1O34A

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o34A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o34A02
2ANMH 4MNVA 5FCKA 3S9BA 3FZDA 1C5WB 3MU4A 1LO6A 2BLVA 1CGHA 5C5NA 6ESTA 1CHOF 1GJ4H 2Z9KA 4KELA 1TAWA 4O3UA 3P8OA 2HNTF 3QZRA 1XX9A 2PGBB 3F9HA 1O5BB 3ATMA 5DPAA 4X2XA 3ATIA 2HRVA 4IS5A 3P8NA 4J1YA 3CP7A 1C5ZB 2V6NA 2W7SA 2C3SA 1GMHF 1YP9A 4RSPA 1DDJA 4ABHA 3RXBA 4AYYB 1K9OE 2VIDA 1GHAF 1V2RT 4OS6A 1EJMA 1DITH 1CE5A 2Y7XA 3LDXH 4Y10E 4TWWA 2BDHA 3E8LA 1V6DA 4NFEA 3ITIA 1MD7A 4SGAE 1ACBE 3RXCA 3JZ2B 4K8BA 4Z0KA 2ZHEH 3UQOA 1UCYK 1EATA 2GT7A 5T6DA 2HNTE 4FUDA 2XCNA 5EXMA 2OINA 2PW8H 1H1BA 3SNAA 4JZEH 2ZEBA 4X8SH 2R2WU 2VIOA 5FAHA 1G3EA 1P05A 4F4OC 1Z7KA 3P95A 1LCYA 1ZHRA 2GTBA 2O8LA 4UEHH 4CRCA 4JZ1A 5A0BA 3PWBA 2B0FA 2ZHQH 4X2WA 3RP2A 1P3CA 1RRKA 1O2GH 2ZO3H 3RM0H 2THFB 2OQ5A 4YOIA 2JETC 3RXKA 2ZCHP 2QA9E 3BG4C 1EPTC 5C1UA 1GVLA 1O2QA 2CN0H 1LVOA 1ELCA 1UVSH 1GI7B 4NSYA 2ZC9H 1E37B 3I29A 4K69A 2XWBI 5AVDA 1GBEA 3QWCH 2W3KA 4A92A 2BDBA 2VVUA 3TGIE 3MI4A 3RXQA 1GI5A 2W7UA 1SI5H 1THSH 5AF9H 1S82A 4X8TH 3RXAA 1ZMNA 5HM9A 2WUBA 3D65E 4NA8A 1MCTA 4YOJA 1S83A 1BRUP 4F49A 4XOJA 4ZH8A 1BTUA 4HZHA 1JRSA 2FPZA 2J95A 4NFFA 1K1OA 3Q77A 1GJAB 4ISHH 2TGAA 3ESTA 5HXFA 2AYWA 1DE7H 4E06H 1ELVA 1A3EH 3PV4A 4AGKA 4IBLH 2BZAA 3LKWA 4FUGA 2QGRA 1LKAA 1A7SA 1BCUH 1TPSA 1GG6B 1VITG 3U9AH 2QIQA 2W3IA 3HKIB 1C2EA 1LHEH 1GVKB 3SUEA 3C1KA 1ZJDA 2OP9A 1O2PA 1UK2A 2FTMA 2VIQA 5JBAS 5FBIA 1PPEE 2O8WA 3RMNH 2ZECA 1GHBF 2A5IA 4NWLA 4ZHLU 3OY6U 1HXEH 1P03A 1EPTA 1ZSKA 4E7NA 1GBJA 1SQOA 2ZCLP 4IGDA 1DWBH 4CREA 2PUXB 5FPYA 3D23A 3TIUA 2GV7A 1MAYA 5K0HA 1CVWH 3GY6A 1Y5AT 1P57B 3C27B 3UTUH 3GCNA 3SU3A 4MQAA 3GCHB 3OX7U 1QQ4A 4ABDA 5DGJA 1TNGA 2ZU3A 4HTCH 1S6FA 2ZWLH 4BAMB 2AFQB 1ANEA 1V2MT 2TGTA 1MKWH 4X6NA 2BHGA 2XBXA 1QGFA 3B9FH 5C1XA 2VWNA 2JH6D 3HKJB 1P9UA 1GJBB 1HAYB 1HB0B 2XBVA 4DURA 1O3EA 1UTMA 1KLTA 3K6ZA 4FUFA 1XXDA 4FU7A 1FN8A 3RXUA 4Q7ZA 3S9AA 1O2YA 1GBBA 3PM3A 2AH4X 3N7OA 1T8NA 3STIA 4R0IA 2J34A 4CH8B 1QJ1B 2BVRH 1CT4E 2BYAX 2C93B 3ZVCA 1GBFA 2Z9LA 4DW2U 3GY5A 3V12A 1EAWA 5H4IB 3O8CA 4VGCC 2AGGX 2ZU1A 3E1XB 2FDAA 1RS0A 2SNWA 3M3SA 1TGBA 1GJ9B 5C20A 2A5KA 2EEKA 4CBNA 1C1VH 4X2VA 2ZTZA 1SGFA 5E2PA 4DOQA 5DK1A 1O30A 4IC6A 3SGAE 4BOHA 2FLBH 1O37A 4X1NU 3IWMA 3MNSA 1DY9A 2G81E 5FCRA 3RC5A 4AB8A 3T5FH 1V2VT 4I32A 7GCHF 2O8TA 4ZKOU 5DO4H 1THPB 4LXBH 3A8DA 2ZDNA 4I8KA 1IQFA 4FVBA 3A89A 3ZYEA 4X1SU 1BA8B 1U6QA 3F68H 2ZIQH 1GG6C 2G5NA 2ZQ1A 2WPMS 4X8UH 2TGDA 4BAOB 5JYIA 2Z3EA 1QB9A 1XXFA 3SV2H 3UFAA 1QA7A 1F92A 3E6PH 1BBRK 1IHTH 3VGCB 1Z8JB 2Q6FA 4NSVA 1RTKA 2C90B 3T29A 3H7OA 3TLOA 1UTLM 4RKJB 1W7XH 1HIAB 1MTWA 5PTPA 2GVFA 1O3MA 2SGPE 3MOCA 2TBSA 1YYY1 1G3BA 1K1JA 3RMMH 3TJNA 4ISOA 3GCHC 1GJDB 1UHBA 1EZSC 4Y0ZE 1N6YA 3DHKH 4BAHB 3KIDU 2NU4E 1SBWA 1OKXA 3RXSA 1YPJH 2BDIA 2EI7A 4D7GA 2AERH 4K2YA 5FX6A 1XUFA 2VVVA 3SQHE 4MNYA 1XKAC 3EE0B 1CBWB 1DICA 2ZGXH 1NO9H 1PPGE 2V3OH 3CENA 1G32B 1AVXA 1ZSJA 4BTIB 1BIOA 2GGVB 4IMZA 1NTPA 2A2QH 1P12E 1H4WA 1VCWA 3UOPA 1E34B 4GUXA 5B6OA 4O3TA 4RKOB 3TNTA 5GIBA 3NKKA 5A8ZA 2UUFB 4UD9H 4AG1A 5DP4A 1LHFH 1O3DA 2BY5X 1HAIH 3A82A 3R3GB 4INHA 1SLVB 3M35A 3BSQA 2F9OA 4AFZA 1GDQA 2GCTB 1WYKA 1O3HA 1AHTH 1D3PB 4BTTB 2P16A 1EAUA 1G37A 2BXUH 1A0HB 1AWFH 1Z6JH 4CR5A 1AZ8A 1IHSH 1BOQA 1JBUH 5L2YH 1Y3XA 1ELGA 3OU0A 4UE7H 4AFSA 1HAVB 5JB9S 3PYHA 1WTGH 1D9IA 3F9FA 4Y8YA 2ALPA 2G51A 3LC5A 2O8MA 1IQLA 1O3BA 1KY9A 4YOGA 1HXFH 1TX8A 9ESTA 1O34A 1NFUA 3RXPA 1Y5BT 1B0EA 3VGCC 1INCA 3P8GA 1J14A 4YTAA 1GDNA 3VB7A 1O2RA 1P10A 1X7AC 1GDUA 3D49H 1SQTA 3RLWH 3ATLA 1Z1IA 1A5GH 1ZGIA 1GWAA 1N8OB 4ZAEA 1GBHA 1VR1H 1XVMA 1DX5M 3H7TA 3FFGA 1IQIA 5DP5A 5A0AE 1ELFA 4GLYA 4X8VH 1FZZA 5L30H 3LONA 5FXLA 1F7ZA 1AN1E 1QCPA 4ISLA 5EQSA 2FOGA 4ISIH 1PPBH 1MU6B 1ANBA 4KP0A 3WY8A 1VGCB 1TONA 1W3CA 2BDGA 2J4IA 4DGJA 2HOBA 2OBOA 1DPOA 1O2SA 2BVXH 2ZDKA 2ANKH 3RM2H 1SVPA 3LT3A 1YPLH 3SO3A 4GVUA 3A83A 5DP7A 2WYGA 1K1NA 1LDTT 5ETXA 3RXEA 1IAUA 1SSXA 3QLPH 1AZZA 3KGPA 3SV6A 3RXVA 1C5OH 1EX3A 3KF2A 1AO5A 3UR6A 2OC1A 1PPZA 1Y3WA 4A1VA 4AYVB 1J16A 1E0FD 2H9HA 2CMYA 1C2DA 1HIAA 3BTKE 1H8DH 1BJUA 1LPKB 1MKWK 2GCTC 1QHRB 4YT7H 2NU1E 4MVNA 3E91A 5CMXH 2OQUA 3PB1E 3BTQE 4A5TS 4HFPB 1A2CH 4AGJA 4UFEH 3QGNB 1UTPA 2ALVA 3TJOA 1OWJA 4X6MA 3TJUA 3PWCA 3A8AA 5F8XA 4K5ZA 3SV7A 5I25A 1V2UT 4KKDA 3DUXH 2PV9B 3PMAB 1SC8U 2FLRH 1O2XA 3A8BA 4Y11E 4XBBA 1SL3A 1HJAB 1ID5H 3ZZ8A 1O3KA 1RD3B 3BIVH 1CA8B 2ZU5A 4AZ2B 4H4FA 4B71A 1IQNA 1TNLA 4JK5A 5TCAA 4FU9A 1DVAH 4ZMAH 1A1RA 1SLXB 4A6LA 3ZZ3A 1NFYA 1QBVH 4MLFB 6CHAB 3T27A 1TIOA 1J17T 2QF0A 4MPWA 1N8OC 3RU4E 3RUOA 3W94A 3PLKA 4ZROA 1L1GA 4ABBA 2P94A 1PYTD 2Z6BD 1NFWA 2ESTE 4TY7A 4XSKU 2GZ7A 3A8CA 5GWZA 1LVMA 1P02A 3B23B 3ZVDA 1OXGA 3Q76A 1QTFA 1NRRH 1KYNA 2BD5A 1BRAA 1P2IA 3KN2A 2J9NA 4WY3A 3SJIA 4B2AA 3LGTA 4YM9A 2ZNKH 1O2IA 1XVOA 4CRDA 5JPMH 1ESBA 1P04A 1GI0A 5IYTA 1CT2E 2BTCE 3GY7A 2I6QA 2QYIA 1D3TB 2XBWA 2Z3CA 2GZ9A 1KXAA 2IOTA 1OWKA 1LHCH 2Y5FA 1SGDE 1HAVA 2UUKB 4MPVA 1MBQA 2NWNA 2ODYB 