1O34A

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o34A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o34A02
5EW1H 2O8LA 2A7HA 2FM2A 7GCHF 4ABDA 2G5NA 3HK6B 1MCVA 1CGIE 1ZGVA 2H5CA 3BIUH 4FUEA 1CT0E 4FUBA 1LVOA 1O2RA 3OY5U 1RGQA 2F9BH 1QQ4A 1N8OC 2BX4A 1GBJA 2UWOA 1AIXH 1HFDA 3DHKH 6CHAB 2AGGX 4D8NA 2A45B 3GDSA 2VIWA 2BQWB 4THNH 5CMXH 1C4V2 1DUEA 1J17T 1O3FA 3RLYH 2WYGA 1O3NA 4FU7A 3OU0A 5AFZH 1P3CA 1JWTA 2VIPA 4FUIA 1NTPA 1ZSKA 1W7XH 1TNLA 4U01A 2FOHA 3VFEA 1UK4A 3T27A 3PROA 3RXQA 1FAKH 3SJ8A 1C5WB 1EB1H 1NPMA 2ZFPH 4ZAEA 2JETB 3NPSA 2THFB 1AB9C 1V2JT 1JMOH 1GMHF 2ZIQH 4Y11E 3PO1B 2IPHA 3ENSB 4MNYA 2BDHA 4GVUA 1VITG 1BB0B 5EGMA 4GPGA 4U2WA 5EXNA 3PM3A 4VGCB 1TPAE 2VU8E 3GCTF 3MHWU 5GDSH 4MPVA 2BZAA 1SGFA 1CA0B 4B71A 3EQ0H 2GVFA 1GDQA 1ZYOA 2WPJS 1OSSA 4AGKA 2BHGA 3AW1A 3A86A 1MD8A 5T6DA 2A32A 3VPKA 2Z94A 2FP7B 1P03A 2J2UA 2ZHEH 1OP0A 1BCUH 1CBWB 1IOEA 1CSOE 1BMNH 1D3QB 1XVMA 1W13U 3TJVA 2XYAA 2YOLA 1GBEA 1GI2A 5EXMA 3FFGA 1C2MA 5DP5A 5TJXA 1FY3A 1XUFA 2R3UA 4YLUA 3QUMP 1VJ9U 4XFQA 2OC0A 3K6ZA 2FODA 2PV9B 4ABJA 1P05A 4SGAE 1AMHA 1NRQH 5GCHF 1UTNA 1FN8A 3OTJE 1MTNB 1HAPH 5LH8A 3VB5A 2HWLB 3RDZA 3TNTA 1HV7A 1SGPE 1MTVA 1QJ1B 1G32B 1LHCH 1XXDA 3D65E 2TPIZ 1DSUA 2BYAX 2W3IA 1ELVA 2FI3E 2GDDA 2AGIX 3UTUH 1F0RA 3SUEA 1V3XA 1TOMH 3LGVA 1ZHPA 4IC6A 2FI4E 4LK4A 4DW2U 1Y3VA 1BTUA 2DE9A 2HVXA 3BN9A 1V2OT 1SGQE 3NK8A 4OS4A 4ABGA 1B7XB 3EGKH 4MNWA 1TA2A 4DGJA 4TPYA 1O2YA 2VWNA 2G55A 5EQRA 3HGNA 1SGFG 3M36A 4WMDA 1UMAH 1ZMNA 1HGTH 4A7IB 4WXVA 1A1RA 1H9LB 3QDZB 1UCYE 1VITH 4CRAA 1NY22 3HPTB 1J8AA 1C2LA 4JYTA 2HOBA 1DUAA 5CHAC 3U98H 3ATIA 5FPSA 1C2EA 2EI8A 2A7CA 5DP3A 1QB9A 4UEHH 1O32A 2LNCA 2BXUH 1TFXA 3M3SA 1DICA 1EQ9A 3P95A 1HAOH 1QRWA 3GY5A 3KL6A 2XBYA 2H9HA 2ZDAH 7GCHG 2QA9E 4B2CA 1SGDE 3SN8A 3RC6A 1BDAA 3RXOA 1SG8B 3U8TH 3UY9A 1DLEA 3SORA 1T4VH 2B8OH 1IQLA 1BJUA 1KIGH 1P12E 3TH2H 4BANB 3TGIE 4MNXA 1P57B 2IOTA 2UUJB 1O2XA 7KMEH 3Q3XA 5I46H 1EJNA 1YPJH 1GBMA 1A3BH 2FOGA 1RTLA 5T6GA 3SJOA 3UUZA 1TMTH 3PYHA 1UTPA 1AHTH 3SHCH 1G3DA 3MMGA 4IN1A 3RM0H 3LIWA 1O3KA 2WUBA 3Q76A 4AB9A 3HKJB 5A0BA 1V2LT 1CO7E 3IITA 5GPIB 1ZPCA 3Q3KA 3BV9B 2A5KA 2GMTC 1S85A 4NIVA 1UTKA 3ZZ9A 1IHTH 5T6FA 5F8ZA 3VGCB 1HIAA 3PLKA 4X1SU 4CBOA 4YLQH 3RMNH 3ZZAA 1LKBA 2ZG0H 5LPFA 2QXGA 1EX3A 3LDXH 3UR9A 1GMHG 2D1JA 1SLVB 4AX9H 1UVSH 3A85A 1SPJA 1MKWK 2Q6GA 4FVDA 1FZZA 1W7GH 1C5YB 3GICB 3S0NA 4ZKNU 3NUMA 3B23B 3M5LA 2GTBA 3LGUA 2PGQB 4I31A 3ZZ3A 3NKKA 3UFAA 4B73A 1GJ4H 2P3UB 1IQKA 2WPIS 3BTDE 4A6LA 3A80A 5I25A 1A0HB 1GJDB 2ZHDA 3E90B 2FO9A 3IWMA 3UQOA 4H42U 3URDA 1A0LA 1HPGA 1O35A 3GY7A 3L3TA 1S0RA 1V2UT 2BLWA 3ATMA 2NU2E 1MBQA 1KTTB 1C2DA 3MNXA 1O39A 2HNTE 1O3AA 5FPYA 2PWXA 1GI4A 1A5IA 6GCHG 3ZZBA 1KSNA 1HJAC 2B9LA 1VZQH 1ETRH 1SOTA 2GX4A 5A0AE 4K1TA 1A46H 3S7KB 5GCHG 1O3GA 2WINI 1BBRK 2WYJA 3HATH 1Z8RA 3WY8A 1ANBA 1O3HA 3N7OA 1SI5H 1BITA 1FJSA 1HAZB 5F8XA 1OP2A 2UUFB 4DURA 3SU6A 1ZHRA 1EASA 1KLIH 1EZXC 1ETTH 5JBBS 1AO5A 1FMGA 2A31A 1O2GH 3DT0H 2ZGCA 5HM9A 1YPHE 1NS3A 4MTBA 1CHOF 1AN1E 1O2WA 3A88A 5C67A 4X1NU 1KXCA 1YPLH 2CHAB 1ACBE 1C2JA 4AYVB 6LPRA 2W7UA 1QCPA 1GI3A 4I33A 1YCPM 5G4BA 2ZTXA 4TWWA 3UR6A 1A5HA 5E0JA 4NZQA 5IYTA 5C5NA 3U1IB 3SGBE 3K6YA 4QT8C 2P3TB 1AFEH 1ARBA 2AS9A 1C5SA 5IDKA 1HNEE 3RMOH 9ESTA 4JK5A 1GHZA 3ODDA 4BAOB 1SGNE 1OWJA 3M3TA 2CN0H 1M9UA 3VB4A 1SL3A 2BDYA 1QRZA 1OYTH 3ZVAA 3RXPA 1FPHH 2ZU2A 1HUTH 4NGAH 2ZPRA 4ZXYH 2GCTB 1NC6A 4INHA 1FV9A 4BOHA 1O3OA 2PKAA 5DP6A 2AMDA 2FTMA 1OWKA 2AYWA 5C2ZA 1YCPK 1UK3A 2O8UA 2JETC 2PFEA 1FY1A 2BD3A 1C1SA 2I6QA 2QF0A 1TMUH 1UO6A 2V3HH 2FOCA 1FN6A 5C1XA 1BRBE 1W3CA 2STBE 3PO1C 5AFYH 1SGTA 3SV9A 1O38A 1YF4A 3P8NA 4JK6A 2ZU4A 4DOQA 3B9FH 1NM6A 3RXHA 5EW2H 2Q1JA 1FPCH 5ESBA 4Y7BA 1F5RA 1YPMH 1TWXB 2BD5A 1EP6A 2H5DA 1CGJE 4VGCC 3GYMA 2EI7A 2FYRA 1MU8B 1NROH 2GKVE 1AE8H 3SQHE 3LKWA 3RXRA 2BZ6H 1QY6A 4FUCA 1CA0C 2J38A 3K65B 2NU3E 1AI8H 1AKSA 4NA8A 1V2NT 1Y5UT 3T29A 1QL9A 1GPZA 2FX4A 4HZHA 2ZPSA 3ZYDA 1O0DH 4B74A 4D9QA 1O5DH 1KXBA 3KHVA 3QWCH 1TB6H 1Q3XA 1DANH 1T7CA 1FXYA 2F9NA 4IN2A 5EQQA 1SGCA 4Y7AA 1ZOMA 1O2LA 1O36A 3I78A 4DVAU 2BQ6B 1C5TA 2BY7X 5J4SA 2OQ5A 1P04A 2ASUB 1THRH 3Q3YA 1TPSA 1V2MT 2AMPA 2A2QH 1TALA 1HXFH 3AW0A 2PUXB 2ZTZA 4XDEA 1IQIA 3T26A 1J14A 1DXPA 1YM0A 3A82A 3KQBA 2AMQA 2BY9X 1GBTA 1L4DA 2CV3A 4MLFB 2ZCKP 1LQEA 3TJUA 2AERH 1W14U 1LHDH 4ABHA 5E0HA 2FESH 1EUFA 1OWDA 2FXRA 4WH6A 3RXCA 5FCKA 2VH0A 2SGFE 1F5KU 4YZUA 5T3HA 1K9OE 1O2QA 3EDXB 2QIQA 5AHGH 5A0CA 5EQSA 2CMYA 3TH3H 3E0NB 3ZVBA 2SGEE 1FUJA 2Z9JA 1TONA 1TBQH 3M7QA 2ZHQH 4NSYA 1K1PA 1TYNA 1ZGIA 3AAUA 2QAAA 1FIZA 4AORA 3MH5A 1LVYA 5EPNA 3F68H 4CHAC 2J94A 2FS8A 2VIQA 1E34B 4SGBE 1BTZA 4K60A 1ELDE 1GVKB 1DWEH 4CH2B 1GBBA 1LO6A 1C1WH 3RMLH 4Y10E 1X7AC 1GBLA 1SQAA 2OQUA 3A81A 2Y5HA 1ANEA 3PV4A 1LPZB 1QA7A 2C90B 2FZZA 1IQNA 1P11E 1O5AB 2FYQA 2ZGJA 5JYIA 2KAIB 1CHGA 1QL8A 5E2OA 1CHOG 1EAXA 3MWIU 3I77A 2PKSC 4ABBA 1GI6A 4GHTA 4UFGH 1BZXE 1XMNB 1IQHA 4I8GA 4BNRA 4HGCA 1QIXB 3S9AA 2PTNA 3P92A 3ZV8A 4F49A 