3S69A

Crystal structure of saxthrombin
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
234
structure length
234
Chain Sequence
VIGGDECNINEHRSLVAFFNSTGFFCSGTLINEEWVLTAAHCDNTNFQMKLGVHSKKVLNEDEQTRNPKEKFICPNKKNDEVLDKDIMLIKLDSRVSNSEHIVPLSLPSSPPSVGSVCHIMGWGSITPIKVTYPDVPYCAYINLLDDAVCQAGYPELLTEYRTLCAGILEGGKDTCGGDSGGPLICNGQFQGIVSFGAHPCGQGLKPGVYTKVFDYNHWIQSIIAGNTTVTCPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of saxthrombin, a thrombin-like enzyme from Gloydius saxatilis.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Thrombin-like enzyme defibrase
total genus 56
structure length 234
sequence length 234
ec nomenclature ec 3.4.21.-:
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3s69A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3s69A02
4MQAA 2BY7X 1OYTH 3TGJE 1W13U 5C67A 2HVXA 5L2YH 2GCHG 1BMMH 1BT7A 7ESTE 1VGCC 1QTFA 3RC5A 5JPMH 3GCTF 2C4FH 2WPLS 2G5VA 4OS1A 2ZHFH 1O5AB 1RIWB 1NC6A 4LOYH 2UUJB 4KP0A 2OTVA 3M61U 1DY9A 4O9VA 4GUXA 1Y5BT 3RMMH 2ZHWH 4AFQA 1JXPA 2ANKH 3O8BA 2W7UA 2FS8A 3S9AA 3UQVA 1FPCH 8KME2 3BG8A 1BZXE 2CMYA 1C4U2 3GDUA 4ABAA 5DJ7A 1FMGA 3IG6B 3GCHB 2B8OH 4JK5A 4DG4A 4DT7B 9LPRA 2P16A 1IHTH 1Y3VA 1O2NA 2BDIA 2A4QA 2ZTXA 3UY9A 1O39A 3MH7A 2J2UA 1T8MA 1TGTA 4FUEA 1ZJDA 1O2KA 1TAWA 2XCNA 4OGYA 2NU4E 1O2LA 1NO9H 1NFUA 1XUGA 1O3CA 3TPIZ 1ZHPA 1QGFA 3P8FA 1QJ6B 3MH4A 3ZVFA 3MH5A 3ZZDA 1C9TA 1PFXC 2H9EH 1NRPH 4X8VH 3T25A 2FOBA 1Q3XA 5A2MH 5GWZA 2BY8X 2VIDA 1P2JA 2QV1A 3L33A 1S5SA 1TBZH 1H9IE 1GCTC 1BRCE 1F5LA 2Q6FA 2VIVA 1K1MA 5FX5A 4K5ZA 1C5VA 2WPMS 1CGJE 1Y3XA 1KLIH 1O2ZA 1GHBF 4Y8XA 1UCYH 1GJAB 2ULLA 3LC5A 3Q76A 2QN5T 4BTUB 2AGEX 4WH8A 3SO3A 4UE7H 4ZHMU 1O36A 2J38A 4IC6A 4CH2B 5T3HA 2ZFFH 4YTAA 1C1OA 1GI3A 1C5UA 4ZKOU 1K1OA 2WPIS 1VITF 2FOGA 5A8ZA 1OPHB 3D62A 3SHCH 3LU9B 1BBRH 2QXGA 1UK2A 4DW2U 3SV7A 2O8TA 3T62A 1AUJA 2O8LA 4X2VA 1D6RA 2CV3A 3RXQA 1DDJA 4TPIZ 3KF2A 1B0EA 2G52A 1HAIH 1T7CA 2ZFRH 2PUXB 1W0ZU 1YP9A 4AG1A 2BY6X 2QXHA 1JOUB 1V6DA 3QDZB 2OC0A 1FONA 2B9LA 3M5LA 1KTTB 2Y6TA 4JZ1A 1H8IH 1LO6A 4CRFA 5G4BA 3IWMA 1KYNA 1MQ5A 4H6TA 1C1WH 2VIOA 4NA9H 4TWYA 3PMAB 2AERH 4NFFA 2BDHA 1LPZB 1D3TB 1BB0B 1N1LA 1MU6B 2O8UA 4I8KA 3SUDA 3BN9A 3R3GB 1QBVH 3CS7A 3VB5A 1SLUB 5FPYA 1VCPA 5A0CA 4GCHG 1IOEA 1O2WA 4I31A 1EAIA 1ZTLA 2KAIA 5EG4A 4HTCH 1WTHD 3PMJA 1MZAA 2OQUA 4MPXA 3RXLA 1P03A 1WOFA 1MTNC 2Y5FA 2P8OC 3ATKA 1GMDF 5GDSH 3U8OH 4LK4A 1ANCA 4U2WA 1MTNB 3RXRA 2BZ6H 2FOCA 1GMHF 1G3BA 1FLEE 5AFYH 5DP3A 3OY6U 3W94A 2A5KA 4CRAA 2FYQA 1MKWH 2ZKSA 5T6FA 3S0NA 1NFXA 4UFGH 1ELTA 2TIOA 3KL6A 1QL9A 1E36B 1WTGH 4VGCC 3MU0A 1S85A 3AW1A 1WV7H 1OWDA 3P92A 1PJPA 1T31A 4I8GA 1W12U 2QIQA 2C8ZB 4KGAA 3BEFB 2FS9A 3AW0A 3LGTA 3RXAA 1GMCG 1DXWA 5C1UA 2ZU4A 2YNAA 1GCTB 2P94A 2AS9A 1BMAA 1TBQH 1ZGVA 3F9HA 1DLEA 1F92A 1HAVB 2GGVB 2VNTA 1W10U 1F7ZA 2WPHS 1L1GA 1OS8A 3BG4B 3BTDE 1GJBB 2VB0A 1EPTB 2P95A 1ZRBA 5FAHA 1ETTH 2AIPA 5EU8A 3TH2H 3URDA 3ZVEA 2BQ6B 3E1XB 3GYMA 3UWJH 1V2KT 4INHA 4IW4E 1C5RA 1HBTH 3BTQE 1JRSA 4X1PU 3TK6A 4H42U 1O3GA 3RUOA 3F68H 1SLWB 4XE4A 4DOQA 3SU2A 2PWXA 4A6LA 1UCYE 1OYQA 2ZDVH 1FAXA 4K1EA 4YLUA 4Y6DA 1NT1A 1TMBH 1SB1H 4K2YA 3BSQA 2F9PA 1O2JA 4BXWA 1SHYA 6CHAB 2Y7XA 1TBRH 4OS7A 3KQBA 4MNYA 1KDQB 4BANB 4ZMAH 1AGJA 2QY0B 2B7DH 1THPB 1XUKA 5FXLA 3ZZCA 1H9HE 1TPPA 3RM0H 4HGCA 2ZECA 1FIZA 1WYKA 1FDPA 1GHVH 4ZAEA 2GKVE 1F0SA 3TLOA 4CREA 4A1XA 1O30A 5I46H 1C5QA 4Y76A 3TJNA 2ODYB 3M37A 3CENA 2SNVA 2A7HA 2Y5HA 2AGGX 1GI8B 3HKJB 1SGPE 3KIDU 2BD3A 3ZZ9A 2ZU1A 1TYNA 4TY6A 5TCAA 2F91A 1EJNA 2PV9B 2BHGA 4RKJB 4INLA 2DUCA 3SV9A 1SI5H 3PYHA 4BAOB 4ABFA 4NIXA 3BEIB 1TA6A 3AASA 3EE0B 5EXNA 5EQSA 5CMXH 1AD8H 5LPEA 1TQ7B 3NKKA 3UPEA 2QYIA 1TX7A 4WWYA 4I8JA 1O2XA 2ANWA 4KTSA 1DM4B 1TGBA 2W26A 4CH8B 1ELVA 3URCA 1NROH 2ZDNA 1P04A 2ZHDA 2ZTYA 1OWKA 1EPTC 1FAKH 1SSXA 3SV8A 4GAWA 1EPTA 5B6OA 4JZFH 2FYRA 5EGMA 2NU2E 3MH6A 4Y0ZE 3TNSA 1MCVA 1OP8A 4I33A 1HNEE 1A46H 3MO6A 2BD2A 2NU3E 3A83A 1AQ7A 3RXKA 1V2UT 3A7XA 1EAUA 2ZHQH 3MOCA 4QT8C 1BRUP 1QCPA 1GBLA 1Z6EA 3M3TA 1ZTKA 1MKXH 1UVOA 1OWHA 2UWLA 4X6NA 5E2OA 4F49A 1TNJA 3DD2H 4IN1A 3LGYA 3KQDA 4AGKA 2TGPZ 1AMHA 4X1QU 3T28A 1GI4A 1ESAA 1EOJA 4DJZB 1GBEA 1AVXA 1SGIB 2Y7ZA 3RXVA 3SV6A 2BOHB 1ZOMA 3NXPA 3PV4A 3UR6A 4RN6A 1UTLM 3BTKE 1Y3YA 1O3BA 7LPRA 3PLPA 1H1BA 3RXBA 1EQ9A 3ITIA 4ISIH 1YLDA 2FXRA 3S9CA 1Z8RA 2VINA 2Z94A 2ZFTA 2Z9JA 1GI2A 3M7TA 4X8UH 5CHAB 3MTYA 2JETB 1ZSJA 1A5GH 1AIXH 1DITH 1QBNA 2Z6BD 4TY7A 3GY2A 1O2VA 1O3NA 2FLRH 1GWAA 2A2XH 2HGTH 3KN2A 4ISNA 1GG6C 2VVCA 1EZSC 3TK9A 3E0NB 2WV5A 2F3CE 1O2PA 2FOAA 1BOQA 1C2IA 2R9PA 2QGRA 2WPJS 2LNCA 3A87A 4K1SA 5EQRA 3ELAH 1CO7E 1P0SH 1XXDA 1NRRH 4IBLH 4AFUA 3UNRA 2AH4X 1SGYE 1LKBA 1EKBB 1UTPA 2XBYA 1GJDB 2NWNA 1UTOA 2TGAA 4AFZA 2ZZUH 1T4VH 2OINA 1TPOA 2XYAA 2ZCKP 4FU9A 3F6UH 4WY3A 1HAPH 3CP7A 1SPJA 4NA7A 1GHXH 1TALA 4MNWA 3V7TA 1A0LA 4WMDA 1OOKB 3GYLB 5DP6A 4XOJA 1C1UH 1T8OA 4O3UA 2BB4A 2K1QA 3TK5A 3SJOA 2WPKS 4FUHA 4IGDA 2A4RA 4Y10E 1KXCA 1BHXF 1P3EA 1CSOE 5FHTA 1QR3E 2A32A 3QTOH 2VIQA 3ZV8A 3GCOA 3EAJA 3ATIA 1H4WA 1O5CB 1P2OA 2FESH 1GHYH 2ZG0H 2Z3DA 3M7QA 1K22H 