3P8NA

Crystal structure of hcv ns3/ns4a protease complexed with bi 201335
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
182
structure length
182
Chain Sequence
APITAYSQQTRGLLGCIITSLTGRDKNQVDGEVQVLSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWPAPPGARSMTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGIFRAAVCTRGVAKAVDFIPVESMETTMRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HCV serine protease NS3
publication title Combined X-ray, NMR, and kinetic analyses reveal uncommon binding characteristics of the hepatitis C virus NS3-NS4A protease inhibitor BI 201335.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/hydrolase inhibitor
total genus 42
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3p8nA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3p8nA01
1GVZA 3LONA 2AEIH 1HB0B 1KIGH 1VCPA 2WHXA 1UTOA 2QXGA 4XSKU 2HRVA 2A4OA 1C5LH 2FOBA 1L4DA 5A8YA 8GCHG 1RGQA 2TPIZ 1BUIA 4ZKSU 2BD3A 1O31A 4Y0YE 4J1YA 1BMNH 2A0QB 5FPSA 1IQFA 2G55A 4ESTE 1C1WH 3MI4A 3V13A 1FIWA 1S0QA 4HFPB 5J4QA 4NA9H 2DE8A 4X6NA 4ZKRU 1BT7A 4AFQA 3ZZAA 1MH0A 3ZV8A 1K1IA 2GX4A 4BTIB 3K65B 3GCNA 1MKWH 3EAJA 3NWUA 1MZAA 3T29A 5JPMH 4U32A 1C4V2 1PPEE 1V2NT 1XX9A 2ZTYA 1WQSA 4IMQA 4WXVA 1QB1A 3KHVA 2V6NA 4IS5A 2GDEH 3DT0H 1N6XA 4Y6DA 4I8LA 4ABBA 2C90B 4AB9A 1QR3E 2AMQA 1TPAE 2XWBI 1E36B 1SGCA 3S9AA 4RKJB 1AVXA 1Y5BT 3TH3H 1J16A 2CJIA 1GMCF 1TBRH 1GHAF 1P8VC 3K6YA 2ZFSA 2BXTH 3P8GA 2ZNKH 4WMDA 3C27B 1BRCE 1TNKA 4NSYA 1UVPA 3TLOA 4U2WA 4YOJA 3MO3A 1FUJA 4BXSA 5I25A 2VWOA 3M5NA 1H9HE 1EZXC 1Z8IB 2H1UA 1VGCC 4A5TS 5FCRA 1FI8A 1GHYH 1EZQA 2FPZA 3EE0B 1THSH 2VIWA 4YM9A 1FNIA 4E7NA 1GBAA 1T8NA 2YNAA 3QGJA 1TX8A 2XYAA 3TGIE 1A0HB 1ORFA 1Z71A 4JZFH 4AGKA 4ZKNU 1C2MA 2BD2A 5EQQA 3SJKA 1Z1JA 4E7RG 2BD4A 4JZEH 1P05A 3IITA 3CS0A 2FS9A 2FI5E 1W13U 3HGNA 2Q6FA 1BIOA 4NWKA 2SGPE 2BLWA 1L4ZA 2BDCA 1OWDA 3QWCH 4HI3A 3F9GA 3BSQA 1UTKA 4CBNA 2VIVA 1N1LA 1L2EA 1UK3A 3TGJE 1BA8B 1GI1A 4MTBA 1LVYA 2KAIB 1TGSZ 1TX7A 1C5OH 1SFIA 1QHRB 5EPYA 4KTSA 1VCWA 3A8CA 3MNBA 3N7OA 4NG9H 4CH8B 2FMJA 1JIMA 5C3NA 1NTPA 1T8OA 2D8WA 5GXPA 3SU3A 2G52A 2ZDKA 4I8JA 9ESTA 3Q76A 2BVXH 2V3OH 2TGDA 1C1QA 4ZHLU 2V0BA 5C2ZA 3MO9A 2OBQA 1LVOA 1BMLA 3DUXH 5I46H 2ASUB 4FUJA 4THNH 3RC6A 1HAPH 2VWMA 1O39A 2GTBA 4I32A 4OS2A 1FMGA 3TGKE 2VNTA 1TA2A 1HGTH 5FXLA 3AASA 1EJMA 4MQAA 4BNRA 1C1NA 2FOFA 3SGAE 3SOSA 3M7TA 3BG8A 4X6PA 1B0FA 2GMTC 1N6YA 4O03A 2BDIA 2IOTA 4BTUB 7GCHF 5HMAA 1AE5A 1V2ST 2A1DB 2ILNA 1GVLA 1QQ4A 3R0FA 1L1JA 2FESH 4E06H 2ZDMA 1ELBA 3VXFH 1C5WB 4MVNA 1GJ4H 1HLTH 1V3XA 3FVFB 4FVDA 1AY6H 2QAAA 1C2GA 3SU5A 4JZDH 1QJ7B 1K1OA 1XVOA 2C4FH 2V3HH 3A7TA 1O3PB 1O34A 1QL8A 2SGEE 4I8HA 3UNQA 4J2YB 1CHGA 1ELCA 2RA3A 2Y5HA 1F5RA 1O36A 1TB6H 1DXWA 3SU2A 2HGTH 3KCGH 1WOFA 3AW1A 4B76A 1CO7E 3TJOA 4GSOA 3OTPA 1O32A 3LGYA 5DP6A 1GMCG 1PPGE 1AVGH 3A7YA 4FUCA 1GHAG 1SGYE 4Y8XA 1KDQB 2YOLA 3MH7A 2BVRH 4FUDA 4UFEH 2BB4A 4YOGA 1MBQA 4O3TA 1O3CA 1S85A 1ZPCA 4MPWA 1IQLA 3VGCC 1B7XB 4BAHB 1O5EH 4DW2U 1PQ5A 1SGQE 1AGJA 1DVAH 5LH8A 3TJUA 1PPBH 2CMYA 4CRDA 5F8TA 3U98H 1YPEH 1RIWC 3BIVH 4Y8YA 1GI9B 3T2NA 2Z9IA 3TITA 2XBYA 1PQAA 3RMLH 3ZZ8A 2VH0A 4IMZA 1V2WT 2OC0A 3ODFA 2SGFE 2ZHWH 4CRAA 1SGTA 3ZVCA 2C8WB 5EXLA 1GI2A 4FUGA 4BAOB 3ELAH 6ESTA 3ZZ5A 2D1JA 2TRMA 1ESAA 2XC5A 2OTVA 3DD2H 4K5ZA 4KKDA 1TABE 2J92A 2ODQA 1HXEH 4B2CA 2QYIA 1W12U 3O8BA 4X1RU 3TH2H 1FPCH 3RM2H 1QBNA 1W11U 1OX1A 3RXTA 5GPIB 3SQHE 3MYWA 4A1TA 3PMAB 1YKTA 1DWBH 1P12E 2ZFRH 1F0SA 1V2TT 1PPZA 3RXCA 1FY4A 1TMTH 1ZZZA 1B0EA 2TGTA 5IDKA 3I78A 1FIZA 2QCYA 3EA9A 1G3BA 4MNYA 4SGAE 2Z9KA 1P2JA 1KXCA 5JYIA 4FU9A 1JXPA 1P0SH 1NN6A 2PUQH 1O2GH 1EAUA 1Z7KA 2A45B 1XUFA 3QO6A 1DXPA 2PFEA 2GCHF 2Z3CA 3MOCA 1BJUA 2GD4B 2XCNA 1BQYA 3A81A 4GHTA 1S5SA 1UVSH 1LVMA 1EATA 1KXDA 4B74A 4ABFA 2BDAA 1EZSC 3LIWA 2BDGA 2VWNA 1Q2WA 4MNVA 1PFXC 5DP3A 3S0NA 3RXVA 7GCHG 2CF9H 1EPTB 4KTUA 4XOJA 1FQ3A 5T6DA 1RD3B 4CR5A 1GL1A 2FTLE 1O3LA 2R3UA 3A82A 3H09A 1F2SE 1CA8B 3HGPA 1C1OA 3HK6B 4NCYA 4M9FA 1DANH 3M3SA 4OS7A 4A7IB 1OWIA 2FOAA 1SL3A 1UVUH 1KXEA 4ZROA 3MFJA 1QCPA 2QIQA 3ATMA 3RUOA 3M5MA 5H4IB 2BZ6H 5GWZA 1YYY1 3LGUA 4FUIA 2WPKS 2F83A 2WINI 1TMBH 3KIDU 1QA0A 2ZPSA 2GT7A 4NSVA 5L6NH 4MPUA 4XFQA 4UFFH 1VGCB 4TY7A 3PWCA 3GDSA 4XBBA 5E8EH 3ZVFA 1GDNA 1MQ5A 2PR3A 3PWBA 3WY8A 1G3CA 2ZGBH 2Z94A 3ZZDA 1O3EA 4ABEA 1KXBA 4K8YA 1O2RA 1TOMH 4GUXA 3VFEA 1O2HA 1Z8RA 3UQVA 2ZQ2A 3G01A 2QN5T 4CH2B 4GAWA 2ZTXA 1MTNC 1QJ1B 1QY6A 2CV3A 1FZZA 1SLVB 3SW2B 1HYLA 3SU1A 3F1SB 3RXFA 2A7JA 3A87A 1O33A 5DP4A 1GI3A 1V2UT 1KTTB 2ZU5A 1FONA 1CT4E 5GIBA 3OSYA 1G32B 3U1JB 2ANYA 1C5QA 5CE1A 3LC3A 3P8FA 1ANEA 1GBMA 3ZZ6A 4RN6A 2H9EH 4X2WA 5HM2A 2W7UA 2AERH 4A1VA 1O3DA 1QA7A 1ACBE 3MU0A 4K1EA 1O2XA 3AW0A 1EB2A 3BG4B 1P9SA 3QDZB 6CHAB 3BN9A 1ETRH 4UONA 1C1MA 3BTTE 1QTFA 1SQOA 1ZTKA 4IGDA 3SHAH 2BOKA 4NIXA 5TCCA 1P2MA 5F8XA 1GDQA 3KEEA 3ZVAA 3CP7A 1SQAA 2FZZA 1U6QA 1JOUB 4AN7A 4B2AA 3TJNA 4ISHH 1HFDA 2FOMB 2ZU3A 4DOQA 4YZUA 3ZVBA 1C4U2 3GY8A 4INLA 1TFXA 1XXFA 3I77A 1T4VH 3QTOH 4IW4E 4K2YA 1TIOA 2TBSA 4B2BA 2P3UB 1TRYA 1CVWH 2QV1A 1A4WH 