1O34A

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o34A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o34A02
2AIPA 1DUEA 4D76A 3R0FA 1P05A 2A5AA 3QTVH 3U98H 2FOFA 5JBBS 2OQUA 3GCTF 2BDGA 4ZHMU 1EP5A 5GCHG 2WPMS 1C1PA 1TPPA 2ULLA 4D7GA 4AGJA 4WH6A 4ASHA 4BTIB 1GG6C 3GY6A 3UQOA 4LZ1H 3LGTA 1F92A 2PTCE 4OGXA 3LU9B 3ZVDA 1EPTA 1Y3VA 4BAQB 1ELGA 1QIXB 1INCA 1XUIA 4KELA 5CE1A 3O8BA 3Q3KA 1GHXH 1G32B 3RC4A 2V6NA 1DFPA 3U1JB 1WTHD 3QO6A 4BANB 1UTLM 1F5LA 5L30H 1K9OE 1AN1E 1EJMA 2IPHA 1FN6A 2OD3B 3P8OA 5DP5A 3S9BA 4B2CA 4ABAA 4FUDA 2ZTZA 1AU8A 3MH7A 4UEHH 2QA9E 2LPRA 2HOBA 2JH5D 1TX8A 1ELCA 1HJAC 2PKSC 1YPHE 1V2PT 1SFQB 1O33A 2XC0A 2CHAC 2ZKSA 1Z6JH 3T29A 1WQVH 3LH1A 3PMJA 1C1WH 5C1XA 1CSOE 1AUJA 3E6PH 2XW9A 4Y10E 3M5LA 4JK6A 1BITA 1HXEH 3P6ZB 3LJJA 3S69A 3ELAH 1SBWA 3GDVA 4MPXA 1NS3A 2AEIH 1O2ZA 4GUXA 1GCDA 2OINA 1G2MA 1JXPA 1C5LH 1F5RA 1GDQA 1EASA 1IQIA 2SGPE 5C1YA 1GBHA 3D65E 1HAIH 4GCHG 1AGJA 3ZVGA 4YOJA 1QA0A 2G8TA 4ISOA 4SGBE 4AFUA 5A2MH 2J95A 3VXFH 4X2WA 1NRNH 4GHTA 3RMMH 5C2ZA 3SUGA 2GTBA 1FNIA 3HATH 1NU7B 3A8BA 1DUAA 1LQEA 1LVYA 1P57B 2XNIA 3A7WA 2A7CA 3URCA 2ZZUH 4M7GA 2ZHFH 3SV6A 1BRAA 3MYWA 4X0WU 2VIPA 5T3HA 4BAOB 4AG2A 1KY9A 1A5GH 2GCHF 5GXPA 2KAIA 2C8ZB 2PFEA 2A1DB 1BOQA 1THSH 3MH6A 1C5TA 1O5CB 2GV7A 2GX4A 1QRWA 1TGSZ 2AMQA 1D3TB 4FXGH 1TNJA 4ZROA 2OUAA 3Q00A 1XXFA 1EZQA 4UE7H 2BB4A 1QL8A 3TH4H 2BDAA 4HFPB 3E90B 1C5ZB 1NROH 1T31A 1ZR0A 3A87A 4LZ4B 3IG6B 3M7UA 3EA8A 1F0UA 1MKXK 1XX9A 1QURH 5EXLA 1EPTB 4CRBA 4RKJB 1D6RA 3GY2A 2BLWA 1C5XB 2VIQA 2ZECA 2OBQA 3PO1C 4U32A 1P9SA 2PHBA 2NWNA 2O9QA 3M36A 1BIOA 2G81E 3PMBB 3GCHC 1XKAC 3TK5A 1NFYA 1UTMA 1DT2A 2BY9X 5A8XA 1T4VH 1IQHA 4AX9H 3A8DA 4Y71A 1GMCG 1ZMLA 3T2NA 1O35A 1O38A 3PV4A 2XC5A 1NFXA 1PQ5A 5BRRE 3RUOA 4X1PU 3T25A 1EATA 1L4ZA 1AFQB 3T62A 5GDSH 4Y6DA 4E05H 1C5RA 2ZO3H 5K7RA 3TNSA 2ZFTA 1F0RA 1T4UH 4OS1A 2VU8E 2WYGA 1E37B 1AWHB 2BLVA 2HVXA 1LVBA 1DY8A 5FPTA 3M3TA 1V2MT 1O2NA 1F7ZA 2WPKS 1PPFE 3PTBA 1GG6B 1C5QA 1EB1H 3BTFE 2CF9H 3TK6A 1KXCA 3TH2H 4XFQA 3ODFA 1T8MA 5JPMH 2O8MA 1Y8TA 1MKXH 4U30A 1FV9A 3UUZA 1W0YH 2H9HA 2QC2A 2HALA 1NESE 2BY6X 4I8LA 1GI6A 4MLFB 2ZU2A 2HWLB 3GYMA 1HAYB 4DIHH 2OC8A 2P3FH 4F49A 1AB9C 2D2DA 2TBSA 3MWIU 1ELVA 2O8TA 1O2PA 1HJAB 2KAIB 2PKSB 1WYKA 2A45B 1SL3A 5HM2A 3ZZ6A 2CHAB 1OXGA 2Y81A 3MO3A 1KYNA 2HPQH 3SU5A 3QGNB 1LCYA 1RXPA 1CVWH 1OYQA 2ZEBA 4HGCA 2BD8A 2H5DA 1D9IA 1SVPA 6GCHG 1AVGH 3STJA 2VVUA 3VPKA 1O3GA 4I8HA 1O3LA 2FMJA 4U2WA 2J92A 2BLOA 1P06A 4YOGA 3ATWA 5T6FA 4IMZA 4BAKB 1BRCE 2W26A 4ESTE 1GL1A 1B7XB 3ZZ9A 1Z71A 3SHCH 2A7JA 4MNXA 1BMAA 4ZXYH 1CA0C 5EG4A 1Z8RA 2BD2A 2BX3A 4ABDA 1GHAG 2ZU4A 4YM9A 2TGDA 1GJDB 2OBOA 1KXEA 1W10U 1QGFA 1IQEA 2NU3E 3EGKH 1WCZA 5IDKA 2ZDKA 3TK9A 9ESTA 1C1VH 5C5OA 5HXFA 1Z6EA 1DICA 1GI3A 5FAHA 1C2KA 1PYTD 3RLYH 2G51A 1QJ7B 2VJ1A 2H6MA 1HBTH 1ANBA 1C5MD 1P8VC 1Y59T 4ZXXH 5K0HA 4B2BA 4JYUH 2ZPRA 1P9UA 4K1EA 4TYDA 1B5GH 1V2WT 3GICB 3IITA 1CBWC 1SQAA 1N8OC 1UVPA 4ABGA 1C2EA 4KTUA 4FU8A 3ZYDA 1O2HA 4HZHA 5EPYA 2FZZA 4DW2U 1EQ9A 1LKAA 3QWCH 2XBWA 1WAYB 2D1JA 1KXDA 3NKKA 3SV9A 3LONA 1O34A 5A09A 3RXMA 3D62A 1MTSA 3PO1B 1ESTA 1QBVH 3EDXB 5IYTA 2UUJB 1YC0A 3GCHB 3SJ8A 2JH0D 3DHKH 4IW4E 2NU1E 3MNCA 3KN2A 3E8LA 2ODYB 5EQQA 3OSYA 8GCHG 5LPEA 1DWCH 2PW8H 1GBLA 3UY9A 3TH3H 4DGJA 2NU0E 2C8XB 1FI8A 3TITA 3RXQA 2ZTXA 2F3CE 1GJ5H 1GBJA 1U6QA 4VGCC 3M5NA 1TB6H 3FANA 4NCYA 3VB3A 3S0NA 5EW1H 3QZRA 1DS2E 2AMPA 1ELBA 1AO5A 3UOUA 2W3IA 1C5VA 2FWWA 2HNTC 1EZSC 1C5NH 1O2IA 1XVMA 1IOEA 1IQFA 1O2OA 3SJ9A 4Y7BA 1EOLA 1V2LT 3EYDA 5DP8A 1HIAB 1PPGE 4B75A 1TAWA 1AQ7A 1ETRH 4A5TS 2FO9A 1O2JA 3LC3A 1MKWH 1GBIA 5PTPA 2VWMA 3RXKA 2PV9B 4WVPE 2Q6GA 3KQCA 3E0NB 2OTVA 1LPZB 3UFAA 5JBAS 5DP4A 5AFYH 2PTNA 3S9CA 2PSYA 1QJ1B 4KTSA 3ZZCA 4AFZA 3KL6A 3RMLH 2TGAA 4ABIA 2UWLA 3BV9B 1AB9B 4CBNA 2CJIA 1X7AC 3SORA 3B9FH 1P09A 2XBVA 3OTJE 1JOUB 5FX5A 4AYVB 2QXIA 1PPCE 2UUKB 1C2DA 3OY5U 1GBBA 1OWKA 3A81A 3A82A 1ZTKA 5E0HA 1J17T 3UNQA 1GI5A 2ZG0H 4JZFH 2VH0A 4BNRA 4ZHLU 3F9GA 1IQJA 1EX3A 1O2VA 1GMDF 4BAHB 1FUJA 4I31A 1TMBH 4RN6A 3GY4A 1NM6A 1ZSKA 4AB9A 2GDDA 3A83A 1JWTA 4HI3A 1THPB 2EC9H 1ZHPA 1W13U 3P8NA 1F0SA 3FAOA 2SGAA 3P8FA 3MH5A 2ZHEH 2ZQ1A 4IS5A 3M5MA 3MNSA 4XBDA 1NY22 4A1VA 4ZKRU 1CA0B 1M9UA 2R0KA 1GJ8B 1O5BB 3STIA 4MNWA 4AN7A 3SV2H 1HUTH 1A5HA 3GCTG 1O39A 1IHSH 1RTFB 1SB1H 1VJAU 5DK1A 2VVCA 1O2XA 3BG8A 2ZTYA 1BTUA 1GI4A 2VIOA 1A0LA 3HKJB 2J94A 1Y5AT 3BTKE 1DSUA 2C8YB 5G4BA 4FUHA 3UIRA 2O8LA 5JBCS 4X1RU 1TGCA 3BN9A 1THRH 2GT7A 2R3UA 1GHZA 1CBWB 1QY6A 3ODDA 4ISHH 1PQ8A 1N8OB 3F9FA 1TNKA 2BYAX 1YPHC 2RA0A 3EA9A 2JKHA 1O5EH 2ZU3A 2C93B 1SFIA 2Q6FA 1P10A 3I77A 3C1KA 1V2VT 5C3NA 3TIUA 3URDA 4JYTA 1OP8A 3KEEA 2A2XH 1CHOF 1YCPM 1A1RA 1E36B 5J4SA 3A8AA 3KQBA 1O2TA 4DOQA 1TMUH 2BD7A 1UK3A 1XUFA 1GJ6A 3DA9B 4FVDA 3TU7H 4CHAC 1QB6A 3Q3XA 2ODQA 1O5GH 4Q7ZA 3ZZBA 4JYVH 1P2KA 1C1QA 4DURA 1C1MA 1K28D 4B76A 1ESAA 3OX7U 1EJNA 1KTTB 2P16A 2XXLA 4VGCB 1C9TA 1WOFA 2F83A 1DSTA 1CHGA 2FX4A 2GDEH 3GDSA 1V2OT 3ATIA 4Q2KA 4DVAU 