2ZKSA 1A61H 1N6YA 1TBZH 5A09A 2XC4A 1P2IA 1OXGA 1MKXK 1MTSA 2Z9LA 4K69A 1ZZZA 2RA0A 4J2YB 3UREA 1N1LA 2FIRH 1INCA 4CRCA 4TYDA 1O3BA 1V2ST 1G3CA 3A87A 3SU0A 1MQ5A 1DX5M 2GP9B 1IQMA 3GY2A 3RXAA 1JIRA 2VGCB 4KTUA 3PLPA 4LOYH 4HTCH 2BM2A 2BDGA 8KME2 3MU4A 3EE0B 3VGCC 2UUYA 1HAYB 4PROA 4K5ZA 2SGDE 2TGPZ 3QTVH 2LPRA 3GCNA 4RN6A 1OWEA 1TE0A 3PLBA 2QY0B 2FTLE 1FI8A 1O2TA 5F6MA 2AH4X 1GI5A 1W10U 1VR1H 1ZTLA 2FX6A 1ESAA 1PQ8A 5BRRE 1C1OA 2FLBH 1AU8A 1P10A 2ODYB 5E2PA 1IQGA 1SR5C 3RXMA 2C93B 4NG9H 4NWKA 1K22H 3F1SB 5L2YH 5EPYA 3SHAH 1GG6C 1H9IE 1P2NA 1SLWB 3VB6A 1FAXA 4X8TH 4DT7B 1O37A 1S6HA 4K8BA 1F0SA 2ANMH 2A0QB 1XVOA 3UIRA 1WV7H 2Q6FA 1UCYK 1XUJA 2FOFA 3BEUA 2VJ1A 1P9SA 3UNRA 1EPTB 1IQEA 1H1BA 1VGCB 3SUGA 1HBTH 1GBCA 3RU4E 1FNIA 5EU8A 4Y79A 4ZUHA 1P2QA 2XXLA 4JYUH 5JBAS 3EA7A 2W3KA 1O2ZA 1GWAA 1DY8A 1GHWH 1P0SH 4Q7XA 1GHAF 2PGBB 1UVTH 2VVVA 2ZGBH 1KLJH 2XW9A 4JZEH 1ZR0A 4OS1A 4FUFA 1C5ZB 2A5AA 4R8TB 1O2VA 1GBAA 4H6SB 1P2JA 3FVFB 3GDVA 4XSKU 1QJ6B 1K1IA 1SMFE 4XBCA 1IAUA 3BG8A 5LGOA 4H6TA 4MPWA 1PQAA 4X8UH 1MKWH 2YNBA 2QN5T 3KQDA 1K2I1 3VB7A 1AQ7A 1BRCE 3QN7A 2H2ZA 5C1UA 1PJPA 3O8BA 4I8LA 3TK5A 1GJ8B 2GDEH 5EG4A 1DWDH 2P3FH 1RRKA 4ABEA 3A8DA 4JMYA 3QX5H 1ZMLA 3F9HA 3GYLB 1C4Y2 2HPPH 3NZIA 4AG2A 1BTXA 1O30A 1GGDB 3JZ2B 1MTUA 3IG6B 1B0EA 4Q2KA 4BAHB 2NU4E 1O2OA 2O8WA 5FAHA 1AUTC 3AAVA 2PR3A 1C2GA 2W5EA 4OS7A 3FAOA 4A1XA 1S0QA 1WCZA 7LPRA 4GLYA 1EKBB 2QYIA 1G30B 4ZMAH 3LU9B 1IHSH 5B6OA 1LKAA 4YO9A 2G00A 1THPB 3LGIA 1Y3WA 4MPXA 5E8EH 1PPEE 2Z3EA 2WV4A 1TPOA 3BTHE 1DITH 4UDWH 4DG4A 3VEQB 3V0XA 1BTWA 4H4FA 3RLWH 4A92A 1NRPH 4IW4E 3A89A 3QK1A 4CBNA 1B5GH 1TQ0B 1D6RA 1GBFA 5K7RA 2V6NA 3VXFH 3TITA 1AGJA 3CS7A 6ESTA 3D49H 3A7TA 1AVGH 2VIOA 1C1QA 1H4WA 2VWLA 5FX6A 1J16A 1G2LA 1HRTH 2RG3A 3S7HB 2ZU1A 2ZDKA 3AASA 3F9GA 1EP5A 4X6MA 1SGYE 4NSVA 4BAQB 3EA8A 4O03A 3HKIB 3RXEA 1KLTA 4NIWA 2R0LA 5JBTA 3LJJA 4IGDA 3FZDA 2ZWLH 4NFFA 1A7SA 1GBKA 1HAHH 2FOBA 1WYKA 3GOVB 4Q7ZA 1ZTJA 3BTME 1H8DH 1ZPZA 3KCGH 1UVUH 5GWZA 3MO9A 2EC9H 3DD2H 4RKOB 4MDSA 1QNJA 2V35A 1DPOA 2VWMA 4DIIH 2OC7A 1TPPA 5F03A 2NU0E 1MH0A 1B0FA 2ANKH 1O3CA 3LT3A 3ODFA 2FS9A 1AUJA 4CRDA 1SLXB 1SLUB 4UE7H 2Y5GA 5JB8S 4O97A 1PPGE 2WPMS 3PB1E 4NIXA 1AZZA 1Z8IB 3SJ9A 2C8XB 1DLKB 2ZF0H 3MFJA 1AY6H 1GI7B 1NU7B 1W0ZU 2ZFRH 1N8OB 4RKJB 1WTHD 3T25A 4ABFA 4BTUB 1XUIA 2FPZA 4NCYA 3BTKE 3U8OH 3RXIA 3GCTG 1N6XA 2HALA 3RU4T 3MTYA 4D76A 3TJNA 2XBWA 1EZUC 1YPKH 1C2KA 1KXEA 3E91A 2ZHFH 1LVMA 1ZPBA 1A4WH 1MAXA 2R3YA 1CT4E 1G2MA 3U8RH 3ZVEA 1MBMA 3LJOA 2BY5X 2O8MA 1TQ7B 4FXGH 1EB2A 1W2KH 4DCDA 4YOIA 1CGHA 3G01A 1GHYH 2ZCHP 1P2KA 4O3UA 1TRNA 2PTCE 5E0GA 1LHFH 4E06H 2P59A 2ZNKH 3I29A 4X1RU 3T2NA 4DJZB 1O33A 2VWOA 1QBOA 4UFDH 3SU2A 2HNTF 1TOCB 4ZXXH 2OD3B 1Z1JA 1Q31A 1XKAC 1OWHA 1C5XB 1SGEE 3TH4H 2JKHA 4ZKOU 2O8TA 3UPEA 3RC4A 3OSYA 1Z71A 4I32A 3SV6A 2XRCA 3E3TA 1ELBA 1Z8JB 2Z6BD 1G36A 2ZPQA 3RXDA 4O9VA 2Y80A 1YYY1 1O31A 1BTYA 2ZA5A 4AFSA 3SI4H 1O3PB 2DUCA 1EJAA 2A4QA 2HGTH 2SGQE 2TGTA 2ZP0H 2A5IA 1GCTB 3L33A 2OBOA 2GD4B 2CXVA 4X6PA 4ASHA 1Y5BT 2BD9A 2WV5A 3U69H 3KQEA 2BLVA 6CHAC 2C8WB 4XBBA 2F9OA 3SNBA 1EAIA 4KKDA 1F0TA 2JH5D 4I8KA 2H1UA 1TNGA 4CH8B 4Y71A 5FBIA 4I7YH 3AVZA 1LPKB 3MO3A 2ALPA 4NZLA 1NFXA 1OX1A 1ESTA 4Z0KA 1ZRKA 4X6OA 1ELTA 3A83A 1TMBH 2BD7A 1GJ6A 3KEEA 2J92A 4UD9H 4WF8A 1JRTA 4KP0A 1GI9B 2ZO3H 3ZZCA 1FONA 1V2TT 3E0PB 1C5RA 1KDQB 4I8JA 1WQSA 4OS5A 1NFYA 2QGRA 4I8HA 1XM1A 2TBSA 4AN7A 4CRGA 1TGCA 3W94A 1GBHA 3MNSA 3SU3A 1C5LH 1O2UA 1EPTC 1UTOA 1GMCF 1GI8B 2NWNA 4UONA 2G5VA 2AEIH 1HJ9A 1MQ6A 4BXWA 1CT2E 1MKXH 1PPHE 1K1MA 3EA9A 3F9EA 1C1UH 5LPEA 1MTWA 3KN2A 3T62A 1PPBH 2ZU3A 1GHBF 3ITIA 2QXIA 1GL1A 2ZFTA 2Z3CA 1SQTA 5GXPA 5CHAB 3LOXA 4A1VA 4E05H 4GCHF 2BLOA 3RM2H 2KAIA 1V2WT 3A7YA 1LTOA 1ZJDA 3PMAB 2UWLA 3M7TA 2AIQA 3M35A 4BTIB 2SNWA 3PMJA 4Y8XA 2PUQH 1MMJN 3RXTA 1BMMH 1CBWC 1LCYA 4LZ4B 1HDTH 1OPHB 1Y5AT 1AVXA 5TCAA 3SV8A 5ABWA 5ETXA 2FLRH 1DOJA 2ZDLA 1FY4A 1QB1A 3MU5A 1ZSLA 1GBDA 4OS6A 3SNAA 4FUGA 3DUXH 1IQFA 2ZGHA 2XBVA 4K2YA 4WMFA 2OBQA 2ZFQH 1YGCH 4X6NA 1QRXA 3TJOA 1NRNH 1BTHH 4ZHAA 2J34A 5A2MH 5GIBA 2QXHA 1FLEE 1NO9H 2SGPE 4D9RA 1L0ZA 3PTBA 1NN6A 2YNAA 1MTNC 2XBXA 3BIVH 1C1PA 1UTJA 4XOJA 3DFLA 1DT2A 1O3EA 3MH4A 1UCYH 1SHYA 1WTGH 4FVBA 3P8GA 3PWBA 4AB8A 3Q00A 2ZDVH 4INLA 3PWCA 3V12A 1DM4B 5JPMH 2GMTB 4J1YA 1TIOA 5DP4A 1QURH 2OCVB 4JCNA 1L1JA 4Y8ZA 1S82A 2XCNA 1A5GH 3GDUA 1AZ8A 1Z6EA 4X8VH 3PMBB 2Y7ZA 2BTCE 1GI0A 5DKMA 1F0UA 4NWLA 4KTCA 3CENA 2ALVA 3QGNB 1RJXB 5C1YA 3RP2A 3SU4A 1FIWA 3C1KA 3ZVDA 2Z7FE 4IMZA 5FXLA 4XBDA 5A8XA 2TGDA 4YM9A 4WWYA 4E7NA 1WAYB 2BXTH 1AE5A 3TU7H 3SU1A 1XUGA 2ZDMA 1BIOA 3E16B 3QZQA 2P16A 1V2KT 1C5PA 1T31A 3R0FA 1BRAA 1SFIA 3L6PA 4X1PU 1WBGB 1EPTA 3OX7U 1GMDF 4KGAA 1L2EA 1W11U 2A1DB 2Y82A 1GDUA 1DDJA 1PYTD 2C8ZB 2FOAA 2IN2A 1AWHB 4AFUA 3QLPH 4GAWA 1G3BA 2GZ8A 2PSYA 1ARCA 1MAYA 1F92A 1ZLRA 3ZZ7A 1PPFE 1V2VT 5DP8A 3V3MA 2QXJA 8ESTE 2TRMA 1HJAB 2ZDNA 1EAWA 2NU1E 1FDPA 1RTFB 3ZVFA 3O8DA 1KXFA 3LH1A 3EYDA 3LPRA 2SFAA 4TY6A 4X2WA 2G81E 