1TPSA 1GHBG 1SLUB 3M7QA 2C8XB 1GBLA 1LDTT 2PV9B 4X8UH 1FN8A 3M3VA 4BAKB 1FAKH 3RXJA 3E3TA 4WH6A 4K1TA 1G36A 2ZZUH 4Y10E 1C5MD 3RDZA 1UVOA 3UNRA 1K1MA 4IC6A 2GCHG 1ABIH 4MNWA 1DPOA 2VJ1A 4ABHA 4NWLA 2W3KA 3LT3A 2J38A 1WUNH 2AFQB 5FX6A 1SMFE 1WCZA 3Q77A 2UUFB 1L0ZA 2ZDVH 3CENA 1H9LB 3LPRA 1LTOA 3SNEA 2Z7FE 1F7ZA 2A7HA 4AFSA 3ZVGA 4X1SU 1DLEA 1Y3VA 2A2XH 1INCA 1KLJH 2ZU1A 1ID5H 2PTCE 1S6FA 1SOZA 2G51A 4ZXXH 1M9UA 3P17H 2O8MA 2H5CA 1OS8A 1KYNA 2P94A 3GY4A 4KELA 3KQCA 3OU0A 3FFGA 1PPCE 2FM2A 2QXHA 1G3EA 1OSSA 1GBDA 1QIXB 2Z9JA 2ZIQH 3D23A 3ENSB 1UVTH 1PPFE 4AYYB 3RMOH 1EP5A 1ZRKA 2AIPA 5L2YH 1HXFH 1GJ7B 2OLGA 3SV9A 2GKVE 3M61U 1O3HA 1GHWH 1YC0A 1P57B 2UUJB 1RTFB 4AYVB 1A5HA 1C2IA 1GCTC 3GY3A 5LPEA 3PV4A 3BTEE 3A8BA 1S0RA 4NZLA 1L1GA 3A84A 4BXWA 1H4WA 1MAXA 3LGTA 3F9HA 5EQRA 3V12A 1EZUC 4ISLA 2Z9LA 3ZVEA 2Q1JA 1AO5A 4FU7A 3SUDA 4A6LA 3MNXA 1F0TA 1O5DH 2SGQE 1T8LA 2G5NA 4X1NU 3BEFB 1A7SA 2ANKH 1WXRA 2VU8E 1OKXA 2ESTE 4ZUHA 1LHFH 1P3EA 1S82A 4WXIA 1D6RA 3MH5A 3A7XA 1TNGA 1FJSA 5DP9A 3SNAA 2PW8H 1HAHH 1YP9A 2UWOA 3RXIA 2SNWA 3RU4T 2A2QH 5A0CA 2BY8X 4AGJA 4GCHF 2O9QA 1XXDA 4D76A 3RC4A 1P10A 1SG8B 2A5AA 3LGVA 4X2XA 3A83A 1GG6C 4UFDH 2GP9B 2C93B 1ARBA 1RXPA 1UHBA 3GY6A 4KGAA 1MKXK 1BHXB 3TH4H 1GBIA 2VVUA 3I29A 4Z6AH 2BLQA 1HBTH 1HJAC 4ZHMU 2A5KA 1O2VA 1NRNH 1QBVH 1EPTC 3FP6E 4BAQB 4TPYA 3SJIA 5F8ZA 1O2UA 4H6TA 1DITH 2PSYA 3QK1A 1Z1IA 1ELGA 3B23B 4AFZA 2VIQA 4Y76A 1P06A 2K1QA 1A61H 2RDLA 3U9AH 2BD9A 1GI4A 2B5TB 4B6EA 1BTPA 1BTZA 1DX5M 1HAZB 1H8IH 4ABIA 4JK6A 3ZV9A 1TOCB 3D62A 1O3FA 2HOBA 1GMHF 4RKOB 4Q2KA 2BD8A 5J4SA 1BOQA 3PLBA 4XBDA 3U69H 1HIAB 4GLYA 2OC7A 2BX4A 1AZZA 1EOJA 5EXNA 3GCTF 1O3IA 1BHXF 2PWXA 3MTYA 3NZIA 1C2FA 2XBXA 5GJ4B 3A88A 2ZCKP 1XM1A 1O3MA 1K28D 4U30A 2ZF0H 2FOCA 4I7YH 1G37A 3KN2A 3U8TH 2FLBH 3E0PB 3PV2A 3UOUA 2G8TA 1HJ8A 1SGDE 4AOQA 3SUFA 3TU7H 4YT7H 3GICB 1ZHPA 1LQDB 1MTNB 5HYOA 3GCHC 3VPKA 4YESB 3RXRA 1OP8A 3W95A 1TPOA 5C5NA 3HATH 1P3CA 2WUBA 3QN7A 1AWHB 2B8OH 1EKBB 4CRFA 2ZDLA 3M5OA 2Y5FA 1TWXB 1FPHH 1LO6A 5CHAB 1D3DB 3BG4C 2NU1E 6CHAC 1AI8H 1SGIB 4ZXYH 2OBOA 2QY0B 3RXHA 1A2CH 1QNJA 5BPEA 1JIRA 4ZHAA 3MU1A 1NFWA 4XDEA 1VR1H 4F4OC 2Y82A 3NUMA 3LGIA 1C5TA 4D9QA 1NROH 3SU6A 1F0UA 2SGDE 1P2IA 1GBTA 1UK2A 2OD3B 5EU8A 1SLWB 2WPLS 1EP6A 1BRAA 3STJA 1YPHC 1V2JT 2PLXA 4DY7B 2SGAA 1O2NA 4B6FA 1ELTA 3PTBA 3DFJA 3PMBB 1FN6A 2G4TA 3T27A 1K22H 1GBCA 1HIAA 1P01A 1UO6A 3UTUH 1O3BA 1AQ7A 1YCPM 1TGBA 4GCHG 2FI3E 2FXRA 4LK4A 1L1NA 3UPEA 3D65E 4LOYH 5JDUB 4RSPA 3ATKA 1IQMA 2ZGHA 5FPTA 3D49H 3ITIA 1N8OC 1OWHA 1XUIA 1C2EA 3F6UH 2J4IA 1XUJA 2Z9GA 3BF6H 3P6ZB 1TGTA 1UCYH 2NWNA 2XXLA 3Q00A 3VB6A 2W3IA 1C5SA 3E90B 2GZ9A 3PTNA 1DSTA 1UK4A 1TE0A 1ETSH 2J95A 2ZI2H 2BLOA 3SJ9A 2OUAA 2QA9E 1VCQA 2ZHEH 1XVMA 1LPKB 5IYTA 3BTQE 1GBHA 1MBMA 4LZ1H 1W7XH 2KAIA 4I8GA 5EODA 4IN2A 1THRH 2P3FH 4JYVH 5E2PA 2I6SA 1CGIE 2J34A 4DIHH 2GCTC 1O35A 1Z8JB 1SFQB 1ZR0A 2JETB 1NRQH 3RXPA 1O2SA 1H1BA 3T62A 1GMHG 2W26A 1HJ9A 1DY8A 3TK9A 1DICA 3S9CA 4Y0ZE 2H6MA 1O30A 1DFPA 1O3GA 3KQDA 1KY9A 5DP7A 3SJOA 3STIA 3GCTG 4ZAEA 4X8TH 3RXQA 1A3EH 5G4BA 3SZNA 4XE4A 2XWAA 2BOHB 1E34B 3BTFE 4JMYA 2FOHA 3FZDA 2R0KA 1W10U 1YGCH 1GI5A 3SV8A 1GCTB 1TNIA 1YPKH 4K3JA 1CBWB 1C5NH 5FBIA 1OYTH 1TPPA 1QRXA 1IHSH 4AZ2B 3PLPA 4QT8C 3RXKA 1CE5A 1DWDH 4DGJA 1MKXH 7ESTE 5EW1H 3QX5H 1JBUH 1Y5UT 2OINA 3A8AA 4UFGH 3PV5A 1C1RA 1IQJA 5ETXA 1SGFA 5E2OA 1UTMA 3KL6A 3TNSA 3A8DA 2P3TB 1ESTA 3VEQB 4K8BA 3SUEA 1ZMLA 1LHCH 1NESE 1E35B 1O2KA 1C5UA 2GDDA 1AFEH 4YLUA 3UFAA 4B71A 4U01A 5A2MH 3BEUA 1BB0B 3A85A 1MTVA 1TBZH 2ZPRA 1Z6JH 1X7AC 4JYUH 1HAVB 2ZHQH 4X6OA 4DT7B 3FANA 1O2OA 3A7WA 2R0LA 1F92A 3BTHE 1Z8GA 1V2KT 5C20A 3MH4A 1Y3XA 1AU8A 2H9HA 1GG6B 2QXIA 5E0GA 1GJCB 1V2VT 2RA0A 1KDQA 3P70B 1SGEE 1D3PB 3PROA 3LKWA 1AVWA 1WV7H 3GDUA 1C9PA 1J15A 2BMGB 5JB8S 5FBEA 4TWYA 3S7HB 1CT2E 1HJAB 2FEQH 2QC2A 3KQEA 1BBRK 2BD7A 2AMPA 1FY5A 3RLWH 2Q6DA 2J94A 1SSXA 3R3GB 4I31A 3B9FH 4X1QU 1KXFA 1AB9B 3L3TA 3SV7A 1UCYE 1JMOH 3RU4E 4JZIA 2XRCA 2F9VA 3L6PA 2VVVA 2WZQA 1P11E 3V7TA 1RTLA 2ULLA 2WYGA 4OS4A 5FX5A 3PM3A 1GJ8B 3ODDA 3EGKH 2CF8H 3ZZCA 2YNBA 4O3UA 1V2LT 1GBKA 2VIPA 4Y71A 3SGBE 3QZRA 2VIOA 1QRZA 4X2YA 4CRCA 1IQNA 3RC5A 3K2UA 1IQGA 2BX3A 4KP0A 4GHQA 3MNCA 1G2LA 2H5DA 1GJ6A 3EA7A 3TVJB 1BTYA 1YLDA 3PLKA 1SPJA 4UD9H 3AAUA 1G30B 1O2QA 1CGJE 3H5CB 2W7SA 1CA0C 1TONA 2F3CE 3OTJE 2EC9H 4ABAA 1BTHH 3SZEA 1OOKB 2OP9A 1FV9A 1C9TA 1Y3WA 1B5GH 2ALPA 1A46H 3SO3A 2VIDA 3GCHB 1HAVA 1C5XB 2BXUH 1W8BH 4LZ4B 1TX6A 1BZXE 2EA3A 3BTWE 3PMJA 1GI7B 1UTJA 2FDAA 1D6WA 2WPIS 2BY6X 1D3TB 1EJAA 1O5BB 4X2VA 2G4UA 4AX9H 5JBAS 1OWJA 3OY5U 2EI6A 2VWLA 1CHOF 1MU6B 5CHAC 3TIUA 1ELEE 1MZDA 2HPQH 2VH6A 2O8UA 2ZDNA 4CHAB 1O3KA 1VJAU 1TA6A 5AF9H 1W2KH 1EPTA 3LH3A 2LPRA 3RLYH 2PHBA 2B9LA 3H7OA 5EOKA 4ISIH 3A89A 1GI0A 3SORA 2ZDAH 1XUKA 1YPJH 5T1VA 1TMUH 4OS5A 1LHDH 1EJNA 3V3MA 4D9RA 1OYQA 3UREA 2A32A 4Z0KA 1OP2A 2XW9A 1MU8B 1HRTH 4E05H 2D2DA 3JZ1B 3HK3B 1BMMH 1BTWA 1XUHA 1O2YA 1F5KU 1NZQH 2Y7ZA 5DPAA 1HAYB 4INHA 1ZPBA 4ISOA 1WBGB 1XMNB 3S7KB 3F9EA 3UR9A 2QF0A 3FP7E 1NFUA 2GT8A 2VB0A 3QZQA 1AFQB 1A1RA 