4IC5A 4WMFA 1GI7B 5JBAS 3PTNA 3BF6H 2ZPQA 2WYJA 1Y59T 2PR3A 3TGKE 1HAYB 2XW9A 2FO9A 3QX5H 1ORFA 2Z9IA 1O34A 1UVTH 2CHAB 4I7YH 1HRTH 5L6NH 1BRAA 1SLVB 1ZSLA 5FPTA 1HAZB 3A7TA 2FI4E 1RXPA 4ZUHA 5JB9S 5JYIA 3O8CA 4Y11E 2Y81A 2ZDAH 3RLYH 5IDKA 2QF3A 2VWLA 3SBKA 3LONA 1E37B 2C90B 3SUFA 1QBOA 4AGJA 1FY5A 2QF0A 5PTPA 4FUFA 4KKDA 4VGCB 1TX6A 1CA0B 4HI3A 1PQ8A 1SHHB 4D7GA 3B9FH 1HAHH 4Y8YA 2W5EA 4INKA 1O0DH 2GZ8A 4JZDH 1F0TA 1OSSA 3PTBA 1GJ4H 2ZEBA 1O38A 2BXTH 4X2WA 1AE5A 1YYY1 1HCGA 2A45B 2WYGA 3SUGA 2PKAB 3T5FH 1GMCF 2KAIB 4A92A 2OBOA 4MG3A 4FVBA 3A7YA 1C4Y2 5JB8S 1GHBG 1TMUH 4JYVH 2A0QB 4KTCA 4A7IB 1TRMA 2NU1E 2F9NA 1C2DA 3O8RA 1V2OT 4R0IA 1INCA 3WY8A 5DP4A 1DUAA 1FXYA 1Z1JA 5GJ4B 1D3DB 4ZKRU 3RXJA 2BDAA 1GL1A 2HPPH 5EW2H 2Y5GA 4BXSA 5EXLA 4OS4A 1G37A 2XC4A 4WF8A 4X6OA 5ESBA 1BBRK 1DXPA 4K60A 4X0WU 1EB2A 1DVAH 1O37A 2EI6A 3QK1A 3RXCA 1FV9A 3FP8E 1O3PB 1Y3WA 2PGBB 3K65B 1LHCH 3MFJA 1DLKB 4GSOA 3OSYA 3RMNH 2Z9KA 2GVFA 5AHGH 2VH0A 2R3UA 4SGAE 2ZQ1A 4CBNA 1V2NT 4Q7ZA 3UIRA 5EW1H 2JH5D 3ATMA 5ABWA 1BTZA 2UUFB 1X7AC 5FX6A 1O2QA 3LDXH 2J94A 1S6FA 1G3EA 4YT6H 1C5PA 3OX7U 1EJMA 2F9OA 4ABGA 4ZH8A 1THRH 2STBE 1IHSH 1C1SA 2UUYA 2PHBA 5FBEA 3GY4A 6ESTA 1GGDB 1BUIA 1AN1E 3E0PB 3LH1A 1QRWA 1EJAA 3M5MA 4FUJA 1C5WB 1MAXA 2HRVA 1PPHE 4CHAB 1HXEH 1RFNA 1O3IA 1ZPZA 1O3LA 2M5TA 3BEUA 4JZEH 1K1NA 4XDEA 3LGWA 1NRQH 2ZHEH 2QXJA 1GBCA 1G30B 2GT7A 3F9EA 1O3AA 1MZDA 1XUJA 2R3YA 4GPGA 3ZVCA 3QGJA 3T27A 4WVPE 3A81A 1CBWB 2ZNKH 3KGPA 2XWBI 1AI8H 4XBDA 1UTKA 1E35B 1QJ7B 3MU1A 2OLGA 4KTUA 4B75A 1JIMA 1ZR0A 1W7XH 3QN7A 1CVWH 3E90B 3RXFA 1MAYA 3AAVA 2JETC 5HYOA 1UTNA 8ESTE 3QGNB 3PWCA 2ZA5A 1F5KU 5AVDA 1CHOF 1DICA 1KY9A 2XWAA 1GJCB 2GP9B 2ZPRA 1TPSA 3GCNA 4BAHB 1VITG 3QZQA 1TFXA 1C2GA 1EUFA 4B2CA 3BTEE 2FI3E 2WUBA 1LHDH 1AY6H 1BHXB 2H9HA 1CU1A 1SGRE 2FZZA 1W3CA 4E06H 4YLQH 5A09A 5EODA 2PW8H 5E8EH 4DVAU 3MNSA 1XUHA 1KIGH 1P12E 1DOJA 3SNDA 1RTLA 1J15A 4IMQA 1Z8JB 3NPSA 1VR1H 1EB1H 1YBWA 5FPSA 3A86A 1Z8GA 4X6MA 1S82A 5GXPA 4NG9H 1TMTH 1ZPCA 2AEIH 2FX6A 1XKBC 2D2DA 1MBQA 5C3NA 3TJUA 2SGFE 1C5LH 5DP9A 4YZUA 1LPGB 2XXLA 2EEKA 2Q6GA 1DS2E 1YCPK 3TGIE 4X8SH 5A8YA 4LXBH 1HXFH 4Y0YE 1UJ1A 7GCHG 1ARBA 1SGQE 2OC8A 1C5OH 1O3HA 1FNIA 3K6ZA 6GCHG 4Y8ZA 4Q7XA 3BTME 4GCHF 1HAGE 2ZDLA 2IPHA 1PQ5A 3LGUA 3SZNA 3JZ1B 1WU1A 4JYTA 5ESTE 4D7FA 1VZQH 3MHWU 3ATLA 1OWIA 3ODFA 5FCKA 5J4SA 1A61H 1D3PB 1K2I1 2AGIX 4TPYA 1UVSH 1GBHA 2C8XB 2P8OB 1ZRKA 1LVBA 2P93A 2Z7FE 4WXIA 3HPTB 2A7CA 3K9XB 1K1IA 1AB9B 2BM2A 2P3UB 1ELBA 2BDCA 2HPQH 5C1XA 4DGJA 3DA9B 3RXSA 1Z1IA 4M7GA 3VB6A 1C2LA 2BTCE 4UFEH 2PLXA 4YOIA 1UK3A 1ABIH 3FZZA 3PMHB 1Y5UT 1XUIA 1AZ8A 1W8BH 3BTGE 3SGBE 2RG3A 1D3QB 3NCLA 1JMOH 2P3TB 2R2WU 4OGXA 3RXTA 1YGCH 1ELDE 4FUGA 3SU0A 1SQAA 5L2ZH 1KXFA 2WINI 1ZMLA 1LCYA 2JH6D 2V3OH 1GMHG 4A5TS 1A5HA 3R0FA 1C1QA 3S69A 3SW2B 1SC8U 2G51A 3SNBA 6CHAC 5AFZH 6GCHF 5CE1A 4H6SB 3H7TA 2GDDA 1BBRE 1AVGH 1DWCH 2A5IA 4Q7YA 1QNJA 3UQOA 2A4GA 1V2JT 4FU7A 3LKWA 3SU5A 3DT0H 3A84A 4K3JA 4MPWA 3S7HB 2EI7A 2ZCHP 2WUCA 3P8NA 3P17H 3D49H 2FM2A 1PPBH 3GY6A 3GY3A 1HFDA 1RGQA 1IQJA 2GZ9A 1GHWH 2HWLB 1DPOA 3RU4E 1QIXB 1AUTC 1O2RA 5HM9A 1TLDA 4R8TB 3V0XA 1EX3A 3I78A 2V35A 1PPFE 1VITH 2LPRA 3A7WA 3P95A 4FUDA 1O31A 3VXEH 2OCVB 2XBWA 4AB9A 2SNWA 1P02A 1MUEB 1O5FH 1GI0A 1OP2A 1SGNE 3A8BA 1SQTA 4D8NA 2ZO3H 2IN2A 2STAE 3MWIU 3MMGA 2HALA 1J14A 1ZTJA 1MH0A 5JBBS 2FTLE 1HAXB 1QA0A 3SJIA 1BTPA 5E0GA 3RXDA 1M9UA 1SOTA 5HGGA 2I6QA 1GVLA 1C2JA 5DK1A 1ARCA 4A1TA 3HK3B 4BAMB 3PB1E 2D1JA 1D4PB 1V2LT 2ANYA 3NWUA 2ZDKA 1HUTH 4LZ1H 1FUJA 2GV7A 7KMEH 1GJ9B 2A4OA 4JMYA 6LPRA 1ANEA 3IITA 2R2MB 1GL0E 1GBDA 1FZZA 4MNXA 4D76A 2DE8A 1NTPA 3VXFH 4UONA 3NK8A 1KLJH 4AFSA 1Y3UA 4E7RG 2VU8E 1AWFH 1K1PA 1WQSA 2ZU3A 3AVZA 3BTWE 3TH3H 1ANDA 3RXMA 4JK6A 1AFQC 1RS0A 2ODPA 2RCEA 1JIRA 3FVFB 1GBMA 1O2UA 1Q31A 2ALPA 2H5DA 1B7XB 3UR9A 4THNH 4ISHH 1TWXB 2H5CA 2A31A 2A5AA 3SU3A 2GMTB 1W11U 1ZLRA 2BXUH 5H4IB 2CN0H 5E2PA 1O2YA 2BVXH 2V6NA 2RDLA 1ZZZA 3RMLH 1P8VC 5LPFA 1DSUA 2HNTF 3C1KA 3RP2A 3SI3H 2ALVA 2BYAX 5C2ZA 4NFEA 3N7OA 4ABHA 3SNEA 2G4TA 4MDSA 1GBBA 2EI8A 1MD8A 1EATA 3ZZ4A 4UFFH 2B0FA 3U69H 4K1TA 1E0FD 1TGCA 1O3OA 2AFQB 1YPGH 1S81A 2OUAA 1FN8A 2UWOA 3Q77A 1AO5A 1LVMA 2BD4A 3VGCB 4Z0KA 4FUCA 4K8BA 1TA2A 2H6MA 5EQQA 1PPEE 2TGTA 3MO3A 4O97A 1QRZA 3SGQE 1A5IA 1YPMH 2CF8H 3EQ0H 1YCPM 1TNGA 3MYWA 2GTBA 4BNRA 1GBFA 1SQOA 1QL8A 1C5SA 1G3DA 2C3SA 4MNVA 4SGBE 1PPGE 4HZHA 4YOGA 3EA8A 3RXGA 1DY8A 1T8LA 2J4IA 2XBXA 1TPAE 4OS5A 1SFIA 1LVOA 3F9GA 1LPKB 2WV4A 1O3FA 1NS3A 4Y7AA 1F0RA 3RU4D 1GBIA 1NESE 5DP5A 1EASA 1O5EH 2GDEH 2FMJA 1NPMA 3U1IB 1JRTA 3SOSA 3P8GA 1O33A 1CA8B 2FWWA 1WQVH 1S83A 3FP6E 4B74A 1A0HB 3SU4A 1C5YB 4BOHA 4UEHH 1TNKA 2BZAA 3RC6A 1AKSB 3AAUA 1S84A 1YCPH 1F2SE 2BD5A 3SHAH 3FFGA 4AYVB 4XFQA 2VIPA 2ZU5A 1XVMA 5JBCS 5DKMA 1O3MA 2ZDMA 2Y82A 2GV6A 3MNXA 1HDTH 2O8MA 2GT8A 1UO6A 3VEQB 3Q3XA 1C5MD 1V2WT 1K1JA 2PKSB 8GCHG 1G9IE 1TGNA 1YPHC 1EP5A 2OBQA 2ZU2A 3BG4C 2QCYA 1AFQB 3ZVGA 1HPGA 4I32A 2FOMB 1GI6A 2GMTC 4RKOB 4MPUA 3SORA 1ANBA 1KSNA 4ZXXH 1GDUA 2PGQB 1YM0A 1LMWB 3DUXH 4ZXYH 1C2KA 3HGNA 3QLPH 1AFEH 