3P8NA

Crystal structure of hcv ns3/ns4a protease complexed with bi 201335
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
182
structure length
182
Chain Sequence
APITAYSQQTRGLLGCIITSLTGRDKNQVDGEVQVLSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWPAPPGARSMTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGIFRAAVCTRGVAKAVDFIPVESMETTMRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combined X-ray, NMR, and kinetic analyses reveal uncommon binding characteristics of the hepatitis C virus NS3-NS4A protease inhibitor BI 201335.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HCV serine protease NS3
total genus 42
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3p8nA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3p8nA01
3SNEA 1AY6H 1TPPA 1VGCC 3LKWA 2WHXA 2SFAA 1ABIH 1O2XA 2TGAA 3SJOA 3P92A 1S0QA 3RDZA 3P8GA 2TRMA 4WF8A 4XDEA 1HIAA 4X6NA 2BD8A 1K1MA 1THPB 2D8WA 2Z94A 2SGAA 1MTVA 3ZZBA 1Y3WA 1TNJA 3SGAE 1GJ9B 1RTKA 2GKVE 3K2UA 3HGNA 3SU4A 1J17T 1LTOA 3VGCB 1HJAC 5E2PA 1TBRH 3KGPA 2XYAA 1PPHE 3VPKA 1CT2E 3MMGA 8LPRA 1IQEA 1RGQA 3LGYA 1TPAE 3A89A 2VIVA 2ULLA 3A7VA 1L1NA 2HLCA 2VVCA 3VB5A 3ZV8A 4A7IB 4CRDA 1WAYB 1BA8B 4M7GA 1MD8A 1ZPZA 5L30H 2FESH 3GY5A 1GHAG 1O32A 2NU3E 3BTWE 1MUEB 4KTCA 3M7UA 2VBCA 4ZKRU 2O8UA 4WWYA 1YPEH 3CP7A 2Z9KA 4YM9A 2ANMH 1BRUP 3LU9B 1FXYA 1PPGE 2CXVA 4BTUB 3SJIA 3U8OH 1FI8A 2GZ8A 2TPIZ 1QCPA 3PB1E 1IQGA 4E05H 1C5YB 4K60A 4KKDA 1W14U 2ZDKA 2XXLA 4A1XA 1TONA 1HJ9A 4VGCB 5GXPA 3DA9B 1BCUH 2FO9A 1C5RA 1FLEE 2ZHEH 1S0RA 4IGDA 4J1YA 3SHCH 3P8OA 1C5PA 1UTJA 2W5EA 1AWFH 1NN6A 3VEQB 1PJPA 2A5AA 2XTTB 2J94A 1F0SA 2ZF0H 4AYVB 1A3BH 1B0EA 3NXPA 3GCOA 1HAIH 1EOLA 1M9UA 2FYRA 3TK9A 1CBWC 1SGFG 1P3EA 1YCPK 2BLQA 3UR9A 1BHXF 5C5NA 3RC4A 3SI4H 2ZU3A 1O5EH 2BYAX 5BPEA 2Y7XA 1FMGA 3BTEE 4I8KA 2J4IA 4X0WU 4JYUH 3BIVH 3PO1B 2AGEX 1MZDA 1MMJN 4AG2A 1P2JA 1K1IA 1C2DA 2OK5A 1MKXK 3PMHB 1GI0A 1ELAA 4R8TB 4DIHH 2BVXH 5HYOA 1SQTA 3K9XB 5AVDA 4ABIA 1T4VH 1O5GH 1G30B 2AMDA 2C8XB 4GLYA 3SQEE 3GCTG 1E34B 4X2WA 1K9OE 4X1SU 1XUGA 1MAXA 2BD4A 3A84A 1NROH 1H9HE 2ZIQH 3MTYA 3ZZ4A 4IS5A 4Y8YA 4YOJA 1TLDA 2A7HA 4JK6A 3MI4A 1OWEA 5HXFA 5AF9H 1CA0B 2W7UA 1RRKA 3HK3B 3KF2A 2Z9IA 1VJ9U 3S69A 4MVNA 2ZI2H 4I8LA 4INHA 1RTLA 1ZSJA 2BY9X 2DUCA 1CGIE 2ZPRA 3PYHA 1AUJA 2QA9E 3V12A 1HAYB 1BTWA 5GDSH 3M3TA 3S9BA 