1S5SA 1TGBA 2J95A 2GZ7A 4NIYA 5LPRA 1IQJA 5DPAA 4Y8YA 1Z1IA 3M61U 1XKBC 1SVPA 2C4FH 2Q6DA 2BX3A 1VJAU 2Y81A 2ODQA 3M5NA 3SW2B 4K8YA 1A3EH 4Y0ZE 1AVWA 4ESTE 1HLTH 5DP7A 1L1GA 3RU4D 3E6PH 5JBCS 2J9NA 3S9BA 2JH0D 1JBUH 5HM2A 3P6ZB 4ABIA 2RA3A 1VCPA 2VINA 4LZ1H 3STIA 3MOCA 4A5TS 1EXFA 1J15A 1HAVB 1EZSC 2WUCA 4CRBA 3TK9A 4BTTB 1SQOA 5F8TA 1O2PA 1UTLM 1P8VC 1O5CB 1GMCG 2BVSH 1GBIA 1SFQB 2ZQ2A 3RUOA 1D3PB 1P06A 3P17H 2F9VA 3BSQA 4OGXA 4A1TA 1GI1A 1TRYA 3ELAH 3P8FA 4K3JA 1GHBG 4X1QU 3NWUA 2UWPA 3BTFE 1MCTA 2EEKA 4AYYB 1SGIB 4AFQA 1GCDA 2Z9KA 1ESBA 2STAE 3H7OA 2P8OB 1CE5A 1NRRH 4GCHG 1TX6A 3RXKA 1OP8A 4X0WU 1BOQA 1O2IA 1RIWB 1P3EA 2A4RA 2A2XH 2HLCA 1KXDA 1ELEE 1TX7A 4ISHH 2ZEBA 1TAWA 1NESE 2F3CE 1EZQA 2GGVB 2Y5FA 2R2WU 4U32A 5EOKA 2R9PA 3RMMH 1P02A 2A7JA 2PLXA 4Z6AH 1QA0A 1GJAB 1D3DB 1MU6B 1HAXB 4GUXA 1SHHB 2FDAA 3NCLA 1RXPA 1GJ9B 4ISOA 3TGJE 1O5FH 1C1VH 3B8JA 1D6WA 1ELAA 1ANCA 3W95A 1S84A 2BDAA 2JH6D 3A84A 1FY8E 3LC3A 4CR9A 1NT1A 1V2QT 2ZU5A 1ZHMA 2R0KA 1P9UA 3K2UA 4B2BA 5J4QA 3O8CA 1F2SE 1GJCB 1SC8U 2V3OH 1SGRE 3ZVGA 3RXUA 2CGAA 4U30A 1C4U2 3U9AH 2BDBA 1ZRBA 2DE8A 1TGTA 5FX5A 2BDCA 2Z9IA 3LC5A 3UNSA 1UHBB 1DWCH 2VIDA 3ESTA 4LXBH 1SB1H 3GCHB 2OINA 5EODA 4Y0YE 2XCFA 2BVRH 1GVLA 1F7ZA 5DJ7A 1WOFA 2FEQH 3M5OA 1D4PB 1BT7A 4X8SH 1QQUA 4YOJA 1GCTC 3U1JB 2UUKB 5JDUB 1C2HA 2D8WA 2BDIA 8GCHF 1CU1A 1ANDA 1QR3E 3HGPA 2CHAC 2WPLS 4ISNA 3CP7A 1L1NA 6GCHF 1UJ1A 1TGNA 1W0YH 4B2AA 2GV7A 3A7VA 1O34A 3TLOA 3GCOA 2BLQA 2FOMB 3SNEA 1DVAH 2BD4A 2ZGXH 4MPUA 1UVOA 4TPIZ 1G37A 2BD8A 4IBLH 4YT6H 1QB6A 2ESTE 3M5MA 1TRMA 1YPGH 3P70B 1Y8TA 3QO6A 3T5FH 5ESTE 1E38B 2AGEX 3SNCA 4ZKSU 3H5CB 1TNIA 4WVPE 3MU1A 3GY4A 1GMDG 3MNCA 1BBRH 4E7RG 1YLDA 4WH8A 1C5UA 2FWWA 2CF8H 2GCTC 3GY3A 1AD8H 3M3VA 2QCYA 5CE1A 1YPEH 2ANYA 4MVNA 1GL0E 1E37B 2TGAA 2Y7XA 2XTTB 1RS0A 1JIMA 4CHAB 1KY9A 4OS2A 3SJKA 2VB0A 3QZRA 4TWYA 4K1SA 2F9PA 2XNIA 1F5LA 1EAUA 1NRSH 1BHXB 3BEFB 1XX9A 9LPRA 3BG4B 1QGFA 4B1TA 1LQDB 1SSXA 1O2SA 3MU0A 4GHQA 2XWBI 4KELA 1UVPA 4AZ2B 1ELGA 1T8MA 1DFPA 3SV7A 3RXGA 3DA9B 1QBVH 1GVZA 4FU9A 3SBKA 1TA6A 1SBWA 2PHBA 3MNBA 4MQAA 1ZMJA 1C5VA 3BF6H 2PKSB 1C5QA 1K1NA 2BY8X 1C9TA 1G9IE 2OLGA 3TGKE 1O3JA 3KNXA 2SNVA 1TGSZ 2H6MA 2VVCA 1O3DA 1RTKA 2ZFSA 1NZQH 1AFQB 2A4OA 3SZNA 1P09A 4JZDH 1AWFH 1P2MA 1PFXC 3MU8A 1T8LA 3UOPA 1O5EH 1YCPH 2QC2A 2B7DH 1UK2A 1GDNA 3S9CA 1Z7KA 2WPHS 1Y3UA 3KQCA 2H9TH 1Z6JH 3TNSA 2GT7A 1KTSB 1H9HE 2W26A 3SQEE 4YT7H 5JB9S 1C1NA 2ANWA 2BY6X 4YTAA 4ZROA 5HXFA 3MI4A 1K21H 1T8OA 1GHXH 1GJBB 1NFUA 1O5BB 5HYOA 1RFNA 2CJIA 4DY7B 3LH3A 3FP6E 1LHGH 2BVXH 3ATWA 3R3GB 3RXFA 4AG1A 3SNDA 4JZ1A 3ZVCA 5GJ4B 3BTEE 4OGYA 1GHAG 1HYLA 2TIOA 2ULLA 2FOEA 4F4OC 2PW8H 2V0BA 3FZZA 1JXPA 4HI3A 1JOUB 1MUEB 5C5OA 1C1TA 1PPZA 2G52A 2BD2A 5AVDA 4CREA 2ZQ1A 1OKXA 1GG6B 1LHEH 3SJIA 1KDQA 1S6FA 1HAIH 3JZ1B 2HNTC 2P94A 5SGAE 1E35B 3LGTA 1CA8B 5HGGA 1TNKA 3F9FA 2F9UA 2GCHF 2G8TA 1AB9B 2RCEA 3DFJA 5C20A 2FMJA 5DO4H 3QTOH 3ATLA 2F91A 1O3LA 3RXLA 4IMQA 3CS0A 1PPCE 3OYPA 1C1MA 5FCRA 1LDTT 1C2FA 2BQ7B 2HPQH 3MH7A 3QGJA 2A4GA 4JZIA 1JRSA 1W12U 8GCHG 1O2JA 1QJ7B 3A7XA 1FY5A 1O5GH 5FHTA 3M7UA 1C1RA 4M7GA 3KF2A 3BTQE 4MG3A 3SUDA 4YOGA 5DK1A 1P01A 2QV1A 8LPRA 3D62A 3SGQE 3ATKA 1A0JA 1O2HA 2VNTA 3SO3A 5FPTA 1YPHC 1YP9A 2J4IA 3MYWA 4RSPA 1ELFA 3TVJB 2BOKA 2VVUA 2ZHWH 2XC0A 4CRFA 3A8BA 1GJ7B 1TBRH 4WXIA 1BQYA 1C5NH 3H7TA 1LPGB 4D7GA 5DG6A 4R0IA 1QFKH 1OS8A 2VGCC 2RDLA 2EI6A 1E0FD 1K1JA 1O2KA 2VH6A 1V2PT 4IC5A 1Q2WA 4WY3A 2CF9H 3UNQA 1WU1A 3GY6A 1O2MA 1J9CH 1A2CH 1HIAB 3ZZDA 3FP8E 5FBEA 3TIUA 2Z3DA 4YESB 4CR5A 1ABJH 4O3TA 4UFEH 1EOLA 1THSH 1C9PA 3EAJA 1DY9A 3UQVA 1D9IA 4FUDA 1VCQA 1C5MD 4DIHH 1UTQA 1W8BH 1XXFA 3ZV9A 5L6NH 1TX8A 3VB3A 1ELCA 4AGJA 2FI5E 3UOUA 1LVBA 1MD7A 2GV6A 1K28D 2IJOB 4INKA 1ZSJA 4NFEA 1YLCA 2AIPA 3LONA 2G4TA 3HK3B 5EXLA 3NXPA 1WSSH 2P8OC 2BMGB 3LGWA 4GSOA 1Y3YA 4AFZA 2EA3A 4IS5A 3KIDU 2W7SA 2P93A 1RIWC 2H9EH 1VGCC 3ZZ8A 3SU5A 3E1XB 1BMAA 4FU8A 2AFQB 2B0FA 1P2OA 5K0HA 1ORFA 4XE4A 2ZCLP 2C8YB 1H8IH 1QBNA 1U6QA 3VXEH 3ZZ5A 2C3SA 1TNJA 1TABE 5A8ZA 1YBWA 4Q7YA 4FUHA 3BTWE 4ISLA 3RXSA 1PQ7A 3K9XB 3A7ZA 2HRVA 1DS2E 1SOZA 1O3IA 1HJ8A 2D2DA 2OTVA 3SI3H 2ZI2H 1BA8B 2G4UA 1V2RT 1LMWB 3GISB 2OP9A 1O3MA 2P95A 4TY7A 1K1LA 3Q77A 2ZTYA 2XC5A 4Y76A 4BAMB 1CVWH 1T32A 2Y6TA 1EJMA 2PSXA 4ZHMU 4ZHLU 1DWBH 1WQVH 1XUKA 2ZECA 1BBRE 3E8LA 1WUNH 1UTMA 1C5OH 1TLDA 1G3EA 5A8YA 2WPKS 4Q80A 3MH6A 2VIVA 1KYNA 2F83A 1HCGA 3T28A 3GCHC 1VITF 1EOJA 3FANA 3A8AA 2ZZUH 2K1QA 1DXWA 1L4ZA 1VCWA 2SGAA 4ZH8A 1ID5H 2ODPA 1BRUP 3V7TA 1GJ5H 4HFPB 1OOKB 1D3TB 3BTTE 3RC5A 3LGYA 1NU9A 1OWIA 1GGDC 4B75A 1YKTA 3SOSA 1ABIH 3F6UH 3MO6A 7ESTE 4NA7A 3C27B 3UWJH 1MZAA 3D23A 4K1EA 1XUHA 4WMEA 2OUAA 1QHRB 1ZTKA 3TPIZ 2OC1A 1HAGE 1CQQA 4BXSA 2GT8A 1DE7H 4ABAA 1K1OA 4MNVA 1NFWA 3FP7E 1KXAA 2D26C 5C3NA 4X2YA 2GCHG 1HAVA 3ZZ4A 1Y59T 1S81A 2Z9GA 4D7FA 5PTPA 3PTNA 1HB0B 4UFFH 1BUIA 1Z8GA 3RXBA 1V6DA 1PQ5A 1QTFA 2BB4A 2XWAA 3PMHB 4B76A 5BPEA 2ILNA 3SV2H 3ZZ6A 2PKAB 3SGAE 3S69A 1BMLA 2OXSA 2M5TA 1BJVA 5DGJA 2I6SA 3STJA 3O8RA 5AF9H 4ISIH 5DP9A 1MZDA 1O2NA 4X2VA 1S83A 4X2XA 1DSTA 1FQ3A 1Y3XA 2O9QA 1OYQA 2ZFFH 1YC0A 2ZC9H 1ZJKA 1ETSH 4KTSA 3BG4C 2B5TB 1BTPA 1BHXF 5L30H 4AOQA 3V13A 1QL7A 1T4UH 1C2IA 1RD3B 3KGPA 2G51A 5H4IB 4BAKB 3GY8A 1AKSB 2QF3A 2R2MB 4Y6DA 1GHVH 4ZKRU 3M37A 4JZFH 1EATA 5HMAA 5L2ZH 1TNHA 3OY6U 3P8OA 3A7WA 1T8NA 3URCA 3A8CA 4JYVH 3UWIA 3ZYEA 2OC8A 3RXJA 3BEIB 3TK6A 3RXVA 1HXEH 2GZ9A 4NA9H 4WJG2 1E36B 1PYTC 3BTGE 3SUFA 4FUJA 5TCCA 1UHBA 1AFQC 2BOHB