2OXSA 3M3SA 3U8TH 2BDGA 1MD7A 1S6HA 1RRKA 3KEEA 1UVUH 2FTMA 3F9FA 2HNTE 1CE5A 3U9AH 3A82A 2FLBH 2QC2A 1O3KA 5BPEA 1GI5A 2XCFA 4TWWA 1ZPBA 4X8TH 5F8XA 1IQMA 1AZZA 1WCZA 2PTNA 3VGCC 3ZZ8A 1P57B 4ABIA 1EAXA 1TB6H 1O32A 3H7OA 2TRMA 1NFWA 2SGPE 1QA7A 1CBWC 1DWDH 1EP6A 4NZLA 5JBTA 1HJ8A 4X6PA 1G3CA 3UFAA 1PQAA 2ZCLP 2V0BA 2OQ5A 3VPKA 1TOCB 3RXHA 1XM1A 2EC9H 2BY5X 4NSYA 1N6YA 2V3HH 1SGFG 2H9TH 3LOXA 5F6MA 2BLVA 1SGCA 5K0HA 1O3DA 2IOTA 1E34B 1CHOG 4I8LA 1PQ7A 1LTOA 2VH6A 2ESTE 3Q3KA 5DG6A 4Y7BA 1GJ5H 1A3EH 4AORA 1HGTH 1QQ4A 2PTCE 3T26A 2ZGHA 4UD9H 1O5BB 3EA9A 3M5NA 3SGAE 2FEQH 3GY8A 2HNTC 3RLWH 3HGPA 1MKWK 2R0KA 3KQEA 3SV2H 2QA9E 1CHGA 1JBUH 2XC5A 2THFB 3CS0A 5E0JA 5T6GA 5DPAA 1B0FA 5EPNA 3UREA 2ILNA 1P2QA 3ODDA 3S7KB 3FAOA 1TNLA 3SN8A 3PM3A 3S9BA 1F5RA 1W14U 1ZMNA 5DP7A 1LHFH 2G00A 1BMNH 3ZZAA 1VCQA 2AMDA 1QB6A 1NY22 1A4WH 1GI1A 1FY3A 1LQEA 1D6WA 1AKSA 1YPJH 3P70B 3A8AA 3FANA 1RD3B 1MU8B 2GCHF 3A89A 2ZPSA 3QZRA 2YOLA 1P2IA 3DFLA 3GCTG 1GBAA 2J95A 2QXIA 1KXAA 1SL3A 1VJ9U 4U30A 3RDZA 4GHTA 1A3BH 3TU7H 3HKIB 1HAOH 1RTKA 2ZF0H 2G55A 3SJKA 2HLCA 1P2MA 3UWIA 3PO1C 3QUMP 2C8YB 1GVZA 3SNCA 5CHAC 3KQCA 1DE7H 1MTSA 4AB8A 5C20A 1TE0A 4YM9A 3K6YA 3RC4A 1THSH 1EAWA 2BQ7B 3RXPA 1SR5C 1TX8A 2JH0D 2SGEE 1HIAA 4CRGA 1P01A 2BX4A 1O2MA 2C8WB 5HM2A 1DX5M 1VCWA 3UOPA 3E6PH 1CGHA 5GCHF 1E38B 4D9QA 3GY7A 1JWTA 3KHVA 4DIIH 1IQKA 3M35A 2W3IA 1FPHH 4YOJA 4ZHLU 5E0HA 1XKAC 2P3FH 3QO6A 1ZHRA 1G32B 1QY6A 2VVVA 1BTXA 1ZGIA 1ELCA 3PLBA 3U8RH 2PUQH 1MBMA 9ESTA 3GCHC 5IYTA 1SFQB 4U32A 3HATH 1C5XB 2ZGXH 1EOLA 4JCNA 3MO9A 2BLQA 1ESBA 1O5DH 2ANMH 2PFEA 4F4OC 3ESTA 4LZ4B 3SJ8A 3B8JA 1QHRB 1V2VT 1RIWC 3BIVH 4O3TA 2ASUB 3M5OA 4HFPB 2Q1JA 3DHKH 1XUFA 1UTQA 3GICB 3EGKH 1BIOA 2BDBA 1T32A 2ZWLH 1L4DA 4E05H 1VGCB 1NN6A 1TGSZ 4NWLA 1SGDE 3M3VA 2CXVA 3GDSA 5DP8A 1KXBA 2R0LA 4Q2KA 3JZ2B 5A0BA 1HV7A 2ZFPH 1AU8A 4XBCA 2BDYA 2VWOA 4GLYA 1ELEE 4ASHA 1A2CH 3LGVA 3MNBA 2D26C 4RSPA 1TIOA 1CT0E 2A7JA 2F9BH 1UHBB 4NCYA 3PO1B 1TOMH 3TIUA 1GHAG 3LPRA 3OU0A 4CHAC 1MQ6A 5HXFA 1V3XA 1ZSKA 1O2OA 4ABJA 1A1RA 3ZZBA 3OY5U 2VWMA 1P10A 1TRYA 1GGDC 3L3TA 4DY7B 1C5NH 1UHBA 2H1UA 1G2MA 1QFKH 1SGFA 3LGIA 2SGAA 1Q2WA 1ESTA 2ZI2H 3SU1A 8LPRA 5C1YA 2ODQA 4BTIB 4NIVA 1P05A 1BJUA 1QB1A 1O2IA 4FXGH 4DURA 2FI5E 3MU8A 2Z9LA 4A1VA 3LIWA 2SGDE 2A1DB 3C27B 4B73A 1K28D 4Y71A 3SU6A 1C1MA 4YT7H 2Z3EA 1H9LB 5SGAE 2GCTB 3Q3YA 1ID5H 1P2NA 1NU7B 1ELAA 1ZMJA 8GCHF 3BTTE 4X1NU 3VB4A 2ZTZA 3A88A 3HK6B 4CR5A 1J16A 2G4UA 4B2BA 3U98H 1IQIA 2XTTB 2F83A 1MTWA 2DE9A 1UTMA 4X2YA 4E7NA 1SLXB 2OC7A 1DWEH 1UVPA 1VJAU 5TJXA 1O35A 4B71A 2F9VA 1IQLA 1HLTH 1SOZA 4OS2A 3ZVBA 1C1PA 1V2MT 1ZYOA 1GHAF 3STJA 3K2UA 1YPEH 2AMQA 1FI8A 1O2SA 3I29A 1A0JA 1GI9B 1GMDG 3QWCH 1UK4A 4CRDA 1AHTH 3Q00A 5HMAA 1SGEE 3F1SB 4FVDA 3ZZ3A 1MTVA 4NIWA 1J9CH 1RTFB 4K8YA 3PLKA 1BTWA 1C1VH 1L0ZA 4ISLA 3ZZ7A 2BD8A 1QRXA 5FBIA 4JZIA 1HIAB 3TJOA 1BTUA 3E8LA 4J1YA 1CT4E 1SMFE 2EA3A 1F0UA 5EXMA 2ZGCA 3UOUA 2B5TB 1WBGB 2UWPA 2SGQE 1Z71A 2BLOA 2BD9A 3UTUH 4NA8A 3ZYDA 5BRRE 1PYTC 3P8OA 1C4V2 1TABE 1TONA 4AG2A 3W95A 1C5TA 1T8NA 3RU4T 3ATWA 1H8DH 4J2YB 4B2AA 3KNXA 1DANH 1GJ6A 3BTHE 4GVUA 1MKXK 4Y79A 5EPYA 4NWKA 3MNCA 1GPZA 3GDVA 1ZHMA 3M7UA 1QURH 1CQQA 2RA3A 4ZHAA 1O2TA 2TBSA 1AWHB 5GIBA 1FQ3A 5DGJA 1XXFA 1QB9A 1YLCA 1G2LA 4AYYB 1TQ0B 1BMLA 1C9PA 3TNTA 1WAYB 2TGDA 3RM2H 3VB7A 1O2GH 1LDTT 1O3JA 2QAAA 2ZFQH 1IQEA 4IS5A 1Z7KA 2CHAC 1CA0C 2I6SA 3GOVB 5GCHG 4BTTB 1ELFA 1DT2A 1C1NA 5L30H 1KXDA 1GHZA 4WH6A 1XMNB 1V2RT 2BX3A 1C1TA 5I25A 5TCCA 1BTYA 1O5GH 1P11E 1PPCE 1MTUA 1WSSH 1HYLA 1P09A 1FIWA 1P9SA 3M36A 5LPRA 2CJIA 4NGAH 4GHQA 3GY5A 4D9RA 7GCHF 1KDQA 4NZQA 3ZVDA 5DO4H 2OC1A 3O8DA 3V3MA 4X2XA 3TH4H 1QQUA 2Y80A 1QL7A 1UMAH 1B5GH 1O3EA 1EZQA 2FOHA 4TYDA 4X1RU 4Q80A 1GBKA 2ZIQH 3H5CB 1D9IA 3SNAA 3STIA 2GZ7A 4AX9H 1T4UH 4ZROA 1YKTA 1P3CA 2CF9H 2VWNA 4WXVA 4CBOA 4YO9A 3PMBB 4Z6AH 1K9OE 4U01A 3RXEA 3ENSB 3I77A 4BAKB 1LQDB 3RXOA 3LJOA 2XBVA 1OWEA 2ZGJA 1C5ZB 1YPHE 1PYTD 1WUNH 1C2FA 1S0QA 3FZDA 4MTBA 3LT3A 1EZXC 1YPKH 4AOQA 2O8WA 3D65E 1Y8TA 1P2KA 1AE8H 3UNQA 1LHGH 3SQEE 4DIHH 5A8XA 1U6QA 1GJ8B 1RJXB 4IN2A 2PKAA 1BQYA 1BCUH 2YNBA 3D23A 2J92A 4MPVA 1AB9C 4NIYA 1DFPA 1DWBH 2VIWA 1J17T 1KLTA 4CRBA 5F03A 4YESB 1BITA 1V2TT 3RMOH 3A85A 1FN6A 1OXGA 2BMGB 1BDAA 2H2ZA 4UFDH 2ZP0H 4BAQB 3V12A 2FOFA 1IQHA 1SVPA 1EXFA 3V13A 1DUEA 3E3TA 1V2QT 1UTJA 1L1JA 1GCDA 3ZVAA 1V2ST 1O2HA 1L2EA 1W0YH 3E91A 1MCTA 5F8TA 1L1NA 4B1TA 5C5NA 4CRCA 1OX1A 2XC0A 1FY8E 5LH8A 2UUKB 1HJAC 1UCYK 4ZKNU 3NUMA 4KELA 1LHEH 4FU8A 2IJOB 1BTHH 1OP0A 2Z9GA 1NRNH 2XNIA 1GBTA 1HJAB 1J8AA 1TNHA 2J34A 3PWBA 1SBWA 1K1LA 2ZFSA 4FUIA 3TITA 1QJ1B 1ETRH 2CGAA 1C2EA 1LKAA 5K7RA 2P59A 2AYWA 2BD7A 3UUZA 1CGIE 1Y5AT 2BOKA 3BV9B 4B76A 3BIUH 1IQGA 3ZV9A 1K21H 1W7GH 2FOEA 2RA0A 2G5NA 2PSXA 4FUBA 1V2PT 2BQWB 1ELGA 3SI4H 3LJJA 2BY9X 3LH3A 1NZQH 2BLWA 3B23B 1N8OC 2W3KA 5ETXA 4OS6A 3MU4A 3SJ9A 1S0RA 2F9UA 1OWJA 5LGOA 1PPZA 4AN7A 4I8HA 1ACBE 4UDWH 3LC3A 2OD3B 3OYPA 1HAVA 1MMJN 2O9QA 3EDXB 3A8DA 2ZC9H 4ABDA 1CT2E 1G36A 3TJVA 4X1SU 5GPIB 3ZZ6A 1SGTA 1Z6JH 3QTVH 3GISB 5JDUB 1P06A 1GDQA 3RXUA 