3S69A

Crystal structure of saxthrombin
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
234
structure length
234
Chain Sequence
VIGGDECNINEHRSLVAFFNSTGFFCSGTLINEEWVLTAAHCDNTNFQMKLGVHSKKVLNEDEQTRNPKEKFICPNKKNDEVLDKDIMLIKLDSRVSNSEHIVPLSLPSSPPSVGSVCHIMGWGSITPIKVTYPDVPYCAYINLLDDAVCQAGYPELLTEYRTLCAGILEGGKDTCGGDSGGPLICNGQFQGIVSFGAHPCGQGLKPGVYTKVFDYNHWIQSIIAGNTTVTCPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thrombin-like enzyme defibrase
publication title Structure of saxthrombin, a thrombin-like enzyme from Gloydius saxatilis.
pubmed doi rcsb
total genus 56
structure length 234
sequence length 234
ec nomenclature ec 3.4.21.-:
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3s69A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3s69A02
1A5IA 2NU3E 1OWIA 1XUJA 2BLQA 1ZTKA 3M36A 2P3FH 4BAMB 3BG4B 1SGTA 1YCPH 1S83A 1Y5BT 2HRVA 2J92A 1HFDA 1DOJA 3EQ0H 1GJ8B 4IW4E 3BIVH 1MD7A 5A0CA 5AFZH 1K1NA 9ESTA 2A31A 5JB9S 1LTOA 4Z6AH 1MMJN 3RLWH 1THPB 1SFQB 1O2QA 1SL3A 3MFJA 3RM0H 1QHRB 2PKSC 3OU0A 2BDAA 8GCHF 1RTFB 1FUJA 1X7AC 1HPGA 1PQ8A 1K1LA 3RMMH 1ELFA 1SGDE 5CHAB 1GHYH 3SHCH 1L4DA 2O8TA 1GCTB 1P0SH 5DP5A 1BHXB 1ELTA 5LH8A 1EZUC 4MG3A 1LMWB 1A5GH 2FOEA 1GHBG 3IWMA 4UONA 1C2IA 4MLFB 1DLEA 2QAAA 2QN5T 2VH0A 4DIHH 1A0HB 1G30B 3A7ZA 3SUEA 1KXCA 2XBVA 2J4IA 1O3MA 3K65B 1UTKA 2QXIA 1LHDH 1SLUB 1PPZA 5B6OA 1F0UA 1IQJA 2SGFE 1GHAF 2ANYA 1D3PB 1TRMA 4CHAC 2XW9A 3BTWE 4B2AA 3ZZ6A 1NFWA 1SGRE 2R2MB 1NPMA 3K6ZA 1JBUH 1B0EA 1DS2E 3RXAA 3MH5A 4H6SB 2STBE 4NA9H 3OSYA 3HKIB 1KLIH 1O3JA 1QL7A 4LZ1H 5DK1A 1ZRKA 1MZDA 8KME2 3ATWA 2RA3A 1CHOG 3SI4H 3HGNA 1H4WA 4Y8ZA 1BUIA 1AUTC 2G00A 5F6MA 4WJG2 2SNWA 3LGYA 5A8XA 1C2EA 1O5GH 2UWPA 1L2EA 3H5CB 4FVBA 1OPHB 4TWYA 4AYYB 3EGKH 1TLDA 1ID5H 1MKXK 4ASHA 2OLGA 1K22H 1C5UA 2ZFPH 1Z8JB 1T8NA 1UVPA 3RLYH 1C9TA 2FIRH 1TABE 3RXVA 2BDGA 2QIQA 3SU2A 5HM2A 2V3OH 4WY3A 1RRKA 2WV5A 1H9IE 1QJ7B 3UREA 2VWOA 1A61H 1SHHB 1RXPA 1P8VC 1ZSLA 1OS8A 4YTAA 1ELCA 4KTCA 1AFQB 1O3OA 4UDWH 2H9TH 4FUEA 3M5LA 2SGDE 1L0ZA 3RXDA 1EZQA 2G55A 3RDZA 4XOJA 5IDKA 3UQVA 4ISLA 1GJ7B 1ZPBA 1GL1A 2FX4A 1HRTH 3GCNA 2QC2A 1ZTLA 1BBRK 1C5WB 2WPLS 4AGJA 4ISOA 3UY9A 3SGBE 1C4U2 1PYTC 2FI3E 1ELVA 3O8BA 1NS3A 4IN2A 1ELDE 4CRDA 2JETC 2UUFB 4GHTA 1V2NT 1S81A 2VGCB 2ZDKA 4XDEA 1B5GH 1K28D 2ZO3H 2P95A 1AU8A 1C5YB 2UUYA 3SU1A 3RMLH 4INLA 4HTCH 4A1TA 1EJNA 2I6QA 2THFB 1C5NH 3F9HA 1ARCA 2F9BH 1O3KA 2VIWA 3PM3A 1C9PA 1HAVB 1UCYE 3UOUA 1SLXB 1ZLRA 1P12E 1P2QA 2Y7XA 2GCHG 1E35B 4A6LA 4Y11E 4GHQA 1ARBA 1V3XA 4LXBH 4JYVH 2XC5A 4UE7H 1GHBF 1MCVA 3SUGA 1G3CA 3KL6A 1GI4A 1GMDG 3KF2A 4K1EA 1BQYA 2BDHA 2UWLA 4D76A 5LPFA 5FPTA 2DE8A 2ZFTA 2ZHEH 5DP9A 2F9VA 2PR3A 3UTUH 2ZFRH 1V2KT 4UFGH 1G32B 2NU1E 1XXFA 1HGTH 5A8YA 4AG2A 1TALA 2G8TA 4IMQA 4B71A 3GISB 4ZUHA 4IBLH 1Y3WA 4NFEA 1F92A 4FUJA 1GHWH 1NFYA 5E0JA 6CHAB 2Q1JA 2SGQE 3RXMA 3LGUA 1YC0A 4ZMAH 3T29A 4ABAA 3RXKA 4A7IB 4CRAA 4YT7H 4FUHA 5A8ZA 5C5NA 2A4RA 3PLBA 3P92A 1MU8B 1PPBH 2PW8H 1GHVH 3ATLA 1O3EA 3E1XB 1RTKA 1A1RA 3E0PB 3TJNA 1ELBA 4D8NA 1BJVA 4GVUA 1GJBB 3QWCH 3ZV9A 3BTFE 3P6ZB 3AAUA 3W94A 2PSYA 2TIOA 2PKAA 2BVRH 1SSXA 2JKHA 1NESE 3S7KB 1CA0B 3KQBA 1Y3VA 2PUXB 1C5PA 1ZMJA 3RXTA 3M7TA 3U8TH 1SR5C 3SU3A 5EXNA 2ZCKP 4Y8XA 4KTUA 1EAXA 1EPTB 4U32A 3SJ9A 3SW2B 2G81E 1OXGA 2JH0D 2A2XH 3A86A 1NRNH 4MTBA 2FX6A 3EE0B 5GPIB 5C1UA 7ESTE 2J2UA 1EX3A 1MKXH 6GCHF 4NWKA 3RXCA 3ZYDA 1C1WH 1V6DA 1AKSB 4I31A 2Y5HA 1CHGA 1HLTH 3T26A 3VB5A 3SQHE 2BQ6B 2GDEH 4AX9H 1FXYA 2TGPZ 1GBBA 4MPWA 1HAGE 5E8EH 5GDSH 1PPFE 2XCNA 1FPHH 2AIQA 1GI8B 1T8OA 3N7OA 5LPRA 2TRMA 2AH4X 2ILNA 4CHAB 1GVZA 4CRGA 1MAYA 2UWOA 1ETTH 2OBQA 5EW2H 3ELAH 1MH0A 3RXRA 1J16A 4ZKNU 3D23A 1CBWC 3CENA 3E3TA 1Z7KA 2FP7B 3NKKA 2H9EH 4Q7XA 1OX1A 1XX9A 1O5EH 2Y6TA 3A7TA 4RKOB 1HYLA 2FYQA 1HJAC 1IQMA 1C2HA 3ESTA 4Y10E 2TGDA 1C5SA 2NWNA 4NGAH 1DDJA 1GMDF 2ZECA 2EI8A 3M3TA 3TIUA 3SV9A 2BDYA 1HAOH 2BYAX 4ISIH 3ZZCA 4XSKU 1TGSZ 1BTHH 3AW1A 3A88A 3MU5A 1OYQA 3K9XB 1H8IH 4GLYA 4IN1A 3SNBA 2BHGA 1EZXC 2OBOA 3U9AH 1VCQA 1Z8IB 4E05H 1SI5H 3GCTG 2BXUH 4RN6A 1D3QB 5FX5A 3BTKE 1D4PB 3AW0A 5T3HA 1KLJH 1S6FA 2BTCE 1P3EA 1KXEA 2LNCA 1SHYA 2VIPA 2Z3EA 4Y0YE 1S82A 2VVCA 1O3BA 2Z3CA 1BIOA 1KYNA 1AWHB 2KAIB 2HNTF 1WU1A 1K2I1 5HMAA 4BTUB 1J14A 4B2BA 1GJ5H 1WTGH 1GMCF 2VVUA 2ZCHP 1TNHA 3MI4A 2ALPA 2QF0A 2H2ZA 1TGTA 1BMLA 1Y59T 2ZGBH 4JZIA 3MH7A 5E2OA 1AHTH 1PQAA 2GV6A 2TPIZ 1GI9B 2XYAA 4HI3A 1O31A 1YKTA 1N8OC 2XNIA 1C2DA 1EJMA 3U98H 4YT6H 1OWJA 1GI1A 3UNQA 5EODA 5PTPA 1PPGE 1WUNH 3S9AA 1VITH 2F83A 4BTIB 4XBCA 2PSXA 1C5TA 4NA8A 1IQKA 1LKAA 2CMYA 4UFFH 5C67A 1T4UH 3OX7U 1Z6EA 3P17H 1C2GA 1D6RA 4CBOA 1HJ8A 3EDXB 1P06A 1E37B 2FXRA 4IMZA 3MNSA 1C5VA 1MZAA 4I8LA 2NU4E 1RTLA 2P3UB 4BOHA 4O03A 1LHCH 3PMAB 4JZEH 4MNVA 4D9QA 4TWWA 1MTWA 4NCYA 5FBIA 1UMAH 1DWDH 3OTJE 1CO7E 2ZFFH 2GV7A 1P04A 8GCHG 1C1OA 3NWUA 5A0AE 1MQ6A 1O3DA 3SUDA 3MU1A 1ZHPA 3ZVDA 1LVMA 2QXHA 4NZQA 3ZZBA 1BA8B 4X6MA 1UCYH 4ABEA 5HM9A 4Q80A 2GVFA 5DP4A 1EASA 3A87A 3TGJE 3RXJA 1AN1E 5A09A 3U1JB 2QYIA 5FHTA 1QNJA 1O2YA 1CVWH 4AORA 4CREA 1T32A 3DUXH 4I8JA 1TRYA 1GBKA 