1S83A 2ZGJA 1LKAA 1VITH 2H2ZA 2PKSC 1C1SA 3O8DA 2FX6A 2XCFA 3UQOA 1LHEH 1N8OB 3GY2A 2P8OC 2FYRA 2JH0D 1IQEA 1GJ9B 1OXGA 4ASHA 3ESTA 4NA7A 1C2LA 4ABJA 1C4Y2 4MPVA 3HPTB 3QTVH 3K6ZA 2BD5A 4WVPE 3GOVB 5FPYA 4D7FA 3FAOA 5LPRA 9LPRA 4RI0A 3RXDA 3SNCA 3TPIZ 1YPHE 4SGBE 1ZGIA 6LPRA 3M35A 3VB7A 1HDTH 4IN1A 1T31A 2P59A 5E0HA 3QGNB 1QQUA 3LOXA 1TQ0B 2PSXA 1NO9H 2I6QA 1AUTC 5EW2H 2JETC 4VGCC 2OC8A 3MO6A 3BV9B 1ZJKA 2GCTB 5C1UA 1AN1E 1LKBA 2ZU2A 2STAE 3ATIA 3SI3H 1T8MA 4ZH8A 2WPHS 5ESBA 4Y7BA 3HKIB 3TK6A 1BMAA 3ZZBA 3H7TA 2Q6GA 1GDUA 1PYTD 3EQ0H 1NU9A 3TJVA 1QRWA 3T25A 1ZLRA 8KME2 2XNIA 1UCYK 1NM6A 1YF4A 2ZG0H 4INKA 2TGPZ 2FIRH 1FXYA 1IAUA 2AGGX 1DY9A 1JRSA 3L33A 2A31A 3HKJB 2P16A 5JBBS 1CBWC 4MLFB 3UIRA 4Q7XA 3RXBA 1CT0E 4CRBA 2G81E 2XTTB 1CSOE 4NA8A 4FUBA 2FOGA 3MU5A 1AE8H 4OS1A 3GDVA 1GPZA 2BHGA 3MH6A 4OS6A 1PQ7A 1MD8A 4HZHA 5TJXA 2PTNA 1SR5C 3DA9B 1DWCH 2NU2E 1BBRH 1ANCA 4CR9A 1UMAH 1EXFA 1QL7A 2WPMS 1OWEA 2FOEA 3P8OA 1NRRH 4ABDA 3UNSA 1C5ZB 1NU7B 2FP7B 2UWLA 1CHOG 2EI8A 3BTGE 2STBE 2VGCC 3IG6B 2XC4A 3TK5A 2BDBA 5C5OA 1EAWA 1PJPA 3LU9B 1SGRE 4DURA 2ZFQH 1QGFA 1K21H 1C2KA 1NFYA 1ELDE 1T32A 5L30H 2Y80A 1O2TA 1C1PA 1ABJH 4DG4A 5B6LA 3RXUA 2GVFA 3SBKA 1V2QT 1AKSB 4FVBA 4WWYA 3LH1A 1O37A 1A0LA 2F9OA 3NK8A 1XKBC 2BLVA 2FS8A 2ZTZA 1TRNA 2M5TA 1TALA 2ZFTA 5LPFA 2ZFFH 1HAGE 4AORA 2CN0H 2ANMH 2Y81A 3A80A 2BDYA 4A92A 5PTPA 3F68H 1GJAB 1LPZB 4B73A 1GJBB 2EI7A 2UWPA 1NRPH 1V6DA 1VITF 1DDJA 2BM2A 1GWAA 1SHYA 2OK5A 2C3SA 1TGNA 4Q80A 5A09A 1K1JA 5C67A 1AB9C 4Y11E 3LC5A 2FWWA 1SGNE 1MTWA 3DHKH 3PMHB 1O2ZA 1J14A 2OQUA 3IWMA 5HXFA 4CRGA 4FU8A 4I33A 2XC0A 3RXOA 1GVKB 1SB1H 3KQBA 3CS7A 3EA8A 3FZZA 2BDHA 2BZAA 2IN2A 4WY3A 3P92A 5EQSA 2G00A 3ATWA 1NY22 4NGAH 1WQVH 4NIVA 2ZECA 1NFXA 2RCEA 5AFYH 1Z6EA 3SJ8A 4TPIZ 1ZJDA 3E16B 1BRBE 1JRTA 4BOHA 2D26C 1PPHE 3MHWU 1SC8U 2C8YB 1O5GH 4D7GA 5A0BA 2ZU4A 1EAXA 5A8ZA 2CGAA 2W5EA 1CA0B 3E6PH 3V0XA 1GCDA 2CXVA 4UDWH 3MU8A 3MWIU 2RG3A 5K0HA 4DVAU 1NC6A 1AKSA 2ZGXH 3SQEE 1ZRBA 4Q7ZA 4YTAA 4FUEA 5DK1A 5F03A 1TRMA 2XBVA 1SQTA 2F91A 3A7VA 2FI4E 1D4PB 1DUAA 1EASA 4ABGA 4UE7H 3B8JA 3GYMA 1S84A 2UUYA 1ANDA 2WUCA 5GCHF 2OC1A 4DJZB 4CHAC 1SVPA 1GBJA 5DKMA 4MPXA 1PQ8A 4AG2A 1HAIH 3VB3A 4BANB 1TNLA 2A5IA 1YLCA 2GV6A 4MNXA 1WU1A 3BTDE 1ZPZA 1BJVA 4NIWA 2WV4A 1AHTH 1BBRE 1MTUA 3RXEA 5BRRE 1DOJA 5DO4H 1NRSH 3UWIA 2AGEX 5FCKA 3P8NA 4K69A 1P02A 3QLPH 1FAXA 5DJ7A 1ARCA 4ISNA 3BIUH 1C1TA 3AAVA 2VBCA 1DM4B 1ZHRA 4H4FA 4Y79A 4HTCH 3SHCH 2F9PA 3RXAA 3KF2A 1PYTC 2BQ6B 3RXMA 1W0YH 1YPGH 1RJXB 3NKKA 4H6SB 2ZGCA 1CU1A 2UUKB 4WF8A 1Y3YA 1AFQC 1WSSH 1NS3A 1S81A 2AIQA 1ANBA 2Y6TA 1O3NA 1SGPE 2PKSB 5EG4A 5JB9S 1RS0A 3E8LA 1FDPA 2P8OB 1G3DA 2R2MB 3SI4H 4Q7YA 3PO1B 3BTKE 4H42U 2A4QA 3URCA 1MQ6A 4YLQH 2R9PA 4Y7AA 1E38B 2A7CA 1AWFH 1NPMA 2PKAB 1HPGA 2PGQB 2R2WU 4X6MA 2BYAX 1P2KA 4IBLH 5GNDA 4D8NA 2Y5GA 1K2I1 1O38A 1VITG 2THFB 2ZHDA 5T3HA 4AFUA 1EQ9A 1QJ6B 2TGAA 4B1TA 2PGBB 1G2MA 3MNSA 1A5IA 1QB6A 2JH6D 2VVCA 2ZFPH 3QUMP 2B7DH 1HNEE 1ESBA 2EEKA 4VGCB 3ZZ7A 6GCHF 2XBWA 3OYPA 3RXLA 3U8RH 3O8RA 1QBOA 7LPRA 5DP5A 2GGVB 3RMMH 4X1PU 2HNTC 5C1XA 3EYDA 5C1YA 3SN8A 1RFNA 3VB4A 2HWLB 4NFEA 4YT6H 4YO9A 3RMNH 3LJOA 1KLTA 1C5VA 1P2OA 3DFLA 3SYJA 3ZVDA 3SV2H 4TY6A 1DS2E 3W94A 2ZPQA 1ZMNA 3ZZ9A 1Y8TA 3SUGA 1HAOH 5GDSH 2ZKSA 2FX4A 1E37B 2ZHFH 2DUCA 1JWTA 2BY5X 1BDAA 1VZQH 3RM0H 3SGQE 1J17T 1P04A 1E0FD 3UR6A 1DSUA 5JBTA 2IPHA 5FAHA 1GGDB 4AG1A 3AVZA 1OP0A 1MTSA 3GYLB 3P95A 1EX3A 1MCTA 2BTCE 4NFFA 3RP2A 3E1XB 1QL9A 1UJ1A 1K1PA 4B75A 1RRKA 1Y5AT 1V2MT 4WMEA 5E0JA 4UEHH 4FUFA 2NU3E 3Q3YA 1FY3A 2FLRH 1VJ9U 2WV9A 5GCHG 1O2LA 2FYQA 2R3YA 2PKAA 2VGCB 4IC5A 4K60A 5DG6A 4PROA 2OCVB 1TNHA 1C5PA 3JZ2B 2WV5A 2CHAC 2J9NA 3M7UA 2ODPA 1GMDF 1P2NA 1LVBA 2FTMA 4CBOA 5AFZH 1KSNA 1Q3XA 2FO9A 4Y8ZA 1UTPA 2DE9A 1YPLH 1GL0E 1GJDB 1RTKA 1HV7A 4F49A 1GHVH 5EXMA 1P2QA 1A5GH 1EOLA 1GHBF 1YPMH 1YCPK 1ELFA 1O2MA 3UY9A 1H8DH 1Y59T 2Z3EA 2QF3A 1P09A 2AH4X 3SU4A 4O97A 2F4LA 1OWKA 3VXEH 1OPHB 1C5YB 1O2JA 5F6MA 1O2WA 1DWEH 1THPB 3E91A 3SV6A 1ETTH 1IQIA 4OGYA 2BQWB 1WAYB 1C1VH 1O5AB 3OY6U 2PUXB 1KLIH 1D9IA 5DP8A 1O5FH 1ZOMA 4X8VH 2JKHA 2OXSA 4ZMAH 2AS9A 4XBCA 5K7RA 1V2RT 4OM9A 4WJG2 1BITA 1LHGH 3KNXA 1IQHA 1O3JA 3LJJA 1ZSLA 4GVUA 1ZSJA 1TYNA 1MD7A 1MAYA 2OQ5A 6GCHG 5EGMA 4TYDA 5A0AE 5LGOA 1ELAA 3RU4D 1SGFG 3URDA 5ABWA 2O8TA 1WTGH 4YOIA 2Z3DA 5SGAE 1MKWK 1BCUH 1SBWA 2O8LA 3T5FH 1EAIA 4TWWA 3O8CA 4KTCA 2J2UA 3KGPA 1G9IE 1O3AA 2Y7XA 3ZZ3A 1EB1H 4LXBH 8LPRA 1W3CA 4HGCA 1LMWB 1A3BH 1GBEA 1HCGA 3GCOA 1O2PA 3GY5A 1A0JA 1BTUA 1BTXA 1MCVA 3GISB 2WPJS 1SLXB 4NIYA 2ZP0H 3S9BA 4AB8A 4FUHA 3EDXB 4K1SA 5T6GA 4BAMB 1ZHMA 3K9XB 3SU0A 1K1NA 1MMJN 2ALVA 5CMXH 1IHTH 1GJ5H 1LQEA 1Q31A 2BVSH 1ZSKA 2WYJA 1ZTJA 4JCNA 1ZTLA 1P03A 1W14U 2F9UA 1XKAC 2C8ZB 3SNBA 4WMFA 2SNVA 1HAXB 1SOTA 1J8AA 1Y3UA 3S69A 2Z6BD 3T26A 1W0ZU 2ZO3H 2AGIX 5DGJA 3BTME 2JH5D 4NZQA 8GCHF 4DIIH 1AUJA 2HVXA 2AYWA 4JYTA 3ZYEA 1GBBA 1C1UH 5JBCS 1T4UH 1O5CB 1J9CH 4GPGA 2G5VA 4O9VA 2LNCA 1FY8E 4DCDA 1W7GH 2ODYB 1GMDG 2A4RA 1D3QB 1O3OA 1QB9A 2P95A 2HLCA 1QFKH 2NU4E 1IQKA 1GI8B 1DT2A 1O0DH 1ZMJA 