1TQ0B 2G52A 2Z9IA 2ZFQH 4KTCA 3EA8A 4CRGA 5GJ4B 2Z3DA 4Y76A 4TPIZ 2Y80A 5K7RA 1L2EA 2XYAA 2ZGCA 1ZGVA 4I7YH 3SHCH 1EQ9A 1L1JA 4WXVA 3VB6A 1WQVH 2RCEA 1O5AB 2XC5A 1OOKB 5E0HA 1C2GA 1OYQA 3UY9A 3Q3YA 1IQMA 5EXLA 4CRFA 2STAE 3SJ9A 1DWEH 2ZU4A 1KXEA 2P3UB 2PKAB 4NIYA 3Q00A 4YLUA 4ZHAA 1O2UA 1QB6A 2SGAA 1LVBA 1WQSA 1YCPK 1EB1H 1D3QB 2CHAB 8GCHF 3ATWA 1DLKB 2IPHA 3M3VA 1W7GH 1GPZA 2QAAA 3NK8A 1DUAA 1SFQB 5EODA 1C5QA 2A7JA 2FX6A 2GZ8A 1BTHH 2SGEE 4WVPE 4ABAA 4DT7B 1V2KT 1TPOA 2PR3A 4H6SB 3SJKA 2AEIH 4WH6A 1HJAC 2QY0B 2AGIX 2RG3A 3SUGA 3GY3A 5C1YA 2LNCA 1AQ7A 4B73A 2OCVB 2H1UA 4AORA 1O39A 5A8XA 1L4DA 4U01A 1ARBA 5EOKA 4H6TA 3MO3A 2F9VA 3IG6B 3GDVA 4M7GA 4ABEA 3LPRA 1FPHH 6CHAC 4I8LA 3BTHE 4JZFH 2A31A 3SN8A 1ZJKA 2NU3E 5J4SA 2BLWA 1RXPA 3HPTB 4ZKSU 4CRBA 3JZ1B 3U98H 1SGQE 1SG8B 3DFLA 1EAIA 1WSSH 2Q6DA 4Z6AH 2R2MB 4D9QA 3U1IB 1YLDA 2FO9A 1C1TA 2HNTC 3RXJA 1OWHA 6LPRA 1MZAA 1DT2A 2HGTH 1O5EH 4I8HA 5EXNA 1HUTH 3MNBA 2SNVA 1TNIA 2BD4A 3H5CB 1C2JA 1C1QA 3T2NA 1K21H 3FP7E 2G00A 3E0PB 4VGCB 1BZXE 1GBMA 4X1PU 1GI3A 3KEEA 5FX5A 1C9TA 3I78A 3RDZA 5ESBA 2P3FH 5DP8A 2ZCKP 1GI8B 2PGQB 2ASUB 5HGGA 2UUYA 2AGEX 3AW0A 2P93A 3RXMA 4BXWA 2ZGBH 3GCOA 2ZDMA 3KQDA 2G4TA 4NWKA 3KQCA 4DCDA 1TE0A 1C1NA 1W11U 1IQHA 2C8YB 2OXSA 3FAOA 1ZTLA 3K6YA 3OY5U 2F9NA 1AIXH 2HWLB 2CHAC 4ESTE 1S85A 1O2OA 1C4Y2 3T28A 1TB6H 1UTJA 2ZTYA 3TK6A 1Y3VA 2PLXA 4LK4A 3VPKA 5BRRE 4WXIA 2VGCC 3O8BA 1P2QA 1TLDA 1AE8H 3MU5A 2IJOB 1PQ8A 1ZSLA 1QIXB 3LGYA 1O3GA 1G9IE 2GCHF 1J9CH 3SNCA 5BPEA 4ZHMU 3CS0A 3URCA 4R8TB 2PFEA 2STBE 2OUAA 3M37A 3VEQB 4PROA 1TMBH 1ZOMA 3STJA 2XCFA 1F0SA 3TU7H 1D4PB 3PLPA 3QX5H 4GCHG 4NA7A 3EGKH 3ZVAA 1C5PA 1VZQH 2FXRA 1GI4A 3VXEH 1ZPCA 1V2OT 2BLQA 1SOZA 1YPGH 4BAKB 1QJ6B 2WV5A 4O97A 1MTVA 5A8YA 1O3FA 4JK6A 1FY4A 2FOFA 1W0YH 2D2DA 2FOMB 2WPJS 1G3CA 3MFJA 3RMOH 1TGCA 2BD8A 2GD4B 2PKAA 3NCLA 3F9EA 2OC7A 1ZZZA 1K1IA 3P6ZB 3TH4H 1MBMA 2OC0A 2YNAA 5I46H 3MO6A 1YPEH 1DOJA 2WPHS 1GL0E 4TWYA 3SUDA 3KL6A 5DKMA 1EZQA 1LTOA 1PQ7A 7KMEH 4JYVH 2QV1A 1ABIH 1MMJN 4LZ1H 2QXGA 1JXPA 1P06A 1XUGA 2FEQH 3P17H 1HJ9A 3ZZAA 1C1SA 3FANA 4Y71A 5AFZH 3V13A 1C2IA 4Q7XA 2ZF0H 1VJAU 3SZNA 2BMGB 1SR5C 2ZZUH 1ARCA 4NZQA 3EYDA 1HCGA 3M61U 3E16B 1IQKA 1JMOH 2VNTA 3RXHA 3A7TA 1WBGB 5GPIB 1NRNH 4UFFH 1EP5A 1ZTKA 1EJAA 1VITH 3FP6E 2F9BH 1AD8H 3ZZBA 2FM2A 2BY9X 2AIPA 4UONA 1PPHE 4MTBA 2Q6GA 1LPGB 1A5HA 1EJNA 1O2JA 3T25A 1PPFE 1ZRBA 1GBTA 1UVOA 2D8WA 2UUJB 3U8OH 1ETTH 2RA0A 4U32A 2H5CA 2WV4A 2TPIZ 3MU0A 2HVXA 3NZIA 1CGIE 4CR9A 2CXVA 1LHGH 2EI8A 1TMUH 4B75A 1MQ6A 1OP0A 2BD3A 1TGSZ 1HDTH 1C1UH 1XM1A 5ABWA 2C8WB 4Y0YE 4FU8A 1K1MA 6GCHG 1A3BH 1RFNA 5EW2H 1ZTJA 4SGBE 3ZZCA 5L2ZH 4FUHA 4KTSA 4XBCA 3UNSA 3AAUA 4Y8ZA 1AKSB 3M3TA 5L6NH 2AMQA 2XTTB 3A7WA 2I6SA 2R0KA 1KLIH 1O3JA 1SGYE 1VITF 2P59A 1BMNH 1GBIA 1O2LA 2C4FH 5CE1A 2PTCE 3GOVB 3F6UH 2ZFRH 3KQBA 1F0UA 2GV6A 5TJXA 1YBWA 3SU1A 3LGVA 4K3JA 2CV3A 8ESTE 3BTFE 4I31A 1QURH 1YM0A 2VB0A 2A0QB 1G2LA 4XDEA 1TALA 1YPHE 1ETSH 3SNBA 5T6FA 2GDEH 7LPRA 1DLEA 3BN9A 4Q7YA 2ZFSA 1O2ZA 3TGKE 4WMEA 1H9LB 2YOLA 4GCHF 4DJZB 5EQQA 2EI6A 1GMDG 1QRWA 1UK3A 4O03A 3S7HB 1DWDH 1ZR0A 5F8ZA 3EAJA 4Y6DA 3AAVA 4BNRA 5LH8A 3RXDA 3URDA 1Z8GA 1A46H 2QXHA 1YPHC 1XKBC 3U69H 1W14U 2UWLA 1UVPA 1BMLA 1Q31A 1C5LH 4X6PA 1OX1A 1FI8A 3DA9B 3BTWE 2F9PA 3M36A 7ESTE 1HNEE 4AX9H 2VWOA 2ZFTA 3A85A 3ZVGA 1C5XB 1O3PB 2A4GA 2H2ZA 1QQUA 1FN6A 1SHHB 1TA6A 3K2UA 2B9LA 5GDSH 1G36A 4XBDA 1MTSA 5E8EH 1NC6A 2G4UA 3EA9A 3GDUA 2A5AA 1Y3UA 1BITA 3BTEE 1TWXB 1C5SA 4WWYA 1AE5A 1Z8IB 2R3YA 4AG2A 1L1NA 1AGJA 3HGPA 1OWIA 4X1QU 1V2NT 1P2MA 3GY8A 1W0ZU 3A7YA 1OYTH 3MMGA 1ZHPA 2BXTH 4BAQB 2ZGHA 1QJ7B 2V0BA 4DG4A 2TGPZ 4K1SA 1CSOE 1NRQH 1OWEA 4I33A 1O3OA 2AS9A 3ZZ6A 2W5EA 1UVTH 1K1LA 2XC4A 1GI9B 3PMHB 2BY7X 2HPQH 4IC5A 1DY8A 3NPSA 1A61H 1MQ5A 3PROA 2NU2E 4NCYA 1TX6A 2VWLA 5GCHG 5HMAA 3EDXB 4A1TA 3M7TA 1KXFA 3LOXA 3TK5A 1J8AA 1JWTA 1ZMLA 3BTGE 1LQEA 2ULLA 2A4OA 3RXFA 1TMTH 2H9TH 1NT1A 1O5DH 1TA2A 1O2WA 2FI4E 3AVZA 5E0GA 4ZXXH 1O3CA 1O35A 2GMTB 1GHXH 3T26A 1MCVA 1O2KA 2BOHB 1NPMA 4GPGA 1HJ8A 4IN1A 1C1PA 4E7RG 1TFXA 1EOJA 3BEIB 1BRBE 1TRMA 3SHAH 1B7XB 1GBKA 3A87A 3SU0A 2J2UA 3PTNA 5CHAB 1SGPE 5EPNA 1T7CA 1NS3A 2YNBA 3Q3XA 2ZTXA 3UWIA 1K1PA 2BB4A 1AI8H 3SGBE 1UCYE 3ZYDA 1AVGH 1Q2WA 2ANYA 1HPGA 3VXFH 2FWWA 2WYJA 4OS2A 1Z8RA 3PMBB 1KLJH 3SBKA 1TYNA 2BY8X 4GHQA 1S84A 1AKSA 1EUFA 1Z1JA 1SGEE 3SW2B 1O2TA 3A80A 3RC6A 4I8GA 1BTPA 2BLOA 1F5KU 3VB3A 1C2MA 2JH5D 4JZDH 3LIWA 1GMHG 1YC0A 4ZUHA 1TOCB 2WUCA 1GHAG 5TCCA 3QO6A 5SGAE 4ABIA 3HK6B 1FIWA 3G01A 2BX3A 1C2KA 2FZZA 2R0LA 4FXGH 2BD7A 2Y5GA 1QR3E 3DFJA 1FLEE 1V2TT 4BTUB 4XFQA 2ZP0H 2FI5E 2NU0E 1PFXC 2BZ6H 1ZYOA 1MH0A 2IN2A 2EA3A 4AFUA 5JBTA 4DVAU 3SOSA 1S6HA 1UTOA 3P92A 3NUMA 1TGNA 4D7FA 2A2XH 3L33A 4Q2KA 4U30A 3QZQA 3SU5A 1EP6A 1TOMH 1D3DB 9LPRA 1KIGH 1ESTA 1N1LA 1C4U2 1QL8A 2OC8A 1BMMH 2VIWA 3S9CA 1UK4A 4Y79A 1DANH 4FUBA 1K22H 1Y3YA 1MTNB 2QC2A 4FUCA 1TNHA 5IDKA 1SGFG 3SNEA 1C5TA 1PJPA 3KNXA 1XUHA 2FMJA 1ETRH 1TGTA 1SHYA 4WMDA 2ZU2A 1C1OA 