3A7VA 4PROA 1BJVA 2AMPA 3L6PA 1EZUC 2Q6DA 2FDAA 1XVOA 4CR9A 1NU9A 1GVKB 2G81E 4JYUH 3EA7A 1IQNA 4ESTE 2D8WA 1LVYA 2PKSC 1GJ7B 3BTFE 1DSTA 3FP7E 4MVNA 2HOBA 1IAUA 1GBJA 3EYDA 3P6ZB 5AF9H 2ZQ2A 2FPZA 1NM6A 1C2MA 2NU0E 5FCRA 3MU5A 4O03A 4ABBA 3A7ZA 1AVWA 3A8CA 2Z3CA 2JKHA 1IQFA 1OKXA 4ZKSU 1FJSA 3OTJE 2VGCB 3ZZ5A 2G8TA 1BA8B 3VB3A 2VGCC 1HJ9A 3UNSA 5J4QA 3VFEA 3A80A 1Z8IB 3E16B 2GD4B 2PSYA 1ZJKA 1SG8B 2VJ1A 3U1JB 3DFJA 2C93B 1C2HA 2GCTC 1YC0A 1L4ZA 2OP9A 2FODA 3T2NA 1XX9A 4AZ2B 1KTSB 1YPLH 1YF4A 4ISOA 3G01A 1ABJH 4NSVA 1W2KH 2XRCA 2A2QH 2SFAA 5T6DA 4DCDA 3ZYEA 1C1RA 1P9UA 2FIRH 3PROA 5EOKA 4ABEA 4MLFB 3MI4A 2FP7B 4XSKU 1BRBE 1TRNA 4XBBA 2GX4A 1FY4A 4WMEA 4H4FA 5F8ZA 4IMZA 2W7SA 3T29A 1ETSH 2FX4A 2ZGBH 1N6XA 3TVJB 3SUEA 1A7SA 2TPIZ 5A0AE 1GG6B 1FY1A 3SQHE 4K69A 1N8OB 2J9NA 4WJG2 2BVRH 3RXIA 3KCGH 1NRSH 3NZIA 5C5OA 2VVUA 2AIQA 1KXEA 2BVSH 1HB0B 1GDNA 1TNIA 1NFYA
chains in the Genus database with same CATH superfamily
4MQAA 2BY7X 1OYTH 3TGJE 1W13U 5C67A 2HVXA 5L2YH 2GCHG 1BMMH 1BT7A 7ESTE 5KECA 1VGCC 1QTFA 3RC5A 5JPMH 3GCTF 2C4FH 2WPLS 2VBCA 2G5VA 4OS1A 2ZHFH 1O5AB 1RIWB 1NC6A 4LOYH 2UUJB 4KP0A 2OTVA 3M61U 1DY9A 4O9VA 4GUXA 1Y5BT 3RMMH 2ZHWH 4AFQA 1JXPA 2ANKH 3O8BA 2KCYA 2W7UA 2FS8A 3S9AA 3UQVA 1FPCH 8KME2 3BG8A 1BZXE 2CMYA 1C4U2 3GDUA 4ABAA 5DJ7A 2YMSD 1FMGA 3IG6B 3GCHB 2B8OH 4JK5A 4DG4A 4DT7B 9LPRA 2P16A 1IHTH 1Y3VA 5KEDA 1O2NA 2BDIA 2A4QA 2ZTXA 3UY9A 1O39A 3MH7A 2J2UA 1T8MA 1TGTA 4FUEA 1ZJDA 5CDFE 1O2KA 1TAWA 2XCNA 4OGYA 2NU4E 1O2LA 1NO9H 1NFUA 1XUGA 2WSSD 1O3CA 3TPIZ 1ZHPA 1QGFA 4ZCNA 3P8FA 1QJ6B 3MH4A 3ZVFA 1NBME 3MH5A 3ZZDA 1C9TA 1PFXC 2H9EH 1NRPH 4X8VH 3T25A 2FOBA 1Q3XA 5A2MH 2EY4C 5GWZA 2QF4A 4DT4A 2BY8X 2VIDA 1P2JA 2QV1A 3L33A 1S5SA 1TBZH 1H9IE 1GCTC 1BRCE 1F5LA 2Q6FA 2VIVA 1K1MA 5FX5A 4K5ZA 1C5VA 2WPMS 1CGJE 1Y3XA 1KLIH 1O2ZA 1GHBF 4Y8XA 1UCYH 1GJAB 2ULLA 3LC5A 3Q76A 2QN5T 4BTUB 2AGEX 4WH8A 3SO3A 4UE7H 4ZHMU 1O36A 2J38A 4IC6A 4CH2B 5T3HA 2ZFFH 4YTAA 1C1OA 1GI3A 1C5UA 4ZKOU 1K1OA 2WPIS 1VITF 2FOGA 5A8ZA 1OPHB 3D62A 3SHCH 3LU9B 1BBRH 2QXGA 1UK2A 4DW2U 3SV7A 2J97A 2O8TA 3T62A 1AUJA 5C0UA 2O8LA 4X2VA 1D6RA 3NRLA 2CV3A 3RXQA 1DDJA 2HLDD 4TPIZ 3KF2A 1B0EA 2G52A 1HAIH 1T7CA 2ZFRH 2PUXB 1W0ZU 1YP9A 2M2AA 4AG1A 2BY6X 2QXHA 1JOUB 1V6DA 3QDZB 2OC0A 1FONA 2B9LA 3M5LA 1KTTB 2Y6TA 5HIZA 4JZ1A 1H8IH 1LO6A 4CRFA 5G4BA 3IWMA 1QZ8A 1KYNA 1MQ5A 4H6TA 1C1WH 2VIOA 4NA9H 4TWYA 3PMAB 1SQRA 2AERH 4NFFA 2BDHA 1LPZB 1D3TB 1BB0B 1N1LA 1MU6B 2O8UA 4I8KA 3SUDA 3BN9A 3R3GB 1QBVH 3CS7A 3VB5A 1SLUB 5FPYA 1VCPA 5A0CA 4GCHG 1IOEA 1O2WA 4I31A 1EAIA 1ZTLA 2KAIA 5EG4A 1E1QD 4HTCH 1WTHD 3PMJA 3F3BA 1MZAA 2OQUA 4MPXA 3RXLA 1P03A 1WOFA 1MTNC 2Y5FA 2P8OC 3ATKA 3PV5A 1GMDF 5GDSH 3U8OH 4LK4A 1ANCA 4U2WA 1MTNB 3RXRA 5FL7D 2BZ6H 2FOCA 1GMHF 1G3BA 1FLEE 5AFYH 5DP3A 3EE7A 3OY6U 3W94A 2A5KA 4CRAA 3OEED 2FYQA 1MKWH 2ZKSA 5T6FA 3S0NA 1NFXA 4UFGH 4Z1MD 1ELTA 2TIOA 3KL6A 3PRDA 1QL9A 1E36B 1WTGH 4VGCC 3MU0A 1S85A 3AW1A 1FX0B 1OWDA 1WV7H 3P92A 1PJPA 1T31A 4I8GA 1W12U 2QIQA 2C8ZB 4KGAA 3BEFB 2FS9A 3AW0A 3LGTA 3RXAA 1GMCG 1DXWA 5C1UA 2ZU4A 2YNAA 1GCTB 2P94A 2AS9A 1BMAA 1TBQH 1ZGVA 3F9HA 1DLEA 1F92A 1HAVB 2GGVB 2VNTA 1W10U 1F7ZA 2WPHS 1L1GA 1OS8A 3BG4B 3BTDE 1GJBB 2VB0A 1EPTB 2P95A 1ZRBA 5FAHA 1ETTH 2AIPA 5EU8A 3TH2H 3URDA 3ZVEA 2BQ6B 3E1XB 3GYMA 3UWJH 1V2KT 4INHA 4IW4E 4Q63A 1C5RA 1HBTH 3BTQE 3PRBA 1JRSA 4X1PU 3TK6A 4H42U 1O3GA 3RUOA 3F68H 5EIYA 1SLWB 4XE4A 4DOQA 3SU2A 2PWXA 4A6LA 2XNDD 1UCYE 1OYQA 2ZDVH 1FAXA 4K1EA 4YLUA 4Y6DA 1NT1A 1TMBH 1SB1H 4K2YA 3BSQA 2F9PA 1O2JA 4BXWA 3W1EA 1SHYA 6CHAB 2Y7XA 1TBRH 4OS7A 2J5UA 3KQBA 4MNYA 1KDQB 4BANB 4ZMAH 1AGJA 2QY0B 2B7DH 1THPB 1XUKA 5FXLA 3ZZCA 1H9HE 1TPPA 3RM0H 4HGCA 2ZECA 1FIZA 1WYKA 1FDPA 1GHVH 4ZAEA 2GKVE 1F0SA 3TLOA 4CREA 4A1XA 1O30A 5I46H 1C5QA 4Y76A 3TJNA 2ODYB 3M37A 3CENA 2SNVA 2A7HA 2Y5HA 2AGGX 1GI8B 3HKJB 1EFRD 1SGPE 3KIDU 2BD3A 3ZZ9A 2ZU1A 1TYNA 4TY6A 5TCAA 2F91A 1EJNA 2PV9B 2BHGA 4RKJB 4INLA 2DUCA 3SV9A 1SI5H 3PYHA 4BAOB 4ABFA 4NIXA 3BEIB 1TA6A 3AASA 3EE0B 5EXNA 5EQSA 5CMXH 1AD8H 5LPEA 1TQ7B 3NKKA 3UPEA 2QYIA 1TX7A 4WWYA 4I8JA 1O2XA 2ANWA 4KTSA 1DM4B 1TGBA 2W26A 4CH8B 1ELVA 3URCA 1NROH 2ZDNA 1P04A 2ZHDA 2ZTYA 1OWKA 1EPTC 1FAKH 1SSXA 4Q4LA 4GAWA 3SV8A 1EPTA 5B6OA 4JZFH 2FYRA 5EGMA 2NU2E 3MH6A 4Y0ZE 3TNSA 1MCVA 1OP8A 4I33A 1HNEE 1A46H 3MO6A 2BD2A 2NU3E 3A83A 1AQ7A 4OM9A 3RXKA 1V2UT 3A7XA 1EAUA 2ZHQH 3MOCA 4QT8C 1BRUP 1QCPA 1GBLA 1Z6EA 3M3TA 1ZTKA 1MKXH 1UVOA 1OWHA 2UWLA 4X6NA 5E2OA 2PP6A 4F49A 1TNJA 3DD2H 4IN1A 3LGYA 3KQDA 4AGKA 2TGPZ 4TSFD 1AMHA 4X1QU 3T28A 1GI4A 1ESAA 1EOJA 4DJZB 1GBEA 1AVXA 1SGIB 2Y7ZA 3RXVA 3SV6A 2BOHB 1ZOMA 3F2FA 3NXPA 3PV4A 3UR6A 4RN6A 1UTLM 3BTKE 1Y3YA 1O3BA 7LPRA 3PLPA 1H1BA 3RXBA 1EQ9A 3ITIA 4ISIH 1YLDA 2FXRA 3S9CA 1Z8RA 2VINA 2Z94A 2ZFTA 2Z9JA 1GI2A 3M7TA 4X8UH 5CHAB 3MTYA 2JETB 1YLNA 1ZSJA 1A5GH 1AIXH 1DITH 1QBNA 2Z6BD 4TY7A 3GY2A 1O2VA 1O3NA 2FLRH 1GWAA 2A2XH 2HGTH 3KN2A 4ISNA 1GG6C 2VVCA 1EZSC 3TK9A 3E0NB 2WV5A 2F3CE 1O2PA 2FOAA 1BOQA 1C2IA 2R9PA 2QGRA 2WPJS 2LNCA 3A87A 4K1SA 5EQRA 3SYJA 3ELAH 1CO7E 1P0SH 1XXDA 1NRRH 4IBLH 4AFUA 