3NPSA 1TGCA 3PO1C 2NU0E 1FLEE 2F9BH 2GMTB 5HGGA 1GI6A 3FP8E 1TNJA 3C1KA 1UTNA 1K1LA 2FODA 1F0RA 3AK5A 3A86A 2V35A 1LCYA 1ELVA 4A1XA 3NCLA 1GBFA 2ZCLP 2QXJA 2B0FA 2TIOA 1CGHA 3Q3KA 1DUEA 1DLKB 1TBQH 3M36A 2BQ7B 5AVDA 1S6HA 1TAWA 1O2IA 1UTLM 3LDXH 4M7GA 3OX7U 1YBWA 3F9FA 1AIXH 1KTSB 1AMHA 1GHZA 2HALA 2O8WA 2GZ7A 4FXGH 3M5LA 2F9NA 4R0IA 3M37A 1C2JA 4JZ1A 1SI5H 2ZA5A 1F5LA 1C5RA 1FY1A 3MMGA 2ZC9H 3PB1E 1V2PT 4I8KA 2SFAA 1XUGA 2ZQ1A 3U8OH 1CQQA 3LGWA 1TQ7B 8ESTE 1UHBB 5A8XA 4R8TB 1WTHD 5HM9A 3UWJH 2ZWLH 1AZ8A 1BRUP 1NT1A 3GY7A 3ZYDA 2IJD1 4WH8A 1EUFA 5L2ZH 5AHGH 3MU4A 3VGCB 3ATLA 1ZYOA 2GZ8A 2HPPH 1GGDC 1K9OE 5FHTA 5TCAA 5ESTE 1TLDA 3RXSA 4CREA 3ZZ4A 1C2DA 3Q3XA 1ZGVA 1YCPH 5T6FA 4OGXA 3SNDA 2GV7A 2BY9X 1RIWB 1SHHB 2BY7X 3RXGA 2P93A 3BEIB 4BTTB 3TNTA 2HNTE 2HNTF 2AMDA 1IOEA 3M3TA 3A7ZA 2ZCHP 2H9TH 4MDSA 4JK5A 1HUTH 3VB5A 1UTQA 1WYKA 1YM0A 2ANWA 3E0NB 1MUEB 3UOPA 1AD8H 1LPGB 1V2OT 4ZKOU 3UUZA 1GHXH 4X8SH 1KXAA 1QURH 5EPNA 2IJOB 7KMEH 2CHAB 4X0WU 2QGRA 3PYHA 2A4GA 4MG3A 3U1IB 1C2HA 2ZEBA 3NXPA 1T7CA 1DE7H 5B6OA 1H9IE 1P9UA 3T28A 2VINA
chains in the Genus database with same CATH superfamily
1GVZA 3LONA 2AEIH 1HB0B 1KIGH 1VCPA 2WHXA 1UTOA 2QXGA 4XSKU 2HRVA 2A4OA 1C5LH 2FOBA 1L4DA 5A8YA 8GCHG 1RGQA 2TPIZ 1BUIA 4ZKSU 2BD3A 1O31A 4Y0YE 4J1YA 5HKKD 1BMNH 2A0QB 5FPSA 1IQFA 2G55A 4ESTE 1C1WH 3F2HA 3MI4A 3V13A 1FIWA 5C17A 1S0QA 4HFPB 5J4QA 4NA9H 2DE8A 4X6NA 4ZKRU 1BT7A 4AFQA 3ZZAA 1MH0A 3ZV8A 1K1IA 2GX4A 4BTIB 3K65B 3GCNA 1MKWH 3OEED 3EAJA 3NWUA 3KQ5A 1MZAA 3T29A 5JPMH 4U32A 1C4V2 2J97A 1PPEE 1V2NT 1XX9A 2ZTYA 1WQSA 4IMQA 4WXVA 1QB1A 3KHVA 2V6NA 4IS5A 2GDEH 3DT0H 1N6XA 4Y6DA 2RDEA 4I8LA 4ABBA 2C90B 4AB9A 1QR3E 2AMQA 1TPAE 2XWBI 1E36B 1SGCA 3S9AA 4RKJB 1AVXA 1Y5BT 3TH3H 1J16A 2CJIA 1GMCF 1TBRH 1GHAF 1P8VC 3K6YA 2ZFSA 2BXTH 3P8GA 2ZNKH 4WMDA 3C27B 1BRCE 1TNKA 4NSYA 1UVPA 3TLOA 4U2WA 4YOJA 3MO3A 1FUJA 4BXSA 5I25A 2QF4A 2VWOA 3M5NA 1H9HE 3FKSD 1EZXC 1Z8IB 2H1UA 1VGCC 4A5TS 5FCRA 1FI8A 1GHYH 5EJ1A 1EZQA 4P00A 2FPZA 3EE0B 1THSH 2VIWA 4YM9A 1FNIA 4E7NA 1GBAA 1T8NA 2YNAA 3QGJA 1TX8A 2XYAA 3TGIE 3DCLA 1A0HB 1ORFA 1Z71A 4JZFH 4AGKA 4ZKNU 1C2MA 2BD2A 5EQQA 3SJKA 1Z1JA 4E7RG 2BD4A 4JZEH 1P05A 3IITA 3CS0A 2FS9A 2FI5E 1W13U 2YMSB 3HGNA 2Q6FA 1BIOA 4NWKA 4ZCNA 2SGPE 2BLWA 1L4ZA 2BDCA 1OWDA 3QWCH 4HI3A 3F9GA 3BSQA 1UTKA 4CBNA 2VIVA 1N1LA 5C0UA 1L2EA 1UK3A 3TGJE 1BA8B 1GI1A 4MTBA 1LVYA 4XD7D 2KAIB 1TGSZ 1TX7A 1C5OH 1SFIA 1QHRB 5EPYA 4KTSA 1VCWA 3A8CA 3MNBA 3N7OA 4NG9H 4CH8B 2FMJA 1JIMA 5C3NA 1NTPA 1T8OA 2D8WA 5GXPA 3SU3A 2G52A 2ZDKA 4I8JA 9ESTA 3Q76A 2BVXH 2V3OH 2TGDA 1C1QA 4ZHLU 2V0BA 5C2ZA 3MO9A 2OBQA 1LVOA 1BMLA 3DUXH 5I46H 2ASUB 4FUJA 4THNH 3RC6A 1HAPH 2VWMA 1O39A 2GTBA 4I32A 4OS2A 1FMGA 3TGKE 2VNTA 1TA2A 2KM0A 1HGTH 5FXLA 3AASA 1EJMA 2QF5A 4MQAA 4BNRA 1C1NA 2FOFA 2YMSD 3SGAE 3SOSA 3M7TA 3BG8A 4X6PA 1B0FA 2GMTC 1N6YA 4O03A 2BDIA 2IOTA 4BTUB 7GCHF 5HMAA 1AE5A 1V2ST 2A1DB 2ILNA 1GVLA 1QQ4A 3R0FA 1L1JA 2FESH 4E06H 2ZDMA 1ELBA 3VXFH 1C5WB 4MVNA 1GJ4H 1HLTH 1V3XA 3FVFB 4FVDA 1AY6H 2QAAA 1C2GA 3SU5A 4JZDH 1QJ7B 1K1OA 1XVOA 2C4FH 2V3HH 3A7TA 1O3PB 1O34A 1QL8A 2SGEE 4I8HA 3UNQA 4J2YB 1CHGA 1ELCA 2RA3A 2Y5HA 1F5RA 1O36A 1TB6H 1DXWA 3SU2A 2HGTH 3KCGH 1WOFA 3AW1A 4B76A 1CO7E 3TJOA 4GSOA 3OTPA 1O32A 3LGYA 5DP6A 1GMCG 1PPGE 1AVGH 3A7YA 4FUCA 1GHAG 1SGYE 4Y8XA 1KDQB 2YOLA 3MH7A 2BVRH 4FUDA 4UFEH 2BB4A 4YOGA 1MBQA 4O3TA 1O3CA 1S85A 1ZPCA 4MPWA 1IQLA 3VGCC 1B7XB 4BAHB 1O5EH 4DW2U 1PQ5A 1SGQE 1AGJA 1DVAH 5LH8A 3TJUA 1PPBH 2CMYA 4CRDA 5F8TA 3U98H 1YPEH 1RIWC 3BIVH 4Y8YA 1GI9B 3T2NA 4TT3D 2Z9IA 3TITA 2XBYA 1PQAA 3RMLH 3ZZ8A 2VH0A 4IMZA 1V2WT 2OC0A 3ODFA 2SGFE 2ZHWH 4CRAA 1SGTA 3ZVCA 2C8WB 5EXLA 1GI2A 4FUGA 4BAOB 3ELAH 6ESTA 3ZZ5A 2D1JA 2W6JD 2TRMA 1ESAA 2XC5A 2OTVA 3DD2H 3VG8A 4K5ZA 4KKDA 1TABE 2J92A 2ODQA 1HXEH 4B2CA 2QYIA 1W12U 3O8BA 4X1RU 3TH2H 1FPCH 3RM2H 5F53A 1QBNA 1W11U 1OX1A 3RXTA 5GPIB 3SQHE 4Q4LA 3MYWA 4A1TA 3PMAB 1YKTA 1DWBH 1P12E 2ZFRH 3DSOA 1F0SA 1V2TT 1PPZA 3RXCA 1FY4A 1TMTH 1ZZZA 1B0EA 2TGTA 5DSFA 5IDKA 3MQKC 1OHHD 2IPQX 3I78A 1FIZA 2QCYA 3EA9A 1G3BA 4MNYA 4SGAE 2Z9KA 1P2JA 1KXCA 5JYIA 4FU9A 1JXPA 1P0SH 1NN6A 2PUQH 1O2GH 1EAUA 1Z7KA 2A45B 1XUFA 3QO6A 1DXPA 2PFEA 2GCHF 2Z3CA 3MOCA 1BJUA 2GD4B 2W6ID 2XCNA 5KECA 1BQYA 3A81A 4GHTA 1S5SA 1UVSH 1LVMA 1EATA 1KXDA 4B74A 4ABFA 2BDAA 1EZSC 3LIWA 2BDGA 2VWNA 1Q2WA 4MNVA 1PFXC 5DP3A 3S0NA 3RXVA 7GCHG 2CF9H 1EPTB 4KTUA 4XOJA 1FQ3A 5T6DA 1RD3B 4CR5A 1GL1A 2FTLE 1O3LA 2R3UA 3A82A 3H09A 1F2SE 1CA8B 3HGPA 1C1OA 3HK6B 4NCYA 2QE7D 4M9FA 1DANH 3M3SA 4OS7A 4A7IB 1OWIA 2FOAA 1SL3A 1UVUH 1KXEA 4ZROA 3MFJA 1QCPA 2QIQA 3ATMA 3RUOA 3M5MA 5H4IB 1EFRD 2BZ6H 5GWZA 1YYY1 3LGUA 4FUIA 2WPKS 2F83A 2WINI 1TMBH 3KIDU 1QA0A 2ZPSA 2GT7A 4NSVA 5L6NH 4MPUA 4XFQA 4UFFH 1VGCB 4TY7A 3PWCA 3GDSA 4XBBA 5E8EH 3ZVFA 1GDNA 1MQ5A 2PR3A 3PWBA 3WY8A 1G3CA 2ZGBH 2Z94A 3ZZDA 1O3EA 4ABEA 1KXBA 4K8YA 1O2RA 1TOMH 4GUXA 3VFEA 1O2HA 2YMSC 1Z8RA 3UQVA 2ZQ2A 3G01A 2QN5T 4CH2B 4GAWA 2ZTXA 1MTNC 1QJ1B 1QY6A 2CV3A 1FZZA 1SLVB 3SW2B 1HYLA 3SU1A 3F1SB 3RXFA 2A7JA 3A87A 1O33A 5DP4A 1GI3A 1V2UT 1KTTB 2ZU5A 