2C8YB 1UTPA 1LPKB 3RXOA 1S5SA 1ESBA 1TBZH 3QTOH 1UTJA 2GZ9A 3IG6B 1FN8A 1W10U 2A7JA 2YOLA 2VWLA 1DSUA 5HGGA 4KTSA 4ZHLU 4IC6A 2GMTC 2Y82A 1HUTH 3ZV8A 3HPTB 3VB3A 1GHAG 1IQGA 1LHFH 5GJ4B 1BTUA 2F3CE 2ZI2H 4FUIA 3GY8A 1KLTA 1YPGH 3M3SA 1C1TA 2ZPRA 1SGFG 4YZUA 1QFKH 2EA3A 4K8BA 4Q7YA 3MMGA 1QCPA 1GBLA 1QA7A 1LHGH 2W5EA 1AVGH 3GCHC 1SVPA 4X2YA 1E34B 1YPKH 1TNJA 1THSH 1O3HA 1SGCA 2OXSA 2ZFQH 1SOZA 5FBEA 4OGXA 2ZFSA 1KXFA 2OC7A 1AD8H 1FJSA 1O33A 1TMUH 1DICA 1NTPA 2BVSH 5BRRE 1Z6JH 3UIRA 4DGJA 4JK6A 2CF8H 2Q6FA 5DP3A 2RG3A 1BDAA 1W11U 1DX5M 2FI5E 1YPHC 3A83A 4AG1A 4B74A 1LQDB 3LT3A 3PROA 3CP7A 1EATA 4R8TB 3VXFH 1TB6H 1YPHE 2XC4A 4Y6DA 1K21H 3E91A 3Q3YA 1BZXE 2CHAB 2F9UA 2ZPSA 1YLCA 5FXLA 3PB1E 3NXPA 3QO6A 2Z6BD 2Z7FE 1YM0A 1C1VH 4FVDA 3TH3H 1BTPA 4YOGA 1K1MA 4MNXA 4HGCA 1HJAB 1L1GA 1BTZA 5A2MH 2CGAA 1ZGVA 2G4TA 2ZDVH 5AFYH 4U01A 4YLQH 1TMBH 2Y81A 1W3CA 4X2WA 1GPZA 3T27A 1W12U 4SGAE 1H1BA 1FQ3A 4B2CA 2A0QB 1DPOA 3EA8A 2H1UA 1P05A 5E0HA 1SQAA 4FUFA 3GDUA 1V2OT 1W2KH 3SJIA 2Z9JA 1LCYA 4DG4A 3P8GA 2P94A 2A2QH 3ZZ3A 1QB9A 3SJ8A 1LVBA 4NWLA 2LPRA 3SJOA 3V0XA 1HIAA 3RXFA 4NSYA 1CU1A 1ELAA 2ZGHA 3LGWA 4HZHA 3SQEE 1GVKB 1ZJDA 2VIOA 1PFXC 2JH6D 1DITH 1JOUB 4AFSA 4GCHF 2BY7X 1CSOE 2XC0A 1C1PA 5G4BA 3GY2A 1LPZB 2OQUA 3SNEA 1SGNE 1EAWA 3TH2H 1C2FA 4DT7B 1SGEE 1LVOA 4D9RA 1QRZA 3PYHA 3ATIA 5GCHF 3RU4T 1OWKA 1AE5A 2WPJS 2AYWA 1O5CB 2F9NA 1C4Y2 1QY6A 4IS5A 3MU8A 4AFZA 2C3SA 3LC5A 1ZRBA 1HJ9A 2W7SA 1FY5A 5DJ7A 1UTLM 1NM6A 3A84A 2GP9B 3TK5A 4ABGA 2FM2A 1P57B 1B7XB 2ZP0H 4NIWA 1P10A 4X1PU 2O8UA 3Q76A 2HGTH 3E0NB 1Z1IA 2VIDA 1E36B 2P16A 2ZEBA 4O3UA 3KNXA 1EOLA 3BG8A 1KXDA 2ULLA 3LGVA 1TFXA 1T8MA 2A5AA 5DGJA 4GPGA 1C2LA 2J9NA 4X8VH 1JIRA 4DW2U 2C90B 1IQNA 1F5RA 1KTTB 3TGIE 3SU4A 3GCOA 1IOEA 2ZU3A 1BTYA 1BTWA 2BOHB 4MQAA 1O2UA 1TGBA 4BTTB 1GG6C 2SGEE 1NRPH 2W7UA 1O5DH 5CMXH 1GBEA 1T31A 1YCPM 5J4QA 5F8XA 1TQ7B 1EB1H 2W3KA 1C5RA 1GJDB 4FU7A 1Y5UT 4Y76A 3R3GB 4ZHMU 2VWNA 1Y8TA 1TNKA 3PO1C 3FZZA 1GJ6A 2R0KA 2Z9IA 1ZYOA 1A5HA 4KP0A 4TYDA 1VZQH 1MTNC 2G51A 1EB2A 3O8DA 3TK6A 5EQRA 1GBDA 1T7CA 4CRFA 3DFJA 4ABFA 2AMQA 2ZHQH 1VCWA 1TPOA 1C2KA 4X6PA 1EUFA 1O2TA 2OC1A 4OS6A 2R3UA 3D65E 3K2UA 2ZHDA 1BRCE 1ESAA 2BX4A 4F49A 6GCHG 2GDDA 1QTFA 3GDSA 2PHBA 1GBMA 1UTOA 2QY0B 1C5MD 4NSVA 1PJPA 1ZMNA 1WTHD 7GCHF 1CA8B 3SNDA 3M61U 5F03A 1BTXA 4CR5A 1V2WT 4WMEA 2GCTC 4INKA 4Y7BA 1K9OE 3F9FA 1TONA 2BD7A 2GMTB 3F1SB 2ZDMA 3GY4A 3SBKA 5JPMH 3KEEA 4JMYA 1ZR0A 1C5OH 4NFFA 2OTVA 1QQ4A 3T5FH 4AN7A 2ANKH 2BD3A 1ABIH 1HAXB 2C4FH 3AASA 1EQ9A 3Q00A 4MDSA 3MH6A 2J38A 1P09A 1S85A 1UJ1A 1GBTA 1UK4A 2PGBB 3TNSA 1DUAA 3BTME 1SMFE 4BAQB 3ZVCA 2EC9H 3O8CA 1SGPE 5EXLA 1O3LA 1O0DH 1OYTH 2ALVA 4X1QU 1W7GH 3A82A 1YGCH 4LZ4B 2GGVB 5J4SA 1AO5A 3PMBB 4Q2KA 5ESTE 2OCVB 2NU0E 3BEFB 1HXEH 1TNIA 5TJXA 2AMPA 3E16B 2ZTZA 3RU4E 1KTSB 3MOCA 3S69A 3F68H 3RM2H 1KSNA 1UVTH 1FPCH 1OWDA 5FX6A 4A5TS 3RU4D 1A3BH 1DFPA 1V2UT 1UTMA 4NZLA 2A7HA 3P70B 2OC0A 4X8TH 3U8OH 2FS8A 4DIIH 3QTVH 3MU0A 5JBBS 2FYRA 5I25A 3U1IB 1P2MA 3UFAA 3B23B 3MNBA 1RIWC 2D1JA 4DCDA 1WAYB 4IC5A 5IYTA 4WF8A 4I33A 1Q2WA 4FUBA 2CF9H 4DURA 3LOXA 1ZTJA 2P8OC 1SOTA 1A46H 3URDA 2R0LA 3Q77A 1GMCG 3PWBA 1FDPA 1ZPCA 4D7FA 3RMOH 1A4WH 4ZROA 1GL0E 4Y0ZE 1XUIA 2ZGXH 1P01A 2PKSB 1Y3XA 3MNCA 1C1UH 1D3TB 1LKBA 1NN6A 4ZKOU 4AFQA 3U8RH 1O32A 1FZZA 2STAE 1LPGB 1S84A 3SV6A 1IAUA 4AOQA 3ZZAA 3QLPH 5JBCS 1P2JA 1UHBA 1C5QA 1XUHA 1P2OA 4U2WA 1O3GA 2OD3B 2HPPH 3TGKE 1OSSA 3KN2A 2RCEA 3L33A 3BSQA 1O3PB 1CGJE 2B5TB 2FOHA 2HPQH 1AVWA 1C1RA 9LPRA 2K1QA 4WVPE 4BXWA 1GBHA 2D26C 3RXIA 3VEQB 3SU6A 1DVAH 1Y3UA 3M35A 2NU2E 5CE1A 3VB4A 2PKAB 3FVFB 5GWZA 4Y71A 4JYTA 2D8WA 2ODPA 2ZC9H 1WOFA 1DANH 2IOTA 4I8KA 4WWYA 3K6YA 4K2YA 4O97A 2ZU2A 1AE8H 2FOGA 1O39A 1BBRH 1OOKB 1YBWA 4K3JA 3AVZA 1N6YA 1ELGA 1HDTH 2F9OA 4M7GA 4GAWA 5H4IB 6LPRA 1TOMH 3A7VA 3VGCC 5L6NH 1TYNA 4HFPB 2B9LA 3MH4A 2QA9E 4UD9H 1TGCA 1SGYE 1GHZA 2A7CA 3T62A 4NIXA 1BRUP 1JRSA 4XBBA 1K1IA 1AGJA 3QZQA 1NC6A 3PO1B 1XUKA 1XM1A 4YO9A 1UTQA 4INHA 5JYIA 1AMHA 4DJZB 3HKJB 1MTNB 3DA9B 1F2SE 1A7SA 1V2JT 1TIOA 5DP7A 2A4GA 3GICB 3RXUA 1BMMH 2VVVA 5C2ZA 3BIUH 3S7HB 1WV7H 2EI7A 3MNXA 1SFIA 1MTUA 5I46H 2PLXA 2ZG0H 1GGDC 2FEQH 3GOVB 3PLKA 4U30A 2FLBH 3FP7E 2ZHFH 1H9LB 4B76A 2ZTXA 3BG4C 3DT0H 5L30H 1G3DA 1Z8RA 2ZWLH 3S9BA 3PMHB 1QB6A 2ZGCA 1AI8H 2PFEA 2GCTB 2ZCLP 1DY9A 4Q7ZA 3BEIB 2JETB 4F4OC 1GI5A 3EA9A 5F8ZA 3A8CA 3T2NA 4CBNA 4E06H 2VU8E 1QURH 2BD8A 1SB1H 3QK1A 2ZHWH 1CGIE 1GCTC 2FOBA 3KGPA 1C1QA 1CT2E 1GI6A 1TX6A 1A3EH 2CXVA 4Y8YA 1ESTA 3TJVA 4TY7A 2Y5FA 3BTEE 2IPHA 1ETSH 2RA0A 3HK6B 1P03A 4E7NA 3M37A 1ZJKA 2YNAA 1SLVB 3A80A 3QGJA 3O8RA 4TPYA 3HGPA 1L4ZA 1O34A 1FV9A 3SGQE 3RP2A 1G3BA 3KQDA 3BV9B 2J34A 1HBTH 1O2HA 3L6PA 1DWEH 4B73A 1NFXA 1ZHRA 4JYUH 4X1SU 1YCPK 3B8JA 1P2NA 3RXPA 2VH6A 1FAXA 2QGRA 2ZDAH 2TBSA 1O2IA 4CR9A 1P2IA 1IQHA 3D62A 3SI3H 3M5NA 3A7XA 2OQ5A 4AGKA 3TPIZ 1O2NA 2G4UA 2OINA 1XMNB 2IN2A 1QBVH 5L2YH 1YYY1 3LKWA 1RJXB 1EZSC 1HAYB 1SBWA 3BTHE 1IQIA 1OWHA 3R0FA 2UUKB 1NROH 1Q3XA 3M3VA 4GCHG 3SNCA 1DM4B 2ZF0H 5EXMA 3BTTE 4OS1A 2Z9KA 3BTDE 1MCTA 1ZGIA 3ZZ5A 1O2XA 