3S69A

Crystal structure of saxthrombin
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
234
structure length
234
Chain Sequence
VIGGDECNINEHRSLVAFFNSTGFFCSGTLINEEWVLTAAHCDNTNFQMKLGVHSKKVLNEDEQTRNPKEKFICPNKKNDEVLDKDIMLIKLDSRVSNSEHIVPLSLPSSPPSVGSVCHIMGWGSITPIKVTYPDVPYCAYINLLDDAVCQAGYPELLTEYRTLCAGILEGGKDTCGGDSGGPLICNGQFQGIVSFGAHPCGQGLKPGVYTKVFDYNHWIQSIIAGNTTVTCPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thrombin-like enzyme defibrase
publication title Structure of saxthrombin, a thrombin-like enzyme from Gloydius saxatilis.
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 234
sequence length 234
ec nomenclature ec 3.4.21.-:
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3s69A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3s69A02
2Z6BD 1MUEB 4BAOB 1B0EA 1OKXA 2HVXA 1FUJA 1ZPBA 1KTTB 5DGJA 1TIOA 4D7GA 1SGPE 3IG6B 1ZOMA 1O5FH 1XUKA 1O5EH 2V3HH 1BHXF 3ELAH 3NCLA 5EG4A 1IQJA 2ZCKP 1G2LA 1O2UA 3PLPA 1GCDA 3TJNA 1C9PA 4NIWA 4I8KA 2W3IA 5EXMA 2HALA 2ZPQA 3MU4A 3S7KB 1SG8B 2XCNA 3SN8A 3D65E 1FAKH 3M3VA 1J15A 4WMEA 4DURA 2EEKA 1U6QA 2Z9KA 1QJ1B 1CBWC 4VGCB 3A8BA 1QR3E 2BD3A 1MCTA 2EI8A 1GBIA 1C2JA 1NRPH 3RXBA 1MAYA 1LVBA 4K1SA 1ZGIA 1ESTA 4K60A 4ISOA 3K65B 1LDTT 2QIQA 1HGTH 2ILNA 1MTNC 1TBRH 2BZ6H 1Z6EA 2Y81A 3QK1A 4Z6AH 1UTKA 1BRBE 4NIXA 2RDLA 3P8GA 3IWMA 1KXDA 2AS9A 1HXEH 4FUGA 2BD7A 2A5AA 2OBOA 2G4UA 1SSXA 3UNSA 2BDBA 5FXLA 3LC3A 1C2MA 3SI3H 2HNTF 3UQOA 3UWJH 5FBIA 4KTUA 4ABHA 3E0PB 4R8TB 1P8VC 1F5LA 1V2VT 2BOHB 1YBWA 1EPTB 1GHYH 2H5CA 1F2SE 1LPKB 2BY7X 2AMPA 2ZDMA 5DP7A 2GT7A 4HI3A 1DICA 1TMTH 4YLQH 1LQEA 3MNBA 1RFNA 3LGYA 4R0IA 4OS1A 3MH6A 1W0ZU 3MO3A 1E35B 3I77A 3K9XB 2ZO3H 1V3XA 4ZUHA 1BTXA 4U30A 1A46H 1KSNA 1KXCA 2WUCA 3LGVA 1CSOE 1O3AA 1EZXC 2R2WU 1TNKA 1Z1JA 3SNEA 1CA0C 3R3GB 4AB9A 2XBYA 1WTGH 2Y6TA 4CRCA 1TPPA 3KGPA 2FO9A 5TCCA 2GDEH 2G4TA 4HGCA 1ELFA 1K1MA 2ODQA 1O2IA 2FLRH 1W14U 7LPRA 1SQTA 2W7UA 1O33A 4IC6A 1L1NA 4AN7A 1A1RA 1GG6C 1ORFA 3SJ8A 1FMGA 3RXCA 2A2QH 1BRUP 1PQ5A 1V2QT 3F9GA 2P59A 2F9UA 1A2CH 4INHA 4LZ1H 2P3UB 4CR9A 5L2YH 2RCEA 1SGDE 1DANH 2VH6A 2QCYA 1T31A 3TLOA 1ELDE 1ZMNA 5I46H 1UCYH 3KQEA 4YZUA 3CP7A 4NFFA 2TGTA 4YT6H 4THNH 3ZVBA 1P12E 1GI5A 5G4BA 1D4PB 1K1IA 3BTME 4X2WA 1F0SA 2FOFA 4X8SH 3Q3YA 2V6NA 1GVZA 2BMGB 2JH5D 3GY8A 2ZC9H 1J14A 3L33A 1YC0A 2VWMA 1P0SH 4MNVA 3UIRA 3S9BA 1GI6A 1QL8A 2A5IA 1BOQA 1P2QA 4X6PA 4JYTA 2VIOA 3BTEE 1Z8RA 2UUKB 3BTHE 2PW8H 1K2I1 3HKJB 1ETRH 2CF8H 2F91A 5ETXA 4AYYB 1AZ8A 4NZLA 5FPTA 5FBEA 1C1QA 3CS7A 5H4IB 5JYIA 4H6SB 3ZZBA 1Q2WA 2BQWB 1H9IE 3N7OA 3T5FH 4X1SU 4K1TA 2WYGA 3HKIB 3UOUA 2FM2A 2G81E 4U2WA 1C9TA 1TNGA 2QV1A 3QUMP 1LO6A 3SHAH 4ZAEA 2QC2A 3TVJB 4CH2B 1DLKB 1C5LH 1TRMA 2GKVE 2XW9A 1LVOA 2NU4E 4X6OA 3SGQE 1BJUA 3GCHC 1P3CA 4JMYA 4AB8A 1C5XB 1GMDF 1O2XA 1ACBE 1Y5AT 4CBOA 1MKWK 2ANMH 3ENSB 6ESTA 2VGCB 1V2PT 3PROA 3TJVA 1AGJA 3H7OA 3VXEH 3ZYEA 3GY7A 5JBBS 1C1OA 4DOQA 4Y7AA 5ESBA 1IQMA 1QB9A 4GCHF 5FX5A 2GP9B 1VJ9U 2CHAB 4FU8A 1MTSA 2C93B 4NCYA 1TA2A 4GLYA 2CGAA 3UNRA 1BTUA 2OQ5A 4DG4A 1GMDG 1P11E 4ZXXH 2G52A 1YPMH 1O5BB 2A0QB 2NU3E 1NU7B 2QXHA 3M36A 4MPUA 1NT1A 1IQKA 1EUFA 2Z9GA 2GCTB 1EOLA 1PPZA 2ZDAH 2SGAA 3MU1A 3BIUH 1AZZA 3V7TA 1LVYA 1O3JA 1WAYB 2GT8A 3RDZA 4YO9A 2VU8E 3M5NA 3TIUA 1ELAA 2Q6FA 4MNXA 1IQHA 1MQ6A 1O2OA 2ZDVH 1ARBA 4GCHG 1OSSA 4DY7B 1NESE 1W11U 1C5YB 2BDAA 4JZDH 2D2DA 4Y0YE 1P9UA 2F9OA 2A5KA 5CHAC 2QF3A 3VEQB 1AB9C 3HK3B 4NZQA 4MQAA 4NSVA 2BLWA 2NWNA 5AHGH 3UOPA 1W2KH 1TRNA 1CGJE 4WXIA 4WY3A 2H5DA 2ZP0H 1QBNA 3A84A 3LH3A 4X6MA 4JZFH 4YESB 3RXFA 1CGIE 2PFEA 1BBRE 1MCVA 2FOEA 2FTLE 5F8ZA 1ANDA 3GY3A 2VWOA 4X1NU 1QURH 2Y80A 4ZHMU 2ULLA 5EOKA 1EAWA 1S82A 3K2UA 4CRGA 1O39A 3QO6A 2AYWA 2XTTB 1O2YA 3PYHA 1O3FA 3SU1A 1SGFG 1UTJA 3MTYA 1CQQA 1SI5H 5AFZH 1PYTD 4IGDA 1C5RA 1O3EA 3QZQA 3LIWA 1P09A 2XNIA 3AVZA 1DS2E 3PLKA 4XOJA 3DD2H 1KLIH 3HK6B 2FOBA 3P70B 2BY5X 2J95A 3ZZ8A 3SU3A 2FS8A 3EGKH 3ODDA 3PWBA 2GV7A 5A8YA 4ASHA 1XXFA 3KF2A 3SJKA 3M7QA 5J4SA 4H6TA 4H42U 3SU4A 1TNLA 5C5NA 1F5RA 1XMNB 2PTCE 4MVNA 2FOGA 1DT2A 2XC5A 3UNQA 3U8RH 2Y5FA 5L2ZH 1GHBF 2ZU5A 3S7HB 3UR9A 1GI9B 1T4VH 1EB2A 4NWKA 5EW2H 1FIZA 1Z7KA 5K7RA 2GCHF 5K0HA 1AE5A 3W95A 3EQ0H 1QRZA 3A8CA 1C5SA 3RLWH 1QA7A 3FANA 5DG6A 1KLJH 4Y79A 4K5ZA 1ZHMA 4X8VH 1T8NA 4XBDA 3MNXA 4U32A 1WV7H 3L6PA 3BEIB 5DP9A 1SGEE 3PM3A 3EAJA 3RXMA 4GVUA 2OCVB 1GHBG 2VIQA 3SNBA 1AFQC 1TE0A 1DPOA 2ANKH 3NK8A 4E7RG 1ETTH 2F9PA 1MKWH 1O5CB 1AMHA 4JK6A 2GCHG 3NWUA 2ZNKH 4F4OC 2A2XH 2KAIB 1OYTH 1PPEE 1C1WH 1C4V2 1NN6A 1PPHE 3Q77A 2UWOA 4WVPE 4KELA 1SGIB 1TX7A 2HGTH 1ESBA 2F9VA 2C4FH 1DOJA 2W26A 2NU1E 1G3BA 1SB1H 1ZR0A 1SQAA 1FY4A 1MU8B 1LHCH 1NRSH 5E0GA 5E8EH 1CA8B 1GBEA 1ZJKA 1YPKH 2P16A 1P01A 3URCA 1C1RA 3UREA 1ZZZA 1P2KA 2GDDA 2BXTH 1EQ9A 2PLXA 2IJOB 2ZKSA 3RUOA 3RXQA 2A7CA 1BJVA 5F03A 6CHAC 3AAVA 2XWBI 3BEFB 1Y3WA 3E91A 1GBLA 1A5GH 4GAWA 2ZGHA 4ISIH 1GI0A 4BAMB 2LPRA 1SMFE 3VFEA 4X1QU 2IPHA 2AGIX 2GVFA 3NXPA 1O5AB 1HYLA 3GY4A 2AERH 1O3IA 2BDIA 3PB1E 2AIQA 4X2YA 2WPLS 3U98H 2BM2A 1DVAH 2VWLA 2FX6A 1GJAB 1GVLA 1XVMA 1ZMLA 3UPEA 2FXRA 4D9RA 