chains in the Genus database with same CATH superfamily
5EW1H 2O8LA 2A7HA 2FM2A 7GCHF 4ABDA 2G5NA 3HK6B 1MCVA 1CGIE 1ZGVA 2H5CA 4HG6A 3BIUH 4FUEA 1CT0E 4FUBA 1LVOA 1O2RA 3OY5U 1RGQA 2F9BH 1QQ4A 2GJGA 1N8OC 2BX4A 1GBJA 2UWOA 1AIXH 1HFDA 3DHKH 6CHAB 2AGGX 4D8NA 2A45B 3GDSA 2VIWA 2BQWB 4THNH 5CMXH 1C4V2 1DUEA 1J17T 1O3FA 3RLYH 2WYGA 1O3NA 2LP6A 4FU7A 3OU0A 3DSOA 5AFZH 1P3CA 1JWTA 2VIPA 4FUIA 1NTPA 1ZSKA 1W7XH 1TNLA 5CHBA 4U01A 2FOHA 3VFEA 1UK4A 3T27A 3PROA 3RXQA 1FAKH 3SJ8A 1C5WB 1EB1H 3OFND 1NPMA 2ZFPH 4ZAEA 2JETB 3NPSA 2THFB 1AB9C 1V2JT 1JMOH 1GMHF 2ZIQH 4Y11E 3PO1B 2IPHA 3ENSB 4MNYA 2BDHA 4GVUA 2CK3D 1VITG 1BB0B 5EGMA 4GPGA 4U2WA 5EXNA 3PM3A 4VGCB 1TPAE 2VU8E 3GCTF 3MHWU 5GDSH 4MPVA 2BZAA 3KQ5A 3SZEA 1SGFA 5C0TA 1CA0B 4B71A 1QZ8A 3DSGA 3EQ0H 2GVFA 1GDQA 1ZYOA 2WPJS 1OSSA 1YLNA 4AGKA 2BHGA 3AW1A 3A86A 2EY4C 1MD8A 5T6DA 2A32A 3VPKA 2Z94A 2FP7B 1P03A 2J2UA 2ZHEH 1OP0A 1BCUH 4P02A 1CBWB 1IOEA 1CSOE 1BMNH 1D3QB 1XVMA 1W13U 3TJVA 2XYAA 2YOLA 2M2AA 1GBEA 1GI2A 5EXMA 3FFGA 1C2MA 5DP5A 5TJXA 1FY3A 1XUFA 2R3UA 4YLUA 3QUMP 1VJ9U 4XFQA 2OC0A 3K6ZA 2FODA 2RFKC 2PV9B 4ABJA 1P05A 4SGAE 1AMHA 1NRQH 5GCHF 1UTNA 1FN8A 3OTJE 1MTNB 1HAPH 5LH8A 3VB5A 2HWLB 3RDZA 3TNTA 2XNDD 1HV7A 1SGPE 1MTVA 1QJ1B 1G32B 1LHCH 4TSFD 1XXDA 3D65E 2TPIZ 1DSUA 2BYAX 2W3IA 1ELVA 2FI3E 2GDDA 2AGIX 3UTUH 1F0RA 3SUEA 1V3XA 5EJZA 1TOMH 3LGVA 1ZHPA 4IC6A 2FI4E 4LK4A 4DW2U 1Y3VA 1BTUA 2DE9A 2HVXA 3BN9A 1W0KD 1V2OT 1SGQE 3NK8A 4OS4A 4ABGA 1B7XB 3EGKH 4MNWA 1TA2A 4DGJA 4TPYA 1O2YA 2VWNA 2G55A 5EQRA 3HGNA 1SGFG 3M36A 4Q4LA 4WMDA 1UMAH 1ZMNA 1HGTH 4A7IB 2KFWA 4WXVA 1A1RA 1H9LB 3QDZB 1UCYE 1VITH 4CRAA 1NY22 3HPTB 1J8AA 1C2LA 4JYTA 2HOBA 1DUAA 5CHAC 3U98H 3ATIA 5FPSA 1C2EA 2EI8A 2A7CA 5DP3A 1QB9A 4UEHH 1O32A 2LNCA 3U28C 2BXUH 1TFXA 3M3SA 1DICA 1EQ9A 3P95A 1HAOH 1QRWA 3GY5A 3KL6A 2XBYA 2H9HA 2ZDAH 7GCHG 2QA9E 4B2CA 1SGDE 3SN8A 3RC6A 1BDAA 3RXOA 1SG8B 3U8TH 3UY9A 1DLEA 3SORA 1T4VH 4TT3D 2B8OH 1IQLA 1BJUA 1KIGH 1P12E 3TH2H 4BANB 3TGIE 4MNXA 1P57B 2IOTA 2UUJB 1O2XA 7KMEH 3Q3XA 5I46H 1EJNA 1YPJH 1GBMA 1A3BH 2FOGA 1RTLA 5T6GA 3SJOA 3UUZA 1TMTH 3PYHA 1UTPA 1AHTH 3SHCH 1G3DA 3MMGA 2YMSB 4IN1A 3RM0H 3LIWA 1O3KA 2WUBA 3Q76A 4AB9A 3HKJB 5A0BA 1V2LT 1CO7E 3IITA 5GPIB 1ZPCA 2JDID 3Q3KA 1NBME 3BV9B 2A5KA 2GMTC 1S85A 4NIVA 1UTKA 3ZZ9A 1IHTH 5T6FA 1BMFD 5F8ZA 3VGCB 2F43B 1HIAA 3PLKA 4X1SU 4CBOA 4YLQH 3RMNH 3ZZAA 1LKBA 2ZG0H 5LPFA 2QXGA 1EX3A 3LDXH 3UR9A 1GMHG 2D1JA 1SLVB 4AX9H 1UVSH 3A85A 1SPJA 3SYJA 1MKWK 2Q6GA 4FVDA 1FZZA 1W7GH 1C5YB 3GICB 3S0NA 1OHHD 4ZKNU 3NUMA 3B23B 3M5LA 2GTBA 3LGUA 3FOAA 2PGQB 4I31A 3ZZ3A 3NKKA 3UFAA 4B73A 1GJ4H 2P3UB 1IQKA 2WPIS 3BTDE 4A6LA 3A80A 5I25A 1A0HB 1GJDB 2ZHDA 3E90B 2FO9A 4XD7D 3IWMA 3UQOA 4H42U 3URDA 1A0LA 1HPGA 1O35A 3GY7A 3L3TA 1S0RA 1V2UT 2BLWA 3DCLA 3ATMA 2NU2E 1MBQA 1KTTB 1C2DA 2WSSD 3MNXA 1O39A 2HNTE 1O3AA 5FPYA 2PWXA 1GI4A 1A5IA 6GCHG 3ZZBA 1KSNA 1VZQH 2B9LA 1HJAC 1ETRH 1SOTA 2GX4A 5A0AE 4K1TA 1A46H 3S7KB 5GCHG 1O3GA 2WINI 1BBRK 2WYJA 3HATH 1Z8RA 3WY8A 1ANBA 1O3HA 3MQKC 3N7OA 1SI5H 1BITA 1FJSA 1HAZB 5F8XA 1OP2A 2UUFB 4DURA 3SU6A 1ZHRA 1EASA 1KLIH 1EZXC 1ETTH 5JBBS 1AO5A 1FMGA 2A31A 1O2GH 3DT0H 2ZGCA 5HM9A 1YPHE 1NS3A 4MTBA 1CHOF 1AN1E 1O2WA 3A88A 5C67A 4X1NU 1KXCA 1YPLH 2CHAB 1ACBE 1C2JA 4AYVB 6LPRA 2W7UA 1QCPA 1GI3A 4I33A 1YCPM 5G4BA 2ZTXA 4TWWA 3UR6A 1A5HA 5E0JA 4NZQA 5IYTA 5C5NA 2W6ID 3U1IB 3SGBE 3K6YA 4QT8C 1AFEH 2P3TB 1ARBA 2AS9A 1C5SA 3FKSD 1HNEE 5IDKA 3RMOH 9ESTA 4JK5A 2KCYA 1GHZA 3ODDA 4BAOB 1SGNE 1OWJA 3M3TA 2CN0H 1M9UA 3VB4A 1SL3A 2BDYA 1QRZA 1OYTH 3ZVAA 3RXPA 1FPHH 2ZU2A 3WWBA 1HUTH 4NGAH 2ZPRA 4ZXYH 2GCTB 1NC6A 4INHA 1FV9A 4BOHA 1O3OA 2PKAA 5DP6A 2AMDA 2FTMA 1OWKA 2AYWA 5C2ZA 1YCPK 1UK3A 2O8UA 2JETC 2PFEA 1FY1A 2BD3A 1C1SA 2I6QA 2QF0A 1TMUH 1UO6A 2V3HH 2FOCA 1FN6A 5C1XA 1BRBE 1W3CA 2STBE 3PO1C 5AFYH 1SGTA 3SV9A 1O38A 1YF4A 3P8NA 4JK6A 2ZU4A 4DOQA 3B9FH 1NM6A 3RXHA 5EW2H 2Q1JA 1FPCH 5ESBA 4Y7BA 1F5RA 1YPMH 1TWXB 2BD5A 3UB0A 1EP6A 2H5DA 1CGJE 4VGCC 3GYMA 2EI7A 2FYRA 1MU8B 1NROH 2GKVE 1AE8H 3AK5A 3SQHE 3LKWA 4AC9A 3RXRA 2BZ6H 1QY6A 4FUCA 1MABB 1CA0C 2J38A 3K65B 2NU3E 2K0QA 1AI8H 1AKSA 4NA8A 1V2NT 1Y5UT 1S6LA 3T29A 1QL9A 1GPZA 5C0UA 2FX4A 4HZHA 2ZPSA 3ZYDA 1O0DH 4B74A 4D9QA 1O5DH 1KXBA 4F55A 3KHVA 4YXWD 3QWCH 2IPQX 1TB6H 1Q3XA 1DANH 1T7CA 1FXYA 2F9NA 4IN2A 5EQQA 1SGCA 4Y7AA 1ZOMA 1O2LA 1O36A 3I78A 4DVAU 2BQ6B 1C5TA 2BY7X 5J4SA 2OQ5A 1P04A 2ASUB 1THRH 3Q3YA 1TPSA 1V2MT 2AMPA 2A2QH 1TALA 1HXFH 3AW0A 2PUXB 2ZTZA 3CNRA 4XDEA 5EJ1A 1IQIA 3T26A 1J14A 