2ZG0H 1HV7A 2PSYA 4LZ4B 1FMGA 4TPYA 3U8TH 2G55A 1O33A 2Q1JA 3GISB 2GMTC 1HGTH 2ZDLA 2FOCA 4INKA 1O3LA 2VIVA 5FHTA 3BG8A 3AW1A 4AOQA 2A7CA 2ZPQA 3MH5A 5ESTE 1DSTA 3L3TA 4FUIA 5GCHF 2J92A 1GI2A 1VCPA 4B2BA 4CHAC 1GI1A 1AVWA 4CRAA 5CHAC 1NRPH 1MTUA 3NWUA 3SU2A 2VJ1A 4THNH 3UREA 2Z9GA 1P2OA 1NRSH 2FOBA 3TJVA 1TBRH 3BV9B 1FAKH 3QTVH 1GHYH 1BBRH 2ZHFH 1OSSA 5E0JA 1C2LA 2C8XB 3TH3H 5DP6A 3GICB 2WPIS 3M5MA 2XWAA 1SGNE 4FVDA 2BQ7B 3RXOA 3ZVBA 3OSYA 2G8TA 1HBTH 3ZZ9A 2VGCB 2PHBA 4D8NA 2BVSH 3W95A 1FQ3A 4I8JA 5J4QA 1B0FA 3U1JB 2BD2A 3MH6A 1C5NH 3VFEA 1CGJE 2CF8H 3GY2A 1THRH 2PTNA 1T8MA 2XXLA 3K65B 4FUJA 2HALA 4AFQA 1FY5A 3V0XA 1HAOH 3U8RH 4JZIA 2ZQ2A 4YLQH 5HM2A 3ENSB 1C2HA 3SI3H 1SGRE 5DJ7A 1EZUC 1AFEH 1K28D 5T3HA 1C5MD 1N6XA 1XMNB 1MUEB 1SQAA 1BQYA 1IOEA 3M5OA 1O32A 2ZI2H 3BTTE 2A45B 1PPCE 1NZQH 3ATKA 3PMJA 3GCTG 1CT0E 3FZZA 1P9SA 2H5DA 5EG4A 3EA7A 1HAGE 2BX4A 1C1WH 4ZKNU 4WH8A 2GDDA 3KCGH 4YESB 4AB9A 1QB1A 1ELEE 3D62A 3KQEA 1MTNC 1ELBA 2BQ6B 4YT6H 1HRTH 4GAWA 1FY8E 1ZPBA 3RU4D 2Z9JA 1TRNA 5EU8A 3TPIZ 1FUJA 1W13U 3M7UA 1V2LT 1V2WT 2FYQA 3ELAH 3FVFB 1O31A 1W8BH 4UFGH 3SNDA 1C5VA 3MHWU 1GCDA 2H9EH 3FP8E 1CA0B 1Q3XA 1OS8A 2UWPA 3SJ8A 2FIRH 1BBRE 3V7TA 1WCZA 2B5TB 3ZZ4A 2F83A 4AN7A 1O36A 4MNXA 1DFPA 1TPPA 1QRXA 2J94A 4MDSA 4D76A 3MU8A 2AIQA 4ZKRU 1S0RA 5E2OA 5C5OA 3TGJE 1DXPA 1PQAA 1TBZH 4MG3A 1GBCA 1RTLA 7GCHG 3MYWA 1Y5UT 2BDYA 2Y82A 2TIOA 3SORA 1A0LA 1UHBB 5F6MA 1HAXB 1EB2A 1BHXB 2ZPSA 4ISNA 1GJ8B 4BANB 3HGNA 4DIIH 3E0NB 1H9IE 3L6PA 5HYOA 3RXGA 1C1MA 3OTJE 3A84A 3PO1B 1OPHB 2BDCA 1C1RA 1D6WA 1KDQB 2O8UA 2QF3A 3TVJB 3A81A 4WMFA 1SLWB 1FJSA 5LPFA 4K1EA 4O9VA 3RXLA 1CHGA 1NU7B 1QFKH 2SGDE 4HI3A 4WF8A 1W10U 1TNJA 5DP9A 2BDAA 3LH1A 4NA9H 1O2HA 2FI3E 2PWXA 4K1TA 1O5CB 4B76A 3NXPA 1FY3A 1AFQB 3DT0H 4Y7BA 1QBNA 1K2I1 1BHXF 3ZV9A 1C5RA 2Y7ZA 3TH2H 3A7XA 3MH4A 1EXFA 2XW9A 2Y5HA 1DWCH 3MNCA 1UMAH 3SI4H 5C3NA 4ABGA 1UTQA 1H8IH 3T62A 2JH0D 1P2NA 1G30B 3S69A 1GI6A 2VINA 1AMHA 1JOUB 4Y8XA 1T4VH 2WINI 2FOEA 3UOUA 8LPRA 1CA0C 5DG6A 4DIHH 1AB9B 1O38A 3BF6H 1EZXC 2Y81A 1H9HE 1T32A 3GCTF 3PLBA 1C2FA 3ZZDA 1GCTB 1G3DA 1GHZA 1UTNA 1CU1A 4BXSA 3ZV8A 3SV9A 1LHDH 1HYLA 2P95A 3OYPA 1BTXA 1GBLA 3RXRA 2P8OB 1O3AA 1GMCG 3AASA 4X2YA 2PSXA 4UDWH 2FP7B 4NG9H 1P2JA 1TNKA 2FOHA 1V2ST 3BTDE 3BEFB 1IQGA 1Z6EA 2ODPA 2QCYA 2A32A 4HGCA 1KSNA 1S81A 4TY6A 1M9UA 1FDPA 2AMDA 1EASA 1QL9A 4NGAH 1UO6A 3SUFA 2VH6A 5EW1H 1YF4A 3F9GA 2BQWB 2K1QA 1WTHD 1AU8A 3UNQA 3M5LA 2WPKS 1ELTA 3LU9B 5F8TA 2A4RA 1YGCH 1XUKA 1YCPM 3F1SB 2F91A 4YO9A 4NIXA 2GT8A 2Z94A 3PO1C 1P0SH 1J15A 4ASHA 3QGJA 1AUJA 4LOYH 2M5TA 3GYMA 2ZFFH 3KHVA 2A4QA 2O9QA 3RXIA 1ABJH 4X0WU 1O0DH 1P11E 3ZVFA 1MD8A 1HLTH 4IMQA 4OGYA 1WV7H 2CGAA 4A7IB 1OP2A 2KAIB 1F0RA 3UUZA 4CH2B 3A86A 1GBAA 1FNIA 1FY1A 3GY4A 4K8YA 2D1JA 5F03A 1FONA 5LPEA 3QN7A 4MNWA 2QXIA 1A0JA 1NROH 1AFQC 2R9PA 4UFDH 1GVZA 2BM2A 1ANDA 1E35B 1C9PA 1CQQA 2G5VA 4B74A 1O5GH 1ORFA 2A7HA 1UJ1A 1QL7A 1SPJA 1P8VC 2JKHA 2GKVE 1MKXH 1L4ZA 3SGQE 3MH7A 3ZVEA 3UPEA 3LH3A 3GDSA 1C5UA 3LJOA 5LPRA 1LPZB 1TABE 1HAHH 1AB9C 1FPCH 1LKBA 1YCPH 3EQ0H 1LQDB 1WAYB 2FS9A 1GCTC 1XUIA 4JMYA 1KDQA 1MAXA 2HLCA 2TRMA 1ZMJA 1BTWA 1O3IA 3CS7A 1TPAE 1FV9A 1WU1A 2P8OC 3RU4T 2R3UA 2Z7FE 1OP8A 1RIWB 8KME2 2W26A 5DP3A 1F0TA 1SOTA 5JB8S 2VVCA 1AY6H 5C2ZA 2FYRA 4OS1A 1HAZB 1T8OA 1GGDB 1FIZA 1Y8TA 1KTTB 5GXPA 4U2WA 1KXBA 4JCNA 5FPTA 2OTVA 3SV8A 3A7ZA 4A1XA 1GL1A 4KTUA 1F5LA 2FX4A 4INLA 4MPXA 5EQRA 1BB0B 1DM4B 1GHVH 1NY22 1ZRKA 1L0ZA 1UCYH 5AHGH 2ZGJA 3UQVA 5JBBS 1NM6A 1KXDA 1B5GH 1GMCF 4NIWA 4B1TA 3ZZ7A 1O5FH 3LGWA 4OS5A 1O2NA 3P70B 3UIRA 1TQ7B 1DSUA 3PTBA 4FUEA 1QRZA 1BTYA 2RDLA 2ZA5A 2BOKA 3B8JA 1IQEA 4GSOA 1DS2E 1EOLA 2ZHDA 1VJ9U 1P2KA 2VIPA 4Y7AA 3BEUA 2XBYA 3RLYH 5A2MH 1Y59T 2FTLE 2B7DH 1RJXB 1FXYA 3HK3B 2PKSB 2RA3A 3E90B 1V2JT 2P3TB 5JBCS 1GBDA 1JIMA 1WOFA 5A09A 2H6MA 5LGOA 2QN5T 2FESH 4ABFA 1BJVA 1G2MA 6GCHF 5C67A 1QNJA 1ZPZA 5JDUB 1LMWB 1JRTA 2PUQH 4NIVA 4OGXA 4B2CA 1ESAA 5FPSA 1MZDA 3QDZB 1PYTC 1W12U 2VU8E 2ZDVH 2DE8A 3V3MA 4KGAA 2BY6X 2EC9H 3SQEE 3VB4A 1C5YB 3BTME 3SJOA 1BMAA 1RGQA 4ZXYH 1EAXA 2B8OH 5EGMA 1KTSB 3LGUA 3HATH 4CHAB 1AUTC 2ZFPH 2A1DB 3M5NA 1ANCA 2ODQA 1CBWC 4X6OA 3UR9A 1SB1H 1QA0A 2XRCA 3LGIA 4GHTA 1UVUH 1CHOG 3S0NA 8GCHG 1BRCE 1IQJA 1GJ5H 1RIWC 3SU4A 1T31A 1YPMH 2KAIA 1O2MA 3TITA 1BUIA 1P01A 2UWOA 2F9UA 2FS8A 2XNIA 4XE4A 1GMDF 3Q3KA 4X1RU 1GGDC 1SFIA 2SFAA 4JYTA 3I77A 1NFXA 1D6RA 1S0QA 1ZLRA 1JIRA 1TBQH 1V2PT 3BIUH 2WPLS 1SLUB 1TRYA 1TX7A 2D26C 3VB5A 1WUNH 3LC3A 4CBOA 4TYDA 2Y6TA 3QUMP 1PQ5A 1AWHB 4WJG2 2GX4A 5A0CA 1XUJA 3K9XB 1BT7A 4J2YB 4NZLA 2C8ZB 5T6GA 1SGIB 4RN6A 1FAXA 2OD3B 4E05H 2BD9A 3M7QA 2FODA 1UTKA 1YLCA 3MO9A 3S7KB 5G4BA 2HPPH 1YKTA 1OWDA 2ZHWH 5FBEA 1A4WH 2DE9A 4DY7B 2PKSC 2DUCA 4QT8C 3R0FA 4Q80A 2VH0A 2ZKSA 3ODFA 1T8LA 1SGCA 2OBQA 3O8DA 4IW4E 2GP9B 1ELDE 1E38B 2XC0A 1T4UH 1RTFB 1A5IA 1KXCA 2SGQE 4OS7A 2ZDAH 2AMPA 2J38A 1C4V2 1QBOA 1F2SE 1S5SA 2V3HH 3MTYA 1GJCB 4JYUH 3IITA 1E36B 2VWMA 3ODDA 1BDAA 5AFYH 1F5RA 3LJJA 1SMFE 3RMLH 2FOAA 1VCQA 4YZUA 1ELAA 3RXTA 3DD2H 1P3EA 1DUEA 1LVYA 2ZPRA 3GYLB 2ILNA 3MU1A 2JETB 2F3CE 2QXJA 1GJ6A 4ABJA 1HAPH 1VGCC 1O3NA 3E3TA 3BG4B 4IN2A 3TK9A 1EPTB 1EKBB 2LPRA 3TNSA 3RC4A 1V3XA 1P09A 5EPYA 3SU6A 3QK1A 3MNXA 4K60A 3UWJH 2CJIA 4H42U 1CO7E 1W2KH 3A7VA 1MU8B 1GHWH 1NESE 1SGTA 1YPKH 4MPUA 3ZZ5A 2OLGA 1NU9A 1GJ7B 2CF9H 2SGFE 4D9RA 1DXWA 1NN6A 3O8RA 4OS4A 3MWIU 1Z71A 1HFDA 1MKXK 1V2QT 3P8FA 2V35A 2GCHG 3A88A 3QTOH 3UNRA 1O2VA 2ANWA 1BTZA 1GHBG 1ZHMA 1QY6A
