3P8NA

Crystal structure of hcv ns3/ns4a protease complexed with bi 201335
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
182
structure length
182
Chain Sequence
APITAYSQQTRGLLGCIITSLTGRDKNQVDGEVQVLSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWPAPPGARSMTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGIFRAAVCTRGVAKAVDFIPVESMETTMRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HCV serine protease NS3
publication title Combined X-ray, NMR, and kinetic analyses reveal uncommon binding characteristics of the hepatitis C virus NS3-NS4A protease inhibitor BI 201335.
pubmed doi rcsb
source organism Hepatitis c virus
total genus 42
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3p8nA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3p8nA01
5DKMA 2BDAA 5L6NH 5EW2H 4TPYA 1TGCA 3SU4A 3KCGH 1ETSH 1FIWA 3URCA 1D6RA 1O3CA 3T5FH 4ZH8A 3T62A 1EPTA 2ZDAH 4OGXA 2PUXB 3FP8E 3MO6A 2UUYA 3MH5A 2O8LA 3SBKA 1TNGA 1MCVA 1TONA 3NWUA 1A7SA 4MPWA 1EAWA 1C1TA 4MNYA 4MPXA 3ZZ4A 1AY6H 1X7AC 3OX7U 2FM2A 1O38A 2P3UB 1QNJA 1ZPBA 1RXPA 1HAVB 1BHXF 3ZVBA 4K69A 3RMNH 1O2IA 2CXVA 2VVVA 4X1NU 3LJOA 2JH5D 1WQSA 2FO9A 5GCHF 2BD4A 2EC9H 4YM9A 4WF8A 2BLOA 2ZTZA 5F8XA 1A5IA 1VCQA 1P9SA 1SGDE 1UK3A 1GI8B 1F2SE 3RXCA 5C5NA 1AMHA 2O8WA 3W95A 1LMWB 3IITA 2I6SA 2DUCA 2STBE 2ULLA 3ZVGA 1SGCA 1G36A 4MDSA 1GDUA 3FP6E 1B7XB 1G2MA 2PWXA 2FWWA 1SOZA 5DG6A 1HIAA 1SGTA 3E0PB 4YLUA 5H4IB 5JPMH 3QGNB 5FX5A 4MPVA 1GHWH 2J34A 1B0FA 3M37A 2NU3E 1Y3UA 2LNCA 1EJMA 3HPTB 5ESTE 1O35A 1QY6A 1MCTA 1MBQA 2GP9B 4I8KA 2CJIA 1O2WA 1O2GH 1GHZA 2HPPH 1KTTB 3ZZ5A 2BQWB 2BVSH 4BANB 4UEHH 3UWJH 1T8NA 2WV9A 1V2WT 2H6MA 1WCZA 3A83A 1C4V2 1C2EA 1BTWA 1MQ6A 1WBGB 1EJAA 3VFEA 1E36B 3KHVA 1O39A 4O3TA 1O33A 7GCHG 4Y7AA 2VH0A 2BD2A 3SV9A 3SZEA 2IN2A 5JBBS 3E6PH 1MD8A 1JXPA 1WTHD 1OXGA 4JZ1A 1AWFH 2AMQA 1W13U 1OOKB 1C1RA 2Y7XA 1QBNA 4AB9A 3VGCB 1G3BA 1HV7A 1ELTA 2WV4A 4JK5A 2ZU2A 5T3HA 3SV2H 4AORA 5L2ZH 5JB9S 4YLQH 3NKKA 1NS3A 4AFSA 2G00A 1V3XA 2BLQA 2SGQE 2NU4E 1Y3YA 4O3UA 1DXWA 2WINI 1O2JA 4IC5A 2G4UA 4WJG2 3GYMA 1GMCF 3A88A 2Z3CA 4FXGH 1NFUA 5A2MH 3S69A 4DIIH 1PFXC 1THSH 1W0YH 1HYLA 1JWTA 3MHWU 2FP7B 1FPCH 5A0BA 1TNJA 1C2GA 1HLTH 3QWCH 4Y79A 1O2MA 1O3GA 1TALA 2VWOA 3P70B 5CHAB 2VGCC 2G8TA 2F4LA 2BMGB 2TGDA 4VGCB 3HKJB 5FHTA 1QB9A 2TPIZ 2OP9A 2FZZA 3AASA 1HPGA 4INLA 4AX9H 1O2VA 3LPRA 1P2JA 1QRXA 2RA0A 4KGAA 3W94A 5GNDA 1BTZA 4B2AA 2F9NA 1BDAA 1VCPA 5LPEA 4DJZB 2BHGA 2BZAA 4M7GA 7KMEH 4HFPB 4KTSA 5C1UA 3RC6A 1N8OC 3P92A 1LHGH 1GHVH 5I25A 1P09A 4ABHA 1NT1A 1EX3A 1FUJA 1DFPA 2PKSB 1A3BH 2BQ7B 2C8YB 1KY9A 2BD9A 2A4GA 4CR9A 3Q00A 1ETTH 1TPAE 2BXTH 2P59A 1DOJA 4BTTB 4IW4E 1EPTB 1SSXA 1P8VC 1GDNA 1K22H 5C1XA 3S0NA 1BQYA 1OWJA 3KQCA 3PWCA 4AN7A 4Y8ZA 1YLDA 4A92A 1EAUA 4CRDA 1O2NA 2XW9A 5DJ7A 1G32B 2HGTH 2A31A 1C2DA 1UMAH 3HKIB 3EQ0H 4YO9A 4GVUA 1G37A 1DY9A 5JBTA 1HGTH 1EXFA 2JETC 1F5LA 2V3OH 2AS9A 2ZDVH 4BOHA 1AHTH 1OWHA 2PHBA 1ANEA 1C4U2 2QXIA 1HAYB 3E8LA 1D4PB 1TGBA 4JZEH 4DURA 1GPZA 2CV3A 2ZNKH 4MNWA 4X8UH 2QF0A 2Q6FA 2AFQB 3E90B 3A85A 2F9UA 2J9NA 1V2ST 4CREA 3VB5A 1F5RA 2F83A 4FUEA 2OD3B 1IQFA 1YPGH 1GBFA 4I8GA 1CHGA 3VXFH 4MVNA 3SI4H 1GMDF 1YCPM 4ASHA 1HJAC 3V13A 5F8ZA 3LH3A 2ZQ1A 1DWCH 4AGKA 4B6EA 1C5WB 3Q3XA 2QCYA 3A7TA 2QY0B 1L1GA 1GBDA 1W14U 5E0HA 1EZXC 1HIAB 1XUIA 1SLUB 2CF8H 1B0EA 4WXIA 2ZPQA 1KXFA 1HUTH 1GBIA 1JIMA 3U1JB 4Q80A 2WPJS 1NPMA 2IJD1 2ZFFH 2QF3A 1AE8H 1S82A 2ZFQH 4D76A 1ABJH 3AAVA 3GDUA 1A3EH 1C1NA 1TYNA 3BTGE 2F91A 2TRMA 1TOCB 2GGVB 1H8DH 1T8LA 3NUMA 3SNCA 3JZ1B 1GI1A 1GGDB 2EEKA 2VVUA 4GPGA 1DDJA 3GY8A 2QIQA 2CHAB 3M7UA 1SB1H 3STIA 1KXAA 2GCHF 3PV4A 1AKSA 2VINA 6GCHG 1NFWA 3Q76A 4X1SU 1T8MA 4BAHB 1TRNA 3RXOA 3DD2H 1ZGIA 4AOQA 3KF2A 4AFUA 1P3EA 1TFXA 1P02A 2O9QA 2ZU3A 4MG3A 1TQ7B 3ZZ3A 1ZRKA 1P06A 1O2HA 2WYGA 2BYAX 1WOFA 2K1QA 4U32A 3S9CA 2GVFA 2EA3A 1O2XA 2RG3A 3VEQB 1GWAA 4B2CA 1N6XA 3MI4A 1MTNC 3K65B 3T25A 2OK5A 1GHXH 3GCTG 1W8BH 3PWBA 3ZVFA 4ZHLU 3QTOH 1LQDB 1TB6H 1C9TA 4XE4A 4DVAU 2ZFSA 4CRAA 2J38A 2C4FH 1JBUH 3C1KA 2CN0H 4CR5A 2OC8A 5E2PA 1Y5BT 1L4ZA 1C5UA 1QRWA 1NC6A 1O31A 1Z1IA 4XBCA 1AUTC 2F9BH 1C2JA 1L1NA 3NCLA 4X6MA 1QURH 2ZU1A 2THFB 4K1SA 3T29A 1OWEA 3SNEA 4ABBA 2A5IA 3AK5A 3SJKA 4AFZA 1KDQA 4FUBA 2Z6BD 2Z7FE 1IQGA 1CGJE 5DP4A 1DXPA 1H4WA 1YLCA 1F0SA 2UWPA 3GISB 2GMTB 3MYWA 9LPRA 4NFFA 3EA9A 1C4Y2 2XNIA 3RXTA 1O2QA 2AMDA 1PPEE 4INHA 1C1WH 3F9GA 3SGQE 4UONA 3ODDA 1QHRB 4OS6A 2DE9A 2BY7X 1ACBE 1T32A 1Y3WA 2W7UA 1NFXA 3RM2H 5DP5A 1SR5C 4ABFA 1ZJDA 5DO4H 1P10A 2VIQA 3UOPA 3KN2A 3EA8A 2A4OA 3ZVEA 2FTMA 1PQ8A 2ALPA 4WWYA 3RXRA 2JKHA 1FNIA 4GCHG 1UVSH 2Z3EA 4OS5A 2P93A 1C5QA 3TNTA 2BX4A 1GBAA 2AEIH 2J92A 1SGRE 2WPHS 3TPIZ 4DG4A 1V2LT 1OX1A 4B76A 4FUGA 1DWDH 1VR1H 3H7OA 1UJ1A 3SU0A 1K1MA 1TA2A 5A8ZA 3ZVDA 1AB9B 1C5YB 2BY9X 1RFNA 4J1YA 3FP7E 1HAGE 1O2SA 2ILNA 3LIWA 1IQJA 1PPHE 2OQUA 4WXVA 4XBBA 2ODQA 2WPIS 5AHGH 4HTCH 1EATA 1ESBA 1LCYA 4BTUB 4I8JA 2G4TA 1YGCH 3BG4C 4AG1A 1PPFE 2AIPA 3N7OA 5B6LA 1O3NA 2FMJA 4H42U 3UNQA 1BMNH 1EOJA 2BVXH 2Q6GA 1IHSH 3OY6U 3BN9A 4THNH 4UD9H 1CA0C 2A7CA 3U98H 