1DXPA 1YM0A 4ASUD 3A82A 3KQBA 2AMQA 2BY9X 1GBTA 3F3BA 4P00A 1L4DA 2CV3A 2JJ2D 4MLFB 2ZCKP 1LQEA 3TJUA 2AERH 1W14U 1LHDH 4ABHA 5E0HA 2FESH 1EUFA 1OWDA 2FXRA 4WH6A 3RXCA 5FCKA 2VH0A 5C17A 2SGFE 1F5KU 4YZUA 5T3HA 5DSFA 1K9OE 1O2QA 3EDXB 2QIQA 5AHGH 5A0CA 5EQSA 2CMYA 3TH3H 3E0NB 3ZVBA 2SGEE 1FUJA 2Z9JA 1TONA 1TBQH 3M7QA 2ZHQH 4NSYA 1K1PA 1TYNA 1ZGIA 3AAUA 2QAAA 1FIZA 4AORA 3MH5A 1LVYA 5EPNA 3F68H 4CHAC 2J94A 2FS8A 2VIQA 1E34B 4SGBE 1BTZA 4K60A 1ELDE 1GVKB 1DWEH 4CH2B 1GBBA 1LO6A 1C1WH 3RMLH 4Y10E 1X7AC 1GBLA 1SQAA 2OQUA 3A81A 2Y5HA 1ANEA 3PV4A 1LPZB 1QA7A 2C90B 2FZZA 1IQNA 1P11E 1O5AB 2FYQA 2ZGJA 5JYIA 2KAIB 1CHGA 1QL8A 4ZCNA 5E2OA 1CHOG 1EAXA 3MWIU 3I77A 2PKSC 4ABBA 1GI6A 4GHTA 4UFGH 2K8IA 1BZXE 1XMNB 1IQHA 4I8GA 4BNRA 4HGCA 1QIXB 3S9AA 2PTNA 3P92A 3ZV8A 4F49A 2J98B 2ZKSA 1A61H 1N6YA 1TBZH 5A09A 2XC4A 1P2IA 1OXGA 1MKXK 1MTSA 2Z9LA 4K69A 1ZZZA 2RA0A 4J2YB 3UREA 1N1LA 2FIRH 2YMSC 1INCA 4CRCA 4TYDA 2V3MA 1O3BA 1V2ST 1G3CA 3A87A 3SU0A 1MQ5A 1DX5M 2GP9B 1IQMA 3GY2A 3RXAA 1JIRA 2VGCB 4KTUA 3PLPA 4LOYH 4HTCH 2BM2A 2BDGA 8KME2 3MU4A 3EE0B 3VGCC 2UUYA 1HAYB 4PROA 4F48B 4K5ZA 2SGDE 2TGPZ 1H8HD 2LPRA 3QTVH 3GCNA 4RN6A 1OWEA 1TE0A 3PLBA 2QY0B 2L74A 2FTLE 1FI8A 1O2TA 5F6MA 2AH4X 3PV2A 1GI5A 2W6JD 1W10U 1VR1H 1ZTLA 2FX6A 1ESAA 1PQ8A 5BRRE 1C1OA 2FLBH 1AU8A 1P10A 2ODYB 5E2PA 1IQGA 1SR5C 3RXMA 2C93B 4NG9H 4NWKA 1K22H 3F1SB 5L2YH 5EPYA 3SHAH 1GG6C 1H9IE 1P2NA 1SLWB 3VB6A 3F2GA 1FAXA 4X8TH 4DT7B 1O37A 1S6HA 4K8BA 1F0SA 5T1VA 2ANMH 2A0QB 1XVOA 3UIRA 1WV7H 2Q6FA 1UCYK 2RDEA 1XUJA 2FOFA 3BEUA 2VJ1A 1P9SA 3UNRA 1EPTB 1IQEA 1H1BA 1VGCB 1W0JD 2F4LA 3SUGA 1HBTH 1GBCA 3RU4E 1FNIA 5EU8A 4Y79A 4ZUHA 1P2QA 3F2HA 2XXLA 4JYUH 5JBAS 3EA7A 2W3KA 1O2ZA 1GWAA 5F53A 1DY8A 2WHXA 1GHWH 1P0SH 4Q7XA 1GHAF 3NRLA 2PGBB 1UVTH 2VVVA 2ZGBH 1KLJH 2XW9A 4JZEH 1ZR0A 4OS1A 4FUFA 1C5ZB 2A5AA 2J97A 4R8TB 1O2VA 1GBAA 4H6SB 4B6EA 1P2JA 3FVFB 3GDVA 4XSKU 1QJ6B 1K1IA 1SMFE 4XBCA 1IAUA 3BG8A 5LGOA 4H6TA 4MPWA 1PQAA 4X8UH 1MKWH 2YNBA 2QN5T 3KQDA 1K2I1 3VB7A 1AQ7A 1BRCE 3QN7A 2H2ZA 5C1UA 1PJPA 3O8BA 4I8LA 3TK5A 1GJ8B 2GDEH 5EG4A 1DWDH 2P3FH 1RRKA 4ABEA 3A8DA 4JMYA 3QX5H 1ZMLA 3F9HA 3GYLB 1C4Y2 2HPPH 3NZIA 4Z1MD 4AG2A 1BTXA 1O30A 1GGDB 3JZ2B 1MTUA 1UW7A 3IG6B 1B0EA 4Q2KA 4BAHB 2NU4E 1O2OA 2KX4A 2O8WA 5FAHA 1AUTC 3AAVA 2PR3A 1C2GA 2W5EA 4OS7A 3F0PA 3FAOA 4A1XA 1S0QA 1WCZA 7LPRA 4GLYA 1EKBB 2QYIA 1G30B 4ZMAH 4RT0A 3LU9B 1IHSH 5B6OA 1LKAA 4YO9A 2G00A 1THPB 3LGIA 1Y3WA 4MPXA 5E8EH 1PPEE 2Z3EA 2WV4A 1TPOA 2KCOA 3BTHE 1DITH 4UDWH 4DG4A 3VEQB 3V0XA 1BTWA 4H4FA 3RLWH 4A92A 1NRPH 4IW4E 3A89A 3QK1A 4CBNA 1B5GH 1TQ0B 1D6RA 1GBFA 5K7RA 2V6NA 3VXFH 3TITA 1AGJA 3CS7A 6ESTA 3D49H 3A7TA 1AVGH 2VIOA 4XRNA 1C1QA 1H4WA 2VWLA 5FX6A 1J16A 1G2LA 1HRTH 1NBMD 2RG3A 2WV9A 3S7HB 2ZU1A 2ZDKA 3AASA 3F9GA 1EP5A 4X6MA 1SGYE 4NSVA 4BAQB 3EA8A 4O03A 3HKIB 3KYGA 1YWUA 3RXEA 1KLTA 4NIWA 2R0LA 5JBTA 3LJJA 4IGDA 3FZDA 2ZWLH 4NFFA 1A7SA 1GBKA 1HAHH 2FOBA 1WYKA 3GOVB 4Q7ZA 1ZTJA 3BTME 1H8DH 1ZPZA 3KCGH 1UVUH 5GWZA 3MO9A 2EC9H 3DD2H 4RKOB 4MDSA 3FN8A 1QNJA 2V35A 1DPOA 4RI0A 2VWMA 4DIIH 2OC7A 1TPPA 5F03A 2NU0E 1MH0A 1B0FA 2ANKH 2PP6A 1O3CA 3LT3A 3ODFA 2FS9A 1AUJA 4CRDA 1SLXB 1SLUB 4UE7H 2Y5GA 1WXRA 5JB8S 4O97A 1PPGE 2WPMS 3PB1E 4NIXA 1AZZA 1Z8IB 3SJ9A 2C8XB 1DLKB 2ZF0H 3MFJA 1AY6H 1GI7B 1NU7B 1W0ZU 2ZFRH 1N8OB 4RKJB 1WTHD 3T25A 3F2FA 4ABFA 4BTUB 1XUIA 2LELA 2FPZA 4NCYA 3BTKE 3U8OH 3RXIA 3GCTG 1N6XA 2HALA 3RU4T 3MTYA 4D76A 3TJNA 2XBWA 1EZUC 1YPKH 1C2KA 5EIYA 1KXEA 3E91A 2ZHFH 1LVMA 3F0OA 1ZPBA 1A4WH 1MAXA 2R3YA 1CT4E 1G2MA 3U8RH 3ZVEA 1MBMA 3LJOA 2BY5X 2O8MA 1TQ7B 4FXGH 3PRBA 1EB2A 1W2KH 4DCDA 4YOIA 1CGHA 3G01A 1GHYH 2ZCHP 1P2KA 4O3UA 1TRNA 2PTCE 5E0GA 1LHFH 4E06H 3PV5A 5FL7D 2P59A 2ZNKH 3I29A 4X1RU 3T2NA 4DJZB 1O33A 1K0HA 2VWOA 1QBOA 4UFDH 3SU2A 2HNTF 1TOCB 4ZXXH 2OD3B 1Z1JA 1Q31A 1XKAC 1OWHA 1C5XB 1SGEE 3TH4H 2JKHA 4ZKOU 2O8TA 3UPEA 3RC4A 3OSYA 1Z71A 4I32A 3SV6A 2XRCA 3E3TA 1ELBA 1Z8JB 2Z6BD 1G36A 2ZPQA 3RXDA 4O9VA 2Y80A 1YYY1 1O31A 1BTYA 2ZA5A 4AFSA 3SI4H 1O3PB 2DUCA 1EJAA 2A4QA 2HGTH 2SGQE 2TGTA 2ZP0H 2A5IA 3WW7A 4ACBA 1GCTB 3L33A 2OBOA 2GD4B 2CXVA 4X6PA 5HIZA 4ASHA 1Y5BT 2BD9A 2WV5A 3U69H 3KQEA 2BLVA 6CHAC 2C8WB 3H09A 4XBBA 2F9OA 3SNBA 1EAIA 4KKDA 1F0TA 2JH5D 4I8KA 2H1UA 5B6LA 1TNGA 4CH8B 4Y71A 5FBIA 2OK5A 4I7YH 3AVZA 1LPKB 3MO3A 2ALPA 4NZLA 1NFXA 1OX1A 1ESTA 4Z0KA 1ZRKA 4X6OA 1ELTA 3A83A 1TMBH 2BD7A 1GJ6A 3KEEA 2J92A 4UD9H 4WF8A 1JRTA 4KP0A 1GI9B 2JIZD 2ZO3H 3ZZCA 1FONA 1V2TT 3E0PB 1C5RA 1KDQB 4I8JA 1WQSA 4OS5A 1NFYA 2QGRA 4I8HA 1XM1A 2TBSA 4AN7A 4CRGA 1TGCA 3W94A 1GBHA 3MNSA 3SU3A 1C5LH 1O2UA 1EPTC 1UTOA 1GMCF 1GI8B 2NWNA 2WZQA 4UONA 2G5VA 2AEIH 1HJ9A 1MQ6A 4BXWA 1CT2E 1MKXH 1PPHE 1K1MA 3EA9A 3F9EA 1C1UH 5LPEA 1MTWA 3KN2A 3T62A 1PPBH 2ZU3A 1GHBF 3ITIA 2QXIA 1GL1A 2ZFTA 2Z3CA 1SQTA 5GXPA 5CHAB 3LOXA 4A1VA 4E05H 5CDFE 4GCHF 2BLOA 3RM2H 2KAIA 1V2WT 3A7YA 1LTOA 1ZJDA 3PMAB 2UWLA 3M7TA 2AIQA 3M35A 4BTIB 2SNWA 3PMJA 4Y8XA 2PUQH 1MMJN 3RXTA 1BMMH 1CBWC 1LCYA 4LZ4B 1HDTH 1OPHB 1Y5AT 