1O2SA 4CHAC 1GL0E 2PKAA 2WPMS 1DUAA 1N6XA 4NSYA 3FFGA 2GZ7A 1HJ9A 5B6OA 2ZFRH 1NPMA 1GCTC 4Y76A 5C5OA 1O3BA 2D1JA 2FI3E 1GDUA 1RXPA 3L3TA 4UFFH 1NFUA 2EC9H 1AKSA 2J38A 2CV3A 1CBWB 2BDGA 1P57B 5DP8A 5I25A 3EA8A 1MZAA 3U1IB 3SQHE 2OTVA 4I8HA 1TX6A 1QGFA 3ZZ9A 1ELGA 1W0YH 2UUJB 1F5KU 4WMFA 1O3MA 1K21H 4YOGA 4AFUA 1MTNB 1C2FA 3TK5A 2ZEBA 2UWPA 4Z0KA 1TBZH 2J34A 2ZU2A 3O8BA 1NY22 5A0BA 2WV5A 4ABAA 3QGJA 1GBKA 1SPJA 1CU1A 5TJXA 1G3CA 3LH1A 5FHTA 4BTTB 1NS3A 5A8XA 1J9CH 1THSH 2BY6X 4CR5A 3MWIU 1OOKB 3TJOA 1IAUA 3BTGE 5E0HA 3S9AA 2CXVA 3FVFB 1BMAA 1BITA 1UTLM 1O0DH 1V2MT 1C1VH 3ZV9A 3STIA 3MYWA 1S81A 1O2JA 1TX8A 3RXIA 3A7YA 1O32A 4RKJB 1AHTH 4BAHB 3RU4E 1PQ7A 2BY9X 2QY0B 1FDPA 4AZ2B 1HAIH 1CT4E 3RXDA 4Q7XA 9LPRA 1SGYE 4CREA 5FCKA 3MMGA 3LGUA 3Q00A 1TGTA 1O2ZA 4Y7BA 1CA0B 4K3JA 2A4RA 3ATMA 1QJ6B 2NU2E 3P8NA 4BNRA 1QNJA 3GYLB 5GDSH 1NFWA 3RXTA 4SGAE 4LZ4B 1GBMA 3A86A 1PYTC 2ZHDA 4JK5A 1Y3UA 1GI8B 3VXFH 1Y8TA 1OXGA 4ABGA 5AFYH 1Q3XA 4Y10E 1GG6B 4A5TS 3TGKE 1D6RA 1D9IA 1TNIA 2FTMA 1O3LA 1YPJH 1GBDA 3URDA 2P8OC 1NFXA 4FUJA 3TPIZ 2BTCE 3ITIA 2XXLA 1GJ7B 1SHHB 1QQ4A 1OWJA 1P2IA 1MMJN 4HTCH 1ETSH 1FPHH 1UK2A 1IQEA 3E16B 1CO7E 3F9EA 2V35A 5HYOA 2ZF0H 2VVVA 1AIXH 1A4WH 4FVBA 1HAZB 4NIYA 1P10A 2AMDA 1Z8JB 2XBXA 1F7ZA 4A6LA 5T6GA 1GJ9B 1M9UA 1MD8A 1WCZA 4TY6A 1P2OA 8ESTE 1TB6H 5E2PA 3PO1C 1O2KA 1DSTA 2SGFE 1K9OE 1NROH 2BDYA 1GGDC 3NPSA 1HNEE 2K1QA 2OC7A 3BEUA 1C1UH 1B0FA 1XX9A 6GCHF 5LPRA 3SORA 1L4DA 1EKBB 3RXSA 1LHFH 3BV9B 1ZJDA 4ZMAH 1BTPA 1TMBH 1AU8A 3SU6A 2AMQA 4XSKU 1FXYA 4J1YA 2HNTE 1V6DA 4OGXA 4YLUA 1PFXC 2BD4A 2BYAX 1H1BA 1W12U 3ZV8A 3LGIA 3Q3KA 1DSUA 4BANB 3BTWE 3KIDU 3RC6A 1UK3A 2ESTE 5E0JA 2C8WB 2B9LA 3O8RA 3GCHB 3TK9A 1QL9A 2JKHA 2BD9A 3VB5A 3DHKH 2UWLA 1TRYA 2BVXH 2HPQH 4AGKA 6GCHG 3MI4A 1GI3A 5EGMA 1OP8A 3BG4C 1ANEA 1Y3YA 4OS2A 1UTMA 5T3HA 1D3DB 1O2GH 3M5MA 1VITH 5LH8A 2FS9A 2G00A 1T8OA 2QXIA 1UTPA 1VGCC 2Z3EA 1HPGA 4MPXA 4O03A 1BTHH 3B8JA 1S6HA 1GHAF 1AI8H 1G2MA 2BQ6B 3BIVH 1KXEA 1RRKA 2ALVA 1BDAA 3A87A 1HAXB 1TOCB 4A7IB 3E6PH 4CH8B 1QQUA 1YM0A 3TH2H 3PTNA 3CENA 1XM1A 3ZVDA 1O3HA 2Z3CA 1O38A 2OXSA 1K1JA 3EA7A 4DCDA 2OQUA 3MHWU 1V2RT 4TWWA 4I32A 4X1RU 2O8UA 1V2ST 4HFPB 1HAVA 1SLUB 1YCPM 4MG3A 4WMDA 1A5HA 2Z9LA 3GICB 3SJOA 4JCNA 4YTAA 1GHAG 2PKSC 3HPTB 1D3PB 2DE9A 1Z8IB 1A61H 1NRRH 5CHAB 1AB9B 1FPCH 2BVRH 1H8DH 4NG9H 1GJDB 2ZTZA 1TGNA 1QIXB 2FPZA 1C2IA 8KME2 4TYDA 9ESTA 3M3SA 4ISHH 2ZPRA 1HAGE 4BAQB 1SLXB 4JZEH 5LPFA 4FUHA 2PGBB 3LC5A 4D76A 1J16A 3T25A 1FIWA 1EX3A 3GYMA 3A7TA 1OWIA 5HM2A 1TAWA 2ANYA 1GBBA 2ZHWH 1SHYA 1V2TT 2Y7ZA 2WV4A 5JBCS 2O8TA 1ZSLA 1HAOH 1H9HE 5FAHA 7GCHF 1O36A 3FAOA 3FP8E 1TPAE 1AWFH 1DE7H 1QB1A 2V0BA 3ZYDA 4FU7A 1V2JT 1QCPA 3AW0A 3SJ9A 4K8BA 2XC4A 3LJOA 1YLDA 3KL6A 3LT3A 3VB7A 2FMJA 5T6FA 3OSYA 3SBKA 3ZZ3A 4KGAA 1HCGA 1KXBA 1SOZA 5HMAA 1TABE 3DFJA 1Z6JH 3ZVGA 3QTOH 3RXKA 3RMLH 2IOTA 1YPEH 4X2XA 5E2OA 1FN8A 4I8GA 7GCHG 1V2NT 5C1UA 1C1MA 4DT7B 3UQVA 2R0KA 4LXBH 1WQVH 2XWAA 1C5ZB 1XUJA 3H7TA 1BUIA 1YLCA 2EI7A 5DPAA 3V0XA 1RGQA 3GISB 1JBUH 1LPGB 1GMHF 1KLTA 1HLTH 4KTSA 4YT7H 1FY8E 3MNSA 2HWLB 1DFPA 1HV7A 5F8TA 1P06A 2XBVA 1AFQB 3KN2A 2ZU3A 3U9AH 1SBWA 1OP0A 2EA3A 1UO6A 1ZRBA 1ZTLA 4BOHA 1T32A 1RJXB 3B23B 3A85A 4A1TA 1UTNA 3EE0B 2BLOA 4NA9H 2D8WA 3Q76A 2SGEE 1BQYA 3RU4D 3V12A 1DWBH 2SNVA 4UDWH 1O2WA 2F83A 5EXNA 3SV6A 1JWTA 1HIAA 1DDJA 4GHQA 3B9FH 1GHVH 1GMHG 1DY8A 1ZGVA 1P3EA 3P92A 1BMLA 4ZHAA 1NZQH 3ZZ4A 3RXAA 1YGCH 3KNXA 3TGIE 1UJ1A 4UE7H 2GZ8A 3A82A 2ZHEH 2ZHQH 1ELVA 1S0QA 1FN6A 4A92A 6CHAB 1HFDA 3P17H 4UD9H 1TALA 2PSXA 2STBE 1ABJH 1SGTA 1S83A 3QGNB 2C90B 1O2HA 2ZPSA 4AFQA 3GY6A 2OD3B 4FUBA 1UHBA 2VIDA 4XBCA 4WH6A 2JETC 1HAYB 3O8CA 5JPMH 4GPGA 5C20A 1KY9A 4CHAB 1GJCB 1YCPH 3AAUA 1N8OC 1GCTB 3BF6H 3GY2A 4DJZB 1O34A 1HUTH 3ZZCA 1SGNE 2FYQA 5FPSA 2CF9H 4NA8A 3F9FA 4ZKOU 3SO3A 2PWXA 1CVWH 1WBGB 4B71A 5EQRA 3M37A 4B2BA 5C2ZA 1ELBA 1KIGH 3F9HA 4Q80A 4Y8ZA 2DUCA 1GMCF 5EQSA 5EPNA 1C5NH 2PKAB 1PPGE 4D7FA 4ZKRU 5CE1A 2ZIQH 2ZECA 1B7XB 4WWYA 3FZDA 3LDXH 1BA8B 4MPWA 1GBCA 1AKSB 1WYKA 1EAXA 2YNBA 1FV9A 1TGBA 2VIPA 4U01A 1FQ3A 2J94A 2BOKA 4Q2KA 4IBLH 1GPZA 3ODFA 1GL1A 3OTJE 4AX9H 5ABWA 1AY6H 3LU9B 3SGBE 1P2MA 4INLA 3BTKE 1GMCG 4Y71A 3E1XB 1UCYE 3F68H 2ZFTA 1CHGA 5TCAA 2A45B 5T6DA 4X6NA 4OS4A 3BTFE 1O3KA 1BHXB 2B5TB 2GMTC 1O5DH 4ZKSU 5GCHF 2TGDA 2ZCHP 1TGSZ 2A4OA 3E3TA 2QXJA 4IN2A 2QYIA 2ZU4A 3OY6U 2BQ7B 1P2NA 1JRTA 3A83A 3SU0A 1GDQA 1QTFA 1DM4B 2I6SA 2NU0E 1XVOA 1LHDH 1C5QA 4IMZA 3BG8A 4IS5A 5EODA 1IQNA 4H4FA 1BRAA 1BTWA 1C5PA 1GBJA 1PQ8A 1T7CA 2Y5HA 2FEQH 1YP9A 5FPYA 1CT0E 1L0ZA 3C27B 2ALPA 4AG1A 2VIWA 4O97A 4Y11E 5GCHG 3SUGA 3RXOA 1OS8A 2H6MA 2ZGJA 2P8OB 4GUXA 3VGCC 4RSPA 1F0RA 1SGQE 1G30B 2ZFFH 2R3UA 4MNYA 4OS5A 1TNHA 1V2OT 1MZDA 3FP7E 1AVWA 1C2EA 1DXWA 3DUXH 1SFQB 4ABEA 1LKBA 2HPPH 4ZHLU 1KDQA 3TH3H 4ZKNU 1LMWB 2QN5T 4NA7A 4E06H 3SV7A 1AE8H 5HGGA 1SQOA 3SUDA 2O8MA 3S69A 1MBMA 1S85A 3PO1B 2ZFPH 2C8ZB 1ID5H 4Y6DA 1G37A 1KTSB 4WXVA 5BRRE 3LGTA 3O8DA 2J9NA 2F9BH 1GGDB 4LOYH 3PTBA 3ZVCA 3RM2H 1FY5A 2GTBA 4WJG2 1A7SA 4F49A 1ABIH 8LPRA 1OYQA 1GVKB 5C3NA 1O3OA 1BMNH 