4OS4A 5IYTA 3UUZA 1P3CA 2A2XH 1YP9A 2VIWA 3D23A 3EDXB 3UY9A 1ELFA 5FPTA 2H9HA 1MU6B 2CMYA 3SU2A 1BT7A 1FPHH 1ZTJA 5AF9H 2BLVA 3EGKH 4ISIH 3PLBA 4AGJA 3QGJA 1AVXA 4JMYA 1TBZH 1ZTKA 3SYJA 2ZIQH 3D65E 5HGGA 1RTKA 3QUMP 1IAUA 3SV8A 2FOFA 3BTHE 1PQAA 5HM2A 4Y76A 7ESTE 3OSYA 1FAXA 1QTFA 4ISLA 1CT0E 4X2YA 1FI8A 1FN8A 3A82A 3TGKE 1BA8B 3E1XB 1BRCE 3SGAE 4D9QA 4RKJB 2VJ1A 1YKTA 3V12A 1MAYA 2WUCA 1HFDA 3A8DA 4DIHH 1CBWB 4B2BA 3A7ZA 1NROH 1VITF 4O9VA 4X6OA 1FQ3A 1ZHRA 3MU4A 3PO1B 5EQSA 1DSUA 2O8MA 1HAOH 4A1XA 2HWLB 1W0ZU 1GI9B 4M9FA 1D3QB 5TCAA 1SFIA 4DW2U 1SGNE 3MH7A 2V3HH 2F9OA 4ZXYH 3UNSA 4AG2A 3LGTA 1Y3VA 3TK5A 3U1IB 8GCHG 4Y7BA 2ZU5A 1UHBB 5EPNA 2GV7A 4IC6A 1GCTC 1QB1A 4OS1A 1EOLA 1JOUB 3GY6A 4X6NA 5EU8A 4H6SB 4YESB 1TPOA 2ODYB 3U8OH 2SGAA 1GI3A 1PPZA 5PTPA 2M5TA 2HNTF 4BAMB 4UFEH 2BD7A 1C1PA 1XUHA 1RIWC 3VB4A 5C20A 1V2JT 2H1UA 3A8AA 2VVCA 2QV1A 1HJ9A 3A8CA 2ZCLP 2FYQA 1TMBH 1Z8RA 1ID5H 1RRKA 1UTMA 1NRNH 3VPKA 2Z9KA 1EKBB 2GV6A 4OGYA 1THPB 2ODPA 4JZFH 4AZ2B 2FYRA 1O3EA 1YF4A 1KDQB 4I8HA 1GVKB 2RCEA 3F1SB 3MNBA 1GBKA 1GCDA 3ATLA 4ISOA 3FANA 3M35A 2P3FH 1GHYH 2AERH 2BDBA 1Y59T 1MZAA 3U8RH 4JZIA 3KL6A 5HMAA 9ESTA 5GJ4B 1O5CB 1SHHB 1GVZA 2A7JA 1UTNA 1CSOE 3BTFE 2ZHQH 1RGQA 1GMHF 3E16B 2PKAA 5DPAA 1FY8E 1HAIH 2C8ZB 4MLFB 1UTKA 1YPJH 1BRUP 1NRPH 1ZPCA 1CHOF 1FDPA 2ZQ2A 4K1TA 3LGVA 1O2OA 2ZI2H 3D49H 1YM0A 3U8TH 1QR3E 1XMNB 1AQ7A 2OQ5A 1DITH 1P03A 3FZDA 1SGQE 3SN8A 3P17H 1TNKA 1A4WH 2KAIA 3L6PA 4F4OC 1T7CA 5HM9A 1GG6C 2NU2E 3TJNA 1QGFA 4WMDA 1O5DH 3IG6B 5F6MA 2GZ7A 2ANYA 4I33A 1G2LA 2OUAA 3DHKH 3SUEA 3RU4E 4IN2A 3SUDA 1LPZB 3UQVA 2ZHDA 1K1JA 1DX5M 3H5CB 3SU3A 4K2YA 4ZROA 5SGAE 1L0ZA 1EB1H 5GCHG 2SGPE 3LOXA 8LPRA 5EG4A 3P6ZB 5A0AE 2ZDMA 2FLRH 5EODA 4FU7A 1V2TT 1SI5H 1S6FA 1MBMA 2G5NA 1ELBA 1H1BA 1AZZA 1T31A 5CE1A 2STAE 1N1LA 4K5ZA 1BTHH 2FODA 3RC5A 1P2QA 2B0FA 3GY2A 1V2OT 3RUOA 1HAXB 5C67A 1LHCH 1D9IA 1RTFB 1U6QA 2ZFPH 3BSQA 3F9EA 1P57B 4XBDA 4DOQA 2W3KA 2BQ6B 8ESTE 1VGCC 3C27B 3B9FH 4Y71A 4NIYA 2EI6A 4CRCA 3FAOA 1Z6JH 3SORA 5DP3A 1CA8B 3MOCA 3SW2B 4A7IB 1G3CA 4HI3A 1S5SA 1LQEA 1ZGVA 1AN1E 3SQHE 2A4RA 2HRVA 3LDXH 1O3LA 2V35A 2VWMA 2O8TA 1C1SA 1XUFA 1O3KA 1AFQC 1ELAA 2AMPA 2PFEA 4ZHAA 1C2FA 4CHAC 1LKBA 1OP2A 1VZQH 3S9AA 3RLWH 2GZ8A 4OS2A 4NIXA 1AFEH 2GTBA 1BBRE 1GHAF 4ZKOU 1ZHMA 4MNVA 2QN5T 1IQNA 4ZKRU 1E34B 1GJ5H 1BIOA 3O8BA 2GKVE 2OXSA 2ZZUH 1QFKH 3EE0B 2FI3E 4JZDH 1GI0A 1O3DA 4FUDA 4E05H 2EI8A 1C2IA 3D62A 4TWWA 1CT2E 1FONA 4R8TB 3BV9B 2ZGJA 2BY8X 1XX9A 1BMMH 2GCTC 3NK8A 1UTJA 1GMCG 2O8UA 1P2OA 3MNSA 1HB0B 2ZF0H 3RXLA 4B74A 1ZLRA 1EAXA 2WYJA 4D9RA 1AO5A 1SL3A 5FBEA 3BEIB 2TBSA 5K0HA 2ANMH 4ZKNU 2TGAA 1QCPA 3ZV9A 2ZGCA 1TNHA 3PTNA 3QTVH 5HYOA 1W12U 2ZEBA 3OTJE 3K9XB 2Z94A 3CS7A 1OKXA 1DWBH 2D1JA 1BMLA 3A7VA 3DFJA 3DFLA 3FZZA 5A09A 1HBTH 3GDSA 1D3TB 1J8AA 3GCHC 2XCNA 5EXNA 4CBOA 1L2EA 4BAQB 3O8RA 3QLPH 3CENA 3LGYA 3M5LA 1GJ9B 4OS7A 3OTPA 1DWEH 4Y10E 5C1YA 1MTWA 1O3OA 1DT2A 5GPIB 1QQUA 1SLXB 2TIOA 2ZTXA 3BG8A 1GJBB 1KYNA 4UFDH 4NSYA 3SQEE 3M7TA 3SU1A 6CHAC 1VITH 4FUFA 1UTPA 1DUEA 2Y6TA 1GI6A 5CMXH 1SLVB 2BY6X 1HAZB 1C5OH 1G3DA 1OSSA 2JH0D 1SHYA 1UVOA 1GJAB 3MH6A 2FI4E 3OU0A 1D3PB 4HZHA 1LVMA 2ESTE 4YTAA 1C2KA 3TU7H 2G81E 3OYPA 1XVOA 1GDQA 5AVDA 2G52A 1NRRH 1BUIA 1P05A 3PM3A 1IQHA 4QT8C 1V2MT 2H5CA 1WV7H 2FOEA 1DPOA 2FDAA 2Y5HA 1GJCB 1Z8JB 3A7WA 3UWIA 3BF6H 1TAWA 4CRBA 1QJ7B 1IQMA 4GAWA 5BRRE 1DANH 1RD3B 1FN6A 3MMGA 1GJ6A 4KP0A 4ZHMU 3A87A 1AD8H 1O3FA 3M5NA 3ATIA 3SNAA 1MZDA 1LPGB 1O3HA 1S85A 3ZZBA 2Y81A 1HNEE 2VGCB 3SJ9A 2HNTE 3SUFA 1A46H 3P8GA 3TLOA 1PQ7A 3UQOA 1XXDA 2XWAA 3KQBA 4A6LA 1GHBG 3MU0A 2WPKS 5J4SA 3NPSA 5FBIA 4BAOB 4Y8YA 3L33A 2B7DH 3MTYA 1BTYA 1GMDG 2ZFTA 1IOEA 2SNWA 3NZIA 2ZCHP 2I6QA 1ZMLA 1BJUA 3Q77A 3RXSA 2GX4A 3RXHA 1TOMH 1ZOMA 2FTLE 1E38B 3UR6A 1EZQA 1KLIH 2ZDKA 2XBXA 3MU5A 1LPKB 1QL9A 2FXRA 4YOGA 3BEFB 4H6TA 3TH4H 1LHEH 4FUHA 1N8OB 4YOJA 2CGAA 2GDEH 1GJDB 4B75A 1MTUA 4WH8A 3E3TA 4K8BA 3Q3KA 1BOQA 4ZMAH 4BTIB 4TWYA 1K1LA 3FFGA 1JMOH 1OP0A 1C5VA 1UTLM 3A89A 2FOMB 4RKOB 1S0RA 2AGIX 2FLBH 1ZTLA 3GY5A 1CGIE 4NSVA 3SHCH 2Z9IA 4X1PU 1SOTA 3TIUA 3LU9B 3QK1A 3LT3A 5T1VA 3SNDA 5EQQA 1AU8A 2SGEE 4XDEA 1GI2A 1O37A 1TGSZ 2P94A 2VWNA 1ANDA 4MQAA 1SG8B 5FCKA 2GCHG 3OY5U 2A5KA 5EQRA 2AYWA 2OC7A 4NIWA 1SGPE 2ZFRH 2HNTC 2ZO3H 1F92A 1GJ8B 4Y6DA 2SGDE 3LC5A 1TX8A 1OYTH 1IQEA 1DY8A 2JETB 4GHTA 1SGYE 5C2ZA 2Y80A 4YT7H 2J95A 3SJIA 3BTTE 3P8FA 3SV7A 1NESE 1PQ5A 3SNBA 1BTXA 3SU6A 3A84A 2QC2A 1C5SA 4ABAA 3QZRA 3PMHB 1RJXB 4ABIA 4D8NA 3S7KB 3RU4T 1GBHA 2VNTA 1THRH 4IS5A 3BTDE 3K6ZA 3GICB 3WY8A 2ZCKP 2HVXA 1ANCA 1WXRA 1J15A 3ZZ6A 1HJAB 1DE7H 1P11E 4NFEA 2PLXA 1Y8TA 2OBOA 2BY5X 1TPPA 4ZKSU 1OWDA 3URDA 5T6GA 3M7QA 4K1EA 1EASA 1W11U 1Q3XA 1GBJA 1TBRH 2Y5GA 5DP6A 2AIQA 3IWMA 1W3CA 8KME2 2ANKH 2BDGA 1A2CH 2FI5E 4JCNA 4U2WA 1ZMNA 2XBYA 3SJOA 4YT6H 2QA9E 4X8TH 2ZPSA 3M5OA 1J16A 5JBAS 4X0WU 1BZXE 1Q31A 5DK1A 4ESTE 1YPHE 3G01A 2BD8A 1KXDA 3GDVA 3JZ2B 5E0JA 3TJUA 3PLKA 3S9BA 1OP8A 5FX6A 2RA3A 1FXYA 4UFFH 2ZDLA 4CRGA 1QL8A 1S81A 2B8OH 3ZZDA 1KLTA 4UFGH 5I46H 1FY3A 3S7HB 1DUAA 6LPRA 2GT8A 1ETRH 