1FONA 1CT4E 5GIBA 3OSYA 1G32B 3U1JB 2ANYA 1C5QA 5CE1A 3LC3A 3P8FA 1ANEA 1GBMA 5EJLA 3ZZ6A 4RN6A 2H9EH 4X2WA 5HM2A 2W7UA 4ACBA 2AERH 4A1VA 3F0OA 1O3DA 1QA7A 1ACBE 3MU0A 4K1EA 1O2XA 3AW0A 1EB2A 3BG4B 1P9SA 3QDZB 6CHAB 5EIYA 3BN9A 4Z1MD 1ETRH 4UONA 1C1MA 3BTTE 1QTFA 1SQOA 4F55A 1ZTKA 4IGDA 3SHAH 2BOKA 3F0PA 4NIXA 5TCCA 1P2MA 5F8XA 1GDQA 3KEEA 3ZVAA 3CP7A 1SQAA 2FZZA 1U6QA 1JOUB 4AN7A 4B2AA 3TJNA 3OEHD 4ISHH 1HFDA 2FOMB 2ZU3A 4DOQA 4YZUA 3ZVBA 1C4U2 3GY8A 4INLA 1TFXA 1XXFA 3I77A 1T4VH 3QTOH 4IW4E 4K2YA 1TIOA 2TBSA 4B2BA 2P3UB 1TRYA 1CVWH 2QV1A 1A4WH 1TPSA 3DSGA 1GHBG 1SLUB 3M7QA 2C8XB 1GBLA 1LDTT 2PV9B 4X8UH 1FN8A 3M3VA 4BAKB 1FAKH 2XOKD 3RXJA 3E3TA 4WH6A 4K1TA 1G36A 2ZZUH 4Y10E 1C5MD 3RDZA 1UVOA 3UNRA 1K1MA 1FX0B 4IC6A 2GCHG 1ABIH 4MNWA 1DPOA 2VJ1A 4ABHA 4NWLA 2W3KA 3LT3A 2J38A 1WUNH 2AFQB 5FX6A 1SMFE 1WCZA 3Q77A 2UUFB 1L0ZA 2ZDVH 3CENA 1H9LB 5KEDA 3LPRA 1LTOA 3SNEA 2Z7FE 1F7ZA 2A7HA 4AFSA 3ZVGA 4X1SU 1DLEA 1Y3VA 2A2XH 1INCA 1KLJH 2ZU1A 1ID5H 2PTCE 1S6FA 1SOZA 2G51A 4ZXXH 1M9UA 3P17H 2O8MA 2H5CA 1OS8A 1KYNA 2P94A 3GY4A 4KELA 3KQCA 3OU0A 3FFGA 1PPCE 2FM2A 2K0QA 2QXHA 1G3EA 1OSSA 1GBDA 4AC9A 1QIXB 2Z9JA 2ZIQH 3D23A 3ENSB 1UVTH 1PPFE 5CDFE 4AYYB 3RMOH 1EP5A 1ZRKA 2AIPA 5L2YH 1HXFH 1GJ7B 3OE7D 2OLGA 3SV9A 2GKVE 3M61U 1O3HA 1GHWH 1YC0A 1P57B 2UUJB 1RTFB 4AYVB 1A5HA 1QZ8A 1MABB 1C2IA 1GCTC 3GY3A 5LPEA 3PV4A 3BTEE 3A8BA 1S0RA 4NZLA 1L1GA 3A84A 3W1EA 4RT1A 4BXWA 1H4WA 1MAXA 2KR7A 3LGTA 3F9HA 5EQRA 3V12A 1EZUC 2KFWA 4ISLA 2Z9LA 3ZVEA 2Q1JA 1AO5A 2HVYB 4FU7A 1SQRA 3SUDA 4A6LA 3MNXA 1F0TA 1O5DH 2SGQE 1T8LA 2G5NA 4X1NU 3BEFB 1A7SA 2ANKH 1WXRA 2VU8E 1OKXA 4RT0A 2ESTE 4ZUHA 1NBME 1LHFH 1P3EA 1S82A 4WXIA 1D6RA 3MH5A 3A7XA 1TNGA 1FJSA 5DP9A 2JJ1D 2PW8H 3SNAA 1HAHH 1YP9A 2UWOA 3RXIA 2SNWA 3RU4T 2A2QH 5A0CA 2BY8X 4AGJA 4GCHF 2EQNA 2O9QA 1XXDA 2J98B 4D76A 3RC4A 4ASUD 1P10A 3N7EA 1SG8B 2A5AA 3LGVA 4X2XA 3A83A 1GG6C 3NRLA 4UFDH 2GP9B 2C93B 1ARBA 1RXPA 1UHBA 3GY6A 4KGAA 1MKXK 1BHXB 3TH4H 1GBIA 2VVUA 3I29A 4Z6AH 2BLQA 1HBTH 1HJAC 4ZHMU 2A5KA 1O2VA 1NRNH 1QBVH 1EPTC 3FP6E 4BAQB 4TPYA 3SJIA 5F8ZA 1O2UA 4H6TA 1DITH 2PSYA 3QK1A 1Z1IA 1ELGA 3B23B 4AFZA 2VIQA 4Y76A 1P06A 2CK3D 2K1QA 1A61H 2RDLA 3U9AH 2BD9A 1GI4A 2B5TB 4B6EA 1BTPA 1BTZA 1DX5M 1HAZB 1H8IH 4ABIA 4JK6A 3ZV9A 1TOCB 3D62A 1O3FA 2HOBA 1GMHF 4RKOB 4Q2KA 2BD8A 5J4SA 1BOQA 3PLBA 4XBDA 3U69H 1HIAB 4GLYA 2OC7A 2BX4A 1AZZA 1EOJA 5EXNA 3GCTF 1O3IA 1BHXF 2PWXA 3MTYA 3NZIA 1C2FA 2XBXA 5GJ4B 3A88A 2ZCKP 1XM1A 1O3MA 1K28D 4U30A 2ZF0H 3UAIC 2FOCA 4I7YH 1G37A 3KN2A 3U8TH 2FLBH 3E0PB 3PV2A 3UOUA 2G8TA 1HJ8A 1SGDE 4AOQA 3SUFA 3TU7H 4YT7H 3GICB 1ZHPA 1LQDB 1MTNB 5HYOA 3GCHC 3VPKA 4YESB 3RXRA 2RFKC 1OP8A 3W95A 1TPOA 5C5NA 3HATH 1P3CA 2WUBA 3QN7A 1AWHB 2B8OH 1EKBB 4CRFA 2ZDLA 3M5OA 2Y5FA 1TWXB 1FPHH 1LO6A 5CHAB 1D3DB 3BG4C 2NU1E 6CHAC 1AI8H 1SGIB 4ZXYH 2OBOA 2QY0B 3RXHA 1A2CH 1QNJA 5BPEA 1JIRA 4ZHAA 3MU1A 1NFWA 4XDEA 1VR1H 4F4OC 2Y82A 3NUMA 3LGIA 1C5TA 4D9QA 1NROH 3SU6A 1F0UA 2SGDE 1P2IA 1GBTA 1UK2A 2LP6A 2OD3B 5EU8A 1SLWB 2WPLS 4FETA 1EP6A 1BRAA 3STJA 1YPHC 1V2JT 2PLXA 4DY7B 2SGAA 1O2NA 4B6FA 1ELTA 3PTBA 3DFJA 3PMBB 1FN6A 2G4TA 2JIZD 3T27A 1K22H 1GBCA 1HIAA 1P01A 1UO6A 3UTUH 1O3BA 1AQ7A 1YCPM 1TGBA 4GCHG 2FI3E 2FXRA 4LK4A 1L1NA 3UPEA 5EJZA 3D65E 4LOYH 5JDUB 4RSPA 3ATKA 1IQMA 2ZGHA 5FPTA 3D49H 3ITIA 1N8OC 1OWHA 1XUIA 1C2EA 3F6UH 2J4IA 1XUJA 2Z9GA 3BF6H 3P6ZB 1TGTA 1UCYH 2NWNA 2XXLA 3Q00A 3VB6A 4XRNA 2W3IA 2F43B 1C5SA 3E90B 2GZ9A 3PTNA 1K0HA 1DSTA 1UK4A 1TE0A 1ETSH 2J95A 2ZI2H 2BLOA 3SJ9A 2OUAA 2QA9E 1VCQA 2ZHEH 1XVMA 1LPKB 4ACAA 5IYTA 3BTQE 1GBHA 1MBMA 5IK2D 1W7XH 4LZ1H 2KAIA 4I8GA 5EODA 4IN2A 1THRH 2P3FH 4JYVH 5E2PA 2I6SA 3F3BA 1CGIE 2J34A 4DIHH 2GCTC 1O35A 1Z8JB 1SFQB 1ZR0A 2JETB 1NRQH 3RXPA 1O2SA 1H1BA 3T62A 1GMHG 2W26A 1HJ9A 2V7QD 1DY8A 3TK9A 2EY4C 1DICA 3S9CA 4Y0ZE 2H6MA 1O30A 5HIYA 1DFPA 1O3GA 3KQDA 1KY9A 5DP7A 3WWFA 3SJOA 3STIA 3GCTG 4ZAEA 4X8TH 3RXQA 1A3EH 5G4BA 3SZNA 4XE4A 2XWAA 2BOHB 1E34B 3BTFE 4JMYA 2FOHA 3PRDA 3FZDA 2R0KA 1W10U 1YGCH 1GI5A 3SV8A 1GCTB 1TNIA 1YPKH 1YLNA 4K3JA 1CBWB 1C5NH 5FBIA 1OYTH 1TPPA 1QRXA 3KYFA 1IHSH 4AZ2B 2AHME 3PLPA 4QT8C 3RXKA 1CE5A 1DWDH 4DGJA 1MKXH 7ESTE 5EW1H 3QX5H 1JBUH 1Y5UT 2OINA 3A8AA 4UFGH 3PV5A 1C1RA 1IQJA 5ETXA 1SGFA 5E2OA 1UTMA 3KL6A 3TNSA 3A8DA 2P3TB 1ESTA 3VEQB 4K8BA 3SUEA 1ZMLA 1LHCH 1NESE 1E35B 1O2KA 1C5UA 2GDDA 1AFEH 4YLUA 3UFAA 4B71A 4U01A 5A2MH 3BEUA 1SKYE 1BB0B 2JDID 3A85A 1MTVA 1TBZH 2ZPRA 1Z6JH 1X7AC 4JYUH 1HAVB 2ZHQH 4X6OA 4DT7B 3FANA 1O2OA 3A7WA 2R0LA 1F92A 3BTHE 1Z8GA 1V2KT 5C20A 3MH4A 1Y3XA 1AU8A 2H9HA 1GG6B 2QXIA 5E0GA 1GJCB 1V2VT 2RA0A 1KDQA 3P70B 1SGEE 1D3PB 3PROA 3LKWA 1AVWA 1WV7H 3GDUA 1C9PA 1J15A 2BMGB 5JB8S 5FBEA 4TWYA 3S7HB 1CT2E 1HJAB 2FEQH 2QC2A 3KQEA 1BBRK 2BD7A 2K8IA 2AMPA 1FY5A 3RLWH 2Q6DA 2J94A 1SSXA 3R3GB 4I86A 4I31A 3B9FH 4X1QU 1KXFA 1AB9B 3L3TA 3SV7A 1UCYE 1JMOH 3RU4E 4JZIA 2XRCA 2F9VA 3L6PA 2VVVA 2WZQA 1P11E 3V7TA 1RTLA 2ULLA 2WYGA 4OS4A 5FX5A 3PM3A 1GJ8B 3ODDA 3EGKH 3U28C 2CF8H 3ZZCA 2YNBA 4O3UA 1V2LT 1GBKA 2VIPA 5KGOA 4Y71A 3SGBE 3QZRA 2VIOA 1QRZA 4X2YA 4CRCA 1IQNA 3RC5A 