1ELEE 1AUTC 1HJAC 2VNTA 2XC0A 4RN6A 4XDEA 2BB4A 1O37A 2HRVA 4TY7A 3T28A 3TU7H 1W13U 1AD8H 1V2UT 1AVGH 4FUDA 2TRMA 1O3CA 1G36A 3TJUA 4XBBA 3VPKA 3UTUH 3SNDA 4FUIA 1SOTA 3UWIA 1ARCA 4CRBA 1E37B 1W7XH 5A0AE 5DKMA 1PPBH 1TBQH 1PQAA 5FCRA 4DIHH 1SGRE 1FAXA 3BG4B 2ZU1A 2ZGCA 1AQ7A 1VCQA 3WY8A 1F92A 2ZHFH 4TPIZ 1W10U 1VGCB 1MBQA 1SLVB 4B1TA 1Z71A 1CHOF 2ZI2H 2XRCA 3ESTA 3QWCH 1PJPA 2Z94A 3CS0A 4K8YA 1LPZB 4AGJA 2R9PA 2GV6A 5LPEA 4D9QA 4FVDA 1GBTA 1EJNA 1BBRK 1JIMA 3A7ZA 3P6ZB 1QRXA 3K6ZA 1EZUC 2P94A 2TGAA 4ISNA 4NWLA 1RD3B 2W5EA 1ZHRA 2KAIA 2AH4X 1HB0B 3UUZA 2BD5A 2CN0H 2BD8A 1O2MA 4GSOA 1CHOG 2D26C 2PKSB 2FOAA 5C1XA 3A8DA 2FOHA 2BX4A 1DWDH 1T8LA 3EA9A 3M3TA 1RS0A 1IHTH 4Q7ZA 4K2YA 1GWAA 5AVDA 1MU6B 1TMUH 3T29A 1T4UH 3DFLA 4JYUH 3ZZ7A 2XBWA 3GOVB 4I8LA 2V3OH 4GHTA 1S0RA 1TGCA 4INKA 3SI4H 1EP6A 1HAVB 4E7NA 2Z9JA 1V2KT 4IMQA 4TPYA 2H1UA 3M7TA 2AFQB 4NFEA 3PWCA 1O3DA 1OP2A 4D8NA 1TFXA 1RTLA 3STJA 2G51A 3S0NA 1Y5BT 2HNTC 4B73A 3VB4A 4YOJA 5L30H 1YPHE 1BCUH 2IN2A 4ZXYH 5GJ4B 3AW1A 2BLQA 1HBTH 3TK6A 3ATKA 1QFKH 1OWKA 4KP0A 3OU0A 5IDKA 4CBNA 2TGPZ 1BTYA 1EAIA 2QGRA 1D3TB 3TNSA 1IOEA 1OWEA 3GDUA 3A80A 4O9VA 2BDHA 5L6NH 3LJJA 3P8OA 4DGJA 4OGYA 1HJ8A 2P93A 1G3EA 1HXFH 5F8XA 1IQLA 1GI2A 1NO9H 2OLGA 2STAE 1GJ8B 3QX5H 4IC5A 4X8TH 3I29A 2FZZA 1SR5C 3SV9A 1FNIA 3M7UA 2SGPE 3RXEA 1EJAA 2WPKS 1C1SA 1K1LA 5JDUB 3RMMH 1XXDA 3SNAA 3NZIA 1AVXA 2OC1A 1EB1H 3ATWA 1ANCA 1VJAU 4J2YB 2OBQA 4AFZA 5DP4A 3BN9A 2BX3A 5DO4H 1A3EH 2ZFSA 3SU5A 2SGDE 2ZFQH 1SFIA 1ZSKA 3PMAB 1L4ZA 1T8MA 2ZQ2A 1MKXK 2ANWA 1G32B 3RXPA 5A0CA 1GHXH 5PTPA 3U69H 3GDSA 1ZHPA 4UONA 1QL7A 2LNCA 1INCA 2VINA 2A4GA 1O5GH 3RU4T 1QB6A 2O8LA 2SNWA 1ZRKA 3SNCA 2Q1JA 3TH4H 5A8ZA 1BB0B 3RMNH 4IW4E 1RIWC 2QF0A 3RLYH 5HXFA 2B8OH 1CE5A 3MOCA 3V13A 1WOFA 1C1PA 1NRNH 1BBRH 3PLBA 3M35A 1SVPA 1HRTH 3A89A 2C8XB 1TONA 2G8TA 1W7GH 4I7YH 4O3UA 1WUNH 3C1KA 2F3CE 1UVSH 1YYY1 2QA9E 4FUEA 1DWCH 2THFB 1HIAB 3H5CB 4YOIA 3E0NB 1TA6A 1YCPK 2PSYA 3D62A 2JETB 1TNJA 2AEIH 1VR1H 2FI4E 2ZDLA 3MU5A 1TPSA 4WH8A 3HATH 4NIVA 1TQ7B 1C5OH 1DITH 3GCNA 2TIOA 4FUFA 1N8OB 1Q31A 4WF8A 1YF4A 2J2UA 2XCFA 3RXGA 1EZSC 2HOBA 4HZHA 3MU8A 3T2NA 2FDAA 1BMMH 2BY8X 1UHBB 3NKKA 1UVTH 2BLVA 5FX6A 4AFSA 1BZXE 1KXFA 5SGAE 4MPVA 3RC4A 1VZQH 2OC8A 2FP7B 3PV4A 2Q6DA 4TWYA 1FY1A 1X7AC 5BPEA 4RKOB 1WTHD 3SOSA 1IQGA 3JZ2B 1SGFA 1O3NA 3T27A 4ISLA 1NRQH 5LGOA 2FOCA 5EXLA 2WYJA 1K28D 3OX7U 1P04A 1JIRA 1JXPA 2DE8A 5J4QA 4ABFA 5HM9A 1C5UA 2O8WA 1EJMA 2GGVB 2PR3A 2PTNA 4CRFA 2VWNA 1TLDA 4CRAA 3AASA 1WSSH 5ESTE 6LPRA 2A31A 4B74A 2H9TH 3MO9A 2BZAA 1C1NA 2ODPA 2G5NA 3FZZA 2FYRA 5JBAS 3Q3XA 1FLEE 1CGHA 1WU1A 1SL3A 2RG3A 1D3QB 2WPHS 2F9NA 1IQIA 2XYAA 5AF9H 3RP2A 1IQFA 1JMOH 2M5TA 4VGCC 4MTBA 2GMTB 3JZ1B 4Y8XA 4BXWA 1ZPCA 4DVAU 1MH0A 3BTQE 3D49H 5CMXH 2BVSH 5DJ7A 4JYVH 3TITA 3RXLA 1N1LA 5DP6A 1Y5UT 3BTTE 3PMHB 1ZYOA 2RA3A 3FP6E 3LOXA 1EPTA 4I33A 1GI1A 1QY6A 1F0UA 3QZRA 1GJBB 3VB3A 1OWHA 4BTIB 3LGWA 4K1EA 4UEHH 1EAUA 2P95A 2Y7XA 1MKXH 5A09A 2VH0A 1F0TA 3GY5A 1MD7A 2WPJS 2P3FH 1Y59T 3SZNA 1C5WB 3W94A 3HGPA 1OWDA 3QTVH 4MNWA 5GXPA 3VGCB 1EPTC 2Y5GA 1BIOA 1MAXA 2GX4A 1O2NA 3ATIA 5EPYA 1YPGH 1LTOA 1O2PA 2WPIS 3M5LA 3F1SB 3P95A 2B7DH 2ODYB 2B0FA 3GCOA 1RTKA 2PUQH 1O35A 1UTQA 1O30A 1G9IE 2FOMB 4SGBE 1TOMH 1H4WA 4NGAH 2G5VA 1DY9A 1L1GA 1VCPA 1O2QA 4UFEH 2ZDKA 2OINA 3D23A 1UVUH 3HGNA 3MH5A 1E38B 3QN7A 3DA9B 1KDQB 3SGAE 1GJ5H 1K22H 1C5TA 1FONA 2SFAA 1GDNA 1HJAB 4BAKB 3PMBB 1ANBA 3A8AA 1A0HB 4OS6A 3RXHA 1CT2E 1VITF 2R0LA 1P03A 2Y82A 1O2TA 1ZLRA 1UTOA 4LK4A 2VB0A 2GD4B 3OYPA 1D6WA 3ZZAA 3GDVA 2SGQE 1C5MD 4M7GA 1FJSA 1P02A 3KEEA 4K69A 3E90B 1QBVH 4O3TA 1E34B 1MTVA 4UFGH 1Z1IA 1C2GA 2JH6D 1NTPA 1JRSA 1PPCE 3ZVAA 1EZQA 3VB6A 1AFEH 1XKAC 1A5IA 3GCTF 3S9CA 3SW2B 5DP5A 1L1JA 2OUAA 1VITG 1HDTH 1TWXB 3MH4A 5EQQA 2FWWA 1OPHB 1QA0A 1EXFA 1O31A 3MU0A 1A0LA 3LPRA 2H2ZA 2VJ1A 1XKBC 1FI8A 5EW1H 1ESAA 5JB8S 2BHGA 3E8LA 2FX4A 2TPIZ 3RM0H 2ZQ1A 2ZTYA 3TNTA 1QJ7B 2ZWLH 3V3MA 5GWZA 5JBTA 3R0FA 1WQSA 5C1YA 4YM9A 3SJIA 2I6QA 2ASUB 1AN1E 2C8YB 3GCTG 7ESTE 2QAAA 4UFDH 1C2KA 4I8JA 1OX1A 3RXVA 3KQCA 4AYVB 1Y3VA 1XUHA 2BDCA 4Y0ZE 1LHGH 3F6UH 1SLWB 3BSQA 3DT0H 1XUFA 1E36B 1Z8GA 1HAHH 2R3YA 4BXSA 4JZ1A 2VGCC 1ZMJA 1GHZA 1P9SA 3ZZDA 4ABIA 1SGCA 1QHRB 3SV8A 4OS7A 4CRDA 5A2MH 1ZPZA 1C1TA 1H8IH 4ZROA 2CHAC 1ELTA 2CMYA 1K1OA 1S5SA 1JOUB 4PROA 1C4Y2 2GZ9A 3M61U 1O2VA 3ZVEA 1VCWA 1AWHB 3SU2A 4AG2A 4DW2U 1BTZA 5DK1A 1V2WT 4ZH8A 4I31A 4XFQA 1UVOA 2GCTC 4AOQA 1SC8U 2PUXB 4XE4A 2RA0A 3SUEA 3MFJA 1DUEA 1H9LB 3UFAA 1C2LA 4A1XA 3U1JB 1C5VA 2YNAA 3MH7A 2UUFB 1ZTKA 3SUFA 1GBHA 4ESTE 1S6FA 2P3TB 4ABBA 1ZTJA 3U8OH 1LVMA 4A1VA 5IYTA 1HAPH 4ABDA 3ZZ6A 2BD2A 3NUMA 2ZG0H 2AIPA 1P05A 1NFYA 3IITA 2PGQB 1DLEA 1MTWA 3QDZB 1KYNA 4MDSA 2OC0A 2Q6GA 1NC6A 1MTUA 1PPFE 2ZGBH 1EATA 2Z3DA 4ABJA 4Q7YA 2ZGXH 1DWEH 1FZZA 1TYNA 2H9EH 1YKTA 2C3SA 5DP3A 1TPOA 2WUBA 4AORA 1EP5A 4KTCA 1A0JA 1BRCE 4X8UH 2FI5E 1UK4A 1P2JA 1XUIA 2W3KA 1K1PA 3OY5U 3PMJA 1THRH 3UR6A 2FODA 3KHVA 1L2EA 1GI7B 4B2AA 1O2RA 1DXPA 1KXAA 1LKAA 2FIRH 1W8BH 4JZIA 1A3BH 2A4QA 2FESH 3T62A 2ZA5A 5F6MA 5GIBA 4B2CA 1LHEH 