5K7RA 1SVPA 5EGMA 1C5TA 4E7NA 1GJ7B 3GY7A 4AYYB 1KSNA 2ZPRA 2P95A 4X2VA 1MKWK 3TNSA 4DGJA 4NWLA 1C1MA 1SC8U 4NWKA 2ZP0H 1V2QT 3SO3A 3Q3YA 3K6YA 3AVZA 1FV9A 3DA9B 2XYAA 2OTVA 3PV2A 1MMJN 4NGAH 1ZHPA 1O2RA 3ZZ8A 5B6OA 3P8OA 1MTNB 5GDSH 5TCCA 3B8JA 1C5ZB 3LGIA 4UE7H 3UR9A 1BTPA 2WUBA 5DP8A 4IMZA 5C3NA 1IQLA 5E2OA 1NM6A 3RXDA 3VB3A 2Q1JA 1C1UH 5HXFA 1A5HA 2QYIA 1GI5A 2R3YA 2V0BA 3ATKA 2BOHB 3RU4D 2IOTA 3UFAA 2ZA5A 3ZVCA 4FUJA 3CP7A 3BIUH 1C5RA 5GWZA 2VU8E 3TVJB 1TPSA 3TITA 1TNIA 1YPHC 5FPYA 4X2XA 4UDWH 2C93B 1SFQB 2Y7ZA 1ORFA 2PSXA 3V0XA 4LZ1H 1VJAU 1AUJA 5GXPA 1SGEE 4H4FA 1WTGH 2BTCE 3RXAA 2FESH 3AW0A 3RXVA 3K2UA 1WAYB 1TGNA 1O2PA 1E37B 2BLWA 3ZYDA 1XUKA 2FS9A 3RXFA 2TGPZ 2A45B 1ZSJA 2BX3A 3ITIA 4A1TA 3TJVA 1BHXB 1ZSLA 1AKSB 2J94A 3SZNA 4GSOA 1KLJH 2B9LA 2XRCA 2VH6A 1PPBH 1Z8GA 1TWXB 1TMUH 4I7YH 1ARBA 1MKXK 3RXBA 2C8WB 2DE8A 2ZDNA 3E91A 3M3VA 2ZWLH 4NA8A 4ABJA 1AGJA 1S83A 1O30A 2FOCA 1CE5A 3I29A 1AVGH 4GHQA 4LXBH 4NIVA 3QX5H 1O36A 4TYDA 3HGPA 2UUJB 1HCGA 4NZLA 2Z3DA 3F6UH 4XFQA 3PMAB 1BTUA 3LKWA 2ZGBH 1L1JA 1VITG 1UCYE 1BBRK 1QBVH 4X8VH 4ABDA 2HOBA 3SOSA 4ABGA 1C2LA 2FS8A 2ZC9H 2UUKB 1C5PA 1GBTA 3VGCC 2IPHA 2VWLA 3ZYEA 1DSTA 1O2ZA 1Z8IB 4CRFA 1FY5A 1CQQA 4DCDA 3RXEA 2F3CE 2FOGA 3LGUA 3BG4B 1MKWH 1BRBE 1O5EH 2FEQH 1TE0A 1DM4B 4IN1A 5BPEA 3PV5A 1CA0B 1TA6A 2XC5A 1MAXA 1D6WA 3AAUA 1ESAA 1LKAA 2OLGA 4K60A 1RTLA 3RM0H 4PROA 1D3DB 3A86A 3LONA 3V3MA 5CHAC 3MO9A 3TK9A 1UVUH 1SQOA 3ENSB 3ESTA 4VGCC 4LZ4B 1VCWA 4A5TS 1QB6A 3SU5A 2P8OC 1QA7A 2BD3A 2R2WU 1GBCA 1A0HB 1PYTC 5C5OA 1O34A 1YC0A 2A0QB 2VBCA 1CU1A 1P2MA 1OYQA 4FUCA 1SQAA 1T4UH 1FY4A 1GL1A 2W5EA 1HRTH 3R0FA 2H9EH 1K1PA 1KXCA 3T2NA 3I77A 2XC4A 2W7SA 1W7GH 1S84A 2FOAA 1GMHG 4YOIA 1XKBC 2ZGHA 2RDLA 1QA0A 3DUXH 1ZSKA 1CHOG 1VJ9U 2WPMS 5G4BA 1ZJKA 1C2MA 3PTBA 2PKSC 2IJOB 1T8OA 5A8XA 1T4VH 7GCHF 4BAKB 5EPYA 1O2UA 3TK6A 2P16A 4MNXA 2Y5FA 3KGPA 3QZQA 4A1VA 1O0DH 1GI7B 1O5FH 3B23B 3SI3H 4FU9A 1NY22 1V2PT 1EPTC 1MKXH 2SNVA 3TGIE 1JIRA 1ELDE 1DLKB 1ANBA 1BCUH 1EUFA 1G9IE 1P9UA 2XBWA 3PMBB 1UVPA 3BTQE 1TX6A 1IQIA 1FAKH 5F8TA 1QQ4A 2VIOA 3ZZ7A 1CGHA 1NRSH 1GCTB 2A2QH 4I8LA 2HLCA 1MQ5A 2YNBA 4Q7XA 4SGBE 4B73A 1SGFA 1ZMJA 2NU1E 2F9PA 2XTTB 5EW1H 1BBRH 3UREA 3SV6A 1RIWB 3U69H 2BXUH 5L2YH 2BVRH 2R0KA 3F68H 1GJ4H 1HAPH 3SHAH 1C2HA 3A8BA 3R3GB 1A5GH 1BJVA 3F9HA 4I31A 1F0RA 5TJXA 4XSKU 1JRTA 1DVAH 1V2UT 1EAIA 1HXFH 1EB2A 3STJA 1FJSA 5LPFA 4RI0A 3T28A 1UK2A 3VXEH 2GDDA 2QXGA 2FPZA 1YCPK 1QL7A 3HATH 1FMGA 4I32A 1HAHH 1LDTT 1SGIB 2OC0A 2D26C 1LVYA 5JBCS 1S0QA 1ABIH 1ARCA 3M3TA 3ZZ9A 3UNRA 1LO6A 3H7TA 1TRMA 1A0JA 3GCOA 1DLEA 3LGWA 1WYKA 4R0IA 1F5KU 2LPRA 2P8OB 1OWIA 2J2UA 1CO7E 1C5XB 1GHAG 1TX7A 1V2VT 2FOBA 1GG6B 4BNRA 4AB8A 1IHTH 3QDZB 1A61H 1LVBA 4Q2KA 2BDCA 5DGJA 7LPRA 1GGDC 1F7ZA 4K3JA 1O2TA 4NA7A 1WU1A 4Q7YA 3T27A 1TIOA 1P04A 2CHAC 3BEUA 1Y3XA 3BTWE 2WV5A 2QXHA 1BB0B 1O5BB 2AGGX 3KNXA 5JB8S 1ZYOA 3KQDA 5FXLA 1AIXH 1EQ9A 2VIVA 1QBOA 1YPLH 2WHXA 4XOJA 1BITA 5FCRA 1FZZA 3UTUH 2OINA 2FX6A 2A32A 2G5VA 4NZQA 5T6DA 2UUFB 3MU8A 1S6HA 4D7FA 1NO9H 4HGCA 1DS2E 1WQVH 2BDYA 1HDTH 4WMEA 2A7HA 4FUIA 1TQ0B 1W2KH 1C1VH 4KKDA 2XWBI 1J17T 4X8SH 4YZUA 1P2KA 2ZGXH 1AVWA 1KTSB 1EZUC 2YNAA 1V2NT 2WPLS 3EYDA 2C8XB 6ESTA 1GBMA 1W7XH 5ESBA 3ZV8A 5FAHA 1VGCB 4AYVB 2GT7A 1YPMH 3F9FA 4B6FA 5E0GA 3U9AH 2A4QA 4TY6A 2PKAB 2PTNA 1UO6A 2D2DA 3SJ8A 2H9TH 1ZR0A 2F9VA 1ZZZA 3LH1A 3GY4A 1INCA 3EAJA 5T6FA 1PJPA 5DP9A 1ZPZA 1SPJA 1OS8A 5ETXA 1ESTA 4ZUHA 1CVWH 1AFQB 2KAIB 1O3MA 1P12E 1A0LA 2PV9B 3M61U 1XM1A 4WH6A 4X6PA 1MTSA 4CHAB 1PPGE 3SUGA 5IDKA 5LH8A 1FIZA 1O3AA 1GHBF 2GMTC 1Q2WA 2QGRA 2WZQA 1UTQA 1B5GH 2BOKA 1V6DA 2ZHEH 3RLYH 3E0NB 3O8CA 2BD5A 2QAAA 1YCPH 3TGJE 2ZU4A 3PYHA 1YBWA 4ABEA 6GCHF 1P01A 3A7XA 2GCTB 1K1NA 1TMTH 2Z9GA 1KXEA 5E8EH 3EA7A 1TBQH 2A1DB 3HK3B 2PUQH 1YYY1 3M3SA 1P2IA 2D8WA 1A1RA 1M9UA 1RS0A 2YOLA 2H5DA 2XBVA 1C5MD 3A7YA 2VB0A 3LJJA 1SQTA 1NU7B 2A5AA 4CH2B 3RMOH 2CF9H 2V6NA 3GCTF 4Z0KA 3UOUA 1O3PB 5A0CA 1OPHB 2Z9LA 4X2WA 1AB9C 4Z6AH 3GCHB 1XKAC 2BDIA 1CT4E 1K9OE 2FOHA 4BXWA 1W10U 5EXLA 3ZZCA 3QN7A 5FPSA 1H9HE 4TY7A 1G30B 3AW1A 5DP7A 3MO3A 3RMLH 1TABE 1LHDH 4GLYA 3DT0H 1GL0E 1ELCA 1MUEB 1IQKA 1UHBA 6CHAB 4OM9A 4JK6A 1NZQH 1C5NH 2R9PA 1AE5A 5ABWA 3ELAH 3LC3A 4JYUH 3TH3H 4ZXXH 4B71A 4E06H 1UTOA 3GOVB 4D7GA 1JRSA 1QIXB 1P2NA 4Y11E 1TRYA 4IBLH 1ZRBA 3RXPA 5AFYH 3RDZA 2ALVA 2PR3A 1Y5UT 1MH0A 2P3TB 3FVFB 3UPEA 4U01A 3HGNA 1XVMA 1NTPA 2NU0E 1XXFA 2ZKSA 2W3IA 5JDUB 2EI7A 2PTCE 2HPQH 4ISHH 2SGFE 2ZG0H 5JYIA 3KIDU 3RC4A 1XUGA 1LVOA 4Q7ZA 3UIRA 1GVLA 1DICA 3SGBE 1PYTD 3BIVH 3ATWA 1TNLA 1YPEH 3MNXA 1G3EA 2XC0A 4JYVH 1F0TA 4GCHF 1HAVA 2BZ6H 1QRZA 1N6YA 5LGOA 2BDHA 1SMFE 1TLDA 1KIGH 1C1QA 1CBWC 1GBLA 5L30H 1ELEE 1UCYK 3A80A 1O3JA 3RXQA 1AI8H 3P95A 2HALA 3PO1C 4Y8XA 4J2YB 4O97A 1E0FD 1H8IH 3ZVAA 4KTUA 3KEEA 1K21H 2QXJA 2R2MB 2ZHFH 1C9PA 4RSPA 1K2I1 2SFAA 4MTBA 2J4IA 5EOKA 4FVBA 1O2KA 1AZ8A 2BB4A 3P8NA 3ZZAA 2UWOA 1O3IA 3A81A 4Y0ZE 3RXKA 2AGEX 4NCYA 4IGDA 1HJ8A 1QJ1B 2OC1A 2ASUB 2PGBB 4RN6A 4X1QU 1Z71A 4NG9H 3BTEE 5EXMA 4X1RU 1WSSH 1SGFG 1Z6EA 3VB7A 1BRAA 1WUNH 1O5AB 