1OOKB 3WY8A 1S84A 4YTAA 3KF2A 3ZVBA 2P94A 3RXVA 1YM0A 2JH6D 1Q3XA 4K2YA 5A8ZA 2GCHG 5GWZA 1BTHH 4Q80A 1TLDA 4E06H 3VB7A 3M35A 3TPIZ 2J4IA 2FLBH 4YT6H 1ZHMA 1DM4B 2ZPQA 3FZZA 2A4GA 1DDJA 2W3KA 2ZDLA 1J9CH 3LGWA 4FUJA 2VWNA 1GVLA 5LPFA 1DE7H 1C2GA 1QB9A 1QCPA 4X8UH 3UPEA 1QRZA 1FMGA 4Z0KA 4YZUA 1HYLA 1Z8IB 1ZOMA 1W0ZU 1AE5A 2Y5GA 1GJ9B 2A5IA 4Y79A 3RMOH 5LH8A 3GISB 1ZMNA 1K22H 3SNCA 8LPRA 4X1SU 4ISLA 5CHAC 1GBKA 1ABJH 3RXBA 3S7HB 4X6MA 1PFXC 1W2KH 4MDSA 4NA7A 2A4QA 1QJ6B 4CBOA 1BTPA 2D8WA 4NZQA 4YLUA 1PJPA 2TPIZ 3BTDE 3NCLA 2J2UA 5DPAA 3MI4A 3RXEA 4DIIH 1MAYA 1O2UA 2ZHDA 3PB1E 2VWLA 2A5KA 1TNGA 1O3NA 3UWJH 1K1LA 1HJ9A 1RIWC 1FLEE 1H1BA 4B71A 1A2CH 1GMHF 1LQDB 2F91A 2AGEX 1C2LA 1P11E 1FJSA 1A3BH 4WH8A 1O2LA 4X8VH 2GVFA 2YNAA 2FOEA 1RJXB 4MPWA 3A88A 1SLUB 2XRCA 3LDXH 3EE0B 2WPLS 1BHXB 1F2SE 1G3CA 3LGIA 3DT0H 4NIYA 1O5AB 1BRBE 1C1UH 2ANMH 2A4OA 3SW2B 4AFSA 1DXPA 5ESBA 4E7RG 1G30B 2FYQA 4XBCA 4B74A 1FIZA 4TPIZ 1LHDH 2BHGA 3ZVCA 1LHFH 5C5NA 2FPZA 1K1JA 3BTEE 3NK8A 3GY7A 1MAXA 2FOBA 1SOTA 3MU8A 1TE0A 1O3EA 5AHGH 3SJKA 4CR9A 3NUMA 1O37A 4AZ2B 1SSXA 1HAZB 4ZMAH 4JMYA 5DGJA 2FDAA 1SGNE 1MQ5A 3ATLA 3RXIA 1YPMH 3RM0H 1ZTJA 2RG3A 2ZWLH 1QR3E 2FOGA 2FXRA 1ZYOA 2Y82A 3TNTA 1MMJN 5L2YH 1TRMA 2A7HA 1AFQC 4THNH 3TJVA 3A85A 3PM3A 2B9LA 4H6TA 1P2NA 1XM1A 3DFJA 2Z9KA 2FLRH 1WSSH 1VGCC 4CHAB 3V12A 1ZRBA 1NU9A 2H5CA 2F9OA 1DANH 5I25A 4I7YH 3ZVAA 2AERH 1S5SA 1AZZA 1P2MA 1GJAB 1VCQA 3M3VA 4Y11E 1Y3WA 1O3CA 3DFLA 1C2HA 3M61U 2F9PA 4OS4A 2BY8X 5EQSA 1EAXA 1O2GH 1HAOH 1YLDA 5GCHF 1O32A 4X1NU 1AVXA 1ZGVA 1C2JA 3HKIB 2GD4B 3E16B 1O3DA 1Y3UA 1SGEE 2BZAA 3RXPA 3A7XA 3LT3A 2V3HH 5F8TA 4NIWA 1VCWA 1C1NA 2ZA5A 5E0GA 1S85A 1Z8GA 2HPPH 2QCYA 4ZKOU 2Y80A 1QQUA 2HNTF 3CP7A 4ZKSU 4OGYA 4B1TA 1KXFA 1P0SH 2BMGB 2CF8H 1P3CA 2ESTE 1P03A 3D23A 2VNTA 3QUMP 2SNVA 1C2IA 2Z9JA 4X6OA 2Y7ZA 1AMHA 1GI1A 1VITF 1E0FD 1V2RT 1QQ4A 1XUJA 3M7TA 4AYYB 3QLPH 3KIDU 1T8NA 3HK3B 1LHEH 2C4FH 1S6FA 1RRKA 4D9RA 4JZ1A 1KXBA 3GCNA 1D3QB 3MNBA 1L1JA 1EUFA 1O3OA 3SI3H 1RS0A 2DE9A 1GBAA 1MH0A 2ZFPH 1YPLH 7KMEH 2BOHB 1ZGIA 5CHAB 5FPSA 1GHWH 3O8CA 5E2OA 1E34B 1GL0E 3QDZB 1HB0B 1DXWA 4R0IA 1SGTA 1SGCA 1KSNA 1KLJH 1K1PA 4BTUB 1EB2A 3KQDA 1ELAA 1SC8U 2BDCA 1E38B 3BTWE 2EI7A 2ZF0H 1DOJA 3BTHE 1C2FA 3IWMA 1GI2A 2OCVB 1DITH 4CH8B 2VIWA 3L3TA 1RTLA 1RIWB 4X6PA 2B8OH 2TRMA 3M5OA 1YF4A 5B6OA 3LOXA 4ZUHA 1ORFA 3V0XA 2BOKA 3MTYA 4I32A 2P95A 5BPEA 1CA8B 2BD4A 4GSOA 1T7CA 1UVUH 4NFFA 5ETXA 3O8RA 3CS7A 1C5UA 3GYLB 1ID5H 1O2MA 2UUYA 1ELFA 2CGAA 5JB8S 1PYTC 4NSVA 1KDQA 1XUGA 3PMHB 1HIAA 5JBTA 4K8BA 3CENA 1ZHRA 2GT8A 3G01A 4J2YB 2TGTA 1TQ7B 1SHYA 4INLA 4F4OC 1ZTLA 1P2OA 2YNBA 2EI8A 2GV6A 1J16A 3F68H 1HAPH 2R0LA 4KKDA 1BHXF 1PQAA 1W7GH 1ANDA 3NZIA 1OYTH 1SI5H 1SQTA 3SV7A 4K60A 3BTME 1L4DA 4Q7XA 1ZPBA 2Q6DA 3VB4A 2VIVA 1VITH 1ANCA 1MTVA 1V2QT 1WV7H 2UWOA 1GHVH 2VH6A 2PGBB 1GBCA 3L6PA 2ZC9H 3ENSB 2FS9A 4GPGA 1D4PB 1MZDA 3HGNA 2GP9B 1GMDG 1OWIA 3UOPA 1V2UT 3KNXA 4RSPA 2GMTC 1GMCF 1G3EA 3HK6B 2SFAA 1MBMA 1VGCB 3P92A 4UONA 1MKWK 2WPHS 4BAMB 5AVDA 5FHTA 3QK1A 1UK4A 2UUFB 1TA2A 1K2I1 3ZZAA 3MO9A 4Z6AH 4ZKNU 5HM9A 1HCGA 6ESTA 1YPKH 2FX6A 2A0QB 2OC7A 1B0EA 3LC5A 4NIVA 4OS7A 4CR5A 1FONA 2A31A 2V3OH 3RXCA 4ABBA 2V0BA 2FI3E 4Y76A 1A5IA 2ILNA 3ATMA 1TQ0B 1HLTH 2AS9A 2FOMB 5FX6A 1AKSA 3SQEE 2ZGCA 1B0FA 3EAJA 1SMFE 3E1XB 7GCHG 3LPRA 3ZVFA 4FUCA 3K9XB 3MMGA 1YLCA 4KGAA 1AIXH 2WPIS 3PYHA 3ESTA 1O3KA 2P8OC 3MU1A 5FBEA 1GJ4H 1NTPA 2BM2A 5EODA 3NWUA 1LDTT 3TJOA 5JB9S 1SGFA 2FS8A 1TMTH 1ARCA 1HFDA 1KDQB 1A0JA 3PLPA 1H9LB 1IQNA 3UR9A 2PUQH 3FZDA 3RC5A 1O2KA 2WV4A 3LGVA 3VB5A 1QNJA 4R8TB 1NZQH 2ZDNA 2G5VA 4I8JA 4OS5A 3RXAA 1G3DA 2FOHA 3PLBA 1WBGB 3SHAH 2RDLA 4K1SA 1CHOG 3SO3A 1S82A 2WUBA 1W7XH 6GCHF 2FODA 2XTTB 1O36A 1QA7A 1H9HE 2ZCKP 1UTOA 1VCPA 2FESH 3SNBA 1J15A 1FY3A 2VVVA 3MU5A 3RC6A 2V35A 1SQOA 2CXVA 3AW1A 1PPEE 1UHBA 4FUFA 3T27A 4O3UA 5EU8A 1GHAF 1NC6A 1BTZA 1SGRE 1VJ9U 2ZP0H 3ZZ7A 4FU7A 1GJ7B 1FAXA 1GHYH 1YPJH 4CRGA 2EEKA 4FUEA 9LPRA 3QN7A 3E0PB 1P12E 1C5WB 3BTTE 1FZZA 1ABIH 4JCNA 1S6HA 1S81A 1NRSH 1MBQA 1DY9A 1BTWA 1ZSLA 4TWYA 1E35B 3RXRA 4BXWA 4XOJA 4X8SH 1GJBB 3E3TA 4MTBA 1TNIA 3LGUA 3VXEH 1O5DH 2B0FA 1CT4E 1CGHA 3OU0A 3SU4A 1NT1A 4O9VA 2QAAA 3D49H 2DUCA 2OC0A 4A92A 2A2QH 2QV1A 2G4UA 3SV8A 2QN5T 1GI7B 2XBYA 5I46H 3CS0A 1CE5A 4A1XA 1LHCH 1AKSB 1WUNH 4NWKA 2BVXH 3VFEA 5HMAA 3U1IB 1O5FH 2R2MB 4X6NA 4DJZB 3S9AA 2WV5A 5EGMA 5SGAE 2XWBI 1BBRK 1DWBH 1UJ1A 1HAVB 1RFNA 1ARBA 2A32A 2W7UA 3A86A 1Z1JA 2HRVA 4X1QU 4GHQA 1LVOA 1UVSH 2CMYA 3U8OH 3GY5A 1GBEA 2NU2E 4XDEA 5E8EH 1P2IA 1A4WH 2ALVA 2GMTB 1FIWA 3KQEA 1JIRA 2TGPZ 2GKVE 8GCHF 1GBFA 2BQ6B 4YESB 1Z1IA 2GZ7A 3GY3A 2ANKH 1GHBF 1SGPE 3MHWU 1O31A 1ETTH 2O8WA 1XUHA 1V3XA 2HLCA 1GMHG 4A6LA 3R3GB 1ZZZA 4GLYA 2XCFA 1MD8A 1A0HB 1O2RA 2I6QA 3LKWA 1BT7A 3TJUA 1XVOA 4K8YA 1G9IE 4K5ZA 4WJG2 1UVTH 2YOLA 5ESTE 2C3SA 3UNSA 5F6MA 1P3EA 3V3MA 1AVWA 1GVKB 3FFGA 3HPTB 2VB0A 1W14U 1L1GA 1S0RA 3P8GA 2FI5E 2P93A 4X8TH 3SGBE 1QL7A 4Y8ZA 5C20A 1TYNA 1WTGH 4FUGA 3K6ZA 