1MQ5A 2FLBH 2H9HA 2VVCA 3RMOH 2G55A 4FU9A 3UY9A 4X1PU 2Z7FE 2JH0D 1E0FD 1V2LT 1C4U2 4FUCA 2J92A 3A7XA 1RTFB 3LONA 2A32A 3MO6A 3EYDA 1O3PB 4BTUB 2UUYA 3TGJE 1GJ4H 4IN1A 3A88A 3M5OA 2VIVA 1ZSJA 5C67A 1RIWB 3RC5A 2ZTXA 2WINI 1NU9A 1TQ0B 4X2VA 1AUJA 2BXUH 3A81A 3KQDA 2ZCLP 1GHWH 2J4IA 1YPLH 1AO5A 2A7JA 3G01A 5GPIB 2W7SA 1J17T 1YPHC 3U8TH 4Y8YA 3RXJA 8GCHF 4QT8C 3KCGH 1LQDB 2AGEX 1GI4A 1O3GA 4DIIH 1EOJA 3I78A 1NM6A 2TBSA 5EU8A 1UVPA 2HLCA 3BTDE 1S84A 1DX5M 3A7WA 1QBOA 1K1NA 1QRWA 2A7HA 1C2DA 3A7VA 1Y3XA 3K6YA 2VVUA 2OP9A 3RXRA 1ELCA 3SQEE 1W3CA 2AGGX 2A1DB 1J8AA 1O2LA 4X0WU 2ZDNA 1N6YA 3LKWA 7KMEH 2CJIA 4E05H 2Z9IA 3ATLA 2PHBA 2R2MB 2ZZUH 3KQBA 3ZZ5A 1GBFA 3T26A 2O9QA 3EDXB 3RXUA 1UMAH 8GCHG 3MNCA 4B76A 1UCYK 2QXGA 3ZVFA 4B75A 1IHSH 1C2HA 3QLPH 3P8FA 1FY3A 4KKDA 3SHCH 1GBAA 2PV9B 2YOLA 1LCYA 3SV2H 2EI6A 1BT7A 1GJ6A 1G3DA 4MLFB 5JB9S 1EASA 1THPB 4FXGH 1B5GH 1XUGA
chains in the Genus database with same CATH superfamily
2Z6BD 1MUEB 4BAOB 1B0EA 1OKXA 2HVXA 1FUJA 1ZPBA 1KTTB 5DGJA 4P02A 1TIOA 4D7GA 1SGPE 3IG6B 1ZOMA 1O5FH 2JIZD 1XUKA 1O5EH 2V3HH 1BHXF 3ELAH 3NCLA 5EG4A 1IQJA 2ZCKP 1G2LA 1O2UA 5T1VA 3PLPA 1GCDA 3TJNA 1C9PA 4NIWA 4I8KA 2W3IA 5EXMA 2HALA 2ZPQA 3MU4A 3S7KB 1SG8B 2XCNA 3SN8A 3D65E 1FAKH 3M3VA 1J15A 4WMEA 4DURA 2EEKA 1U6QA 2Z9KA 1QJ1B 1CBWC 4VGCB 3A8BA 1QR3E 2BD3A 1MCTA 2EI8A 1GBIA 1C2JA 1NRPH 3RXBA 1MAYA 1LVBA 4K1SA 1ZGIA 1ESTA 4K60A 4ISOA 3K65B 1LDTT 2QIQA 3PV2A 1HGTH 2ILNA 1MTNC 1TBRH 2BZ6H 1Z6EA 2Y81A 3QK1A 4Z6AH 1UTKA 1BRBE 4NIXA 2RDLA 3P8GA 3IWMA 1KXDA 2AS9A 1HXEH 4FUGA 2BD7A 2A5AA 2OBOA 2G4UA 1SSXA 3UNSA 2BDBA 5FXLA 3LC3A 1C2MA 3SI3H 2HNTF 3UQOA 3UWJH 5FBIA 4KTUA 4ABHA 3E0PB 4R8TB 1P8VC 1F5LA 1V2VT 2BOHB 1YBWA 1EPTB 1GHYH 2H5CA 1F2SE 1LPKB 2BY7X 2AMPA 2ZDMA 5DP7A 2GT7A 4HI3A 2HLDD 1DICA 1TMTH 4YLQH 1LQEA 2WZQA 3MNBA 1RFNA 3LGYA 4R0IA 4DT4A 4OS1A 3MH6A 1W0ZU 3MO3A 1E35B 3I77A 3K9XB 2ZO3H 1V3XA 4ZUHA 1BTXA 4U30A 1A46H 1KSNA 1KXCA 2WUCA 3LGVA 1CSOE 3FO8D 1O3AA 1EZXC 2R2WU 1TNKA 1Z1JA 3SNEA 1CA0C 3R3GB 4AB9A 2XBYA 1WTGH 2Y6TA 4CRCA 1TPPA 2QE7D 3KGPA 2FO9A 5TCCA 2GDEH 2G4TA 4HGCA 1ELFA 2YMSC 5B6LA 2HVYB 1K1MA 2ODQA 1O2IA 2FLRH 1W14U 7LPRA 1E79D 1SQTA 2W7UA 1O33A 4IC6A 1L1NA 4AN7A 1A1RA 1GG6C 1ORFA 3SJ8A 1FMGA 4ACBA 3RXCA 2A2QH 1BRUP 1PQ5A 1V2QT 3F9GA 2P59A 2F9UA 1A2CH 3N7DA 4INHA 4LZ1H 2P3UB 4CR9A 5L2YH 2RCEA 1SGDE 1DANH 2VH6A 2QCYA 1T31A 3TLOA 1ELDE 1ZMNA 5I46H 1UCYH 3KQEA 4YZUA 3CP7A 4NFFA 2TGTA 4YT6H 4THNH 3ZVBA 1P12E 1GI5A 5G4BA 1D4PB 1K1IA 3BTME 4X2WA 1F0SA 2FOFA 4X8SH 3Q3YA 2V6NA 1GVZA 2BMGB 2JH5D 2QF5A 2ZC9H 1J14A 3GY8A 1YC0A 2VWMA 1P0SH 3L33A 4MNVA 3UIRA 1GI6A 3S9BA 1QL8A 3KYGA 2A5IA 1BOQA 1P2QA 2GJGA 4X6PA 4JYTA 2VIOA 3BTEE 5C0UA 1Z8RA 2UUKB 3BTHE 2PW8H 1K2I1 3HKJB 1ETRH 2CF8H 2F91A 5ETXA 4AYYB 1AZ8A 4NZLA 5FPTA 5FBEA 1C1QA 3CS7A 5H4IB 5JYIA 4H6SB 5DSFA 3ZZBA 1Q2WA 2BQWB 1H9IE 3N7OA 3T5FH 4X1SU 4K1TA 2WYGA 3HKIB 3UOUA 2FM2A 2G81E 4U2WA 1C9TA 1TNGA 2QV1A 3QUMP 1LO6A 3SHAH 4ZAEA 2QC2A 3TVJB 4CH2B 1DLKB 1C5LH 2GKVE 1TRMA 2XW9A 1LVOA 2NU4E 4X6OA 3SGQE 3H09A 1BJUA 3GCHC 1P3CA 4JMYA 4AB8A 1C5XB 1GMDF 1O2XA 3U28C 1ACBE 1UW7A 1Y5AT 4CBOA 1MKWK 2ANMH 3ENSB 6ESTA 2VGCB 1V2PT 3PROA 3TJVA 1AGJA 3H7OA 3VXEH 3ZYEA 3GY7A 5JBBS 1C1OA 4DOQA 4Y7AA 5ESBA 1IQMA 1QB9A 4GCHF 5FX5A 2GP9B 1VJ9U 2CHAB 4FU8A 1MTSA 2C93B 4NCYA 3SYJA 1TA2A 4GLYA 3WW7A 2CGAA 3UNRA 1BTUA 2OQ5A 4DG4A 1GMDG 1P11E 4ZXXH 2G52A 1YPMH 1O5BB 2A0QB 2NU3E 1NU7B 2QXHA 3M36A 4MPUA 2XOKD 1NT1A 1IQKA 1EUFA 2Z9GA 2GCTB 1EOLA 1PPZA 2ZDAH 2SGAA 3MU1A 3BIUH 1AZZA 3V7TA 1LVYA 1O3JA 1WAYB 2GT8A 3RDZA 4YO9A 2VU8E 3M5NA 3TIUA 1ELAA 2Q6FA 4MNXA 5EIYA 1IQHA 1MQ6A 1O2OA 2ZDVH 1ARBA 4GCHG 1OSSA 4DY7B 1NESE 1W11U 2RFKC 1C5YB 2BDAA 4JZDH 2D2DA 4Y0YE 1P9UA 2F9OA 2A5KA 5CHAC 2QF3A 3VEQB 1AB9C 3HK3B 4NZQA 4MQAA 4NSVA 2BLWA 2NWNA 5AHGH 3UOPA 1W2KH 1TRNA 1CGJE 4WXIA 4WY3A 2H5DA 2ZP0H 1QBNA 3A84A 3LH3A 4X6MA 4JZFH 4YESB 3RXFA 1CGIE 1BBRE 1MCVA 2FOEA 2FTLE 2PFEA 5F8ZA 1ANDA 1E1QD 2VWOA 3GY3A 1QURH 4X1NU 2Y80A 4ZHMU 2ULLA 5EOKA 1EAWA 1S82A 3K2UA 4CRGA 1O39A 3QO6A 2AYWA 2XTTB 1O2YA 3PYHA 1O3FA 3SU1A 1SGFG 1UTJA 3KYFA 3MTYA 1CQQA 1SI5H 5AFZH 1PYTD 4IGDA 1C5RA 1O3EA 3QZQA 3LIWA 1P09A 2XNIA 3AVZA 1DS2E 3PLKA 4XOJA 3DD2H 1KLIH 3HK6B 2FOBA 3P70B 2BY5X 2J95A 3ZZ8A 3SU3A 2FS8A 3EGKH 3ODDA 3PWBA 2GV7A 4Z1MD 5A8YA 4ASHA 1XXFA 3KF2A 5CDFE 3SJKA 3M7QA 5J4SA 1SQRA 4H6TA 4H42U 3SU4A 1TNLA 5C5NA 1F5RA 1XMNB 2PTCE 4MVNA 2FOGA 1DT2A 2XC5A 3UNQA 3U8RH 2Y5FA 5L2ZH 1GHBF 2ZU5A 3S7HB 3UR9A 1GI9B 1T4VH 1EB2A 4NWKA 5EW2H 1FIZA 1Z7KA 5K7RA 2GCHF 5K0HA 1AE5A 3W95A 3EQ0H 5IK2D 1QRZA 3A8CA 3F3BA 1C5SA 3RLWH 1E1RD 1QA7A 3FANA 5DG6A 1KLJH 4Y79A 4K5ZA 1ZHMA 4X8VH 1T8NA 4XBDA 3MNXA 4U32A 1WV7H 3L6PA 3BEIB 5DP9A 1SGEE 2QF4A 3PM3A 3EAJA 3RXMA 4GVUA 2OCVB 1GHBG 2VIQA 3SNBA 1AFQC 1TE0A 1DPOA 2ANKH 3NK8A 4E7RG 1ETTH 2F9PA 1MKWH 1O5CB 1AMHA 4JK6A 2GCHG 3NWUA 2ZNKH 4F4OC 2A2XH 2KAIB 3KQ5A 1OYTH 1PPEE 1C1WH 1C4V2 1NN6A 1PPHE 3Q77A 2UWOA 4WVPE 4KELA 1SGIB 1TX7A 2HGTH 1ESBA 4OM9A 2F9VA 2C4FH 1DOJA 2W26A 2NU1E 3AK5A 1G3BA 1SB1H 1ZR0A 1SQAA 1FY4A 1MU8B 1LHCH 1NRSH 5E0GA 