3BTKE 4NA9H 2GD4B 1GI4A 3PROA 2TGTA 3MWIU 2B5TB 2XXLA 4IMQA 5LPRA 1KXBA 2Q6DA 2OBQA 3ATMA 2JH6D 4GUXA 5J4QA 4DT7B 3RXUA 2C3SA 4E7RG 1LHFH 1P0SH 4WY3A 1C5LH 2R3UA 2NWNA 4SGAE 1J14A 1ELVA 2ZTYA 1K28D 3MNCA 3RXMA 2PSYA 3PB1E 1QJ6B 3O8DA 4FU8A 1Z1JA 1NFYA 4LK4A 1MD7A 1OWKA 4CBNA 2PGQB 2FIRH 4LOYH 1O5GH 1H9IE 1L4DA 2Y82A 3MU1A 4MPUA 2ANWA 2VIDA 2G55A 1TGTA 5AFZH 1EP6A 4K8YA 2PW8H 1XUJA 1V2KT 3RXGA 1FLEE 1O32A 3TJOA 3M5MA 1EZSC 3I78A 2C90B 4DY7B 3NXPA 1PPCE 1UVTH 3GY3A 1EP5A 1Z7KA 4FVDA 1V2RT 3GYLB 3RXJA 1NU9A 1GBBA 1F0UA 4AFQA 1ELGA 2G51A 1E35B 1Y5AT 3MH4A 2FX4A 1C1OA 4ZAEA 4O03A 1O3BA 3ODFA 4TPIZ 1AWHB 1YPKH 1GBEA 1H9LB 4B1TA 8GCHF 2ZECA 1UK4A 2ZHWH 4U30A 4CH8B 2BM2A 1EJNA 2W26A 5GIBA 2AH4X 2Z9JA 1J9CH 2H2ZA 3L3TA 1O2LA 2UWLA 4KTCA 4Y0YE 4ISNA 4KELA 3VB6A 1HXEH 3RMMH 1UCYH 3RP2A 3H09A 3CS0A 4F49A 1SBWA 3MFJA 1FY1A 3QO6A 5F03A 1K1OA 1SLWB 1NRQH 3KQEA 1O2YA 1BMAA 2VIPA 2OCVB 3M36A 3TH2H 2GZ9A 3V7TA 4INKA 1MTVA 4WVPE 1NN6A 3T26A 3BTME 3RXIA 2XCFA 4WMFA 5A8YA 1K1IA 3HK6B 3GCNA 1LTOA 1MU8B 4BXSA 2R0LA 4JYTA 3PMJA 3PLPA
chains in the Genus database with same CATH superfamily
5DKMA 2BDAA 2J97A 5L6NH 5EW2H 1W0KD 4TPYA 1TGCA 3SU4A 3KCGH 3UAIC 1ETSH 1FIWA 3URCA 1D6RA 1O3CA 3T5FH 4ZH8A 3T62A 1EPTA 2ZDAH 4OGXA 2PUXB 3FP8E 3MO6A 2UUYA 3MH5A 2O8LA 1H8HD 3SBKA 1TNGA 1MCVA 1TONA 2W6ID 3NWUA 1A7SA 4MPWA 3OEHD 1EAWA 3N7EA 1C1TA 4MNYA 1W0JD 4MPXA 3ZZ4A 1AY6H 1X7AC 3OX7U 2FM2A 1O38A 2P3UB 1QNJA 1ZPBA 1RXPA 1HAVB 1BHXF 3ZVBA 4K69A 3RMNH 1O2IA 2CXVA 2VVVA 4X1NU 3LJOA 2JH5D 1WQSA 2FO9A 5GCHF 2BD4A 2EC9H 4YM9A 4WF8A 2BLOA 2ZTZA 5F8XA 1A5IA 1VCQA 1P9SA 1SGDE 1UK3A 1GI8B 1F2SE 3RXCA 5C5NA 1AMHA 2O8WA 3W95A 1LMWB 3IITA 2I6SA 2DUCA 2STBE 2ULLA 3ZVGA 1SGCA 1G36A 4MDSA 1GDUA 3FP6E 1B7XB 1G2MA 2PWXA 2V7QD 2FWWA 1SOZA 5DG6A 1HIAA 1SGTA 3E0PB 4YLUA 5H4IB 5JPMH 2QE7D 3QGNB 5FX5A 4MPVA 1GHWH 2J34A 1B0FA 3M37A 2NU3E 1Y3UA 2LNCA 1EJMA 3HPTB 5ESTE 1O35A 5KECA 1QY6A 1MCTA 1MBQA 2GP9B 4I8KA 2CJIA 1O2WA 1O2GH 1GHZA 2HPPH 1KTTB 3ZZ5A 2BQWB 2BVSH 4BANB 4UEHH 3UWJH 1T8NA 2WV9A 1V2WT 2H6MA 1WCZA 3A83A 1C4V2 1C2EA 1BTWA 1MQ6A 1WBGB 1EJAA 3VFEA 1E36B 3KHVA 1O39A 4O3TA 1O33A 5HIYA 7GCHG 4Y7AA 2VH0A 2BD2A 3SV9A 3SZEA 2IN2A 5JBBS 3E6PH 4FETA 1MD8A 2K0QA 1JXPA 1WTHD 1OXGA 4JZ1A 1AWFH 2AMQA 1W13U 1OOKB 1C1RA 2Y7XA 1QBNA 4AB9A 3VGCB 1G3BA 1HV7A 1ELTA 2WV4A 4JK5A 2ZU2A 5EIYA 5T3HA 3SV2H 2J98B 4AORA 5L2ZH 5JB9S 4YLQH 3NKKA 1NS3A 4AFSA 2G00A 1V3XA 2BLQA 2SGQE 2NU4E 1Y3YA 4O3UA 1DXWA 2WINI 1O2JA 4IC5A 2KCAA 2G4UA 4WJG2 3GYMA 1GMCF 3A88A 4TSFD 2Z3CA 4FXGH 1NFUA 5A2MH 3S69A 4DIIH 1PFXC 1THSH 1W0YH 1HYLA 1JWTA 3MHWU 2FP7B 1FPCH 5A0BA 1TNJA 1C2GA 1HLTH 3QWCH 4Y79A 1O2MA 1O3GA 1TALA 2KCPA 2VWOA 3P70B 5CHAB 2VGCC 2F4LA 2G8TA 2BMGB 2TGDA 2LELA 4VGCB 3HKJB 5FHTA 1QB9A 1VKYA 2TPIZ 2OP9A 2FZZA 3AASA 1HPGA 4INLA 4AX9H 1O2VA 3LPRA 1P2JA 1QRXA 2RA0A 2L74A 4KGAA 3W94A 5GNDA 1BTZA 4B2AA 2F9NA 1BDAA 1VCPA 5LPEA 4DJZB 2BHGA 2BZAA 4M7GA 7KMEH 4HFPB 4KTSA 5C1UA 3RC6A 1N8OC 3P92A 1LHGH 1GHVH 5I25A 1P09A 3F0PA 4ABHA 1NT1A 1EX3A 1FUJA 5KEDA 1DFPA 2PKSB 1A3BH 2BQ7B 2C8YB 1KY9A 2BD9A 2A4GA 4CR9A 4YXWD 3Q00A 1ETTH 1TPAE 2BXTH 2P59A 1DOJA 4BTTB 4IW4E 1EPTB 1SSXA 1P8VC 1GDNA 1K22H 5C1XA 3S0NA 1BQYA 1OWJA 3KQCA 3PWCA 4AN7A 4Y8ZA 1YLDA 4A92A 1EAUA 4CRDA 1O2NA 2XW9A 5DJ7A 1G32B 2HGTH 2A31A 1C2DA 1UMAH 3HKIB 3EQ0H 4YO9A 3GS9A 4GVUA 1G37A 1DY9A 3F2GA 5JBTA 1HGTH 1EXFA 2JETC 1F5LA 2V3OH 2AS9A 2ZDVH 4Q63A 4BOHA 1AHTH 1OWHA 2PHBA 3NRLA 3ZIAD 1ANEA 1C4U2 2QXIA 1HAYB 3E8LA 1D4PB 1TGBA 4JZEH 4DURA 1GPZA 2CV3A 3F2FA 2YMSB 2ZNKH 4MNWA 4X8UH 2QF0A 2Q6FA 2AFQB 3E90B 3A85A 2F9UA 2J9NA 1V2ST 4CREA 3VB5A 1F5RA 2F83A 4FUEA 2OD3B 1IQFA 1YPGH 1GBFA 4I8GA 1CHGA 3VXFH 4MVNA 3SI4H 1GMDF 1YCPM 4ASHA 1HJAC 3V13A 5F8ZA 3LH3A 2ZQ1A 1DWCH 4AGKA 4B6EA 1C5WB 3Q3XA 2QCYA 2KFWA 3A7TA 2QY0B 2KM0A 1L1GA 1GBDA 1W14U 5E0HA 1EZXC 1HIAB 1XUIA 5DN6D 1SLUB 2CF8H 1B0EA 4WXIA 2ZPQA 1KXFA 1HUTH 1GBIA 1JIMA 3U1JB 4Q80A 2WPJS 1NPMA 2IJD1 2ZFFH 2QF3A 1AE8H 1S82A 2ZFQH 4D76A 1ABJH 3AAVA 2W6JD 1A3EH 1C1NA 3GDUA 1TYNA 3BTGE 3OAAD 2F91A 2TRMA 1TOCB 2GGVB 1H8DH 1T8LA 3NUMA 3SNCA 3JZ1B 1GI1A 1GGDB 2EEKA 2VVUA 4GPGA 1DDJA 3GY8A 2QIQA 2CHAB 3M7UA 1SB1H 3STIA 1KXAA 2GCHF 3PV4A 1AKSA 2VINA 6GCHG 1NFWA 3Q76A 4X1SU 1T8MA 1E79D 4BAHB 1TRNA 3RXOA 3DD2H 1ZGIA 4AOQA 3KF2A 3DSOA 4AFUA 1P3EA 1TFXA 1P02A 2O9QA 2ZU3A 4MG3A 1TQ7B 2KCOA 3ZZ3A 1ZRKA 5F53A 1P06A 1O2HA 1KMHB 2WYGA 2BYAX 1WOFA 2K1QA 4U32A 3S9CA 2GVFA 2EA3A 1O2XA 2RG3A 3VEQB 1GWAA 4B2CA 1N6XA 3MI4A 1MTNC 3K65B 2OK5A 3T25A 1GHXH 3GCTG 1W8BH 3PWBA 1YWUA 3ZVFA 4ZHLU 3QTOH 1LQDB 1TB6H 1C9TA 4XE4A 4DVAU 2ZFSA 4CRAA 2J38A 2C4FH 1JBUH 3C1KA 2CN0H 4CR5A 2OC8A 5E2PA 1Y5BT 1L4ZA 1C5UA 1QRWA 1NC6A 1O31A 1Z1IA 4XBCA 1AUTC 2F9BH 1C2JA 1L1NA 3NCLA 4X6MA 1QURH 2ZU1A 2THFB 3OFND 4K1SA 3T29A 1OWEA 3SNEA 4ABBA 2A5IA 3AK5A 3SJKA 3WWBA 1KDQA 4FUBA 4AFZA 2Z6BD 3DSPA 2Z7FE 1IQGA 1CGJE 5DP4A 1DXPA 1H4WA 1YLCA 1F0SA 2UWPA 3GISB 2GMTB 3MYWA 9LPRA 4NFFA 3EA9A 1C4Y2 3UB0A 5C0TA 2XNIA 3RXTA 1O2QA 2AMDA 1PPEE 4INHA 1C1WH 3F9GA 3SGQE 4UONA 3ODDA 1QHRB 4OS6A 2DE9A 2BY7X 1ACBE 