4BXSA 1JMOH 3FP6E 4X6NA 3UPEA 2FZZA 5LGOA 1G2LA 3NZIA 4AB8A 1CGHA 3SV8A 3SO3A 2P3TB 3STIA 5GCHG 1MKWK 5ESBA 3C27B 1Z1JA 2BDBA 3LGIA 3UNRA 1LHEH 3MYWA 2ZPQA 3PLPA 4RSPA 2BQ7B 2HOBA 3TJOA 1JXPA 3QDZB 4YOIA 4DY7B 1TWXB 5A0BA 1AFQC 1LQEA 1DY8A 3F9EA 1F0TA 3E90B 4FUDA 5EPYA 1RGQA 4Y79A 3KQEA 1W14U 1TAWA 1YPJH 2Z9LA 3DHKH 1WQVH 1V2MT 3KIDU 3RMNH 2WPMS 3ZZ9A 1O35A 4K69A 2PTNA 5LPEA 4FU9A 5T6GA 1ZSJA 2IJOB 5FPYA 5FCKA 3EAJA 1O2RA 4OS4A 5C20A 1P9SA 4NIYA 1GCDA 1L1JA 2VGCC 2ZNKH 5DKMA 5C1XA 1O3FA 5C3NA 2CN0H 5EU8A 3ZVAA 1O3NA 4X2VA 2BMGB 1EP6A 1TA6A 3UUZA 1FLEE 1XUFA 3SV7A 1ZZZA 1YPLH 5TCCA 3GY7A 5EGMA 1XKBC 3P95A 3UWIA 3D49H 1CBWB 4BAHB 1IHTH 2XBYA 2RDLA 2BZAA 2BY8X 3ATKA 3V7TA 2QF3A 2TGTA 1O2GH 1CQQA 4X1RU 2BY5X 1P02A 1WSSH 2Z9GA 2H5CA 1SGQE 1QJ6B 4WXVA 3SV2H 1O2MA 2J95A 1CE5A 4THNH 5L2ZH 2HWLB 1S0QA 4DOQA 1HAIH 5EPNA 3UR9A 4R0IA 3WY8A 1BITA 5DP8A 2A45B 1MU6B 1BMNH 7GCHG 3GYLB 2FO9A 2O8WA 4XFQA 3I78A 4MVNA 4ZKSU 5JB8S 3PTNA 1DT2A 2I6SA 1BB0B 4K8YA 1O3IA 5JBAS 4J2YB 1WCZA 2SFAA 4A92A 2DUCA 1IQFA 2GKVE 1TPSA 1W0YH 4OS2A 2FESH 2CJIA 1P3CA 1D3DB 1O38A 3RXBA 1ANBA 1FY1A 3ODFA 3SNAA 1BBRE 2FWWA 1XKAC 1ZOMA 4K5ZA 1QJ1B 1DXPA 2AEIH 3TITA 3GY6A 4J1YA 1ZMLA 3LDXH 1BMAA 1QRWA 1OP0A 2AIPA 1TA2A 1IQLA 1AB9C 3P8OA 1NU9A 4TY6A 1O30A 4MNWA 1DWCH 2ZZUH 3NK8A 2AGEX 4XBDA 1CA0C 1ANCA 1QIXB 2WYGA 3T28A 3CS0A 3LC3A 1EPTC 2H9HA 3FFGA 4RKJB 1NO9H 3MHWU 1VITF 3FANA 2SGPE 1HIAB 2PUQH 1N8OB 1D9IA 4JZFH 1LDTT 3UNSA 4YLUA 2H5DA 3ZZ4A 1EKBB 1PPEE 3RUOA 3L3TA 4X8SH 1MKWH 1G2MA 4I8HA 2ODYB 1TPAE 3A8AA 3VFEA 1AIXH 4WH6A 2BB4A 3CS7A 2VNTA 2BQWB 3T25A 1JWTA 1NU7B 1LVYA 2GTBA 5TCAA 2BD2A 2ZU5A 7KMEH 1EXFA 1FY3A 3BEUA 1LO6A 3A7WA 3F9GA 1RS0A 1YF4A 2A32A 1XVMA 1PPHE 3G01A 3RXQA 1TMTH 1ANDA 3GYMA 4A1XA 3RC4A 1C4V2 1BJUA 3MTYA 1KY9A 1FIZA 1C5XB 3ZVFA 2ASUB 1GMHG 2QV1A 3M5OA 2ZU4A 4I7YH 3VPKA 4FUGA 1O3CA 3MWIU 5EOKA 2GD4B 3LONA 3ZYEA 1DSTA 2VINA 2A5KA 4TPIZ 1GDQA 1YP9A 2EI6A 1G3EA 1A0JA 2VJ1A 4B75A 3OY6U 2VIQA 4K1TA 2PGQB 2OP9A 3HATH 4KKDA 4ABBA 4A1VA 4BANB 2FOAA 1VGCC 1O36A 1AZ8A 3TH4H 1GI7B 2VB0A 2XWAA 1HAVA 3SU0A 3RC6A 4AB9A 2Q6DA 1O2OA 1GBIA 5BPEA 3SGAE 3SZNA 4GUXA 4OGYA 3V12A 1RFNA 2ZA5A 2BOKA 2BY9X 3PMJA 3ZZ7A 2WV4A 1GBFA 1J15A 4PROA 5E0GA 1CT0E 1EJAA 8ESTE 1KXBA 4H4FA 2XBXA 1V2RT 3GCHB 3LGTA 4JZDH 2JH5D 3IITA 1Q31A 2V3HH 4AYVB 2FOCA 1AZZA 3U69H 2G5NA 1RD3B 3RXEA 5DG6A 3KCGH 4UFDH 3SUFA 3ZVEA 5AHGH 3BF6H 4YESB 3UOPA 2P93A 2Y7ZA 1QBNA 1PYTD 1UVUH 3QN7A 4MNYA 2R2WU 1M9UA 4D7GA 1VJ9U 2ZDNA 8LPRA 1FY8E 2XTTB 2QXGA 4MPUA 3HK3B 2W26A 3SN8A 3V3MA 1O37A 1INCA 3LU9B 1NRQH 1O2LA 2FOFA 2H6MA 1MD8A 1O2PA 1C5LH 4BAOB 5K7RA 3OY5U 5ABWA 1GDNA 3DFLA 1D6WA 2C8WB 1ELEE 1W0ZU 3ENSB 2HLCA 3JZ1B 3PWCA 4ABDA 4E7RG 1QBOA 3MU4A 3P8NA 1VCPA 2FTLE 3Q3KA 1MTSA 1HCGA 1TOCB 1BT7A 2BD5A 2AMDA 1XXDA 2BX3A 1OKXA 1SQTA 1BOQA 3URCA 4WXIA 3W95A 4VGCC 3M7UA 2ZIQH 5FCRA 4O9VA 1TGNA 4ESTE 1EPTA 2J94A 4JCNA 1DUEA 1N1LA 3LJJA 1GBJA 1MBQA 1E38B 4WMFA 4OS7A 2QXJA 1F0RA 4QT8C 4CRCA 1HNEE 1ZHMA 1O2ZA 2ZU1A 1AKSA 4MPVA 1NT1A 3KHVA 1GI2A 1CHOF 1GMHF 2B8OH 4IGDA 1OP2A 2BM2A 3FAOA 2C8XB 3S9CA 3ODDA 3M7QA 3QGNB 5DP6A 5EQSA 1SG8B 3SJKA 1SQOA 5GXPA 1S6HA 1P2KA 2O9QA 3ITIA 1AB9B 1ANEA 3MO6A 1J8AA 1EAUA 4FXGH 1FN6A 1HB0B 3A7YA 4ABHA 4ISHH 2GZ8A 3UR6A 3SOSA 1VR1H 3TNTA 4ZAEA 1THRH 3A81A 1EAIA 1EP5A 2R9PA 1XVOA 2FS9A 3ZZDA 1TBQH 2BDIA 1SPJA 2Y80A 3UWJH 5DPAA 2BLVA 1V2ST 1HAZB 4Y7AA 1C2JA 2G5VA 4NG9H 1WQSA 3A89A 2A1DB 1IQEA 3VB7A 1KIGH 1GI3A 3LH3A 3E6PH 1IHSH 4WH8A 4BAKB 1T8LA 1UK3A 2W3IA 4X2XA 1MQ5A 1TQ0B 2TGAA 1UO6A 4KELA 1UCYK 3TJUA 2BXTH 3LJOA 1C1MA 2V35A 4UEHH 2ODQA 1W13U 3F6UH 3SHAH 4SGBE 5FAHA 5E2PA 1ORFA 3LIWA 1N6XA 4X8UH 1QL9A 1OP8A 1UHBB 1F0SA 2WUCA 1W8BH 1GG6B 2YNBA 3A85A 5GIBA 1GJ4H 3EYDA 3SU5A 2XWBI 1A2CH 4AZ2B 1AY6H 3H7OA 1AVXA 3JZ2B 1DE7H 3TU7H 3PV4A 1V2LT 2O8LA 1SGFA 6ESTA 1O2KA 4ZHAA 4YOJA 3ZVGA 1UK2A 2AERH 1B0FA 1Y5AT 3M5MA 2CHAC 2GCHF 2PTCE 4H6TA 1V2TT 1BHXF 2ZDLA 1C5ZB 1PQ7A 1H9HE 1MTVA 2V6NA 1FNIA 2KAIA 2ANWA 1QRXA 1YLDA 1K1PA 1MAXA 2SNVA 2AGGX 1GDUA 2A4OA 2WPIS 3I29A 2FODA 3GY5A 5EQQA 3FP8E 2Z3DA 1V2QT 2FDAA 1GJAB 5SGAE 2FMJA 1VGCB 1TE0A 3E8LA 5AVDA 3P8FA 4WMDA 1PQ5A 1TX8A 1UTNA 1L1NA 1BRBE 2QCYA 5ETXA 1SGIB 1O5AB 2A5IA 1HAPH 1AWFH 2CV3A 5C1YA 1TBRH 1FIWA 2R3YA 3S0NA 2WPHS 4K1SA 2XCFA 5CHAC 1TX7A 5JDUB 2Z94A 2FPZA 1YPEH 4ZXYH 5HXFA 1QA0A 2BLOA 1AFEH 2ZGJA 1MUEB 2BLWA 2ESTE 1QL8A 1T4VH 1YPMH 1FMGA 1TNLA 4O3TA 1BRAA 2ZQ2A 1HV7A 2F9PA 4NA7A 5F8TA 2SGAA 1MBMA 4JK5A 1KDQA 2AFQB 2XBWA 1V2VT 1GJ9B 5T6DA 1DXWA 1S0RA 2P59A 3TLOA 1Z71A 1ETRH 1U6QA 2PWXA 3TVJB 2BD4A 4YM9A 1ABJH 1KXAA 3B9FH 4XE4A 1VJAU 3EA7A 2HALA 1HXFH 1NRSH 1ACBE 3A8BA 5EW1H 3ZVBA 2FI4E 2GX4A 1F5KU 1QR3E 2C8ZB 3KQCA 5FPSA 1QB1A 1NY22 3NUMA 1G37A 1O2VA 3VXEH 5DO4H 1GVLA 3MO3A 1TPPA 4X6OA 2O8MA 2HNTC 2V0BA 3VB6A 3STJA 1C1NA 2WINI 1RIWB 5EG4A 1WBGB 2HNTE 3RXGA 1GWAA 2Q6GA 1GI0A 4VGCB 4X0WU 3UQOA 1TNGA 3QZRA 1SLWB 1H8DH 3OYPA 4LOYH 2D2DA 1UVSH 1KDQB 1J9CH 1O5FH 2OUAA 2P8OB 4CH2B 4CRBA 4K60A 4I32A 1BCUH 2C93B 4KGAA 5K0HA 3SORA 4ISNA 2BZ6H 2ANMH 4CH8B 3RXHA 1O5BB 3LH1A 1GJCB 2BD9A 