1K1OA

Bovine trypsin-inhibitor complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TRYPSIN
publication title Factorising ligand affinity: a combined thermodynamic and crystallographic study of trypsin and thrombin inhibition.
pubmed doi rcsb
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k1oA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k1oA02
3TU7H 4XBBA 3SGAE 1O33A 2LNCA 4YZUA 1D6RA 1C2KA 1OSSA 2Z3EA 5I46H 5L2ZH 1FNIA 4FUJA 1F5LA 4UD9H 3H7OA 3Q3XA 4RSPA 1RTLA 1C1SA 3FZDA 1SG8B 2VIWA 1MKWH 2R3UA 3SV8A 3KN2A 3PROA 2BX4A 1EP6A 2BXTH 3RDZA 5EW2H 1O2ZA 1J15A 3HATH 8GCHF 5LH8A 1FIWA 1QA7A 4ABFA 1T32A 1T8OA 1S84A 1JBUH 5ESTE 1EUFA 3MTYA 3E90B 1T7CA 1O2OA 1LHEH 2Y82A 1IHTH 2R2WU 5DP9A 1Z6JH 1SGQE 1CHOF 4D8NA 1C1WH 1FY4A 2D26C 2ZHDA 2NWNA 1UCYE 3ZV9A 1ZR0A 2F3CE 2V35A 1TALA 2ZCKP 1MBMA 3HKIB 3FZZA 3HPTB 1LQDB 1O2IA 2GDEH 1EAIA 1BMNH 4WXVA 4YOGA 3KQBA 5DP8A 3TNSA 3AAUA 1QCPA 1ZGIA 3ATWA 3RXHA 3ZYEA 1EZXC 1YF4A 2HNTF 3GY7A 1PQAA 2J94A 5EG4A 1WYKA 3QZRA 5DK1A 1SB1H 1DY9A 3A80A 1G32B 3TGJE 1JOUB 2P93A 3GYLB 1ZJDA 2BY8X 3UIRA 1ORFA 3KEEA 4YESB 4U32A 1MCVA 4X0WU 2ZFFH 2WPMS 1ELBA 1QQUA 1F7ZA 3LU9B 2FO9A 1Z8JB 4U2WA 1QURH 3UQOA 3B23B 2Z3DA 1PPGE 2ZHQH 3RXQA 2EI6A 2BB4A 3LPRA 9ESTA 1DPOA 3C27B 2FYRA 3GCHC 4AFQA 1RXPA 4E7RG 2M5TA 2YOLA 4YOIA 1OWKA 1BIOA 2J34A 1EOLA 2O8UA 4UFDH 1AKSA 4GCHF 2BX3A 2ZDNA 3ELAH 1TPAE 2AH4X 3OYPA 4M7GA 1IQEA 1MZDA 3A7ZA 3SNAA 3TJOA 1GHBF 2PLXA 1A0HB 1DANH 1GG6C 3RXMA 1HUTH 4AFZA 5JB9S 2A2XH 3E1XB 2BDCA 1QB6A 1SGRE 1NS3A 1NRSH 1Y3VA 3LGYA 1W0YH 1WOFA 2ANMH 5E0HA 4IS5A 2ZCHP 4DIHH 2HGTH 4CRAA 2DE9A 1D3TB 1TNIA 1G30B 2XW9A 2ZA5A 3RXVA 1K2I1 1AB9C 4NSYA 1FIZA 3VB6A 1GBTA 1O2KA 2J4IA 5A0BA 2SNVA 2ZZUH 1BMAA 3RMMH 2RA0A 1MQ6A 1EJNA 3TNTA 3VXEH 3U1IB 5B6OA 3KGPA 1LVBA 2QXIA 1VZQH 3ESTA 1AUJA 3SGQE 1GI4A 5CE1A 1FAXA 3WY8A 4B2BA 3EGKH 3ZVBA 2G5VA 4K5ZA 4OS7A 1OP8A 4TPYA 2A4RA 1O3KA 3H5CB 1KTSB 2R9PA 4HTCH 5JPMH 2G4TA 3TIUA 4A1VA 1NO9H 1OXGA 2VVUA 2NU1E 1EATA 1TRYA 2BY9X 1SGDE 4ABJA 5F8XA 3SUDA 4I32A 1TGNA 3CS0A 3GY2A 3U69H 1FY5A 1GVLA 4BAOB 5A0CA 1TRNA 3A83A 4X1SU 1W2KH 1UJ1A 2C8XB 4U30A 1KLIH 3BTKE 3UUZA 3MNSA 5EQQA 4ISOA 4BAMB 1YBWA 2FLBH 2Z7FE 1THSH 2Y80A 3M5MA 3BN9A 1NRQH 2XC0A 2XTTB 1AZ8A 2BLQA 3ZVEA 5HMAA 2A4GA 4Y6DA 3A88A 4Y7BA 1OWIA 1DUAA 2VWNA 4NG9H 1V2QT 2GV7A 4MVNA 1UHBA 1BCUH 2NU2E 2AGEX 1SSXA 1MH0A 2SFAA 1XKBC 3A81A 1PPCE 1TPOA 2PUXB 3GY6A 1GBKA 1HXEH 3SHAH 2EA3A 2FM2A 2PHBA 3VFEA 5GJ4B 4Q80A 4ZH8A 4FUDA 1MTNB 4D7FA 2QY0B 2VJ1A 2A7CA 1GMDF 1SGPE 1W13U 1LCYA 1KTTB 1S0RA 1EAUA 3M7QA 4X1PU 2ZEBA 3MMGA 1IOEA 2NU4E 2AEIH 1SGYE 3SGBE 4AOQA 1EASA 4CBNA 3LGIA 1AKSB 3L33A 1C5WB 3M7UA 4ZXXH 1Y5AT 1IQMA 3IG6B 2BD3A 1FDPA 1EXFA 2ZIQH 1DXWA 1AWFH 3QLPH 1NTPA 1G3BA 2BY5X 3ATLA 1FY3A 4FUBA 4ABGA 1D6WA 2FIRH 1BRAA 2YNBA 3OU0A 3ZVCA 1EAWA 1CQQA 2BQ7B 1D4PB 1MKWK 1YPHE 1K9OE 1CA8B 2WUCA 4Z6AH 1P02A 3EA9A 3ZZDA 2ZO3H 3E3TA 3A8AA 5BPEA 1LKAA 2BHGA 4ISLA 4D9RA 1EOJA 1W8BH 2RA3A 1VITG 4WMEA 3PO1C 1GHBG 2TGAA 4NFEA 3SUFA 1TBQH 2BMGB 4VGCC 1GL0E 4LZ4B 1F5KU 3GCTF 3SW2B 1TE0A 2SGDE 2UUKB 3DFJA 4GHTA 3E0PB 3S9BA 3TJUA 1GJ4H 4O3TA 1C1UH 2JH0D 3O8BA 3SNDA 3SU6A 2UWPA 2OBQA 3RXRA 1BMLA 5GDSH 1YCPH 2FP7B 4ZKOU 4AB9A 3IWMA 3KCGH 5FX6A 1IQHA 5AHGH 1Z1JA 4JK6A 1C2EA 5FPTA 3VEQB 4R8TB 3PMAB 3LT3A 5EODA 3P70B 1YPGH 1C2HA 1H9LB 3A89A 1TMUH 1GI6A 1PFXC 5GPIB 2BD8A 1QL9A 2FMJA 4O97A 2XC4A 2GKVE 3VGCB 1P3EA 2Y81A 3M37A 5JDUB 1Y5BT 3QWCH 4MPXA 2FXRA 1YLDA 1W7XH 3A86A 3BTEE 3RU4D 2TRMA 4ISNA 4MQAA 1TGSZ 3RC4A 4ABIA 3F9EA 2AMPA 2J2UA 3FP6E 4H6SB 4X6MA 3V3MA 1LKBA 4XSKU 1P12E 1A4WH 1PYTC 4YTAA 2GVFA 1UTMA 3PMBB 1UHBB 1K1IA 2QF0A 1ZRKA 1T8NA 3RC5A 1UK2A 4FXGH 3B8JA 2Q6DA 3AW0A 3ZZBA 6GCHG 4K60A 3FVFB 2VWLA 2GGVB 1DOJA 3TGKE 5HM9A 4BTTB 2BYAX 1THPB 1J14A 2FI3E 3HGNA 1O3CA 1HXFH 2IOTA 4ABAA 4FUIA 4ZXYH 3GDVA 1ZTJA 2FODA 5LPRA 4MLFB 1VITH 1O5AB 1GJDB 1ZZZA 4K69A 2CHAB 5LGOA 1YGCH 1GWAA 4CH2B 4CRFA 1GVKB 4MDSA 1QL8A 1HJAB 1Q2WA 1MUEB 4JMYA 1O2XA 1GMDG 3UREA 1V2JT 3HKJB 1HRTH 2Z9KA 4HZHA 2GZ9A 3RXIA 4B1TA 2F9BH 1ZHPA 3DHKH 1SGFA 4I8LA 2C93B 1W12U 1GCTB 1KXBA 3ZV8A 2OC0A 4Y8YA 1OX1A 4JYTA 1XXDA 4INKA 2GT7A 4Y71A 2ZPSA 1ZSJA 3ZZ9A 1VR1H 2G5NA 2ZTZA 5EQSA 4KTUA 2HNTE 4WH8A 3HGPA 4YOJA 2CV3A 5EGMA 3OX7U 2AGIX 2UWOA 2EC9H 1XKAC 4DIIH 1MKXH 5FBIA 3SORA 3SHCH 1BTZA 2FEQH 5F03A 1O2GH 3QN7A 1O30A 2CN0H 1DY8A 4CREA 1GGDB 4NIVA 5GCHF 3RXJA 1O2JA 4I7YH 2ZP0H 5L30H 1B0FA 1BBRH 3GY3A 1AMHA 3BTFE 3GCTG 5IDKA 1GHAF 2OP9A 1WQSA 2ZI2H 2W3KA 1NY22 1M9UA 2ZGBH 3OY6U 5F8ZA 1O0DH 3O8RA 4A5TS 3ZZAA 3QTVH 3STJA 1Z8IB 2O8WA 1EP5A 1PQ5A 2VGCB 2ZDMA 1G3CA 1P57B 1PQ8A 3T26A 3BTWE 1OP0A 1O3FA 4BAQB 4DG4A 1GBLA 4NZLA 2BDAA 1C5PA 2VIQA 1NC6A 3MO6A 1NRNH 1S6HA 1TGTA 2C8YB 1VCWA 2BVXH 2SGPE 2ZDKA 4GUXA 3RUOA 3U9AH 3RU4E 1GBBA 1N8OB 1XUKA 1P05A 4KP0A 5PTPA 1ZPCA 1LVOA 3UNRA 3M3TA 1GJ6A 4KELA 1VJ9U 1LDTT 2K1QA 3MU4A 2BLVA 5DO4H 3URCA 1UTQA 1UCYH 1O3NA 1MTVA 1QY6A 2PKAA 1SL3A 2WYJA 1WUNH 1UVPA 1YM0A 3VB7A 4A1TA 2YNAA 3BTHE 3HK6B 3SU0A 1LPGB 4Y8ZA 1LPZB 1IQFA 