1T32A 1Y3WA 2W7UA 1NFXA 3RM2H 5DP5A 1SR5C 4ABFA 1ZJDA 5DO4H 1P10A 2VIQA 3UOPA 3KN2A 3EA8A 2A4OA 3ZVEA 2FTMA 1PQ8A 2ALPA 4WWYA 3RXRA 2JKHA 1FNIA 4GCHG 1UVSH 2K8IA 2Z3EA 4OS5A 2P93A 1C5QA 3TNTA 2BX4A 1GBAA 2AEIH 2J92A 1SGRE 2WPHS 3TPIZ 4DG4A 1V2LT 1OX1A 4B76A 4FUGA 1DWDH 1VR1H 3H7OA 1UJ1A 3SU0A 1K1MA 1TA2A 5A8ZA 3ZVDA 1AB9B 1C5YB 2BY9X 1RFNA 4J1YA 3FP7E 1HAGE 1O2SA 2ILNA 3LIWA 1IQJA 1PPHE 2OQUA 4WXVA 4XBBA 2ODQA 2WPIS 1NBME 5AHGH 4HTCH 1EATA 1ESBA 1LCYA 4BTUB 2XOKD 4I8JA 1YLNA 2G4TA 1YGCH 3BG4C 4AG1A 5C94A 1PPFE 2AIPA 3N7OA 5B6LA 1O3NA 2FMJA 4H42U 3UNQA 1BMNH 1EOJA 2BVXH 2Q6GA 1IHSH 3OY6U 3BN9A 4THNH 4UD9H 1CA0C 2A7CA 3U98H 4OS4A 5IYTA 3UUZA 1P3CA 2A2XH 1YP9A 2VIWA 3D23A 3EDXB 3UY9A 1ELFA 5FPTA 2H9HA 1MU6B 2CMYA 3SU2A 1BT7A 1FPHH 1ZTJA 2KX4A 3WWFA 5AF9H 2BLVA 3EGKH 4ISIH 3PLBA 4AGJA 3QGJA 1AVXA 4JMYA 1TBZH 1ZTKA 3SYJA 2ZIQH 5KGOA 3D65E 1H8ED 5HGGA 1RTKA 3QUMP 1IAUA 3SV8A 2FOFA 3BTHE 1PQAA 5HM2A 4Y76A 7ESTE 3OSYA 1FAXA 1QTFA 4ISLA 1CT0E 4X2YA 1FI8A 1FN8A 3A82A 3TGKE 1BA8B 3E1XB 1BRCE 3SGAE 4D9QA 4RKJB 2VJ1A 1YKTA 3V12A 1MAYA 2WUCA 1HFDA 3A8DA 4DIHH 1CBWB 4B2BA 3A7ZA 1NROH 1VITF 4O9VA 4X6OA 1FQ3A 1ZHRA 3MU4A 3PO1B 5EQSA 1DSUA 2O8MA 1HAOH 4A1XA 2HWLB 1W0ZU 1GI9B 4M9FA 1D3QB 5TCAA 1SFIA 4DW2U 1SGNE 3MH7A 2V3HH 2F9OA 3FN8A 4ZXYH 3UNSA 4AG2A 3LGTA 1SKYE 1Y3VA 3TK5A 3U1IB 8GCHG 4Y7BA 2ZU5A 1UHBB 5EPNA 2GV7A 4IC6A 1GCTC 1QB1A 4OS1A 1EOLA 1JOUB 4HG6A 3GY6A 4X6NA 5EU8A 2AHME 4H6SB 4YESB 1TPOA 2ODYB 3U8OH 2SGAA 1GI3A 1PPZA 5PTPA 2M5TA 2HNTF 4BAMB 4UFEH 2BD7A 1C1PA 1XUHA 1RIWC 3VB4A 5C20A 1V2JT 2H1UA 3A8AA 2VVCA 2QV1A 1HJ9A 3A8CA 2ZCLP 5IK2D 2FYQA 1TMBH 1Z8RA 1ID5H 1RRKA 1UTMA 1NRNH 3VPKA 3DSGA 2Z9KA 1EKBB 2GV6A 4OGYA 1THPB 2ODPA 4JZFH 4AZ2B 2FYRA 1O3EA 1YF4A 1KDQB 4I8HA 1GVKB 2RCEA 3F1SB 3MNBA 1GBKA 1GCDA 3ATLA 4ISOA 3FANA 3M35A 4ASUD 2P3FH 1GHYH 2AERH 2BDBA 1Y59T 1MZAA 3U8RH 4JZIA 3KL6A 5HMAA 9ESTA 5GJ4B 1O5CB 1SHHB 1GVZA 2A7JA 5CDFE 1UTNA 1CSOE 3BTFE 2ZHQH 1RGQA 1GMHF 3E16B 2PKAA 5DPAA 1FY8E 1HAIH 2C8ZB 4MLFB 1UTKA 1YPJH 1BRUP 1NRPH 1ZPCA 1CHOF 1FDPA 2ZQ2A 1FX0B 4K1TA 3LGVA 1O2OA 2ZI2H 3D49H 1YM0A 3U8TH 1QR3E 1XMNB 1AQ7A 2OQ5A 1DITH 1P03A 3FZDA 1SGQE 3SN8A 3P17H 1TNKA 1A4WH 2KAIA 3L6PA 4F4OC 1T7CA 5HM9A 1GG6C 2NU2E 3TJNA 1QGFA 4WMDA 1O5DH 3IG6B 5F6MA 2GZ7A 2ANYA 4I33A 1G2LA 2OUAA 3DHKH 3SUEA 3RU4E 4IN2A 3SUDA 1LPZB 3UQVA 2ZHDA 1K1JA 1DX5M 3H5CB 3SU3A 4K2YA 4ZROA 5SGAE 1L0ZA 1EB1H 5GCHG 2SGPE 3LOXA 8LPRA 5EG4A 3P6ZB 5A0AE 2ZDMA 2FLRH 5EODA 4FU7A 1V2TT 1SI5H 1S6FA 1MBMA 2G5NA 1ELBA 1H1BA 1AZZA 1T31A 5CE1A 3N99A 2STAE 1N1LA 3PRBA 4K5ZA 1BTHH 2FODA 3RC5A 1P2QA 2B0FA 3GY2A 1V2OT 4XRNA 1HAXB 3RUOA 5C67A 1LHCH 1D9IA 1RTFB 1U6QA 2ZFPH 3BSQA 3F9EA 1P57B 4XBDA 4DOQA 2W3KA 2BQ6B 8ESTE 1VGCC 3C27B 3B9FH 4Y71A 4NIYA 2EI6A 4CRCA 3FAOA 1Z6JH 3SORA 5DP3A 1CA8B 3MOCA 3SW2B 4A7IB 1G3CA 4HI3A 1S5SA 1LQEA 1ZGVA 1AN1E 3SQHE 2A4RA 2HRVA 3LDXH 1O3LA 2V35A 2VWMA 2O8TA 1C1SA 1XUFA 1O3KA 1E1RD 1AFQC 1ELAA 2AMPA 2PFEA 4ZHAA 1C2FA 4AC9A 4CHAC 1LKBA 1OP2A 1VZQH 1QZ8A 3S9AA 3RLWH 2GZ8A 4OS2A 4NIXA 1AFEH 2GTBA 1BBRE 1GHAF 4ZKOU 1ZHMA 4MNVA 2QN5T 1IQNA 4ZKRU 1E34B 1GJ5H 1BIOA 3O8BA 2GKVE 2OXSA 2ZZUH 1QFKH 3EE0B 2FI3E 4JZDH 1GI0A 1O3DA 4FUDA 4E05H 2EI8A 1C2IA 3D62A 3EE7A 1CT2E 1FONA 4TWWA 4R8TB 3BV9B 2ZGJA 2BY8X 1XX9A 1BMMH 2GCTC 3NK8A 4XD7D 1UTJA 1GMCG 2O8UA 1P2OA 3MNSA 1HB0B 2ZF0H 3RXLA 4B74A 1ZLRA 1EAXA 2WYJA 4D9RA 1AO5A 1SL3A 5FBEA 3BEIB 2TBSA 5K0HA 2ANMH 4ZKNU 2TGAA 1QCPA 3ZV9A 2ZGCA 1TNHA 3PTNA 3QTVH 5HYOA 4I86A 1W12U 2ZEBA 3OTJE 3K9XB 2Z94A 3F3BA 3CS7A 1OKXA 1DWBH 2D1JA 1BMLA 3A7VA 3DFJA 3DFLA 3FZZA 3KYFA 5A09A 1HBTH 3GDSA 1D3TB 1J8AA 3GCHC 2XCNA 5EXNA 4CBOA 1L2EA 4BAQB 3O8RA 3QLPH 3CENA 3LGYA 3M5LA 1GJ9B 4OS7A 3OTPA 1DWEH 4Y10E 5C1YA 1MTWA 1O3OA 1DT2A 5GPIB 1QQUA 1SLXB 1WDIA 2TIOA 2ZTXA 3BG8A 1GJBB 1KYNA 4UFDH 4NSYA 3SQEE 3M7TA 3SU1A 6CHAC 1VITH 4FUFA 1UTPA 1DUEA 1K0HA 2Y6TA 1GI6A 5CMXH 1SLVB 2BY6X 1HAZB 1C5OH 1G3DA 1OSSA 2JH0D 1SHYA 1UVOA 1OHHD 1GJAB 3MH6A 2FI4E 3OU0A 1D3PB 4HZHA 1LVMA 2ESTE 4YTAA 1C2KA 3TU7H 2G81E 3OYPA 1XVOA 1GDQA 5AVDA 2G52A 1NRRH 1BUIA 1P05A 3PM3A 1IQHA 4QT8C 1V2MT 2H5CA 3F0OA 1WV7H 2FOEA 1DPOA 2F43B 5EJZA 2FDAA 2Y5HA 1GJCB 1Z8JB 3A7WA 4TT3D 3UWIA 3BF6H 1TAWA 4CRBA 1QJ7B 1IQMA 4GAWA 2JJ1D 5BRRE 1DANH 1RD3B 1FN6A 2XNDD 3MMGA 1GJ6A 4KP0A 4ZHMU 3A87A 1AD8H 1O3FA 3M5NA 3ATIA 3SNAA 1MZDA 1LPGB 2RDEA 3KQ5A 1O3HA 1S85A 3ZZBA 2Y81A 1HNEE 2VGCB 3SJ9A 2HNTE 3SUFA 1A46H 3P8GA 3TLOA 1PQ7A 3UQOA 1XXDA 2XWAA 3KQBA 4A6LA 1GHBG 3MU0A 2WPKS 1COWD 3NPSA 5FBIA 4BAOB 5J4SA 4Y8YA 3L33A 2B7DH 3MTYA 1BTYA 2QF4A 1GMDG 2ZFTA 1IOEA 2SNWA 1NBMD 2ZCHP 2I6QA 3NZIA 1ZMLA 1BJUA 3U28C 3Q77A 3RXSA 2GX4A 3RXHA 1TOMH 1ZOMA 2FTLE 1E38B 3UR6A 1EZQA 1KLIH 2ZDKA 2XBXA 3MU5A 1LPKB 1QL9A 2FXRA 4YOGA 3BEFB 4H6TA 3TH4H 1LHEH 4FUHA 1N8OB 4YOJA 2CGAA 2GDEH 1GJDB 4B75A 1MTUA 2KZ4A 4WH8A 3E3TA 4K8BA 3Q3KA 1BOQA 4ZMAH 4BTIB 4TWYA 1K1LA 3FFGA 1JMOH 1OP0A 1C5VA 1UTLM 3A89A 2FOMB 4RKOB 1S0RA 2AGIX 2FLBH 1ZTLA 3GY5A 1CGIE 4NSVA 3SHCH 2Z9IA 4X1PU 1SOTA 3TIUA 3LU9B 3QK1A 3LT3A 5T1VA 2CK3D 3SNDA 5EQQA 1AU8A 2SGEE 4XDEA 1GI2A 