chains in the Genus database with same CATH superfamily
2ANMH 4MNVA 5FCKA 3S9BA 3FZDA 1C5WB 3MU4A 1LO6A 2BLVA 1CGHA 5C5NA 6ESTA 1CHOF 1GJ4H 2Z9KA 4KELA 1TAWA 4O3UA 3P8OA 2HNTF 3QZRA 1XX9A 2PGBB 3F9HA 1O5BB 3ATMA 5DPAA 4X2XA 3ATIA 2HRVA 4IS5A 3P8NA 2J98B 4J1YA 3CP7A 1C5ZB 2V6NA 2W7SA 2C3SA 1GMHF 1YP9A 4RSPA 1DDJA 4ABHA 3RXBA 4AYYB 1K9OE 2VIDA 1GHAF 1V2RT 1EFRD 4OS6A 1EJMA 1DITH 1CE5A 2Y7XA 3LDXH 4Y10E 4TWWA 2BDHA 5T1VA 3E8LA 1V6DA 4NFEA 3ITIA 1MD7A 4SGAE 1ACBE 3RXCA 3JZ2B 4K8BA 4Z0KA 2ZHEH 3UQOA 2L6OA 1UCYK 1EATA 2GT7A 5T6DA 2HNTE 4FUDA 2XCNA 5EXMA 2OINA 2PW8H 1H1BA 3SNAA 4JZEH 2ZEBA 4X8SH 2R2WU 2VIOA 5FAHA 1G3EA 1P05A 4F4OC 1Z7KA 3P95A 1LCYA 1ZHRA 2GTBA 2O8LA 4UEHH 4CRCA 4JZ1A 5A0BA 5HKKD 1H8ED 1MABB 3PWBA 2B0FA 2ZHQH 4X2WA 3RP2A 1P3CA 1RRKA 1O2GH 2ZO3H 3RM0H 2THFB 2OQ5A 4YOIA 2JETC 3RXKA 2ZCHP 2QA9E 3BG4C 1EPTC 5C1UA 1GVLA 1O2QA 2CN0H 1LVOA 1ELCA 1UVSH 1GI7B 4NSYA 2ZC9H 1E37B 3I29A 4K69A 2XWBI 5C17A 5AVDA 2F4LA 1GBEA 3QWCH 2W3KA 4A92A 2BDBA 2VVUA 2WV9A 3TGIE 3MI4A 3RXQA 1GI5A 3WWBA 2W7UA 1SI5H 1THSH 5AF9H 1S82A 2AHME 4X8TH 3RXAA 1ZMNA 2K8IA 5FL7D 5HM9A 2WUBA 3D65E 4NA8A 1MCTA 4YOJA 1S83A 1BRUP 4F49A 4XOJA 4ZH8A 1BTUA 4HZHA 1JRSA 2FPZA 2J95A 4NFFA 1K1OA 3Q77A 1GJAB 4ISHH 2TGAA 3ESTA 5HXFA 2KCYA 2AYWA 1DE7H 4E06H 1ELVA 1A3EH 3PV4A 4AGKA 4IBLH 2BZAA 3LKWA 4FUGA 2QGRA 1LKAA 1A7SA 1BCUH 1TPSA 1GG6B 1VITG 3U9AH 2QIQA 2W3IA 3HKIB 1C2EA 1LHEH 1GVKB 3SUEA 3C1KA 3H09A 1ZJDA 2OP9A 1O2PA 1UK2A 2FTMA 2VIQA 5JBAS 5FBIA 1PPEE 2O8WA 3RMNH 2ZECA 1GHBF 2A5IA 4NWLA 4ZHLU 3OY6U 1HXEH 1P03A 1EPTA 1ZSKA 4E7NA 1GBJA 1SQOA 2ZCLP 4IGDA 1DWBH 4CREA 2PUXB 3OEHD 3D23A 5FPYA 3TIUA 3U28C 2GV7A 1MAYA 5K0HA 1CVWH 3GY6A 1Y5AT 4B6EA 1P57B 3C27B 3UTUH 3N7DA 3GCNA 3SU3A 4MQAA 3GCHB 3OX7U 1QQ4A 4ABDA 5DGJA 1TNGA 2ZU3A 4HTCH 1S6FA 2ZWLH 4BAMB 2AFQB 1ANEA 1V2MT 2TGTA 1MKWH 4X6NA 2BHGA 2XBXA 1QGFA 3B9FH 5C0TA 2VWNA 5C1XA 2JH6D 3HKJB 1P9UA 1GJBB 1HAYB 1HB0B 2XBVA 1FX0B 4DURA 1O3EA 5F53A 1UTMA 1KLTA 3K6ZA 4FUFA 1XXDA 4FU7A 1FN8A 3FOAA 4Q7ZA 3RXUA 3S9AA 1O2YA 1K0HA 1GBBA 3PM3A 2AH4X 1YLNA 3N7OA 1T8NA 3STIA 4R0IA 2J34A 4CH8B 1QJ1B 2BVRH 1CT4E 2BYAX 2C93B 3ZVCA 1GBFA 2Z9LA 4DW2U 3GY5A 3V12A 1EAWA 5H4IB 3O8CA 4VGCC 2AGGX 2J98A 2ZU1A 3E1XB 2FDAA 1RS0A 2SNWA 3M3SA 1TGBA 1GJ9B 5C20A 2A5KA 2EEKA 4CBNA 1C1VH 2L74A 4X2VA 2ZTZA 1SGFA 5E2PA 4DOQA 5CDFE 5DK1A 1O30A 4IC6A 3SGAE 4BOHA 2FLBH 3NRLA 1O37A 4X1NU 3IWMA 3MNSA 1DY9A 2G81E 5FCRA 3RC5A 1BMFD 4AB8A 3T5FH 1W0JD 1V2VT 4I32A 7GCHF 2O8TA 2J97A 4ZKOU 5DO4H 1THPB 4LXBH 3A8DA 2ZDNA 4I8KA 1IQFA 4FVBA 3A89A 3ZYEA 4X1SU 1BA8B 1U6QA 3F68H 2ZIQH 1GG6C 2G5NA 2ZQ1A 3AK5A 2WPMS 4X8UH 2TGDA 2LELA 4BAOB 5JYIA 2Z3EA 1QB9A 1XXFA 1E1RD 3SV2H 3UFAA 1QA7A 1F92A 3E6PH 1BBRK 1IHTH 3VGCB 1Z8JB 2Q6FA 4NSVA 1RTKA 2C90B 3T29A 3H7OA 3TLOA 1UTLM 4RKJB 1W7XH 1HIAB 3WW7A 1MTWA 5PTPA 2GVFA 1O3MA 2SGPE 3MOCA 1YY3A 2TBSA 1YYY1 1G3BA 1K1JA 3RMMH 3TJNA 4ISOA 3GCHC 1GJDB 1UHBA 1EZSC 4Y0ZE 1N6YA 3DHKH 4BAHB 3KIDU 2NU4E 1SBWA 1OKXA 3RXSA 1YPJH 2BDIA 2EI7A 4D7GA 2RDEA 2AERH 4K2YA 5FX6A 1XUFA 2VVVA 3SQHE 4MNYA 1XKAC 3EE0B 2W6ID 1CBWB 1DICA 2ZGXH 1NO9H 1PPGE 2V3OH 3CENA 1G32B 1AVXA 1ZSJA 4BTIB 2HVYB 1BIOA 2GGVB 4IMZA 1NTPA 2A2QH 1P12E 1H4WA 1VCWA 3UOPA 4TT3D 1E34B 2PP6A 4GUXA 5B6OA 2JJ1D 4O3TA 4RKOB 3TNTA 5GIBA 3NKKA 5A8ZA 2UUFB 4UD9H 4AG1A 5DP4A 1LHFH 1O3DA 2BY5X 1HAIH 3A82A 3R3GB 4INHA 1SLVB 3M35A 3BSQA 2F9OA 4AFZA 1GDQA 2GCTB 1WYKA 1O3HA 1AHTH 1D3PB 4BTTB 2P16A 1EAUA 1G37A 2BXUH 1A0HB 1AWFH 1Z6JH 4CR5A 1AZ8A 1IHSH 1BOQA 1JBUH 5L2YH 1Y3XA 1ELGA 3OU0A 4UE7H 4AFSA 1HAVB 5JB9S 3PYHA 1WTGH 1D9IA 3F9FA 4Y8YA 2ALPA 2G51A 3LC5A 2O8MA 1IQLA 1O3BA 1KY9A 4YOGA 1HXFH 1TX8A 9ESTA 1O34A 1NFUA 3RXPA 1Y5BT 1B0EA 3VGCC 1INCA 3P8GA 1J14A 4YTAA 1GDNA 3VB7A 1O2RA 1P10A 1X7AC 1GDUA 3D49H 1SQTA 3RLWH 3ATLA 1Z1IA 1A5GH 1S6LA 1ZGIA 1GWAA 1N8OB 4ZAEA 1GBHA 1VR1H 1XVMA 1DX5M 3H7TA 3FFGA 1IQIA 5DP5A 5A0AE 1ELFA 3OE7D 4GLYA 4ZCNA 4X8VH 1FZZA 5L30H 3LONA 5FXLA 1F7ZA 1AN1E 1QCPA 4ISLA 5EQSA 2FOGA 2YMSD 4ISIH 1PPBH 1MU6B 1NBMD 3F2HA 1ANBA 5IK2D 4KP0A 3WY8A 1VGCB 1TONA 1W3CA 2BDGA 2J4IA 4DGJA 2HOBA 2OBOA 1DPOA 1O2SA 2BVXH 2ZDKA 2LP6A 2ANKH 3RM2H 1SVPA 3LT3A 1YPLH 5DSFA 3SO3A 4GVUA 3A83A 5DP7A 2WYGA 1K1NA 1LDTT 5ETXA 3RXEA 4HG6A 1IAUA 1SSXA 3QLPH 1AZZA 3KGPA 3SV6A 2JJ2D 3RXVA 1C5OH 1EX3A 3KF2A 1AO5A 3UR6A 2OC1A 1PPZA 1Y3WA 4A1VA 4AYVB 1J16A 1E0FD 2H9HA 2CMYA 1C2DA 1HIAA 3BTKE 1H8DH 1BJUA 1LPKB 1MKWK 2GCTC 1QHRB 4YT7H 2NU1E 4MVNA 3E91A 2EQNA 5CMXH 2OQUA 3PB1E 3BTQE 4A5TS 4HFPB 3OAAD 1A2CH 4AGJA 