3UNRA 2AH4X 1SGYE 1LKBA 1EKBB 1UTPA 2XBYA 1GJDB 2NWNA 1UTOA 2TGAA 4AFZA 2ZZUH 1T4VH 2OINA 1TPOA 3F0PA 2XYAA 2ZCKP 4FU9A 3F6UH 3KYFA 4WY3A 1HAPH 1H8HD 3CP7A 1SPJA 4NA7A 1GHXH 1TALA 4MNWA 3V7TA 1A0LA 4WMDA 1OOKB 3GYLB 5DP6A 4XOJA 1C1UH 1T8OA 4O3UA 2BB4A 2K1QA 3TK5A 5EJZA 3F2HA 3SJOA 2WPKS 4FUHA 4IGDA 2A4RA 4Y10E 1KXCA 1BHXF 1P3EA 1CSOE 1K0HA 5FHTA 1QR3E 2A32A 3QTOH 2VIQA 3ZV8A 3GCOA 3EAJA 3ATIA 1H4WA 1O5CB 3KQ5A 1P2OA 2FESH 1GHYH 2ZG0H 2Z3DA 3M7QA 1K22H 4IC5A 4WMFA 1GI7B 5JBAS 3PTNA 3BF6H 2ZPQA 2WYJA 1Y59T 2PR3A 3TGKE 1HAYB 2XW9A 2FO9A 3QX5H 1ORFA 2Z9IA 1O34A 1UVTH 2CHAB 4I7YH 1HRTH 5L6NH 1BRAA 1SLVB 1ZSLA 3OEHD 5FPTA 1HAZB 3A7TA 2FI4E 1RXPA 4ZUHA 5JB9S 5JYIA 3O8CA 4Y11E 2Y81A 2ZDAH 3RLYH 5IDKA 2QF3A 2VWLA 3SBKA 3LONA 1E37B 2C90B 3SUFA 1QBOA 4AGJA 1FY5A 2QF0A 5PTPA 4FUFA 4KKDA 1UW7A 4VGCB 1TX6A 1CA0B 4FETA 4HI3A 1PQ8A 1SHHB 4D7GA 3B9FH 1HAHH 4Y8YA 2W5EA 4INKA 1O0DH 2GZ8A 4JZDH 1F0TA 1OSSA 3PTBA 1GJ4H 2ZEBA 1O38A 2BXTH 4X2WA 1AE5A 1YYY1 1HCGA 2A45B 2WYGA 3SUGA 2PKAB 3T5FH 1GMCF 2KAIB 4A92A 2OBOA 4MG3A 4FVBA 3A7YA 1C4Y2 5JB8S 1GHBG 1TMUH 4JYVH 2A0QB 4KTCA 4A7IB 2NU1E 1TRMA 2F9NA 5HIYA 1C2DA 3O8RA 1V2OT 4R0IA 1H8ED 1INCA 3WY8A 5DP4A 1DUAA 1FXYA 1Z1JA 5GJ4B 1D3DB 4ZKRU 3RXJA 2BDAA 1GL1A 2HPPH 5EW2H 2Y5GA 4BXSA 5EXLA 4P00A 4OS4A 1G37A 2XC4A 1YY3A 4WF8A 4X6OA 5ESBA 1BBRK 1DXPA 4K60A 4X0WU 1EB2A 1DVAH 1O37A 2EI6A 3QK1A 2EQNA 1FV9A 3FP8E 3RXCA 1O3PB 1Y3WA 2PGBB 3K65B 1LHCH 3MFJA 1DLKB 4GSOA 3OSYA 2CK3D 3RMNH 2Z9KA 2GVFA 5AHGH 2VH0A 2R3UA 1YWUA 4SGAE 2ZQ1A 4CBNA 1V2NT 4Q7ZA 3UIRA 5EW1H 2JH5D 3ATMA 5ABWA 1BTZA 2UUFB 1X7AC 4ACBA 5FX6A 1O2QA 3LDXH 2J94A 1S6FA 1G3EA 4YT6H 1C5PA 3OX7U 1EJMA 2F9OA 4ABGA 4ZH8A 1THRH 2STBE 1IHSH 1C1SA 2UUYA 2PHBA 5FBEA 3GY4A 6ESTA 1GGDB 1BUIA 1AN1E 3E0PB 3LH1A 1QRWA 1EJAA 1NBMD 3M5MA 4FUJA 1C5WB 1MAXA 2HRVA 1PPHE 4CHAB 1HXEH 1RFNA 1O3IA 1ZPZA 1O3LA 2M5TA 3BEUA 4JZEH 1K1NA 4XDEA 3LGWA 1NRQH 2ZHEH 2QXJA 1GBCA 5DN6D 1G30B 2GT7A 3F9EA 1O3AA 1MZDA 1XUJA 2R3YA 4GPGA 3ZVCA 3QGJA 3T27A 4WVPE 3A81A 1CBWB 2ZNKH 3KGPA 2XWBI 1AI8H 4XBDA 1UTKA 1E35B 1QJ7B 3MU1A 2OLGA 4KTUA 4B75A 1JIMA 1ZR0A 1W7XH 3QN7A 1CVWH 3E90B 3RXFA 1MAYA 3AAVA 2KZ4A 4AC9A 2JETC 5HYOA 1UTNA 2JJ2D 8ESTE 3QGNB 3PWCA 2ZA5A 1F5KU 5AVDA 1CHOF 1DICA 1KY9A 2XWAA 1GJCB 2GP9B 2ZPRA 1TPSA 3GCNA 4BAHB 1VITG 3QZQA 1TFXA 3OFND 1C2GA 1EUFA 4B2CA 3BTEE 2FI3E 2WUBA 1LHDH 1AY6H 1BHXB 2H9HA 1CU1A 1SGRE 2FZZA 3F2GA 1W3CA 4E06H 4YLQH 5A09A 5EODA 2PW8H 5E8EH 4DVAU 3MNSA 1XUHA 1KIGH 1P12E 1DOJA 3SNDA 1RTLA 1J15A 4IMQA 4F48B 1Z8JB 3NPSA 1VR1H 2RFKC 1EB1H 1MABB 1YBWA 5FPSA 3A86A 1Z8GA 4X6MA 1S82A 5GXPA 4NG9H 1TMTH 1ZPCA 2AEIH 2FX6A 1XKBC 2D2DA 1MBQA 5C3NA 3TJUA 2SGFE 1C5LH 5DP9A 4YZUA 1LPGB 2XXLA 2EEKA 2Q6GA 1DS2E 1YCPK 3TGIE 4X8SH 5A8YA 4LXBH 1HXFH 4Y0YE 1UJ1A 7GCHG 1ARBA 1SGQE 2OC8A 1C5OH 1O3HA 1FNIA 3K6ZA 6GCHG 4Y8ZA 4Q7XA 3BTME 4GCHF 1HAGE 2ZDLA 2IPHA 2KX4A 1PQ5A 3LGUA 3SZNA 3JZ1B 1WU1A 4JYTA 5T1VA 5ESTE 4D7FA 1VZQH 3MHWU 3ATLA 1OWIA 3ODFA 5FCKA 5J4SA 1A61H 1D3PB 1K2I1 2AGIX 4TPYA 1UVSH 1GBHA 2C8XB 2P8OB 1ZRKA 1LVBA 2P93A 2Z7FE 4WXIA 3HPTB 2A7CA 3K9XB 1K1IA 1AB9B 2BM2A 2P3UB 1ELBA 2BDCA 2HPQH 5C1XA 4DGJA 3DA9B 3RXSA 1Z1IA 4M7GA 3VB6A 1C2LA 2BTCE 4UFEH 2PLXA 4YOIA 1UK3A 5C0TA 1ABIH 3FZZA 3PMHB 1Y5UT 1XUIA 1AZ8A 1W8BH 3BTGE 3SGBE 2RG3A 1D3QB 3NCLA 1JMOH 2P3TB 2R2WU 4OGXA 3RXTA 1YGCH 1ELDE 4FUGA 3SU0A 1SQAA 4TT3D 5L2ZH 1KXFA 2V7QD 2WINI 1ZMLA 1LCYA 2JH6D 2V3OH 1GMHG 4A5TS 1A5HA 3R0FA 1C1QA 3S69A 3SW2B 1SC8U 2G51A 3SNBA 6CHAC 5AFZH 6GCHF 5CE1A 4H6SB 3H7TA 2GDDA 1BBRE 1AVGH 1DWCH 2A5IA 2JDID 1QNJA 4Q7YA 3UQOA 2A4GA 1V2JT 4FU7A 3LKWA 3SU5A 3DT0H 3A84A 4K3JA 4MPWA 5F53A 3S7HB 2EI7A 2ZCHP 2WUCA 3P8NA 3P17H 3D49H 2FM2A 4M9FA 1PPBH 3GY6A 3GY3A 1HFDA 1RGQA 1IQJA 2GZ9A 1GHWH 2HWLB 1DPOA 3RU4E 1QIXB 3OAAD 1AUTC 1O2RA 5HM9A 1TLDA 4R8TB 3V0XA 1EX3A 2IPQX 3I78A 2V35A 1PPFE 1VITH 2LPRA 3A7WA 3P95A 4FUDA 1O31A 3VXEH 2OCVB 1E1RD 2XBWA 4AB9A 2SNWA 1P02A 1MUEB 1O5FH 1GI0A 1OP2A 1SGNE 3A8BA 2J98A 1SQTA 4D8NA 2ZO3H 2IN2A 2STAE 3MWIU 3MMGA 2HALA 1J14A 1ZTJA 1MH0A 5JBBS 2FTLE 1HAXB 1QA0A 3SJIA 1BTPA 5E0GA 3RXDA 1M9UA 1SOTA 5HGGA 2I6QA 1GVLA 1C2JA 5DK1A 5KGOA 1ARCA 4A1TA 3HK3B 4BAMB 3PB1E 2D1JA 4ACAA 5B6LA 1D4PB 1V2LT 2ANYA 3NWUA 2ZDKA 2J98B 1HUTH 3DSGA 4LZ1H 1FUJA 2GV7A 7KMEH 1GJ9B 2A4OA 4JMYA 6LPRA 1ANEA 3IITA 2R2MB 1GL0E 3ZIAD 1GBDA 1FZZA 4MNXA 4D76A 2DE8A 1NTPA 3VXFH 4UONA 3NK8A 1KLJH 4AFSA 1Y3UA 4E7RG 2VU8E 1AWFH 1K1PA 2K8IA 1WQSA 2ZU3A 3AVZA 3BTWE 3TH3H 1ANDA 3RXMA 4JK6A 1AFQC 1RS0A 2ODPA 2RCEA 1JIRA 3FVFB 1GBMA 1O2UA 1Q31A 2ALPA 2H5DA 1B7XB 3UR9A 4THNH 2V3MA 4ISHH 1TWXB 4XD7D 2H5CA 2A31A 2A5AA 3SU3A 2GMTB 1W11U 1ZLRA 2BXUH 5H4IB 2CN0H 5E2PA 1O2YA 2BVXH 2V6NA 2RDLA 1ZZZA 3RMLH 1P8VC 5LPFA 1DSUA 3FOAA 2HNTF 3C1KA 3RP2A 3SI3H 2ALVA 2BYAX 5C2ZA 4NFEA 3N7OA 4ABHA 3SNEA 2G4TA 4MDSA 1GBBA 2EI8A 1MD8A 1EATA 3ZZ4A 4UFFH 2B0FA 3U69H 4K1TA 1E0FD 1TGCA 1O3OA 2AFQB 1YPGH 1S81A 2OUAA 1FN8A 2UWOA 3Q77A 1AO5A 1LVMA 2BD4A 4RT0A 3VGCB 4Z0KA 4FUCA 4K8BA 1TA2A 2H6MA 5EQQA 1PPEE 2TGTA 3MO3A 4O97A 1QRZA 3SGQE 1A5IA 1YPMH 2CF8H 3EQ0H 1YCPM 1TNGA 3MYWA 