1O37A 1TGSZ 2P94A 3WW7A 2VWNA 1ANDA 4MQAA 1SG8B 5FCKA 2GCHG 3OY5U 2A5KA 5EQRA 2AYWA 2OC7A 4NIWA 1SGPE 2ZFRH 2HNTC 2ZO3H 1F92A 1GJ8B 4Y6DA 2SGDE 3LC5A 1TX8A 1OYTH 3FO8D 1IQEA 1DY8A 2JETB 4GHTA 1SGYE 5C2ZA 2Y80A 4YT7H 4FOUC 2J95A 3SJIA 3BTTE 3P8FA 3SV7A 1NESE 1PQ5A 3SNBA 1BTXA 3SU6A 3A84A 2QC2A 1C5SA 4ABAA 3QZRA 2EQNA 2RFKC 3OE7D 3PMHB 1RJXB 4ABIA 4D8NA 3S7KB 3RU4T 1GBHA 2VNTA 1THRH 4IS5A 3BTDE 3K6ZA 2KCYA 3GICB 3WY8A 2ZCKP 2HVXA 1ANCA 1WXRA 1J15A 3ZZ6A 1HJAB 1DE7H 1P11E 4NFEA 2PLXA 1Y8TA 2OBOA 2BY5X 1TPPA 4ZKSU 1OWDA 3URDA 5T6GA 3M7QA 4K1EA 1EASA 1W11U 1Q3XA 1GBJA 1TBRH 2Y5GA 5DP6A 2AIQA 3IWMA 1W3CA 8KME2 2ANKH 2BDGA 1A2CH 2FI5E 4JCNA 4U2WA 1ZMNA 2XBYA 3SJOA 4YT6H 2QA9E 4X8TH 2ZPSA 3M5OA 1J16A 5JBAS 4X0WU 1BZXE 1Q31A 5DK1A 4ESTE 1YPHE 2JDID 3G01A 2BD8A 1KXDA 3GDVA 3JZ2B 5E0JA 3TJUA 3PLKA 3S9BA 1OP8A 5FX6A 2RA3A 1FXYA 4UFFH 2ZDLA 4CRGA 2V3MA 1QL8A 1S81A 2B8OH 3ZZDA 1KLTA 4UFGH 5I46H 1FY3A 4F55A 3S7HB 1DUAA 6LPRA 1BMFD 2GT8A 1ETRH 5K7RA 1SVPA 5EGMA 1C5TA 4E7NA 1GJ7B 3GY7A 4AYYB 1KSNA 2ZPRA 2P95A 4X2VA 1MKWK 3TNSA 4DGJA 4NWLA 1C1MA 1SC8U 4NWKA 2ZP0H 1V2QT 3SO3A 3Q3YA 3K6YA 3AVZA 1FV9A 3DA9B 2XYAA 2OTVA 3PV2A 1MMJN 4NGAH 1ZHPA 1O2RA 3ZZ8A 5B6OA 3P8OA 1MTNB 5GDSH 5TCCA 5HKKD 3B8JA 1C5ZB 3LGIA 4UE7H 3UR9A 1BTPA 2WUBA 5DP8A 4IMZA 5C3NA 1IQLA 5E2OA 1NM6A 3RXDA 3VB3A 2Q1JA 1C1UH 5HXFA 1A5HA 2QYIA 1GI5A 2R3YA 2V0BA 3ATKA 2BOHB 3RU4D 2IOTA 3UFAA 2ZA5A 3ZVCA 4FUJA 3CP7A 3BIUH 1C5RA 5GWZA 2VU8E 3TVJB 1TPSA 3TITA 1TNIA 1YPHC 5FPYA 4X2XA 4UDWH 2C93B 1SFQB 2Y7ZA 1ORFA 2PSXA 3V0XA 4LZ1H 1VJAU 1AUJA 5GXPA 1SGEE 4H4FA 1WTGH 2BTCE 3RXAA 2FESH 3AW0A 3RXVA 3K2UA 1WAYB 1TGNA 1O2PA 1E37B 2BLWA 3ZYDA 1XUKA 2FS9A 3RXFA 2TGPZ 2A45B 1ZSJA 2BX3A 3ITIA 4A1TA 3TJVA 1BHXB 1ZSLA 1AKSB 1S6LA 2J94A 3SZNA 4GSOA 1KLJH 2B9LA 2XRCA 2VH6A 1PPBH 2EY4C 1Z8GA 1TWXB 1EFRD 1TMUH 4I7YH 1ARBA 1MKXK 3RXBA 3MQKC 2C8WB 2DE8A 2ZDNA 2JJ2D 3E91A 3M3VA 2ZWLH 4NA8A 4ABJA 1AGJA 1S83A 1O30A 2FOCA 1CE5A 3I29A 1AVGH 4GHQA 4LXBH 4NIVA 3QX5H 1O36A 4TYDA 3HGPA 2UUJB 1HCGA 4NZLA 2Z3DA 3F6UH 4XFQA 3PMAB 1BTUA 3LKWA 2ZGBH 1L1JA 1VITG 1UCYE 1BBRK 1QBVH 4X8VH 4ABDA 2HOBA 4DT4A 5EJLA 3SOSA 4ABGA 1C2LA 2FS8A 2ZC9H 2UUKB 1C5PA 1GBTA 3VGCC 2IPHA 2VWLA 3ZYEA 1DSTA 1O2ZA 1Z8IB 4CRFA 1FY5A 1CQQA 4DCDA 3RXEA 2F3CE 2FOGA 3LGUA 3BG4B 1MKWH 1BRBE 1O5EH 2FEQH 1TE0A 2IPQX 1DM4B 4IN1A 5BPEA 3PV5A 1CA0B 1TA6A 2XC5A 1MAXA 1D6WA 3AAUA 1ESAA 1LKAA 2OLGA 2KR7A 4K60A 1RTLA 3RM0H 3FKSD 4PROA 1D3DB 3A86A 3LONA 3V3MA 5CHAC 3MO9A 3TK9A 1UVUH 1SQOA 3ENSB 3ESTA 4VGCC 4LZ4B 1VCWA 2HVYB 4A5TS 1QB6A 3SU5A 1QA7A 2P8OC 2BD3A 2R2WU 1GBCA 1A0HB 1PYTC 5C5OA 1O34A 1YC0A 2A0QB 2VBCA 1CU1A 1P2MA 1OYQA 4FUCA 1SQAA 1T4UH 1FY4A 1GL1A 2W5EA 1HRTH 3R0FA 2H9EH 1K1PA 1KXCA 3T2NA 3I77A 2XC4A 3KYGA 2PP6A 5HIZA 2W7SA 1W7GH 1S84A 2FOAA 1GMHG 4YOIA 1XKBC 2ZGHA 2RDLA 1QA0A 3DUXH 1ZSKA 1CHOG 1VJ9U 2WPMS 5G4BA 1ZJKA 1C2MA 3PTBA 2IJOB 2PKSC 1T8OA 5A8XA 1T4VH 7GCHF 4BAKB 5EPYA 1O2UA 3TK6A 2P16A 4MNXA 2Y5FA 3KGPA 3QZQA 4A1VA 1O0DH 1GI7B 1O5FH 3B23B 3SI3H 3CNRA 4FU9A 1NY22 1V2PT 1EPTC 1MKXH 2SNVA 3TGIE 1JIRA 1ELDE 1DLKB 1ANBA 1BCUH 1EUFA 1G9IE 1P9UA 2XBWA 3PMBB 5C0UA 1UVPA 3BTQE 1TX6A 1IQIA 1FAKH 5F8TA 1QQ4A 2VIOA 3ZZ7A 1CGHA 1NRSH 4RT1A 1GCTB 2A2QH 4I8LA 2HLCA 1MQ5A 2YNBA 4Q7XA 4SGBE 4B73A 1SGFA 1ZMJA 2NU1E 2F9PA 2XTTB 5EW1H 1BBRH 3UREA 3SV6A 1RIWB 3U69H 2BXUH 5DSFA 5L2YH 2BVRH 2R0KA 3F68H 1GJ4H 1HAPH 3SHAH 2YMSC 1C2HA 3A8BA 3R3GB 3VG8A 1A5GH 1BJVA 3F9HA 4I31A 1F0RA 5TJXA 4XSKU 1JRTA 1DVAH 1V2UT 1EAIA 1HXFH 1EB2A 3STJA 1FJSA 2WPDD 5LPFA 4RI0A 3T28A 1UK2A 3VXEH 4ACBA 2GDDA 2QXGA 2FPZA 1YCPK 1QL7A 3HATH 1FMGA 4I32A 1HAHH 1LDTT 1SGIB 2OC0A 2D26C 1LVYA 2J5UA 5JBCS 1S0QA 1ABIH 1ARCA 3M3TA 3ZZ9A 3UNRA 1LO6A 3H7TA 1TRMA 1A0JA 3GCOA 1SQRA 1DLEA 3LGWA 1WYKA 4R0IA 1F5KU 2LPRA 2P8OB 2L6OA 1OWIA 2J2UA 1CO7E 1C5XB 1GHAG 1TX7A 1V2VT 2FOBA 1GG6B 4BNRA 4AB8A 1IHTH 4ZCNA 3QDZB 1A61H 1LVBA 4Q2KA 2BDCA 5DGJA 7LPRA 1GGDC 1F7ZA 4K3JA 1O2TA 4NA7A 1WU1A 4Q7YA 3T27A 1TIOA 1P04A 2CHAC 3BEUA 1Y3XA 3BTWE 3F2HA 2WV5A 3FOAA 2QXHA 1BB0B 1O5BB 2AGGX 3KNXA 5JB8S 1ZYOA 3KQDA 5FXLA 1AIXH 1EQ9A 2QF5A 2VIVA 1QBOA 1YPLH 2WHXA 4XOJA 1BITA 5FCRA 1FZZA 3UTUH 2OINA 4Q4LA 2FX6A 2A32A 2G5VA 4NZQA 5T6DA 2UUFB 3MU8A 1S6HA 4D7FA 1NO9H 4HGCA 1DS2E 1WQVH 2BDYA 4F48B 1HDTH 4WMEA 2A7HA 4FUIA 1TQ0B 1W2KH 1C1VH 4KKDA 2XWBI 1J17T 4X8SH 4YZUA 1P2KA 2ZGXH 1AVWA 1KTSB 1EZUC 2YNAA 1V2NT 2WPLS 2JIZD 3EYDA 2C8XB 6ESTA 1GBMA 1W7XH 5ESBA 3ZV8A 5FAHA 1VGCB 4AYVB 2GT7A 1YPMH 3F9FA 4B6FA 5E0GA 3U9AH 2A4QA 4TY6A 2PKAB 2PTNA 1UO6A 2D2DA 3SJ8A 2H9TH 1ZR0A 2F9VA 1ZZZA 3LH1A 3GY4A 1INCA 3EAJA 5T6FA 1PJPA 5DP9A 1ZPZA 1SPJA 1OS8A 5ETXA 1ESTA 4ZUHA 1CVWH 1AFQB 3OEED 2KAIB 4ACAA 1O3MA 1P12E 1A0LA 2PV9B 3M61U 1XM1A 4WH6A 4X6PA 1MTSA 4CHAB 1PPGE 3SUGA 5IDKA 5LH8A 1FIZA 1O3AA 1GHBF 2GMTC 1Q2WA 2QGRA 2WZQA 1UTQA 1B5GH 2BOKA 1V6DA 2ZHEH 3RLYH 3E0NB 3O8CA 2BD5A 2QAAA 1YCPH 3TGJE 2ZU4A 3PYHA 4Z1MD 1YBWA 4ABEA 6GCHF 1P01A 3A7XA 2GCTB 1K1NA 1TMTH 2Z9GA 1KXEA 5E8EH 3EA7A 1TBQH 2A1DB 3HK3B 2PUQH 1YYY1 3M3SA 1P2IA 2D8WA 1A1RA 1M9UA 1RS0A 2YOLA 2H5DA 2XBVA 1C5MD 3A7YA 