1UHBB 3BEFB 4TWWA 1TBRH 1IQKA 5TJXA 4WMEA 5DP7A 1RD3B 3NXPA 1G36A 2ZI2H 3SGQE 3FP6E 1BJVA 4D9QA 1SLXB 1KIGH 2ZHWH 4ISIH 2P8OB 1BBRH 2BXTH 3B23B 3K6YA 1ZPCA 3RXHA 8KME2 1A46H 1K1OA 3F1SB 4NZLA 2ANWA 4WMFA 1NPMA 2Z9GA 5C1UA 2SGEE 3V13A 1W3CA 1MTNC 1SPJA 2RA3A 4LOYH 1SGYE 1MTUA 1IHTH 3UTUH 2ZFSA 4LK4A 4AFQA 2BY7X 1JRTA 2OP9A 1YPGH 3BIVH 3QTOH 5L2ZH 1H9IE 4O03A 1C4V2 2Z6BD 1CU1A 1YKTA 3OYPA 1ZRKA 1TFXA 1OKXA 5EXNA 1SGQE 4CRAA 1IQLA 3AAUA 4KP0A 1V2NT 1AI8H 1A3EH 1ZMJA 2BD3A 4B2AA 4X2YA 1SGIB 3TGIE 3K2UA 1T32A 5LPRA 5FPYA 1EKBB 2ZPSA 3SU2A 5AF9H 1W8BH 3FP8E 1LMWB 4AORA 1UVOA 3BTQE 2J38A 1RGQA 4IN1A 3A7YA 2STBE 1TPAE 3SU0A 4QT8C 1GBMA 1MUEB 3LJOA 5FXLA 3ZYEA 2ZIQH 5FBIA 3SNDA 2ZNKH 2CV3A 1GGDC 1TRNA 1C4Y2 1EAWA 2BDIA 1FPHH 8ESTE 4TY6A 1YBWA 1EOJA 1Y3YA 1AE8H 1BJUA 3MO6A 1P04A 2PLXA 1PQ7A 1HGTH 4DCDA 4WWYA 4YLQH 3V7TA 1BCUH 1P2JA 3VEQB 1DVAH 2CN0H 1VITG 3I29A 4ZHAA 3SGAE 1UK2A 1J14A 1OP2A 1ACBE 1MTWA 3A7ZA 1BUIA 1GWAA 1TOCB 4XSKU 1O2WA 1JBUH 1ZJKA 5T6DA 3A84A 2FEQH 5DJ7A 3RU4D 1NRQH 2ZFFH 1MCTA 4YOIA 3RXLA 2BZ6H 2F9BH 3TVJB 1O3AA 3AAVA 1ESBA 1OX1A 3ZZ8A 1FY1A 2PKAA 3RU4T 4JZEH 1PPHE 1QHRB 1EXFA 3UNRA 4AB8A 4IC5A 1FAKH 4NIXA 2F9UA 4IC6A 3RXDA 2FM2A 3GCOA 2ZU1A 4WF8A 4E7NA 1HAGE 1N6XA 3PLKA 5F8XA 2R2WU 5EQRA 3T28A 1C1TA 1O3HA 2GZ9A 4KTCA 4UD9H 5F03A 2IOTA 4RKOB 3TLOA 2ZDVH 5FCRA 3PWBA 3A7TA 3SZNA 3VB6A 2AGIX 3E91A 3RM2H 2R9PA 1Y5BT 5A0AE 1CT0E 2Y6TA 1TALA 2AIQA 4K3JA 1L1NA 1TNLA 3RXFA 2J34A 3BF6H 3M3SA 2P3UB 3P95A 1QTFA 3FVFB 2C90B 3GY8A 5HYOA 5L6NH 2BDYA 3RXTA 1D3DB 1CT2E 1ELTA 2BX4A 4HTCH 1EAIA 1SR5C 1GBTA 1W12U 1SG8B 2DE8A 3Q3YA 1OWDA 1UTKA 5EOKA 3UR6A 4OS2A 1FY5A 1C5YB 4UFFH 7ESTE 4GAWA 4SGAE 2SGQE 1TGBA 3RXOA 1K1IA 2THFB 2XC4A 5E0JA 4WXVA 1V2ST 4MNVA 2BY5X 3RU4E 3LIWA 2J9NA 5J4QA 1LVMA 1EJAA 4X2XA 5DP9A 1MTNB 2BD5A 1S83A 2H9EH 2QF0A 1TABE 1KLIH 3SU3A 2NU4E 1L0ZA 4INHA 2UWPA 3LGYA 3PMAB 1IAUA 1Y3XA 4O3TA 2QXHA 1FDPA 2FOCA 3SUDA 3A8CA 2AH4X 1TBQH 5AFZH 3VGCC 1GCTC 1FN8A 1DWDH 1G37A 2VGCC 1JMOH 1UTJA 2WINI 3I78A 4LXBH 1SLVB 4O97A 3DUXH 2PUXB 1GI9B 1O2YA 5CMXH 3SU1A 1ZJDA 3AASA 2ZCHP 1DX5M 1TWXB 3UQVA 1ETSH 4MPUA 3RMNH 3AW0A 5F8ZA 2EA3A 5EPNA 2Y7XA 2PGQB 2BXUH 3UWIA 3ITIA 1D3PB 1KXAA 5HGGA 2BQ7B 4DT7B 1TBZH 1UCYK 1LHGH 2PKAB 2SNWA 1C9PA 2VWOA 1BBRE 4X2VA 2F9VA 1GGDB 1DPOA 1TGTA 2B5TB 3U69H 2STAE 4A7IB 1UTPA 1XUKA 3MFJA 1N6YA 1OP0A 3ATKA 3BG4C 4BOHA 1MU6B 4GCHF 3JZ1B 1FQ3A 2G00A 1YGCH 2QYIA 1Z7KA 3HGPA 2QIQA 2W7SA 2Y5HA 1GI8B 1HRTH 1OSSA 2BQWB 4ABFA 3SU6A 2ZGBH 1DWEH 3B8JA 1S0QA 5T6GA 1K21H 5H4IB 3QZQA 1GDNA 3KHVA 1RTKA 5DKMA 3RP2A 1YYY1 2ANYA 4U01A 1O0DH 3SUEA 4I33A 1Q31A 3SOSA 2GGVB 2PSXA 2BDBA 5A8YA 1CO7E 4H6SB 4BXSA 3ZV9A 2W5EA 1BZXE 4TPYA 5A0CA 1JIMA 2C8WB 2JETC 1OPHB 3MH4A 1FY8E 2Z3EA 1BDAA 2Z3DA 2Q1JA 1UCYH 2ZFQH 2P59A 1GJCB 3GOVB 1H8DH 1DLKB 2ALPA 1BQYA 3RDZA 2GCTC 1EP6A 4K1TA 4NSYA 2OXSA 1V6DA 2O8UA 5EW2H 1K1MA 3P70B 2G52A 2BD9A 1OWEA 3PWCA 1EAUA 2PR3A 1BTXA 2G5NA 4Y0ZE 4NWLA 1ELDE 2OQ5A 3ZV8A 4I8GA 3W94A 4ABHA 3PTNA 1HV7A 2VIDA 2ZFRH 3ZZDA 1TNHA 1OWHA 1O2SA 2ZHQH 1NFUA 3ZVEA 1WU1A 4FUBA 3SJOA 1BMLA 1P2QA 2Z3CA 1L2EA 2QY0B 3SNEA 3N7OA 2WUCA 1C4U2 4Y7AA 5TCCA 2FI4E 4AG1A 4DG4A 3QGJA 1O3IA 1F5KU 1H8IH 1HNEE 3ZZ5A 4IMQA 4K69A 3BTGE 2AMDA 5GIBA 1C1OA 1CGJE 3O8DA 1BTYA 1C5PA 1GVZA 1GDUA 1CQQA 1P02A 2SGDE 1HJ8A 1TPSA 1QBNA 2FTMA 2G55A 1ZPZA 2ZQ2A 1K1NA 2SGFE 1AY6H 1NFWA 4UFEH 2M5TA 1NO9H 4IN2A 5DG6A 1A61H 3KGPA 5GPIB 2XCNA 5EXMA 4IBLH 1SLWB 1QL9A 1W11U 4NA8A 1HAVA 1V2JT 1Q2WA 1C2MA 4YT7H 3LH3A 6CHAC 2OLGA 3VGCB 1GCTB 2VGCB 1HPGA 1XXDA 1YPEH 1O3BA 2BTCE 1IQGA 4ISNA 3AVZA 3KCGH 4PROA 3F9HA 4I8KA 1TPOA 3FP7E 1MZAA 1GHBG 1QFKH 3W95A 1KTSB 4MQAA 1V2TT 5DO4H 3H5CB 2RCEA 3U9AH 4Q7YA 2VINA 1SGDE 4XBBA 1LPKB 1BA8B 1NN6A 3K65B 3U8TH 1FPCH 3U8RH 3BEUA 1MU8B 1UO6A 1ZLRA 1UTQA 5JYIA 3ZZ4A 2OC1A 1OWJA 2H1UA 1C1RA 5GJ4B 1XMNB 1AZ8A 2QXJA 3H7TA 1NRPH 3BG4B 2Z9LA 1C5OH 1VR1H 3EQ0H 4FUIA 1ANEA 1JRSA 1TGNA 1AD8H 3MU4A 1WQSA 4Y0YE 2IJOB 1QRXA 1H4WA 3TGKE 2QF3A 2ZGHA 3Q76A 4JK5A 4MNYA 2EI6A 4MG3A 4UFDH 4ABJA 2FYRA 1YCPK 3Q77A 5DP6A 1TX7A 2A4RA 3SUFA 1O30A 4DY7B 5ABWA 2BVRH 2XBXA 3MOCA 4TY7A 4CRCA 3UREA 1O3PB 3SJIA 1GPZA 4B73A 1NRRH 1AWFH 2XYAA 1DLEA 3M7QA 1MQ6A 5LGOA 3QX5H 2LNCA 3EA7A 4GVUA 1UTNA 7LPRA 2H2ZA 3T5FH 4AOQA 2JETB 4J1YA 1LO6A 4ABEA 4XE4A 3F9EA 4IGDA 1EZXC 3RXUA 2AFQB 4CREA 1LPGB 1HXFH 1AHTH 2GCTB 5FCKA 1V2KT 3A7VA 1FY4A 3JZ2B 1TOMH 4A1TA 3NPSA 5JDUB 2R3YA 3MU0A 2WYJA 2IN2A 1GBDA 1J8AA 2BLQA 4JZDH 4NFEA 2FTLE 4YO9A 1G3BA 2TIOA 2K1QA 4OS6A 2Z9IA 1MD7A 1PPZA 1T8OA 2WPJS 1TIOA 2ZGJA 1HAHH 1YCPH 1TRYA 4H42U 4D8NA 2FIRH 2G4TA 3T26A 4CRDA 1AUTC 3RXJA 7GCHF 1KLTA 2ZDAH 1QBOA 3A80A 3C27B 4MPVA 1AFEH 3TJNA 1C1SA 6LPRA 1A7SA 1HDTH 1TX6A 3ZZ3A 2ZU5A 1YP9A 3RLWH 1BMMH 1IQMA 1GI0A 3L33A 2PWXA 1TONA 2QXGA 1LKBA 5A0BA 2I6SA 4WY3A 3BIUH 1LTOA 4D7FA 2ZGXH 1OS8A 1SHHB 2F9NA 2HNTE 3H7OA 4FVBA 1BRUP 1UCYE 1C5SA 4CH2B 2ZCLP 1MCVA 1ELEE 1EZUC 2Z94A 3OY6U 4UFGH 2ODPA 3TGJE 2H9TH 2ZDMA 4NA9H 1Y5UT 2HGTH 3BSQA 4CRFA 2GZ8A 4INKA 4Y8XA 5TCAA 3M37A 4BTTB 1TA6A 3SN8A 1O2QA 4NGAH 4ZAEA 1ZSJA 2ASUB 4NG9H 4WMDA 4MVNA 1VZQH 1BB0B 6CHAB 1G2LA 2BDHA 1O3JA 4FU9A 1Z8JB 4H4FA 1FXYA 4AGKA 1PPBH 3BEIB 1O3FA 3P17H 2BVSH 1EPTC 4UDWH 2D26C 1N1LA 1CGIE 5E2PA 1F0TA 3SI4H 5DP3A 4JZIA 2Y5FA 1SGFG 3F6UH 3SBKA 3S7KB 2FP7B 1P01A 1T8LA 3PROA 3RXGA 3SQHE 3DD2H 2AGGX 1XKBC 3MNXA 2XWAA 1SOZA 5C67A 3GDUA 1BMNH 2B7DH 4WXIA 2P3TB 2FOAA 2QGRA 1D6WA 1O3MA 1QB1A 3SNAA 4Y8YA 1HAXB 1UMAH 3RXSA 2Z7FE 2AYWA 3A89A 4ZH8A