5E8EH 1CA8B 2J98A 1GBEA 1ZJKA 1YPKH 2P16A 1P01A 3URCA 1C1RA 3DSPA 3UREA 1ZZZA 1P2KA 2GDDA 2BXTH 2KM0A 4ACAA 1EQ9A 2PLXA 2IJOB 2ZKSA 3RUOA 3RXQA 2A7CA 1BJVA 5F03A 6CHAC 3AAVA 2XWBI 3BEFB 1Y3WA 3E91A 1GBLA 1A5GH 4GAWA 2ZGHA 4ISIH 1GI0A 4BAMB 2LPRA 1SMFE 3VFEA 4X1QU 2IPHA 2AGIX 2GVFA 3NXPA 1O5AB 1HYLA 3GY4A 2AERH 1O3IA 2BDIA 3PB1E 2AIQA 4X2YA 2WPLS 3U98H 2BM2A 1DVAH 3F2GA 2VWLA 2FX6A 1GJAB 1GVLA 1XVMA 1ZMLA 3VG8A 3UPEA 2FXRA 4D9RA 1O2SA 4CHAC 1FX0B 1GL0E 2WPDD 2PKAA 2WPMS 1DUAA 1N6XA 4NSYA 3FFGA 2GZ7A 1HJ9A 5B6OA 2ZFRH 1NPMA 1GCTC 4Y76A 5C5OA 1O3BA 2D1JA 2FI3E 1GDUA 1RXPA 3L3TA 4UFFH 4F55A 1NFUA 2EC9H 1AKSA 2J38A 2CV3A 1CBWB 2BDGA 1P57B 5DP8A 5I25A 3EA8A 1MZAA 3U1IB 3SQHE 2OTVA 5C94A 4I8HA 1TX6A 1QGFA 3ZZ9A 1ELGA 1W0YH 2UUJB 1F5KU 4WMFA 1O3MA 1K21H 4RT0A 4YOGA 2KZ4A 4AFUA 1MTNB 1C2FA 3TK5A 2ZEBA 2UWPA 4Z0KA 1TBZH 2J34A 2ZU2A 3O8BA 1NY22 5A0BA 2WV5A 4ABAA 3QGJA 1GBKA 1SPJA 1CU1A 5TJXA 1G3CA 3LH1A 5FHTA 4BTTB 1NS3A 5A8XA 1J9CH 1THSH 2BY6X 2L6OA 3MWIU 4HG6A 4CR5A 1OOKB 3TJOA 1IAUA 1NBME 3BTGE 5E0HA 3S9AA 2CXVA 3FVFB 1BMAA 1BITA 1UTLM 1O0DH 1V2MT 1C1VH 3ZV9A 3STIA 3MYWA 1S81A 1O2JA 1TX8A 3RXIA 3A7YA 1O32A 4RKJB 1AHTH 4BAHB 3RU4E 1PQ7A 2BY9X 2QY0B 1FDPA 4AZ2B 1HAIH 1CT4E 3RXDA 4Q7XA 9LPRA 3F0OA 1SGYE 4CREA 5FCKA 3MMGA 3LGUA 3Q00A 1TGTA 1O2ZA 4Y7BA 1CA0B 4K3JA 4M9FA 2A4RA 3ATMA 1QJ6B 2KFWA 2NU2E 3P8NA 4BNRA 1QNJA 2YMSB 3GYLB 5GDSH 1NFWA 3RXTA 4SGAE 4LZ4B 1GBMA 3A86A 1PYTC 2ZHDA 4JK5A 1Y3UA 1GI8B 3VXFH 1Y8TA 1OXGA 4ABGA 5AFYH 1Q3XA 4Y10E 1GG6B 4A5TS 3TGKE 1D6RA 1OHHD 1D9IA 1TNIA 2FTMA 1O3LA 1YPJH 1GBDA 3URDA 2P8OC 1NFXA 4FUJA 3TPIZ 2BTCE 3ITIA 2XXLA 1GJ7B 1SHHB 1QQ4A 1OWJA 1P2IA 1MMJN 4HTCH 5KGOA 1ETSH 1FPHH 1UK2A 1IQEA 3E16B 1CO7E 3F9EA 2V35A 5HYOA 2ZF0H 2VVVA 1AIXH 1A4WH 4FVBA 2KCYA 1HAZB 4NIYA 1P10A 2AMDA 1Z8JB 2XBXA 1F7ZA 4A6LA 5T6GA 1GJ9B 1M9UA 1MD8A 2M2AA 2WHXA 1WCZA 4TY6A 1P2OA 8ESTE 1TB6H 5E2PA 3PO1C 1O2KA 1DSTA 2SGFE 1K9OE 1NROH 2BDYA 1GGDC 3NPSA 1HNEE 2K1QA 2OC7A 3BEUA 1C1UH 1B0FA 1XX9A 6GCHF 5LPRA 3SORA 1L4DA 1EKBB 3RXSA 1LHFH 3BV9B 1ZJDA 4ZMAH 1BTPA 1TMBH 1AU8A 3OEHD 2AMQA 4XSKU 3SU6A 1FXYA 4J1YA 2HNTE 1V6DA 4OGXA 4YLUA 1PFXC 2BD4A 2BYAX 1H1BA 1W12U 3ZV8A 3LGIA 3Q3KA 2L74A 1DSUA 4BANB 3BTWE 3KIDU 3RC6A 1UK3A 2ESTE 5E0JA 2C8WB 2B9LA 3O8RA 3GCHB 3TK9A 1QL9A 2JKHA 2BD9A 3VB5A 3DHKH 2UWLA 1TRYA 2BVXH 2HPQH 4AGKA 6GCHG 3MI4A 1GI3A 5EGMA 1VKYA 1OP8A 3BG4C 1ANEA 1Y3YA 4OS2A 1UTMA 5T3HA 1D3DB 1O2GH 3M5MA 1VITH 1QZ8A 5LH8A 2FS9A 2G00A 1T8OA 2QXIA 1UTPA 1VGCC 2Z3EA 1HPGA 4MPXA 4O03A 1BTHH 3B8JA 1S6HA 1GHAF 1AI8H 1G2MA 2BQ6B 3BIVH 1KXEA 1KMHB 1RRKA 2ALVA 1BDAA 3A87A 3FKSD 1HAXB 1TOCB 4A7IB 3E6PH 4CH8B 1QQUA 1YM0A 3TH2H 3PTNA 3CENA 1XM1A 3ZVDA 1O3HA 2Z3CA 1O38A 2OXSA 1K1JA 3EA7A 4DCDA 2OQUA 3MHWU 1V2RT 4TWWA 4I32A 4X1RU 2O8UA 1V2ST 4HFPB 1HAVA 1SLUB 1YCPM 4MG3A 4WMDA 1A5HA 2Z9LA 3GICB 3SJOA 4JCNA 4YTAA 1GHAG 2PKSC 3HPTB 1D3PB 2DE9A 1Z8IB 2WV9A 3ZIAD 1A61H 1NRRH 5CHAB 1AB9B 1FPCH 2BVRH 1H8DH 4NG9H 1GJDB 2ZTZA 1TGNA 1QIXB 2FPZA 2XNDD 1C2IA 8KME2 4TYDA 4FOUC 9ESTA 3M3SA 4ISHH 2ZPRA 1HAGE 4BAQB 1SLXB 4JZEH 5LPFA 4FUHA 2PGBB 3LC5A 4D76A 1J16A 3T25A 4RT1A 1FIWA 1EX3A 3GYMA 3A7TA 1OWIA 5HM2A 1TAWA 2ANYA 1GBBA 2ZHWH 5EJLA 1SHYA 1V2TT 3UAIC 2Y7ZA 2WV4A 5JBCS 2O8TA 1ZSLA 1HAOH 5GNDA 1H9HE 5FAHA 7GCHF 1O36A 3FAOA 3FP8E 1TPAE 1AWFH 1DE7H 1QB1A 2V0BA 3ZYDA 4FU7A 1V2JT 1QCPA 3AW0A 3SJ9A 3OE7D 4K8BA 2XC4A 3LJOA 1YLDA 3KL6A 3LT3A 3VB7A 2FMJA 5T6FA 3OSYA 3SBKA 3ZZ3A 4KGAA 2KCAA 1HCGA 1KXBA 1SOZA 5HMAA 1TABE 3DFJA 1Z6JH 3ZVGA 3QTOH 3RXKA 3RMLH 2IOTA 1YPEH 4X2XA 5E2OA 1FN8A 4I8GA 7GCHG 1V2NT 5C1UA 1C1MA 4DT7B 3UQVA 2R0KA 4LXBH 1WQVH 4B6EA 2XWAA 1C5ZB 1XUJA 3H7TA 1BUIA 1YLCA 2EI7A 5DPAA 3V0XA 1RGQA 3GISB 1JBUH 1LPGB 1GMHF 1KLTA 1HLTH 1NBMD 4KTSA 1FY8E 3MNSA 4YT7H 2HWLB 1DFPA 1HV7A 5F8TA 1P06A 2XBVA 1AFQB 3KN2A 2ZU3A 3U9AH 1SBWA 1OP0A 2EQNA 2EA3A 1UO6A 1ZRBA 1ZTLA 4BOHA 1T32A 1RJXB 3B23B 3A85A 4A1TA 1UTNA 2EY4C 3EE0B 2BLOA 4NA9H 2D8WA 3Q76A 4FETA 2SGEE 1BQYA 3RU4D 3V12A 1DWBH 2SNVA 4UDWH 1O2WA 2F83A 5EXNA 3SV6A 1JWTA 1HIAA 1DDJA 4GHQA 3B9FH 2IPQX 1GHVH 1GMHG 1DY8A 1ZGVA 1P3EA 3P92A 1BMLA 4ZHAA 1NZQH 3ZZ4A 3RXAA 1YGCH 3KNXA 1YLNA 3TGIE 1UJ1A 4UE7H 2GZ8A 3A82A 2ZHEH 2ZHQH 1ELVA 1S0QA 1FN6A 4A92A 3OTPA 6CHAB 1HFDA 3P17H 4UD9H 1TALA 4TT3D 2WSSD 5CHBA 2PSXA 2STBE 1ABJH 1SGTA 1S83A 3QGNB 2C90B 1O2HA 2ZPSA 2J98B 4AFQA 3GY6A 2OD3B 4FUBA 1UHBA 2VIDA 4XBCA 4WH6A 2JETC 1HAYB 3O8CA 3DCLA 5JPMH 4GPGA 5C20A 4Q4LA 1KY9A 2K8IA 4CHAB 1GJCB 1YCPH 3AAUA 1N8OC 1GCTB 3BF6H 3GY2A 4DJZB 1O34A 1HUTH 3ZZCA 1SGNE 2FYQA 5FPSA 2CF9H 4NA8A 3F9FA 4ZKOU 3SO3A 2PWXA 1CVWH 1WBGB 4B71A 5EQRA 3M37A 4B2BA 5C2ZA 1ELBA 1KIGH 3F9HA 4Q80A 4Y8ZA 2K0QA 2DUCA 1GMCF 5EQSA 5EPNA 1C5NH 2PKAB 1PPGE 4D7FA 1MABB 4ZKRU 5CE1A 5HIYA 2ZIQH 2ZECA 1B7XB 4WWYA 5DN6D 3FZDA 3LDXH 1BA8B 4MPWA 1GBCA 1AKSB 1WYKA 1S6LA 2W6ID 1EAXA 2YNBA 1FV9A 1TGBA 2VIPA 4U01A 1FQ3A 2J94A 2BOKA 4Q2KA 4IBLH 1GPZA 3ODFA 1GL1A 3OTJE 4AX9H 5ABWA 1AY6H 3LU9B 3SGBE 1P2MA 4INLA 3BTKE 1GMCG 4Y71A 3E1XB 1UCYE 3F68H 2ZFTA 1CHGA 5TCAA 2A45B 5T6DA 4X6NA 4OS4A 3BTFE 1O3KA 1BHXB 2B5TB 