4UFEH 3QGNB 1UTPA 2ALVA 3TJOA 1OWJA 4X6MA 3TJUA 3PWCA 3A8AA 5F8XA 4K5ZA 3SV7A 5I25A 1V2UT 4KKDA 3DUXH 2PV9B 3PMAB 1SC8U 2FLRH 1O2XA 3A8BA 4Y11E 4XBBA 1SL3A 1HJAB 1ID5H 3ZZ8A 1O3KA 1RD3B 3BIVH 5HIYA 1CA8B 2ZU5A 4AZ2B 4H4FA 4B71A 1IQNA 1TNLA 4JK5A 5TCAA 4FU9A 1DVAH 4ZMAH 1A1RA 1SLXB 2QE7D 4A6LA 3ZZ3A 1NFYA 1QBVH 4MLFB 6CHAB 3T27A 1TIOA 1J17T 2QF0A 4MPWA 1N8OC 3RU4E 3RUOA 3W94A 3PLKA 4ZROA 1L1GA 4ABBA 2P94A 1PYTD 2Z6BD 1NFWA 5KGOA 2ESTE 4TY7A 1OHHD 4XSKU 2GZ7A 3A8CA 5GWZA 3F2GA 1LVMA 1P02A 3B23B 5EJZA 3DSGA 3ZVDA 1OXGA 3Q76A 1QTFA 1NRRH 1KYNA 2BD5A 1BRAA 1P2IA 3KN2A 2J9NA 4WY3A 3SJIA 4B2AA 3LGTA 2QF5A 4YM9A 2ZNKH 1O2IA 1XVOA 4CRDA 5JPMH 1ESBA 1P04A 1GI0A 2VBCA 5IYTA 1CT2E 2BTCE 3GY7A 2I6QA 2QYIA 1D3TB 2XBWA 2Z3CA 2GZ9A 1KXAA 2IOTA 1OWKA 1LHCH 2Y5FA 1SGDE 1HAVA 2UUKB 4MPVA 1MBQA 2NWNA 2ODYB 1TQ0B 2G52A 2Z9IA 2ZFQH 4KTCA 3EA8A 4CRGA 5GJ4B 2Z3DA 4Y76A 4TPIZ 2Y80A 2XNDD 5K7RA 1L2EA 2XYAA 2ZGCA 1ZGVA 3PV2A 4I7YH 3SHCH 1EQ9A 1L1JA 4WXVA 3VB6A 1WQVH 2RCEA 1O5AB 2XC5A 1OOKB 5E0HA 1C2GA 1OYQA 3UY9A 3Q3YA 3UB0A 1IQMA 5EXLA 4CRFA 2STAE 3SJ9A 1DWEH 2ZU4A 1KXEA 2P3UB 2PKAB 4NIYA 3Q00A 4YLUA 4ZHAA 1O2UA 1QB6A 2SGAA 1LVBA 1WQSA 1YCPK 1EB1H 1D3QB 2CHAB 4OM9A 8GCHF 3ATWA 1DLKB 2IPHA 3M3VA 1W7GH 1GPZA 2QAAA 3NK8A 1DUAA 1SFQB 2EY4C 3EE7A 3W1EA 2JIZD 5EODA 2V3MA 1C5QA 2A7JA 2FX6A 2GZ8A 1BTHH 2SGEE 4WVPE 4ABAA 4DT7B 3PRBA 1V2KT 1TPOA 2PR3A 4H6SB 3SJKA 2AEIH 4WH6A 1HJAC 2QY0B 2AGIX 2RG3A 3SUGA 3GY3A 5C1YA 2LNCA 1AQ7A 4B73A 2OCVB 2H1UA 4AORA 1O39A 5A8XA 1L4DA 4U01A 1ARBA 5EOKA 4H6TA 3MO3A 2F9VA 3IG6B 3GDVA 4M7GA 4ABEA 3LPRA 1FPHH 6CHAC 4I8LA 3BTHE 4JZFH 2A31A 3SN8A 1ZJKA 2NU3E 1COWD 5J4SA 2BLWA 1RXPA 3HPTB 4ZKSU 4CRBA 3JZ1B 3U98H 1SGQE 1SG8B 3DFLA 1EAIA 1WSSH 2Q6DA 3KYGA 2R2MB 4Z6AH 4D9QA 3U1IB 1YLDA 2FO9A 1C1TA 2HNTC 3RXJA 1OWHA 6LPRA 1MZAA 1DT2A 2HGTH 1O5EH 4I8HA 5EXNA 1HUTH 3MNBA 2SNVA 1TNIA 2BD4A 3H5CB 1C2JA 1C1QA 3T2NA 1K21H 3FP7E 2G00A 3E0PB 4VGCB 2WSSD 1BZXE 1GBMA 4X1PU 1GI3A 3KEEA 5FX5A 1C9TA 3I78A 3RDZA 5ESBA 2P3FH 5DP8A 2ZCKP 1GI8B 2PGQB 2ASUB 5HGGA 2UUYA 3DSPA 2AGEX 3AW0A 2P93A 3RXMA 4BXWA 2ZGBH 3GCOA 2ZDMA 3KQDA 2G4TA 4NWKA 3KQCA 4DCDA 1TE0A 1C1NA 1W11U 1IQHA 2C8YB 2OXSA 3FAOA 1ZTLA 3K6YA 3OY5U 2F9NA 1AIXH 1QZ8A 2HWLB 2CHAC 4ESTE 1S85A 1O2OA 1C4Y2 3T28A 1TB6H 1UTJA 2ZTYA 3TK6A 1Y3VA 2PLXA 4LK4A 3VPKA 5BRRE 4Q4LA 4WXIA 2VGCC 3O8BA 1P2QA 1TLDA 1AE8H 3MU5A 2IJOB 1PQ8A 1ZSLA 1QIXB 3LGYA 1O3GA 1G9IE 2GCHF 1J9CH 3SNCA 5BPEA 2KFWA 4ZHMU 3CS0A 3URCA 4R8TB 2PFEA 2STBE 2OUAA 4P02A 3M37A 3VEQB 4PROA 1TMBH 1ZOMA 3STJA 2XCFA 1F0SA 3TU7H 1D4PB 3PLPA 3QX5H 4GCHG 4NA7A 3EGKH 3ZVAA 1C5PA 1VZQH 2FXRA 1GI4A 3VXEH 1ZPCA 1V2OT 2BLQA 1SOZA 1YPGH 4BAKB 1QJ6B 2WV5A 4O97A 1MTVA 5A8YA 1O3FA 4JK6A 1FY4A 2FOFA 1W0YH 2D2DA 2FOMB 2WPJS 1G3CA 3MFJA 2W6JD 3RMOH 1TGCA 2BD8A 2GD4B 2PKAA 3NCLA 3F9EA 2OC7A 1ZZZA 3SZEA 1K1IA 3P6ZB 3TH4H 1MBMA 2OC0A 2YNAA 5I46H 3MO6A 1YPEH 1DOJA 2WPHS 1GL0E 4TWYA 3SUDA 3KL6A 5DKMA 1EZQA 1LTOA 1PQ7A 7KMEH 4JYVH 2QV1A 1ABIH 1MMJN 4LZ1H 2QXGA 1JXPA 1P06A 1XUGA 2FEQH 3P17H 1HJ9A 3ZZAA 1C1SA 3FANA 4Y71A 5AFZH 3V13A 1C2IA 4Q7XA 2ZF0H 1VJAU 3SZNA 2BMGB 1SR5C 2ZZUH 1ARCA 4NZQA 3EYDA 1HCGA 3M61U 3E16B 1IQKA 1WDIA 1JMOH 2VNTA 3RXHA 3A7TA 1WBGB 5GPIB 1SKYE 1NRNH 4UFFH 1EP5A 1ZTKA 1EJAA 1VITH 3FP6E 2F9BH 1AD8H 3ZZBA 2FM2A 2BY9X 2AIPA 4UONA 1PPHE 4MTBA 2Q6GA 1LPGB 1A5HA 1EJNA 1O2JA 3T25A 1PPFE 1ZRBA 1GBTA 1UVOA 2D8WA 2UUJB 3U8OH 1ETTH 2RA0A 4U32A 2H5CA 2WV4A 2TPIZ 2KM0A 2HVXA 3MU0A 3NZIA 1CGIE 4CR9A 2CXVA 1LHGH 2EI8A 1TMUH 4B75A 1MQ6A 1OP0A 3F2FA 2BD3A 1TGSZ 1HDTH 1C1UH 1XM1A 5ABWA 2C8WB 4Y0YE 4FU8A 1K1MA 6GCHG 1A3BH 1RFNA 5EW2H 1ZTJA 4SGBE 3ZZCA 5L2ZH 4FUHA 4KTSA 4XBCA 3UNSA 3AAUA 4Y8ZA 3CNRA 1AKSB 3M3TA 5L6NH 2AMQA 2XTTB 3A7WA 2I6SA 2K0QA 2R0KA 2KCOA 1KLIH 1O3JA 1SGYE 1VITF 2P59A 1BMNH 1GBIA 1O2LA 2C4FH 5CE1A 2PTCE 3GOVB 3F6UH 2ZFRH 3KQBA 1F0UA 2GV6A 5TJXA 1YBWA 3SU1A 3LGVA 4K3JA 2CV3A 8ESTE 3BTFE 4I31A 1QURH 1YM0A 2VB0A 2A0QB 3ZIAD 1G2LA 4XDEA 1TALA 1YPHE 1ETSH 3SNBA 5T6FA 2GDEH 2HLDD 7LPRA 1DLEA 3BN9A 3FO8D 4Q7YA 2ZFSA 1O2ZA 3TGKE 4WMEA 1H9LB 2YOLA 4GCHF 4DJZB 5EQQA 2EI6A 1GMDG 1QRWA 1UK3A 4O03A 3S7HB 1DWDH 1ZR0A 5F8ZA 3EAJA 4Y6DA 3AAVA 4BNRA 5LH8A 3RXDA 3URDA 1Z8GA 1A46H 2QXHA 1YPHC 1XKBC 3U69H 4M9FA 1W14U 2UWLA 3OEED 1UVPA 1BMLA 1Q31A 1C5LH 4X6PA 1OX1A 1FI8A 3DA9B 3BTWE 2F9PA 3M36A 7ESTE 1HNEE 4AX9H 2VWOA 2ZFTA 3A85A 3ZVGA 1C5XB 1O3PB 2A4GA 2H2ZA 1QQUA 1FN6A 1SHHB 1TA6A 3K2UA 2B9LA 5GDSH 1G36A 4XBDA 1MTSA 5E8EH 1NC6A 2G4UA 3EA9A 3GDUA 2A5AA 1Y3UA 1BITA 3BTEE 1TWXB 1C5SA 4WWYA 1AE5A 1Z8IB 2R3YA 4AG2A 1L1NA 1AGJA 3HGPA 2OK5A 1OWIA 4X1QU 1V2NT 1P2MA 3GY8A 1W0ZU 3A7YA 1OYTH 3MMGA 1ZHPA 2BXTH 4BAQB 2ZGHA 1QJ7B 2V0BA 4I86A 4DG4A 2TGPZ 4K1SA 1CSOE 1NRQH 1OWEA 4F55A 4I33A 1O3OA 2AS9A 3ZZ6A 2W5EA 1UVTH 1K1LA 2XC4A 4XRNA 1GI9B 3PMHB 4FETA 2BY7X 2HPQH 4IC5A 1DY8A 3NPSA 1A61H 4RT1A 5C0UA 1MQ5A 3PROA 2NU2E 4NCYA 1TX6A 2VWLA 5GCHG 5HMAA 3EDXB 4A1TA 3M7TA 1KXFA 3LOXA 3TK5A 1J8AA 1JWTA 1ZMLA 3BTGE 1LQEA 2ULLA 2A4OA 3RXFA 