7LPRA 2ZTYA 4OS5A 1G36A 4B1TA 1F5LA 2EEKA 3GDVA 1K1OA 1PPCE 4AFUA 3I77A 1FONA 1O3AA 1VITG 2GT8A 1W7XH 4FU8A 3GY3A 1GHXH 1Z8GA 1QQUA 4H42U 4GSOA 1F7ZA 1GBAA 4ABIA 1JIMA 3MO9A 3RXSA 3QUMP 2GT7A 4Z0KA 1K1JA 2BDCA 2WUBA 1DWBH 1XUGA 2ZQ1A 3NPSA 3LPRA 4X1NU 1C2MA 3GCTF 3ZZ8A 1E0FD 1WYKA 1P9UA 1JRTA 2FOMB 1TRNA 2AS9A 3A8DA 5JBTA 1HAHH 4MPXA 1P11E 2B0FA 3ATMA 4DVAU 2FLRH 1SC8U 1FAKH 5AF9H 1AUJA 1CT4E 2UUJB 3BN9A 1ZSKA 3TK9A 2ZKSA 1FI8A 5HYOA 3RC5A 5T6FA 1OWEA 2BVXH 1O2SA 1DLKB 2HVXA 4ZKRU 3DD2H 2VIVA 2BY6X 3FZDA 2PV9B 2M5TA 2B7DH 2OC8A 3BTQE 1GBCA 1A0LA 2WPKS 1ZPZA 4ZXXH 1EOJA 1QGFA 2GZ7A 1FY4A 3VGCB 1C1SA 2XRCA 4NIVA 1G9IE 3PTBA 4UFEH 1O2JA 3V13A 5C5OA 3BTGE 2FTMA 1AQ7A 2VWMA 4ZH8A 2DE9A 2A4QA 2Y5GA 3QX5H 2F91A 1V2PT 4JZ1A 4ABJA 1UVOA 1Y3YA 2G52A 3H7TA 6CHAC 4LK4A 3AAVA 2WYJA 4BNRA 2AGIX 4FUCA 3C1KA 1O2WA 2XXLA 1J17T 1NFUA 3Q3XA 4I8GA 3RXLA 1GGDB 1NZQH 1NRRH 3NCLA
chains in the Genus database with same CATH superfamily
1A5IA 2NU3E 1OWIA 1XUJA 2BLQA 1ZTKA 3M36A 2P3FH 4BAMB 3BG4B 1SGTA 1YCPH 1S83A 1Y5BT 2HRVA 2J92A 3OE7D 1HFDA 1DOJA 3EQ0H 1GJ8B 4IW4E 3BIVH 1MD7A 5A0CA 5AFZH 1K1NA 9ESTA 2A31A 5JB9S 1LTOA 4Z6AH 1MMJN 3RLWH 1THPB 1SFQB 1O2QA 1SL3A 3MFJA 3RM0H 1QHRB 2PKSC 3OU0A 2BDAA 8GCHF 1RTFB 1FUJA 1X7AC 1HPGA 1PQ8A 1K1LA 3RMMH 2JJ2D 1ELFA 1SGDE 5CHAB 4F48B 1GHYH 3SHCH 1L4DA 2O8TA 1GCTB 1P0SH 5DP5A 5HIYA 1BHXB 1ELTA 5LH8A 1EZUC 4MG3A 1LMWB 2QF4A 1A5GH 2FOEA 1GHBG 3IWMA 4UONA 1C2IA 4MLFB 1DLEA 2QAAA 2QN5T 2VH0A 4DIHH 1A0HB 1G30B 3A7ZA 3SUEA 1KXCA 2XBVA 2J4IA 1O3MA 3K65B 1UTKA 4YXWD 2QXIA 1LHDH 1SLUB 1PPZA 5B6OA 1F0UA 1IQJA 2SGFE 1GHAF 2ANYA 1D3PB 1TRMA 4CHAC 2XW9A 3BTWE 4B2AA 3ZZ6A 1NFWA 1SGRE 2R2MB 1NPMA 3K6ZA 1JBUH 1B0EA 1DS2E 3RXAA 3MH5A 4H6SB 2STBE 4NA9H 3OSYA 3HKIB 1KLIH 1O3JA 1QL7A 3NRLA 5DK1A 4LZ1H 1ZRKA 1MZDA 8KME2 3ATWA 2RA3A 1CHOG 3SI4H 3HGNA 1H4WA 4Y8ZA 1BUIA 1AUTC 2G00A 5F6MA 4WJG2 2SNWA 3LGYA 5A8XA 1C2EA 1O5GH 2UWPA 1L2EA 3H5CB 4FVBA 1OPHB 4TWYA 4AYYB 3EGKH 1TLDA 1ID5H 1MKXK 4ASHA 2OLGA 3VG8A 3F2HA 1K22H 1C5UA 2ZFPH 1Z8JB 3ZIAD 1T8NA 1UVPA 3RLYH 1C9TA 2FIRH 1TABE 3RXVA 2BDGA 2QIQA 3SU2A 5HM2A 2V3OH 4WY3A 1RRKA 2WV5A 1H9IE 1QJ7B 3UREA 2VWOA 1A61H 1SHHB 1RXPA 1P8VC 5F53A 1ZSLA 1OS8A 4YTAA 1ELCA 4KTCA 1AFQB 1O3OA 4UDWH 2H9TH 4FUEA 3M5LA 2SGDE 1L0ZA 3RXDA 1EZQA 2G55A 3RDZA 4XOJA 5IDKA 3UQVA 4ISLA 1GJ7B 1ZPBA 1GL1A 2FX4A 1HRTH 3GCNA 2QC2A 1ZTLA 1BBRK 1C5WB 2WPLS 4AGJA 4ISOA 3UY9A 3SGBE 1C4U2 1PYTC 2FI3E 1ELVA 3O8BA 1NS3A 4IN2A 1ELDE 4CRDA 2JETC 2UUFB 4GHTA 1V2NT 1S81A 2VGCB 2ZDKA 4XDEA 1B5GH 1K28D 2ZO3H 2P95A 1AU8A 1C5YB 2UUYA 3SU1A 3RMLH 4INLA 4HTCH 4A1TA 1EJNA 2I6QA 2THFB 1C5NH 3F9HA 1ARCA 2F9BH 1O3KA 2VIWA 3PM3A 1C9PA 1HAVB 1UCYE 3UOUA 1SLXB 1ZLRA 1P12E 1P2QA 2Y7XA 2GCHG 1E35B 4A6LA 4Y11E 4GHQA 1ARBA 1V3XA 4LXBH 4JYVH 2XC5A 4UE7H 1GHBF 1MCVA 3SUGA 1G3CA 3KL6A 1GI4A 1GMDG 3KF2A 4K1EA 1BQYA 2BDHA 2UWLA 4D76A 5LPFA 5FPTA 2DE8A 2ZFTA 2ZHEH 5DP9A 2F9VA 1NBME 2PR3A 3UTUH 2ZFRH 1V2KT 4UFGH 1G32B 2NU1E 1XXFA 1HGTH 5A8YA 1NBMD 4AG2A 1TALA 2G8TA 4IMQA 4B71A 3GISB 4ZUHA 4IBLH 1Y3WA 4NFEA 1F92A 2JIZD 4FUJA 1GHWH 1NFYA 5E0JA 6CHAB 2Q1JA 2SGQE 3RXMA 3LGUA 2WV9A 1YC0A 4ZMAH 3T29A 4ABAA 3RXKA 4A7IB 4CRAA 4YT7H 3F2FA 4FUHA 5A8ZA 5C5NA 2A4RA 3PLBA 3P92A 1MU8B 1PPBH 2PW8H 1GHVH 3ATLA 1O3EA 2KCPA 3E1XB 1RTKA 1A1RA 3E0PB 3TJNA 1ELBA 4D8NA 1BJVA 4GVUA 1GJBB 3QWCH 3ZV9A 2V3MA 3BTFE 2W6ID 3P6ZB 3AAUA 3W94A 2PSYA 2TIOA 2PKAA 2BVRH 1SSXA 2JKHA 1NESE 3S7KB 1CA0B 3KQBA 1Y3VA 2PUXB 1C5PA 1ZMJA 3RXTA 3M7TA 3U8TH 1SR5C 3SU3A 5EXNA 2ZCKP 4Y8XA 4KTUA 1EAXA 1EPTB 2IPQX 4U32A 3SJ9A 2PP6A 3SW2B 2G81E 1OXGA 2JH0D 2A2XH 3A86A 1NRNH 4MTBA 2FX6A 3EE0B 5GPIB 5C1UA 7ESTE 2J2UA 1EX3A 1MKXH 6GCHF 4NWKA 3RXCA 3ZYDA 1C1WH 1V6DA 1AKSB 4I31A 2Y5HA 1CHGA 1HLTH 3T26A 3VB5A 3SQHE 2BQ6B 2GDEH 4AX9H 1FXYA 2TGPZ 1GBBA 4MPWA 1HAGE 5E8EH 5GDSH 1PPFE 2XCNA 2WPDD 1FPHH 4TT3D 2AIQA 1GI8B 1T8OA 3N7OA 5LPRA 2TRMA 2AH4X 2ILNA 4CHAB 1GVZA 4CRGA 2QE7D 1MAYA 2UWOA 2KCAA 1ETTH 2OBQA 3PV5A 3ELAH 1MH0A 3RXRA 5EW2H 1J16A 4ZKNU 3D23A 1CBWC 3CENA 3E3TA 1Z7KA 2FP7B 3NKKA 3KYFA 2H9EH 4Q7XA 1OX1A 4M9FA 1XX9A 1O5EH 2Y6TA 3A7TA 4RKOB 1HYLA 2FYQA 1HJAC 1IQMA 1C2HA 3ESTA 4Y10E 2TGDA 1C5SA 2NWNA 4NGAH 1DDJA 1GMDF 2ZECA 2EI8A 3M3TA 3TIUA 3SV9A 2BDYA 1HAOH 2BYAX 4ISIH 3ZZCA 4XSKU 1TGSZ 1BTHH 3AW1A 5C17A 3A88A 3MU5A 1OYQA 3K9XB 1H8IH 4GLYA 4IN1A 3SNBA 1BMFD 1EZXC 2BHGA 2OBOA 3U9AH 1VCQA 1Z8IB 4E05H 1SI5H 3GCTG 2BXUH 4RN6A 1D3QB 5FX5A 3BTKE 1D4PB 5C94A 3AW0A 5T3HA 1KLJH 1S6FA 2LP6A 2BTCE 3OEHD 4B6EA 1P3EA 3PRBA 1KXEA 2LNCA 1SHYA 2VIPA 2Z3EA 4Y0YE 1S82A 2VVCA 1O3BA 2Z3CA 1FX0B 1BIOA 1KYNA 1AWHB 2KAIB 2HNTF 1WU1A 1K2I1 5HMAA 4BTUB 1J14A 4B2BA 3PRDA 1GJ5H 1WTGH 1GMCF 2VVUA 2ZCHP 1TNHA 3MI4A 2ALPA 2QF0A 2OK5A 2H2ZA 1TGTA 1BMLA 1Y59T 2ZGBH 4JZIA 2KCOA 5CDFE 3MH7A 3OAAD 5E2OA 1AHTH 5EJ1A 1PQAA 2GV6A 2TPIZ 1GI9B 2XYAA 4HI3A 1O31A 1YKTA 1N8OC 2XNIA 2EQNA 1C2DA 1EJMA 3U98H 4YT6H 1OWJA 1GI1A 3EE7A 3UNQA 5EODA 5PTPA 1PPGE 1WUNH 3S9AA 1VITH 1E1RD 2F83A 4BTIB 4XBCA 2PSXA 1C5TA 4NA8A 1IQKA 1LKAA 2CMYA 4UFFH 5C67A 1T4UH 3OX7U 1Z6EA 3P17H 1C2GA 1D6RA 4CBOA 1HJ8A 