4FVDA 3MH4A 1A5IA 3Q3YA 3LIWA 1HJ8A 1QBVH 2UWLA 1HJ9A 3U1JB 4JCNA 1VGCB 2GMTB 2ILNA 3R0FA 1KXFA 3BTQE 1SQTA 4X2WA 1GBIA 4Q7ZA 1SLVB 3QTOH 1SC8U 1GBHA 2ODQA 2OQUA 4THNH 4CRBA 3R3GB 2BD2A 2QN5T 1BUIA 4WMFA 1AO5A 2Y7XA 2QV1A 2R0KA 3D23A 4BAKB 1QRWA 4E06H 1SOTA 1AFEH 1P9SA 1YKTA 1IAUA 2BQWB 1RRKA 3ZZ5A 1G2LA 4AB8A 6CHAB 4H6TA 5EPYA 1XXFA 1C5SA 3MU0A 1E36B 2VINA 3TPIZ 2WINI 3K2UA 2QIQA 1QA0A 2GCTC 2GT8A 3D62A 3U8RH 4B74A 1ZSKA 1ELTA 3SNCA 1F0SA 1MQ5A 3QX5H 2ZU2A 2GZ8A 1EAXA 5HYOA 3M35A 1ELEE 1SVPA 1UO6A 2IPHA 1O5GH 1GHWH 1NM6A 4AN7A 2ZQ2A 3AW1A 1CBWB 1ZTLA 2JH5D 1GBCA 4H42U 3M61U 5EXMA 4AGKA 2B8OH 4AZ2B 3SJ9A 1TX7A 1F5RA 4ABBA 2H5CA 2THFB 3KQEA 2QXJA 1O37A 2H6MA 3JZ2B 1SFIA 2FS9A 3PYHA 1FY1A 1BQYA 2AIQA 3GICB 2PGQB 1U6QA 3LGWA 2VIPA 2A0QB 3BF6H 4MG3A 1QR3E 2PKSB 1Z8RA 1O3PB 2D8WA 1NN6A 2Y5FA 3MHWU 3F9HA 1T4VH 2BDHA 2O8MA 3SQHE 1BTPA 2VIVA 3L6PA 3LC5A 1MU8B 3ZZ4A 1ETSH 1ESAA 3T2NA 3BTDE 1O2NA 5T6DA 2ANYA 2C8ZB 1CA0C 1GHAG 2OLGA 4OS4A 1MTNC 2V3HH 1K21H 4XOJA 3UWIA 3A8BA 1O3AA 1ESBA 2FX6A 1CT0E 1DS2E 1S6FA 1WCZA 3LGTA 3MFJA 1BTXA 4JYVH 4I33A 1P2OA 1HAPH 1A3EH 3TH4H 2VWMA 4NWLA 4JZ1A 2ULLA 1C1VH 1OOKB 4X8TH 4AYVB 4CBOA 3RLYH 1ANCA 1TNJA 1V6DA 3A7YA 2QXGA 1AN1E 3NUMA 1FI8A 2H9HA 2ASUB 1H4WA 1L4ZA 2D1JA 5CHAB 2G51A 1JIMA 3RXDA 3OTJE 1GHVH 2PKAB 1JXPA 1O39A 1AE5A 1P2KA 4SGBE 1HPGA 1UVUH 1P09A 2OBOA 1DX5M 2A7HA 2ZTXA 2P59A 1GMHF 3EA8A 1Y8TA 5C1UA 1SHYA 1S83A 2BVSH 1FAKH 1RJXB 1GI0A 1ZLRA 5EXNA 1UVTH 3RXAA 1D9IA 2Z9GA 4MNVA 3F1SB 3E0NB 3Q3KA 1XUJA 2FOHA 3W94A 2ZC9H 2FTMA 3SUGA 2WPLS 2FOBA 1EB2A 1XMNB 5E2OA 1BRUP 1CT4E 3V0XA 1GI5A 1TOMH 1VCQA 1Y5UT 3T62A 1C5YB 4UDWH 1MZAA 1LHGH 1AVGH 5JBBS 1MD8A 5FPSA 3MU8A 3SJ8A 1P10A 3GISB 3CENA 2CF8H 4B75A 1MKXK 3P8GA 2ESTE 4Q7XA 2QCYA 2GX4A 2BVRH 1ZGVA 1OWEA 1SOZA 4YLQH 2RCEA 1HAZB 1O2VA 1V2NT 1UVOA 2C3SA 1GBFA 2PFEA 3AVZA 1SGEE 2HLCA 2BD9A 2FYQA 7ESTE 1V2OT 2F9VA 1RIWB 2J38A 2XCNA 1O36A 2ZGJA 1V2VT 1TOCB 4FUFA 3F68H 1TQ7B 3L3TA 1BBRK 3PLBA 1EJAA 1SFQB 1ACBE 1QJ1B 2WPJS 2C90B 5T6GA 4X2XA 3FP8E 1KY9A 2P8OC 4DGJA 3QGNB 1MAXA 2JH6D 2GCHF 2FI4E 4ZHAA 1H1BA 2QAAA 1AFQB 2AERH 1VJAU 4NIXA 1ELCA 2O8TA 1UTKA 1C2GA 3UPEA 1QL7A 1N6XA 2WPIS 1NESE 1S81A 5K0HA 2P95A 2TBSA 3A7VA 1C4V2 1TBZH 3RXSA 3LC3A 4X6NA 1GBAA 1BHXF 1ARBA 1O2LA 1C1RA 4JYUH 3STIA 2FZZA 8GCHG 4AG1A 3EAJA 2ZFTA 4ABDA 1HGTH 5G4BA 1C2DA 4XBDA 3QGJA 3UWJH 5EQRA 1CHOG 3UTUH 4XDEA 3Q76A 2DUCA 2Y6TA 1P06A 3DT0H 2TGPZ 1LPKB 3CP7A 1BRBE 3GCOA 2PSXA 3PLKA 1ZOMA 5T6FA 4DURA 1DXPA 1GDNA 2FWWA 4NZQA 2OCVB 4ZKRU 1SPJA 3A7WA 4Y11E 1KLJH 3BEUA 3QUMP 4NA7A 2A45B 4NIWA 3BG4C 2AIPA 4AX9H 2AMDA 1GL1A 4X1NU 5HM2A 3SO3A 4H4FA 3UR9A 4YT6H 2ZCLP 1SGFG 2XC5A 1K1LA 1T31A 5DP5A 3PB1E 1UVSH 1AGJA 4O9VA 1IQKA 2SGEE 3ZZ6A 2F9OA 2QC2A 5EOKA 1V3XA 1YP9A 2Q1JA 1GJ7B 5GIBA 2FX4A 2WPKS 1OP2A 5A0AE 2OQ5A 1UTOA 1DSUA 4IW4E 1NU9A 5DP3A 1CE5A 1GCTC 1MAYA 3KHVA 5AFZH 2OC8A 3RP2A 2WV5A 4FVBA 1ABIH 1GI7B 3M3VA 1PYTD 2OC7A 1P0SH 2ZKSA 2ZQ1A 3GY8A 2SGFE 3EE0B 1GJCB 2ZTYA 3MNXA 3MO9A 3GDSA 5L6NH 1MCTA 1IHSH 3HK3B 1SGCA 1F2SE 1C4Y2 1JIRA 1W14U 4GCHG 4AFSA 1WV7H 2UUFB 3V12A 3ENSB 4CRGA 3KNXA 3T5FH 2Z94A 2F91A 1E35B 4DT7B 2Y7ZA 1H8IH 1CT2E 1LO6A 4INLA 3RXFA 1PPEE 2BZ6H 4BANB 2KAIA 1DFPA 4Y76A 1GGDC 1BT7A 3TH2H 1O3DA 3ZZ3A 6ESTA 1V2LT 1CGJE 3K6ZA 3RXOA 1TMBH 2A2QH 1V2ST 1B5GH 5ABWA 2FOCA 3P17H 1HAIH 3T27A 1K28D 1O38A 1O2QA 2ZNKH 4WMDA 1S85A 2TGDA 2V3OH 5GXPA 1TONA 1O5EH 3SJKA 1AIXH 1AB9B 4DW2U 1PJPA 4K1SA 3ATKA 1GJ9B 2BTCE 3RM0H 5HXFA 1BB0B 1DWDH 1MTWA 4WWYA 4E05H 3E91A 4UFFH 2FOMB 1QRZA 3SU4A 3RXCA 3ZZCA 2WV4A 1B7XB 4KGAA 4GVUA 2A7JA 4K8BA 4IC5A 3SQEE 3BSQA 1MU6B 1N8OC 1KXCA 1K22H 5K7RA 1O34A 3Q77A 1AVXA 2OTVA 1TGBA 3T29A 1OYQA 1Y3YA 4Y10E 2W26A 2ZFSA 2XYAA 1GDQA 2ZFQH 3SNBA 4OS1A 2QA9E 2STAE 3LJOA 4NSVA 1HAGE 3O8CA 1DLEA 1Z71A 1L1JA 2HVXA 3LONA 4A92A 2F9NA 1LQEA 1EZUC 3GDUA 3RU4T 1O32A 4MPUA 4I8HA 1A1RA 2VIOA 4IBLH 2UUJB 3UY9A 3P8OA 4WXIA 3FP7E 4B76A 4D76A 3FAOA 1WSSH 3ZZ7A 1O3OA 7GCHF 3M5OA 3BIUH 5C20A 4AG2A 4IN2A 1GDUA 1YCPM 4OS5A 1W0ZU 1EZQA 2O8LA 1O2UA 1KSNA 1P03A 4IMQA 5I25A 1DE7H 1RD3B 1SGIB 4B2AA 4D9QA 1P2IA 2Z3CA 3U98H 4ESTE 1O3JA 1QB9A 2CJIA 2GDDA 4MNWA 1TNGA 2BY6X 2OINA 2BM2A 4LOYH 2W5EA 1A5HA 3A8DA 1BA8B 2BOKA 1AE8H 3A7XA 1GJBB 2I6SA 2ZDVH 1O5BB 4JK5A 3ZVGA 4ABHA 2WUBA 2ANWA 1WAYB 2IJOB 1TLDA 3T28A 3NK8A 1P11E 4JZIA 1LHCH 2A32A 3PM3A 3P95A 2CF9H 1ZJKA 2XXLA 3RXTA 1O2RA 1BTWA 3PV4A 4IC6A 2ZFRH 2ZHEH 4HI3A 2W3IA 5F8TA 3MWIU 1SR5C 3EA7A 4X1RU 1BZXE 2KAIB 1IQIA 5C1XA 1ZPZA 1TMTH 3S9AA 1S0QA 1DUEA 2ZWLH 1FMGA 2F83A 1HBTH 1A2CH 2PKSC 1KDQA 4NGAH 3NPSA 4U01A 4TPIZ 4ISIH 5DPAA 4QT8C 1O3GA 2W7UA 1ELVA 4K2YA 3UQVA 2R0LA 1OKXA 1MD7A 4X6OA 5HGGA 4AGJA 1DT2A 4GPGA 4J2YB 2GZ7A 3PO1B 1TYNA 1PPZA 3RXKA 1GMCF 1LVMA 1HAOH 1G2MA 1KYNA 2Q6FA 2ZU1A 1A0JA 5L2YH 3M5NA 1LMWB 2J92A 1H9HE 5ESBA 3D49H 1JMOH 3B9FH 4B2CA 1YPMH 1C2MA 4D7GA 1UK4A 4A1XA 2BQ6B 3NKKA 4RKJB 4MTBA 1AD8H 1OWDA 2CXVA 5CHAC 3MH7A 2TPIZ 2SNWA 3A84A 1BDAA 1HFDA 2F9PA 1ZHRA 3MYWA 2ZF0H 2PTCE 2QF3A 3P6ZB 4KTSA 2A5IA 2H1UA 4BNRA 