RXMA 5AF9H 5FBIA 1C4V2 1P2MA 4Q2KA 3ATLA 1GVLA 5J4QA 2FOMB 4YO9A 1G30B 1FV9A 1ANEA 4ZKNU 1CT0E 1ELCA 1TPPA 3G01A 5G4BA 4Y8XA 3TJOA 1VITH 4UE7H 3ZZ7A 2BLWA 2ZQ1A 1F0TA 9LPRA 1VJ9U 1SC8U 2ZKSA 4NCYA 3UFAA 1V2WT 3NZIA 4ESTE 3QZQA 2A2QH 3MU0A 5FCKA 1DXWA 1L1JA 3PB1E 1N6XA 2WUCA 1ELBA 1F5KU 2BDBA 1ETRH 5JYIA 1IQFA 1C2IA 3RXLA 4GLYA 4D7FA 1MKWK 4YOGA 2UWLA 1GL0E 1F7ZA 1YPGH 3PM3A 3VXEH 5C5OA 3A80A 4U32A 3U98H 3RXTA 1KY9A 3UOUA 5T6DA 1AVWA 5EXNA 1AI8H 4BAMB 3GY3A 1OWJA 3CP7A 3B8JA 4Y0ZE 1KXBA 4YT7H 1RJXB 4AB8A 3MU5A 2QV1A 2SNWA 2VIOA 1O39A 4Q7YA 1DFPA 1G3BA 2ZWLH 1QB1A 1NFYA 3U69H 2FI3E 1JWTA 1C5NH 1ZTLA 2BZAA 3GCOA 1YM0A 1E0FD 4NA7A 5JBBS 2OQUA 1H8DH 2VIQA 3PYHA 1INCA 3E0PB 1EQ9A 3FP7E 1GJ5H 1P02A 4AYVB 2OBOA 4ISHH 1O5DH 1OWHA 2ZECA 1BBRE 1CBWC 2BVXH 1H9LB 5AHGH 4D9QA 5C2ZA 4X6NA 1O3EA 1UHBA 3LOXA 2EI6A 1BB0B 2CF9H 1MBMA 3E0NB 4FU7A 4BAKB 1HRTH 3ZVEA 1BA8B 1B5GH 1DLKB 1EASA 1O3KA 3BTGE 3LDXH 4R0IA 1HIAB 1K21H 4NWLA 3M5OA 2G51A 2ZU1A 4JK5A 1O35A 3UTUH 1C1UH 2Q6GA 1SGEE 2TGDA 2GD4B 4Y8ZA 3P8GA 4AG1A 2A5KA 1GBCA 1F2SE 1CGJE 8GCHF 5LPEA 2F9UA 4ABJA 3TH4H 5C1UA 2P8OB 4MPVA 3UNSA 2TGTA 1QJ1B 1O3CA 3SUDA 4DY7B 4X1SU 1AQ7A 2PTCE 1DICA 3A83A 1HPGA 1YP9A 1QB6A 3K6ZA 3T25A 1O3AA 1TPAE 3T5FH 1QFKH 2A7JA 1SGNE 1OKXA 4K5ZA 1W14U 1GMDF 3P95A 3A86A 1C5SA 1HAVA 2Q6FA 2FPZA 1SGRE 2H5CA 3ZZAA 1P9SA 3DFLA 1BMLA 1O3FA 1A5IA 3SBKA 1Z8JB 2ZCHP 3KHVA 1TNLA 1TB6H 4ZHLU 1BTXA 3EQ0H 1YPEH 2FOEA 2QAAA 2GKVE 4BTIB 5A0CA 3SGQE 2AGGX 3RXUA 1ZSJA 1G2MA 2B8OH 4LOYH 1TALA 1LQDB 3ZYEA 3SJ9A 1O5AB 5E0JA 1G3EA 1RIWB 1FAKH 3D23A 1K1PA 3ZVG