3EDXB 1P06A 1E37B 2FXRA 4IMZA 3MNSA 1C5VA 1MZAA 4I8LA 2NU4E 1RTLA 2P3UB 4BOHA 4O03A 1LHCH 1OHHD 3PMAB 4JZEH 4MNVA 4D9QA 4TWWA 1MTWA 4NCYA 5FBIA 4P02A 1UMAH 1DWDH 3OTJE 1CO7E 2ZFFH 2GV7A 1P04A 8GCHG 1C1OA 3NWUA 5A0AE 1MQ6A 1O3DA 3SUDA 3MU1A 1ZHPA 3ZVDA 1LVMA 2QXHA 4NZQA 3ZZBA 1BA8B 4X6MA 1UCYH 4ABEA 5HM9A 4Q80A 2GVFA 5DP4A 1EASA 3A87A 3TGJE 3RXJA 1AN1E 5A09A 3U1JB 5EJLA 2QYIA 5FHTA 1QNJA 1O2YA 1CVWH 4AORA 4CREA 1T32A 3DUXH 4I8JA 1YY3A 1TRYA 1GBKA 5HIZA 2C8YB 1UTPA 1LPKB 3RXOA 1S5SA 1ESBA 1TBZH 3QTOH 1UTJA 2GZ9A 3IG6B 1FN8A 2KCYA 1W10U 2A7JA 2YOLA 2VWLA 4P00A 1DSUA 5HGGA 4KTSA 4ZHLU 4IC6A 2GMTC 2Y82A 1HUTH 3ZV8A 3HPTB 3VB3A 1GHAG 1IQGA 1LHFH 5GJ4B 1BTUA 2F3CE 2ZI2H 4FUIA 3GY8A 1KLTA 1YPGH 3M3SA 1C1TA 2ZPRA 1SGFG 4YZUA 1QFKH 2EA3A 4K8BA 4Q4LA 4Q7YA 3MMGA 1QCPA 1GBLA 1QA7A 1LHGH 2W5EA 1AVGH 3GCHC 1SVPA 4X2YA 1E34B 1YPKH 1TNJA 1THSH 1O3HA 1SGCA 2OXSA 2ZFQH 1SOZA 5FBEA 4OGXA 2ZFSA 1KXFA 2OC7A 1AD8H 1FJSA 1O33A 1TMUH 1DICA 1NTPA 2BVSH 5BRRE 1Z6JH 3UIRA 4DGJA 4JK6A 2CF8H 2Q6FA 5DP3A 2RG3A 1BDAA 1W11U 1DX5M 2FI5E 1YPHC 3A83A 4AG1A 4B74A 1LQDB 3LT3A 3PROA 3CP7A 1EATA 4R8TB 3VXFH 1TB6H 1YPHE 2XC4A 4Y6DA 1K21H 3E91A 3Q3YA 1BZXE 2CHAB 2F9UA 2ZPSA 1YLCA 5FXLA 3PB1E 3NXPA 3QO6A 3UAIC 2Z6BD 2Z7FE 1YM0A 1C1VH 4FVDA 3TH3H 1BTPA 4YOGA 1K1MA 4MNXA 4HGCA 1HJAB 1L1GA 1BTZA 5A2MH 2CGAA 1ZGVA 2G4TA 2ZDVH 5AFYH 4U01A 4YLQH 1TMBH 2Y81A 1W3CA 4X2WA 1GPZA 3T27A 1W12U 4SGAE 1H1BA 1FQ3A 4B2CA 2A0QB 1DPOA 3EA8A 2H1UA 1P05A 5E0HA 1SQAA 2F43B 4FUFA 3GDUA 1V2OT 1W2KH 3SJIA 2Z9JA 1LCYA 4DG4A 3P8GA 2P94A 4RT1A 2A2QH 3ZZ3A 1QB9A 3SJ8A 1LVBA 4NWLA 2LPRA 3SJOA 3V0XA 1HIAA 3RXFA 4NSYA 1CU1A 3CNRA 1ELAA 2ZGHA 3LGWA 4HZHA 3SQEE 1GVKB 1ZJDA 2VIOA 1PFXC 2JH6D 4OM9A 1DITH 1JOUB 4AFSA 4GCHF 2BY7X 1CSOE 2XC0A 1C1PA 5G4BA 3GY2A 1LPZB 2OQUA 3SNEA 1SGNE 1EAWA 3TH2H 1C2FA 4DT7B 1SGEE 1LVOA 4D9RA 1QRZA 3PYHA 3ATIA 5GCHF 3RU4T 1OWKA 1AE5A 2WPJS 2AYWA 1O5CB 2F9NA 1C4Y2 1QY6A 2J98A 3MU8A 4IS5A 4AFZA 2C3SA 3LC5A 1ZRBA 1HJ9A 2W7SA 1FY5A 5DJ7A 1UTLM 1NM6A 3A84A 2GP9B 3TK5A 4ABGA 2EY4C 3SYJA 2FM2A 1P57B 1EFRD 1B7XB 2ZP0H 4NIWA 2HVYB 1P10A 4X1PU 2O8UA 3Q76A 2HGTH 3E0NB 1Z1IA 3N99A 2VIDA 1E36B 2P16A 2ZEBA 4O3UA 5GNDA 3KNXA 1EOLA 3BG8A 1KXDA 2JJ1D 2ULLA 3LGVA 1TFXA 1T8MA 2A5AA 5DGJA 4GPGA 1C2LA 2J9NA 4X8VH 1JIRA 4DW2U 2C90B 1IQNA 1F5RA 1KTTB 3TGIE 3SU4A 3GCOA 1IOEA 2ZU3A 1BTYA 1BTWA 2BOHB 4MQAA 1O2UA 1TGBA 4BTTB 1GG6C 2SGEE 1NRPH 2W7UA 1O5DH 5CMXH 1GBEA 1T31A 1YCPM 5J4QA 5F8XA 1TQ7B 1EB1H 2W3KA 1C5RA 1GJDB 4FU7A 1Y5UT 4Y76A 3R3GB 4ZHMU 2VWNA 1Y8TA 1TNKA 3PO1C 3FZZA 1GJ6A 2R0KA 2Z9IA 1ZYOA 1A5HA 4KP0A 4TYDA 1VZQH 1MTNC 2G51A 1EB2A 3O8DA 3TK6A 5B6LA 5EQRA 1GBDA 1T7CA 4HG6A 4CRFA 3DFJA 4ABFA 2AMQA 2ZHQH 1VCWA 1TPOA 1C2KA 4X6PA 1EUFA 1O2TA 2OC1A 4OS6A 2R3UA 3D65E 3K2UA 2ZHDA 1BRCE 1ESAA 1SKYE 2BX4A 4F49A 1H8ED 3U28C 6GCHG 2GDDA 1QTFA 3GDSA 2PHBA 1GBMA 1UTOA 2QY0B 1C5MD 4NSVA 1PJPA 1ZMNA 1WTHD 7GCHF 1CA8B 3SNDA 3M61U 5F03A 1BTXA 4CR5A 1V2WT 4WMEA 2GCTC 2J97A 4INKA 4Y7BA 1K9OE 3F9FA 1TONA 2BD7A 2GMTB 3F1SB 2ZDMA 3GY4A 3SBKA 5JPMH 3KEEA 4JMYA 1ZR0A 1C5OH 4NFFA 2OTVA 3OEED 1QQ4A 3T5FH 4AN7A 2ANKH 2BD3A 1ABIH 4DT4A 1HAXB 2C4FH 3AASA 1EQ9A 3Q00A 4MDSA 3MH6A 2J38A 1P09A 1S85A 1UJ1A 1GBTA 1UK4A 2PGBB 3TNSA 1DUAA 3BTME 1SMFE 4BAQB 3ZVCA 2EC9H 3O8CA 1SGPE 5EXLA 1O3LA 1O0DH 3PV2A 1OYTH 1YWUA 2ALVA 4X1QU 1W7GH 3A82A 1YGCH 4LZ4B 2GGVB 5J4SA 2YMSB 1AO5A 3PMBB 4Q2KA 1H8HD 5ESTE 1VKYA 2NU0E 2OCVB 3BEFB 1HXEH 1TNIA 5TJXA 2AMPA 3E16B 2ZTZA 4F55A 3RU4E 1KTSB 3MOCA 3S69A 3F68H 3RM2H 1KSNA 1UVTH 1FPCH 1OWDA 5FX6A 4A5TS 5DN6D 3RU4D 1A3BH 1DFPA 1V2UT 1UTMA 4NZLA 2A7HA 3P70B 2OC0A 4X8TH 3U8OH 2FS8A 4DIIH 3QTVH 3MU0A 5JBBS 2FYRA 5I25A 3U1IB 2KM0A 1P2MA 3UFAA 3B23B 3MNBA 1RIWC 2D1JA 4DCDA 1WAYB 4IC5A 5IYTA 4WF8A 4I33A 1Q2WA 4FUBA 5EIYA 2CF9H 3FO8D 4DURA 3LOXA 1ZTJA 2P8OC 1SOTA 1A46H 3URDA 2R0LA 3Q77A 1GMCG 3PWBA 1FDPA 1ZPCA 4D7FA 3RMOH 1A4WH 4ZROA 1GL0E 4Y0ZE 1XUIA 2ZGXH 1P01A 2PKSB 1Y3XA 3MNCA 1C1UH 1D3TB 1LKBA 1NN6A 4ZKOU 4AFQA 3U8RH 1O32A 1FZZA 2STAE 1LPGB 1S84A 3SV6A 1IAUA 4AOQA 3ZZAA 3QLPH 2RDEA 5JBCS 1P2JA 1UHBA 1C5QA 3H09A 1XUHA 1P2OA 4U2WA 2J5UA 1O3GA 2OD3B 2HPPH 3TGKE 1OSSA 3KN2A 2RCEA 2HLDD 3L33A 3BSQA 1O3PB 1CGJE 2B5TB 2FOHA 2HPQH 1AVWA 1C1RA 9LPRA 2K1QA 4WVPE 4BXWA 1GBHA 2D26C 3RXIA 3VEQB 3SU6A 1DVAH 1Y3UA 3M35A 2NU2E 5CE1A 2IJD1 3VB4A 2PKAB 3FVFB 5GWZA 4Y71A 4JYTA 2D8WA 2ODPA 2ZC9H 1WOFA 1DANH 2IOTA 4I8KA 4WWYA 3K6YA 4K2YA 1WDIA 4O97A 2ZU2A 1AE8H 2FOGA 1O39A 1BBRH 1OOKB 1YBWA 4K3JA 3AVZA 1N6YA 1ELGA 1HDTH 2F9OA 4M7GA 4GAWA 5H4IB 6LPRA 3OFND 1TOMH 3A7VA 3VGCC 5L6NH 1TYNA 4HFPB 2B9LA 3MH4A 2QA9E 4UD9H 1TGCA 1SGYE 1GHZA 2A7CA 3T62A 4NIXA 1BRUP 1JRSA 4XBBA 1K1IA 1AGJA 3QZQA 1NC6A 3PO1B 1XUKA 1XM1A 4YO9A 1UTQA 4INHA 5JYIA 1AMHA 4DJZB 3HKJB 1MTNB 3DA9B 3F3BA 1F2SE 1A7SA 1V2JT 1TIOA 5DP7A 2A4GA 3GICB 3RXUA 1BMMH 2VVVA 5C2ZA 3BIUH 3S7HB 1WV7H 4ZCNA 2EI7A 3MNXA 1SFIA 1MTUA 5I46H 2PLXA 2ZG0H 1GGDC 2FEQH 4XRNA 3GOVB 3PLKA 4U30A 2FLBH 3FP7E 2QF5A 2ZHFH 1E79D 1H9LB 4B76A 2ZTXA 3BG4C 3DT0H 5L30H 1G3DA 1Z8RA 4ACBA 2ZWLH 3S9BA 3PMHB 5HKKD 1QB6A 2ZGCA 