2JETB 3SU1A 3ZVFA 1N1LA 1Y3UA 1C2LA 1EPTA 3G01A 3URDA 3PMJA 3A7TA 3GY4A 5EPNA 2ZG0H 3MU1A 1XVOA 3AAVA 1C1NA 5AVDA 5CMXH 1TA6A 3MNBA 1UMAH 1AQ7A 1FQ3A 1SMFE 2BD4A 2HRVA 2ZU4A 4NWKA 1ELGA 1GI9B 1ID5H 1C9TA 1O5FH 2D2DA 1C5RA 4AORA 1YPJH 5J4QA 2VIDA 3MOCA 4OS6A 1THRH 2ZECA 3SU5A 3NXPA 2EI8A 1C5VA 2XWBI 5FX5A 1V2MT 1C5TA 1K1JA 2GD4B 3SU3A 2BDYA 1TRMA 1Z6EA 4K3JA 3SU2A 3LDXH 2PSYA 2XRCA 4JZEH 4MNXA 1FPCH 2A4OA 1BTUA 3LH3A 2UUYA 1YCPK 3FANA 3SN8A 3ODDA 1C2FA 1B0EA 2AFQB 3BEFB 1PPHE 1QQ4A 1RFNA 1BBRE 4X8UH 1O2PA 4SGAE 4Q7YA 3ITIA 5SGAE 3RMOH 3F9GA 1ELDE 1XX9A 5C67A 3S0NA 3KQCA 3RLWH 3IITA 3TLOA 5J4SA 5DG6A 4ASHA 2ODPA 4XBCA 4GSOA 4I31A 2A31A 1OS8A 1KDQB 2O9QA 3OSYA 5T3HA 2FS8A 2G8TA 3E6PH 1WTGH 1XUIA 1YYY1 3TVJB 3GYMA 1RGQA 1WQVH 3RMNH 3P8NA 3FFGA 4LK4A 1HAHH 3I78A 1Z7KA 2ZPRA 2P3UB 5JBTA 1GHZA 4X2VA 2HWLB 4RN6A 1QHRB 4K1EA 5JYIA 3SV6A 1DLKB 1HNEE 1O2MA 4Q2KA 4CHAB 4OGXA 3OY5U 3V13A 2FTLE 5GCHG 3PLPA 1XVMA 1LHFH 1P8VC 2G55A 4FU8A 2AGGX 5FXLA 3P92A 4BTUB 4ZHLU 1T8LA 3NWUA 1TNHA 2TGTA 1GMCG 2A5AA 1TABE 4Y0YE 4GLYA 2BDIA 2AYWA 5EU8A 4DJZB 4YT7H 3TK9A 1C5UA 3RXEA 2ZGXH 1HCGA 9LPRA 5GWZA 1EX3A 1H9IE 4ISHH 4WJG2 5AF9H 1GJ5H 2H9EH 1YPLH 4MPWA 3LOXA 3Q00A 1TNLA 1EPTB 2BD7A 4JZDH 2PUQH 1GVZA 3UOPA 1A3BH 1XUFA 2C4FH 2ZHWH 4LZ1H 1KXAA 4MNYA 5F6MA 1S5SA 1WTHD 3RXUA 1ZYOA 2SGQE 3SOSA 1O5DH 1HIAA 3ATIA 1VCPA 4IMZA 1J8AA 1GI8B 1BHXB 1BRCE 3SI3H 2W7SA 1IQJA 3TGIE 4B71A 1O3HA 1TBRH 3K9XB 3MI4A 1BTYA 1SQAA 4NIYA 2Q6GA 1FY8E 5A8XA 5FBEA 3RXGA 1E34B 1GPZA 4BOHA 4K1TA 5LPEA 5FAHA 3LJJA 3BG8A 2B9LA 2BZAA 1GBEA 4X8SH 4CR9A 1ANDA 2FPZA 1N6YA 3SBKA 1A5GH 3UNSA 1VITF 1O2WA 1TA2A 1LHDH 2ZU3A 1QBOA 4ABEA 2EI7A 2Y5GA 3KIDU 7LPRA 2ZGHA 1P3CA 4HFPB 4UFEH 2FOGA 2FI5E 3KF2A 2G52A 1C1PA 4ZAEA 3SV2H 4BXSA 3EQ0H 1G3DA 4UE7H 1UTPA 1ANBA 1ZMNA 2P3FH 2H2ZA 3A82A 5E2PA 3KQDA 1NPMA 2F9UA 1GJ8B 1UTJA 1GCDA 4WVPE 4A6LA 2FLRH 1QRXA 1V2KT 1AI8H 4XFQA 1GI2A 2R3YA 3VB4A 1MTSA 4X2YA 2PTNA 2BOHB 3I77A 3QO6A 1CHGA 1AUTC 3VGCC 4X8VH 5E0GA 1V2UT 1P2NA 2FESH 1K1PA 1BMMH 2FDAA 1YC0A 2GTBA 2Y5HA 4KTCA 4R0IA 1FJSA 3ODFA 5DP7A 1PPBH 1V2RT 3V7TA 2OUAA 3A85A 1W10U 4DCDA 2OC1A 2HALA 3SUEA 1OWHA 2VNTA 4FU7A 1OWJA 1TIOA 3TITA 2XWAA 1ABJH 1ARCA 1QGFA 1HDTH 1CGIE 1F0UA 2GCTB 1ZMLA 1C4U2 1S82A 1WU1A 1O2HA 1GBDA 3QK1A 1C5ZB 2C8WB 1K1NA 3MH6A 1TQ0B 1FXYA 2V6NA 1UCYK 2AMQA 4OGYA 3S7KB 1QTFA 1DSTA 5FPYA 4I8JA 1O35A 2BXUH 1QNJA 4X6PA 1ZRBA 4FUCA 3BTME 4F4OC 3KL6A 1NRRH 6GCHF 1EZSC 1TWXB 1QBNA 4E7NA 4YLUA 1K1OA 3MU5A 1P2MA 4O3UA 1ETRH 2VH6A 2CHAC 1RTFB 1UK3A 4K8YA 1DICA 5C1YA 1NT1A 1EQ9A 1YPHC 1P9UA 1CVWH 2ZGCA 2Z9IA 1CGHA 5IYTA 2B0FA 1V2TT 1HJAC 1XM1A 1KXEA 1D3DB 3GOVB 1C1QA 1KIGH 3BEIB 3PTBA 1TGCA 3PTNA 3M7TA 4ZUHA 1FUJA 1IQNA 1CA0B 1P2QA 3K6YA 4Y0ZE 1G3EA 1T4UH 1TX6A 1HIAB 1NFYA 3NZIA 1MMJN 1HB0B 1O3IA 1QJ6B 1FZZA 1ELFA 1C2JA 1UTNA 1C1TA 3H7TA 1EKBB 5A8YA 1ZHMA 3PMHB 1J17T 1L0ZA 1GMHG 1P2JA 1QFKH 3O8DA 1NU7B 1UTLM 5JBAS 1RS0A 1C5XB 3UR6A 2ZDAH 3GCHB 5E0JA 1Y59T 1W11U 4CH8B 2QYIA 3LKWA 8LPRA 1FONA 3A87A 1G9IE 1O3LA 3ZVAA 2H9TH 1NFWA 5FCRA 1C5MD 1Y3WA 2ZDLA 3EDXB 1O5CB 1E38B 1GG6B 2EEKA 1GI1A 4ZHMU 2H5DA 2VH0A 3TK5A 2WPHS 1P04A 2P94A 2VVCA 1AHTH 2VB0A 8KME2 2GV6A 3DFLA 4NFFA 1G36A 5AFYH 2HOBA 1AWHB 4MPVA 2ANKH 1YPKH 2CGAA 1O31A 2BLWA 2NU3E 2VGCC 5C3NA 2P3TB 2OD3B 1A61H 3ATMA 3M3SA 3P8FA 1HLTH 4A7IB 1GJAB 1OPHB 4IN1A 4DY7B 1KXDA 3QZQA 2SGAA 1IQGA 1WBGB 1AY6H 3SI4H 5C5NA 2JKHA 2QGRA 2GCHG 1MBQA 3ZVDA 2VU8E 5DKMA 3BV9B 4GHQA 3SV7A 3JZ1B 4YM9A 1TPSA 1HAYB 4TWWA 1QIXB 3SJOA 1BTHH 5JBCS 1INCA 1DWCH 1C2IA 1BJUA 3RC6A 2JETC 2P8OB 4DOQA 4B73A 1L1NA 1DM4B 1Z1IA 3T25A 1G37A 1YLCA 1HAVA 1DWEH 4XE4A 1ZMJA 3F6UH 4TWYA 3M5LA 1SGNE 2NU0E 1C1OA 5JB8S 4FUEA 3ZYDA 5DP4A 1JRSA 1A7SA 1BJVA 1RTKA 1E37B 4Y8XA 3SNEA 2VVVA 5A2MH 3U8OH 1MTUA 3DD2H 2HPQH 1VGCC 2GMTC 3MO3A 1AZZA 1FLEE 1Y3XA 3A8CA 4IGDA 5TCAA 2G81E 4I8KA 1FN6A 1OYTH 1EB1H 4I8GA 2RDLA 2B5TB 4NA8A 4TY7A 2ZU5A 1BITA 5H4IB 4HGCA 5TJXA 5DGJA 1C5NH 2TIOA 2ZPQA 2HNTC 2XBXA 4FUGA 5FCKA 2I6QA 1PPFE 5A09A 1V2WT 1IQLA 2XBYA 2DE8A 5FHTA 1L1GA 2STBE 2XNIA 2LPRA 1DWBH 1ELAA 5ETXA 3UOUA 6CHAC 3BG4B 3RM2H 1D3QB 2P16A 4BXWA 4DVAU 2OXSA 1A46H 1CO7E 1GHXH 3S7HB 4NCYA 1AVWA 1SHHB 2AS9A 1J9CH 3D65E 1NZQH 1DITH 2BY7X 1ZSLA 3SZNA 1NRPH 1GBJA 3F9FA 4OS2A 4ZKNU 2VWOA 1GI3A 1D3PB 2ALVA 3VB3A 4UEHH 1W3CA 1QJ7B 1CBWC 1LTOA 1HYLA 1SBWA 1XUHA 2WYGA 3U8TH 1AU8A 7KMEH 2ZHFH 1E0FD 1DVAH 1ETTH 1TNKA 1C1MA 1X7AC 3GCNA 2QXHA 4WH6A 2GP9B 2ODYB 1SLXB 3BTTE 2ALPA 1TB6H 3DA9B 4PROA 3PWBA 4CRCA 5DJ7A 2XBVA 1ZTKA 2Z9JA 3VXFH 1JRTA 2FOFA 2FOEA 1TX8A 1O2YA 1L2EA 3SJIA 4INHA 1K1MA 4CHAC 5A8ZA 2ZFPH 4WF8A 5E8EH 2J9NA 8ESTE 1ZPBA 4Z0KA 1P01A 5DP6A 4AFUA 2HPPH 2BDGA 4J1YA 3N7OA 3VPKA 4FU9A 1C5QA 1C5LH 3SV9A 1SLWB 5EW1H 2J95A 3RXBA 1Q31A 3TK6A 3RMLH 4VGCB 3S9CA 4AYYB 3UFAA 1BOQA 2PGBB 3QDZB 1C5OH 3TJVA 2R2MB 1A0LA 1XUGA 3AASA 3E16B 1TPPA 3K65B 3LH1A 3BTGE 2Z6BD 2RG3A 3C1KA 1NROH 3GY5A 3RXLA 1TFXA 3CS7A 1C9PA 1LVYA 1QB1A 1HAXB 2CMYA 1FPHH 1EPTC 1HAVB 1O3BA 1SI5H 2IN2A 2G00A 1CU1A 4GAWA 4ZROA 1SQOA 4JZFH 1DDJA 4O03A 3I29A 5C2ZA 1SLUB 3LGVA 1ESTA 3M36A 1F0TA 4YO9A 5EXLA 4TYDA 3E8LA 4X1QU 3MNCA 3NCLA 2Z9LA 1PQ7A 1O2SA 1YPEH 3BIVH 2PV9B 1L4DA 3LGUA 2V0BA 3EYDA 4UFGH 1F92A 2XCFA 3RXPA 1FN8A 2B7DH 2BD5A 2A1DB 5C5OA 4FUHA 1NFUA 2BLOA 1TAWA 1W7GH 4WY3A 1V2PT 4CRDA 1NFXA 3TJNA 2A5KA 5BRRE 1O3EA 3W95A 1GBMA 2PW8H 3DUXH 2XBWA 6LPRA 1O3MA 1SGTA 4BTIB 2A4QA 4RKOB 1HV7A 3S69A 1O2TA 7GCHG 1CSOE 5LPFA 1GHYH 4CR5A 4LXBH 3TH3H 4NA9H 1RIWC 3PWCA 4TY6A 4UONA 1F0RA 1J16A 1H8DH 1EJMA 1ANEA 4Y79A 1JWTA 4Y7AA 5TCCA 2FOAA 3UNQA 3MH5A 4F49A 2BDBA 2PWXA 1Z8GA 2PR3A 4ZMAH 1T8MA 1Q3XA 4BAHB 4KKDA 1KLTA 3VB5A 1FV9A 1AFQC 2G4UA 4ZKSU 3ZZ8A