1TMTH 2H9TH 1NT1A 1O5DH 1TA2A 1O2WA 2FI4E 2KR7A 3AVZA 5E0GA 1O3CA 1O35A 2GMTB 4ZXXH 1GHXH 3T26A 1MCVA 1O2KA 2BOHB 1NPMA 4GPGA 1HJ8A 4IN1A 1C1PA 4E7RG 1TFXA 1EOJA 3BEIB 1BRBE 1TRMA 3SHAH 1B7XB 1GBKA 3A87A 3SU0A 2J2UA 3PTNA 5CHAB 1SGPE 5EPNA 1T7CA 4P00A 1NS3A 2YNBA 3Q3XA 2ZTXA 3UWIA 4F48B 1K1PA 3SYJA 2BB4A 1AI8H 3SGBE 1UCYE 3ZYDA 1AVGH 1Q2WA 2ANYA 1HPGA 3VXFH 2FWWA 2WYJA 4OS2A 1Z8RA 3PMBB 1KLJH 4TSFD 3SBKA 1TYNA 2BY8X 4GHQA 1S84A 1AKSA 1EUFA 1Z1JA 1SGEE 3SW2B 1O2TA 3A80A 3RC6A 4I8GA 1BTPA 2BLOA 1F5KU 3VB3A 1C2MA 2JH5D 4JZDH 3LIWA 1GMHG 5KEDA 1YC0A 4ZUHA 1TOCB 2WUCA 1GHAG 2IPQX 5TCCA 3QO6A 5SGAE 4ABIA 3HK6B 1FIWA 3G01A 2BX3A 1C2KA 2FZZA 2R0LA 4FXGH 2BD7A 2Y5GA 1QR3E 3DFJA 1FLEE 1V2TT 4BTUB 4XFQA 2ZP0H 2FI5E 2NU0E 1PFXC 2BZ6H 1ZYOA 1MH0A 2IN2A 2EA3A 4AFUA 5JBTA 4DVAU 3SOSA 1S6HA 1UTOA 3P92A 3NUMA 1TGNA 4D7FA 2A2XH 3OFND 3L33A 4Q2KA 4U30A 3QZQA 3SU5A 1EP6A 1TOMH 1D3DB 9LPRA 1KIGH 3FKSD 1ESTA 1N1LA 1C4U2 1QL8A 2OC8A 1BMMH 2VIWA 3S9CA 1UK4A 4Y79A 1DANH 4FUBA 3MQKC 1K22H 1Y3YA 1MTNB 2QC2A 3PRDA 4FUCA 1TNHA 5IDKA 2XOKD 1SGFG 3SNEA 1C5TA 1PJPA 3KNXA 1XUHA 2FMJA 1ETRH 1TGTA 1SHYA 4ACBA 4WMDA 2ZU2A 1C1OA 2ZG0H 1HV7A 2PSYA 4LZ4B 1FMGA 4TPYA 3U8TH 2G55A 1O33A 2Q1JA 3GISB 2GMTC 1HGTH 2ZDLA 2FOCA 4INKA 1O3LA 2VIVA 5FHTA 3BG8A 3AW1A 4AOQA 2A7CA 2ZPQA 3MH5A 5ESTE 1DSTA 3L3TA 5DN6D 4FUIA 5GCHF 2J92A 1GI2A 1VCPA 4B2BA 4CHAC 1GI1A 1AVWA 4CRAA 5CHAC 1NRPH 1MTUA 3NWUA 3SU2A 2VJ1A 4RT0A 4THNH 3UREA 2Z9GA 3FN8A 1P2OA 1NRSH 2FOBA 3TJVA 1TBRH 3BV9B 1FAKH 1KMHB 3QTVH 1GHYH 1BBRH 2ZHFH 1OSSA 5E0JA 1C2LA 2C8XB 3TH3H 1SQRA 5DP6A 3GICB 2WPIS 3M5MA 2XWAA 5HIZA 1SGNE 4FVDA 2BQ7B 3RXOA 3ZVBA 3OSYA 2G8TA 1HBTH 3ZZ9A 2VGCB 2PHBA 4D8NA 2BVSH 3W95A 1FQ3A 4I8JA 5J4QA 1B0FA 3U1JB 2BD2A 3MH6A 1C5NH 3VFEA 1CGJE 2CF8H 3GY2A 1THRH 2PTNA 1T8MA 2XXLA 3K65B 4FUJA 2HALA 4AFQA 1FY5A 3V0XA 1HAOH 3KYFA 3U8RH 4JZIA 2ZQ2A 4YLQH 5HM2A 3ENSB 5B6LA 1C2HA 3SI3H 5KECA 1SGRE 5DJ7A 1EZUC 1AFEH 1K28D 5T3HA 1C5MD 1N6XA 1XMNB 1MUEB 1SQAA 1BQYA 1IOEA 3M5OA 2KX4A 1O32A 2ZI2H 3BTTE 2A45B 1PPCE 1NZQH 3ATKA 3PMJA 3GCTG 1CT0E 3FZZA 1P9SA 2H5DA 5EG4A 3EA7A 1HAGE 2BX4A 1C1WH 2V7QD 4ZKNU 4WH8A 2GDDA 3KCGH 4YESB 4AB9A 1QB1A 1ELEE 3D62A 5EJLA 2WPDD 3KQEA 4Q63A 2RFKC 1MTNC 1ELBA 2BQ6B 4YT6H 1HRTH 4GAWA 1FY8E 1ZPBA 3RU4D 2Z9JA 1TRNA 5EU8A 3TPIZ 1FUJA 1W13U 3M7UA 2WZQA 1V2LT 1V2WT 2FYQA 3ELAH 3FVFB 1O31A 1W8BH 4UFGH 3SNDA 1C5VA 3MHWU 1GCDA 3N99A 2H9EH 3FP8E 1CA0B 1Q3XA 1OS8A 2UWPA 3SJ8A 2FIRH 1BBRE 3V7TA 1WCZA 2B5TB 3ZZ4A 2F83A 4AN7A 1O36A 4MNXA 1DFPA 1TPPA 1QRXA 2J94A 4MDSA 4D76A 3MU8A 2AIQA 2KCAA 4ZKRU 1S0RA 5E2OA 5C5OA 3TGJE 1DXPA 5CHBA 1PQAA 1TBZH 4MG3A 1GBCA 1E79D 1RTLA 7GCHG 3MYWA 1Y5UT 3GS9A 2BDYA 2Y82A 3DSOA 2TIOA 3SORA 4RI0A 1A0LA 1UHBB 5F6MA 1HAXB 1EB2A 1BHXB 2ZPSA 4ISNA 1GJ8B 4BANB 3HGNA 4DIIH 3E0NB 1H9IE 3L6PA 5HYOA 3RXGA 1C1MA 3OTJE 3A84A 3PO1B 1OPHB 2BDCA 1C1RA 5GNDA 1D6WA 1KDQB 2O8UA 2QF3A 3TVJB 3A81A 3F0PA 4WMFA 1SLWB 1FJSA 5LPFA 4K1EA 4O9VA 3RXLA 1CHGA 1NU7B 1QFKH 2SGDE 4HI3A 4WF8A 1W10U 1TNJA 5DP9A 2BDAA 3LH1A 4NA9H 1O2HA 2FI3E 2PWXA 4Z1MD 4K1TA 1O5CB 4B76A 3NXPA 1FY3A 1AFQB 3DT0H 4Y7BA 1QBNA 1K2I1 1BHXF 3ZV9A 5C94A 1C5RA 2Y7ZA 3TH2H 3A7XA 3MH4A 1EXFA 2XW9A 2Y5HA 1DWCH 3MNCA 1UMAH 3SI4H 5C3NA 4ABGA 1UTQA 1H8IH 3T62A 2JH0D 1P2NA 2J5UA 1G30B 3OTPA 3S69A 1GI6A 2VINA 1AMHA 1JOUB 4Y8XA 1YWUA 4B6FA 4ACAA 1T4VH 2WINI 2FOEA 3UOUA 8LPRA 1CA0C 5DG6A 4DIHH 1AB9B 1O38A 3BF6H 1EZXC 2Y81A 1H9HE 1T32A 3GCTF 2YMSB 3PLBA 1C2FA 3ZZDA 1GCTB 1G3DA 1GHZA 1UTNA 1CU1A 3VG8A 4BXSA 3ZV8A 2WHXA 3SV9A 1LHDH 1HYLA 2P95A 3OYPA 1BTXA 1GBLA 3RXRA 2P8OB 1O3AA 1GMCG 3AASA 4X2YA 2PSXA 4UDWH 2FP7B 4NG9H 1P2JA 1TNKA 2FOHA 1V2ST 3BTDE 3BEFB 1IQGA 1Z6EA 2ODPA 2QCYA 2A32A 4HGCA 1KSNA 1S81A 4TY6A 1M9UA 1FDPA 2AMDA 1EASA 1QL9A 4NGAH 1UO6A 3SUFA 2VH6A 5EW1H 1YF4A 1UW7A 3F9GA 2BQWB 2QF4A 2K1QA 1WTHD 1AU8A 3UNQA 3M5LA 3F0OA 2WPKS 1ELTA 3LU9B 5F8TA 2A4RA 1YGCH 1XUKA 1E1QD 1YCPM 3F1SB 2F91A 4YO9A 4NIXA 2GT8A 2Z94A 3PO1C 1P0SH 1J15A 4ASHA 3QGJA 1AUJA 4LOYH 2M5TA 3GYMA 2ZFFH 3KHVA 2A4QA 2O9QA 3RXIA 1ABJH 4X0WU 1O0DH 1P11E 3ZVFA 1MD8A 1HLTH 4IMQA 4OGYA 1WV7H 2CGAA 4A7IB 1OP2A 2KAIB 1F0RA 3UUZA 4CH2B 3A86A 1GBAA 1FNIA 1FY1A 3GY4A 4K8YA 2D1JA 5F03A 1FONA 5LPEA 3QN7A 4MNWA 2QXIA 1A0JA 1NROH 1AFQC 2R9PA 4UFDH 3WWFA 1GVZA 2BM2A 1ANDA 1E35B 1C9PA 2GJGA 1CQQA 2G5VA 4B74A 1O5GH 1ORFA 1NBME 2A7HA 1UJ1A 1QL7A 1SPJA 1P8VC 2JKHA 2GKVE 1MKXH 1L4ZA 3SGQE 3MH7A 3ZVEA 3UPEA 3LH3A 3GDSA 1C5UA 3LJOA 5LPRA 1LPZB 1TABE 1HAHH 1AB9C 1FPCH 1LKBA 1YCPH 2YMSC 3EQ0H 1LQDB 1WAYB 2FS9A 1GCTC 1XUIA 4JMYA 1KDQA 1MAXA 2HLCA 2TRMA 1ZMJA 1BTWA 1O3IA 3CS7A 5EIYA 1TPAE 1FV9A 1WU1A 2P8OC 3RU4T 2R3UA 2Z7FE 1OP8A 1RIWB 8KME2 2W26A 5DP3A 4XD7D 1F0TA 1SOTA 5JB8S 2VVCA 1AY6H 5C2ZA 2FYRA 2KZ4A 4FOUC 4OS1A 1HAZB 1T8OA 1GGDB 1FIZA 1Y8TA 1KTTB 5GXPA 4U2WA 1KXBA 4JCNA 5FPTA 2OTVA 3SV8A 3A7ZA 1VKYA 4A1XA 1GL1A 4KTUA 1F5LA 2CK3D 2FX4A 4INLA 4MPXA 1BB0B 1DM4B 1GHVH 1NY22 1ZRKA 1L0ZA 5EQRA 1UCYH 5AHGH 2ZGJA 3KQ5A 5JBBS 3UQVA 1NM6A 1KXDA 