4FOUC 1AVXA 5TCAA 3SV8A 5ABWA 5ETXA 2FLRH 1DOJA 2ZDLA 1FY4A 1QB1A 3MU5A 1ZSLA 1GBDA 4OS6A 3SNAA 4FUGA 3DUXH 1IQFA 2ZGHA 2XBVA 4K2YA 4WMFA 2OBQA 2ZFQH 1YGCH 4X6NA 1QRXA 2J98A 3TJOA 3EE7A 1NRNH 1BTHH 4ZHAA 2J34A 5A2MH 5GIBA 2QXHA 1FLEE 1NO9H 2SGPE 4D9RA 1L0ZA 3PTBA 1NN6A 2YNAA 1MTNC 2XBXA 3BIVH 1C1PA 1UTJA 4XOJA 3DFLA 1DT2A 1O3EA 3MH4A 1UCYH 1SHYA 1WTGH 4FVBA 3P8GA 3PWBA 4AB8A 3Q00A 2ZDVH 4INLA 3PWCA 3V12A 1DM4B 1E79D 5JPMH 2KZ4A 2GMTB 3N7EA 4J1YA 1TIOA 5DP4A 1QURH 2OCVB 4JCNA 1L1JA 4Y8ZA 1S82A 2XCNA 1A5GH 3GDUA 1AZ8A 1Z6EA 3N7DA 4X8VH 3PMBB 2Y7ZA 2BTCE 1GI0A 5DKMA 1F0UA 4NWLA 4KTCA 3CENA 2ALVA 3QGNB 1RJXB 5C1YA 3RP2A 3SU4A 1FIWA 2WPDD 3C1KA 3ZVDA 2Z7FE 4IMZA 5FXLA 4XBDA 5A8XA 2TGDA 4YM9A 4WWYA 4E7NA 1WAYB 2AHME 2BXTH 1AE5A 3TU7H 3SU1A 1XUGA 2ZDMA 1BIOA 3E16B 3QZQA 2P16A 1V2KT 1C5PA 1T31A 3R0FA 1BRAA 1SFIA 5C94A 3L6PA 4X1PU 1WBGB 1EPTA 3OX7U 1GMDF 4KGAA 1L2EA 1W11U 2A1DB 2Y82A 1GDUA 1DDJA 1PYTD 2C8ZB 2FOAA 2IN2A 1AWHB 4AFUA 3QLPH 4GAWA 1G3BA 2GZ8A 5KECA 2PSYA 1ARCA 1MAYA 1F92A 1ZLRA 3ZZ7A 1PPFE 1V2VT 5DP8A 3V3MA 2QXJA 8ESTE 2TRMA 1HJAB 2ZDNA 1EAWA 2NU1E 1FDPA 1RTFB 3ZVFA 3O8DA 1KXFA 3LH1A 3EYDA 3LPRA 2SFAA 4TY6A 4X2WA 2G81E 2KM0A 1S5SA 1TGBA 2J95A 2GZ7A 4NIYA 5LPRA 1IQJA 5DPAA 4Y8YA 1FX0B 1Z1IA 3M61U 1XKBC 1SVPA 2C4FH 2Q6DA 2BX3A 1VJAU 2Y81A 2ODQA 3M5NA 3SW2B 4K8YA 1A3EH 4Y0ZE 1AVWA 4ESTE 1HLTH 5DP7A 1L1GA 3RU4D 3E6PH 5JBCS 2J9NA 3S9BA 2JH0D 1JBUH 5HM2A 3P6ZB 4ABIA 2RA3A 1VCPA 2VINA 3UAIC 4LZ1H 3STIA 3MOCA 2IJD1 4A5TS 1EXFA 1J15A 1HAVB 1EZSC 2WUCA 4CRBA 3TK9A 4BTTB 1SQOA 5F8TA 1H8ED 1O2PA 1UTLM 1P8VC 1O5CB 1GMCG 2BVSH 1GBIA 1SFQB 2ZQ2A 3RUOA 1D3PB 1P06A 3OEHD 2F9VA 3P17H 3BSQA 4OGXA 4A1TA 1GI1A 1TRYA 3ELAH 3P8FA 4K3JA 1GHBG 4X1QU 3NWUA 2UWPA 3BTFE 1MCTA 1WDIA 2EEKA 4AYYB 1SGIB 4AFQA 1GCDA 2Z9KA 1ESBA 2STAE 3H7OA 2P8OB 1CE5A 1NRRH 4GCHG 1TX6A 3RXKA 1OP8A 4X0WU 1BOQA 1O2IA 1RIWB 1P3EA 2A4RA 2A2XH 2HLCA 1KXDA 1ELEE 1TX7A 4ISHH 2ZEBA 1TAWA 1NESE 2F3CE 1EZQA 2GGVB 2Y5FA 2R2WU 4U32A 5EOKA 2R9PA 3RMMH 5HKKD 3OAAD 1P02A 2A7JA 2PLXA 4Z6AH 1QA0A 1GJAB 1D3DB 1YY3A 1MU6B 1HAXB 4GUXA 1SHHB 2FDAA 3NCLA 1RXPA 1GJ9B 4ISOA 3TGJE 1O5FH 1C1VH 2QE7D 3B8JA 1D6WA 1ELAA 1ANCA 3W95A 1S84A 2BDAA 2JH6D 3A84A 1FY8E 3LC3A 4CR9A 1NT1A 1V2QT 2ZU5A 1ZHMA 5EJLA 2R0KA 1P9UA 3K2UA 4B2BA 5J4QA 3O8CA 1F2SE 1GJCB 1SC8U 2V3OH 1SGRE 3ZVGA 3RXUA 2CGAA 4U30A 1C4U2 3U9AH 2BDBA 1ZRBA 2DE8A 2HVYB 1TGTA 5FX5A 2BDCA 2Z9IA 3LC5A 4DT4A 3UNSA 1UHBB 1DWCH 2VIDA 3ESTA 4LXBH 1SB1H 3GCHB 2OINA 5EODA 4Y0YE 2XCFA 4RT1A 2BVRH 1GVLA 1F7ZA 5DJ7A 3OEED 1WOFA 2FEQH 3M5OA 1D4PB 1BT7A 4X8SH 1QQUA 4YOJA 1GCTC 3U1JB 2UUKB 5JDUB 1C2HA 2D8WA 2BDIA 8GCHF 1CU1A 1ANDA 1QR3E 3HGPA 2CHAC 2WPLS 4ISNA 3CP7A 1L1NA 6GCHF 1UJ1A 1TGNA 1W0YH 4B2AA 2GV7A 3A7VA 1O34A 3TLOA 3GCOA 2BLQA 2FOMB 3SNEA 1E1QD 1DVAH 2BD4A 2ZGXH 4MPUA 1UVOA 4TPIZ 1G37A 2BD8A 4IBLH 4YT6H 1QB6A 2ESTE 3M5MA 1TRMA 1YPGH 3P70B 1Y8TA 3QO6A 3T5FH 5ESTE 1E38B 2AGEX 3SNCA 4ZKSU 3H5CB 1TNIA 4WVPE 3MU1A 3GY4A 1GMDG 3MNCA 1BBRH 4E7RG 1YLDA 1COWD 4WH8A 1C5UA 2XOKD 2FWWA 2CF8H 2GCTC 3GY3A 1AD8H 3M3VA 2QCYA 5CE1A 1YPEH 2ANYA 4MVNA 1GL0E 1E37B 2TGAA 2Y7XA 2XTTB 1RS0A 1JIMA 4CHAB 2L6OA 1KY9A 4OS2A 3SJKA 2VB0A 3QZRA 4TWYA 4K1SA 2F9PA 2XNIA 1F5LA 1EAUA 1NRSH 1BHXB 3BEFB 1XX9A 9LPRA 3BG4B 1QGFA 4B1TA 1LQDB 1SSXA 1O2SA 3MU0A 4GHQA 2XWBI 4KELA 1UVPA 4AZ2B 1ELGA 1T8MA 1DFPA 3SV7A 3RXGA 3DA9B 1QBVH 1GVZA 4FU9A 3SBKA 1TA6A 1SBWA 2PHBA 3MNBA 4MQAA 1ZMJA 1C5VA 3BF6H 2PKSB 1C5QA 1K1NA 2BY8X 1C9TA 1G9IE 2OLGA 3TGKE 1O3JA 3KNXA 2SNVA 1TGSZ 2H6MA 2VVCA 1O3DA 2KR7A 1RTKA 2ZFSA 1NZQH 1AFQB 2A4OA 3SZNA 1P09A 4JZDH 1AWFH 1P2MA 1PFXC 3MU8A 1T8LA 3UOPA 1O5EH 1YCPH 2QC2A 2B7DH 1UK2A 1GDNA 3S9CA 1Z7KA 2WPHS 1Y3UA 3KQCA 2H9TH 1Z6JH 3TNSA 2GT7A 1KTSB 1H9HE 2W26A 4OM9A 3SQEE 4YT7H 5JB9S 1C1NA 2ANWA 2BY6X 4YTAA 4ZROA 5HXFA 3MI4A 2V7QD 1K21H 1T8OA 1GHXH 1GJBB 1NFUA 1O5BB 5HYOA 1RFNA 2CJIA 4DY7B 3LH3A 3FP6E 1LHGH 2BVXH 3ATWA 3R3GB 3RXFA 4AG1A 3N99A 3SNDA 4JZ1A 4I86A 3ZVCA 5GJ4B 3BTEE 4OGYA 1GHAG 1HYLA 5KEDA 2TIOA 2ULLA 2FOEA 4F4OC 2PW8H 2V0BA 3FZZA 1JXPA 4HI3A 1JOUB 3VG8A 2JJ1D 1MUEB 5C5OA 1C1TA 1PPZA 2G52A 2BD2A 5AVDA 4CREA 2ZQ1A 1OKXA 1GG6B 1LHEH 3SJIA 1KDQA 1S6FA 1HAIH 3JZ1B 2HNTC 3DSPA 2P94A 5SGAE 1E35B 3LGTA 1CA8B 5HGGA 1TNKA 3F9FA 2F9UA 2GCHF 2G8TA 1AB9B 2RCEA 3DFJA 5C20A 2FMJA 5DO4H 3QTOH 3ATLA 2F91A 1O3LA 3RXLA 4IMQA 3CS0A 1PPCE 3OYPA 1C1MA 5FCRA 1LDTT 1C2FA 2BQ7B 2HPQH 3MH7A 3QGJA 1EFRD 2A4GA 4JZIA 1JRSA 1W12U 8GCHG 4FETA 1O2JA 1QJ7B 3A7XA 1FY5A 1O5GH 5FHTA 3M7UA 1C1RA 4M7GA 3KF2A 3OE7D 3BTQE 4MG3A 3SUDA 4YOGA 5DK1A 1P01A 2QV1A 8LPRA 3D62A 3PRDA 3SGQE 1E1RD 3ATKA 1A0JA 1O2HA 2VNTA 3SO3A 5FPTA 1YPHC 1YP9A 2J4IA 3MYWA 4RSPA 1ELFA 3TVJB 2BOKA 2VVUA 2ZHWH 2XC0A 4CRFA 3A8BA 3OTPA 1GJ7B 1TBRH 4WXIA 1BQYA 1C5NH 3H7TA 1LPGB 4D7GA 5DG6A 4R0IA 1QFKH 3FO8D 3W1EA 1OS8A 2VGCC 2RDLA 2EI6A 1E0FD 1K1JA 1O2KA 2VH6A 1V2PT 4IC5A 1Q2WA 4WY3A 2CF9H 2KCAA 5HIYA 3UNQA 1WU1A 3GY6A 1O2MA 1J9CH 1A2CH 1HIAB 1SKYE 3ZZDA 3FP8E 1SQRA 5FBEA 3TIUA 2Z3DA 