chains in the Genus database with same CATH superfamily
3TU7H 4XBBA 3SGAE 1O33A 2LNCA 4YZUA 1D6RA 1C2KA 2XNDD 1OSSA 2Z3EA 5I46H 5L2ZH 1FNIA 4FUJA 1F5LA 4UD9H 3H7OA 3Q3XA 4RSPA 1RTLA 1C1SA 3FZDA 1SG8B 2VIWA 1MKWH 2R3UA 3SV8A 2K8IA 3KN2A 3PROA 2BX4A 1EP6A 2BXTH 3RDZA 5EW2H 1O2ZA 1J15A 3HATH 8GCHF 5LH8A 1FIWA 1QA7A 4ABFA 1T32A 1T8OA 1S84A 1JBUH 5ESTE 1EUFA 3MTYA 3E90B 1T7CA 1O2OA 1LHEH 2Y82A 1IHTH 2R2WU 1E1QD 5DP9A 1Z6JH 1SGQE 1CHOF 4D8NA 1C1WH 1FY4A 2D26C 2ZHDA 2NWNA 1UCYE 4P02A 3ZV9A 1ZR0A 2F3CE 2V35A 1S6LA 1TALA 2ZCKP 1MBMA 3HKIB 4Q4LA 3FZZA 3HPTB 1LQDB 1O2IA 2GDEH 1EAIA 1BMNH 4WXVA 4YOGA 3KQBA 5DP8A 3TNSA 3AAUA 1QCPA 1ZGIA 3ATWA 3RXHA 3ZYEA 1EZXC 1YF4A 2HNTF 3GY7A 1PQAA 2J94A 5EG4A 1WYKA 3QZRA 5DK1A 1SB1H 1DY9A 3A80A 1G32B 3TGJE 1JOUB 2P93A 4TSFD 3GYLB 1ZJDA 2BY8X 3UIRA 1ORFA 3KEEA 4YESB 4U32A 1MCVA 2W6ID 4X0WU 2ZFFH 2WPMS 1ELBA 5EIYA 1QQUA 1F7ZA 3LU9B 2FO9A 1Z8JB 4U2WA 1QURH 3UQOA 3B23B 2Z3DA 1PPGE 2ZHQH 3RXQA 2EI6A 2BB4A 3LPRA 9ESTA 1DPOA 3C27B 2FYRA 3PRDA 3GCHC 4AFQA 1RXPA 4E7RG 1OHHD 2M5TA 2YOLA 4YOIA 1OWKA 1BIOA 2J34A 1EOLA 2O8UA 4UFDH 5EJLA 1AKSA 4GCHF 5C17A 2BX3A 2ZDNA 3ELAH 1TPAE 2AH4X 3OYPA 4M7GA 1IQEA 1MZDA 3A7ZA 3SNAA 3FKSD 1GHBF 2PLXA 1A0HB 1DANH 1GG6C 3RXMA 3TJOA 1HUTH 2HLDD 4AFZA 5JB9S 2A2XH 3E1XB 2BDCA 1QB6A 1SGRE 1NS3A 1NRSH 1Y3VA 3LGYA 1W0YH 1WOFA 2ANMH 5E0HA 4IS5A 2ZCHP 4DIHH 2HGTH 4CRAA 2DE9A 1D3TB 1TNIA 1G30B 2XW9A 2ZA5A 3RXVA 1K2I1 1AB9C 2J5UA 4NSYA 1FIZA 3VB6A 1GBTA 1O2KA 2J4IA 5A0BA 2SNVA 3W1EA 2ZZUH 1BMAA 3RMMH 2RA0A 1MQ6A 1EJNA 3TNTA 2OK5A 3VXEH 3U1IB 5B6OA 3KGPA 1LVBA 2QXIA 1VZQH 3ESTA 1AUJA 3SGQE 1GI4A 5CE1A 1FAXA 3WY8A 4B2BA 3EGKH 3ZVBA 2G5VA 4K5ZA 4OS7A 1OP8A 4TPYA 2A4RA 5T1VA 1O3KA 3H5CB 1KTSB 2R9PA 4HTCH 5JPMH 2G4TA 3TIUA 4A1VA 1NO9H 1OXGA 2VVUA 2NU1E 1EATA 1TRYA 2BY9X 1SGDE 4ABJA 5F8XA 2WHXA 3SUDA 4I32A 1TGNA 3CS0A 3GY2A 3U69H 4M9FA 1FY5A 1GVLA 4BAOB 5A0CA 1TRNA 3A83A 4X1SU 1W2KH 1UJ1A 2C8XB 4U30A 1KLIH 2YMSC 3BTKE 1E79D 3UUZA 3MNSA 5EQQA 4B6EA 4ISOA 4BAMB 4AC9A 1YBWA 2FLBH 2Z7FE 3DSPA 1THSH 2Y80A 3M5MA 3BN9A 1NRQH 2XC0A 2XTTB 1AZ8A 2BLQA 3ZVEA 5HMAA 2A4GA 4Y6DA 3A88A 4Y7BA 1OWIA 1DUAA 2VWNA 4NG9H 3FOAA 5C94A 1V2QT 2GV7A 4MVNA 1UHBA 1BCUH 2NU2E 2AGEX 1SSXA 4F48B 4RI0A 1MH0A 2SFAA 1XKBC 3A81A 1PPCE 1TPOA 2PUXB 3GY6A 3F3BA 1GBKA 1HXEH 3SHAH 2EA3A 2FM2A 2PHBA 3VFEA 5GJ4B 4Q80A 4ZH8A 4FUDA 1MTNB 4D7FA 2QE7D 2QY0B 2VJ1A 2A7CA 3U28C 1GMDF 1SGPE 1W13U 1LCYA 1KTTB 1S0RA 1EAUA 3M7QA 4X1PU 2ZEBA 3MMGA 1IOEA 2NU4E 2AEIH 1SGYE 3SGBE 4AOQA 1EASA 4CBNA 3LGIA 1AKSB 3L33A 1C5WB 3M7UA 4ZXXH 1Y5AT 1IQMA 3IG6B 2BD3A 1FDPA 1EXFA 2ZIQH 1DXWA 2EQNA 1AWFH 3QLPH 1NTPA 1G3BA 2BY5X 3ATLA 1FY3A 4FUBA 4ABGA 1D6WA 2FIRH 4ACAA 1BRAA 2YNBA 3OU0A 3ZVCA 1EAWA 1CQQA 2BQ7B 1D4PB 1MKWK 1YPHE 1K9OE 1CA8B 2WUCA 4Z6AH 1P02A 1H8ED 3EA9A 3ZZDA 2ZO3H 3E3TA 3A8AA 5BPEA 1LKAA 2BHGA 4ISLA 4D9RA 1EOJA 1W8BH 2RA3A 1VITG 4WMEA 3PO1C 1GHBG 2TGAA 4NFEA 3SUFA 1TBQH 2BMGB 4VGCC 1GL0E 4LZ4B 1F5KU 3GCTF 3SW2B 1TE0A 2SGDE 2UUKB 3DFJA 4GHTA 3E0PB 3S9BA 3TJUA 1GJ4H 4O3TA 1C1UH 2JH0D 3O8BA 3SNDA 3SU6A 2UWPA 2OBQA 3RXRA 1BMLA 5GDSH 1YCPH 2IPQX 2FP7B 4ZKOU 4AB9A 3IWMA 3KCGH 5FX6A 1IQHA 1MABB 5AHGH 1Z1JA 4JK6A 1C2EA 5FPTA 3VEQB 4R8TB 3PMAB 3LT3A 5EODA 3P70B 1YPGH 1C2HA 1H9LB 3A89A 2M2AA 1TMUH 1GI6A 1PFXC 5GPIB 2BD8A 1QL9A 2FMJA 4O97A 2XC4A 2GKVE 3VGCB 1P3EA 2Y81A 3M37A 5JDUB 1Y5BT 4DT4A 3QWCH 4MPXA 2FXRA 1YLDA 1W7XH 3A86A 3BTEE 3RU4D 2TRMA 4ISNA 4MQAA 1TGSZ 3RC4A 4ABIA 3F9EA 2AMPA 2J2UA 3FP6E 4H6SB 4X6MA 3V3MA 1LKBA 4XSKU 1P12E 1A4WH 1PYTC 4YTAA 2GVFA 1UTMA 3PMBB 1UHBB 1K1IA 2QF0A 1ZRKA 1T8NA 3RC5A 1UK2A 4FXGH 3B8JA 2Q6DA 3AW0A 3ZZBA 6GCHG 4K60A 2LELA 3FVFB 2VWLA 2JJ2D 2GGVB 1DOJA 3TGKE 3F0OA 5HM9A 4BTTB 2BYAX 1THPB 1J14A 2FI3E 3HGNA 1O3CA 1HXFH 2IOTA 4ABAA 4FUIA 4ZXYH 3GDVA 1ZTJA 2FODA 5LPRA 4MLFB 1VITH 1O5AB 1GJDB 1ZZZA 4K69A 2CHAB 5C0UA 5LGOA 1YGCH 1GWAA 4CH2B 4CRFA 1GVKB 4MDSA 1QL8A 1HJAB 1Q2WA 1MUEB 4JMYA 1O2XA 1GMDG 3UREA 1V2JT 3HKJB 1HRTH 2Z9KA 4HZHA 2GZ9A 3RXIA 4B1TA 2F9BH 1ZHPA 3DHKH 1SGFA 4I8LA 2C93B 1W12U 1GCTB 1KXBA 2JDID 3ZV8A 2OC0A 4Y8YA 1OX1A 4JYTA 1XXDA 4INKA 2GT7A 4Y71A 2ZPSA 1ZSJA 3ZZ9A 1VR1H 2G5NA 2ZTZA 5EQSA 4KTUA 2HNTE 4WH8A 3HGPA 4YOJA 2CV3A 5EGMA 3OX7U 2AGIX 2UWOA 2EC9H 1XKAC 4DIIH 1MKXH 5FBIA 3SORA 3SHCH 1BTZA 2FEQH 5F03A 1O2GH 3QN7A 1O30A 2CN0H 1DY8A 4CREA 1GGDB 4NIVA 5GCHF 3RXJA 1O2JA 4I7YH 2ZP0H 2F4LA 5L30H 