1B5GH 1GMCF 3DCLA 4NIWA 1W0KD 4B1TA 3ZZ7A 1O5FH 3LGWA 4OS5A 1O2NA 3P70B 3UIRA 1TQ7B 1DSUA 3PTBA 4FUEA 1QRZA 1BTYA 2RDLA 2ZA5A 2BOKA 3B8JA 1IQEA 4GSOA 1DS2E 1EOLA 2ZHDA 1VJ9U 1P2KA 2VIPA 4Y7AA 3BEUA 2XBYA 3RLYH 5A2MH 1Y59T 2FTLE 2B7DH 1RJXB 1FXYA 3HK3B 2PKSB 2RA3A 3E90B 1V2JT 2P3TB 3PV5A 1GBDA 5JBCS 1JIMA 1WOFA 5A09A 2H6MA 5LGOA 2QN5T 2FESH 4ABFA 1BJVA 1G2MA 6GCHF 5C67A 1QNJA 4DT4A 1ZPZA 5JDUB 1LMWB 1JRTA 2PUQH 4NIVA 4OGXA 4B2CA 1ESAA 5FPSA 3F3BA 1MZDA 3QDZB 1PYTC 1W12U 2VU8E 2ZDVH 2DE8A 3V3MA 4KGAA 2BY6X 2EC9H 3SQEE 3VB4A 1C5YB 3BTME 3SJOA 1BMAA 1RGQA 4ZXYH 1EAXA 2B8OH 5EGMA 1KTSB 3LGUA 3HATH 4CHAB 5EJ1A 1AUTC 2ZFPH 2A1DB 3M5NA 4AC9A 1ANCA 2ODQA 1CBWC 4X6OA 3UR9A 1SB1H 1QA0A 2XRCA 3LGIA 1H8HD 1UVUH 4GHTA 1CHOG 3S0NA 8GCHG 1BRCE 1IQJA 1GJ5H 1RIWC 3SU4A 1T31A 1YPMH 2KAIA 1O2MA 3TITA 1BUIA 1P01A 2UWOA 2F9UA 2FS8A 2XNIA 4XE4A 1GMDF 3Q3KA 4X1RU 1GGDC 1SFIA 2SFAA 4JYTA 3I77A 1NFXA 1D6RA 1S0QA 1ZLRA 1JIRA 1TBQH 1V2PT 3BIUH 2WPLS 1SLUB 1TRYA 1TX7A 2D26C 3VB5A 2KCPA 1WUNH 3LC3A 4CBOA 4TYDA 2Y6TA 3QUMP 1PQ5A 2JDID 1AWHB 4WJG2 2GX4A 5A0CA 1XUJA 3K9XB 1BT7A 4J2YB 4NZLA 2C8ZB 5T6GA 1SGIB 4RN6A 4ASUD 1FAXA 2OD3B 4E05H 2BD9A 3M7QA 2FODA 1UTKA 1YLCA 3MO9A 3S7KB 5G4BA 2HPPH 1YKTA 1OWDA 2ZHWH 5FBEA 1A4WH 2DE9A 4DY7B 2PKSC 2DUCA 4QT8C 3R0FA 3N7EA 4Q80A 2VH0A 2ZKSA 3ODFA 1T8LA 1SGCA 2OBQA 3O8DA 4IW4E 2GP9B 1ELDE 1E38B 2XC0A 1T4UH 1RTFB 1A5IA 1KXCA 2SGQE 4OS7A 2ZDAH 2AMPA 2J38A 1C4V2 1QBOA 1F2SE 1S5SA 2M2AA 2V3HH 3MTYA 1GJCB 4JYUH 3IITA 3UAIC 1E36B 2VWMA 3ODDA 1BDAA 5AFYH 1F5RA 3LJJA 1SMFE 3RMLH 1WXRA 4YXWD 2FOAA 1VCQA 4YZUA 1ELAA 3RXTA 3DD2H 1P3EA 1DUEA 1LVYA 2ZPRA 3GYLB 2ILNA 3MU1A 2JETB 2F3CE 2QXJA 1GJ6A 4ABJA 1HAPH 1VGCC 1O3NA 3E3TA 3BG4B 4IN2A 3TK9A 1EPTB 1EKBB 2LPRA 3TNSA 3RC4A 1V3XA 1P09A 2F43B 5EPYA 3QK1A 3SU6A 3MNXA 4K60A 3UWJH 2CJIA 4H42U 1CO7E 1W2KH 3A7VA 1MU8B 1GHWH 1NESE 1SGTA 1YPKH 4MPUA 3ZZ5A 2OLGA 1NU9A 1GJ7B 2CF9H 2SGFE 4D9RA 1DXWA 1NN6A 3O8RA 4OS4A 3MWIU 1Z71A 1HFDA 1MKXK 1V2QT 3P8FA 2V35A 2GCHG 3A88A 3QTOH 3UNRA 2IJD1 1O2VA 2ANWA 1BTZA 1GHBG 1ZHMA 1QY6A
chains in the Genus database with same CATH topology
2ANMH 4MNVA 5FCKA 3S9BA 3FZDA 1C5WB 3MU4A 1LO6A 2BLVA 1CGHA 5C5NA 6ESTA 1CHOF 1GJ4H 2Z9KA 4KELA 1TAWA 4O3UA 3P8OA 2HNTF 3QZRA 1XX9A 2PGBB 3F9HA 1O5BB 3ATMA 5DPAA 4X2XA 3ATIA 2HRVA 4IS5A 3P8NA 4J1YA 3CP7A 1C5ZB 2V6NA 2W7SA 2C3SA 1GMHF 1YP9A 4RSPA 1DDJA 4ABHA 3RXBA 4AYYB 1K9OE 2VIDA 1GHAF 1V2RT 4OS6A 1EJMA 1DITH 1CE5A 2Y7XA 3LDXH 4Y10E 4TWWA 2BDHA 3E8LA 1V6DA 4NFEA 3ITIA 1MD7A 4SGAE 1ACBE 3RXCA 3JZ2B 4K8BA 4Z0KA 2ZHEH 3UQOA 1UCYK 1EATA 2GT7A 5T6DA 2HNTE 4FUDA 2XCNA 5EXMA 2OINA 2PW8H 1H1BA 3SNAA 4JZEH 2ZEBA 4X8SH 2R2WU 2VIOA 5FAHA 1G3EA 1P05A 4F4OC 1Z7KA 3P95A 1LCYA 1ZHRA 2GTBA 2O8LA 4UEHH 4CRCA 4JZ1A 5A0BA 3PWBA 2B0FA 2ZHQH 4X2WA 3RP2A 1P3CA 1RRKA 1O2GH 2ZO3H 3RM0H 2THFB 2OQ5A 4YOIA 2JETC 3RXKA 2ZCHP 2QA9E 3BG4C 1EPTC 5C1UA 1GVLA 1O2QA 2CN0H 1LVOA 1ELCA 1UVSH 1GI7B 4NSYA 2ZC9H 1E37B 3I29A 4K69A 2XWBI 5AVDA 1GBEA 3QWCH 2W3KA 4A92A 2BDBA 2VVUA 3TGIE 3MI4A 3RXQA 1GI5A 2W7UA 1SI5H 1THSH 5AF9H 1S82A 4X8TH 3RXAA 1ZMNA 5HM9A 2WUBA 3D65E 4NA8A 1MCTA 4YOJA 1S83A 1BRUP 4F49A 4XOJA 4ZH8A 1BTUA 4HZHA 1JRSA 2FPZA 2J95A 4NFFA 1K1OA 3Q77A 1GJAB 4ISHH 2TGAA 3ESTA 5HXFA 2AYWA 1DE7H 4E06H 1ELVA 1A3EH 3PV4A 4AGKA 4IBLH 2BZAA 3LKWA 4FUGA 2QGRA 1LKAA 1A7SA 1BCUH 1TPSA 1GG6B 1VITG 3U9AH 2QIQA 2W3IA 3HKIB 1C2EA 1LHEH 1GVKB 3SUEA 3C1KA 1ZJDA 2OP9A 1O2PA 1UK2A 2FTMA 2VIQA 5JBAS 5FBIA 1PPEE 2O8WA 3RMNH 2ZECA 1GHBF 2A5IA 4NWLA 4ZHLU 3OY6U 1HXEH 1P03A 1EPTA 1ZSKA 4E7NA 1GBJA 1SQOA 2ZCLP 4IGDA 1DWBH 4CREA 2PUXB 5FPYA 3D23A 3TIUA 2GV7A 1MAYA 5K0HA 1CVWH 3GY6A 1Y5AT 1P57B 3C27B 3UTUH 3GCNA 3SU3A 4MQAA 3GCHB 3OX7U 1QQ4A 4ABDA 5DGJA 1TNGA 2ZU3A 4HTCH 1S6FA 2ZWLH 4BAMB 2AFQB 1ANEA 1V2MT 2TGTA 1MKWH 4X6NA 2BHGA 2XBXA 1QGFA 3B9FH 5C1XA 2VWNA 2JH6D 3HKJB 1P9UA 1GJBB 1HAYB 1HB0B 2XBVA 4DURA 1O3EA 1UTMA 1KLTA 3K6ZA 4FUFA 1XXDA 4FU7A 1FN8A 3RXUA 4Q7ZA 3S9AA 1O2YA 1GBBA 3PM3A 2AH4X 3N7OA 1T8NA 3STIA 4R0IA 2J34A 4CH8B 1QJ1B 2BVRH 1CT4E 2BYAX 2C93B 3ZVCA 1GBFA 2Z9LA 4DW2U 3GY5A 3V12A 1EAWA 5H4IB 3O8CA 4VGCC 2AGGX 2ZU1A 3E1XB 2FDAA 1RS0A 2SNWA 3M3SA 1TGBA 1GJ9B 5C20A 2A5KA 2EEKA 4CBNA 1C1VH 4X2VA 2ZTZA 1SGFA 5E2PA 4DOQA 5DK1A 1O30A 4IC6A 3SGAE 4BOHA 2FLBH 1O37A 4X1NU 3IWMA 3MNSA 1DY9A 2G81E 5FCRA 3RC5A 4AB8A 3T5FH 1V2VT 4I32A 7GCHF 2O8TA 4ZKOU 5DO4H 1THPB 4LXBH 3A8DA 2ZDNA 4I8KA 1IQFA 4FVBA 3A89A 3ZYEA 4X1SU 1BA8B 1U6QA 3F68H 2ZIQH 1GG6C 2G5NA 2ZQ1A 2WPMS 4X8UH 2TGDA 4BAOB 5JYIA 2Z3EA 1QB9A 1XXFA 3SV2H 3UFAA 1QA7A 1F92A 3E6PH 1BBRK 1IHTH 3VGCB 1Z8JB 2Q6FA 4NSVA 1RTKA 2C90B 3T29A 3H7OA 3TLOA 1UTLM 4RKJB 1W7XH 1HIAB 1MTWA 5PTPA 2GVFA 1O3MA 2SGPE 3MOCA 2TBSA 1YYY1 1G3BA 1K1JA 3RMMH 3TJNA 4ISOA 3GCHC 1GJDB 1UHBA 1EZSC 4Y0ZE 1N6YA 3DHKH 4BAHB 3KIDU 2NU4E 1SBWA 1OKXA 3RXSA 1YPJH 2BDIA 2EI7A 4D7GA 2AERH 4K2YA 5FX6A 1XUFA 2VVVA 3SQHE 4MNYA 1XKAC 3EE0B 1CBWB 1DICA 2ZGXH 1NO9H 1PPGE 2V3OH 3CENA 1G32B 1AVXA 1ZSJA 4BTIB 1BIOA 2GGVB 4IMZA 1NTPA 