2VB0A 3LJJA 1SQTA 1NU7B 2A5AA 4CH2B 4P02A 3RMOH 2CF9H 2V6NA 3GCTF 4Z0KA 3UOUA 1O3PB 5A0CA 1OPHB 2Z9LA 4X2WA 1AB9C 4Z6AH 3GCHB 1XKAC 2BDIA 1CT4E 1K9OE 2FOHA 4BXWA 1W10U 5EXLA 3ZZCA 3QN7A 5FPSA 1H9HE 4TY7A 1G30B 3AW1A 5DP7A 1MABB 3MO3A 3RMLH 3W1EA 1TABE 1LHDH 4GLYA 3DT0H 1GL0E 1ELCA 1MUEB 1IQKA 1UHBA 6CHAB 4OM9A 4JK6A 1NZQH 1C5NH 2R9PA 1AE5A 5ABWA 3ELAH 3LC3A 4JYUH 3TH3H 4ZXXH 4B71A 4RT0A 1UTOA 3GOVB 4D7GA 4E06H 1JRSA 1QIXB 1P2NA 4Y11E 3DCLA 5C17A 1TRYA 4IBLH 1ZRBA 3RXPA 5AFYH 3RDZA 2ALVA 5EJ1A 2HLDD 1Y5UT 1MH0A 2P3TB 2PR3A 3FVFB 3UPEA 4U01A 3HGNA 1XVMA 1NTPA 2NU0E 1XXFA 2ZKSA 2W3IA 5JDUB 2EI7A 2PTCE 2HPQH 5FL7D 4ISHH 2SGFE 1E1QD 2ZG0H 5JYIA 3KIDU 3PRDA 3RC4A 1XUGA 1LVOA 4Q7ZA 3UIRA 1GVLA 1DICA 3SGBE 1PYTD 3BIVH 3ATWA 2LP6A 1TNLA 1YPEH 3MNXA 1G3EA 2XC0A 4JYVH 1F0TA 2M2AA 1HAVA 2BZ6H 1QRZA 1N6YA 4GCHF 2WSSD 2BDHA 5LGOA 1SMFE 1TLDA 1KIGH 1C1QA 1CBWC 1GBLA 5L30H 1ELEE 1UCYK 3A80A 1O3JA 3RXQA 1AI8H 3P95A 2HALA 3PO1C 4Y8XA 4J2YB 4O97A 1E0FD 1H8IH 3ZVAA 4KTUA 3KEEA 1K21H 2QXJA 2R2MB 2ZHFH 1C9PA 4RSPA 1K2I1 2SFAA 4MTBA 2J4IA 5EOKA 4FVBA 1O2KA 1AZ8A 2BB4A 3N7DA 3P8NA 3ZZAA 2UWOA 1O3IA 3A81A 4Y0ZE 3RXKA 2AGEX 4NCYA 4IGDA 1HJ8A 1QJ1B 2OC1A 2ASUB 2PGBB 4RN6A 4X1QU 1Z71A 4NG9H 3BTEE 5EXMA 4X1RU 1WSSH 1SGFG 1Z6EA 3VB7A 1BRAA 1WUNH 1O5AB 3BTKE 4NA9H 2GD4B 1GI4A 3PROA 2TGTA 3MWIU 2B5TB 2XXLA 4IMQA 5LPRA 1KXBA 2Q6DA 2OBQA 3ATMA 2JH6D 4GUXA 5J4QA 4DT7B 3RXUA 2C3SA 4E7RG 1LHFH 1P0SH 4WY3A 1C5LH 2R3UA 2NWNA 4SGAE 1J14A 1ELVA 2ZTYA 1K28D 4P00A 3MNCA 3RXMA 2PSYA 3PB1E 1QJ6B 3O8DA 4FU8A 1Z1JA 1NFYA 4LK4A 1MD7A 1OWKA 4CBNA 2PGQB 2YMSD 2FIRH 4LOYH 1O5GH 1H9IE 1L4DA 2Y82A 3MU1A 4MPUA 2ANWA 2VIDA 2G55A 1TGTA 5AFZH 1EP6A 4K8YA 2PW8H 1XUJA 1V2KT 3RXGA 1FLEE 1O32A 2J98A 3TJOA 3M5MA 1EZSC 3I78A 2C90B 4DY7B 3NXPA 1PPCE 1UVTH 3GY3A 1EP5A 2GJGA 1Z7KA 4FVDA 1V2RT 3GYLB 3RXJA 1NU9A 1GBBA 1F0UA 4AFQA 1ELGA 2G51A 1E35B 1Y5AT 3MH4A 2FX4A 1C1OA 4ZAEA 4O03A 1O3BA 3ODFA 4TPIZ 1AWHB 1YPKH 1GBEA 1H9LB 4B1TA 1UW7A 8GCHF 1YY3A 2ZECA 1UK4A 2ZHWH 4U30A 4CH8B 2BM2A 1EJNA 2W26A 5GIBA 2AH4X 2Z9JA 1J9CH 2H2ZA 3L3TA 1O2LA 2UWLA 4KTCA 4Y0YE 4ISNA 4KELA 3VB6A 1HXEH 3H09A 1UCYH 5CHBA 3RMMH 3RP2A 3CS0A 4F49A 1SBWA 3MFJA 1FY1A 3QO6A 5F03A 1K1OA 1SLWB 1NRQH 3KQEA 1O2YA 1BMAA 2VIPA 2OCVB 3M36A 3TH2H 2GZ9A 3V7TA 4INKA 1MTVA 4WVPE 1NN6A 3T26A 3BTME 3RXIA 2XCFA 4WMFA 5A8YA 1K1IA 3HK6B 3GCNA 1LTOA 1MU8B 4BXSA 2R0LA 4JYTA 3PMJA 3PLPA
chains in the Genus database with same CATH topology
5DKMA 2BDAA 5L6NH 5EW2H 1W0KD 4TPYA 1TGCA 3SU4A 3KCGH 1ETSH 1FIWA 3URCA 1D6RA 1O3CA 3T5FH 4ZH8A 3T62A 1EPTA 2ZDAH 4OGXA 2PUXB 3FP8E 3MO6A 2UUYA 3MH5A 2O8LA 1H8HD 3SBKA 1TNGA 1MCVA 1TONA 3NWUA 2W6ID 1A7SA 4MPWA 3OEHD 1EAWA 3N7EA 1C1TA 4MNYA 1W0JD 4MPXA 3ZZ4A 1AY6H 1X7AC 3OX7U 2FM2A 1O38A 2P3UB 1QNJA 1ZPBA 1RXPA 1HAVB 1BHXF 3ZVBA 4K69A 3RMNH 1O2IA 2CXVA 2VVVA 4X1NU 3LJOA 2JH5D 1WQSA 2FO9A 5GCHF 2BD4A 2EC9H 4YM9A 4WF8A 2BLOA 2ZTZA 5F8XA 1A5IA 1VCQA 1P9SA 1SGDE 1UK3A 1GI8B 1F2SE 3RXCA 5C5NA 1AMHA 2O8WA 3W95A 1LMWB 3IITA 2I6SA 2DUCA 2STBE 2ULLA 3ZVGA 1SGCA 1G36A 4MDSA 1GDUA 3FP6E 1B7XB 1G2MA 2PWXA 2V7QD 2FWWA 1SOZA 5DG6A 1HIAA 1SGTA 3E0PB 4YLUA 5H4IB 5JPMH 3QGNB 5FX5A 2QE7D 4MPVA 1GHWH 2J34A 1B0FA 3M37A 2NU3E 1Y3UA 2LNCA 1EJMA 3HPTB 5ESTE 1O35A 1QY6A 1MCTA 1MBQA 2GP9B 4I8KA 2CJIA 1O2WA 1O2GH 1GHZA 2HPPH 1KTTB 3ZZ5A 2BQWB 2BVSH 4BANB 4UEHH 3UWJH 1T8NA 2WV9A 1V2WT 2H6MA 1WCZA 3A83A 1C4V2 1C2EA 1BTWA 1MQ6A 1WBGB 1EJAA 3VFEA 1E36B 3KHVA 1O39A 4O3TA 1O33A 7GCHG 4Y7AA 2VH0A 2BD2A 3SV9A 3SZEA 2IN2A 5JBBS 3E6PH 4FETA 1MD8A 2K0QA 1JXPA 1WTHD 1OXGA 4JZ1A 1AWFH 2AMQA 1W13U 1OOKB 1C1RA 2Y7XA 1QBNA 4AB9A 3VGCB 1G3BA 1HV7A 1ELTA 2WV4A 4JK5A 2ZU2A 5T3HA 3SV2H 4AORA 5L2ZH 5JB9S 4YLQH 3NKKA 1NS3A 4AFSA 2G00A 1V3XA 2BLQA 2SGQE 2NU4E 1Y3YA 4O3UA 1DXWA 2WINI 1O2JA 4IC5A 2KCAA 2G4UA 4WJG2 3GYMA 1GMCF 3A88A 4TSFD 2Z3CA 4FXGH 1NFUA 5A2MH 3S69A 4DIIH 1PFXC 1THSH 1W0YH 1HYLA 1JWTA 3MHWU 2FP7B 1FPCH 5A0BA 1TNJA 1C2GA 1HLTH 3QWCH 4Y79A 1O2MA 1O3GA 1TALA 2KCPA 2VWOA 3P70B 5CHAB 2VGCC 2G8TA 2F4LA 2BMGB 2TGDA 2LELA 4VGCB 3HKJB 5FHTA 1QB9A 2TPIZ 2OP9A 2FZZA 3AASA 1HPGA 4INLA 4AX9H 1O2VA 3LPRA 1P2JA 1QRXA 2RA0A 4KGAA 3W94A 5GNDA 1BTZA 4B2AA 2F9NA 1BDAA 1VCPA 5LPEA 4DJZB 2BHGA 2BZAA 4M7GA 7KMEH 4HFPB 4KTSA 5C1UA 3RC6A 1N8OC 3P92A 1LHGH 1GHVH 5I25A 1P09A 3F0PA 4ABHA 1NT1A 1EX3A 1FUJA 1DFPA 2PKSB 1A3BH 2BQ7B 2C8YB 1KY9A 2BD9A 2A4GA 4CR9A 4YXWD 3Q00A 1ETTH 1TPAE 2BXTH 2P59A 1DOJA 4BTTB 4IW4E 1EPTB 1SSXA 1P8VC 1GDNA 1K22H 5C1XA 3S0NA 1BQYA 1OWJA 3KQCA 3PWCA 4AN7A 4Y8ZA 1YLDA 4A92A 1EAUA 4CRDA 1O2NA 2XW9A 5DJ7A 1G32B 2HGTH 2A31A 1C2DA 1UMAH 3HKIB 3EQ0H 4YO9A 3GS9A 4GVUA 1G37A 1DY9A 5JBTA 3F2GA 1HGTH 1EXFA 2JETC 1F5LA 2V3OH 2AS9A 2ZDVH 4Q63A 4BOHA 1AHTH 1OWHA 2PHBA 3NRLA 3ZIAD 1ANEA 1C4U2 2QXIA 1HAYB 3E8LA 1D4PB 1TGBA 4JZEH 4DURA 1GPZA 2CV3A 3F2FA 2YMSB 2ZNKH 4MNWA 4X8UH 2QF0A 2Q6FA 2AFQB 3E90B 3A85A 2F9UA 2J9NA 1V2ST 4CREA 3VB5A 1F5RA 2F83A 4FUEA 2OD3B 1IQFA 1YPGH 1GBFA 4I8GA 1CHGA 3VXFH 4MVNA 3SI4H 1GMDF 1YCPM 4ASHA 1HJAC 3V13A 5F8ZA 3LH3A 2ZQ1A 1DWCH 4AGKA 4B6EA 1C5WB 3Q3XA 2QCYA 