3K2UA 1IQGA 2BX3A 4KP0A 4GHQA 3MNCA 1G2LA 2H5DA 1GJ6A 3EA7A 4Q63A 3TVJB 1BTYA 1YLDA 3PLKA 1SPJA 4UD9H 3AAUA 4YXWD 1G30B 1O2QA 1CGJE 3H5CB 2W7SA 1CA0C 1TONA 2F3CE 3OTJE 2EC9H 4ABAA 1BTHH 3SZEA 1OOKB 2OP9A 1FV9A 1C9TA 1Y3WA 1B5GH 2ALPA 2L6OA 1A46H 2KCPA 3SO3A 2VIDA 3KYGA 3GCHB 1HAVA 1C5XB 2BXUH 1W8BH 4LZ4B 1TX6A 1BZXE 2EA3A 3BTWE 3PMJA 1GI7B 1UTJA 2FDAA 1D6WA 2WPIS 2BY6X 1D3TB 1EJAA 1O5BB 4X2VA 2G4UA 4AX9H 5JBAS 1OWJA 3OY5U 2EI6A 2VWLA 1CHOF 1MU6B 5CHAC 3TIUA 1ELEE 1MZDA 2HPQH 2VH6A 2O8UA 2ZDNA 4CHAB 1O3KA 1VJAU 1TA6A 5AF9H 1W2KH 1EPTA 3LH3A 2LPRA 3RLYH 2PHBA 2B9LA 3H7OA 5EOKA 4ISIH 3A89A 1GI0A 3SORA 1H8HD 2ZDAH 1XUKA 1YPJH 5T1VA 1TMUH 4OS5A 1LHDH 1EJNA 2WSSD 3V3MA 4D9RA 1OYQA 3UREA 2A32A 4Z0KA 1OP2A 2XW9A 1MU8B 1HRTH 4E05H 2D2DA 3JZ1B 3HK3B 1BMMH 1BTWA 1XUHA 1O2YA 1F5KU 1NZQH 2Y7ZA 5DPAA 1HAYB 4INHA 1ZPBA 4ISOA 1WBGB 1XMNB 3S7KB 3F9EA 3UR9A 2QF0A 3FP7E 1NFUA 2GT8A 2VB0A 3QZQA 1AFQB 1A1RA 1S83A 2ZGJA 1LKAA 1VITH 2H2ZA 2PKSC 1C1SA 3O8DA 2FX6A 2XCFA 3UQOA 1LHEH 1N8OB 3GY2A 2P8OC 2FYRA 2JH0D 1IQEA 1GJ9B 1OXGA 4ASHA 3ESTA 4NA7A 1C2LA 4ABJA 1C4Y2 4MPVA 3HPTB 3QTVH 3K6ZA 2BD5A 4WVPE 3GOVB 5FPYA 4D7FA 3FAOA 5LPRA 9LPRA 4RI0A 1H8ED 3RXDA 3SNCA 3TPIZ 1YPHE 4SGBE 1ZGIA 6LPRA 3M35A 3VB7A 1HDTH 4IN1A 1T31A 2P59A 5E0HA 3QGNB 1QQUA 3LOXA 3N7DA 1TQ0B 2PSXA 1NO9H 2I6QA 1AUTC 5EW2H 2JETC 4VGCC 3FO8D 2OC8A 3MO6A 3BV9B 1ZJKA 2GCTB 5C1UA 1AN1E 1LKBA 2ZU2A 2STAE 3ATIA 3PRBA 3SI3H 1T8MA 4ZH8A 2WPHS 5ESBA 4Y7BA 3HKIB 2KZ4A 3TK6A 1BMAA 3ZZBA 3H7TA 2Q6GA 1GDUA 1PYTD 3EQ0H 1NU9A 3TJVA 1QRWA 3T25A 3FOAA 1ZLRA 8KME2 2XNIA 1UCYK 1NM6A 1YF4A 2ZG0H 4INKA 2TGPZ 2FIRH 1FXYA 1IAUA 2AGGX 1DY9A 1JRSA 3L33A 2A31A 3HKJB 2P16A 5JBBS 1CBWC 4MLFB 3UIRA 4Q7XA 3RXBA 1CT0E 4CRBA 2G81E 2XTTB 1CSOE 4NA8A 4FUBA 2FOGA 3MU5A 1AE8H 4OS1A 3GDVA 1E1QD 1GPZA 2BHGA 3MH6A 4OS6A 1PQ7A 1MD8A 4HZHA 5TJXA 2PTNA 1SR5C 3DA9B 1DWCH 2NU2E 1BBRH 1ANCA 4CR9A 1UMAH 1EXFA 1QL7A 2WPMS 1OWEA 2FOEA 3P8OA 1NRRH 4ABDA 3UNSA 1C5ZB 1NU7B 2FP7B 2UWLA 1CHOG 2EI8A 3BTGE 2STBE 2VGCC 3IG6B 2XC4A 3TK5A 2BDBA 5C5OA 1W0JD 1EAWA 1PJPA 3LU9B 1SGRE 4DURA 2ZFQH 1QGFA 1K21H 1C2KA 1NFYA 1ELDE 1T32A 5L30H 2Y80A 1O2TA 1C1PA 1ABJH 4DG4A 5B6LA 3RXUA 2GVFA 3SBKA 1V2QT 1AKSB 4FVBA 4WWYA 3LH1A 1O37A 1A0LA 2F9OA 3NK8A 1XKBC 2BLVA 2FS8A 2ZTZA 3ZIAD 1TRNA 2M5TA 1TALA 1KMHB 2ZFTA 5LPFA 2ZFFH 1HAGE 1NBMD 4AORA 2CN0H 2ANMH 2Y81A 3A80A 2BDYA 4A92A 5PTPA 3F68H 1GJAB 1LPZB 4B73A 1GJBB 2EI7A 2UWPA 1NRPH 1V6DA 1VITF 1DDJA 2BM2A 1GWAA 1SHYA 2OK5A 2C3SA 1TGNA 4Q80A 5A09A 1K1JA 5C67A 1AB9C 4Y11E 3LC5A 2FWWA 1SGNE 1MTWA 3DHKH 2KCAA 3PMHB 1O2ZA 1S6LA 1J14A 2OQUA 2XNDD 3IWMA 5HXFA 4CRGA 4FU8A 4I33A 2XC0A 3RXOA 1GVKB 1SB1H 3KQBA 3CS7A 3EA8A 3FZZA 2BDHA 2BZAA 2IN2A 4WY3A 3P92A 5EQSA 2G00A 3ATWA 1NY22 4NGAH 1WQVH 4NIVA 2ZECA 1NFXA 2RCEA 5AFYH 1Z6EA 3SJ8A 4TPIZ 1ZJDA 3E16B 1BRBE 1JRTA 4BOHA 2D26C 1PPHE 3MHWU 1SC8U 2C8YB 1O5GH 4D7GA 5A0BA 2ZU4A 1EAXA 3GS9A 5A8ZA 2CGAA 2W5EA 4P02A 1CA0B 3E6PH 3V0XA 1GCDA 2CXVA 4UDWH 3MU8A 3MWIU 1E1RD 2J98A 2RG3A 5K0HA 4DVAU 1E79D 1NC6A 1AKSA 2ZGXH 3SQEE 1ZRBA 4Q7ZA 4YTAA 4TSFD 4FUEA 5DK1A 5F03A 1TRMA 2XBVA 1SQTA 2F91A 3A7VA 3N99A 2FI4E 1D4PB 1DUAA 1EASA 4ABGA 4UE7H 3B8JA 3GYMA 1S84A 2UUYA 1ANDA 2WUCA 5GCHF 2OC1A 4DJZB 4CHAC 4F48B 1SVPA 1GBJA 5DKMA 4MPXA 1PQ8A 4AG2A 1HAIH 3VB3A 4BANB 1TNLA 2A5IA 1YLCA 2GV6A 4MNXA 1WU1A 3BTDE 1ZPZA 1BJVA 3WWBA 4NIWA 2WV4A 1AHTH 1BBRE 1MTUA 3RXEA 5BRRE 1DOJA 2M2AA 5DO4H 1NRSH 3UWIA 2AGEX 5FCKA 3P8NA 4K69A 1P02A 3QLPH 1FAXA 5DJ7A 4FOUC 1ARCA 4ISNA 3BIUH 1C1TA 3AAVA 2VBCA 3FN8A 1DM4B 1ZHRA 4H4FA 4Y79A 4HTCH 3SHCH 2F9PA 5C0TA 3RXAA 3KF2A 1PYTC 2BQ6B 3RXMA 1W0YH 1YPGH 1RJXB 3NKKA 4H6SB 2ZGCA 1CU1A 2UUKB 4WF8A 1Y3YA 1AFQC 2KX4A 1WSSH 1NS3A 1S81A 2AIQA 4DT4A 1ANBA 2PP6A 3F2GA 2Y6TA 1O3NA 1SGPE 2PKSB 5EG4A 5JB9S 1RS0A 3E8LA 1FDPA 2P8OB 1G3DA 2R2MB 3SI4H 4Q7YA 3PO1B 3BTKE 4H42U 2A4QA 3URCA 1MQ6A 4YLQH 2R9PA 4Y7AA 1E38B 2A7CA 1AWFH 1NPMA 2PKAB 1HPGA 2PGQB 2R2WU 4X6MA 2BYAX 1P2KA 4IBLH 5GNDA 4D8NA 2Y5GA 1K2I1 1O38A 1VITG 2THFB 2ZHDA 5T3HA 4AFUA 1EQ9A 1QJ6B 1VKYA 2TGAA 4B1TA 2PGBB 1G2MA 3MNSA 1A5IA 1QB6A 2JH6D 2VVCA 2ZFPH 3QUMP 2B7DH 1HNEE 1ESBA 2EEKA 4VGCB 2GJGA 3ZZ7A 6GCHF 2XBWA 5FL7D 3OYPA 3RXLA 3U8RH 3O8RA 1QBOA 7LPRA 5DP5A 2GGVB 3RMMH 4X1PU 2HNTC 5C1XA 3EYDA 5C1YA 3SN8A 1RFNA 2KCOA 3VB4A 2HWLB 4NFEA 4YT6H 4YO9A 3RMNH 3LJOA 1KLTA 1C5VA 1P2OA 3DFLA 3SYJA 3ZVDA 3SV2H 4TY6A 1DS2E 3W94A 2ZPQA 1ZMNA 3ZZ9A 1Y8TA 3SUGA 1HAOH 5GDSH 2ZKSA 2FX4A 1E37B 2ZHFH 2DUCA 1JWTA 2BY5X 1BDAA 1VZQH 3RM0H 3SGQE 1J17T 1P04A 1E0FD 3UR6A 1DSUA 5JBTA 2IPHA 5FAHA 1GGDB 4AG1A 3AVZA 1OP0A 1MTSA 3GYLB 3P95A 3F2FA 1EX3A 1MCTA 2BTCE 4NFFA 3RP2A 3E1XB 1QL9A 1UJ1A 1K1PA 4B75A 1RRKA 1Y5AT 1V2MT 2LELA 4WMEA 5E0JA 4UEHH 4FUFA 5C94A 2NU3E 3Q3YA 1FY3A 2FLRH 1VJ9U 2WV9A 5GCHG 1O2LA 2FYQA 2R3YA 2PKAA 2VGCB 4IC5A 4K60A 5DG6A 4PROA 2OCVB 1TNHA 1C5PA 3JZ2B 2WV5A 2CHAC 2J9NA 3M7UA 2ODPA 1GMDF 1P2NA 1LVBA 2FTMA 4CBOA 5AFZH 1KSNA 1Q3XA 2FO9A 4Y8ZA 1UTPA 2DE9A 1YPLH 1GL0E 1GJDB 1RTKA 1HV7A 4F49A 1GHVH 5EXMA 1P2QA 1A5GH 1EOLA 1GHBF 1YPMH 1YCPK 1ELFA 1O2MA 3UY9A 1H8DH 1Y59T 