2GTBA 2WHXA 1GBFA 4BNRA 1SQOA 1QL8A 1C5SA 1G3DA 2C3SA 4MNVA 4SGBE 1PPGE 2GJGA 4HZHA 1SKYE 3EA8A 4YOGA 3RXGA 1DY8A 1T8LA 2J4IA 2LP6A 2XBXA 1TPAE 4OS5A 1SFIA 1LVOA 3F9GA 1LPKB 2WV4A 1O3FA 1NS3A 4Y7AA 1F0RA 3RU4D 3MQKC 1GBIA 1NESE 5DP5A 1EASA 1O5EH 2GDEH 2FMJA 1NPMA 3U1IB 1JRTA 3SOSA 3P8GA 1O33A 1CA8B 2FWWA 1WQVH 1S83A 3FP6E 4B74A 2KM0A 1A0HB 3SU4A 1C5YB 4BOHA 4UEHH 1TNKA 2BZAA 3RC6A 1AKSB 3AAUA 1S84A 1YCPH 1F2SE 2BD5A 3SHAH 3FFGA 2KCAA 4AYVB 4XFQA 2VIPA 2ZU5A 1XVMA 5JBCS 5DKMA 1O3MA 2ZDMA 2Y82A 2GV6A 3MNXA 1HDTH 3N99A 2O8MA 2GT8A 1UO6A 3VEQB 3Q3XA 1C5MD 1V2WT 2KR7A 1K1JA 2PKSB 8GCHG 4RT1A 1G9IE 1TGNA 1YPHC 1EP5A 2OBQA 2ZU2A 3BG4C 2QCYA 1AFQB 3ZVGA 1HPGA 4I32A 2FOMB 1GI6A 2GMTC 4RKOB 1W0KD 4MPUA 3SORA 1ANBA 1KSNA 4ZXXH 1GDUA 2PGQB 1YM0A 1LMWB 3WWBA 3DUXH 4ZXYH 1C2KA 3HGNA 3QLPH 1AFEH 2OXSA 3M3SA 3U8TH 2BDGA 1MD7A 2F4LA 1S6HA 1RRKA 3KEEA 1UVUH 2FTMA 3F9FA 2HNTE 1CE5A 3U9AH 3A82A 2FLBH 2QC2A 1O3KA 5BPEA 1GI5A 2XCFA 4TWWA 1ZPBA 4X8TH 5F8XA 1IQMA 1AZZA 1WCZA 2PTNA 3VGCC 3ZZ8A 1P57B 4ABIA 1EAXA 1TB6H 1O32A 3H7OA 2TRMA 1NFWA 2SGPE 1QA7A 1CBWC 1DWDH 1EP6A 4NZLA 5JBTA 1HJ8A 4X6PA 1G3CA 3UFAA 1PQAA 2ZCLP 2V0BA 2OQ5A 3VPKA 1TOCB 3RXHA 1XM1A 2EC9H 2BY5X 4NSYA 1N6YA 2V3HH 1SGFG 2H9TH 3LOXA 5F6MA 2RDEA 2BLVA 5HKKD 1SGCA 5K0HA 1O3DA 2IOTA 1E34B 1CHOG 4I8LA 1PQ7A 1LTOA 2VH6A 2ESTE 3Q3KA 4FOUC 5DG6A 4Y7BA 1GJ5H 1A3EH 3KYGA 1WXRA 4AORA 1HGTH 1QQ4A 2PTCE 3T26A 2ZGHA 4UD9H 1O5BB 3EA9A 3M5NA 3SGAE 2FEQH 3GY8A 2HNTC 3RLWH 3HGPA 3PV2A 1MKWK 4B6EA 3DCLA 2R0KA 3KQEA 3SV2H 2QA9E 1CHGA 1JBUH 2XC5A 2THFB 3CS0A 5E0JA 5T6GA 5DPAA 1B0FA 5EPNA 3UREA 2ILNA 1P2QA 3ODDA 3S7KB 3FAOA 1TNLA 3SN8A 3PM3A 3S9BA 1F5RA 1W14U 3FKSD 3CNRA 1ZMNA 5DP7A 1LHFH 2G00A 2KFWA 1BMNH 3FO8D 3ZZAA 1VCQA 2AMDA 1QB6A 1NY22 1A4WH 1GI1A 1FY3A 1LQEA 1D6WA 1AKSA 2F43B 1YPJH 3P70B 3A8AA 3FANA 3WW7A 1RD3B 1MU8B 4XRNA 2GCHF 3A89A 2ZPSA 2K0QA 3QZRA 2YOLA 1P2IA 3DFLA 3GCTG 1GBAA 2J95A 2QXIA 1KXAA 1SL3A 1VJ9U 4U30A 1OHHD 3RDZA 4GHTA 1A3BH 3TU7H 1COWD 3HKIB 1HAOH 1RTKA 2KCPA 2ZF0H 2G55A 3SJKA 2HLCA 1P2MA 3UWIA 3PO1C 3QUMP 5CHBA 2C8YB 1BMFD 1GVZA 5CHAC 2XOKD 1DE7H 3KQCA 1MTSA 3SNCA 4AB8A 5C20A 1TE0A 4YM9A 3K6YA 3RC4A 1THSH 1EAWA 2BQ7B 3RXPA 1SR5C 1TX8A 2JH0D 2SGEE 1HIAA 4CRGA 1P01A 2BX4A 2WZQA 1O2MA 2C8WB 5HM2A 1DX5M 1VCWA 3UOPA 3E6PH 1CGHA 5GCHF 1E38B 4D9QA 3GY7A 1JWTA 3KHVA 4DIIH 1IQKA 3M35A 2W3IA 1FPHH 4YOJA 4P02A 3AK5A 4ZHLU 5E0HA 1XKAC 2P3FH 3QO6A 1ZHRA 1G32B 1QY6A 2VVVA 1BTXA 1ZGIA 1ELCA 3PLBA 3U8RH 2PUQH 1W0JD 1MBMA 9ESTA 3GCHC 4B6FA 5IYTA 1SFQB 4U32A 3HATH 1C5XB 2ZGXH 1EOLA 4JCNA 3MO9A 2BLQA 1ESBA 1O5DH 2ANMH 2PFEA 4F4OC 3ESTA 4LZ4B 3SJ8A 3B8JA 1QHRB 1V2VT 1RIWC 3BIVH 4O3TA 2ASUB 3M5OA 4HFPB 2Q1JA 3DHKH 1XUFA 1UTQA 3GICB 3EGKH 1BIOA 2BDBA 1T32A 2ZWLH 1L4DA 4E05H 1VGCB 1NN6A 1TGSZ 4NWLA 1SGDE 3M3VA 2CXVA 3GDSA 5DP8A 1KXBA 2R0LA 4Q2KA 3JZ2B 5A0BA 1HV7A 2ZFPH 1AU8A 4XBCA 2BDYA 3OE7D 2VWOA 4GLYA 1ELEE 2L74A 4ASHA 1A2CH 3LGVA 3MNBA 2D26C 4RSPA 1TIOA 1CT0E 2A7JA 2F9BH 1UHBB 4NCYA 3PO1B 1TOMH 3TIUA 1GHAG 3LPRA 3OU0A 4CHAC 1MQ6A 5HXFA 1V3XA 1ZSKA 1O2OA 4ABJA 1A1RA 2W6ID 3ZZBA 3FN8A 3OY5U 2VWMA 1P10A 1TRYA 1GGDC 3L3TA 4DY7B 1C5NH 1UHBA 2H1UA 1G2MA 1QFKH 1SGFA 3LGIA 2SGAA 1Q2WA 1ESTA 2ZI2H 3SU1A 8LPRA 5C1YA 2ODQA 3SZEA 4BTIB 4NIVA 1P05A 1BJUA 1QB1A 4YXWD 1O2IA 4FXGH 4DURA 2FI5E 3MU8A 2Z9LA 4A1VA 3LIWA 2SGDE 2A1DB 3C27B 4B73A 1K28D 4Y71A 3SU6A 1C1MA 4YT7H 5EJLA 2Z3EA 1H9LB 5SGAE 2GCTB 3Q3YA 1ID5H 1P2NA 1NU7B 5DSFA 1ELAA 1ZMJA 8GCHF 3BTTE 4X1NU 3VB4A 2ZTZA 3A88A 3HK6B 4CR5A 1J16A 2G4UA 4B2BA 3U98H 3WWFA 1IQIA 2XTTB 2F83A 1MTWA 2DE9A 1UTMA 4X2YA 4E7NA 1SLXB 2OC7A 1DWEH 1UVPA 1VJAU 5TJXA 1O35A 4B71A 2F9VA 1IQLA 1HLTH 1SOZA 4OS2A 3ZVBA 1C1PA 1V2MT 1ZYOA 1S6LA 1GHAF 3STJA 3K2UA 1YPEH 2AMQA 1FI8A 1O2SA 3I29A 1A0JA 1GI9B 1GMDG 3QWCH 1UK4A 4CRDA 1AHTH 2JJ1D 3Q00A 5HMAA 1SGEE 3F1SB 4FVDA 3ZZ3A 1MTVA 4NIWA 1J9CH 1RTFB 4K8YA 3PLKA 1BTWA 1C1VH 2KCOA 1L0ZA 4ISLA 3ZZ7A 2BD8A 1QRXA 5FBIA 4JZIA 1HIAB 3TJOA 1BTUA 3E8LA 4J1YA 1CT4E 1SMFE 2EA3A 1F0UA 5EXMA 2ZGCA 2IJD1 3UOUA 2B5TB 1WBGB 2UWPA 2SGQE 1Z71A 2BLOA 1VKYA 2BD9A 3UTUH 4NA8A 3ZYDA 1E79D 5BRRE 1PYTC 3P8OA 1C4V2 1TABE 1TONA 4AG2A 3W95A 2QF5A 1C5TA 1T8NA 3RU4T 3ATWA 1H8DH 4J2YB 4B2AA 2QE7D 3KNXA 1DANH 1GJ6A 3BTHE 4GVUA 1MKXK 4Y79A 5EPYA 4NWKA 3MNCA 1GPZA 3GDVA 1ZHMA 3M7UA 1QURH 1CQQA 2RA3A 4ZHAA 1O2TA 2TBSA 1AWHB 5GIBA 1FQ3A 5DGJA 1XXFA 1QB9A 1YLCA 1G2LA 4AYYB 4HG6A 1TQ0B 1BMLA 1C9PA 3TNTA 1WAYB 2TGDA 3RM2H 3VB7A 1O2GH 1LDTT 1O3JA 2QAAA 2ZFQH 1IQEA 4IS5A 1Z7KA 2CHAC 1CA0C 2I6SA 3GOVB 5GCHG 4BTTB 1ELFA 1DT2A 1C1NA 5L30H 1KXDA 2JIZD 1GHZA 4WH6A 1XMNB 1V2RT 2BX3A 2YMSC 1C1TA 5I25A 5TCCA 1BTYA 1O5GH 1P11E 1PPCE 1MTUA 1WSSH 1HYLA 1P09A 1FIWA 1P9SA 3M36A 5LPRA 2CJIA 4NGAH 4GHQA 3GY5A 4D9RA 7GCHF 1KDQA 4NZQA 3ZVDA 5DO4H 5C94A 2OC1A 3O8DA 3V3MA 4X2XA 3TH4H 1QQUA 2Y80A 1QL7A 1UMAH 1B5GH 1O3EA 1EZQA 2FOHA 3DSOA 4TYDA 4X1RU 4Q80A 1GBKA 2HVYB 2ZIQH 3H5CB 1D9IA 3SNAA 3STIA 2GZ7A 4AX9H 1T4UH 4ZROA 1YKTA 1P3CA 3DSPA 2CF9H 2VWNA 4WXVA 4CBOA 4YO9A 3PMBB 4Z6AH 1K9OE 4U01A 3RXEA 3ENSB 3I77A 4BAKB 1LQDB 3RXOA 3LJOA 2XBVA 