2GMTC 1O5DH 4ZKSU 5GCHF 2TGDA 2ZCHP 1TGSZ 2A4OA 3E3TA 2QXJA 4IN2A 2QYIA 2ZU4A 3OY6U 2BQ7B 1P2NA 3N99A 1JRTA 3A83A 3SU0A 1GDQA 1QTFA 1DM4B 2I6SA 2NU0E 1XVOA 1LHDH 1C5QA 4IMZA 3BG8A 4IS5A 5EODA 1IQNA 4H4FA 1BRAA 1BTWA 1C5PA 1GBJA 1PQ8A 4TSFD 1T7CA 2Y5HA 1H8ED 2FEQH 1YP9A 5FPYA 1CT0E 1L0ZA 3C27B 2ALPA 4AG1A 2VIWA 4O97A 1BMFD 4Y11E 5GCHG 3SUGA 3RXOA 1OS8A 2H6MA 2ZGJA 3EE7A 2P8OB 4GUXA 3VGCC 4RSPA 1F0RA 1SGQE 1G30B 2ZFFH 2R3UA 4MNYA 4OS5A 1TNHA 1V2OT 1MZDA 3FP7E 1AVWA 1C2EA 1DXWA 3DUXH 1SFQB 4ABEA 1LKBA 2HPPH 4ZHLU 1KDQA 3TH3H 2RDEA 4ZKNU 1LMWB 2QN5T 4NA7A 2VBCA 4E06H 3SV7A 1AE8H 5HGGA 1SQOA 3SUDA 2O8MA 3S69A 1MBMA 2W6JD 1S85A 3PO1B 2ZFPH 2C8ZB 1ID5H 4Y6DA 1G37A 1KTSB 4WXVA 5BRRE 3LGTA 3O8DA 2J9NA 2F9BH 1GGDB 4LOYH 3PTBA 3ZVCA 3RM2H 1FY5A 2GTBA 4WJG2 1A7SA 4F49A 1ABIH 2JDID 8LPRA 1OYQA 1GVKB 5C3NA 1O3OA 1BMNH 1ELEE 1AUTC 1HJAC 2VNTA 2XC0A 4RN6A 4XDEA 2BB4A 1O37A 2HRVA 4TY7A 3T28A 3TU7H 1W13U 1AD8H 1V2UT 1AVGH 4FUDA 2TRMA 1O3CA 1G36A 3TJUA 4XBBA 3VPKA 3UTUH 3SNDA 4FUIA 1SOTA 3UWIA 1ARCA 4CRBA 1E37B 1W7XH 5A0AE 5DKMA 1PPBH 1TBQH 1PQAA 5FCRA 4DIHH 1SGRE 1FAXA 3BG4B 2ZU1A 2ZGCA 1AQ7A 1VCQA 1W0JD 3WY8A 1F92A 2ZHFH 2LELA 4TPIZ 1W10U 1VGCB 1MBQA 1SLVB 4B1TA 1Z71A 3UB0A 1CHOF 2ZI2H 2XRCA 3ESTA 3QWCH 1PJPA 2Z94A 3CS0A 4K8YA 1LPZB 4AGJA 2R9PA 2GV6A 5LPEA 4D9QA 4FVDA 1GBTA 1EJNA 1BBRK 1JIMA 3A7ZA 3P6ZB 1QRXA 3K6ZA 1EZUC 2P94A 2TGAA 4ISNA 4NWLA 1YY3A 1RD3B 2W5EA 1ZHRA 2KAIA 2AH4X 1HB0B 3UUZA 2BD5A 2CN0H 2BD8A 1O2MA 4GSOA 1CHOG 2D26C 2PKSB 2FOAA 5C1XA 3A8DA 2FOHA 2BX4A 1DWDH 1T8LA 3EA9A 3M3TA 1RS0A 1IHTH 4Q7ZA 4K2YA 1GWAA 2OK5A 5AVDA 1MU6B 1TMUH 3T29A 1T4UH 3DFLA 4JYUH 3ZZ7A 2XBWA 3GOVB 4I8LA 2V3OH 4GHTA 1S0RA 4F48B 1TGCA 4INKA 3SI4H 1EP6A 1HAVB 1SKYE 4E7NA 2Z9JA 1V2KT 4IMQA 4TPYA 2H1UA 4Q63A 3M7TA 2AFQB 3F0PA 3PWCA 4NFEA 2KR7A 1O3DA 2J97A 1OP2A 4D8NA 1TFXA 1RTLA 3OFND 3STJA 2G51A 3W1EA 3S0NA 1Y5BT 2HNTC 4B73A 3VB4A 4YOJA 5L30H 1YPHE 1BCUH 2IN2A 4ZXYH 5GJ4B 3AW1A 2BLQA 1HBTH 3TK6A 3ATKA 1QFKH 1OWKA 4KP0A 3OU0A 5IDKA 4CBNA 3MQKC 2TGPZ 1BTYA 1EAIA 2QGRA 1D3TB 3TNSA 2F43B 1IOEA 1OWEA 3GDUA 3A80A 4O9VA 2BDHA 5L6NH 3LJJA 3P8OA 5HIZA 3DSGA 4DGJA 4OGYA 1HJ8A 2P93A 1G3EA 1HXFH 5F8XA 1COWD 1IQLA 1GI2A 1NO9H 2OLGA 2STAE 1GJ8B 3QX5H 1WDIA 4IC5A 4X8TH 3I29A 2FZZA 1SR5C 3SV9A 1FNIA 3M7UA 2SGPE 3RXEA 1EJAA 3WWBA 2WPKS 1C1SA 1K1LA 5JDUB 3RMMH 1XXDA 3SNAA 4I86A 3NZIA 1AVXA 2OC1A 1EB1H 3ATWA 1ANCA 1VJAU 4J2YB 2OBQA 4AFZA 5DP4A 3BN9A 2BX3A 5DO4H 1A3EH 2ZFSA 3SU5A 3GS9A 2SGDE 2ZFQH 1SFIA 1ZSKA 3PMAB 1L4ZA 1T8MA 2ZQ2A 1MKXK 2ANWA 1G32B 3RXPA 5A0CA 1GHXH 5PTPA 3U69H 3GDSA 1ZHPA 4UONA 1QL7A 2LNCA 1INCA 2VINA 2A4GA 1O5GH 3RU4T 1QB6A 2O8LA 2SNWA 1ZRKA 3SNCA 2Q1JA 3TH4H 5A8ZA 1BB0B 3RMNH 4IW4E 1RIWC 2QF0A 3RLYH 5HXFA 2B8OH 1CE5A 3MOCA 3V13A 1WOFA 1C1PA 1NRNH 3CNRA 1BBRH 3PLBA 3M35A 1SVPA 1HRTH 3A89A 2C8XB 5FL7D 1TONA 2G8TA 1W7GH 4I7YH 4O3UA 1WUNH 3C1KA 2F3CE 1UVSH 1YYY1 2QA9E 4FUEA 1DWCH 2THFB 1HIAB 3H5CB 4YOIA 3E0NB 3WWFA 1TA6A 1YCPK 2PSYA 3D62A 2JETB 1TNJA 2AEIH 1VR1H 2FI4E 2ZDLA 3MU5A 1TPSA 3OEED 4WH8A 3HATH 4NIVA 1TQ7B 1C5OH 1DITH 3GCNA 2TIOA 4FUFA 1N8OB 1Q31A 4WF8A 1YF4A 2J2UA 2XCFA 3RXGA 1EZSC 2HOBA 4HZHA 3MU8A 3T2NA 2FDAA 1BMMH 2BY8X 1UHBB 3NKKA 1UVTH 2BLVA 5FX6A 4AFSA 5C17A 1BZXE 1KXFA 5SGAE 4MPVA 3RC4A 1VZQH 2OC8A 2FP7B 3PV4A 2Q6DA 4TWYA 1FY1A 1X7AC 5BPEA 4RKOB 1WTHD 3SOSA 1IQGA 3JZ2B 1SGFA 1O3NA 3T27A 4ISLA 1NRQH 5LGOA 2FOCA 5EXLA 2WYJA 1K28D 3OX7U 1P04A 1JIRA 1JXPA 2DE8A 5J4QA 4ABFA 5HM9A 1C5UA 2O8WA 1EJMA 2GGVB 2PR3A 2PTNA 4CRFA 2VWNA 1TLDA 2V3MA 4CRAA 3AASA 1WSSH 5ESTE 6LPRA 2A31A 3N7EA 4B74A 2H9TH 3MO9A 2BZAA 1C1NA 2ODPA 2G5NA 3FZZA 2FYRA 5EJZA 5JBAS 3Q3XA 1FLEE 1CGHA 1WU1A 1SL3A 2RG3A 1D3QB 2WPHS 2F9NA 1IQIA 2XYAA 5AF9H 3RP2A 1IQFA 1JMOH 2M5TA 4VGCC 4MTBA 2GMTB 3JZ1B 4Y8XA 4BXWA 1ZPCA 4DVAU 1MH0A 3BTQE 3D49H 5CMXH 2BVSH 5DJ7A 4JYVH 3TITA 3RXLA 1N1LA 2J5UA 5DP6A 1Y5UT 3BTTE 3PMHB 1ZYOA 2RA3A 3FP6E 3LOXA 1EPTA 4I33A 1K0HA 3NRLA 1GI1A 1QY6A 1F0UA 3QZRA 1GJBB 3VB3A 1OWHA 4BTIB 3LGWA 4K1EA 4UEHH 1EAUA 2P95A 2Y7XA 1MKXH 5A09A 2VH0A 1F0TA 3GY5A 1MD7A 2WPJS 2P3FH 1Y59T 3SZNA 1C5WB 3W94A 3HGPA 1OWDA 3QTVH 4MNWA 5GXPA 3VGCB 1EPTC 2Y5GA 1BIOA 1MAXA 2GX4A 1O2NA 3ATIA 5EPYA 1YPGH 1LTOA 1O2PA 2WPIS 3M5LA 3F1SB 3P95A 2B7DH 4ZCNA 2ODYB 5KECA 2B0FA 3GCOA 1RTKA 2PUQH 1O35A 1UTQA 1O30A 1G9IE 2AHME 2FOMB 4SGBE 1TOMH 1H4WA 4NGAH 2G5VA 1DY9A 4YXWD 1L1GA 1VCPA 1O2QA 4UFEH 2ZDKA 2OINA 3D23A 1UVUH 3HGNA 3MH5A 1E38B 3QN7A 3DA9B 1KDQB 3SGAE 1GJ5H 1K22H 1C5TA 1FONA 2SFAA 1GDNA 1HJAB 4BAKB 3PMBB 1ANBA 3A8AA 1A0HB 4OS6A 3RXHA 1CT2E 1VITF 2R0LA 1P03A 2Y82A 1O2TA 1ZLRA 1UTOA 4LK4A 2VB0A 2GD4B 3OYPA 1D6WA 3ZZAA 3GDVA 2SGQE 1C5MD 4M7GA 1FJSA 1P02A 3KEEA 4K69A 3E90B 1QBVH 4O3TA 1E34B 1MTVA 4UFGH 1Z1IA 1C2GA 2JH6D 1NTPA 1JRSA 1PPCE 3ZVAA 1EZQA 3VB6A 5KEDA 1AFEH 5C0TA 1XKAC 1A5IA 2KCPA 3GCTF 3S9CA 3SW2B 5DP5A 1L1JA 2OUAA 1VITG 1HDTH 1TWXB 3MH4A 4RI0A 5EQQA 2FWWA 3PRDA 1OPHB 3F2HA 1QA0A 1EXFA 1O31A 3MU0A 1A0LA 1EFRD 2H2ZA 3LPRA 2VJ1A 3FOAA 1XKBC 1FI8A 4AC9A 5EW1H 1ESAA 5JB8S 2BHGA 3E8LA 2FX4A 2TPIZ 3RM0H 2ZQ1A 2ZTYA 3TNTA 