1AI8H 2PFEA 2GCTB 2ZCLP 1DY9A 4Q7ZA 1S6LA 3BEIB 2JETB 4F4OC 1GI5A 3EA9A 5F8ZA 3A8CA 3T2NA 4CBNA 4E06H 2VU8E 1QURH 2BD8A 3WWBA 1SB1H 3QK1A 2ZHWH 1CGIE 1GCTC 2FOBA 3KGPA 1C1QA 1CT2E 1GI6A 1TX6A 1A3EH 2CXVA 4Y8YA 1ESTA 3TJVA 4TY7A 2Y5FA 3BTEE 4Z1MD 2IPHA 1ETSH 2RA0A 3HK6B 1P03A 4E7NA 3M37A 1ZJKA 2YNAA 1SLVB 3A80A 3QGJA 3DSGA 3O8RA 4TPYA 3HGPA 1L4ZA 1O34A 1FV9A 3SGQE 3RP2A 1G3BA 3KQDA 3BV9B 2J34A 1HBTH 1O2HA 5KEDA 3L6PA 1DWEH 4B73A 1NFXA 1ZHRA 4JYUH 2KFWA 4X1SU 1YCPK 3B8JA 1P2NA 3RXPA 2VH6A 1FAXA 2QGRA 2ZDAH 2TBSA 1O2IA 4CR9A 1P2IA 1IQHA 3D62A 3SI3H 3M5NA 3A7XA 3F2GA 2OQ5A 4AGKA 3TPIZ 1O2NA 2G4UA 2OINA 1XMNB 2IN2A 1QBVH 5L2YH 1YYY1 3LKWA 1RJXB 1EZSC 1HAYB 1SBWA 3BTHE 1IQIA 1OWHA 3R0FA 2UUKB 1NROH 1Q3XA 3M3VA 4GCHG 3SNCA 1DM4B 2ZF0H 5EXMA 3BTTE 4OS1A 2Z9KA 3BTDE 1MCTA 1ZGIA 3ZZ5A 1O2XA 4BXSA 1JMOH 3FP6E 4X6NA 3UPEA 2FZZA 5LGOA 1G2LA 3NZIA 1MABB 4AB8A 2JDID 1CGHA 3SV8A 3SO3A 2P3TB 3STIA 5GCHG 1MKWK 5ESBA 3C27B 1Z1JA 3F0OA 2BDBA 3LGIA 3UNRA 1LHEH 3MYWA 2ZPQA 3PLPA 4RSPA 2BQ7B 2HOBA 3TJOA 1JXPA 3QDZB 4YOIA 4DY7B 1TWXB 5A0BA 1AFQC 1LQEA 1DY8A 3F9EA 1F0TA 3E90B 4FUDA 5EPYA 5C0UA 1RGQA 2L6OA 4Y79A 3KQEA 1W14U 1TAWA 1YPJH 2Z9LA 4FETA 3DHKH 1WQVH 1V2MT 3KIDU 3RMNH 2WPMS 3ZZ9A 1O35A 4K69A 2PTNA 5LPEA 4FU9A 5T6GA 1ZSJA 2IJOB 5FPYA 5FCKA 3EAJA 1O2RA 4OS4A 5C20A 1P9SA 4NIYA 1GCDA 1L1JA 2VGCC 2ZNKH 5DKMA 5C1XA 1O3FA 5C3NA 2CN0H 5EU8A 3ZVAA 1O3NA 4X2VA 2BMGB 3FN8A 1EP6A 1TA6A 3UUZA 1FLEE 1XUFA 5EJZA 3SV7A 1E1QD 1ZZZA 1YPLH 5TCCA 3GY7A 5EGMA 1XKBC 3FKSD 2KR7A 3P95A 3UWIA 2RFKC 3D49H 1CBWB 4BAHB 1IHTH 2XBYA 2RDLA 2BZAA 2KX4A 2BY8X 3ATKA 3V7TA 4ASUD 2QF3A 5IK2D 2TGTA 1O2GH 4RT0A 1CQQA 4X1RU 2BY5X 1P02A 3OTPA 1WSSH 2Z9GA 2H5CA 1SGQE 1QJ6B 4WXVA 3SV2H 1O2MA 2J95A 1CE5A 2K8IA 4THNH 5L2ZH 2HWLB 3N7DA 1S0QA 4DOQA 1HAIH 5EPNA 3UR9A 4R0IA 3WY8A 1BITA 5DP8A 2A45B 1MU6B 1BMNH 7GCHG 3GYLB 3MQKC 2FO9A 2O8WA 4XFQA 3I78A 4MVNA 4ZKSU 5JB8S 3PTNA 1DT2A 2I6SA 1BB0B 4K8YA 1O3IA 5JBAS 4J2YB 1WCZA 2SFAA 4A92A 2DUCA 1IQFA 2GKVE 1TPSA 1W0YH 4OS2A 2FESH 2CJIA 1P3CA 1D3DB 1O38A 3RXBA 1ANBA 1FY1A 3ODFA 3SNAA 1BBRE 2FWWA 1XKAC 1ZOMA 4K5ZA 1QJ1B 1DXPA 2AEIH 3TITA 3GY6A 4J1YA 1ZMLA 3LDXH 1BMAA 1QRWA 1OP0A 2AIPA 1TA2A 1IQLA 1AB9C 3P8OA 1NU9A 4TY6A 1O30A 4MNWA 1DWCH 2ZZUH 3NK8A 5FL7D 2AGEX 4XBDA 1CA0C 1ANCA 1QIXB 2WYGA 3T28A 3CS0A 3LC3A 1EPTC 2H9HA 3FFGA 4RKJB 1NO9H 3MHWU 1VITF 3FANA 2SGPE 1HIAB 2PUQH 1N8OB 1D9IA 4JZFH 1LDTT 3UNSA 3KQ5A 4YLUA 2H5DA 3ZZ4A 1EKBB 1PPEE 3RUOA 3L3TA 4X8SH 1MKWH 1G2MA 4I8HA 2ODYB 1TPAE 3A8AA 3VFEA 1AIXH 4WH6A 2BB4A 3CS7A 2VNTA 2BQWB 3T25A 1JWTA 1NU7B 1LVYA 2GTBA 5TCAA 2BD2A 2ZU5A 7KMEH 1EXFA 1FY3A 3BEUA 1LO6A 3A7WA 3F9GA 1RS0A 1YF4A 2J98B 1SQRA 2K0QA 2A32A 1XVMA 1PPHE 3G01A 3RXQA 1TMTH 2XNDD 1ANDA 3WWFA 3GYMA 4A1XA 3RC4A 1C4V2 1BJUA 3MTYA 1KY9A 1FIZA 1C5XB 2WZQA 3ZVFA 2ASUB 1GMHG 2QV1A 3M5OA 2ZU4A 4I7YH 3VPKA 2GJGA 4FUGA 1O3CA 3MWIU 5EOKA 2GD4B 3LONA 3ZYEA 1DSTA 2VINA 2A5KA 4TPIZ 1GDQA 1W0JD 1YP9A 2EI6A 1G3EA 1A0JA 2L74A 2VJ1A 4B75A 3OY6U 2VIQA 4K1TA 2PGQB 2OP9A 3HATH 4KKDA 4ABBA 4A1VA 4BANB 2FOAA 1VGCC 4Q63A 1O36A 1AZ8A 3TH4H 1GI7B 2VB0A 2XWAA 1HAVA 3SU0A 3RC6A 4AB9A 2Q6DA 1O2OA 1GBIA 5BPEA 3SGAE 3SZNA 4GUXA 4OGYA 3V12A 1RFNA 2ZA5A 2BOKA 2BY9X 3PMJA 3ZZ7A 2WV4A 2AHME 1GBFA 1J15A 4PROA 5E0GA 4ACAA 1CT0E 1EJAA 8ESTE 1KXBA 4H4FA 2XBXA 1V2RT 2WHXA 3GCHB 3LGTA 4JZDH 2JH5D 3IITA 1Q31A 2V3HH 4AYVB 1W0KD 2FOCA 1AZZA 3U69H 2G5NA 1RD3B 3RXEA 5DG6A 3KCGH 4UFDH 3AK5A 3SUFA 3ZVEA 5AHGH 3BF6H 4YESB 3UOPA 2P93A 2Y7ZA 1QBNA 1PYTD 1UVUH 3QN7A 4MNYA 2R2WU 1M9UA 4D7GA 1VJ9U 2ZDNA 8LPRA 1FY8E 2XTTB 2QXGA 4MPUA 4AC9A 3HK3B 3DSOA 2W26A 3SN8A 3V3MA 1O37A 1INCA 3LU9B 1NRQH 2LELA 1O2LA 2FOFA 2H6MA 1MD8A 1O2PA 1C5LH 4BAOB 5K7RA 3OY5U 5ABWA 1GDNA 3DFLA 1D6WA 1WXRA 2C8WB 1ELEE 1W0ZU 3ENSB 2HLCA 3JZ1B 3PWCA 4ABDA 4E7RG 1QBOA 3MU4A 3P8NA 1VCPA 2FTLE 3Q3KA 2W6JD 1MTSA 1HCGA 1TOCB 4RI0A 3UB0A 1BT7A 2BD5A 2AMDA 1XXDA 2BX3A 1OKXA 1SQTA 1BOQA 3URCA 4WXIA 3W95A 4VGCC 3M7UA 2ZIQH 5FCRA 4O9VA 1TGNA 4ESTE 1EPTA 1KMHB 2J94A 4JCNA 1DUEA 1N1LA 3LJJA 1GBJA 1MBQA 1E38B 4WMFA 4B6FA 4OS7A 2QXJA 1F0RA 4QT8C 4CRCA 1HNEE 1ZHMA 1O2ZA 2ZU1A 1AKSA 4MPVA 5T1VA 1NT1A 3KHVA 1GI2A 1UW7A 1CHOF 1GMHF 2B8OH 4IGDA 1OP2A 2BM2A 3FAOA 2C8XB 3S9CA 3ODDA 3M7QA 1QZ8A 3QGNB 5DP6A 5EQSA 1SG8B 2KZ4A 3SJKA 1SQOA 5GXPA 1S6HA 1P2KA 2O9QA 3ITIA 1AB9B 1ANEA 3MO6A 1J8AA 1EAUA 4FXGH 1FN6A 1HB0B 3A7YA 4ABHA 4ISHH 2GZ8A 3UR6A 3SOSA 1VR1H 3TNTA 4ZAEA 1THRH 3A81A 1EAIA 1EP5A 2R9PA 1XVOA 2FS9A 3ZZDA 1TBQH 2BDIA 1SPJA 2Y80A 3UWJH 5DPAA 2BLVA 1V2ST 1HAZB 4Y7AA 2V7QD 1C2JA 2G5VA 4NG9H 1WQSA 3A89A 2A1DB 1IQEA 4TSFD 3VB7A 1KIGH 1GI3A 2CK3D 3LH3A 3E6PH 1IHSH 4WH8A 4BAKB 1T8LA 1UK3A 2W3IA 4X2XA 1MQ5A 1TQ0B 2TGAA 1UO6A 4KELA 1UCYK 3TJUA 2BXTH 3LJOA 1C1MA 2V35A 4UEHH 2ODQA 1W13U 3F6UH 3SHAH 4SGBE 5FAHA 5E2PA 1ORFA 3LIWA 1N6XA 4X8UH 1QL9A 1OP8A 1UHBB 1F0SA 2WUCA 1W8BH 1GG6B 2YNBA 3A85A 5GIBA 1GJ4H 3EYDA 3SU5A 2XWBI 1A2CH 4AZ2B 1AY6H 3H7OA 1AVXA 3JZ2B 1DE7H 5DSFA 3TU7H 3PV4A 1V2LT 2O8LA 1SGFA 6ESTA 1O2KA 4ZHAA 4YOJA 3ZVGA 1UK2A 2AERH 1B0FA 1Y5AT 3M5MA 2CHAC 3DSPA 2GCHF 2PTCE 