1OWEA 2ZGJA 1C5ZB 1YPHE 1PYTD 1WUNH 1C2FA 1S0QA 2LELA 3FZDA 3LT3A 4MTBA 1EZXC 1YPKH 4AOQA 2O8WA 3D65E 1Y8TA 2WPDD 1P2KA 1AE8H 3UNQA 1LHGH 3SQEE 4DIHH 5A8XA 1U6QA 1GJ8B 1RJXB 4IN2A 2PKAA 1BQYA 1BCUH 2YNBA 3D23A 2J92A 4MPVA 1AB9C 4NIYA 1DFPA 1DWBH 2WV9A 2VIWA 1J17T 1KLTA 4CRBA 5F03A 4YESB 1BITA 1V2TT 3RMOH 3A85A 1FN6A 1OXGA 2BMGB 1BDAA 2H2ZA 4UFDH 2ZP0H 4BAQB 3V12A 2FOFA 1IQHA 1SVPA 1EXFA 3V13A 1DUEA 3E3TA 1V2QT 1UTJA 1L1JA 1GCDA 3ZVAA 1V2ST 1O2HA 1L2EA 1W0YH 3E91A 1MCTA 5F8TA 1L1NA 4B1TA 5C5NA 4CRCA 1OX1A 2XC0A 1FY8E 5LH8A 2UUKB 1HJAC 1UCYK 4ZKNU 3NUMA 4KELA 1LHEH 4RI0A 4FU8A 2IJOB 1BTHH 2YMSB 1OP0A 2Z9GA 1NRNH 2XNIA 1GBTA 1HJAB 1J8AA 1TNHA 2J34A 3PWBA 1SBWA 1K1LA 2ZFSA 4FUIA 3TITA 1QJ1B 1ETRH 2CGAA 1C2EA 1LKAA 5K7RA 2P59A 2AYWA 1KMHB 2BD7A 3UUZA 1CGIE 1Y5AT 2BOKA 3BV9B 4B76A 5EJ1A 3BIUH 1IQGA 3ZV9A 1K21H 1W7GH 2FOEA 2RA0A 2G5NA 2PSXA 4ASUD 4FUBA 3OTPA 1V2PT 2BQWB 1ELGA 3SI4H 3LJJA 2AHME 2BY9X 3LH3A 1NZQH 3U28C 2BLWA 3B23B 1N8OC 2W3KA 5ETXA 4OS6A 3MU4A 3SJ9A 1S0RA 2F9UA 1OWJA 5LGOA 1PPZA 4AN7A 4I8HA 1ACBE 4UDWH 3LC3A 2OD3B 3OYPA 1HAVA 1MMJN 2O9QA 3EDXB 3A8DA 2ZC9H 4ABDA 1CT2E 1G36A 3GS9A 3TJVA 4X1SU 5GPIB 3ZZ6A 1SGTA 1Z6JH 3QTVH 3GISB 5JDUB 1P06A 1GDQA 3RXUA 3F0OA 3VG8A 3A7VA 4PROA 1BJVA 2AMPA 3L6PA 1EZUC 2Q6DA 2FDAA 1XVOA 3N7EA 4CR9A 1NU9A 1GVKB 2G81E 4JYUH 3EA7A 2L6OA 1IQNA 4ESTE 2D8WA 1LVYA 2PKSC 1GJ7B 3BTFE 5C17A 1DSTA 3FP7E 4MVNA 2HOBA 1IAUA 1GBJA 3EYDA 3P6ZB 5AF9H 2ZQ2A 2FPZA 1NM6A 1C2MA 2NU0E 5FCRA 3UB0A 3MU5A 4O03A 4ABBA 3A7ZA 1AVWA 3A8CA 2Z3CA 2JKHA 1IQFA 1OKXA 1WDIA 4ZKSU 1FJSA 3OTJE 2VGCB 3N7DA 3ZZ5A 3UAIC 2G8TA 1BA8B 3VB3A 2VGCC 1HJ9A 3UNSA 5J4QA 5GNDA 3VFEA 3A80A 1Z8IB 3E16B 2GD4B 2W6JD 2PSYA 1ZJKA 1SG8B 2VJ1A 4F55A 3DFJA 3U1JB 2C93B 1C2HA 2GCTC 1YC0A 1L4ZA 2OP9A 2FODA 3T2NA 1XX9A 4AZ2B 1KTSB 1YPLH 1YF4A 4ISOA 3G01A 1ABJH 4NSVA 5IK2D 1W2KH 2XRCA 2A2QH 2SFAA 5T6DA 4DCDA 3H09A 3ZYEA 1C1RA 1P9UA 2FIRH 3PROA 5EOKA 4ABEA 4MLFB 3MI4A 2FP7B 4XSKU 4I86A 1BRBE 1TRNA 4XBBA 2GX4A 1FY4A 4WMEA 4H4FA 2OK5A 5F8ZA 4IMZA 2W7SA 3T29A 1ETSH 2FX4A 2ZGBH 1N6XA 3TVJB 3SUEA 1A7SA 2TPIZ 5A0AE 1GG6B 1FY1A 3SQHE 4K69A 1N8OB 2J9NA 4WJG2 2BVRH 3RXIA 3KCGH 1NRSH 3NZIA 5C5OA 2VVUA 2AIQA 1KXEA 2BVSH 1HB0B 1GDNA 1TNIA 1NFYA
chains in the Genus database with same CATH topology
4MQAA 2BY7X 1OYTH 3TGJE 1W13U 5C67A 2HVXA 5L2YH 2GCHG 1BMMH 1BT7A 7ESTE 1VGCC 1QTFA 3RC5A 5JPMH 3GCTF 2C4FH 2WPLS 2G5VA 4OS1A 2ZHFH 1O5AB 1RIWB 1NC6A 4LOYH 2UUJB 4KP0A 2OTVA 3M61U 1DY9A 4O9VA 4GUXA 1Y5BT 3RMMH 2ZHWH 4AFQA 1JXPA 2ANKH 3O8BA 2W7UA 2FS8A 3S9AA 3UQVA 1FPCH 8KME2 3BG8A 1BZXE 2CMYA 1C4U2 3GDUA 4ABAA 5DJ7A 1FMGA 3IG6B 3GCHB 2B8OH 4JK5A 4DG4A 4DT7B 9LPRA 2P16A 1IHTH 1Y3VA 1O2NA 2BDIA 2A4QA 2ZTXA 3UY9A 1O39A 3MH7A 2J2UA 1T8MA 1TGTA 4FUEA 1ZJDA 1O2KA 1TAWA 2XCNA 4OGYA 2NU4E 1O2LA 1NO9H 1NFUA 1XUGA 1O3CA 3TPIZ 1ZHPA 1QGFA 3P8FA 1QJ6B 3MH4A 3ZVFA 3MH5A 3ZZDA 1C9TA 1PFXC 2H9EH 1NRPH 4X8VH 3T25A 2FOBA 1Q3XA 5A2MH 5GWZA 2BY8X 2VIDA 1P2JA 2QV1A 3L33A 1S5SA 1TBZH 1H9IE 1GCTC 1BRCE 1F5LA 2Q6FA 2VIVA 1K1MA 5FX5A 4K5ZA 1C5VA 2WPMS 1CGJE 1Y3XA 1KLIH 1O2ZA 1GHBF 4Y8XA 1UCYH 1GJAB 2ULLA 3LC5A 3Q76A 2QN5T 4BTUB 2AGEX 4WH8A 3SO3A 4UE7H 4ZHMU 1O36A 2J38A 4IC6A 4CH2B 5T3HA 2ZFFH 4YTAA 1C1OA 1GI3A 1C5UA 4ZKOU 1K1OA 2WPIS 1VITF 2FOGA 5A8ZA 1OPHB 3D62A 3SHCH 3LU9B 1BBRH 2QXGA 1UK2A 4DW2U 3SV7A 2O8TA 3T62A 1AUJA 2O8LA 4X2VA 1D6RA 2CV3A 3RXQA 1DDJA 4TPIZ 3KF2A 1B0EA 2G52A 1HAIH 1T7CA 2ZFRH 2PUXB 1W0ZU 1YP9A 4AG1A 2BY6X 2QXHA 1JOUB 1V6DA 3QDZB 2OC0A 1FONA 2B9LA 3M5LA 1KTTB 2Y6TA 4JZ1A 1H8IH 1LO6A 4CRFA 5G4BA 3IWMA 1KYNA 1MQ5A 4H6TA 1C1WH 2VIOA 4NA9H 4TWYA 3PMAB 2AERH 4NFFA 2BDHA 1LPZB 1D3TB 1BB0B 1N1LA 1MU6B 2O8UA 4I8KA 3SUDA 3BN9A 3R3GB 1QBVH 3CS7A 3VB5A 1SLUB 5FPYA 1VCPA 5A0CA 4GCHG 1IOEA 1O2WA 4I31A 1EAIA 1ZTLA 2KAIA 5EG4A 4HTCH 1WTHD 3PMJA 1MZAA 2OQUA 4MPXA 3RXLA 1P03A 1WOFA 1MTNC 2Y5FA 2P8OC 3ATKA 1GMDF 5GDSH 3U8OH 4LK4A 1ANCA 4U2WA 1MTNB 3RXRA 2BZ6H 2FOCA 1GMHF 1G3BA 1FLEE 5AFYH 5DP3A 3OY6U 3W94A 2A5KA 4CRAA 2FYQA 1MKWH 2ZKSA 5T6FA 3S0NA 1NFXA 4UFGH 1ELTA 2TIOA 3KL6A 1QL9A 1E36B 1WTGH 4VGCC 3MU0A 1S85A 3AW1A 1WV7H 1OWDA 3P92A 1PJPA 1T31A 4I8GA 1W12U 2QIQA 2C8ZB 4KGAA 3BEFB 2FS9A 3AW0A 3LGTA 3RXAA 1GMCG 1DXWA 5C1UA 2ZU4A 2YNAA 1GCTB 2P94A 2AS9A 1BMAA 1TBQH 1ZGVA 3F9HA 1DLEA 1F92A 1HAVB 2GGVB 2VNTA 1W10U 1F7ZA 2WPHS 1L1GA 1OS8A 3BG4B 3BTDE 1GJBB 2VB0A 1EPTB 2P95A 1ZRBA 5FAHA 1ETTH 2AIPA 5EU8A 3TH2H 3URDA 3ZVEA 2BQ6B 3E1XB 3GYMA 3UWJH 1V2KT 4INHA 4IW4E 1C5RA 1HBTH 3BTQE 1JRSA 4X1PU 3TK6A 4H42U 1O3GA 3RUOA 3F68H 1SLWB 4XE4A 4DOQA 3SU2A 2PWXA 4A6LA 1UCYE 1OYQA 2ZDVH 1FAXA 4K1EA 4YLUA 4Y6DA 1NT1A 1TMBH 1SB1H 4K2YA 3BSQA 2F9PA 1O2JA 4BXWA 1SHYA 6CHAB 2Y7XA 1TBRH 4OS7A 3KQBA 4MNYA 1KDQB 4BANB 4ZMAH 1AGJA 2QY0B 2B7DH 1THPB 1XUKA 5FXLA 3ZZCA 1H9HE 1TPPA 3RM0H 4HGCA 2ZECA 1FIZA 1WYKA 1FDPA 1GHVH 4ZAEA 2GKVE 1F0SA 3TLOA 4CREA 4A1XA 1O30A 5I46H 1C5QA 4Y76A 3TJNA 2ODYB 3M37A 3CENA 2SNVA 2A7HA 2Y5HA 2AGGX 1GI8B 3HKJB 1SGPE 3KIDU 2BD3A 3ZZ9A 2ZU1A 1TYNA 4TY6A 5TCAA 2F91A 1EJNA 2PV9B 2BHGA 4RKJB 4INLA 2DUCA 3SV9A 1SI5H 3PYHA 4BAOB 4ABFA 