3OFND 2Z3EA 2QF3A 1P09A 1YY3A 2AH4X 3SU4A 4HG6A 4O97A 2F4LA 1OWKA 3VXEH 1OPHB 1C5YB 1O2JA 5F6MA 1O2WA 1DWEH 1THPB 3E91A 3SV6A 1ETTH 1UW7A 1IQIA 4OGYA 2BQWB 1WAYB 1C1VH 1O5AB 3OY6U 2PUXB 1KLIH 1D9IA 5DP8A 1O5FH 1ZOMA 4X8VH 2JKHA 2OXSA 4ZMAH 2AS9A 4XBCA 5K7RA 3WW7A 3CNRA 1V2RT 4OM9A 4WJG2 1BITA 1LHGH 3KNXA 1IQHA 1O3JA 3LJJA 1ZSLA 4GVUA 1ZSJA 1TYNA 1MD7A 1MAYA 2OQ5A 6GCHG 5EGMA 2WPDD 4TYDA 5A0AE 5LGOA 1ELAA 3RU4D 1SGFG 1W0KD 3URDA 5DN6D 5ABWA 2O8TA 1WTGH 4YOIA 2Z3DA 5SGAE 1MKWK 1BCUH 1SBWA 2O8LA 3T5FH 1EAIA 4TWWA 3O8CA 4KTCA 2J2UA 3KGPA 1G9IE 1O3AA 2Y7XA 3ZZ3A 1EB1H 4LXBH 8LPRA 1W3CA 4HGCA 1LMWB 1A3BH 2HLDD 1GBEA 1HCGA 3GCOA 1O2PA 3GY5A 1A0JA 1BTUA 1BTXA 1MCVA 3GISB 2WPJS 1SLXB 4NIYA 2ZP0H 3S9BA 4AB8A 4FUHA 3EDXB 4K1SA 5T6GA 4BAMB 1ZHMA 3K9XB 3SU0A 1K1NA 1MMJN 2ALVA 5CMXH 1IHTH 2J5UA 1GJ5H 1YWUA 1LQEA 1Q31A 2BVSH 1ZSKA 2WYJA 1ZTJA 4JCNA 1ZTLA 2KCYA 1P03A 1W14U 2F9UA 1XKAC 2C8ZB 3SNBA 2L74A 4WMFA 2SNVA 2V3MA 1HAXB 1SOTA 1J8AA 1Y3UA 3S69A 2Z6BD 3T26A 1W0ZU 2ZO3H 2AGIX 5DGJA 3BTME 2JH5D 4NZQA 8GCHF 4DIIH 1AUJA 2HVXA 2AYWA 2JJ2D 4JYTA 3ZYEA 1GBBA 1C1UH 5JBCS 1T4UH 1O5CB 1J9CH 4GPGA 5CHBA 2G5VA 3DSPA 4O9VA 2LNCA 1FY8E 4DCDA 1W7GH 2ODYB 2A4RA 1GMDG 1BMFD 1D3QB 1O3OA 1QB9A 1WDIA 2P95A 1COWD 2HLCA 1QFKH 2NU4E 1IQKA 1GI8B 1DT2A 1O0DH 1ZMJA 3NPSA 1TGCA 3PO1C 2NU0E 1FLEE 2F9BH 2GMTB 5HGGA 1GI6A 3FP8E 1TNJA 3C1KA 1UTNA 5HIZA 1K1LA 2FODA 1F0RA 3AK5A 3A86A 2V35A 1LCYA 1ELVA 4A1XA 3NCLA 1GBFA 2ZCLP 2QXJA 2B0FA 2TIOA 1CGHA 3Q3KA 1DUEA 1DLKB 1TBQH 3M36A 2BQ7B 5AVDA 1S6HA 1TAWA 1O2IA 1UTLM 3LDXH 4M7GA 3OX7U 1YBWA 3F9FA 1AIXH 1KTSB 1AMHA 1GHZA 2HALA 2O8WA 2GZ7A 4FXGH 3M5LA 2F9NA 4R0IA 3M37A 1C2JA 4JZ1A 1SI5H 2ZA5A 1F5LA 1C5RA 1FY1A 3MMGA 2ZC9H 3PB1E 1V2PT 4I8KA 2SFAA 1XUGA 2ZQ1A 3U8OH 1CQQA 3LGWA 1TQ7B 8ESTE 1UHBB 5A8XA 4R8TB 1WTHD 5HM9A 3UWJH 2ZWLH 1AZ8A 1BRUP 1NT1A 3GY7A 3ZYDA 2IJD1 4WH8A 1EUFA 5L2ZH 5AHGH 3EE7A 3MU4A 3VGCB 3ATLA 1ZYOA 2GZ8A 2HPPH 1GGDC 1K9OE 5FHTA 5TCAA 5ESTE 1TLDA 3RXSA 4CREA 3ZZ4A 1C2DA 3Q3XA 1ZGVA 3UB0A 1YCPH 5T6FA 4OGXA 3SNDA 2GV7A 2BY9X 1RIWB 1SHHB 3OAAD 2BY7X 3RXGA 2P93A 3BEIB 4BTTB 3TNTA 2HNTE 2HNTF 2AMDA 1IOEA 3M3TA 3A7ZA 2ZCHP 2H9TH 4MDSA 4JK5A 1HUTH 3VB5A 1UTQA 1WYKA 1YM0A 2ANWA 3E0NB 1MUEB 3UOPA 1AD8H 1LPGB 1V2OT 4ZKOU 3UUZA 1GHXH 4X8SH 1KXAA 1QURH 5EPNA 2IJOB 7KMEH 2CHAB 4X0WU 2QGRA 3PYHA 2A4GA 4MG3A 3U1IB 1C2HA 2ZEBA 3NXPA 1T7CA 1DE7H 5B6OA 1H9IE 1P9UA 3T28A 2VINA
chains in the Genus database with same CATH topology
1GVZA 3LONA 2AEIH 1HB0B 1KIGH 1VCPA 2WHXA 1UTOA 2QXGA 4XSKU 2HRVA 2A4OA 1C5LH 2FOBA 1L4DA 5A8YA 8GCHG 1RGQA 2TPIZ 1BUIA 4ZKSU 2BD3A 1O31A 4Y0YE 4J1YA 5HKKD 1BMNH 2A0QB 5FPSA 1IQFA 2G55A 4ESTE 1C1WH 3F2HA 3MI4A 3V13A 1FIWA 5C17A 1S0QA 4HFPB 5J4QA 4NA9H 2DE8A 4X6NA 4ZKRU 1BT7A 4AFQA 3ZZAA 1MH0A 3ZV8A 1K1IA 2GX4A 4BTIB 3K65B 3GCNA 1MKWH 3OEED 3EAJA 3NWUA 1MZAA 3T29A 5JPMH 4U32A 1C4V2 1PPEE 1V2NT 1XX9A 2ZTYA 1WQSA 4IMQA 4WXVA 1QB1A 3KHVA 2V6NA 4IS5A 2GDEH 3DT0H 1N6XA 4Y6DA 4I8LA 4ABBA 2C90B 4AB9A 1QR3E 2AMQA 1TPAE 2XWBI 1E36B 1SGCA 3S9AA 4RKJB 1AVXA 1Y5BT 3TH3H 1J16A 2CJIA 1GMCF 1TBRH 1GHAF 1P8VC 3K6YA 2ZFSA 2BXTH 3P8GA 2ZNKH 4WMDA 3C27B 1BRCE 1TNKA 4NSYA 1UVPA 3TLOA 4U2WA 4YOJA 3MO3A 1FUJA 4BXSA 5I25A 2QF4A 2VWOA 3M5NA 1H9HE 3FKSD 1EZXC 1Z8IB 2H1UA 1VGCC 4A5TS 5FCRA 1FI8A 1GHYH 1EZQA 2FPZA 3EE0B 1THSH 2VIWA 4YM9A 1FNIA 4E7NA 1GBAA 1T8NA 2YNAA 3QGJA 1TX8A 2XYAA 3TGIE 3DCLA 1A0HB 1ORFA 1Z71A 4JZFH 4AGKA 4ZKNU 1C2MA 2BD2A 5EQQA 3SJKA 1Z1JA 4E7RG 2BD4A 4JZEH 1P05A 3IITA 3CS0A 2FS9A 2FI5E 1W13U 2YMSB 3HGNA 2Q6FA 1BIOA 4NWKA 4ZCNA 2SGPE 2BLWA 1L4ZA 2BDCA 1OWDA 3QWCH 4HI3A 3F9GA 3BSQA 1UTKA 4CBNA 2VIVA 1N1LA 5C0UA 1L2EA 1UK3A 3TGJE 1BA8B 1GI1A 4MTBA 1LVYA 4XD7D 2KAIB 1TGSZ 1TX7A 1C5OH 1SFIA 1QHRB 5EPYA 4KTSA 1VCWA 3A8CA 3MNBA 3N7OA 4NG9H 4CH8B 2FMJA 1JIMA 5C3NA 1NTPA 1T8OA 2D8WA 5GXPA 3SU3A 2G52A 2ZDKA 4I8JA 9ESTA 3Q76A 2BVXH 2V3OH 2TGDA 1C1QA 4ZHLU 2V0BA 5C2ZA 3MO9A 2OBQA 1LVOA 1BMLA 3DUXH 5I46H 2ASUB 4FUJA 4THNH 3RC6A 1HAPH 2VWMA 1O39A 2GTBA 4I32A 4OS2A 1FMGA 3TGKE 2VNTA 1TA2A 2KM0A 1HGTH 5FXLA 3AASA 1EJMA 4MQAA 2QF5A 4BNRA 1C1NA 2FOFA 2YMSD 3SGAE 3SOSA 3M7TA 3BG8A 4X6PA 1B0FA 2GMTC 1N6YA 4O03A 2BDIA 2IOTA 4BTUB 7GCHF 5HMAA 1AE5A 1V2ST 2A1DB 2ILNA 1GVLA 1QQ4A 3R0FA 1L1JA 2FESH 4E06H 2ZDMA 1ELBA 3VXFH 1C5WB 4MVNA 1GJ4H 1HLTH 1V3XA 3FVFB 4FVDA 1AY6H 2QAAA 1C2GA 3SU5A 4JZDH 1QJ7B 1K1OA 1XVOA 2C4FH 2V3HH 3A7TA 1O3PB 1O34A 1QL8A 2SGEE 4I8HA 3UNQA 4J2YB 1CHGA 1ELCA 2RA3A 2Y5HA 1F5RA 1O36A 1TB6H 1DXWA 3SU2A 2HGTH 3KCGH 1WOFA 3AW1A 4B76A 1CO7E 3TJOA 4GSOA 3OTPA 1O32A 3LGYA 5DP6A 1GMCG 1PPGE 1AVGH 3A7YA 4FUCA 1GHAG 1SGYE 4Y8XA 1KDQB 2YOLA 3MH7A 2BVRH 4FUDA 4UFEH 2BB4A 4YOGA 1MBQA 4O3TA 1O3CA 1S85A 1ZPCA 4MPWA 1IQLA 3VGCC 1B7XB 4BAHB 1O5EH 4DW2U 1PQ5A 1SGQE 1AGJA 1DVAH 5LH8A 3TJUA 1PPBH 2CMYA 4CRDA 5F8TA 3U98H 1YPEH 1RIWC 3BIVH 4Y8YA 1GI9B 3T2NA 4TT3D 2Z9IA 3TITA 2XBYA 1PQAA 3RMLH 3ZZ8A 2VH0A 4IMZA 1V2WT 2OC0A 3ODFA 2SGFE 2ZHWH 4CRAA 1SGTA 3ZVCA 2C8WB 5EXLA 1GI2A 4FUGA 4BAOB 3ELAH 6ESTA 3ZZ5A 2D1JA 2W6JD 2TRMA 1ESAA 2XC5A 2OTVA 3DD2H 3VG8A 4K5ZA 4KKDA 