1QJ7B 2ZWLH 3V3MA 5GWZA 5JBTA 3R0FA 1WQSA 5C1YA 4YM9A 3SJIA 2I6QA 2ASUB 1AN1E 2C8YB 2F4LA 3GCTG 7ESTE 2QAAA 4UFDH 1C2KA 4I8JA 1OX1A 3RXVA 3KQCA 4AYVB 1Y3VA 1XUHA 2BDCA 1W0KD 1LHGH 3F6UH 4Y0ZE 1SLWB 3BSQA 3DT0H 1XUFA 1E36B 1Z8GA 1HAHH 2R3YA 4BXSA 4JZ1A 2VGCC 1ZMJA 1GHZA 1P9SA 3OAAD 3ZZDA 4ABIA 1SGCA 1QHRB 1H8HD 4OS7A 3SV8A 4CRDA 5A2MH 1ZPZA 1C1TA 1H8IH 4ZROA 2CHAC 1ELTA 2CMYA 1K1OA 1S5SA 1JOUB 4PROA 1C4Y2 2GZ9A 3M61U 1O2VA 3ZVEA 1VCWA 1AWHB 3SU2A 4AG2A 4DW2U 1BTZA 5DK1A 1V2WT 4ZH8A 4I31A 4XFQA 1UVOA 3PV5A 2GCTC 4AOQA 1SC8U 2PUXB 4XE4A 2RA0A 4P00A 3SUEA 3MFJA 1DUEA 2V7QD 1H9LB 3UFAA 1C2LA 4A1XA 3U1JB 1C5VA 2YNAA 3MH7A 2UUFB 1ZTKA 3SUFA 1GBHA 4ESTE 1S6FA 2P3TB 4ABBA 1ZTJA 3U8OH 1WXRA 1LVMA 4A1VA 5IYTA 1HAPH 4ABDA 3ZZ6A 2BD2A 3NUMA 2ZG0H 2AIPA 1P05A 1NFYA 3IITA 2PGQB 1DLEA 1MTWA 3QDZB 1KYNA 4MDSA 2OC0A 2Q6GA 4XRNA 1NC6A 1MTUA 1PPFE 2ZGBH 1EATA 5EJ1A 2Z3DA 4ABJA 4Q7YA 2ZGXH 4XD7D 1DWEH 1FZZA 1TYNA 5F53A 2H9EH 1YKTA 2C3SA 3PRBA 5DP3A 1TPOA 2WUBA 4AORA 1EP5A 4KTCA 2JJ1D 1A0JA 1BRCE 4X8UH 2FI5E 1UK4A 1P2JA 1XUIA 2W3KA 1K1PA 3OY5U 2YMSD 3PMJA 1THRH 3UR6A 2FODA 3KHVA 1L2EA 2KX4A 3DSOA 1GI7B 4B2AA 1O2RA 1DXPA 1KXAA 1LKAA 2CK3D 2FIRH 2LP6A 1W8BH 4JZIA 1A3BH 2A4QA 2FESH 3T62A 2ZA5A 5F6MA 5GIBA 4B2CA 1LHEH 1MQ5A 2FLBH 4ASUD 2H9HA 2VVCA 3RMOH 2G55A 4FU9A 3UY9A 4X1PU 2Z7FE 2JH0D 1E0FD 1V2LT 1C4U2 4FUCA 2J92A 3A7XA 1RTFB 3F2FA 3LONA 2A32A 3MO6A 3EYDA 1O3PB 4BTUB 2UUYA 2KCOA 3TGJE 1GJ4H 4IN1A 3A88A 3M5OA 2VIVA 1ZSJA 5C67A 1RIWB 3RC5A 2ZTXA 5HKKD 2WINI 1NU9A 1TQ0B 4X2VA 1AUJA 2BXUH 3A81A 3KQDA 2ZCLP 1GHWH 2J4IA 1YPLH 1AO5A 2A7JA 3G01A 5GPIB 2W7SA 1J17T 1YPHC 3U8TH 4Y8YA 3RXJA 8GCHF 4QT8C 3KCGH 3SZEA 1LQDB 2AGEX 1GI4A 1O3GA 4DIIH 1EOJA 3I78A 1NM6A 2TBSA 5EU8A 1UVPA 2HLCA 3BTDE 1S84A 1DX5M 3A7WA 1QBOA 1K1NA 1YWUA 1QRWA 2A7HA 1C2DA 2IJD1 3A7VA 1Y3XA 2PP6A 3K6YA 2VVUA 2OP9A 3RXRA 1ELCA 3SQEE 1W3CA 2AGGX 2A1DB 1J8AA 1O2LA 4X0WU 2ZDNA 1N6YA 3LKWA 7KMEH 2CJIA 4E05H 2Z9IA 3ATLA 3FN8A 2PHBA 2R2MB 2ZZUH 3KQBA 3ZZ5A 1GBFA 3T26A 2O9QA 3EDXB 3RXUA 4B6FA 1UMAH 8GCHG 3MNCA 4B76A 1UCYK 2QXGA 3ZVFA 4B75A 1IHSH 1C2HA 3QLPH 3P8FA 1FY3A 4KKDA 3SHCH 1GBAA 2JJ2D 2PV9B 2YOLA 1LCYA 3SV2H 2EI6A 1BT7A 1GJ6A 1G3DA 4MLFB 5JB9S 1EASA 1THPB 4FXGH 1B5GH 1XUGA
chains in the Genus database with same CATH topology
2Z6BD 1MUEB 4BAOB 1B0EA 1OKXA 2HVXA 1FUJA 1ZPBA 1KTTB 5DGJA 1TIOA 4D7GA 1SGPE 3IG6B 1ZOMA 1O5FH 1XUKA 1O5EH 2V3HH 1BHXF 3ELAH 3NCLA 5EG4A 1IQJA 2ZCKP 1G2LA 1O2UA 3PLPA 1GCDA 3TJNA 1C9PA 4NIWA 4I8KA 2W3IA 5EXMA 2HALA 2ZPQA 3MU4A 3S7KB 1SG8B 2XCNA 3SN8A 3D65E 1FAKH 3M3VA 1J15A 4WMEA 4DURA 2EEKA 1U6QA 2Z9KA 1QJ1B 1CBWC 4VGCB 3A8BA 1QR3E 2BD3A 1MCTA 2EI8A 1GBIA 1C2JA 1NRPH 3RXBA 1MAYA 1LVBA 4K1SA 1ZGIA 1ESTA 4K60A 4ISOA 3K65B 1LDTT 2QIQA 1HGTH 2ILNA 1MTNC 1TBRH 2BZ6H 1Z6EA 2Y81A 3QK1A 4Z6AH 1UTKA 1BRBE 4NIXA 2RDLA 3P8GA 3IWMA 1KXDA 2AS9A 1HXEH 4FUGA 2BD7A 2A5AA 2OBOA 2G4UA 1SSXA 3UNSA 2BDBA 5FXLA 3LC3A 1C2MA 3SI3H 2HNTF 3UQOA 3UWJH 5FBIA 4KTUA 4ABHA 3E0PB 4R8TB 1P8VC 1F5LA 1V2VT 2BOHB 1YBWA 1EPTB 1GHYH 2H5CA 1F2SE 1LPKB 2BY7X 2AMPA 2ZDMA 5DP7A 2GT7A 4HI3A 1DICA 1TMTH 4YLQH 1LQEA 3MNBA 1RFNA 3LGYA 4R0IA 4OS1A 3MH6A 1W0ZU 3MO3A 1E35B 3I77A 3K9XB 2ZO3H 1V3XA 4ZUHA 1BTXA 4U30A 1A46H 1KSNA 1KXCA 2WUCA 3LGVA 1CSOE 1O3AA 1EZXC 2R2WU 1TNKA 1Z1JA 3SNEA 1CA0C 3R3GB 4AB9A 2XBYA 1WTGH 2Y6TA 4CRCA 1TPPA 3KGPA 2FO9A 5TCCA 2GDEH 2G4TA 4HGCA 1ELFA 1K1MA 2ODQA 1O2IA 2FLRH 1W14U 7LPRA 1SQTA 2W7UA 1O33A 4IC6A 1L1NA 4AN7A 1A1RA 1GG6C 1ORFA 3SJ8A 1FMGA 3RXCA 2A2QH 1BRUP 1PQ5A 1V2QT 3F9GA 2P59A 2F9UA 1A2CH 4INHA 4LZ1H 2P3UB 4CR9A 5L2YH 2RCEA 1SGDE 1DANH 2VH6A 2QCYA 1T31A 3TLOA 1ELDE 1ZMNA 5I46H 1UCYH 3KQEA 4YZUA 3CP7A 4NFFA 2TGTA 4YT6H 4THNH 3ZVBA 1P12E 1GI5A 5G4BA 1D4PB 1K1IA 3BTME 4X2WA 1F0SA 2FOFA 4X8SH 3Q3YA 2V6NA 1GVZA 2BMGB 2JH5D 3GY8A 2ZC9H 1J14A 3L33A 1YC0A 2VWMA 1P0SH 4MNVA 3UIRA 3S9BA 1GI6A 1QL8A 2A5IA 1BOQA 1P2QA 4X6PA 4JYTA 2VIOA 3BTEE 1Z8RA 2UUKB 3BTHE 2PW8H 1K2I1 3HKJB 1ETRH 2CF8H 2F91A 5ETXA 4AYYB 1AZ8A 4NZLA 5FPTA 5FBEA 1C1QA 3CS7A 5H4IB 5JYIA 4H6SB 3ZZBA 1Q2WA 2BQWB 1H9IE 3N7OA 3T5FH 4X1SU 4K1TA 2WYGA 3HKIB 3UOUA 2FM2A 2G81E 4U2WA 1C9TA 1TNGA 2QV1A 3QUMP 1LO6A 3SHAH 4ZAEA 2QC2A 3TVJB 4CH2B 1DLKB 1C5LH 1TRMA 2GKVE 2XW9A 1LVOA 2NU4E 4X6OA 3SGQE 1BJUA 3GCHC 1P3CA 4JMYA 4AB8A 1C5XB 1GMDF 1O2XA 1ACBE 1Y5AT 4CBOA 1MKWK 2ANMH 3ENSB 6ESTA 2VGCB 1V2PT 3PROA 3TJVA 1AGJA 3H7OA 3VXEH 3ZYEA 3GY7A 5JBBS 1C1OA 4DOQA 4Y7AA 5ESBA 1IQMA 1QB9A 4GCHF 5FX5A 2GP9B 1VJ9U 2CHAB 4FU8A 1MTSA 2C93B 4NCYA 1TA2A 4GLYA 2CGAA 3UNRA 1BTUA 2OQ5A 4DG4A 1GMDG 1P11E 4ZXXH 2G52A 1YPMH 1O5BB 2A0QB 2NU3E 1NU7B 2QXHA 3M36A 4MPUA 1NT1A 1IQKA 1EUFA 2Z9GA 2GCTB 1EOLA 1PPZA 2ZDAH 2SGAA 3MU1A 3BIUH 1AZZA 3V7TA 1LVYA 1O3JA 1WAYB 2GT8A 3RDZA 4YO9A 2VU8E 3M5NA 3TIUA 1ELAA 2Q6FA 4MNXA 1IQHA 1MQ6A 1O2OA 2ZDVH 1ARBA 4GCHG 1OSSA 4DY7B 1NESE 1W11U 1C5YB 2BDAA 4JZDH 2D2DA 4Y0YE 1P9UA 2F9OA 2A5KA 5CHAC 2QF3A 3VEQB 1AB9C 3HK3B 4NZQA 4MQAA 4NSVA 2BLWA 2NWNA 5AHGH 3UOPA 1W2KH 1TRNA 1CGJE 4WXIA 4WY3A 2H5DA 2ZP0H 1QBNA 3A84A 3LH3A 4X6MA 4JZFH 4YESB 3RXFA 1CGIE 2PFEA 1BBRE 