4NIXA 3BEIB 1TA6A 3AASA 3EE0B 5EXNA 5EQSA 5CMXH 1AD8H 5LPEA 1TQ7B 3NKKA 3UPEA 2QYIA 1TX7A 4WWYA 4I8JA 1O2XA 2ANWA 4KTSA 1DM4B 1TGBA 2W26A 4CH8B 1ELVA 3URCA 1NROH 2ZDNA 1P04A 2ZHDA 2ZTYA 1OWKA 1EPTC 1FAKH 1SSXA 3SV8A 4GAWA 1EPTA 5B6OA 4JZFH 2FYRA 5EGMA 2NU2E 3MH6A 4Y0ZE 3TNSA 1MCVA 1OP8A 4I33A 1HNEE 1A46H 3MO6A 2BD2A 2NU3E 3A83A 1AQ7A 3RXKA 1V2UT 3A7XA 1EAUA 2ZHQH 3MOCA 4QT8C 1BRUP 1QCPA 1GBLA 1Z6EA 3M3TA 1ZTKA 1MKXH 1UVOA 1OWHA 2UWLA 4X6NA 5E2OA 4F49A 1TNJA 3DD2H 4IN1A 3LGYA 3KQDA 4AGKA 2TGPZ 1AMHA 4X1QU 3T28A 1GI4A 1ESAA 1EOJA 4DJZB 1GBEA 1AVXA 1SGIB 2Y7ZA 3RXVA 3SV6A 2BOHB 1ZOMA 3NXPA 3PV4A 3UR6A 4RN6A 1UTLM 3BTKE 1Y3YA 1O3BA 7LPRA 3PLPA 1H1BA 3RXBA 1EQ9A 3ITIA 4ISIH 1YLDA 2FXRA 3S9CA 1Z8RA 2VINA 2Z94A 2ZFTA 2Z9JA 1GI2A 3M7TA 4X8UH 5CHAB 3MTYA 2JETB 1ZSJA 1A5GH 1AIXH 1DITH 1QBNA 2Z6BD 4TY7A 3GY2A 1O2VA 1O3NA 2FLRH 1GWAA 2A2XH 2HGTH 3KN2A 4ISNA 1GG6C 2VVCA 1EZSC 3TK9A 3E0NB 2WV5A 2F3CE 1O2PA 2FOAA 1BOQA 1C2IA 2R9PA 2QGRA 2WPJS 2LNCA 3A87A 4K1SA 5EQRA 3ELAH 1CO7E 1P0SH 1XXDA 1NRRH 4IBLH 4AFUA 3UNRA 2AH4X 1SGYE 1LKBA 1EKBB 1UTPA 2XBYA 1GJDB 2NWNA 1UTOA 2TGAA 4AFZA 2ZZUH 1T4VH 2OINA 1TPOA 2XYAA 2ZCKP 4FU9A 3F6UH 4WY3A 1HAPH 3CP7A 1SPJA 4NA7A 1GHXH 1TALA 4MNWA 3V7TA 1A0LA 4WMDA 1OOKB 3GYLB 5DP6A 4XOJA 1C1UH 1T8OA 4O3UA 2BB4A 2K1QA 3TK5A 3SJOA 2WPKS 4FUHA 4IGDA 2A4RA 4Y10E 1KXCA 1BHXF 1P3EA 1CSOE 5FHTA 1QR3E 2A32A 3QTOH 2VIQA 3ZV8A 3GCOA 3EAJA 3ATIA 1H4WA 1O5CB 1P2OA 2FESH 1GHYH 2ZG0H 2Z3DA 3M7QA 1K22H 4IC5A 4WMFA 1GI7B 5JBAS 3PTNA 3BF6H 2ZPQA 2WYJA 1Y59T 2PR3A 3TGKE 1HAYB 2XW9A 2FO9A 3QX5H 1ORFA 2Z9IA 1O34A 1UVTH 2CHAB 4I7YH 1HRTH 5L6NH 1BRAA 1SLVB 1ZSLA 5FPTA 1HAZB 3A7TA 2FI4E 1RXPA 4ZUHA 5JB9S 5JYIA 3O8CA 4Y11E 2Y81A 2ZDAH 3RLYH 5IDKA 2QF3A 2VWLA 3SBKA 3LONA 1E37B 2C90B 3SUFA 1QBOA 4AGJA 1FY5A 2QF0A 5PTPA 4FUFA 4KKDA 4VGCB 1TX6A 1CA0B 4HI3A 1PQ8A 1SHHB 4D7GA 3B9FH 1HAHH 4Y8YA 2W5EA 4INKA 1O0DH 2GZ8A 4JZDH 1F0TA 1OSSA 3PTBA 1GJ4H 2ZEBA 1O38A 2BXTH 4X2WA 1AE5A 1YYY1 1HCGA 2A45B 2WYGA 3SUGA 2PKAB 3T5FH 1GMCF 2KAIB 4A92A 2OBOA 4MG3A 4FVBA 3A7YA 1C4Y2 5JB8S 1GHBG 1TMUH 4JYVH 2A0QB 4KTCA 4A7IB 1TRMA 2NU1E 2F9NA 1C2DA 3O8RA 1V2OT 4R0IA 1INCA 3WY8A 5DP4A 1DUAA 1FXYA 1Z1JA 5GJ4B 1D3DB 4ZKRU 3RXJA 2BDAA 1GL1A 2HPPH 5EW2H 2Y5GA 4BXSA 5EXLA 4OS4A 1G37A 2XC4A 4WF8A 4X6OA 5ESBA 1BBRK 1DXPA 4K60A 4X0WU 1EB2A 1DVAH 1O37A 2EI6A 3QK1A 3RXCA 1FV9A 3FP8E 1O3PB 1Y3WA 2PGBB 3K65B 1LHCH 3MFJA 1DLKB 4GSOA 3OSYA 3RMNH 2Z9KA 2GVFA 5AHGH 2VH0A 2R3UA 4SGAE 2ZQ1A 4CBNA 1V2NT 4Q7ZA 3UIRA 5EW1H 2JH5D 3ATMA 5ABWA 1BTZA 2UUFB 1X7AC 5FX6A 1O2QA 3LDXH 2J94A 1S6FA 1G3EA 4YT6H 1C5PA 3OX7U 1EJMA 2F9OA 4ABGA 4ZH8A 1THRH 2STBE 1IHSH 1C1SA 2UUYA 2PHBA 5FBEA 3GY4A 6ESTA 1GGDB 1BUIA 1AN1E 3E0PB 3LH1A 1QRWA 1EJAA 3M5MA 4FUJA 1C5WB 1MAXA 2HRVA 1PPHE 4CHAB 1HXEH 1RFNA 1O3IA 1ZPZA 1O3LA 2M5TA 3BEUA 4JZEH 1K1NA 4XDEA 3LGWA 1NRQH 2ZHEH 2QXJA 1GBCA 1G30B 2GT7A 3F9EA 1O3AA 1MZDA 1XUJA 2R3YA 4GPGA 3ZVCA 3QGJA 3T27A 4WVPE 3A81A 1CBWB 2ZNKH 3KGPA 2XWBI 1AI8H 4XBDA 1UTKA 1E35B 1QJ7B 3MU1A 2OLGA 4KTUA 4B75A 1JIMA 1ZR0A 1W7XH 3QN7A 1CVWH 3E90B 3RXFA 1MAYA 3AAVA 2JETC 5HYOA 1UTNA 8ESTE 3QGNB 3PWCA 2ZA5A 1F5KU 5AVDA 1CHOF 1DICA 1KY9A 2XWAA 1GJCB 2GP9B 2ZPRA 1TPSA 3GCNA 4BAHB 1VITG 3QZQA 1TFXA 1C2GA 1EUFA 4B2CA 3BTEE 2FI3E 2WUBA 1LHDH 1AY6H 1BHXB 2H9HA 1CU1A 1SGRE 2FZZA 1W3CA 4E06H 4YLQH 5A09A 5EODA 2PW8H 5E8EH 4DVAU 3MNSA 1XUHA 1KIGH 1P12E 1DOJA 3SNDA 1RTLA 1J15A 4IMQA 1Z8JB 3NPSA 1VR1H 1EB1H 1YBWA 5FPSA 3A86A 1Z8GA 4X6MA 1S82A 5GXPA 4NG9H 1TMTH 1ZPCA 2AEIH 2FX6A 1XKBC 2D2DA 1MBQA 5C3NA 3TJUA 2SGFE 1C5LH 5DP9A 4YZUA 1LPGB 2XXLA 2EEKA 2Q6GA 1DS2E 1YCPK 3TGIE 4X8SH 5A8YA 4LXBH 1HXFH 4Y0YE 1UJ1A 7GCHG 1ARBA 1SGQE 2OC8A 1C5OH 1O3HA 1FNIA 3K6ZA 6GCHG 4Y8ZA 4Q7XA 3BTME 4GCHF 1HAGE 2ZDLA 2IPHA 1PQ5A 3LGUA 3SZNA 3JZ1B 1WU1A 4JYTA 5ESTE 4D7FA 1VZQH 3MHWU 3ATLA 1OWIA 3ODFA 5FCKA 5J4SA 1A61H 1D3PB 1K2I1 2AGIX 4TPYA 1UVSH 1GBHA 2C8XB 2P8OB 1ZRKA 1LVBA 2P93A 2Z7FE 4WXIA 3HPTB 2A7CA 3K9XB 1K1IA 1AB9B 2BM2A 2P3UB 1ELBA 2BDCA 2HPQH 5C1XA 4DGJA 3DA9B 3RXSA 1Z1IA 4M7GA 3VB6A 1C2LA 2BTCE 4UFEH 2PLXA 4YOIA 1UK3A 1ABIH 3FZZA 3PMHB 1Y5UT 1XUIA 1AZ8A 1W8BH 3BTGE 3SGBE 2RG3A 1D3QB 3NCLA 1JMOH 2P3TB 2R2WU 4OGXA 3RXTA 1YGCH 1ELDE 4FUGA 3SU0A 1SQAA 5L2ZH 1KXFA 2WINI 1ZMLA 1LCYA 2JH6D 2V3OH 1GMHG 4A5TS 1A5HA 3R0FA 1C1QA 3S69A 3SW2B 1SC8U 2G51A 3SNBA 6CHAC 5AFZH 6GCHF 5CE1A 4H6SB 3H7TA 2GDDA 1BBRE 1AVGH 1DWCH 2A5IA 4Q7YA 1QNJA 3UQOA 2A4GA 1V2JT 4FU7A 3LKWA 3SU5A 3DT0H 3A84A 4K3JA 4MPWA 3S7HB 2EI7A 2ZCHP 2WUCA 3P8NA 3P17H 3D49H 2FM2A 1PPBH 3GY6A 3GY3A 1HFDA 1RGQA 1IQJA 2GZ9A 1GHWH 2HWLB 1DPOA 3RU4E 1QIXB 1AUTC 1O2RA 5HM9A 1TLDA 4R8TB 3V0XA 1EX3A 3I78A 2V35A 1PPFE 1VITH 2LPRA 3A7WA 3P95A 4FUDA 1O31A 3VXEH 2OCVB 2XBWA 4AB9A 2SNWA 1P02A 1MUEB 1O5FH 1GI0A 1OP2A 1SGNE 3A8BA 1SQTA 4D8NA 2ZO3H 2IN2A 2STAE 3MWIU 3MMGA 2HALA 1J14A 1ZTJA 1MH0A 5JBBS 2FTLE 1HAXB 1QA0A 3SJIA 1BTPA 5E0GA 3RXDA 1M9UA 1SOTA 5HGGA 2I6QA 1GVLA 1C2JA 5DK1A 1ARCA 4A1TA 3HK3B 4BAMB 3PB1E 2D1JA 1D4PB 1V2LT 2ANYA 3NWUA 2ZDKA 1HUTH 4LZ1H 1FUJA 2GV7A 7KMEH 1GJ9B 2A4OA 4JMYA 6LPRA 1ANEA 3IITA