chains in the Genus database with same CATH superfamily
2AIPA 1DUEA 4D76A 3R0FA 1P05A 2A5AA 3QTVH 3U98H 2FOFA 5JBBS 2OQUA 3GCTF 2BDGA 4ZHMU 1EP5A 5GCHG 2WPMS 1C1PA 1TPPA 2ULLA 3W1EA 4D7GA 4AGJA 4WH6A 4ASHA 4BTIB 1GG6C 3GY6A 1OHHD 3UQOA 4LZ1H 2EQNA 3LGTA 1F92A 2PTCE 4OGXA 3LU9B 3ZVDA 1EPTA 1Y3VA 4BAQB 4Z1MD 1ELGA 1QIXB 1INCA 1XUIA 2QF4A 4KELA 2L6OA 5CE1A 3O8BA 3Q3KA 5HKKD 1GHXH 1G32B 3RC4A 2V6NA 4OM9A 5B6LA 1DFPA 3U1JB 1WTHD 3QO6A 4BANB 1UTLM 1F5LA 5L30H 1K9OE 1AN1E 1EJMA 2IPHA 1FN6A 2OD3B 3P8OA 5DP5A 3S9BA 4B2CA 4ABAA 4FUDA 2ZTZA 1AU8A 3MH7A 4UEHH 2QA9E 2LPRA 2HOBA 2JH5D 1TX8A 1ELCA 1HJAC 2PKSC 1YPHE 1V2PT 1SFQB 1O33A 2XC0A 2CHAC 2ZKSA 1Z6JH 3T29A 1WQVH 3LH1A 3PMJA 1C1WH 5C1XA 1CSOE 1AUJA 3E6PH 2XW9A 4Y10E 3M5LA 4JK6A 1BITA 1HXEH 3P6ZB 3LJJA 3S69A 3ELAH 1SBWA 3GDVA 4MPXA 1NS3A 2AEIH 1O2ZA 4GUXA 1GCDA 2OINA 1G2MA 1JXPA 1C5LH 1F5RA 1GDQA 4XD7D 2RFKC 1YY3A 1EASA 1IQIA 2SGPE 5C1YA 1GBHA 3D65E 1HAIH 4GCHG 1AGJA 3ZVGA 4YOJA 1QA0A 2G8TA 4ISOA 4SGBE 4AFUA 4RI0A 5A2MH 2J95A 3VXFH 4X2WA 1NRNH 4GHTA 3RMMH 5C2ZA 3SUGA 2GTBA 1FNIA 3HATH 1NU7B 3A8BA 1DUAA 1LQEA 1LVYA 1P57B 2XNIA 3A7WA 2A7CA 3VG8A 3URCA 2ZZUH 4M7GA 2ZHFH 3SV6A 1BRAA 3MYWA 4X0WU 2VIPA 5T3HA 4BAOB 4AG2A 1KY9A 1A5GH 2GCHF 5GXPA 2KAIA 2C8ZB 2PFEA 1WDIA 2A1DB 1BOQA 1THSH 3MH6A 1C5TA 1O5CB 2GV7A 2GX4A 1QRWA 1TGSZ 2AMQA 1D3TB 1E79D 4FXGH 1TNJA 4ZROA 2OUAA 3Q00A 1NBMD 1XXFA 1EZQA 4UE7H 2BB4A 1QL8A 3TH4H 2BDAA 2V3MA 4HFPB 3E90B 1C5ZB 1NROH 1T31A 1ZR0A 3A87A 4LZ4B 3IG6B 3WW7A 3M7UA 5FL7D 3EA8A 1F0UA 1MKXK 1XX9A 1QURH 3PRBA 5EXLA 1EPTB 4CRBA 4RKJB 1D6RA 3GY2A 2BLWA 1C5XB 2VIQA 2ZECA 2OBQA 3PO1C 4U32A 1P9SA 2PHBA 2NWNA 2O9QA 3M36A 1BIOA 2G81E 3PMBB 3GCHC 1XKAC 3TK5A 1NFYA 1UTMA 1DT2A 2BY9X 5A8XA 1T4VH 1IQHA 4AX9H 3A8DA 4Y71A 1GMCG 1ZMLA 3T2NA 1O35A 1O38A 3PV4A 2XC5A 1NFXA 1PQ5A 5BRRE 3RUOA 4X1PU 3T25A 1EATA 1L4ZA 1AFQB 3T62A 5GDSH 4Y6DA 4E05H 1C5RA 2ZO3H 5K7RA 3TNSA 2ZFTA 1F0RA 1T4UH 4OS1A 2VU8E 2WYGA 1E37B 1AWHB 2BLVA 2HVXA 1LVBA 1DY8A 5FPTA 3M3TA 1V2MT 1O2NA 1F7ZA 2WPKS 1PPFE 3PTBA 1GG6B 1C5QA 1EB1H 3BTFE 2YMSD 2CF9H 3TK6A 1KXCA 3TH2H 4XFQA 2VBCA 3N7DA 3ODFA 1T8MA 5JPMH 2O8MA 1Y8TA 3F0OA 1MKXH 3U28C 4U30A 1FV9A 1NBME 3UUZA 1W0YH 2H9HA 2QC2A 2HALA 1NESE 2BY6X 4I8LA 1GI6A 4MLFB 2ZU2A 2HWLB 3GYMA 1HAYB 4DIHH 2OC8A 2P3FH 4F49A 1AB9C 2D2DA 2TBSA 3MWIU 1ELVA 2O8TA 1O2PA 1HJAB 2KAIB 2PKSB 1WYKA 2A45B 1SL3A 5HM2A 3ZZ6A 2CHAB 1OXGA 2Y81A 3MO3A 1KYNA 2HPQH 3SU5A 3QGNB 1LCYA 1RXPA 1CVWH 2KX4A 1OYQA 2ZEBA 4HGCA 2K0QA 2BD8A 2H5DA 1D9IA 1SVPA 6GCHG 1AVGH 3STJA 2VVUA 3VPKA 1O3GA 4I8HA 1O3LA 2FMJA 4U2WA 2J92A 2BLOA 1P06A 4YOGA 3ATWA 5T6FA 4IMZA 4BAKB 1BRCE 2W26A 4ESTE 1GL1A 1B7XB 3ZZ9A 1Z71A 3SHCH 2A7JA 3N7EA 4MNXA 1BMAA 4ZXYH 1CA0C 5EG4A 1Z8RA 2BD2A 2BX3A 4ABDA 1GHAG 2ZU4A 4YM9A 2JIZD 2TGDA 1GJDB 2OBOA 1KXEA 1W10U 1QGFA 1IQEA 2NU3E 3EGKH 1WCZA 5IDKA 2ZDKA 3TK9A 9ESTA 1C1VH 5C5OA 5HXFA 1Z6EA 1DICA 1GI3A 5FAHA 1C2KA 1PYTD 3RLYH 2G51A 1QJ7B 2VJ1A 2H6MA 1HBTH 1ANBA 1C5MD 1P8VC 1Y59T 4ZXXH 5K0HA 4B2BA 4JYUH 2ZPRA 2F43B 1P9UA 4K1EA 4TYDA 1B5GH 1V2WT 3GICB 3IITA 1CBWC 4TSFD 1SQAA 1N8OC 1UVPA 4ABGA 1C2EA 4KTUA 4FU8A 3ZYDA 1O2HA 4HZHA 5EPYA 2FZZA 4DW2U 1FX0B 1EQ9A 1LKAA 3QWCH 2XBWA 1WAYB 2D1JA 1KXDA 3NKKA 3SV9A 3LONA 1O34A 5A09A 3RXMA 4ZCNA 3D62A 1MTSA 3PO1B 1ESTA 1QBVH 3F0PA 3EDXB 2QE7D 5IYTA 2UUJB 1YC0A 3GCHB 3SJ8A 2JH0D 3DHKH 2W6ID 4IW4E 2NU1E 3MNCA 3KN2A 3E8LA 2ODYB 5EQQA 3OSYA 8GCHG 5LPEA 1DWCH 2PW8H 3FO8D 1GBLA 3UY9A 3TH3H 4DGJA 2NU0E 2C8XB 1FI8A 3TITA 3RXQA 2ZTXA 2F3CE 1GJ5H 1GBJA 1U6QA 4VGCC 3M5NA 1TB6H 3FANA 4NCYA 3VB3A 3S0NA 5EW1H 1YWUA 3QZRA 1DS2E 2AMPA 1ELBA 1AO5A 3UOUA 2W3IA 1C5VA 2FWWA 2HNTC 1EZSC 1C5NH 1O2IA 1XVMA 1IOEA 1IQFA 1O2OA 3SJ9A 4Y7BA 1EOLA 1QZ8A 1V2LT 3EYDA 5DP8A 1HIAB 1PPGE 4B75A 1TAWA 1AQ7A 1ETRH 4A5TS 2FO9A 4XRNA 1O2JA 3LC3A 1MKWH 1GBIA 5PTPA 2VWMA 3RXKA 2PV9B 4WVPE 2Q6GA 3KQCA 3E0NB 2OTVA 1LPZB 3UFAA 5JBAS 5DP4A 5AFYH 2PTNA 3S9CA 2PSYA 1QJ1B 4KTSA 3ZZCA 4AFZA 3KL6A 3RMLH 2TGAA 4ABIA 2UWLA 3BV9B 3OAAD 1AB9B 4CBNA 2CJIA 1X7AC 2CK3D 3SORA 3B9FH 1P09A 2XBVA 3OTJE 1JOUB 5FX5A 4AYVB 2QXIA 1PPCE 2UUKB 3OE7D 1C2DA 3OY5U 3MQKC 1GBBA 1OWKA 3A81A 3A82A 1ZTKA 5E0HA 1J17T 3UNQA 1GI5A 2KCAA 2ZG0H 4JZFH 2VH0A 4BNRA 4ZHLU 3F9GA 1IQJA 1EX3A 1O2VA 1GMDF 4BAHB 1FUJA 4I31A 5DN6D 1TMBH 4RN6A 3GY4A 2LP6A 1NM6A 1ZSKA 4AB9A 2GDDA 2JJ1D 1JWTA 3A83A 1THPB 4HI3A 2EC9H 5C94A 1ZHPA 1W13U 3P8NA 1F0SA 3FAOA 2SGAA 3P8FA 3MH5A 2ZHEH 2ZQ1A 4IS5A 3M5MA 3MNSA 4XBDA 1NY22 4A1VA 4ZKRU 1CA0B 1M9UA 2R0KA 1GJ8B 3N99A 