1MCVA 2FOEA 2FTLE 5F8ZA 1ANDA 3GY3A 2VWOA 4X1NU 1QURH 2Y80A 4ZHMU 2ULLA 5EOKA 1EAWA 1S82A 3K2UA 4CRGA 1O39A 3QO6A 2AYWA 2XTTB 1O2YA 3PYHA 1O3FA 3SU1A 1SGFG 1UTJA 3MTYA 1CQQA 1SI5H 5AFZH 1PYTD 4IGDA 1C5RA 1O3EA 3QZQA 3LIWA 1P09A 2XNIA 3AVZA 1DS2E 3PLKA 4XOJA 3DD2H 1KLIH 3HK6B 2FOBA 3P70B 2BY5X 2J95A 3ZZ8A 3SU3A 2FS8A 3EGKH 3ODDA 3PWBA 2GV7A 5A8YA 4ASHA 1XXFA 3KF2A 3SJKA 3M7QA 5J4SA 4H6TA 4H42U 3SU4A 1TNLA 5C5NA 1F5RA 1XMNB 2PTCE 4MVNA 2FOGA 1DT2A 2XC5A 3UNQA 3U8RH 2Y5FA 5L2ZH 1GHBF 2ZU5A 3S7HB 3UR9A 1GI9B 1T4VH 1EB2A 4NWKA 5EW2H 1FIZA 1Z7KA 5K7RA 2GCHF 5K0HA 1AE5A 3W95A 3EQ0H 1QRZA 3A8CA 1C5SA 3RLWH 1QA7A 3FANA 5DG6A 1KLJH 4Y79A 4K5ZA 1ZHMA 4X8VH 1T8NA 4XBDA 3MNXA 4U32A 1WV7H 3L6PA 3BEIB 5DP9A 1SGEE 3PM3A 3EAJA 3RXMA 4GVUA 2OCVB 1GHBG 2VIQA 3SNBA 1AFQC 1TE0A 1DPOA 2ANKH 3NK8A 4E7RG 1ETTH 2F9PA 1MKWH 1O5CB 1AMHA 4JK6A 2GCHG 3NWUA 2ZNKH 4F4OC 2A2XH 2KAIB 1OYTH 1PPEE 1C1WH 1C4V2 1NN6A 1PPHE 3Q77A 2UWOA 4WVPE 4KELA 1SGIB 1TX7A 2HGTH 1ESBA 2F9VA 2C4FH 1DOJA 2W26A 2NU1E 1G3BA 1SB1H 1ZR0A 1SQAA 1FY4A 1MU8B 1LHCH 1NRSH 5E0GA 5E8EH 1CA8B 1GBEA 1ZJKA 1YPKH 2P16A 1P01A 3URCA 1C1RA 3UREA 1ZZZA 1P2KA 2GDDA 2BXTH 1EQ9A 2PLXA 2IJOB 2ZKSA 3RUOA 3RXQA 2A7CA 1BJVA 5F03A 6CHAC 3AAVA 2XWBI 3BEFB 1Y3WA 3E91A 1GBLA 1A5GH 4GAWA 2ZGHA 4ISIH 1GI0A 4BAMB 2LPRA 1SMFE 3VFEA 4X1QU 2IPHA 2AGIX 2GVFA 3NXPA 1O5AB 1HYLA 3GY4A 2AERH 1O3IA 2BDIA 3PB1E 2AIQA 4X2YA 2WPLS 3U98H 2BM2A 1DVAH 2VWLA 2FX6A 1GJAB 1GVLA 1XVMA 1ZMLA 3UPEA 2FXRA 4D9RA 1O2SA 4CHAC 1GL0E 2PKAA 2WPMS 1DUAA 1N6XA 4NSYA 3FFGA 2GZ7A 1HJ9A 5B6OA 2ZFRH 1NPMA 1GCTC 4Y76A 5C5OA 1O3BA 2D1JA 2FI3E 1GDUA 1RXPA 3L3TA 4UFFH 1NFUA 2EC9H 1AKSA 2J38A 2CV3A 1CBWB 2BDGA 1P57B 5DP8A 5I25A 3EA8A 1MZAA 3U1IB 3SQHE 2OTVA 4I8HA 1TX6A 1QGFA 3ZZ9A 1ELGA 1W0YH 2UUJB 1F5KU 4WMFA 1O3MA 1K21H 4YOGA 4AFUA 1MTNB 1C2FA 3TK5A 2ZEBA 2UWPA 4Z0KA 1TBZH 2J34A 2ZU2A 3O8BA 1NY22 5A0BA 2WV5A 4ABAA 3QGJA 1GBKA 1SPJA 1CU1A 5TJXA 1G3CA 3LH1A 5FHTA 4BTTB 1NS3A 5A8XA 1J9CH 1THSH 2BY6X 4CR5A 3MWIU 1OOKB 3TJOA 1IAUA 3BTGE 5E0HA 3S9AA 2CXVA 3FVFB 1BMAA 1BITA 1UTLM 1O0DH 1V2MT 1C1VH 3ZV9A 3STIA 3MYWA 1S81A 1O2JA 1TX8A 3RXIA 3A7YA 1O32A 4RKJB 1AHTH 4BAHB 3RU4E 1PQ7A 2BY9X 2QY0B 1FDPA 4AZ2B 1HAIH 1CT4E 3RXDA 4Q7XA 9LPRA 1SGYE 4CREA 5FCKA 3MMGA 3LGUA 3Q00A 1TGTA 1O2ZA 4Y7BA 1CA0B 4K3JA 2A4RA 3ATMA 1QJ6B 2NU2E 3P8NA 4BNRA 1QNJA 3GYLB 5GDSH 1NFWA 3RXTA 4SGAE 4LZ4B 1GBMA 3A86A 1PYTC 2ZHDA 4JK5A 1Y3UA 1GI8B 3VXFH 1Y8TA 1OXGA 4ABGA 5AFYH 1Q3XA 4Y10E 1GG6B 4A5TS 3TGKE 1D6RA 1D9IA 1TNIA 2FTMA 1O3LA 1YPJH 1GBDA 3URDA 2P8OC 1NFXA 4FUJA 3TPIZ 2BTCE 3ITIA 2XXLA 1GJ7B 1SHHB 1QQ4A 1OWJA 1P2IA 1MMJN 4HTCH 1ETSH 1FPHH 1UK2A 1IQEA 3E16B 1CO7E 3F9EA 2V35A 5HYOA 2ZF0H 2VVVA 1AIXH 1A4WH 4FVBA 1HAZB 4NIYA 1P10A 2AMDA 1Z8JB 2XBXA 1F7ZA 4A6LA 5T6GA 1GJ9B 1M9UA 1MD8A 1WCZA 4TY6A 1P2OA 8ESTE 1TB6H 5E2PA 3PO1C 1O2KA 1DSTA 2SGFE 1K9OE 1NROH 2BDYA 1GGDC 3NPSA 1HNEE 2K1QA 2OC7A 3BEUA 1C1UH 1B0FA 1XX9A 6GCHF 5LPRA 3SORA 1L4DA 1EKBB 3RXSA 1LHFH 3BV9B 1ZJDA 4ZMAH 1BTPA 1TMBH 1AU8A 3SU6A 2AMQA 4XSKU 1FXYA 4J1YA 2HNTE 1V6DA 4OGXA 4YLUA 1PFXC 2BD4A 2BYAX 1H1BA 1W12U 3ZV8A 3LGIA 3Q3KA 1DSUA 4BANB 3BTWE 3KIDU 3RC6A 1UK3A 2ESTE 5E0JA 2C8WB 2B9LA 3O8RA 3GCHB 3TK9A 1QL9A 2JKHA 2BD9A 3VB5A 3DHKH 2UWLA 1TRYA 2BVXH 2HPQH 4AGKA 6GCHG 3MI4A 1GI3A 5EGMA 1OP8A 3BG4C 1ANEA 1Y3YA 4OS2A 1UTMA 5T3HA 1D3DB 1O2GH 3M5MA 1VITH 5LH8A 2FS9A 2G00A 1T8OA 2QXIA 1UTPA 1VGCC 2Z3EA 1HPGA 4MPXA 4O03A 1BTHH 3B8JA 1S6HA 1GHAF 1AI8H 1G2MA 2BQ6B 3BIVH 1KXEA 1RRKA 2ALVA 1BDAA 3A87A 1HAXB 1TOCB 4A7IB 3E6PH 4CH8B 1QQUA 1YM0A 3TH2H 3PTNA 3CENA 1XM1A 3ZVDA 1O3HA 2Z3CA 1O38A 2OXSA 1K1JA 3EA7A 4DCDA 2OQUA 3MHWU 1V2RT 4TWWA 4I32A 4X1RU 2O8UA 1V2ST 4HFPB 1HAVA 1SLUB 1YCPM 4MG3A 4WMDA 1A5HA 2Z9LA 3GICB 3SJOA 4JCNA 4YTAA 1GHAG 2PKSC 3HPTB 1D3PB 2DE9A 1Z8IB 1A61H 1NRRH 5CHAB 1AB9B 1FPCH 2BVRH 1H8DH 4NG9H 1GJDB 2ZTZA 1TGNA 1QIXB 2FPZA 1C2IA 8KME2 4TYDA 9ESTA 3M3SA 4ISHH 2ZPRA 1HAGE 4BAQB 1SLXB 4JZEH 5LPFA 4FUHA 2PGBB 3LC5A 4D76A 1J16A 3T25A 1FIWA 1EX3A 3GYMA 3A7TA 1OWIA 5HM2A 1TAWA 2ANYA 1GBBA 2ZHWH 1SHYA 1V2TT 2Y7ZA 2WV4A 5JBCS 2O8TA 1ZSLA 1HAOH 1H9HE 5FAHA 7GCHF 1O36A 3FAOA 3FP8E 1TPAE 1AWFH 1DE7H 1QB1A 2V0BA 3ZYDA 4FU7A 1V2JT 1QCPA 3AW0A 3SJ9A 4K8BA 2XC4A 3LJOA 1YLDA 3KL6A 3LT3A 3VB7A 2FMJA 5T6FA 3OSYA 3SBKA 3ZZ3A 4KGAA 1HCGA 1KXBA 1SOZA 5HMAA 1TABE 3DFJA 1Z6JH 3ZVGA 3QTOH 3RXKA 3RMLH 2IOTA 1YPEH 4X2XA 5E2OA 1FN8A 4I8GA 7GCHG 1V2NT 5C1UA 1C1MA 4DT7B 3UQVA 2R0KA 4LXBH 1WQVH 2XWAA 1C5ZB 1XUJA 3H7TA 1BUIA 1YLCA 2EI7A 5DPAA 3V0XA 1RGQA 3GISB 1JBUH 1LPGB 1GMHF 1KLTA 1HLTH 4KTSA 4YT7H 1FY8E 3MNSA 2HWLB 1DFPA 1HV7A 5F8TA 1P06A 2XBVA 1AFQB 3KN2A 2ZU3A 3U9AH 1SBWA 1OP0A 2EA3A 1UO6A 1ZRBA 1ZTLA 4BOHA 1T32A 1RJXB 3B23B 3A85A 4A1TA 1UTNA 3EE0B 2BLOA 4NA9H 2D8WA 3Q76A 2SGEE 1BQYA 3RU4D 3V12A 1DWBH 2SNVA 4UDWH 1O2WA 2F83A 5EXNA 3SV6A 1JWTA 1HIAA 1DDJA 4GHQA 3B9FH 1GHVH 1GMHG 1DY8A 1ZGVA 1P3EA 3P92A 1BMLA 4ZHAA 1NZQH 3ZZ4A 3RXAA 1YGCH 3KNXA 3TGIE 1UJ1A 4UE7H 2GZ8A 3A82A 2ZHEH 2ZHQH 1ELVA 1S0QA 1FN6A 4A92A 6CHAB 1HFDA 3P17H 4UD9H 1TALA 2PSXA 2STBE 1ABJH 1SGTA 1S83A 3QGNB