1B0FA 1BBRH 3GY3A 1AMHA 3BTFE 3GCTG 5IDKA 1GHAF 2XOKD 2OP9A 2KZ4A 1WQSA 2ZI2H 2W3KA 1NY22 1M9UA 2ZGBH 1YLNA 4ASUD 3OY6U 5F8ZA 1O0DH 3O8RA 4A5TS 3ZZAA 3QTVH 3STJA 3MQKC 1Z8IB 5GNDA 2O8WA 1EP5A 1PQ5A 2VGCB 2ZDMA 1WDIA 1G3CA 1P57B 1PQ8A 3T26A 3BTWE 1OP0A 1O3FA 4BAQB 4DG4A 1GBLA 4NZLA 2BDAA 1C5PA 2VIQA 1NC6A 3MO6A 1NRNH 1S6HA 1TGTA 2C8YB 1VCWA 2BVXH 2SGPE 2ZDKA 4GUXA 3RUOA 3U9AH 3RU4E 1GBBA 1N8OB 5EJ1A 1XUKA 1P05A 4KP0A 5PTPA 1ZPCA 1LVOA 3UNRA 3M3TA 1GJ6A 4KELA 1VJ9U 1LDTT 2K1QA 3MU4A 2BLVA 5KECA 5DO4H 3URCA 1UTQA 1UCYH 1O3NA 1MTVA 1QY6A 2PKAA 1SL3A 2WYJA 1WUNH 2F43B 1UVPA 1YM0A 3VB7A 4A1TA 2YNAA 3BTHE 3HK6B 3SU0A 1LPGB 4Y8ZA 1LPZB 1IQFA 3F2HA 4FVDA 3MH4A 1A5IA 3Q3YA 3LIWA 1HJ8A 1QBVH 2UWLA 1HJ9A 3U1JB 4JCNA 1VGCB 2GMTB 2ILNA 3R0FA 1KXFA 3BTQE 1SQTA 4X2WA 1GBIA 4Q7ZA 1SLVB 3QTOH 1SC8U 1GBHA 2ODQA 2OQUA 4THNH 4CRBA 3R3GB 2BD2A 2QN5T 3DSGA 1BUIA 4WMFA 1AO5A 2Y7XA 2QV1A 2R0KA 3D23A 4BAKB 1QRWA 2L74A 4E06H 1SOTA 1AFEH 1P9SA 1YKTA 1IAUA 2BQWB 1RRKA 3ZZ5A 1G2LA 4AB8A 6CHAB 4H6TA 5EPYA 1XXFA 3KYGA 1C5SA 3MU0A 1E36B 2VINA 3TPIZ 2WINI 3K2UA 2QIQA 1QA0A 2GCTC 2GT8A 3D62A 3U8RH 4B74A 1ZSKA 1ELTA 3SNCA 1F0SA 1MQ5A 3QX5H 2ZU2A 2GZ8A 1EAXA 5HYOA 3M35A 1ELEE 1SVPA 1UO6A 2IPHA 1O5GH 1FX0B 1GHWH 1NM6A 4AN7A 4FETA 2ZQ2A 3AW1A 1CBWB 1ZTLA 2JH5D 1K0HA 1GBCA 4H42U 3M61U 5EXMA 4AGKA 2B8OH 4AZ2B 3SJ9A 1TX7A 1F5RA 4ABBA 2H5CA 2THFB 3KQEA 2QXJA 1O37A 2H6MA 3JZ2B 1SFIA 2FS9A 3PYHA 1FY1A 3KYFA 1BQYA 2AIQA 3GICB 2PGQB 1U6QA 3LGWA 2VIPA 2A0QB 3BF6H 4MG3A 1QR3E 2PKSB 1Z8RA 1O3PB 2D8WA 1NN6A 2Y5FA 3MHWU 3F9HA 3WW7A 1T4VH 2BDHA 2O8MA 3SQHE 1BTPA 2VIVA 3L6PA 3LC5A 1MU8B 3ZZ4A 1ETSH 1ESAA 3T2NA 3BTDE 1O2NA 5T6DA 2ANYA 2C8ZB 1CA0C 1EFRD 1GHAG 3KQ5A 2OLGA 4Q63A 4OS4A 1MTNC 2V3HH 1K21H 4XOJA 3UWIA 3A8BA 1O3AA 1ESBA 2FX6A 1CT0E 1DS2E 1S6FA 1WCZA 3LGTA 3MFJA 1BTXA 4JYVH 4I33A 1P2OA 1HAPH 1A3EH 3TH4H 2VWMA 4NWLA 4JZ1A 2ULLA 1C1VH 1OOKB 4X8TH 4AYVB 4CBOA 3OFND 3RLYH 1ANCA 1TNJA 1V6DA 3A7YA 2QXGA 1AN1E 2QF4A 3NUMA 1FI8A 2H9HA 2ASUB 1H4WA 1L4ZA 2D1JA 5CHAB 2G51A 1JIMA 3RXDA 3OTJE 1GHVH 2PKAB 5HIZA 1JXPA 1O39A 1AE5A 2YMSD 1P2KA 4SGBE 1HPGA 1UVUH 1P09A 2OBOA 1DX5M 2A7HA 2ZTXA 2P59A 1GMHF 3EA8A 1Y8TA 5C1UA 1SHYA 1S83A 2BVSH 1FAKH 1RJXB 4OM9A 1GI0A 1ZLRA 5EXNA 1UVTH 3RXAA 1D9IA 2Z9GA 4MNVA 3F1SB 3E0NB 3Q3KA 1XUJA 2FOHA 3W94A 2ZC9H 2FTMA 3SUGA 2WPLS 2FOBA 1EB2A 1XMNB 3DSOA 5E2OA 1BRUP 1CT4E 2GJGA 1GI5A 1TOMH 3V0XA 1VCQA 1Y5UT 3T62A 1C5YB 4UDWH 1MZAA 1LHGH 1AVGH 5JBBS 1MD8A 5FPSA 3MU8A 3SJ8A 1P10A 3GISB 3CENA 2CF8H 4B75A 1MKXK 3P8GA 2ESTE 2HVYB 4Q7XA 2QCYA 2GX4A 2BVRH 1ZGVA 1OWEA 1SOZA 4YLQH 2RCEA 1HAZB 1O2VA 1V2NT 1UVOA 2C3SA 1GBFA 2PFEA 3AVZA 1SGEE 2HLCA 2BD9A 2V3MA 2FYQA 7ESTE 1V2OT 2F9VA 1RIWB 2L6OA 2J38A 2XCNA 1O36A 2ZGJA 1V2VT 1TOCB 4FUFA 3F68H 1TQ7B 3L3TA 1BBRK 3PLBA 1EJAA 1SFQB 1ACBE 1QJ1B 2WPJS 2C90B 5T6GA 4X2XA 3FP8E 3FO8D 1KY9A 2P8OC 4DGJA 3QGNB 1MAXA 2JH6D 2GCHF 2FI4E 4ZHAA 1H1BA 2QAAA 1AFQB 2AERH 1VJAU 4NIXA 1ELCA 2O8TA 1UTKA 1C2GA 2EY4C 3UPEA 1QL7A 1N6XA 2WPIS 1NESE 1S81A 5K0HA 2P95A 2TBSA 3A7VA 1C4V2 1TBZH 3RXSA 1YY3A 3LC3A 4X6NA 1GBAA 1BHXF 1ARBA 1O2LA 1C1RA 4JYUH 3STIA 2FZZA 8GCHG 4AG1A 3EAJA 2ZFTA 4ABDA 1HGTH 5G4BA 2WV9A 1NBMD 1C2DA 4XBDA 3QGJA 3UWJH 5EQRA 1CHOG 3UTUH 4XDEA 3Q76A 2DUCA 2Y6TA 1P06A 3DT0H 2TGPZ 1LPKB 3CP7A 1BRBE 3GCOA 2PSXA 3PLKA 1ZOMA 5T6FA 4DURA 1DXPA 1GDNA 2FWWA 4NZQA 2OCVB 4ZKRU 1SPJA 3A7WA 4Y11E 5DSFA 1KLJH 3BEUA 3QUMP 4NA7A 2A45B 4NIWA 3UB0A 2JJ1D 3BG4C 2AIPA 4AX9H 2AMDA 1GL1A 4X1NU 5HM2A 3SO3A 4H4FA 3UR9A 4YT6H 2ZCLP 1SGFG 2XC5A 1K1LA 1T31A 5DP5A 3PB1E 1UVSH 1AGJA 4O9VA 1IQKA 2SGEE 3ZZ6A 2F9OA 2QC2A 5EOKA 5DN6D 1V3XA 1YP9A 2Q1JA 1GJ7B 5GIBA 2FX4A 2WPKS 1OP2A 5A0AE 2OQ5A 1UTOA 1DSUA 4IW4E 1NU9A 5DP3A 1CE5A 3OEED 1GCTC 1MAYA 3KHVA 5AFZH 2OC8A 3RP2A 2WV5A 4FVBA 1ABIH 1GI7B 2KCOA 3M3VA 1PYTD 2OC7A 1P0SH 2ZKSA 2ZQ1A 3GY8A 2SGFE 3EE0B 1GJCB 2ZTYA 3MNXA 3MO9A 1VKYA 3GDSA 5L6NH 1MCTA 1IHSH 3HK3B 1SGCA 1F2SE 1C4Y2 1JIRA 1W14U 4GCHG 4AFSA 1WV7H 3OE7D 2UUFB 3V12A 3ENSB 4CRGA 3KNXA 3T5FH 2Z94A 2F91A 1E35B 4DT7B 2Y7ZA 1H8IH 1CT2E 1LO6A 4INLA 3RXFA 1PPEE 2BZ6H 4YXWD 4BANB 2KAIA 1DFPA 4Y76A 1GGDC 1COWD 1BT7A 3TH2H 1O3DA 3ZZ3A 2J97A 3VG8A 6ESTA 5B6LA 1V2LT 1CGJE 3K6ZA 3RXOA 1TMBH 2A2QH 1V2ST 1B5GH 1WXRA 5ABWA 2FOCA 3P17H 1HAIH 3T27A 3PV5A 1K28D 1O38A 1O2QA 2ZNKH 4WMDA 1S85A 2TGDA 2V3OH 5GXPA 1TONA 1O5EH 3SJKA 1AIXH 1AB9B 4DW2U 1PJPA 4K1SA 3ATKA 1GJ9B 2BTCE 3RM0H 5HXFA 1BB0B 1DWDH 1MTWA 4WWYA 4E05H 3E91A 4UFFH 2FOMB 1QRZA 3SU4A 3RXCA 3ZZCA 2WV4A 1BMFD 1B7XB 4KGAA 4GVUA 2A7JA 4K8BA 4IC5A 3SQEE 3BSQA 1MU6B 1N8OC 1KXCA 1K22H 5K7RA 1O34A 3Q77A 1AVXA 2OTVA 2IJD1 1TGBA 3T29A 1OYQA 1Y3YA 4Y10E 2W26A 2ZFSA 2XYAA 1GDQA 2ZFQH 3SNBA 4OS1A 2QA9E 1NBME 2STAE 3LJOA 4NSVA 1HAGE 3O8CA 1DLEA 1Z71A 1L1JA 2HVXA 3LONA 4A92A 2F9NA 3PRBA 1LQEA 1EZUC 3GDUA 3RU4T 1O32A 4MPUA 4I8HA 1A1RA 2VIOA 4IBLH 2UUJB 3UY9A 3P8OA 4WXIA 3FP7E 3FN8A 4B76A 4D76A 3FAOA 1WSSH 3ZZ7A 1O3OA 7GCHF 3M5OA 3BIUH 5C20A 4AG2A 4IN2A 4F55A 1GDUA 3F2GA 1YCPM 4OS5A 1W0ZU 1EZQA 2O8LA 1O2UA 1KSNA 