2A2QH 1P12E 1H4WA 1VCWA 3UOPA 1E34B 4GUXA 5B6OA 4O3TA 4RKOB 3TNTA 5GIBA 3NKKA 5A8ZA 2UUFB 4UD9H 4AG1A 5DP4A 1LHFH 1O3DA 2BY5X 1HAIH 3A82A 3R3GB 4INHA 1SLVB 3M35A 3BSQA 2F9OA 4AFZA 1GDQA 2GCTB 1WYKA 1O3HA 1AHTH 1D3PB 4BTTB 2P16A 1EAUA 1G37A 2BXUH 1A0HB 1AWFH 1Z6JH 4CR5A 1AZ8A 1IHSH 1BOQA 1JBUH 5L2YH 1Y3XA 1ELGA 3OU0A 4UE7H 4AFSA 1HAVB 5JB9S 3PYHA 1WTGH 1D9IA 3F9FA 4Y8YA 2ALPA 2G51A 3LC5A 2O8MA 1IQLA 1O3BA 1KY9A 4YOGA 1HXFH 1TX8A 9ESTA 1O34A 1NFUA 3RXPA 1Y5BT 1B0EA 3VGCC 1INCA 3P8GA 1J14A 4YTAA 1GDNA 3VB7A 1O2RA 1P10A 1X7AC 1GDUA 3D49H 1SQTA 3RLWH 3ATLA 1Z1IA 1A5GH 1ZGIA 1GWAA 1N8OB 4ZAEA 1GBHA 1VR1H 1XVMA 1DX5M 3H7TA 3FFGA 1IQIA 5DP5A 5A0AE 1ELFA 4GLYA 4X8VH 1FZZA 5L30H 3LONA 5FXLA 1F7ZA 1AN1E 1QCPA 4ISLA 5EQSA 2FOGA 4ISIH 1PPBH 1MU6B 1ANBA 4KP0A 3WY8A 1VGCB 1TONA 1W3CA 2BDGA 2J4IA 4DGJA 2HOBA 2OBOA 1DPOA 1O2SA 2BVXH 2ZDKA 2ANKH 3RM2H 1SVPA 3LT3A 1YPLH 3SO3A 4GVUA 3A83A 5DP7A 2WYGA 1K1NA 1LDTT 5ETXA 3RXEA 1IAUA 1SSXA 3QLPH 1AZZA 3KGPA 3SV6A 3RXVA 1C5OH 1EX3A 3KF2A 1AO5A 3UR6A 2OC1A 1PPZA 1Y3WA 4A1VA 4AYVB 1J16A 1E0FD 2H9HA 2CMYA 1C2DA 1HIAA 3BTKE 1H8DH 1BJUA 1LPKB 1MKWK 2GCTC 1QHRB 4YT7H 2NU1E 4MVNA 3E91A 5CMXH 2OQUA 3PB1E 3BTQE 4A5TS 4HFPB 1A2CH 4AGJA 4UFEH 3QGNB 1UTPA 2ALVA 3TJOA 1OWJA 4X6MA 3TJUA 3PWCA 3A8AA 5F8XA 4K5ZA 3SV7A 5I25A 1V2UT 4KKDA 3DUXH 2PV9B 3PMAB 1SC8U 2FLRH 1O2XA 3A8BA 4Y11E 4XBBA 1SL3A 1HJAB 1ID5H 3ZZ8A 1O3KA 1RD3B 3BIVH 1CA8B 2ZU5A 4AZ2B 4H4FA 4B71A 1IQNA 1TNLA 4JK5A 5TCAA 4FU9A 1DVAH 4ZMAH 1A1RA 1SLXB 4A6LA 3ZZ3A 1NFYA 1QBVH 4MLFB 6CHAB 3T27A 1TIOA 1J17T 2QF0A 4MPWA 1N8OC 3RU4E 3RUOA 3W94A 3PLKA 4ZROA 1L1GA 4ABBA 2P94A 1PYTD 2Z6BD 1NFWA 2ESTE 4TY7A 4XSKU 2GZ7A 3A8CA 5GWZA 1LVMA 1P02A 3B23B 3ZVDA 1OXGA 3Q76A 1QTFA 1NRRH 1KYNA 2BD5A 1BRAA 1P2IA 3KN2A 2J9NA 4WY3A 3SJIA 4B2AA 3LGTA 4YM9A 2ZNKH 1O2IA 1XVOA 4CRDA 5JPMH 1ESBA 1P04A 1GI0A 5IYTA 1CT2E 2BTCE 3GY7A 2I6QA 2QYIA 1D3TB 2XBWA 2Z3CA 2GZ9A 1KXAA 2IOTA 1OWKA 1LHCH 2Y5FA 1SGDE 1HAVA 2UUKB 4MPVA 1MBQA 2NWNA 2ODYB 1TQ0B 2G52A 2Z9IA 2ZFQH 4KTCA 3EA8A 4CRGA 5GJ4B 2Z3DA 4Y76A 4TPIZ 2Y80A 5K7RA 1L2EA 2XYAA 2ZGCA 1ZGVA 4I7YH 3SHCH 1EQ9A 1L1JA 4WXVA 3VB6A 1WQVH 2RCEA 1O5AB 2XC5A 1OOKB 5E0HA 1C2GA 1OYQA 3UY9A 3Q3YA 1IQMA 5EXLA 4CRFA 2STAE 3SJ9A 1DWEH 2ZU4A 1KXEA 2P3UB 2PKAB 4NIYA 3Q00A 4YLUA 4ZHAA 1O2UA 1QB6A 2SGAA 1LVBA 1WQSA 1YCPK 1EB1H 1D3QB 2CHAB 8GCHF 3ATWA 1DLKB 2IPHA 3M3VA 1W7GH 1GPZA 2QAAA 3NK8A 1DUAA 1SFQB 5EODA 1C5QA 2A7JA 2FX6A 2GZ8A 1BTHH 2SGEE 4WVPE 4ABAA 4DT7B 1V2KT 1TPOA 2PR3A 4H6SB 3SJKA 2AEIH 4WH6A 1HJAC 2QY0B 2AGIX 2RG3A 3SUGA 3GY3A 5C1YA 2LNCA 1AQ7A 4B73A 2OCVB 2H1UA 4AORA 1O39A 5A8XA 1L4DA 4U01A 1ARBA 5EOKA 4H6TA 3MO3A 2F9VA 3IG6B 3GDVA 4M7GA 4ABEA 3LPRA 1FPHH 6CHAC 4I8LA 3BTHE 4JZFH 2A31A 3SN8A 1ZJKA 2NU3E 5J4SA 2BLWA 1RXPA 3HPTB 4ZKSU 4CRBA 3JZ1B 3U98H 1SGQE 1SG8B 3DFLA 1EAIA 1WSSH 2Q6DA 4Z6AH 2R2MB 4D9QA 3U1IB 1YLDA 2FO9A 1C1TA 2HNTC 3RXJA 1OWHA 6LPRA 1MZAA 1DT2A 2HGTH 1O5EH 4I8HA 5EXNA 1HUTH 3MNBA 2SNVA 1TNIA 2BD4A 3H5CB 1C2JA 1C1QA 3T2NA 1K21H 3FP7E 2G00A 3E0PB 4VGCB 1BZXE 1GBMA 4X1PU 1GI3A 3KEEA 5FX5A 1C9TA 3I78A 3RDZA 5ESBA 2P3FH 5DP8A 2ZCKP 1GI8B 2PGQB 2ASUB 5HGGA 2UUYA 2AGEX 3AW0A 2P93A 3RXMA 4BXWA 2ZGBH 3GCOA 2ZDMA 3KQDA 2G4TA 4NWKA 3KQCA 4DCDA 1TE0A 1C1NA 1W11U 1IQHA 2C8YB 2OXSA 3FAOA 1ZTLA 3K6YA 3OY5U 2F9NA 1AIXH 2HWLB 2CHAC 4ESTE 1S85A 1O2OA 1C4Y2 3T28A 1TB6H 1UTJA 2ZTYA 3TK6A 1Y3VA 2PLXA 4LK4A 3VPKA 5BRRE 4WXIA 2VGCC 3O8BA 1P2QA 1TLDA 1AE8H 3MU5A 2IJOB 1PQ8A 1ZSLA 1QIXB 3LGYA 1O3GA 1G9IE 2GCHF 1J9CH 3SNCA 5BPEA 4ZHMU 3CS0A 3URCA 4R8TB 2PFEA 2STBE 2OUAA 3M37A 3VEQB 4PROA 1TMBH 1ZOMA 3STJA 2XCFA 1F0SA 3TU7H 1D4PB 3PLPA 3QX5H 4GCHG 4NA7A 3EGKH 3ZVAA 1C5PA 1VZQH 2FXRA 1GI4A 3VXEH 1ZPCA 1V2OT 2BLQA 1SOZA 1YPGH 4BAKB 1QJ6B 2WV5A 4O97A 1MTVA 5A8YA 1O3FA 4JK6A 1FY4A 2FOFA 1W0YH 2D2DA 2FOMB 2WPJS 1G3CA 3MFJA 3RMOH 1TGCA 2BD8A 2GD4B 2PKAA 3NCLA 3F9EA 2OC7A 1ZZZA 1K1IA 3P6ZB 3TH4H 1MBMA 2OC0A 2YNAA 5I46H 3MO6A 1YPEH 1DOJA 2WPHS 1GL0E 4TWYA 3SUDA 3KL6A 5DKMA 1EZQA 1LTOA 1PQ7A 7KMEH 4JYVH 2QV1A 1ABIH 1MMJN 4LZ1H 2QXGA 1JXPA 1P06A 1XUGA 2FEQH 3P17H 1HJ9A 3ZZAA 1C1SA 3FANA 4Y71A 5AFZH 3V13A 1C2IA 4Q7XA 2ZF0H 1VJAU 3SZNA 2BMGB 1SR5C 2ZZUH 1ARCA 4NZQA 3EYDA 1HCGA 3M61U 3E16B 1IQKA 1JMOH 2VNTA 3RXHA 3A7TA 1WBGB 5GPIB 1NRNH 4UFFH 1EP5A 1ZTKA 1EJAA 1VITH 3FP6E 2F9BH 1AD8H 3ZZBA 2FM2A 2BY9X 2AIPA 4UONA 1PPHE 4MTBA 2Q6GA 1LPGB 1A5HA 1EJNA 1O2JA 3T25A 1PPFE 1ZRBA 1GBTA 1UVOA 2D8WA 2UUJB 3U8OH 1ETTH 2RA0A 4U32A 2H5CA 2WV4A 2TPIZ 3MU0A 2HVXA 3NZIA 1CGIE 4CR9A 2CXVA 1LHGH 2EI8A 1TMUH 4B75A 1MQ6A 1OP0A 2BD3A 1TGSZ 1HDTH 1C1UH 1XM1A 5ABWA 2C8WB 4Y0YE 4FU8A 1K1MA 6GCHG 1A3BH 1RFNA 5EW2H 1ZTJA 4SGBE 3ZZCA 5L2ZH 4FUHA 4KTSA 4XBCA 3UNSA 3AAUA 4Y8ZA 1AKSB 3M3TA 5L6NH 2AMQA 2XTTB 3A7WA 2I6SA 2R0KA 1KLIH 1O3JA 1SGYE 1VITF 2P59A 1BMNH 1GBIA 1O2LA 2C4FH 5CE1A 2PTCE 3GOVB 3F6UH 2ZFRH 3KQBA 1F0UA 2GV6A 5TJXA 1YBWA 3SU1A 3LGVA 4K3JA 2CV3A 8ESTE 3BTFE 4I31A 1QURH 1YM0A 2VB0A 2A0QB 1G2LA 4XDEA 1TALA 1YPHE 1ETSH 3SNBA 5T6FA 2GDEH