1O5BB 3STIA 4MNWA 4AN7A 3SV2H 1HUTH 1A5HA 3GCTG 5KECA 1O39A 1IHSH 1BMFD 1RTFB 1SB1H 1VJAU 5DK1A 2VVCA 1O2XA 3BG8A 2ZTYA 1BTUA 1GI4A 2VIOA 5IK2D 1A0LA 3HKJB 4Q63A 2J94A 1Y5AT 3BTKE 1DSUA 2C8YB 5G4BA 4FUHA 3UIRA 2O8LA 5JBCS 4X1RU 1TGCA 3BN9A 5DSFA 1THRH 2GT7A 2R3UA 1GHZA 1CBWB 1QY6A 3ODDA 4ISHH 1PQ8A 1N8OB 3F9FA 1TNKA 2BYAX 1YPHC 2RA0A 3EA9A 2JKHA 1O5EH 2ZU3A 2C93B 1SFIA 2Q6FA 1P10A 3I77A 3C1KA 1V2VT 5C3NA 3TIUA 3URDA 4JYTA 1OP8A 3KEEA 2A2XH 1CHOF 1K0HA 1YCPM 1A1RA 1E36B 5J4SA 3A8AA 3KQBA 1O2TA 4DOQA 2V7QD 1TMUH 2WV9A 2BD7A 1UK3A 1XUFA 2KCPA 1GJ6A 3DA9B 4FVDA 3TU7H 4CHAC 1QB6A 3Q3XA 2ODQA 1O5GH 4Q7ZA 3ZZBA 4JYVH 1P2KA 1C1QA 4DURA 1C1MA 3F2GA 1K28D 4B76A 1ESAA 3OX7U 1EJNA 1KTTB 3FKSD 2P16A 2XXLA 4VGCB 1C9TA 1WOFA 2F83A 1DSTA 1CHGA 2FX4A 2GDEH 3GDSA 1V2OT 3ATIA 4Q2KA 4DVAU 1OOKB 3WY8A 1S84A 4YTAA 3KF2A 3ZVBA 2P94A 3RXVA 1YM0A 4RT1A 2JH6D 1Q3XA 4K2YA 5A8ZA 2GCHG 5GWZA 1BTHH 4Q80A 1TLDA 4FOUC 4E06H 3VB7A 3M35A 3TPIZ 2J4IA 2FLBH 2QF5A 3OTPA 1ZHMA 1DM4B 4YT6H 2ZPQA 3FZZA 3SYJA 2A4GA 4P00A 1DDJA 2W3KA 2ZDLA 1J9CH 3LGWA 4FUJA 2VWNA 1GVLA 1VKYA 5LPFA 1DE7H 1C2GA 1QB9A 1QCPA 4X8UH 3UPEA 1QRZA 1FMGA 4Z0KA 4YZUA 1HYLA 1Z8IB 1ZOMA 1W0ZU 1AE5A 2Y5GA 1GJ9B 2A5IA 4Y79A 3RMOH 5LH8A 3GISB 1ZMNA 1K22H 3SNCA 8LPRA 4X1SU 4ISLA 5CHAC 1GBKA 1ABJH 3RXBA 3S7HB 1H8HD 2XNDD 4X6MA 1PFXC 1W2KH 4MDSA 4NA7A 2GJGA 2A4QA 1QJ6B 4CBOA 1BTPA 2D8WA 4NZQA 4FETA 4YLUA 1PJPA 2TPIZ 3BTDE 3NCLA 2J2UA 5DPAA 3MI4A 3RXEA 4DIIH 1MAYA 1O2UA 2ZHDA 3PB1E 2VWLA 2A5KA 1TNGA 1O3NA 3UWJH 1K1LA 1HJ9A 1RIWC 1FLEE 1H1BA 4B71A 4ACBA 1A2CH 1GMHF 1LQDB 2F91A 2AGEX 1C2LA 1P11E 1FJSA 1A3BH 4WH8A 1O2LA 4X8VH 3DSOA 2GVFA 2YNAA 2FOEA 1RJXB 4MPWA 3A88A 1SLUB 2XRCA 3LDXH 1E1QD 3EE0B 2WPLS 1BHXB 1F2SE 2KCYA 1G3CA 3LGIA 3DT0H 4NIYA 1O5AB 1BRBE 1C1UH 2ANMH 2HLDD 2A4OA 3SW2B 4AFSA 1DXPA 5ESBA 4E7RG 1G30B 2FYQA 4XBCA 4B74A 1FIZA 4TPIZ 1LHDH 2BHGA 3ZVCA 1LHFH 5C5NA 2FPZA 1K1JA 3BTEE 3NK8A 3GY7A 1MAXA 2FOBA 1SOTA 3KYGA 3MU8A 1TE0A 1O3EA 5AHGH 3SJKA 4CR9A 3NUMA 1O37A 4AZ2B 1SSXA 1HAZB 4ZMAH 4JMYA 5DGJA 2FDAA 1SGNE 1MQ5A 3ATLA 3RXIA 1YPMH 3RM0H 1ZTJA 2WPDD 2RG3A 2ZWLH 1QR3E 2FOGA 2FXRA 1ZYOA 2Y82A 3TNTA 1MMJN 5L2YH 1TRMA 2A7HA 1AFQC 4THNH 3TJVA 3A85A 3PM3A 5HIZA 2B9LA 4H6TA 1P2NA 1XM1A 3DFJA 2Z9KA 2FLRH 1WSSH 1VGCC 4F48B 4CHAB 3V12A 1ZRBA 1NU9A 2H5CA 2F9OA 1DANH 5I25A 5HIYA 2LELA 4I7YH 3ZVAA 2AERH 1S5SA 1AZZA 1P2MA 1GJAB 1VCQA 3M3VA 4Y11E 1Y3WA 1O3CA 2JJ2D 3DFLA 1C2HA 4Q4LA 3M61U 2F9PA 4OS4A 2BY8X 5EQSA 4HG6A 1EAXA 1O2GH 1HAOH 1YLDA 2YMSC 5GCHF 1O32A 4X1NU 1AVXA 1ZGVA 1C2JA 3HKIB 2GD4B 3E16B 1O3DA 1Y3UA 1SGEE 2BZAA 3RXPA 3A7XA 3LT3A 2V3HH 5F8TA 4NIWA 1VCWA 1C1NA 2ZA5A 5E0GA 1S85A 1Z8GA 2HPPH 2QCYA 4ZKOU 2Y80A 1QQUA 2HNTF 3CP7A 4ZKSU 4OGYA 4B1TA 1KXFA 1P0SH 2BMGB 2CF8H 1P3CA 2ESTE 1P03A 3D23A 2VNTA 3QUMP 2SNVA 1C2IA 2Z9JA 4X6OA 2Y7ZA 1AMHA 1GI1A 1VITF 1E0FD 1V2RT 1QQ4A 1XUJA 3M7TA 4AYYB 3QLPH 3KIDU 1T8NA 3HK3B 1LHEH 2C4FH 1S6FA 1RRKA 4D9RA 4JZ1A 1KXBA 3GCNA 1D3QB 3MNBA 1L1JA 1EUFA 1O3OA 3SI3H 1RS0A 2DE9A 1GBAA 1MH0A 2ZFPH 1YPLH 7KMEH 2BOHB 1ZGIA 5CHAB 5FPSA 5C0TA 1GHWH 3O8CA 5E2OA 1E34B 1GL0E 3QDZB 2F4LA 1HB0B 1DXWA 4R0IA 1SGTA 3H09A 1SGCA 1KSNA 1KLJH 1K1PA 1KMHB 4BTUB 1EB2A 3KQDA 1ELAA 5T1VA 1SC8U 2BDCA 1E38B 3BTWE 2EI7A 2ZF0H 1DOJA 4B6EA 3BTHE 1C2FA 3IWMA 1GI2A 2OCVB 1DITH 4CH8B 2VIWA 3L3TA 1RTLA 1RIWB 4X6PA 2B8OH 5F53A 2TRMA 3M5OA 1YF4A 5B6OA 3LOXA 4ZUHA 1ORFA 3V0XA 2BOKA 3MTYA 4I32A 2P95A 5BPEA 1CA8B 2BD4A 4GSOA 1T7CA 1UVUH 4NFFA 5ETXA 4F55A 3O8RA 3CS7A 1C5UA 3GYLB 1ID5H 1O2MA 2UUYA 1ELFA 2CGAA 5JB8S 1PYTC 4NSVA 1KDQA 1XUGA 3PMHB 1HIAA 5JBTA 4K8BA 3CENA 1ZHRA 2GT8A 3G01A 4J2YB 2TGTA 1TQ7B 1SHYA 4INLA 4F4OC 1ZTLA 1P2OA 2YNBA 2EI8A 2GV6A 1J16A 3F68H 1HAPH 2R0LA 4KKDA 1BHXF 1PQAA 1W7GH 1ANDA 2RDEA 2W6JD 3NZIA 1OYTH 1SI5H 1SQTA 3SV7A 4K60A 3BTME 1L4DA 4Q7XA 1ZPBA 2Q6DA 3VB4A 2VIVA 1VITH 3UAIC 1ANCA 1MTVA 1V2QT 1WV7H 2UWOA 1GHVH 2VH6A 2PGBB 1GBCA 3L6PA 2WHXA 2ZC9H 3ENSB 2FS9A 4GPGA 1D4PB 1MZDA 3HGNA 2GP9B 1GMDG 1OWIA 3UOPA 1V2UT 3KNXA 4RSPA 2GMTC 1GMCF 1G3EA 3HK6B 2SFAA 1MBMA 1VGCB 3P92A 4UONA 1MKWK 2WPHS 4BAMB 5AVDA 5FHTA 3QK1A 1UK4A 2UUFB 1TA2A 1K2I1 3ZZAA 3MO9A 4Z6AH 3FOAA 4ZKNU 1HCGA 6ESTA 5HM9A 1YPKH 2FX6A 2A0QB 2OC7A 1B0EA 3LC5A 4NIVA 4OS7A 4ACAA 2YMSB 4CR5A 1FONA 2A31A 2V3OH 3RXCA 4ABBA 2V0BA 2FI3E 4Y76A 1A5IA 2ILNA 3ATMA 1TQ0B 1HLTH 2AS9A 2XOKD 3UB0A 2FOMB 5FX6A 1AKSA 3SQEE 2ZGCA 1B0FA 3EAJA 1SMFE 3E1XB 7GCHG 3LPRA 2L74A 4FUCA 3ZVFA 3K9XB 3MMGA 1YLCA 4KGAA 1AIXH 2WPIS 3PYHA 2OK5A 3ESTA 1O3KA 2P8OC 3MU1A 5FBEA 1GJ4H 2J98B 1NTPA 2BM2A 5EODA 3NWUA 3F3BA 1LDTT 3TJOA 5JB9S 1SGFA 2FS8A 1TMTH 4B6FA 1ARCA 1HFDA 1KDQB 1A0JA 3PLPA 1H9LB 1IQNA 3UR9A 2PUQH 3FZDA 3RC5A 1O2KA 2WV4A 3LGVA 3VB5A 1QNJA 4R8TB 1NZQH 2ZDNA 2G5VA 4I8JA 4OS5A 3RXAA 1G3DA 2FOHA 3PLBA 1WBGB 3SHAH 2RDLA 4K1SA 1YLNA 1CHOG 3SO3A 1S82A 2WUBA 1W7XH 6GCHF 2FODA 2XTTB 3SZEA 1O36A 1QA7A 3F2HA 1H9HE 2ZCKP 1UTOA 1VCPA 2FESH 3SNBA 1J15A 1FY3A 2VVVA 3MU5A 3RC6A 2V35A 1SQOA 2CXVA 3AW1A 1PPEE 1UHBA 4FUFA 