1SQRA 1P03A 4IMQA 3N7DA 3CNRA 1DE7H 1RD3B 1SGIB 4B2AA 5I25A 4D9QA 1P2IA 2Z3CA 3U98H 4ESTE 3OEHD 1O3JA 1QB9A 2CK3D 2CJIA 2GDDA 4MNWA 1TNGA 2BY6X 2OINA 2BM2A 4LOYH 2W5EA 4TT3D 4I86A 1A5HA 3A8DA 1BA8B 2KCYA 2BOKA 1AE8H 3A7XA 1GJBB 2I6SA 2ZDVH 1O5BB 4JK5A 3ZVGA 4ABHA 2WUBA 4FOUC 2ANWA 1WAYB 2IJOB 1TLDA 3T28A 3NK8A 1P11E 4JZIA 1LHCH 2A32A 3PM3A 3P95A 2CF9H 1ZJKA 2XXLA 3RXTA 5KEDA 1O2RA 1BTWA 3PV4A 4IC6A 2ZFRH 2ZHEH 4HI3A 2W3IA 5F8TA 3OAAD 3MWIU 1SR5C 3EA7A 4X1RU 1BZXE 2KAIB 1IQIA 5C1XA 1ZPZA 1TMTH 3S9AA 1S0QA 1DUEA 2ZWLH 1FMGA 2F83A 1HBTH 1A2CH 2KFWA 2PKSC 1KDQA 4NGAH 3NPSA 5CDFE 4U01A 4TPIZ 4ISIH 5DPAA 4QT8C 1O3GA 2KM0A 2W7UA 3SZEA 1ELVA 4K2YA 3UQVA 1KMHB 2R0LA 1OKXA 2AHME 1MD7A 4X6OA 5HGGA 4AGJA 1DT2A 4GPGA 4J2YB 2GZ7A 3PO1B 1TYNA 1PPZA 3RXKA 1GMCF 1LVMA 1HAOH 1G2MA 1KYNA 5KGOA 2Q6FA 2ZU1A 1A0JA 5L2YH 2WSSD 3M5NA 3F0PA 1LMWB 2J92A 1H9HE 5ESBA 3D49H 1JMOH 3B9FH 4B2CA 1YPMH 1C2MA 4D7GA 1UK4A 4A1XA 2BQ6B 3NKKA 4RKJB 4MTBA 1AD8H 1OWDA 2CXVA 5CHAC 3MH7A 2TPIZ 2SNWA 3A84A 1BDAA 1HFDA 2F9PA 1ZHRA 3MYWA 2ZF0H 2PTCE 2QF3A 3P6ZB 4KTSA 2A5IA 2H1UA 5FL7D 4BNRA 2JETB 3SU1A 3ZVFA 1N1LA 1Y3UA 1C2LA 1EPTA 3G01A 3URDA 3PMJA 3A7TA 3GY4A 5EPNA 2ZG0H 3MU1A 1XVOA 3AAVA 1C1NA 5AVDA 5CMXH 1TA6A 3MNBA 1UMAH 1AQ7A 1FQ3A 1SMFE 2BD4A 2HRVA 2ZU4A 4NWKA 1ELGA 1GI9B 1ID5H 1C9TA 1O5FH 2D2DA 1C5RA 4AORA 1YPJH 5J4QA 2K0QA 2VIDA 3MOCA 4OS6A 1THRH 2ZECA 3SU5A 3NXPA 2EI8A 1C5VA 2XWBI 5FX5A 1V2MT 1C5TA 3WWFA 1K1JA 2GD4B 3SU3A 2BDYA 1TRMA 5IK2D 1Z6EA 4K3JA 3SU2A 3LDXH 2PSYA 2XRCA 4JZEH 4MNXA 1FPCH 2A4OA 1BTUA 3LH3A 2UUYA 1YCPK 3FANA 3SN8A 3ODDA 1C2FA 1B0EA 2AFQB 3BEFB 1PPHE 1QQ4A 1RFNA 1BBRE 4X8UH 1O2PA 4SGAE 5F53A 4Q7YA 3ITIA 5SGAE 3RMOH 3F9GA 1ELDE 3UAIC 1XX9A 5C67A 3S0NA 3KQCA 3RLWH 3IITA 3TLOA 5J4SA 5DG6A 4ASHA 2ODPA 4XBCA 4GSOA 4I31A 2A31A 1OS8A 1KDQB 2O9QA 3OSYA 5T3HA 2FS8A 2G8TA 4HG6A 3E6PH 1WTGH 1XUIA 1YYY1 5HIYA 3TVJB 3GYMA 1RGQA 1WQVH 3RMNH 3P8NA 3FFGA 4LK4A 1HAHH 3I78A 2RFKC 1Z7KA 2ZPRA 2P3UB 2JIZD 5JBTA 1GHZA 4X2VA 2HWLB 4RN6A 1QHRB 4K1EA 5JYIA 3SV6A 1DLKB 1HNEE 1O2MA 4Q2KA 4CHAB 4OGXA 3OY5U 3V13A 2FTLE 5GCHG 3PLPA 1XVMA 1LHFH 1P8VC 2G55A 4FU8A 2AGGX 5FXLA 3P92A 4BTUB 4ZHLU 1T8LA 3NWUA 1TNHA 2TGTA 1GMCG 2A5AA 1TABE 4Y0YE 4GLYA 2BDIA 2AYWA 5EU8A 4DJZB 1SKYE 4YT7H 3TK9A 1C5UA 3RXEA 2ZGXH 1HCGA 9LPRA 5GWZA 1EX3A 1H9IE 4ISHH 4WJG2 5AF9H 1GJ5H 2H9EH 1YPLH 4MPWA 3LOXA 3GS9A 3Q00A 1TNLA 1EPTB 2BD7A 4JZDH 2PUQH 1GVZA 3UOPA 1A3BH 1XUFA 2C4FH 2ZHWH 4LZ1H 1KXAA 4MNYA 5F6MA 1S5SA 1WTHD 3RXUA 1ZYOA 2SGQE 3SOSA 1O5DH 1HIAA 3ATIA 1VCPA 4IMZA 1J8AA 1GI8B 1BHXB 1BRCE 3SI3H 2W7SA 1IQJA 3TGIE 4B71A 1O3HA 1TBRH 2PP6A 3K9XB 3MI4A 1BTYA 1SQAA 4NIYA 2Q6GA 1FY8E 5A8XA 5FBEA 3RXGA 1E34B 1GPZA 4BOHA 4K1TA 5LPEA 5EJZA 5FAHA 3LJJA 3BG8A 2B9LA 2BZAA 1GBEA 4X8SH 4CR9A 1ANDA 2FPZA 1N6YA 3SBKA 1A5GH 3UNSA 1VITF 1O2WA 1TA2A 1LHDH 2ZU3A 1QBOA 4ABEA 2EI7A 2Y5GA 3KIDU 7LPRA 2ZGHA 1P3CA 4HFPB 4UFEH 2FOGA 2FI5E 3KF2A 2G52A 1C1PA 4ZAEA 3SV2H 4BXSA 3EQ0H 1G3DA 4UE7H 1UTPA 1ANBA 1ZMNA 2P3FH 2H2ZA 3A82A 5E2PA 3KQDA 1NPMA 2F9UA 1GJ8B 1UTJA 1GCDA 4WVPE 4A6LA 2FLRH 1QRXA 1V2KT 1AI8H 4XFQA 1GI2A 2R3YA 3VB4A 1MTSA 4X2YA 2PTNA 2BOHB 3I77A 3QO6A 1CHGA 1AUTC 3VGCC 4X8VH 5E0GA 1V2UT 1P2NA 2LP6A 2FESH 1K1PA 1BMMH 2FDAA 1YC0A 2GTBA 2Y5HA 4KTCA 4R0IA 1FJSA 3PV2A 3ODFA 5DP7A 1PPBH 1V2RT 3V7TA 2OUAA 3A85A 1W10U 4DCDA 2OC1A 2HALA 3SUEA 1OWHA 2QF5A 2VNTA 4FU7A 1OWJA 1TIOA 3TITA 2XWAA 1ABJH 1ARCA 1QGFA 1HDTH 1CGIE 1F0UA 2GCTB 1ZMLA 1C4U2 1S82A 1WU1A 2W6JD 1O2HA 1GBDA 3QK1A 1C5ZB 2C8WB 1K1NA 3MH6A 1TQ0B 1FXYA 2V6NA 1UCYK 2AMQA 4OGYA 3S7KB 1QTFA 1DSTA 5FPYA 4I8JA 1O35A 2BXUH 1QNJA 4X6PA 3F2FA 1ZRBA 4FUCA 2RDEA 3BTME 4F4OC 3KL6A 1NRRH 6GCHF 1EZSC 1TWXB 1QBNA 4E7NA 4ACBA 4YLUA 1K1OA 3MU5A 1QZ8A 1P2MA 4O3UA 1ETRH 2VH6A 2CHAC 1RTFB 1UK3A 4K8YA 1DICA 5C1YA 1NT1A 1EQ9A 1YPHC 4RT0A 1P9UA 1CVWH 2ZGCA 2Z9IA 1CGHA 5IYTA 2B0FA 1V2TT 1HJAC 1XM1A 1KXEA 1D3DB 3GOVB 3NRLA 3DCLA 1C1QA 3AK5A 1KIGH 3BEIB 3PTBA 1TGCA 3PTNA 3M7TA 4ZUHA 1FUJA 1IQNA 1CA0B 1P2QA 3K6YA 4Y0ZE 3SYJA 1G3EA 1T4UH 1TX6A 1HIAB 1NFYA 3WWBA 3NZIA 1MMJN 1HB0B 1O3IA 1QJ6B 1FZZA 1ELFA 2KR7A 1C2JA 1UTNA 1C1TA 3H7TA 1EKBB 5A8YA 1ZHMA 4Z1MD 3PMHB 1J17T 1L0ZA 1GMHG 1P2JA 1QFKH 3O8DA 1NU7B 1UTLM 5JBAS 1RS0A 1C5XB 3UR6A 2ZDAH 3GCHB 5E0JA 1Y59T 1W11U 4CH8B 2QYIA 3LKWA 8LPRA 1FONA 3A87A 1W0JD 1G9IE 1O3LA 3ZVAA 2H9TH 1NFWA 5FCRA 1C5MD 1Y3WA 2ZDLA 3EDXB 1O5CB 1E38B 1GG6B 2EEKA 1GI1A 4ZHMU 2H5DA 2VH0A 3TK5A 2WPHS 1P04A 2P94A 2VVCA 1AHTH 2VB0A 8KME2 2GV6A 3DFLA 4NFFA 1G36A 5AFYH 2HOBA 1AWHB 4MPVA 2ANKH 1YPKH 2KX4A 2CGAA 1O31A 2BLWA 2NU3E 2VGCC 5C3NA 2P3TB 2OD3B 1A61H 3ATMA 3M3SA 3N7EA 3P8FA 1HLTH 4A7IB 1GJAB 1OPHB 4IN1A 4DY7B 1KXDA 3QZQA 2SGAA 1IQGA 1WBGB 1AY6H 3SI4H 5C5NA 2JKHA 2QGRA 2GCHG 1MBQA 3ZVDA 2VU8E 5DKMA 3BV9B 4GHQA 3SV7A 3JZ1B 4YM9A 1TPSA 1HAYB 4TWWA 1QIXB 2VBCA 3SJOA 1BTHH 5JBCS 1INCA 1DWCH 1C2IA 1BJUA 3RC6A 2JETC 2P8OB 4DOQA 3ZIAD 4B73A 1L1NA 1DM4B 1Z1IA 3T25A 1G37A 1YLCA 1HAVA 1DWEH 4XE4A 1ZMJA 3F6UH 4TWYA 3M5LA 1SGNE 2NU0E 1C1OA 5JB8S 4FUEA 3ZYDA 