1TABE 2J92A 2ODQA 1HXEH 4B2CA 2QYIA 1W12U 3O8BA 4X1RU 3TH2H 1FPCH 3RM2H 5F53A 1QBNA 1W11U 1OX1A 3RXTA 5GPIB 3SQHE 4Q4LA 3MYWA 4A1TA 3PMAB 1YKTA 1DWBH 1P12E 2ZFRH 3DSOA 1F0SA 1V2TT 1PPZA 3RXCA 1FY4A 1TMTH 1ZZZA 1B0EA 2TGTA 5DSFA 5IDKA 1OHHD 3I78A 1FIZA 2QCYA 3EA9A 1G3BA 4MNYA 4SGAE 2Z9KA 1P2JA 1KXCA 5JYIA 4FU9A 1JXPA 1P0SH 1NN6A 2PUQH 1O2GH 1EAUA 1Z7KA 2A45B 1XUFA 3QO6A 1DXPA 2PFEA 2GCHF 2Z3CA 3MOCA 1BJUA 2GD4B 2W6ID 2XCNA 1BQYA 3A81A 4GHTA 1S5SA 1UVSH 1LVMA 1EATA 1KXDA 4B74A 4ABFA 2BDAA 1EZSC 3LIWA 2BDGA 2VWNA 1Q2WA 4MNVA 1PFXC 5DP3A 3S0NA 3RXVA 7GCHG 2CF9H 1EPTB 4KTUA 4XOJA 1FQ3A 5T6DA 1RD3B 4CR5A 1GL1A 2FTLE 1O3LA 2R3UA 3A82A 3H09A 1F2SE 1CA8B 3HGPA 1C1OA 3HK6B 4NCYA 2QE7D 4M9FA 1DANH 3M3SA 4OS7A 4A7IB 1OWIA 2FOAA 1SL3A 1UVUH 1KXEA 4ZROA 3MFJA 1QCPA 2QIQA 3ATMA 3RUOA 3M5MA 5H4IB 2BZ6H 1EFRD 5GWZA 1YYY1 3LGUA 4FUIA 2WPKS 2F83A 2WINI 1TMBH 3KIDU 1QA0A 2ZPSA 2GT7A 4NSVA 5L6NH 4MPUA 4XFQA 4UFFH 1VGCB 4TY7A 3PWCA 3GDSA 4XBBA 5E8EH 3ZVFA 1GDNA 1MQ5A 2PR3A 3PWBA 3WY8A 1G3CA 2ZGBH 2Z94A 3ZZDA 1O3EA 4ABEA 1KXBA 4K8YA 1O2RA 1TOMH 4GUXA 3VFEA 1O2HA 2YMSC 1Z8RA 3UQVA 2ZQ2A 3G01A 2QN5T 4CH2B 4GAWA 2ZTXA 1MTNC 1QJ1B 1QY6A 2CV3A 1FZZA 1SLVB 3SW2B 1HYLA 3SU1A 3F1SB 3RXFA 2A7JA 3A87A 1O33A 5DP4A 1GI3A 1V2UT 1KTTB 2ZU5A 1FONA 1CT4E 5GIBA 3OSYA 1G32B 3U1JB 2ANYA 1C5QA 5CE1A 3LC3A 3P8FA 1ANEA 1GBMA 3ZZ6A 4RN6A 2H9EH 4X2WA 5HM2A 2W7UA 2AERH 4A1VA 3F0OA 1O3DA 1QA7A 1ACBE 3MU0A 4K1EA 1O2XA 3AW0A 1EB2A 3BG4B 1P9SA 3QDZB 6CHAB 3BN9A 4Z1MD 1ETRH 4UONA 1C1MA 3BTTE 1QTFA 1SQOA 4F55A 1ZTKA 4IGDA 3SHAH 2BOKA 4NIXA 5TCCA 3F0PA 1P2MA 5F8XA 1GDQA 3KEEA 3ZVAA 3CP7A 1SQAA 2FZZA 1U6QA 1JOUB 4AN7A 4B2AA 3TJNA 4ISHH 3OEHD 1HFDA 2FOMB 2ZU3A 4DOQA 4YZUA 3ZVBA 1C4U2 3GY8A 4INLA 1TFXA 1XXFA 3I77A 1T4VH 3QTOH 4IW4E 4K2YA 1TIOA 2TBSA 4B2BA 2P3UB 1TRYA 1CVWH 2QV1A 1A4WH 1TPSA 1GHBG 1SLUB 3M7QA 2C8XB 1GBLA 1LDTT 2PV9B 4X8UH 1FN8A 3M3VA 4BAKB 1FAKH 2XOKD 3RXJA 3E3TA 4WH6A 4K1TA 1G36A 2ZZUH 4Y10E 1C5MD 3RDZA 1UVOA 3UNRA 1K1MA 1FX0B 4IC6A 2GCHG 1ABIH 4MNWA 1DPOA 2VJ1A 4ABHA 4NWLA 2W3KA 3LT3A 2J38A 1WUNH 2AFQB 5FX6A 1SMFE 1WCZA 3Q77A 2UUFB 1L0ZA 2ZDVH 3CENA 1H9LB 3LPRA 1LTOA 3SNEA 2Z7FE 1F7ZA 2A7HA 4AFSA 3ZVGA 4X1SU 1DLEA 1Y3VA 2A2XH 1INCA 1KLJH 2ZU1A 1ID5H 2PTCE 1S6FA 1SOZA 2G51A 4ZXXH 1M9UA 3P17H 2O8MA 2H5CA 1OS8A 1KYNA 2P94A 3GY4A 4KELA 3KQCA 3OU0A 3FFGA 1PPCE 2FM2A 2K0QA 2QXHA 1G3EA 1OSSA 1GBDA 1QIXB 2Z9JA 2ZIQH 3D23A 3ENSB 1UVTH 1PPFE 5CDFE 4AYYB 3RMOH 1EP5A 1ZRKA 2AIPA 5L2YH 1HXFH 1GJ7B 3OE7D 2OLGA 3SV9A 2GKVE 3M61U 1O3HA 1GHWH 1YC0A 1P57B 2UUJB 1RTFB 4AYVB 1A5HA 1MABB 1C2IA 1GCTC 3GY3A 5LPEA 3PV4A 3BTEE 3A8BA 1S0RA 4NZLA 1L1GA 3A84A 3W1EA 4BXWA 1H4WA 1MAXA 2KR7A 3LGTA 3F9HA 5EQRA 3V12A 1EZUC 2KFWA 4ISLA 2Z9LA 3ZVEA 2Q1JA 1AO5A 4FU7A 3SUDA 4A6LA 3MNXA 1F0TA 1O5DH 2SGQE 1T8LA 2G5NA 4X1NU 3BEFB 1A7SA 2ANKH 1WXRA 2VU8E 1OKXA 2ESTE 4ZUHA 1NBME 1LHFH 1P3EA 1S82A 4WXIA 1D6RA 3MH5A 3A7XA 1TNGA 1FJSA 5DP9A 3SNAA 2PW8H 2JJ1D 1HAHH 1YP9A 2UWOA 3RXIA 2SNWA 3RU4T 2A2QH 5A0CA 2BY8X 4AGJA 4GCHF 2O9QA 1XXDA 4D76A 3RC4A 4ASUD 1P10A 3N7EA 1SG8B 2A5AA 3LGVA 4X2XA 3A83A 1GG6C 3NRLA 4UFDH 2GP9B 2C93B 1ARBA 1RXPA 1UHBA 3GY6A 4KGAA 1MKXK 1BHXB 3TH4H 1GBIA 2VVUA 3I29A 4Z6AH 2BLQA 1HBTH 1HJAC 4ZHMU 2A5KA 1O2VA 1NRNH 1QBVH 1EPTC 3FP6E 4BAQB 4TPYA 3SJIA 5F8ZA 1O2UA 4H6TA 1DITH 2PSYA 3QK1A 1Z1IA 1ELGA 3B23B 4AFZA 2VIQA 4Y76A 1P06A 2CK3D 2K1QA 1A61H 2RDLA 3U9AH 2BD9A 1GI4A 2B5TB 4B6EA 1BTPA 1BTZA 1DX5M 1HAZB 1H8IH 4ABIA 4JK6A 3ZV9A 1TOCB 3D62A 1O3FA 2HOBA 1GMHF 4RKOB 4Q2KA 2BD8A 5J4SA 1BOQA 3PLBA 4XBDA 3U69H 1HIAB 4GLYA 2OC7A 2BX4A 1AZZA 1EOJA 5EXNA 3GCTF 1O3IA 1BHXF 2PWXA 3MTYA 3NZIA 1C2FA 2XBXA 5GJ4B 3A88A 2ZCKP 1XM1A 1O3MA 1K28D 4U30A 2ZF0H 2FOCA 4I7YH 1G37A 3KN2A 3U8TH 2FLBH 3E0PB 3PV2A 3UOUA 2G8TA 1HJ8A 1SGDE 4AOQA 3SUFA 3TU7H 4YT7H 3GICB 1ZHPA 1LQDB 1MTNB 5HYOA 3GCHC 3VPKA 4YESB 3RXRA 1OP8A 3W95A 1TPOA 5C5NA 3HATH 1P3CA 2WUBA 3QN7A 1AWHB 2B8OH 1EKBB 4CRFA 2ZDLA 3M5OA 2Y5FA 1TWXB 1FPHH 1LO6A 5CHAB 1D3DB 3BG4C 2NU1E 6CHAC 1AI8H 1SGIB 4ZXYH 2OBOA 2QY0B 3RXHA 1A2CH 1QNJA 5BPEA 1JIRA 4ZHAA 3MU1A 1NFWA 4XDEA 1VR1H 4F4OC 2Y82A 3NUMA 3LGIA 1C5TA 4D9QA 1NROH 3SU6A 1F0UA 2SGDE 1P2IA 1GBTA 1UK2A 2OD3B 5EU8A 1SLWB 2WPLS 4FETA 1EP6A 1BRAA 3STJA 1YPHC 1V2JT 2PLXA 4DY7B 2SGAA 1O2NA 4B6FA 1ELTA 3PTBA 3DFJA 3PMBB 1FN6A 2G4TA 3T27A 2JIZD 1K22H 1GBCA 1HIAA 1P01A 1UO6A 3UTUH 1O3BA 1AQ7A 1YCPM 1TGBA 4GCHG 2FI3E 2FXRA 4LK4A 1L1NA 3UPEA 3D65E 4LOYH 5JDUB 4RSPA 3ATKA 1IQMA 2ZGHA 5FPTA 3D49H 3ITIA 1N8OC 1OWHA 1XUIA 1C2EA 3F6UH 2J4IA 1XUJA 2Z9GA 3BF6H 3P6ZB 1TGTA 1UCYH 2NWNA 2XXLA 3Q00A 3VB6A 2W3IA 2F43B 1C5SA 3E90B 2GZ9A 3PTNA 1DSTA 1UK4A 1TE0A 1ETSH 2J95A 2ZI2H 2BLOA 3SJ9A 2OUAA 2QA9E 1VCQA 2ZHEH 1XVMA 1LPKB 5IYTA 3BTQE 1GBHA 1MBMA 4LZ1H 1W7XH 5IK2D 2KAIA 4I8GA 5EODA 4IN2A 1THRH 2P3FH 4JYVH 5E2PA 2I6SA 3F3BA 1CGIE 2J34A 4DIHH 2GCTC 1O35A 1Z8JB 1SFQB 1ZR0A 2JETB 1NRQH 3RXPA 1O2SA 1H1BA 3T62A 1GMHG 2W26A 1HJ9A 2V7QD 1DY8A 3TK9A 1DICA 3S9CA 4Y0ZE 2H6MA 1O30A 1DFPA 1O3GA 3KQDA 1KY9A 5DP7A 3WWFA 3SJOA 3STIA 3GCTG 4ZAEA 4X8TH 3RXQA 1A3EH 5G4BA 3SZNA 4XE4A