4H6TA 1V2TT 1BHXF 2ZDLA 1C5ZB 1PQ7A 1H9HE 1MTVA 2V6NA 1FNIA 2KAIA 2ANWA 1QRXA 1YLDA 1K1PA 1MAXA 3F0PA 2F4LA 2SNVA 5CHBA 2AGGX 1GDUA 2A4OA 2WPIS 3I29A 2FODA 3GY5A 5EQQA 3FP8E 2Z3DA 1V2QT 2FDAA 1GJAB 5SGAE 2FMJA 1VGCB 1TE0A 3E8LA 5AVDA 3P8FA 4WMDA 1PQ5A 1TX8A 1UTNA 1L1NA 1BRBE 2QCYA 5ETXA 1SGIB 1O5AB 2A5IA 1HAPH 1AWFH 2CV3A 5C1YA 1TBRH 1FIWA 2R3YA 3S0NA 2WPHS 4K1SA 2XCFA 5CHAC 3WW7A 1TX7A 5JDUB 4XD7D 2Z94A 2FPZA 1YPEH 4ZXYH 5HXFA 1QA0A 2BLOA 1AFEH 2ZGJA 1MUEB 2BLWA 2ESTE 1QL8A 1T4VH 1YPMH 3GS9A 1FMGA 1TNLA 4O3TA 1BRAA 2ZQ2A 1HV7A 2F9PA 4NA7A 5F8TA 2SGAA 1MBMA 4JK5A 1KDQA 2AFQB 2XBWA 1V2VT 3N7EA 1GJ9B 5T6DA 1DXWA 1S0RA 2P59A 3TLOA 1Z71A 1ETRH 1U6QA 2PWXA 3TVJB 2BD4A 4YM9A 1ABJH 2VBCA 1KXAA 3B9FH 4XE4A 1VJAU 3EA7A 2HALA 1HXFH 2XOKD 1NRSH 1ACBE 3A8BA 5EW1H 3ZVBA 2FI4E 2GX4A 1F5KU 1QR3E 2C8ZB 3KQCA 5FPSA 1QB1A 1NY22 4I86A 3NUMA 1G37A 1O2VA 3VXEH 5DO4H 1GVLA 3MO3A 1TPPA 4X6OA 2O8MA 2HNTC 2V0BA 3VB6A 3STJA 1C1NA 2WINI 1RIWB 5EG4A 1WBGB 2HNTE 3RXGA 1GWAA 2Q6GA 1GI0A 4VGCB 4X0WU 3UQOA 1TNGA 3QZRA 1SLWB 3FOAA 1H8DH 3OYPA 4LOYH 2D2DA 5KECA 1UVSH 1KDQB 3KYGA 1J9CH 1O5FH 2OUAA 2P8OB 4CH2B 1K0HA 4CRBA 4K60A 4I32A 1BCUH 2C93B 4KGAA 5K0HA 3SORA 4ISNA 2BZ6H 2ANMH 4CH8B 3RXHA 1O5BB 3LH1A 1GJCB 2BD9A 7LPRA 2ZTYA 4OS5A 1G36A 4B1TA 1F5LA 2EEKA 3GDVA 1K1OA 1PPCE 4AFUA 3I77A 1FONA 1O3AA 1VITG 2GT8A 1W7XH 4FU8A 3GY3A 1GHXH 1Z8GA 5KGOA 1QQUA 4H42U 4GSOA 1F7ZA 1GBAA 4ABIA 1JIMA 3MO9A 3RXSA 3QUMP 2GT7A 4Z0KA 1K1JA 2BDCA 2WUBA 1DWBH 1XUGA 2ZQ1A 3NPSA 3LPRA 4X1NU 1C2MA 1YLNA 3GCTF 3ZZ8A 1E0FD 1WYKA 1P9UA 1JRTA 2FOMB 1TRNA 2AS9A 3A8DA 5JBTA 1HAHH 4MPXA 1P11E 2B0FA 3ATMA 4DVAU 2FLRH 1SC8U 1FAKH 5AF9H 1AUJA 1CT4E 2UUJB 3BN9A 1ZSKA 1COWD 5C0TA 3TK9A 2ZKSA 1FI8A 5HYOA 3RC5A 5T6FA 1OWEA 2BVXH 1O2SA 2M2AA 1DLKB 2HVXA 4ZKRU 3DD2H 2VIVA 2BY6X 3FZDA 2PV9B 2M5TA 3W1EA 2B7DH 2YMSC 2OC8A 3BTQE 1GBCA 1A0LA 2WPKS 1ZPZA 3DCLA 4ZXXH 1EOJA 1QGFA 2GZ7A 1FY4A 3VGCB 1C1SA 2XRCA 4NIVA 1G9IE 3PTBA 4UFEH 1O2JA 3V13A 5C5OA 3BTGE 2FTMA 1AQ7A 2YMSD 2VWMA 4ZH8A 2DE9A 2A4QA 2Y5GA 3QX5H 2F91A 1V2PT 4JZ1A 4ABJA 1UVOA 4FOUC 1Y3YA 2G52A 3H7TA 6CHAC 4LK4A 2WSSD 3AAVA 2WYJA 4BNRA 2AGIX 4FUCA 3C1KA 1O2WA 2XXLA 1J17T 1NFUA 3Q3XA 4I8GA 3RXLA 1GGDB 1NZQH 3SZEA 1NRRH 3NCLA
chains in the Genus database with same CATH topology
1A5IA 2NU3E 1OWIA 1XUJA 2BLQA 1ZTKA 3M36A 2P3FH 4BAMB 3BG4B 1SGTA 1YCPH 1S83A 1Y5BT 2HRVA 2J92A 1HFDA 1DOJA 3EQ0H 1GJ8B 4IW4E 3BIVH 1MD7A 5A0CA 5AFZH 1K1NA 9ESTA 2A31A 5JB9S 1LTOA 4Z6AH 1MMJN 3RLWH 1THPB 1SFQB 1O2QA 1SL3A 3MFJA 3RM0H 1QHRB 2PKSC 3OU0A 2BDAA 8GCHF 1RTFB 1FUJA 1X7AC 1HPGA 1PQ8A 1K1LA 3RMMH 1ELFA 1SGDE 5CHAB 1GHYH 3SHCH 1L4DA 2O8TA 1GCTB 1P0SH 5DP5A 1BHXB 1ELTA 5LH8A 1EZUC 4MG3A 1LMWB 1A5GH 2FOEA 1GHBG 3IWMA 4UONA 1C2IA 4MLFB 1DLEA 2QAAA 2QN5T 2VH0A 4DIHH 1A0HB 1G30B 3A7ZA 3SUEA 1KXCA 2XBVA 2J4IA 1O3MA 3K65B 1UTKA 2QXIA 1LHDH 1SLUB 1PPZA 5B6OA 1F0UA 1IQJA 2SGFE 1GHAF 2ANYA 1D3PB 1TRMA 4CHAC 2XW9A 3BTWE 4B2AA 3ZZ6A 1NFWA 1SGRE 2R2MB 1NPMA 3K6ZA 1JBUH 1B0EA 1DS2E 3RXAA 3MH5A 4H6SB 2STBE 4NA9H 3OSYA 3HKIB 1KLIH 1O3JA 1QL7A 4LZ1H 5DK1A 1ZRKA 1MZDA 8KME2 3ATWA 2RA3A 1CHOG 3SI4H 3HGNA 1H4WA 4Y8ZA 1BUIA 1AUTC 2G00A 5F6MA 4WJG2 2SNWA 3LGYA 5A8XA 1C2EA 1O5GH 2UWPA 1L2EA 3H5CB 4FVBA 1OPHB 4TWYA 4AYYB 3EGKH 1TLDA 1ID5H 1MKXK 4ASHA 2OLGA 1K22H 1C5UA 2ZFPH 1Z8JB 1T8NA 1UVPA 3RLYH 1C9TA 2FIRH 1TABE 3RXVA 2BDGA 2QIQA 3SU2A 5HM2A 2V3OH 4WY3A 1RRKA 2WV5A 1H9IE 1QJ7B 3UREA 2VWOA 1A61H 1SHHB 1RXPA 1P8VC 1ZSLA 1OS8A 4YTAA 1ELCA 4KTCA 1AFQB 1O3OA 4UDWH 2H9TH 4FUEA 3M5LA 2SGDE 1L0ZA 3RXDA 1EZQA 2G55A 3RDZA 4XOJA 5IDKA 3UQVA 4ISLA 1GJ7B 1ZPBA 1GL1A 2FX4A 1HRTH 3GCNA 2QC2A 1ZTLA 1BBRK 1C5WB 2WPLS 4AGJA 4ISOA 3UY9A 3SGBE 1C4U2 1PYTC 2FI3E 1ELVA 3O8BA 1NS3A 4IN2A 1ELDE 4CRDA 2JETC 2UUFB 4GHTA 1V2NT 1S81A 2VGCB 2ZDKA 4XDEA 1B5GH 1K28D 2ZO3H 2P95A 1AU8A 1C5YB 2UUYA 3SU1A 3RMLH 4INLA 4HTCH 4A1TA 1EJNA 2I6QA 2THFB 1C5NH 3F9HA 1ARCA 2F9BH 1O3KA 2VIWA 3PM3A 1C9PA 1HAVB 1UCYE 3UOUA 1SLXB 1ZLRA 1P12E 1P2QA 2Y7XA 2GCHG 1E35B 4A6LA 4Y11E 4GHQA 1ARBA 1V3XA 4LXBH 4JYVH 2XC5A 4UE7H 1GHBF 1MCVA 3SUGA 1G3CA 3KL6A 1GI4A 1GMDG 3KF2A 4K1EA 1BQYA 2BDHA 2UWLA 4D76A 5LPFA 5FPTA 2DE8A 2ZFTA 2ZHEH 5DP9A 2F9VA 2PR3A 3UTUH 2ZFRH 1V2KT 4UFGH 1G32B 2NU1E 1XXFA 1HGTH 5A8YA 4AG2A 1TALA 2G8TA 4IMQA 4B71A 3GISB 4ZUHA 4IBLH 1Y3WA 4NFEA 1F92A 4FUJA 1GHWH 1NFYA 5E0JA 6CHAB 2Q1JA 2SGQE 3RXMA 3LGUA 1YC0A 4ZMAH 3T29A 4ABAA 3RXKA 4A7IB 4CRAA 4YT7H 4FUHA 5A8ZA 5C5NA 2A4RA 3PLBA 3P92A 1MU8B 1PPBH 2PW8H 1GHVH 3ATLA 1O3EA 3E1XB 1RTKA 1A1RA 3E0PB 3TJNA 1ELBA 4D8NA 1BJVA 4GVUA 1GJBB 3QWCH 3ZV9A 3BTFE 3P6ZB 3AAUA 3W94A 2PSYA 2TIOA 2PKAA 2BVRH 1SSXA 2JKHA 1NESE 3S7KB 1CA0B 3KQBA 1Y3VA 2PUXB 1C5PA 1ZMJA 3RXTA 3M7TA 3U8TH 1SR5C 3SU3A 5EXNA 2ZCKP 4Y8XA 4KTUA 1EAXA 1EPTB 4U32A 3SJ9A 3SW2B 2G81E 1OXGA 2JH0D 2A2XH 3A86A 1NRNH 4MTBA 2FX6A 3EE0B 5GPIB 5C1UA 7ESTE 2J2UA 1EX3A 1MKXH 6GCHF 4NWKA 3RXCA 3ZYDA 1C1WH 1V6DA 1AKSB 4I31A 2Y5HA 1CHGA 1HLTH 3T26A 3VB5A 3SQHE 2BQ6B 2GDEH 4AX9H 1FXYA 2TGPZ 1GBBA 4MPWA 1HAGE 5E8EH 5GDSH 1PPFE 2XCNA 1FPHH 2AIQA 1GI8B 1T8OA 3N7OA 5LPRA 