5DP4A 1JRSA 1A7SA 1BJVA 1RTKA 1E37B 4Y8XA 3SNEA 2VVVA 5A2MH 3U8OH 1MTUA 3DD2H 2HPQH 1VGCC 2GMTC 3MO3A 1AZZA 1FLEE 1Y3XA 3A8CA 4IGDA 2KCAA 5TCAA 2YMSB 2G81E 4I8KA 1FN6A 1OYTH 1EB1H 3H09A 2J98A 4I8GA 2RDLA 2B5TB 4NA8A 4TY7A 2ZU5A 1BITA 5H4IB 4HGCA 5TJXA 4ZCNA 5DGJA 5HKKD 1C5NH 2TIOA 2ZPQA 2HNTC 2XBXA 4FUGA 2V7QD 5FCKA 2I6QA 1PPFE 5A09A 1V2WT 1IQLA 2XBYA 2DE8A 5FHTA 1L1GA 2STBE 2XNIA 2LPRA 1DWBH 1ELAA 5ETXA 3UOUA 6CHAC 3BG4B 3RM2H 1D3QB 2P16A 4BXWA 4DVAU 2OXSA 1A46H 1CO7E 1GHXH 3S7HB 4NCYA 1AVWA 1SHHB 2AS9A 1J9CH 3D65E 4P00A 1NZQH 1DITH 2KCPA 2BY7X 1ZSLA 3SZNA 1NRPH 1GBJA 3F9FA 4OS2A 4ZKNU 2VWOA 1GI3A 1D3PB 2ALVA 3VB3A 4UEHH 1W3CA 1H8HD 1QJ7B 1CBWC 2WPDD 1LTOA 1HYLA 1SBWA 1XUHA 2WYGA 3U8TH 1AU8A 7KMEH 2ZHFH 1E0FD 1DVAH 1E1RD 1ETTH 1TNKA 1C1MA 1X7AC 3GCNA 2QXHA 4WH6A 2GP9B 2ODYB 1SLXB 3BTTE 2ALPA 5CHBA 1TB6H 3DA9B 4PROA 3PWBA 4CRCA 5DJ7A 2XBVA 1ZTKA 2Z9JA 3VXFH 1JRTA 2FOFA 2FOEA 1TX8A 1O2YA 1L2EA 3SJIA 4INHA 1K1MA 4CHAC 5A8ZA 2ZFPH 4WF8A 5E8EH 2J9NA 8ESTE 1ZPBA 4Z0KA 1P01A 5DP6A 4AFUA 2HPPH 2BDGA 4J1YA 3N7OA 3VPKA 4FU9A 1C5QA 1C5LH 4RT1A 3SV9A 1SLWB 5EW1H 2WZQA 2J95A 3RXBA 1Q31A 3TK6A 3RMLH 4XD7D 4VGCB 3S9CA 3EE7A 4AYYB 3UFAA 1BOQA 2PGBB 3QDZB 1C5OH 3TJVA 2R2MB 1A0LA 1XUGA 3AASA 3E16B 1TPPA 3K65B 3LH1A 1UW7A 3BTGE 2Z6BD 2RG3A 3C1KA 1NROH 3GY5A 3RXLA 1TFXA 3CS7A 1C9PA 1LVYA 1QB1A 1HAXB 2CMYA 1FPHH 1EPTC 1HAVB 1O3BA 1SI5H 2IN2A 2G00A 1CU1A 4GAWA 4ZROA 1SQOA 4JZFH 1DDJA 1W0KD 4O03A 3I29A 5C2ZA 1SLUB 3LGVA 1ESTA 3M36A 1F0TA 3N99A 4YO9A 5EXLA 4TYDA 3E8LA 4X1QU 3MNCA 3NCLA 2Z9LA 1PQ7A 1O2SA 1YPEH 3BIVH 2PV9B 1L4DA 3LGUA 2V0BA 3EYDA 4UFGH 1F92A 2XCFA 3RXPA 1FN8A 2B7DH 3OTPA 2BD5A 2A1DB 5C5OA 2J98B 4FUHA 1NFUA 1YWUA 2BLOA 5C0TA 1TAWA 1W7GH 4WY3A 1V2PT 4CRDA 1NFXA 4XRNA 3TJNA 2A5KA 5BRRE 1O3EA 3W95A 1GBMA 2PW8H 3DUXH 2XBWA 6LPRA 1O3MA 1SGTA 4BTIB 2A4QA 4RKOB 1HV7A 3S69A 1O2TA 7GCHG 1CSOE 4B6FA 5LPFA 1GHYH 4CR5A 4LXBH 3TH3H 4NA9H 1RIWC 3PWCA 4TY6A 4UONA 1F0RA 1J16A 1H8DH 1EJMA 1ANEA 4Y79A 1JWTA 4Y7AA 5TCCA 2FOAA 3UNQA 3MH5A 4F49A 2BDBA 2PWXA 1Z8GA 2PR3A 4ZMAH 1T8MA 1Q3XA 4BAHB 4KKDA 1KLTA 3VB5A 1FV9A 1AFQC 2G4UA 4ZKSU 3ZZ8A
chains in the Genus database with same CATH topology
3TU7H 4XBBA 3SGAE 1O33A 2LNCA 4YZUA 1D6RA 1C2KA 1OSSA 2Z3EA 5I46H 5L2ZH 1FNIA 4FUJA 1F5LA 4UD9H 3H7OA 3Q3XA 4RSPA 1RTLA 1C1SA 3FZDA 1SG8B 2VIWA 1MKWH 2R3UA 3SV8A 3KN2A 3PROA 2BX4A 1EP6A 2BXTH 3RDZA 5EW2H 1O2ZA 1J15A 3HATH 8GCHF 5LH8A 1FIWA 1QA7A 4ABFA 1T32A 1T8OA 1S84A 1JBUH 5ESTE 1EUFA 3MTYA 3E90B 1T7CA 1O2OA 1LHEH 2Y82A 1IHTH 2R2WU 5DP9A 1Z6JH 1SGQE 1CHOF 4D8NA 1C1WH 1FY4A 2D26C 2ZHDA 2NWNA 1UCYE 3ZV9A 1ZR0A 2F3CE 2V35A 1TALA 2ZCKP 1MBMA 3HKIB 3FZZA 3HPTB 1LQDB 1O2IA 2GDEH 1EAIA 1BMNH 4WXVA 4YOGA 3KQBA 5DP8A 3TNSA 3AAUA 1QCPA 1ZGIA 3ATWA 3RXHA 3ZYEA 1EZXC 1YF4A 2HNTF 3GY7A 1PQAA 2J94A 5EG4A 1WYKA 3QZRA 5DK1A 1SB1H 1DY9A 3A80A 1G32B 3TGJE 1JOUB 2P93A 3GYLB 1ZJDA 2BY8X 3UIRA 1ORFA 3KEEA 4YESB 4U32A 1MCVA 4X0WU 2ZFFH 2WPMS 1ELBA 1QQUA 1F7ZA 3LU9B 2FO9A 1Z8JB 4U2WA 1QURH 3UQOA 3B23B 2Z3DA 1PPGE 2ZHQH 3RXQA 2EI6A 2BB4A 3LPRA 9ESTA 1DPOA 3C27B 2FYRA 3GCHC 4AFQA 1RXPA 4E7RG 2M5TA 2YOLA 4YOIA 1OWKA 1BIOA 2J34A 1EOLA 2O8UA 4UFDH 1AKSA 4GCHF 2BX3A 2ZDNA 3ELAH 1TPAE 2AH4X 3OYPA 4M7GA 1IQEA 1MZDA 3A7ZA 3SNAA 3TJOA 1GHBF 2PLXA 1A0HB 1DANH 1GG6C 3RXMA 1HUTH 4AFZA 5JB9S 2A2XH 3E1XB 2BDCA 1QB6A 1SGRE 1NS3A 1NRSH 1Y3VA 3LGYA 1W0YH 1WOFA 2ANMH 5E0HA 4IS5A 2ZCHP 4DIHH 2HGTH 4CRAA 2DE9A 1D3TB 1TNIA 1G30B 2XW9A 2ZA5A 3RXVA 1K2I1 1AB9C 4NSYA 1FIZA 3VB6A 1GBTA 1O2KA 2J4IA 5A0BA 2SNVA 2ZZUH 1BMAA 3RMMH 2RA0A 1MQ6A 1EJNA 3TNTA 3VXEH 3U1IB 5B6OA 3KGPA 1LVBA 2QXIA 1VZQH 3ESTA 1AUJA 3SGQE 1GI4A 5CE1A 1FAXA 3WY8A 4B2BA 3EGKH 3ZVBA 2G5VA 4K5ZA 4OS7A 1OP8A 4TPYA 2A4RA 1O3KA 3H5CB 1KTSB 2R9PA 4HTCH 5JPMH 2G4TA 3TIUA 4A1VA 1NO9H 1OXGA 2VVUA 2NU1E 1EATA 1TRYA 2BY9X 1SGDE 4ABJA 5F8XA 3SUDA 4I32A 1TGNA 3CS0A 3GY2A 3U69H 1FY5A 1GVLA 4BAOB 5A0CA 1TRNA 3A83A 4X1SU 1W2KH 1UJ1A 2C8XB 4U30A 1KLIH 3BTKE 3UUZA 3MNSA 5EQQA 4ISOA 4BAMB 1YBWA 2FLBH 2Z7FE 1THSH 2Y80A 3M5MA 3BN9A 1NRQH 2XC0A 2XTTB 1AZ8A 2BLQA 3ZVEA 5HMAA 2A4GA 4Y6DA 3A88A 4Y7BA 1OWIA 1DUAA 2VWNA 4NG9H 1V2QT 2GV7A 4MVNA 1UHBA 1BCUH 2NU2E 2AGEX 1SSXA 1MH0A 2SFAA 1XKBC 3A81A 1PPCE 1TPOA 2PUXB 3GY6A 1GBKA 1HXEH 3SHAH 2EA3A 2FM2A 2PHBA 3VFEA 5GJ4B 4Q80A 4ZH8A 4FUDA 1MTNB 4D7FA 2QY0B 2VJ1A 2A7CA 1GMDF 1SGPE 1W13U 1LCYA 1KTTB 1S0RA 1EAUA 3M7QA 4X1PU 2ZEBA 3MMGA 1IOEA 2NU4E 2AEIH 1SGYE 3SGBE 4AOQA 1EASA 4CBNA 3LGIA 1AKSB 3L33A 1C5WB 3M7UA 4ZXXH 1Y5AT 1IQMA 3IG6B 2BD3A 1FDPA 1EXFA 2ZIQH 1DXWA 1AWFH 3QLPH 1NTPA 1G3BA 2BY5X 3ATLA 1FY3A 4FUBA 4ABGA 1D6WA 2FIRH 1BRAA 2YNBA 3OU0A 3ZVCA 1EAWA 1CQQA 2BQ7B 1D4PB 1MKWK 1YPHE 1K9OE 1CA8B 2WUCA 4Z6AH 1P02A 3EA9A 3ZZDA 2ZO3H 3E3TA 3A8AA 5BPEA 1LKAA 2BHGA 4ISLA 4D9RA 1EOJA 1W8BH 2RA3A 1VITG 4WMEA 3PO1C 1GHBG 2TGAA 4NFEA 3SUFA 1TBQH 2BMGB 4VGCC 1GL0E 4LZ4B 1F5KU 3GCTF 3SW2B 1TE0A 2SGDE 2UUKB 3DFJA 4GHTA 3E0PB 3S9BA 3TJUA 1GJ4H 4O3TA 1C1UH 2JH0D 3O8BA 3SNDA 3SU6A 2UWPA 2OBQA 3RXRA 1BMLA 5GDSH 1YCPH 2FP7B 4ZKOU 