2KFWA 3A7TA 2QY0B 2KM0A 1L1GA 1GBDA 1W14U 5E0HA 1EZXC 1HIAB 1XUIA 5DN6D 1SLUB 2CF8H 1B0EA 4WXIA 2ZPQA 1KXFA 1HUTH 1GBIA 1JIMA 3U1JB 4Q80A 2WPJS 1NPMA 2IJD1 2ZFFH 2QF3A 1AE8H 1S82A 2ZFQH 4D76A 1ABJH 3AAVA 3GDUA 1A3EH 1C1NA 2W6JD 1TYNA 3BTGE 3OAAD 2F91A 2TRMA 1TOCB 2GGVB 1H8DH 1T8LA 3NUMA 3SNCA 3JZ1B 1GI1A 1GGDB 2EEKA 2VVUA 4GPGA 1DDJA 3GY8A 2QIQA 2CHAB 3M7UA 1SB1H 3STIA 1KXAA 2GCHF 3PV4A 1AKSA 2VINA 6GCHG 1NFWA 3Q76A 4X1SU 1T8MA 4BAHB 1E79D 1TRNA 3RXOA 3DD2H 1ZGIA 4AOQA 3KF2A 3DSOA 4AFUA 1P3EA 1TFXA 1P02A 2O9QA 2ZU3A 4MG3A 1TQ7B 2KCOA 3ZZ3A 1ZRKA 5F53A 1P06A 1O2HA 2WYGA 1KMHB 2BYAX 1WOFA 2K1QA 4U32A 3S9CA 2GVFA 2EA3A 1O2XA 2RG3A 3VEQB 1GWAA 4B2CA 1N6XA 3MI4A 1MTNC 3K65B 3T25A 2OK5A 1GHXH 3GCTG 1W8BH 3PWBA 3ZVFA 4ZHLU 3QTOH 1LQDB 1TB6H 1C9TA 4XE4A 4DVAU 2ZFSA 4CRAA 2J38A 2C4FH 1JBUH 3C1KA 2CN0H 4CR5A 2OC8A 5E2PA 1Y5BT 1L4ZA 1C5UA 1QRWA 1NC6A 1O31A 1Z1IA 4XBCA 1AUTC 2F9BH 1C2JA 1L1NA 3NCLA 4X6MA 1QURH 2ZU1A 2THFB 4K1SA 3T29A 3OFND 1OWEA 3SNEA 4ABBA 2A5IA 3AK5A 3SJKA 4AFZA 1KDQA 4FUBA 3WWBA 2Z6BD 3DSPA 2Z7FE 1IQGA 1CGJE 5DP4A 1DXPA 1H4WA 1YLCA 1F0SA 2UWPA 3GISB 2GMTB 3MYWA 9LPRA 4NFFA 3EA9A 1C4Y2 3UB0A 5C0TA 2XNIA 3RXTA 1O2QA 2AMDA 1PPEE 4INHA 1C1WH 3F9GA 3SGQE 4UONA 3ODDA 1QHRB 4OS6A 2DE9A 2BY7X 1ACBE 1T32A 1Y3WA 2W7UA 1NFXA 3RM2H 5DP5A 1SR5C 4ABFA 1ZJDA 5DO4H 1P10A 2VIQA 3UOPA 3KN2A 3EA8A 2A4OA 3ZVEA 2FTMA 1PQ8A 2ALPA 4WWYA 3RXRA 2JKHA 1FNIA 4GCHG 1UVSH 2Z3EA 4OS5A 2K8IA 2P93A 1C5QA 3TNTA 2BX4A 1GBAA 2AEIH 2J92A 1SGRE 2WPHS 3TPIZ 4DG4A 1V2LT 1OX1A 4B76A 4FUGA 1DWDH 1VR1H 3H7OA 1UJ1A 3SU0A 1K1MA 1TA2A 5A8ZA 3ZVDA 1AB9B 1C5YB 2BY9X 1RFNA 4J1YA 3FP7E 1HAGE 1O2SA 2ILNA 3LIWA 1IQJA 1PPHE 2OQUA 4WXVA 4XBBA 2ODQA 2WPIS 1NBME 5AHGH 4HTCH 1EATA 1ESBA 1LCYA 4BTUB 2XOKD 4I8JA 2G4TA 1YGCH 3BG4C 4AG1A 1PPFE 2AIPA 3N7OA 5B6LA 1O3NA 2FMJA 4H42U 3UNQA 1BMNH 1EOJA 2BVXH 2Q6GA 1IHSH 3OY6U 3BN9A 4THNH 4UD9H 1CA0C 2A7CA 3U98H 4OS4A 5IYTA 3UUZA 1P3CA 2A2XH 1YP9A 2VIWA 3D23A 3EDXB 3UY9A 1ELFA 5FPTA 2H9HA 1MU6B 2CMYA 3SU2A 1BT7A 1FPHH 1ZTJA 3WWFA 5AF9H 2BLVA 3EGKH 4ISIH 3PLBA 4AGJA 3QGJA 1AVXA 4JMYA 1TBZH 1ZTKA 3SYJA 2ZIQH 3D65E 1H8ED 5HGGA 1RTKA 3QUMP 1IAUA 3SV8A 2FOFA 3BTHE 1PQAA 5HM2A 4Y76A 7ESTE 3OSYA 1FAXA 1QTFA 4ISLA 1CT0E 4X2YA 1FI8A 1FN8A 3A82A 3TGKE 1BA8B 3E1XB 1BRCE 3SGAE 4D9QA 4RKJB 2VJ1A 1YKTA 3V12A 1MAYA 2WUCA 1HFDA 3A8DA 4DIHH 1CBWB 4B2BA 3A7ZA 1NROH 1VITF 4O9VA 4X6OA 1FQ3A 1ZHRA 3MU4A 3PO1B 5EQSA 1DSUA 2O8MA 1HAOH 4A1XA 2HWLB 1W0ZU 1GI9B 4M9FA 1D3QB 5TCAA 1SFIA 4DW2U 1SGNE 3MH7A 2V3HH 2F9OA 3FN8A 4ZXYH 3UNSA 4AG2A 3LGTA 1SKYE 1Y3VA 3TK5A 3U1IB 8GCHG 4Y7BA 2ZU5A 1UHBB 5EPNA 2GV7A 4IC6A 1GCTC 1QB1A 4OS1A 1EOLA 1JOUB 3GY6A 4X6NA 5EU8A 2AHME 4H6SB 4YESB 1TPOA 2ODYB 3U8OH 2SGAA 1GI3A 1PPZA 5PTPA 2M5TA 2HNTF 4BAMB 4UFEH 2BD7A 1C1PA 1XUHA 1RIWC 3VB4A 5C20A 1V2JT 2H1UA 3A8AA 2VVCA 2QV1A 1HJ9A 3A8CA 2ZCLP 5IK2D 2FYQA 1TMBH 1Z8RA 1ID5H 1RRKA 1UTMA 1NRNH 3VPKA 2Z9KA 1EKBB 2GV6A 4OGYA 1THPB 2ODPA 4JZFH 4AZ2B 2FYRA 1O3EA 1YF4A 1KDQB 4I8HA 1GVKB 2RCEA 3F1SB 3MNBA 1GBKA 1GCDA 3ATLA 4ISOA 3FANA 3M35A 4ASUD 2P3FH 1GHYH 2AERH 2BDBA 1Y59T 1MZAA 3U8RH 4JZIA 3KL6A 5HMAA 9ESTA 5GJ4B 1O5CB 1SHHB 1GVZA 2A7JA 5CDFE 1UTNA 1CSOE 3BTFE 2ZHQH 1RGQA 1GMHF 3E16B 2PKAA 5DPAA 1FY8E 1HAIH 2C8ZB 4MLFB 1UTKA 1YPJH 1BRUP 1NRPH 1ZPCA 1CHOF 1FDPA 2ZQ2A 1FX0B 4K1TA 3LGVA 1O2OA 2ZI2H 3D49H 1YM0A 3U8TH 1QR3E 1XMNB 1AQ7A 2OQ5A 1DITH 1P03A 3FZDA 1SGQE 3SN8A 3P17H 1TNKA 1A4WH 2KAIA 3L6PA 4F4OC 1T7CA 5HM9A 1GG6C 2NU2E 3TJNA 1QGFA 4WMDA 1O5DH 3IG6B 5F6MA 2GZ7A 2ANYA 4I33A 1G2LA 2OUAA 3DHKH 3SUEA 3RU4E 4IN2A 3SUDA 1LPZB 3UQVA 2ZHDA 1K1JA 1DX5M 3H5CB 3SU3A 4K2YA 4ZROA 5SGAE 1L0ZA 1EB1H 5GCHG 2SGPE 3LOXA 8LPRA 5EG4A 3P6ZB 5A0AE 2ZDMA 2FLRH 5EODA 4FU7A 1V2TT 1SI5H 1S6FA 1MBMA 2G5NA 1ELBA 1H1BA 1AZZA 1T31A 5CE1A 3N99A 2STAE 1N1LA 3PRBA 4K5ZA 1BTHH 2FODA 3RC5A 1P2QA 2B0FA 3GY2A 1V2OT 3RUOA 1HAXB 5C67A 1LHCH 1D9IA 1RTFB 1U6QA 2ZFPH 3BSQA 3F9EA 1P57B 4XBDA 4DOQA 2W3KA 2BQ6B 8ESTE 1VGCC 3C27B 3B9FH 4Y71A 4NIYA 2EI6A 4CRCA 3FAOA 1Z6JH 3SORA 5DP3A 1CA8B 3MOCA 3SW2B 4A7IB 1G3CA 4HI3A 1S5SA 1LQEA 1ZGVA 1AN1E 3SQHE 2A4RA 2HRVA 3LDXH 1O3LA 2V35A 2VWMA 2O8TA 1C1SA 1XUFA 1O3KA 1E1RD 1AFQC 1ELAA 2AMPA 2PFEA 4ZHAA 1C2FA 4CHAC 1LKBA 1OP2A 1VZQH 3S9AA 3RLWH 2GZ8A 4OS2A 4NIXA 1AFEH 2GTBA 1BBRE 1GHAF 4ZKOU 1ZHMA 4MNVA 2QN5T 1IQNA 4ZKRU 1E34B 1GJ5H 1BIOA 3O8BA 2GKVE 2OXSA 2ZZUH 1QFKH 3EE0B 2FI3E 4JZDH 1GI0A 1O3DA 4FUDA 4E05H 2EI8A 1C2IA 3D62A 4TWWA 1CT2E 1FONA 4R8TB 3BV9B 2ZGJA 2BY8X 1XX9A 1BMMH 2GCTC 3NK8A 4XD7D 1UTJA 1GMCG 2O8UA 1P2OA 3MNSA 1HB0B 2ZF0H 3RXLA 4B74A 1ZLRA 1EAXA 2WYJA 4D9RA 1AO5A 1SL3A 5FBEA 3BEIB 2TBSA 5K0HA 2ANMH 4ZKNU 2TGAA 1QCPA 3ZV9A 2ZGCA 1TNHA 3PTNA 3QTVH 5HYOA 1W12U 2ZEBA 3OTJE 3K9XB 2Z94A 3F3BA 3CS7A 1OKXA 1DWBH 2D1JA 1BMLA 3A7VA 3DFJA 3DFLA 3FZZA 5A09A 1HBTH 3GDSA 1D3TB 1J8AA 3GCHC 2XCNA 5EXNA 4CBOA 1L2EA 4BAQB 3O8RA 3QLPH 3CENA 3LGYA 3M5LA 1GJ9B 4OS7A 3OTPA 1DWEH 4Y10E 5C1YA 1MTWA 1O3OA 1DT2A 5GPIB 1QQUA 1SLXB 2TIOA 2ZTXA 3BG8A 1GJBB 1KYNA 4UFDH 4NSYA 3SQEE 3M7TA 3SU1A 6CHAC 1VITH 4FUFA 1UTPA 1DUEA 2Y6TA 1GI6A