2TRMA 2AH4X 2ILNA 4CHAB 1GVZA 4CRGA 1MAYA 2UWOA 1ETTH 2OBQA 5EW2H 3ELAH 1MH0A 3RXRA 1J16A 4ZKNU 3D23A 1CBWC 3CENA 3E3TA 1Z7KA 2FP7B 3NKKA 2H9EH 4Q7XA 1OX1A 1XX9A 1O5EH 2Y6TA 3A7TA 4RKOB 1HYLA 2FYQA 1HJAC 1IQMA 1C2HA 3ESTA 4Y10E 2TGDA 1C5SA 2NWNA 4NGAH 1DDJA 1GMDF 2ZECA 2EI8A 3M3TA 3TIUA 3SV9A 2BDYA 1HAOH 2BYAX 4ISIH 3ZZCA 4XSKU 1TGSZ 1BTHH 3AW1A 3A88A 3MU5A 1OYQA 3K9XB 1H8IH 4GLYA 4IN1A 3SNBA 2BHGA 1EZXC 2OBOA 3U9AH 1VCQA 1Z8IB 4E05H 1SI5H 3GCTG 2BXUH 4RN6A 1D3QB 5FX5A 3BTKE 1D4PB 3AW0A 5T3HA 1KLJH 1S6FA 2BTCE 1P3EA 1KXEA 2LNCA 1SHYA 2VIPA 2Z3EA 4Y0YE 1S82A 2VVCA 1O3BA 2Z3CA 1BIOA 1KYNA 1AWHB 2KAIB 2HNTF 1WU1A 1K2I1 5HMAA 4BTUB 1J14A 4B2BA 1GJ5H 1WTGH 1GMCF 2VVUA 2ZCHP 1TNHA 3MI4A 2ALPA 2QF0A 2H2ZA 1TGTA 1BMLA 1Y59T 2ZGBH 4JZIA 3MH7A 5E2OA 1AHTH 1PQAA 2GV6A 2TPIZ 1GI9B 2XYAA 4HI3A 1O31A 1YKTA 1N8OC 2XNIA 1C2DA 1EJMA 3U98H 4YT6H 1OWJA 1GI1A 3UNQA 5EODA 5PTPA 1PPGE 1WUNH 3S9AA 1VITH 2F83A 4BTIB 4XBCA 2PSXA 1C5TA 4NA8A 1IQKA 1LKAA 2CMYA 4UFFH 5C67A 1T4UH 3OX7U 1Z6EA 3P17H 1C2GA 1D6RA 4CBOA 1HJ8A 3EDXB 1P06A 1E37B 2FXRA 4IMZA 3MNSA 1C5VA 1MZAA 4I8LA 2NU4E 1RTLA 2P3UB 4BOHA 4O03A 1LHCH 3PMAB 4JZEH 4MNVA 4D9QA 4TWWA 1MTWA 4NCYA 5FBIA 1UMAH 1DWDH 3OTJE 1CO7E 2ZFFH 2GV7A 1P04A 8GCHG 1C1OA 3NWUA 5A0AE 1MQ6A 1O3DA 3SUDA 3MU1A 1ZHPA 3ZVDA 1LVMA 2QXHA 4NZQA 3ZZBA 1BA8B 4X6MA 1UCYH 4ABEA 5HM9A 4Q80A 2GVFA 5DP4A 1EASA 3A87A 3TGJE 3RXJA 1AN1E 5A09A 3U1JB 2QYIA 5FHTA 1QNJA 1O2YA 1CVWH 4AORA 4CREA 1T32A 3DUXH 4I8JA 1TRYA 1GBKA 2C8YB 1UTPA 1LPKB 3RXOA 1S5SA 1ESBA 1TBZH 3QTOH 1UTJA 2GZ9A 3IG6B 1FN8A 1W10U 2A7JA 2YOLA 2VWLA 1DSUA 5HGGA 4KTSA 4ZHLU 4IC6A 2GMTC 2Y82A 1HUTH 3ZV8A 3HPTB 3VB3A 1GHAG 1IQGA 1LHFH 5GJ4B 1BTUA 2F3CE 2ZI2H 4FUIA 3GY8A 1KLTA 1YPGH 3M3SA 1C1TA 2ZPRA 1SGFG 4YZUA 1QFKH 2EA3A 4K8BA 4Q7YA 3MMGA 1QCPA 1GBLA 1QA7A 1LHGH 2W5EA 1AVGH 3GCHC 1SVPA 4X2YA 1E34B 1YPKH 1TNJA 1THSH 1O3HA 1SGCA 2OXSA 2ZFQH 1SOZA 5FBEA 4OGXA 2ZFSA 1KXFA 2OC7A 1AD8H 1FJSA 1O33A 1TMUH 1DICA 1NTPA 2BVSH 5BRRE 1Z6JH 3UIRA 4DGJA 4JK6A 2CF8H 2Q6FA 5DP3A 2RG3A 1BDAA 1W11U 1DX5M 2FI5E 1YPHC 3A83A 4AG1A 4B74A 1LQDB 3LT3A 3PROA 3CP7A 1EATA 4R8TB 3VXFH 1TB6H 1YPHE 2XC4A 4Y6DA 1K21H 3E91A 3Q3YA 1BZXE 2CHAB 2F9UA 2ZPSA 1YLCA 5FXLA 3PB1E 3NXPA 3QO6A 2Z6BD 2Z7FE 1YM0A 1C1VH 4FVDA 3TH3H 1BTPA 4YOGA 1K1MA 4MNXA 4HGCA 1HJAB 1L1GA 1BTZA 5A2MH 2CGAA 1ZGVA 2G4TA 2ZDVH 5AFYH 4U01A 4YLQH 1TMBH 2Y81A 1W3CA 4X2WA 1GPZA 3T27A 1W12U 4SGAE 1H1BA 1FQ3A 4B2CA 2A0QB 1DPOA 3EA8A 2H1UA 1P05A 5E0HA 1SQAA 4FUFA 3GDUA 1V2OT 1W2KH 3SJIA 2Z9JA 1LCYA 4DG4A 3P8GA 2P94A 2A2QH 3ZZ3A 1QB9A 3SJ8A 1LVBA 4NWLA 2LPRA 3SJOA 3V0XA 1HIAA 3RXFA 4NSYA 1CU1A 1ELAA 2ZGHA 3LGWA 4HZHA 3SQEE 1GVKB 1ZJDA 2VIOA 1PFXC 2JH6D 1DITH 1JOUB 4AFSA 4GCHF 2BY7X 1CSOE 2XC0A 1C1PA 5G4BA 3GY2A 1LPZB 2OQUA 3SNEA 1SGNE 1EAWA 3TH2H 1C2FA 4DT7B 1SGEE 1LVOA 4D9RA 1QRZA 3PYHA 3ATIA 5GCHF 3RU4T 1OWKA 1AE5A 2WPJS 2AYWA 1O5CB 2F9NA 1C4Y2 1QY6A 4IS5A 3MU8A 4AFZA 2C3SA 3LC5A 1ZRBA 1HJ9A 2W7SA 1FY5A 5DJ7A 1UTLM 1NM6A 3A84A 2GP9B 3TK5A 4ABGA 2FM2A 1P57B 1B7XB 2ZP0H 4NIWA 1P10A 4X1PU 2O8UA 3Q76A 2HGTH 3E0NB 1Z1IA 2VIDA 1E36B 2P16A 2ZEBA 4O3UA 3KNXA 1EOLA 3BG8A 1KXDA 2ULLA 3LGVA 1TFXA 1T8MA 2A5AA 5DGJA 4GPGA 1C2LA 2J9NA 4X8VH 1JIRA 4DW2U 2C90B 1IQNA 1F5RA 1KTTB 3TGIE 3SU4A 3GCOA 1IOEA 2ZU3A 1BTYA 1BTWA 2BOHB 4MQAA 1O2UA 1TGBA 4BTTB 1GG6C 2SGEE 1NRPH 2W7UA 1O5DH 5CMXH 1GBEA 1T31A 1YCPM 5J4QA 5F8XA 1TQ7B 1EB1H 2W3KA 1C5RA 1GJDB 4FU7A 1Y5UT 4Y76A 3R3GB 4ZHMU 2VWNA 1Y8TA 1TNKA 3PO1C 3FZZA 1GJ6A 2R0KA 2Z9IA 1ZYOA 1A5HA 4KP0A 4TYDA 1VZQH 1MTNC 2G51A 1EB2A 3O8DA 3TK6A 5EQRA 1GBDA 1T7CA 4CRFA 3DFJA 4ABFA 2AMQA 2ZHQH 1VCWA 1TPOA 1C2KA 4X6PA 1EUFA 1O2TA 2OC1A 4OS6A 2R3UA 3D65E 3K2UA 2ZHDA 1BRCE 1ESAA 2BX4A 4F49A 6GCHG 2GDDA 1QTFA 3GDSA 2PHBA 1GBMA 1UTOA 2QY0B 1C5MD 4NSVA 1PJPA 1ZMNA 1WTHD 7GCHF 1CA8B 3SNDA 3M61U 5F03A 1BTXA 4CR5A 1V2WT 4WMEA 2GCTC 4INKA 4Y7BA 1K9OE 3F9FA 1TONA 2BD7A 2GMTB 3F1SB 2ZDMA 3GY4A 3SBKA 5JPMH 3KEEA 4JMYA 1ZR0A 1C5OH 4NFFA 2OTVA 1QQ4A 3T5FH 4AN7A 2ANKH 2BD3A 1ABIH 1HAXB 2C4FH 3AASA 1EQ9A 3Q00A 4MDSA 3MH6A 2J38A 1P09A 1S85A 1UJ1A 1GBTA 1UK4A 2PGBB 3TNSA 1DUAA 3BTME 1SMFE 4BAQB 3ZVCA 2EC9H 3O8CA 1SGPE 5EXLA 1O3LA 1O0DH 1OYTH 2ALVA 4X1QU 1W7GH 3A82A 1YGCH 4LZ4B 2GGVB 5J4SA 1AO5A 3PMBB 4Q2KA 5ESTE 2OCVB 2NU0E 3BEFB 1HXEH 1TNIA 5TJXA 2AMPA 3E16B 2ZTZA 3RU4E 1KTSB 3MOCA 3S69A 3F68H 3RM2H 1KSNA 1UVTH 1FPCH 1OWDA 5FX6A 4A5TS 3RU4D 1A3BH 1DFPA 1V2UT 1UTMA 4NZLA 2A7HA 3P70B 2OC0A 4X8TH 3U8OH 2FS8A 4DIIH 3QTVH 3MU0A 5JBBS 2FYRA 5I25A 3U1IB 1P2MA 3UFAA 3B23B 3MNBA 1RIWC 2D1JA 4DCDA 1WAYB 4IC5A 5IYTA 4WF8A 4I33A 1Q2WA 4FUBA 2CF9H 4DURA 3LOXA 1ZTJA 2P8OC 1SOTA 1A46H 3URDA 2R0LA 3Q77A 1GMCG 3PWBA 1FDPA 1ZPCA 4D7FA 3RMOH 1A4WH 4ZROA 1GL0E 4Y0ZE 1XUIA 2ZGXH 1P01A 2PKSB 1Y3XA 3MNCA 1C1UH 1D3TB 1LKBA 1NN6A 4ZKOU 4AFQA 3U8RH 1O32A 1FZZA 2STAE 1LPGB 1S84A 3SV6A 1IAUA 4AOQA 3ZZAA 3QLPH 5JBCS 1P2JA 1UHBA 1C5QA 1XUHA 1P2OA 4U2WA 1O3GA 2OD3B 2HPPH 3TGKE 1OSSA 3KN2A 2RCEA 3L33A 3BSQA 1O3PB 1CGJE 2B5TB 2FOHA 2HPQH 1AVWA 1C1RA 9LPRA 2K1QA 4WVPE 4BXWA 1GBHA 2D26C 3RXIA 3VEQB 3SU6A 1DVAH 1Y3UA