3T27A 4O3UA 5EU8A 1GHAF 1NC6A 1W0JD 1BTZA 1SGRE 1VJ9U 2ZP0H 3ZZ7A 4FU7A 1GJ7B 1FAXA 1GHYH 1YPJH 4CRGA 3DCLA 2EEKA 4FUEA 9LPRA 3QN7A 3E0PB 1P12E 1C5WB 2IJD1 2PP6A 3BTTE 1FZZA 1ABIH 4JCNA 1S6HA 1S81A 1W0KD 1NRSH 1MBQA 1DY9A 1BTWA 1ZSLA 4TWYA 1E35B 3RXRA 4BXWA 4XOJA 4X8SH 1GJBB 3KQ5A 3E3TA 4MTBA 1TNIA 3LGUA 3VXEH 1O5DH 2B0FA 1CT4E 1CGHA 3OU0A 3SU4A 1NT1A 4O9VA 2QAAA 3D49H 2DUCA 2OC0A 4A92A 2A2QH 2QV1A 2G4UA 3SV8A 2QN5T 1GI7B 2XBYA 5I46H 4P02A 3CS0A 1CE5A 4A1XA 1LHCH 1AKSB 1WUNH 4NWKA 2BVXH 3VFEA 5HMAA 3U1IB 5EJ1A 1O5FH 2R2MB 4X6NA 4DJZB 3S9AA 2WV5A 5EGMA 3GS9A 2XWBI 1BBRK 1DWBH 5SGAE 1UJ1A 1HAVB 1RFNA 1ARBA 2A32A 2W7UA 3A86A 1Z1JA 2HRVA 4X1QU 4GHQA 1LVOA 1UVSH 2CMYA 3U8OH 3GY5A 1GBEA 2NU2E 4XDEA 5E8EH 1P2IA 1A4WH 2ALVA 2GMTB 1FIWA 3KQEA 1JIRA 2TGPZ 2GKVE 8GCHF 1GBFA 2BQ6B 4YESB 1H8ED 1Z1IA 2GZ7A 2ANKH 3GY3A 1GHBF 1SGPE 3MHWU 1O31A 1ETTH 2O8WA 1XUHA 2WZQA 1V3XA 2HLCA 1GMHG 4A6LA 3R3GB 1ZZZA 4GLYA 2XCFA 1MD8A 1A0HB 1O2RA 2I6QA 3LKWA 1BT7A 3TJUA 1XVOA 4K8YA 1G9IE 4K5ZA 4WJG2 1UVTH 2YOLA 5ESTE 2C3SA 3UNSA 5F6MA 1P3EA 3V3MA 1AVWA 1GVKB 3FFGA 3HPTB 2VB0A 1W14U 1L1GA 1S0RA 3P8GA 2FI5E 2P93A 4X8TH 3SGBE 1QL7A 4Y8ZA 5C20A 2AHME 1TYNA 1WTGH 4FUGA 3K6ZA 1UHBB 3BEFB 2EY4C 1TBRH 4TWWA 1IQKA 5TJXA 4WMEA 5DP7A 1RD3B 3NXPA 1G36A 2ZI2H 3SGQE 3FP6E 1BJVA 4D9QA 1SLXB 1KIGH 2ZHWH 4ISIH 2P8OB 1BBRH 2BXTH 3B23B 3K6YA 1ZPCA 3RXHA 8KME2 1A46H 1K1OA 3F1SB 4NZLA 2ANWA 4WMFA 1NPMA 2Z9GA 5C1UA 2SGEE 3V13A 1W3CA 1MTNC 1SPJA 2RA3A 4LOYH 1SGYE 1MTUA 1IHTH 3UTUH 2ZFSA 4LK4A 4AFQA 2BY7X 1JRTA 1E1RD 1YPGH 2OP9A 3BIVH 3QTOH 5L2ZH 1H9IE 4O03A 1C4V2 2Z6BD 2K8IA 1CU1A 1YKTA 3OYPA 1ZRKA 1TFXA 1OKXA 5EXNA 1SGQE 4CRAA 1IQLA 3AAUA 4KP0A 1V2NT 1AI8H 1A3EH 1ZMJA 2BD3A 4B2AA 4X2YA 1SGIB 3TGIE 3K2UA 1T32A 5LPRA 5FPYA 4M9FA 1EKBB 2ZPSA 3SU2A 5AF9H 1W8BH 4DT4A 3FP8E 1LMWB 4AORA 1UVOA 3BTQE 2J38A 1RGQA 4IN1A 3A7YA 2STBE 1TPAE 3SU0A 4QT8C 1GBMA 1MUEB 3LJOA 5FXLA 3ZYEA 2ZIQH 5FBIA 3SNDA 2ZNKH 2CV3A 1GGDC 1TRNA 1C4Y2 1EAWA 2BDIA 1FPHH 8ESTE 4TY6A 1YBWA 1EOJA 1Y3YA 1AE8H 1S6LA 1BJUA 3MO6A 1P04A 2PLXA 1PQ7A 1HGTH 4DCDA 4WWYA 4YLQH 3V7TA 1BCUH 1P2JA 3VEQB 1DVAH 2CN0H 1VITG 1EFRD 3I29A 4ZHAA 3SGAE 2KFWA 1UK2A 1J14A 1OP2A 1ACBE 1MTWA 3A7ZA 1BUIA 5C17A 1GWAA 1TOCB 4XSKU 1O2WA 1JBUH 1ZJKA 5T6DA 3A84A 1MABB 2FEQH 5DJ7A 3RU4D 1NRQH 3OEED 2ZFFH 1MCTA 4YOIA 3RXLA 2BZ6H 2F9BH 3TVJB 1O3AA 3AAVA 1ESBA 1OX1A 3ZZ8A 1FY1A 2PKAA 3RU4T 4JZEH 1PPHE 1QHRB 1EXFA 3UNRA 4AB8A 4IC5A 1FAKH 4NIXA 2F9UA 4IC6A 3RXDA 2FM2A 3GCOA 2ZU1A 4WF8A 4E7NA 1HAGE 1N6XA 3PLKA 5F8XA 2R2WU 5EQRA 3T28A 1C1TA 1O3HA 2GZ9A 2IPQX 4KTCA 4UD9H 5F03A 2IOTA 4RKOB 3TLOA 2ZDVH 5FCRA 4ASUD 3PWBA 3A7TA 3SZNA 3VB6A 2AGIX 3E91A 3RM2H 3DSGA 2R9PA 1Y5BT 5A0AE 1CT0E 2Y6TA 1TALA 2AIQA 4K3JA 1L1NA 1TNLA 3RXFA 2J34A 3BF6H 3M3SA 2P3UB 3P95A 1QTFA 3FVFB 2C90B 3GY8A 5HYOA 5L6NH 2BDYA 3RXTA 1D3DB 1CT2E 1ELTA 2BX4A 4HTCH 1EAIA 1SR5C 1GBTA 1W12U 1SG8B 2DE8A 3Q3YA 1OWDA 1UTKA 5EOKA 3UR6A 4OS2A 1FY5A 1C5YB 4UFFH 7ESTE 4GAWA 4SGAE 2SGQE 1TGBA 3RXOA 1K1IA 2THFB 2XC4A 5E0JA 4WXVA 1V2ST 4MNVA 2BY5X 3RU4E 3WWBA 3LIWA 2J9NA 5J4QA 1LVMA 1EJAA 4X2XA 5DP9A 1MTNB 1SQRA 2BD5A 1S83A 2H9EH 2QF0A 1TABE 1KLIH 3SU3A 2NU4E 1L0ZA 4INHA 2UWPA 3LGYA 3PMAB 1IAUA 1Y3XA 4O3TA 2QXHA 1FDPA 2FOCA 3SUDA 3A8CA 2AH4X 1TBQH 5AFZH 3VGCC 1GCTC 1FN8A 1DWDH 1G37A 2VGCC 1JMOH 1UTJA 2WINI 3I78A 4LXBH 1SLVB 4O97A 3DUXH 2PUXB 1GI9B 1O2YA 3CNRA 5CMXH 3SU1A 1ZJDA 5KGOA 3AASA 2ZCHP 1DX5M 1TWXB 3UQVA 1ETSH 4MPUA 3RMNH 3AW0A 5F8ZA 2EA3A 5EPNA 2Y7XA 2PGQB 2BXUH 3UWIA 3ITIA 1D3PB 1KXAA 5HGGA 2BQ7B 4DT7B 1TBZH 1UCYK 1LHGH 2PKAB 2SNWA 1C9PA 2VWOA 1BBRE 4X2VA 2F9VA 1GGDB 1DPOA 1TGTA 2B5TB 3U69H 2STAE 4A7IB 1UTPA 1XUKA 3MFJA 1N6YA 1OP0A 3ATKA 3BG4C 4BOHA 1MU6B 5EIYA 4GCHF 3AK5A 3JZ1B 1FQ3A 2G00A 1YGCH 2QYIA 1Z7KA 3HGPA 2QIQA 2W7SA 3PV5A 2Y5HA 1GI8B 1HRTH 1OSSA 2BQWB 4ABFA 3SU6A 2ZGBH 1DWEH 3B8JA 1S0QA 2J98A 5T6GA 1K21H 5H4IB 3QZQA 1GDNA 3F2FA 3KHVA 1RTKA 5DKMA 3OEHD 3RP2A 1YYY1 2ANYA 4U01A 1O0DH 3SUEA 4I33A 5EJLA 2JDID 1Q31A 5CDFE 3SOSA 2GGVB 1COWD 2PSXA 2BDBA 5A8YA 1CO7E 4H6SB 4BXSA 3ZV9A 2W5EA 1BZXE 4TPYA 5A0CA 1JIMA 2C8WB 2JETC 1OPHB 3MH4A 1FY8E 2Z3EA 1BDAA 2J97A 2Z3DA 2Q1JA 1UCYH 2ZFQH 2P59A 1GJCB 3GOVB 1H8DH 1DLKB 1WXRA 2ALPA 1BQYA 3RDZA 2GCTC 1EP6A 4K1TA 4NSYA 3EE7A 2OXSA 4RT0A 1V6DA 2O8UA 5EW2H 1K1MA 3P70B 2G52A 2BD9A 1OWEA 3PWCA 1EAUA 2PR3A 1BTXA 2G5NA 4Y0ZE 4AC9A 4NWLA 1ELDE 2OQ5A 3ZV8A 4I8GA 3W94A 4ABHA 3PTNA 1HV7A 2VIDA 2ZFRH 3ZZDA 1TNHA 1OWHA 1O2SA 2ZHQH 1NFUA 3ZVEA 1WU1A 4FUBA 3SJOA 1BMLA 1P2QA 2Z3CA 1L2EA 2QY0B 3SNEA 3N7OA 2WUCA 1C4U2 4Y7AA 5TCCA 2FI4E 4AG1A 4DG4A 5EJZA 3QGJA 1O3IA 1F5KU 1H8IH 1HNEE 3ZZ5A 4IMQA 4K69A 3BTGE 2AMDA 5GIBA 3WWFA 1C1OA 1CGJE 3O8DA 1BTYA 1C5PA 1GVZA 1GDUA 1CQQA 1P02A 2SGDE 1HJ8A 2KM0A 1TPSA 3NRLA 4YXWD 1QBNA 2FTMA 2G55A 1ZPZA 2ZQ2A 1K1NA 5C0UA 2SGFE 1AY6H 1NFWA 4UFEH 2M5TA 1NO9H 4IN2A 5DG6A 1A61H 3KGPA 5GPIB 2XCNA 5EXMA 4IBLH 1SLWB 3DSPA 1QL9A 1W11U 4NA8A 1HAVA 1V2JT 1Q2WA 1C2MA 4YT7H 3PV2A 3LH3A 4I86A 2OLGA 6CHAC 