4YESB 4CR5A 1ABJH 4O3TA 4UFEH 1EOLA 1THSH 1C9PA 3EAJA 1DY9A 3UQVA 1D9IA 4FUDA 1VCQA 1C5MD 4DIHH 1UTQA 1W8BH 1XXFA 3ZV9A 5L6NH 1TX8A 3VB3A 1ELCA 4AGJA 2FI5E 3UOUA 1LVBA 1MD7A 2GV6A 5DN6D 1K28D 2IJOB 4INKA 1ZSJA 4NFEA 1YLCA 2AIPA 3LONA 2G4TA 3HK3B 5EXLA 3NXPA 1WSSH 2P8OC 2BMGB 3LGWA 4GSOA 1Y3YA 4AFZA 2EA3A 4IS5A 3KIDU 2W7SA 2P93A 1RIWC 2H9EH 1VGCC 3ZZ8A 3SU5A 3E1XB 1BMAA 4FU8A 2AFQB 2B0FA 1P2OA 5K0HA 1ORFA 4XE4A 2ZCLP 2C8YB 1H8IH 1QBNA 1U6QA 3VXEH 3ZZ5A 2C3SA 1TNJA 1TABE 4ACAA 5A8ZA 1YBWA 4Q7YA 4FUHA 3BTWE 2KCPA 4ISLA 3RXSA 1PQ7A 3K9XB 3ZIAD 3A7ZA 2HRVA 1DS2E 1SOZA 1O3IA 1HJ8A 2D2DA 2OTVA 3SI3H 2ZI2H 3KYFA 1BA8B 1VKYA 2G4UA 1V2RT 1LMWB 3GISB 2OP9A 1O3MA 2P95A 4TY7A 1K1LA 3Q77A 2ZTYA 2XC5A 4Y76A 4BAMB 1CVWH 1T32A 2Y6TA 1EJMA 2PSXA 4ZHMU 5KGOA 4ZHLU 1DWBH 5GNDA 1WQVH 1XUKA 2ZECA 1BBRE 3E8LA 1WUNH 1UTMA 2VBCA 1C5OH 1TLDA 1G3EA 5A8YA 2WPKS 4Q80A 3MH6A 2VIVA 1KYNA 2F83A 1HCGA 3T28A 3GCHC 1VITF 1EOJA 3FANA 3A8AA 2ZZUH 2K1QA 1DXWA 1L4ZA 1VCWA 2SGAA 4ZH8A 1ID5H 2ODPA 1BRUP 3V7TA 1GJ5H 4HFPB 1OOKB 4Q63A 1D3TB 3BTTE 3RC5A 3LGYA 1NU9A 1OWIA 1GGDC 4B75A 1YKTA 3SOSA 4B6FA 1ABIH 3F6UH 3MO6A 7ESTE 4NA7A 3C27B 3UWJH 1MZAA 3D23A 4K1EA 1XUHA 4WMEA 2OUAA 1QHRB 1ZTKA 3TPIZ 2OC1A 1HAGE 1CQQA 4BXSA 2GT8A 2QF4A 4M9FA 1DE7H 4ABAA 1K1OA 4MNVA 1NFWA 3FP7E 1KXAA 2D26C 5C3NA 4X2YA 2GCHG 1HAVA 1KMHB 3ZZ4A 1Y59T 2QF5A 1S81A 3GS9A 2Z9GA 4D7FA 5PTPA 3PTNA 1HB0B 4UFFH 1BUIA 1Z8GA 3RXBA 1V6DA 1PQ5A 1QTFA 2BB4A 2XWAA 3PMHB 4B76A 5BPEA 2ILNA 3SV2H 3ZZ6A 2PKAB 2J5UA 3SGAE 3S69A 1BMLA 2OXSA 2M5TA 1BJVA 5DGJA 2I6SA 3STJA 3O8RA 5AF9H 4ISIH 5DP9A 1MZDA 1O2NA 4X2VA 1S83A 4X2XA 1DSTA 1FQ3A 1Y3XA 2EQNA 2O9QA 1OYQA 2ZFFH 5IK2D 1YC0A 2ZC9H 1ZJKA 1ETSH 4KTSA 2HLDD 3WWFA 3BG4C 2B5TB 1BTPA 1BHXF 5L30H 4AOQA 3V13A 1QL7A 1T4UH 1C2IA 1RD3B 3KGPA 2G51A 5H4IB 4BAKB 2YMSD 3GY8A 1AKSB 2QF3A 2R2MB 4Y6DA 1GHVH 4ZKRU 3M37A 4JZFH 1EATA 5HMAA 5L2ZH 1TNHA 3OY6U 3P8OA 3A7WA 1T8NA 3URCA 3A8CA 4JYVH 3UWIA 3ZYEA 2OC8A 3RXJA 3BEIB 3TK6A 3RXVA 1HXEH 2GZ9A 4NA9H 4WJG2 1E36B 1PYTC 3BTGE 3SUFA 4FUJA 5TCCA 1UHBA 1AFQC 2BOHB
chains in the Genus database with same CATH topology
5EW1H 2O8LA 2A7HA 2FM2A 7GCHF 4ABDA 2G5NA 3HK6B 1MCVA 1CGIE 1ZGVA 2H5CA 3BIUH 4FUEA 1CT0E 4FUBA 1LVOA 1O2RA 3OY5U 1RGQA 2F9BH 1QQ4A 1N8OC 2BX4A 1GBJA 2UWOA 1AIXH 1HFDA 3DHKH 6CHAB 2AGGX 4D8NA 2A45B 3GDSA 2VIWA 2BQWB 4THNH 5CMXH 1C4V2 1DUEA 1J17T 1O3FA 3RLYH 2WYGA 1O3NA 4FU7A 3OU0A 5AFZH 1P3CA 1JWTA 2VIPA 4FUIA 1NTPA 1ZSKA 1W7XH 1TNLA 4U01A 2FOHA 3VFEA 1UK4A 3T27A 3PROA 3RXQA 1FAKH 3SJ8A 1C5WB 1EB1H 1NPMA 2ZFPH 4ZAEA 2JETB 3NPSA 2THFB 1AB9C 1V2JT 1JMOH 1GMHF 2ZIQH 4Y11E 3PO1B 2IPHA 3ENSB 4MNYA 2BDHA 4GVUA 1VITG 1BB0B 5EGMA 4GPGA 4U2WA 5EXNA 3PM3A 4VGCB 1TPAE 2VU8E 3GCTF 3MHWU 5GDSH 4MPVA 2BZAA 1SGFA 1CA0B 4B71A 3EQ0H 2GVFA 1GDQA 1ZYOA 2WPJS 1OSSA 4AGKA 2BHGA 3AW1A 3A86A 1MD8A 5T6DA 2A32A 3VPKA 2Z94A 2FP7B 1P03A 2J2UA 2ZHEH 1OP0A 1BCUH 1CBWB 1IOEA 1CSOE 1BMNH 1D3QB 1XVMA 1W13U 3TJVA 2XYAA 2YOLA 1GBEA 1GI2A 5EXMA 3FFGA 1C2MA 5DP5A 5TJXA 1FY3A 1XUFA 2R3UA 4YLUA 3QUMP 1VJ9U 4XFQA 2OC0A 3K6ZA 2FODA 2PV9B 4ABJA 1P05A 4SGAE 1AMHA 1NRQH 5GCHF 1UTNA 1FN8A 3OTJE 1MTNB 1HAPH 5LH8A 3VB5A 2HWLB 3RDZA 3TNTA 1HV7A 1SGPE 1MTVA 1QJ1B 1G32B 1LHCH 1XXDA 3D65E 2TPIZ 1DSUA 2BYAX 2W3IA 1ELVA 2FI3E 2GDDA 2AGIX 3UTUH 1F0RA 3SUEA 1V3XA 1TOMH 3LGVA 1ZHPA 4IC6A 2FI4E 4LK4A 4DW2U 1Y3VA 1BTUA 2DE9A 2HVXA 3BN9A 1V2OT 1SGQE 3NK8A 4OS4A 4ABGA 1B7XB 3EGKH 4MNWA 1TA2A 4DGJA 4TPYA 1O2YA 2VWNA 2G55A 5EQRA 3HGNA 1SGFG 3M36A 4WMDA 1UMAH 1ZMNA 1HGTH 4A7IB 4WXVA 1A1RA 1H9LB 3QDZB 1UCYE 1VITH 4CRAA 1NY22 3HPTB 1J8AA 1C2LA 4JYTA 2HOBA 1DUAA 5CHAC 3U98H 3ATIA 5FPSA 1C2EA 2EI8A 2A7CA 5DP3A 1QB9A 4UEHH 1O32A 2LNCA 2BXUH 1TFXA 3M3SA 1DICA 1EQ9A 3P95A 1HAOH 1QRWA 3GY5A 3KL6A 2XBYA 2H9HA 2ZDAH 7GCHG 2QA9E 4B2CA 1SGDE 3SN8A 3RC6A 1BDAA 3RXOA 1SG8B 3U8TH 3UY9A 1DLEA 3SORA 1T4VH 2B8OH 1IQLA 1BJUA 1KIGH 1P12E 3TH2H 4BANB 3TGIE 4MNXA 1P57B 2IOTA 2UUJB 1O2XA 7KMEH 3Q3XA 5I46H 1EJNA 1YPJH 1GBMA 1A3BH 2FOGA 1RTLA 5T6GA 3SJOA 3UUZA 1TMTH 3PYHA 1UTPA 1AHTH 3SHCH 1G3DA 3MMGA 4IN1A 3RM0H 3LIWA 1O3KA 2WUBA 3Q76A 4AB9A 3HKJB 5A0BA 1V2LT 1CO7E 3IITA 5GPIB 1ZPCA 3Q3KA 3BV9B 2A5KA 2GMTC 1S85A 4NIVA 1UTKA 3ZZ9A 1IHTH 5T6FA 5F8ZA 3VGCB 1HIAA 3PLKA 4X1SU 4CBOA 4YLQH 3RMNH 3ZZAA 1LKBA 2ZG0H 5LPFA 2QXGA 1EX3A 3LDXH 3UR9A 1GMHG 2D1JA 1SLVB 4AX9H 1UVSH 3A85A 1SPJA 1MKWK 2Q6GA 4FVDA 1FZZA 1W7GH 1C5YB 3GICB 3S0NA 4ZKNU 3NUMA 3B23B 3M5LA 2GTBA 3LGUA 2PGQB 4I31A 3ZZ3A 3NKKA 3UFAA 4B73A 1GJ4H 2P3UB 1IQKA 2WPIS 3BTDE 4A6LA 3A80A 5I25A 1A0HB 1GJDB 2ZHDA 3E90B 2FO9A 3IWMA 3UQOA 4H42U 3URDA 1A0LA 1HPGA 1O35A 3GY7A 3L3TA 1S0RA 1V2UT 2BLWA 3ATMA 2NU2E 1MBQA 1KTTB 1C2DA 3MNXA 1O39A 2HNTE 1O3AA 5FPYA 2PWXA 1GI4A 1A5IA 6GCHG 3ZZBA 1KSNA 1HJAC 2B9LA 1VZQH 1ETRH 1SOTA 2GX4A 5A0AE 4K1TA 1A46H 3S7KB 5GCHG 1O3GA 2WINI 1BBRK 2WYJA 3HATH 1Z8RA 3WY8A 1ANBA 1O3HA 3N7OA 1SI5H 1BITA 1FJSA 1HAZB 5F8XA 1OP2A 2UUFB 4DURA 3SU6A 1ZHRA 1EASA 1KLIH 1EZXC 1ETTH 5JBBS 1AO5A 1FMGA 2A31A 1O2GH 