4AB9A 3IWMA 3KCGH 5FX6A 1IQHA 5AHGH 1Z1JA 4JK6A 1C2EA 5FPTA 3VEQB 4R8TB 3PMAB 3LT3A 5EODA 3P70B 1YPGH 1C2HA 1H9LB 3A89A 1TMUH 1GI6A 1PFXC 5GPIB 2BD8A 1QL9A 2FMJA 4O97A 2XC4A 2GKVE 3VGCB 1P3EA 2Y81A 3M37A 5JDUB 1Y5BT 3QWCH 4MPXA 2FXRA 1YLDA 1W7XH 3A86A 3BTEE 3RU4D 2TRMA 4ISNA 4MQAA 1TGSZ 3RC4A 4ABIA 3F9EA 2AMPA 2J2UA 3FP6E 4H6SB 4X6MA 3V3MA 1LKBA 4XSKU 1P12E 1A4WH 1PYTC 4YTAA 2GVFA 1UTMA 3PMBB 1UHBB 1K1IA 2QF0A 1ZRKA 1T8NA 3RC5A 1UK2A 4FXGH 3B8JA 2Q6DA 3AW0A 3ZZBA 6GCHG 4K60A 3FVFB 2VWLA 2GGVB 1DOJA 3TGKE 5HM9A 4BTTB 2BYAX 1THPB 1J14A 2FI3E 3HGNA 1O3CA 1HXFH 2IOTA 4ABAA 4FUIA 4ZXYH 3GDVA 1ZTJA 2FODA 5LPRA 4MLFB 1VITH 1O5AB 1GJDB 1ZZZA 4K69A 2CHAB 5LGOA 1YGCH 1GWAA 4CH2B 4CRFA 1GVKB 4MDSA 1QL8A 1HJAB 1Q2WA 1MUEB 4JMYA 1O2XA 1GMDG 3UREA 1V2JT 3HKJB 1HRTH 2Z9KA 4HZHA 2GZ9A 3RXIA 4B1TA 2F9BH 1ZHPA 3DHKH 1SGFA 4I8LA 2C93B 1W12U 1GCTB 1KXBA 3ZV8A 2OC0A 4Y8YA 1OX1A 4JYTA 1XXDA 4INKA 2GT7A 4Y71A 2ZPSA 1ZSJA 3ZZ9A 1VR1H 2G5NA 2ZTZA 5EQSA 4KTUA 2HNTE 4WH8A 3HGPA 4YOJA 2CV3A 5EGMA 3OX7U 2AGIX 2UWOA 2EC9H 1XKAC 4DIIH 1MKXH 5FBIA 3SORA 3SHCH 1BTZA 2FEQH 5F03A 1O2GH 3QN7A 1O30A 2CN0H 1DY8A 4CREA 1GGDB 4NIVA 5GCHF 3RXJA 1O2JA 4I7YH 2ZP0H 5L30H 1B0FA 1BBRH 3GY3A 1AMHA 3BTFE 3GCTG 5IDKA 1GHAF 2OP9A 1WQSA 2ZI2H 2W3KA 1NY22 1M9UA 2ZGBH 3OY6U 5F8ZA 1O0DH 3O8RA 4A5TS 3ZZAA 3QTVH 3STJA 1Z8IB 2O8WA 1EP5A 1PQ5A 2VGCB 2ZDMA 1G3CA 1P57B 1PQ8A 3T26A 3BTWE 1OP0A 1O3FA 4BAQB 4DG4A 1GBLA 4NZLA 2BDAA 1C5PA 2VIQA 1NC6A 3MO6A 1NRNH 1S6HA 1TGTA 2C8YB 1VCWA 2BVXH 2SGPE 2ZDKA 4GUXA 3RUOA 3U9AH 3RU4E 1GBBA 1N8OB 1XUKA 1P05A 4KP0A 5PTPA 1ZPCA 1LVOA 3UNRA 3M3TA 1GJ6A 4KELA 1VJ9U 1LDTT 2K1QA 3MU4A 2BLVA 5DO4H 3URCA 1UTQA 1UCYH 1O3NA 1MTVA 1QY6A 2PKAA 1SL3A 2WYJA 1WUNH 1UVPA 1YM0A 3VB7A 4A1TA 2YNAA 3BTHE 3HK6B 3SU0A 1LPGB 4Y8ZA 1LPZB 1IQFA 4FVDA 3MH4A 1A5IA 3Q3YA 3LIWA 1HJ8A 1QBVH 2UWLA 1HJ9A 3U1JB 4JCNA 1VGCB 2GMTB 2ILNA 3R0FA 1KXFA 3BTQE 1SQTA 4X2WA 1GBIA 4Q7ZA 1SLVB 3QTOH 1SC8U 1GBHA 2ODQA 2OQUA 4THNH 4CRBA 3R3GB 2BD2A 2QN5T 1BUIA 4WMFA 1AO5A 2Y7XA 2QV1A 2R0KA 3D23A 4BAKB 1QRWA 4E06H 1SOTA 1AFEH 1P9SA 1YKTA 1IAUA 2BQWB 1RRKA 3ZZ5A 1G2LA 4AB8A 6CHAB 4H6TA 5EPYA 1XXFA 1C5SA 3MU0A 1E36B 2VINA 3TPIZ 2WINI 3K2UA 2QIQA 1QA0A 2GCTC 2GT8A 3D62A 3U8RH 4B74A 1ZSKA 1ELTA 3SNCA 1F0SA 1MQ5A 3QX5H 2ZU2A 2GZ8A 1EAXA 5HYOA 3M35A 1ELEE 1SVPA 1UO6A 2IPHA 1O5GH 1GHWH 1NM6A 4AN7A 2ZQ2A 3AW1A 1CBWB 1ZTLA 2JH5D 1GBCA 4H42U 3M61U 5EXMA 4AGKA 2B8OH 4AZ2B 3SJ9A 1TX7A 1F5RA 4ABBA 2H5CA 2THFB 3KQEA 2QXJA 1O37A 2H6MA 3JZ2B 1SFIA 2FS9A 3PYHA 1FY1A 1BQYA 2AIQA 3GICB 2PGQB 1U6QA 3LGWA 2VIPA 2A0QB 3BF6H 4MG3A 1QR3E 2PKSB 1Z8RA 1O3PB 2D8WA 1NN6A 2Y5FA 3MHWU 3F9HA 1T4VH 2BDHA 2O8MA 3SQHE 1BTPA 2VIVA 3L6PA 3LC5A 1MU8B 3ZZ4A 1ETSH 1ESAA 3T2NA 3BTDE 1O2NA 5T6DA 2ANYA 2C8ZB 1CA0C 1GHAG 2OLGA 4OS4A 1MTNC 2V3HH 1K21H 4XOJA 3UWIA 3A8BA 1O3AA 1ESBA 2FX6A 1CT0E 1DS2E 1S6FA 1WCZA 3LGTA 3MFJA 1BTXA 4JYVH 4I33A 1P2OA 1HAPH 1A3EH 3TH4H 2VWMA 4NWLA 4JZ1A 2ULLA 1C1VH 1OOKB 4X8TH 4AYVB 4CBOA 3RLYH 1ANCA 1TNJA 1V6DA 3A7YA 2QXGA 1AN1E 3NUMA 1FI8A 2H9HA 2ASUB 1H4WA 1L4ZA 2D1JA 5CHAB 2G51A 1JIMA 3RXDA 3OTJE 1GHVH 2PKAB 1JXPA 1O39A 1AE5A 1P2KA 4SGBE 1HPGA 1UVUH 1P09A 2OBOA 1DX5M 2A7HA 2ZTXA 2P59A 1GMHF 3EA8A 1Y8TA 5C1UA 1SHYA 1S83A 2BVSH 1FAKH 1RJXB 1GI0A 1ZLRA 5EXNA 1UVTH 3RXAA 1D9IA 2Z9GA 4MNVA 3F1SB 3E0NB 3Q3KA 1XUJA 2FOHA 3W94A 2ZC9H 2FTMA 3SUGA 2WPLS 2FOBA 1EB2A 1XMNB 5E2OA 1BRUP 1CT4E 3V0XA 1GI5A 1TOMH 1VCQA 1Y5UT 3T62A 1C5YB 4UDWH 1MZAA 1LHGH 1AVGH 5JBBS 1MD8A 5FPSA 3MU8A 3SJ8A 1P10A 3GISB 3CENA 2CF8H 4B75A 1MKXK 3P8GA 2ESTE 4Q7XA 2QCYA 2GX4A 2BVRH 1ZGVA 1OWEA 1SOZA 4YLQH 2RCEA 1HAZB 1O2VA 1V2NT 1UVOA 2C3SA 1GBFA 2PFEA 3AVZA 1SGEE 2HLCA 2BD9A 2FYQA 7ESTE 1V2OT 2F9VA 1RIWB 2J38A 2XCNA 1O36A 2ZGJA 1V2VT 1TOCB 4FUFA 3F68H 1TQ7B 3L3TA 1BBRK 3PLBA 1EJAA 1SFQB 1ACBE 1QJ1B 2WPJS 2C90B 5T6GA 4X2XA 3FP8E 1KY9A 2P8OC 4DGJA 3QGNB 1MAXA 2JH6D 2GCHF 2FI4E 4ZHAA 1H1BA 2QAAA 1AFQB 2AERH 1VJAU 4NIXA 1ELCA 2O8TA 1UTKA 1C2GA 3UPEA 1QL7A 1N6XA 2WPIS 1NESE 1S81A 5K0HA 2P95A 2TBSA 3A7VA 1C4V2 1TBZH 3RXSA 3LC3A 4X6NA 1GBAA 1BHXF 1ARBA 1O2LA 1C1RA 4JYUH 3STIA 2FZZA 8GCHG 4AG1A 3EAJA 2ZFTA 4ABDA 1HGTH 5G4BA 1C2DA 4XBDA 3QGJA 3UWJH 5EQRA 1CHOG 3UTUH 4XDEA 3Q76A 2DUCA 2Y6TA 1P06A 3DT0H 2TGPZ 1LPKB 3CP7A 1BRBE 3GCOA 2PSXA 3PLKA 1ZOMA 5T6FA 4DURA 1DXPA 1GDNA 2FWWA 4NZQA 2OCVB 4ZKRU 1SPJA 3A7WA 4Y11E 1KLJH 3BEUA 3QUMP 4NA7A 2A45B 4NIWA 3BG4C 2AIPA 4AX9H 2AMDA 1GL1A 4X1NU 5HM2A 3SO3A 4H4FA 3UR9A 4YT6H 2ZCLP 1SGFG 2XC5A 1K1LA 1T31A 5DP5A 3PB1E 1UVSH 1AGJA 4O9VA 1IQKA 2SGEE 3ZZ6A 2F9OA 2QC2A 5EOKA 1V3XA 1YP9A 2Q1JA 1GJ7B 5GIBA 2FX4A 2WPKS 1OP2A 5A0AE 2OQ5A 1UTOA 1DSUA 4IW4E 1NU9A 5DP3A 1CE5A 1GCTC 1MAYA 3KHVA 5AFZH 2OC8A 3RP2A 2WV5A 4FVBA 1ABIH 1GI7B 3M3VA 1PYTD 2OC7A 1P0SH 2ZKSA 2ZQ1A 3GY8A 2SGFE 3EE0B 1GJCB 2ZTYA 3MNXA 3MO9A 3GDSA 5L6NH 1MCTA 1IHSH 3HK3B 1SGCA 1F2SE 1C4Y2 1JIRA 1W14U 4GCHG 4AFSA 1WV7H 2UUFB 3V12A 3ENSB 4CRGA 3KNXA 3T5FH 2Z94A 2F91A 1E35B 4DT7B 2Y7ZA 1H8IH 1CT2E 1LO6A 4INLA 3RXFA 1PPEE 2BZ6H 4BANB 2KAIA 1DFPA