3VGCB 1GCTB 2VGCB 1HPGA 1XXDA 1YPEH 1O3BA 2BTCE 1IQGA 4ISNA 3AVZA 3KCGH 4PROA 3F9HA 4I8KA 1TPOA 3FP7E 1MZAA 1GHBG 1QFKH 3W95A 1KTSB 4MQAA 1V2TT 5DO4H 3H5CB 2RCEA 3U9AH 4Q7YA 2VINA 1SGDE 4XBBA 1LPKB 1BA8B 1NN6A 3K65B 3U8TH 1FPCH 3U8RH 3BEUA 1MU8B 1UO6A 1ZLRA 1UTQA 5JYIA 3ZZ4A 2OC1A 1OWJA 2H1UA 1C1RA 5GJ4B 1XMNB 1AZ8A 3KYFA 2QXJA 3H7TA 1NRPH 3BG4B 2KR7A 2Z9LA 1C5OH 1VR1H 3EQ0H 5CHBA 4FUIA 1ANEA 1JRSA 1TGNA 1AD8H 3MU4A 1WQSA 4Y0YE 2IJOB 1QRXA 1H4WA 3TGKE 2QF3A 2ZGHA 3Q76A 4JK5A 4MNYA 2EI6A 4MG3A 4UFDH 4ABJA 2FYRA 1YCPK 3ZIAD 3Q77A 5DP6A 1TX7A 2A4RA 3SUFA 1O30A 4DY7B 5ABWA 2BVRH 2XBXA 3MOCA 4TY7A 4CRCA 3UREA 1O3PB 1SKYE 3SJIA 1GPZA 4B73A 1NRRH 1AWFH 2XYAA 1DLEA 3M7QA 1MQ6A 5LGOA 3QX5H 2LNCA 3EA7A 4GVUA 1UTNA 7LPRA 2H2ZA 3T5FH 4AOQA 2JETB 4J1YA 1LO6A 4ABEA 4XE4A 3F9EA 4IGDA 1EZXC 3RXUA 2AFQB 4CREA 1LPGB 1HXFH 1AHTH 2GCTB 5FCKA 1V2KT 3A7VA 1FY4A 3JZ2B 1TOMH 4A1TA 3NPSA 5JDUB 2R3YA 3MU0A 2WYJA 2IN2A 1GBDA 1J8AA 2BLQA 4JZDH 4NFEA 2FTLE 4YO9A 1G3BA 2TIOA 2K1QA 4OS6A 2Z9IA 1MD7A 1PPZA 1T8OA 2WPJS 2KZ4A 1TIOA 5GNDA 2ZGJA 1HAHH 1YCPH 1TRYA 4H42U 4D8NA 2FIRH 2G4TA 3T26A 4CRDA 1AUTC 3RXJA 7GCHF 1KLTA 2ZDAH 1QBOA 3A80A 3C27B 4MPVA 2HVYB 1AFEH 3TJNA 1C1SA 6LPRA 1A7SA 1HDTH 1TX6A 3ZZ3A 2WSSD 2ZU5A 1YP9A 3RLWH 1BMMH 5KEDA 1IQMA 1GI0A 3L33A 2PWXA 1TONA 2QXGA 1LKBA 5A0BA 2I6SA 4WY3A 3BIUH 1LTOA 4D7FA 2ZGXH 1OS8A 1SHHB 2F9NA 2HNTE 3H7OA 4FVBA 1BRUP 1UCYE 1C5SA 4TT3D 4CH2B 2ZCLP 1MCVA 1ELEE 1EZUC 2Z94A 3OY6U 4UFGH 2ODPA 3TGJE 2H9TH 2ZDMA 4NA9H 1Y5UT 2HGTH 3OFND 3BSQA 4CRFA 2GZ8A 4INKA 4Y8XA 5TCAA 3M37A 4BTTB 1TA6A 3SN8A 1O2QA 2M2AA 4NGAH 4ZAEA 1ZSJA 2ASUB 4NG9H 4WMDA 4MVNA 1VZQH 1BB0B 6CHAB 1G2LA 2BDHA 1O3JA 4FU9A 1Z8JB 4H4FA 1FXYA 4AGKA 1PPBH 3BEIB 1O3FA 3P17H 2BVSH 1EPTC 4UDWH 2D26C 2J5UA 1N1LA 1CGIE 5E2PA 1F0TA 3FN8A 3SI4H 5DP3A 4JZIA 2Y5FA 1SGFG 3F6UH 3SBKA 3S7KB 2FP7B 1P01A 1T8LA 3PROA 3RXGA 3PRDA 3SQHE 1UW7A 3DD2H 2AGGX 2KCOA 1XKBC 3MNXA 2XWAA 1SOZA 5C67A 3GDUA 1BMNH 2B7DH 4WXIA 2P3TB 2FOAA 2QGRA 1D6WA 1O3MA 1QB1A 3SNAA 4Y8YA 1HAXB 1UMAH 3RXSA 2Z7FE 2AYWA 3A89A 4ZH8A
chains in the Genus database with same CATH topology
2AIPA 1DUEA 4D76A 3R0FA 1P05A 2A5AA 3QTVH 3U98H 2FOFA 5JBBS 2OQUA 3GCTF 2BDGA 4ZHMU 1EP5A 5GCHG 2WPMS 1C1PA 1TPPA 2ULLA 4D7GA 4AGJA 4WH6A 4ASHA 4BTIB 1GG6C 3GY6A 3UQOA 4LZ1H 3LGTA 1F92A 2PTCE 4OGXA 3LU9B 3ZVDA 1EPTA 1Y3VA 4BAQB 1ELGA 1QIXB 1INCA 1XUIA 4KELA 5CE1A 3O8BA 3Q3KA 1GHXH 1G32B 3RC4A 2V6NA 1DFPA 3U1JB 1WTHD 3QO6A 4BANB 1UTLM 1F5LA 5L30H 1K9OE 1AN1E 1EJMA 2IPHA 1FN6A 2OD3B 3P8OA 5DP5A 3S9BA 4B2CA 4ABAA 4FUDA 2ZTZA 1AU8A 3MH7A 4UEHH 2QA9E 2LPRA 2HOBA 2JH5D 1TX8A 1ELCA 1HJAC 2PKSC 1YPHE 1V2PT 1SFQB 1O33A 2XC0A 2CHAC 2ZKSA 1Z6JH 3T29A 1WQVH 3LH1A 3PMJA 1C1WH 5C1XA 1CSOE 1AUJA 3E6PH 2XW9A 4Y10E 3M5LA 4JK6A 1BITA 1HXEH 3P6ZB 3LJJA 3S69A 3ELAH 1SBWA 3GDVA 4MPXA 1NS3A 2AEIH 1O2ZA 4GUXA 1GCDA 2OINA 1G2MA 1JXPA 1C5LH 1F5RA 1GDQA 1EASA 1IQIA 2SGPE 5C1YA 1GBHA 3D65E 1HAIH 4GCHG 1AGJA 3ZVGA 4YOJA 1QA0A 2G8TA 4ISOA 4SGBE 4AFUA 5A2MH 2J95A 3VXFH 4X2WA 1NRNH 4GHTA 3RMMH 5C2ZA 3SUGA 2GTBA 1FNIA 3HATH 1NU7B 3A8BA 1DUAA 1LQEA 1LVYA 1P57B 2XNIA 3A7WA 2A7CA 3URCA 2ZZUH 4M7GA 2ZHFH 3SV6A 1BRAA 3MYWA 4X0WU 2VIPA 5T3HA 4BAOB 4AG2A 1KY9A 1A5GH 2GCHF 5GXPA 2KAIA 2C8ZB 2PFEA 2A1DB 1BOQA 1THSH 3MH6A 1C5TA 1O5CB 2GV7A 2GX4A 1QRWA 1TGSZ 2AMQA 1D3TB 4FXGH 1TNJA 4ZROA 2OUAA 3Q00A 1XXFA 1EZQA 4UE7H 2BB4A 1QL8A 3TH4H 2BDAA 4HFPB 3E90B 1C5ZB 1NROH 1T31A 1ZR0A 3A87A 4LZ4B 3IG6B 3M7UA 3EA8A 1F0UA 1MKXK 1XX9A 1QURH 5EXLA 1EPTB 4CRBA 4RKJB 1D6RA 3GY2A 2BLWA 1C5XB 2VIQA 2ZECA 2OBQA 3PO1C 4U32A 1P9SA 2PHBA 2NWNA 2O9QA 3M36A 1BIOA 2G81E 3PMBB 3GCHC 1XKAC 3TK5A 1NFYA 1UTMA 1DT2A 2BY9X 5A8XA 1T4VH 1IQHA 4AX9H 3A8DA 4Y71A 1GMCG 1ZMLA 3T2NA 1O35A 1O38A 3PV4A 2XC5A 1NFXA 1PQ5A 5BRRE 3RUOA 4X1PU 3T25A 1EATA 1L4ZA 1AFQB 3T62A 5GDSH 4Y6DA 4E05H 1C5RA 2ZO3H 5K7RA 3TNSA 2ZFTA 1F0RA 1T4UH 4OS1A 2VU8E 2WYGA 1E37B 1AWHB 2BLVA 2HVXA 1LVBA 1DY8A 5FPTA 3M3TA 1V2MT 1O2NA 1F7ZA 2WPKS 1PPFE 3PTBA 1GG6B 1C5QA 1EB1H 3BTFE 2CF9H 3TK6A 1KXCA 3TH2H 4XFQA 3ODFA 1T8MA 5JPMH 2O8MA 1Y8TA 1MKXH 4U30A 1FV9A 3UUZA 1W0YH 2H9HA 2QC2A 2HALA 1NESE 2BY6X 4I8LA 1GI6A 4MLFB 2ZU2A 2HWLB 3GYMA 1HAYB 4DIHH 2OC8A 2P3FH 4F49A 1AB9C 2D2DA 2TBSA 3MWIU 1ELVA 2O8TA 1O2PA 1HJAB 2KAIB 2PKSB 1WYKA 2A45B 1SL3A 5HM2A 3ZZ6A 2CHAB 1OXGA 2Y81A 3MO3A 1KYNA 2HPQH 3SU5A 3QGNB 1LCYA 1RXPA 1CVWH 1OYQA 2ZEBA 4HGCA 2BD8A 2H5DA 1D9IA 1SVPA 6GCHG 1AVGH 3STJA 2VVUA 3VPKA 1O3GA 4I8HA 1O3LA 2FMJA 4U2WA 2J92A 2BLOA 1P06A 4YOGA 3ATWA 5T6FA 4IMZA 4BAKB 1BRCE 2W26A 4ESTE 1GL1A 1B7XB 3ZZ9A 1Z71A 3SHCH 2A7JA 4MNXA 1BMAA 4ZXYH 1CA0C 5EG4A 1Z8RA 2BD2A 2BX3A 4ABDA 1GHAG 2ZU4A 4YM9A 2TGDA 1GJDB 2OBOA 1KXEA 1W10U 1QGFA 1IQEA 2NU3E 3EGKH 1WCZA 5IDKA 2ZDKA 3TK9A 9ESTA 1C1VH 5C5OA 5HXFA 1Z6EA 1DICA 1GI3A 5FAHA 1C2KA 1PYTD 3RLYH 2G51A 1QJ7B 2VJ1A 2H6MA 1HBTH 1ANBA 1C5MD 1P8VC 1Y59T 4ZXXH 5K0HA 4B2BA 4JYUH 2ZPRA 1P9UA 4K1EA 4TYDA 1B5GH 1V2WT 3GICB 3IITA 1CBWC 1SQAA 1N8OC 1UVPA 4ABGA 1C2EA 4KTUA 4FU8A 