3DT0H 2ZGCA 5HM9A 1YPHE 1NS3A 4MTBA 1CHOF 1AN1E 1O2WA 3A88A 5C67A 4X1NU 1KXCA 1YPLH 2CHAB 1ACBE 1C2JA 4AYVB 6LPRA 2W7UA 1QCPA 1GI3A 4I33A 1YCPM 5G4BA 2ZTXA 4TWWA 3UR6A 1A5HA 5E0JA 4NZQA 5IYTA 5C5NA 3U1IB 3SGBE 3K6YA 4QT8C 2P3TB 1AFEH 1ARBA 2AS9A 1C5SA 5IDKA 1HNEE 3RMOH 9ESTA 4JK5A 1GHZA 3ODDA 4BAOB 1SGNE 1OWJA 3M3TA 2CN0H 1M9UA 3VB4A 1SL3A 2BDYA 1QRZA 1OYTH 3ZVAA 3RXPA 1FPHH 2ZU2A 1HUTH 4NGAH 2ZPRA 4ZXYH 2GCTB 1NC6A 4INHA 1FV9A 4BOHA 1O3OA 2PKAA 5DP6A 2AMDA 2FTMA 1OWKA 2AYWA 5C2ZA 1YCPK 1UK3A 2O8UA 2JETC 2PFEA 1FY1A 2BD3A 1C1SA 2I6QA 2QF0A 1TMUH 1UO6A 2V3HH 2FOCA 1FN6A 5C1XA 1BRBE 1W3CA 2STBE 3PO1C 5AFYH 1SGTA 3SV9A 1O38A 1YF4A 3P8NA 4JK6A 2ZU4A 4DOQA 3B9FH 1NM6A 3RXHA 5EW2H 2Q1JA 1FPCH 5ESBA 4Y7BA 1F5RA 1YPMH 1TWXB 2BD5A 1EP6A 2H5DA 1CGJE 4VGCC 3GYMA 2EI7A 2FYRA 1MU8B 1NROH 2GKVE 1AE8H 3SQHE 3LKWA 3RXRA 2BZ6H 1QY6A 4FUCA 1CA0C 2J38A 3K65B 2NU3E 1AI8H 1AKSA 4NA8A 1V2NT 1Y5UT 3T29A 1QL9A 1GPZA 2FX4A 4HZHA 2ZPSA 3ZYDA 1O0DH 4B74A 4D9QA 1O5DH 1KXBA 3KHVA 3QWCH 1TB6H 1Q3XA 1DANH 1T7CA 1FXYA 2F9NA 4IN2A 5EQQA 1SGCA 4Y7AA 1ZOMA 1O2LA 1O36A 3I78A 4DVAU 2BQ6B 1C5TA 2BY7X 5J4SA 2OQ5A 1P04A 2ASUB 1THRH 3Q3YA 1TPSA 1V2MT 2AMPA 2A2QH 1TALA 1HXFH 3AW0A 2PUXB 2ZTZA 4XDEA 1IQIA 3T26A 1J14A 1DXPA 1YM0A 3A82A 3KQBA 2AMQA 2BY9X 1GBTA 1L4DA 2CV3A 4MLFB 2ZCKP 1LQEA 3TJUA 2AERH 1W14U 1LHDH 4ABHA 5E0HA 2FESH 1EUFA 1OWDA 2FXRA 4WH6A 3RXCA 5FCKA 2VH0A 2SGFE 1F5KU 4YZUA 5T3HA 1K9OE 1O2QA 3EDXB 2QIQA 5AHGH 5A0CA 5EQSA 2CMYA 3TH3H 3E0NB 3ZVBA 2SGEE 1FUJA 2Z9JA 1TONA 1TBQH 3M7QA 2ZHQH 4NSYA 1K1PA 1TYNA 1ZGIA 3AAUA 2QAAA 1FIZA 4AORA 3MH5A 1LVYA 5EPNA 3F68H 4CHAC 2J94A 2FS8A 2VIQA 1E34B 4SGBE 1BTZA 4K60A 1ELDE 1GVKB 1DWEH 4CH2B 1GBBA 1LO6A 1C1WH 3RMLH 4Y10E 1X7AC 1GBLA 1SQAA 2OQUA 3A81A 2Y5HA 1ANEA 3PV4A 1LPZB 1QA7A 2C90B 2FZZA 1IQNA 1P11E 1O5AB 2FYQA 2ZGJA 5JYIA 2KAIB 1CHGA 1QL8A 5E2OA 1CHOG 1EAXA 3MWIU 3I77A 2PKSC 4ABBA 1GI6A 4GHTA 4UFGH 1BZXE 1XMNB 1IQHA 4I8GA 4BNRA 4HGCA 1QIXB 3S9AA 2PTNA 3P92A 3ZV8A 4F49A 2ZKSA 1A61H 1N6YA 1TBZH 5A09A 2XC4A 1P2IA 1OXGA 1MKXK 1MTSA 2Z9LA 4K69A 1ZZZA 2RA0A 4J2YB 3UREA 1N1LA 2FIRH 1INCA 4CRCA 4TYDA 1O3BA 1V2ST 1G3CA 3A87A 3SU0A 1MQ5A 1DX5M 2GP9B 1IQMA 3GY2A 3RXAA 1JIRA 2VGCB 4KTUA 3PLPA 4LOYH 4HTCH 2BM2A 2BDGA 8KME2 3MU4A 3EE0B 3VGCC 2UUYA 1HAYB 4PROA 4K5ZA 2SGDE 2TGPZ 3QTVH 2LPRA 3GCNA 4RN6A 1OWEA 1TE0A 3PLBA 2QY0B 2FTLE 1FI8A 1O2TA 5F6MA 2AH4X 1GI5A 1W10U 1VR1H 1ZTLA 2FX6A 1ESAA 1PQ8A 5BRRE 1C1OA 2FLBH 1AU8A 1P10A 2ODYB 5E2PA 1IQGA 1SR5C 3RXMA 2C93B 4NG9H 4NWKA 1K22H 3F1SB 5L2YH 5EPYA 3SHAH 1GG6C 1H9IE 1P2NA 1SLWB 3VB6A 1FAXA 4X8TH 4DT7B 1O37A 1S6HA 4K8BA 1F0SA 2ANMH 2A0QB 1XVOA 3UIRA 1WV7H 2Q6FA 1UCYK 1XUJA 2FOFA 3BEUA 2VJ1A 1P9SA 3UNRA 1EPTB 1IQEA 1H1BA 1VGCB 3SUGA 1HBTH 1GBCA 3RU4E 1FNIA 5EU8A 4Y79A 4ZUHA 1P2QA 2XXLA 4JYUH 5JBAS 3EA7A 2W3KA 1O2ZA 1GWAA 1DY8A 1GHWH 1P0SH 4Q7XA 1GHAF 2PGBB 1UVTH 2VVVA 2ZGBH 1KLJH 2XW9A 4JZEH 1ZR0A 4OS1A 4FUFA 1C5ZB 2A5AA 4R8TB 1O2VA 1GBAA 4H6SB 1P2JA 3FVFB 3GDVA 4XSKU 1QJ6B 1K1IA 1SMFE 4XBCA 1IAUA 3BG8A 5LGOA 4H6TA 4MPWA 1PQAA 4X8UH 1MKWH 2YNBA 2QN5T 3KQDA 1K2I1 3VB7A 1AQ7A 1BRCE 3QN7A 2H2ZA 5C1UA 1PJPA 3O8BA 4I8LA 3TK5A 1GJ8B 2GDEH 5EG4A 1DWDH 2P3FH 1RRKA 4ABEA 3A8DA 4JMYA 3QX5H 1ZMLA 3F9HA 3GYLB 1C4Y2 2HPPH 3NZIA 4AG2A 1BTXA 1O30A 1GGDB 3JZ2B 1MTUA 3IG6B 1B0EA 4Q2KA 4BAHB 2NU4E 1O2OA 2O8WA 5FAHA 1AUTC 3AAVA 2PR3A 1C2GA 2W5EA 4OS7A 3FAOA 4A1XA 1S0QA 1WCZA 7LPRA 4GLYA 1EKBB 2QYIA 1G30B 4ZMAH 3LU9B 1IHSH 5B6OA 1LKAA 4YO9A 2G00A 1THPB 3LGIA 1Y3WA 4MPXA 5E8EH 1PPEE 2Z3EA 2WV4A 1TPOA 3BTHE 1DITH 4UDWH 4DG4A 3VEQB 3V0XA 1BTWA 4H4FA 3RLWH 4A92A 1NRPH 4IW4E 3A89A 3QK1A 4CBNA 1B5GH 1TQ0B 1D6RA 1GBFA 5K7RA 2V6NA 3VXFH 3TITA 1AGJA 3CS7A 6ESTA 3D49H 3A7TA 1AVGH 2VIOA 1C1QA 1H4WA 2VWLA 5FX6A 1J16A 1G2LA 1HRTH 2RG3A 3S7HB 2ZU1A 2ZDKA 3AASA 3F9GA 1EP5A 4X6MA 1SGYE 4NSVA 4BAQB 3EA8A 4O03A 3HKIB 3RXEA 1KLTA 4NIWA 2R0LA 5JBTA 3LJJA 4IGDA 3FZDA 2ZWLH 4NFFA 1A7SA 1GBKA 1HAHH 2FOBA 1WYKA 3GOVB 4Q7ZA 1ZTJA 3BTME 1H8DH 1ZPZA 3KCGH 1UVUH 5GWZA 3MO9A 2EC9H 3DD2H 4RKOB 4MDSA 1QNJA 2V35A 1DPOA 2VWMA 4DIIH 2OC7A 1TPPA 5F03A 2NU0E 1MH0A 1B0FA 2ANKH 1O3CA 3LT3A 3ODFA 2FS9A 1AUJA 4CRDA 1SLXB 1SLUB 4UE7H 2Y5GA 5JB8S 4O97A 1PPGE 2WPMS 3PB1E 4NIXA 1AZZA 1Z8IB 3SJ9A 2C8XB 1DLKB 2ZF0H 3MFJA 1AY6H 1GI7B 1NU7B 1W0ZU 2ZFRH 1N8OB 4RKJB 1WTHD 3T25A 4ABFA 4BTUB 1XUIA 2FPZA 4NCYA 3BTKE 3U8OH 3RXIA 3GCTG 1N6XA 2HALA 3RU4T 3MTYA 4D76A 3TJNA 2XBWA 1EZUC 1YPKH 1C2KA 1KXEA 3E91A 2ZHFH 1LVMA 1ZPBA 1A4WH 1MAXA 2R3YA 1CT4E 1G2MA 3U8RH 3ZVEA 1MBMA 3LJOA 2BY5X 2O8MA 1TQ7B 4FXGH 1EB2A 1W2KH 4DCDA 4YOIA 1CGHA 3G01A 1GHYH 2ZCHP 1P2KA 4O3UA 1TRNA 2PTCE 5E0GA 1LHFH 4E06H 2P59A 2ZNKH 3I29A 4X1RU 3T2NA 4DJZB 1O33A 2VWOA 1QBOA 4UFDH 3SU2A 2HNTF 1TOCB 4ZXXH 2OD3B 1Z1JA 1Q31A 1XKAC 1OWHA 1C5XB 1SGEE 3TH4H 2JKHA 4ZKOU 2O8TA 3UPEA 3RC4A 3OSYA 1Z71A 4I32A 3SV6A 2XRCA 3E3TA 1ELBA 1Z8JB 2Z6BD 1G36A 2ZPQA 3RXDA 4O9VA 2Y80A 1YYY1 1O31A 1BTYA 2ZA5A 4AFSA 3SI4H 1O3PB 2DUCA 1EJAA 2A4QA 2HGTH 2SGQE 2TGTA 2ZP0H