3ZYDA 1O2HA 4HZHA 5EPYA 2FZZA 4DW2U 1EQ9A 1LKAA 3QWCH 2XBWA 1WAYB 2D1JA 1KXDA 3NKKA 3SV9A 3LONA 1O34A 5A09A 3RXMA 3D62A 1MTSA 3PO1B 1ESTA 1QBVH 3EDXB 5IYTA 2UUJB 1YC0A 3GCHB 3SJ8A 2JH0D 3DHKH 4IW4E 2NU1E 3MNCA 3KN2A 3E8LA 2ODYB 5EQQA 3OSYA 8GCHG 5LPEA 1DWCH 2PW8H 1GBLA 3UY9A 3TH3H 4DGJA 2NU0E 2C8XB 1FI8A 3TITA 3RXQA 2ZTXA 2F3CE 1GJ5H 1GBJA 1U6QA 4VGCC 3M5NA 1TB6H 3FANA 4NCYA 3VB3A 3S0NA 5EW1H 3QZRA 1DS2E 2AMPA 1ELBA 1AO5A 3UOUA 2W3IA 1C5VA 2FWWA 2HNTC 1EZSC 1C5NH 1O2IA 1XVMA 1IOEA 1IQFA 1O2OA 3SJ9A 4Y7BA 1EOLA 1V2LT 3EYDA 5DP8A 1HIAB 1PPGE 4B75A 1TAWA 1AQ7A 1ETRH 4A5TS 2FO9A 1O2JA 3LC3A 1MKWH 1GBIA 5PTPA 2VWMA 3RXKA 2PV9B 4WVPE 2Q6GA 3KQCA 3E0NB 2OTVA 1LPZB 3UFAA 5JBAS 5DP4A 5AFYH 2PTNA 3S9CA 2PSYA 1QJ1B 4KTSA 3ZZCA 4AFZA 3KL6A 3RMLH 2TGAA 4ABIA 2UWLA 3BV9B 1AB9B 4CBNA 2CJIA 1X7AC 3SORA 3B9FH 1P09A 2XBVA 3OTJE 1JOUB 5FX5A 4AYVB 2QXIA 1PPCE 2UUKB 1C2DA 3OY5U 1GBBA 1OWKA 3A81A 3A82A 1ZTKA 5E0HA 1J17T 3UNQA 1GI5A 2ZG0H 4JZFH 2VH0A 4BNRA 4ZHLU 3F9GA 1IQJA 1EX3A 1O2VA 1GMDF 4BAHB 1FUJA 4I31A 1TMBH 4RN6A 3GY4A 1NM6A 1ZSKA 4AB9A 2GDDA 3A83A 1JWTA 4HI3A 1THPB 2EC9H 1ZHPA 1W13U 3P8NA 1F0SA 3FAOA 2SGAA 3P8FA 3MH5A 2ZHEH 2ZQ1A 4IS5A 3M5MA 3MNSA 4XBDA 1NY22 4A1VA 4ZKRU 1CA0B 1M9UA 2R0KA 1GJ8B 1O5BB 3STIA 4MNWA 4AN7A 3SV2H 1HUTH 1A5HA 3GCTG 1O39A 1IHSH 1RTFB 1SB1H 1VJAU 5DK1A 2VVCA 1O2XA 3BG8A 2ZTYA 1BTUA 1GI4A 2VIOA 1A0LA 3HKJB 2J94A 1Y5AT 3BTKE 1DSUA 2C8YB 5G4BA 4FUHA 3UIRA 2O8LA 5JBCS 4X1RU 1TGCA 3BN9A 1THRH 2GT7A 2R3UA 1GHZA 1CBWB 1QY6A 3ODDA 4ISHH 1PQ8A 1N8OB 3F9FA 1TNKA 2BYAX 1YPHC 2RA0A 3EA9A 2JKHA 1O5EH 2ZU3A 2C93B 1SFIA 2Q6FA 1P10A 3I77A 3C1KA 1V2VT 5C3NA 3TIUA 3URDA 4JYTA 1OP8A 3KEEA 2A2XH 1CHOF 1YCPM 1A1RA 1E36B 5J4SA 3A8AA 3KQBA 1O2TA 4DOQA 1TMUH 2BD7A 1UK3A 1XUFA 1GJ6A 3DA9B 4FVDA 3TU7H 4CHAC 1QB6A 3Q3XA 2ODQA 1O5GH 4Q7ZA 3ZZBA 4JYVH 1P2KA 1C1QA 4DURA 1C1MA 1K28D 4B76A 1ESAA 3OX7U 1EJNA 1KTTB 2P16A 2XXLA 4VGCB 1C9TA 1WOFA 2F83A 1DSTA 1CHGA 2FX4A 2GDEH 3GDSA 1V2OT 3ATIA 4Q2KA 4DVAU 1OOKB 3WY8A 1S84A 4YTAA 3KF2A 3ZVBA 2P94A 3RXVA 1YM0A 2JH6D 1Q3XA 4K2YA 5A8ZA 2GCHG 5GWZA 1BTHH 4Q80A 1TLDA 4E06H 3VB7A 3M35A 3TPIZ 2J4IA 2FLBH 4YT6H 1ZHMA 1DM4B 2ZPQA 3FZZA 2A4GA 1DDJA 2W3KA 2ZDLA 1J9CH 3LGWA 4FUJA 2VWNA 1GVLA 5LPFA 1DE7H 1C2GA 1QB9A 1QCPA 4X8UH 3UPEA 1QRZA 1FMGA 4Z0KA 4YZUA 1HYLA 1Z8IB 1ZOMA 1W0ZU 1AE5A 2Y5GA 1GJ9B 2A5IA 4Y79A 3RMOH 5LH8A 3GISB 1ZMNA 1K22H 3SNCA 8LPRA 4X1SU 4ISLA 5CHAC 1GBKA 1ABJH 3RXBA 3S7HB 4X6MA 1PFXC 1W2KH 4MDSA 4NA7A 2A4QA 1QJ6B 4CBOA 1BTPA 2D8WA 4NZQA 4YLUA 1PJPA 2TPIZ 3BTDE 3NCLA 2J2UA 5DPAA 3MI4A 3RXEA 4DIIH 1MAYA 1O2UA 2ZHDA 3PB1E 2VWLA 2A5KA 1TNGA 1O3NA 3UWJH 1K1LA 1HJ9A 1RIWC 1FLEE 1H1BA 4B71A 1A2CH 1GMHF 1LQDB 2F91A 2AGEX 1C2LA 1P11E 1FJSA 1A3BH 4WH8A 1O2LA 4X8VH 2GVFA 2YNAA 2FOEA 1RJXB 4MPWA 3A88A 1SLUB 2XRCA 3LDXH 3EE0B 2WPLS 1BHXB 1F2SE 1G3CA 3LGIA 3DT0H 4NIYA 1O5AB 1BRBE 1C1UH 2ANMH 2A4OA 3SW2B 4AFSA 1DXPA 5ESBA 4E7RG 1G30B 2FYQA 4XBCA 4B74A 1FIZA 4TPIZ 1LHDH 2BHGA 3ZVCA 1LHFH 5C5NA 2FPZA 1K1JA 3BTEE 3NK8A 3GY7A 1MAXA 2FOBA 1SOTA 3MU8A 1TE0A 1O3EA 5AHGH 3SJKA 4CR9A 3NUMA 1O37A 4AZ2B 1SSXA 1HAZB 4ZMAH 4JMYA 5DGJA 2FDAA 1SGNE 1MQ5A 3ATLA 3RXIA 1YPMH 3RM0H 1ZTJA 2RG3A 2ZWLH 1QR3E 2FOGA 2FXRA 1ZYOA 2Y82A 3TNTA 1MMJN 5L2YH 1TRMA 2A7HA 1AFQC 4THNH 3TJVA 3A85A 3PM3A 2B9LA 4H6TA 1P2NA 1XM1A 3DFJA 2Z9KA 2FLRH 1WSSH 1VGCC 4CHAB 3V12A 1ZRBA 1NU9A 2H5CA 2F9OA 1DANH 5I25A 4I7YH 3ZVAA 2AERH 1S5SA 1AZZA 1P2MA 1GJAB 1VCQA 3M3VA 4Y11E 1Y3WA 1O3CA 3DFLA 1C2HA 3M61U 2F9PA 4OS4A 2BY8X 5EQSA 1EAXA 1O2GH 1HAOH 1YLDA 5GCHF 1O32A 4X1NU 1AVXA 1ZGVA 1C2JA 3HKIB 2GD4B 3E16B 1O3DA 1Y3UA 1SGEE 2BZAA 3RXPA 3A7XA 3LT3A 2V3HH 5F8TA 4NIWA 1VCWA 1C1NA 2ZA5A 5E0GA 1S85A 1Z8GA 2HPPH 2QCYA 4ZKOU 2Y80A 1QQUA 2HNTF 3CP7A 4ZKSU 4OGYA 4B1TA 1KXFA 1P0SH 2BMGB 2CF8H 1P3CA 2ESTE 1P03A 3D23A 2VNTA 3QUMP 2SNVA 1C2IA 2Z9JA 4X6OA 2Y7ZA 1AMHA 1GI1A 1VITF 1E0FD 1V2RT 1QQ4A 1XUJA 3M7TA 4AYYB 3QLPH 3KIDU 1T8NA 3HK3B 1LHEH 2C4FH 1S6FA 1RRKA 4D9RA 4JZ1A 1KXBA 3GCNA 1D3QB 3MNBA 1L1JA 1EUFA 1O3OA 3SI3H 1RS0A 2DE9A 1GBAA 1MH0A 2ZFPH 1YPLH 7KMEH 2BOHB 1ZGIA 5CHAB 5FPSA 1GHWH 3O8CA 5E2OA 1E34B 1GL0E 3QDZB 1HB0B 1DXWA 4R0IA 1SGTA 1SGCA 1KSNA 1KLJH 1K1PA 4BTUB 1EB2A 3KQDA 1ELAA 1SC8U 2BDCA 1E38B 3BTWE 2EI7A 2ZF0H 1DOJA 3BTHE 1C2FA 3IWMA 1GI2A 2OCVB 1DITH 4CH8B 2VIWA 3L3TA 1RTLA 1RIWB 4X6PA 2B8OH 2TRMA 3M5OA 1YF4A 5B6OA 3LOXA 4ZUHA 1ORFA 3V0XA 2BOKA 3MTYA 4I32A 2P95A 5BPEA 1CA8B 2BD4A 4GSOA 1T7CA 1UVUH 4NFFA 5ETXA 3O8RA 3CS7A 1C5UA 3GYLB 1ID5H 1O2MA 2UUYA 1ELFA 2CGAA 5JB8S 1PYTC 4NSVA 1KDQA 1XUGA 3PMHB 1HIAA 5JBTA 4K8BA 3CENA 1ZHRA 2GT8A 3G01A 4J2YB 2TGTA 1TQ7B 1SHYA 4INLA 4F4OC 1ZTLA 1P2OA 2YNBA 2EI8A 2GV6A 1J16A 3F68H 1HAPH 2R0LA 4KKDA 1BHXF 1PQAA 1W7GH 1ANDA 3NZIA 1OYTH 1SI5H 1SQTA 3SV7A 4K60A 3BTME 1L4DA 4Q7XA 1ZPBA 2Q6DA 3VB4A 2VIVA 1VITH 1ANCA 1MTVA 1V2QT 1WV7H 2UWOA 1GHVH 2VH6A 2PGBB 1GBCA 3L6PA 2ZC9H 3ENSB 2FS9A 4GPGA 1D4PB 1MZDA 3HGNA 2GP9B 1GMDG 1OWIA 3UOPA 1V2UT 3KNXA 4RSPA 2GMTC 1GMCF 1G3EA 3HK6B 2SFAA