1Z8RA 3PMJA 4YT6H 3RXUA 1GBJA 3OY5U 1HCGA 2FOCA 4DT7B 1QJ1B 3GY3A 1UTKA 2UUFB 1QNJA 1GI6A 3AAUA 1Y3XA 1P2KA 5JDUB 5FHTA 1OYQA 2A5IA 3M5OA 3SU6A 1Z8IB 2SNWA 4NWLA 3RXGA 5EU8A 1WU1A 1FIWA 2FOHA 5FCKA 1JXPA 3LPRA 2B7DH 1YM0A 2CN0H 2GGVB 4FUEA 1TGNA 1UHBA 2P16A 2YNBA 2VWMA 2OBOA 1ZJDA 3LGVA 2PGQB 1JIMA 3A8CA 4B2AA 3PMBB 3DUXH 4ZKSU 1O2WA 2XCFA 1BZXE 1ZHRA 1LKBA 4LK4A 1C1TA 2WV4A 2BY5X 1D6WA 3BF6H 3TVJB 2ODQA 3U69H 1O3OA 3Q3KA 3PLBA 4AFUA 1XUIA 2HNTF 3T26A 1Y3YA 1LHEH 3MU5A 3M35A 4LZ1H 1TOCB 2EI8A 2PTNA 5FBEA 1GL1A 1EPTB 1UTPA 3ZZCA 1RTFB 1GCTC 1GL0E 2QN5T 1O31A 1NPMA 1RIWC 4LXBH 2GCHG 4H6SB 2V3HH 2FXRA 4BOHA 2QXJA 4E06H 2PUQH 1Y3VA 1IQNA 1GHBF 4H6TA 5F8TA 2CF8H 3UOPA 2WV5A 1SOZA 1ZJKA 2C8WB 1FN6A 3GDSA 1Z1JA 3RMOH 4DURA 4JK5A 2ZPSA 4F49A 4DW2U 1ETTH 1G3BA 3AW1A 4TYDA 5C1YA 1G2LA 1GI5A 2J92A 1XVOA 3T29A 3ZZ7A 2QY0B 5DP9A 1SMFE 1Z6EA 2HGTH 1GHYH 1ELCA 2PWXA 4ISNA 2H2ZA 1LVMA 1ZTJA 1O38A 3TPIZ 2OTVA 2VB0A 3LGUA 5A2MH 3BTDE 2NU0E 3GOVB 1PQ5A 1Y5AT 4A92A 2HNTC 5JBAS 3FP7E 3T27A 1YPMH 1TWXB 1HPGA 2BMGB 1VJAU 1GJ8B 3BIUH 1T8MA 1TNGA 1PQAA 1DY9A 1V2PT 3TLOA 2Z9JA 3A82A 3HKJB 4I31A 2BDHA 4GUXA 1O3HA 1EAWA 3I77A 3RXRA 1MCTA 4IBLH 1OSSA 1D6RA 1GMHF 4ZHMU 4BAHB 1FAXA 1BMNH 1QQ4A 1Z8JB 1WCZA 4ZROA 3O8RA 3BTHE 1AGJA 3VXFH 1C2HA 1EB1H 2W3KA 2FOEA 2RA3A 1C5UA 2PKSC 1NM6A 5GJ4B 2JKHA 1GBHA 1BT7A 4FVBA 1QR3E 1EP5A 1ARBA 3RC5A 2F83A 2TBSA 2BVSH 4AB9A 3RXBA 2W3IA 1AB9B 3SV9A 1V2WT 3FZDA 1SGFA 1SHYA 1W7GH 4R0IA 1O36A 4CH8B 2ZTYA 2BTCE 1P12E 1SOTA 1XMNB 4Q7ZA 2AH4X 1VITF 5C1UA 2ZDNA 1GJ7B 1KY9A 4JMYA 1HAGE 2Y81A 1UTOA 3BTKE 3E91A 1SLXB 1O3FA 1IHSH 1Z71A 5A0CA 5DP3A 4B74A 1C1RA 1F7ZA 1VITH 4XBBA 3TNSA 1D3DB 1P10A 1ETSH 2BOHB 1NRNH 2C93B 3URCA 1LCYA 2VGCB 3FFGA 4B1TA 4D76A 1EUFA 1L2EA 1MU6B 5DGJA 2ZDAH 4DGJA 2BLOA 2GV7A 2BXUH 2PR3A 4ISOA 2BD5A 8GCHF 1YP9A 1OWDA 1SGYE 4ZUHA 5JYIA 1QURH 1DS2E 1GHBG 1GBFA 3SU2A 1C1SA 3A7ZA 4IC5A 1Q31A 5J4SA 3RU4E 1DLKB 4LOYH 1O2GH 2R9PA 2FOFA 3FVFB 1EAXA 1SGCA 1G3CA 2ZGJA 1XUKA 2XC0A 2VIPA 2Z3CA 3QTVH 1L0ZA 4NIVA 2G55A 1LQEA 2FI4E 2ZFRH 3D62A 6ESTA 1AMHA 1A46H 5A8XA 3MH6A 1YPKH 2Z3EA 1RFNA 1YBWA 5E2OA 4X8UH 2WPMS 2ZHQH 1V2JT 2BY8X 5A8ZA 1GI4A 1HDTH 1GGDB 1DXWA 1J9CH 1C2MA 1PQ7A 3MU1A 1FQ3A 1H9LB 3EA8A 4YZUA 2BDGA 5HGGA 5EW1H 2G5VA 2VIDA 2FM2A 1QJ6B 3F1SB 2KAIB 2FI3E 2VWOA 3VXEH 2BQ6B 5DKMA 5F6MA 1NC6A 1MD7A 1HAOH 2W7SA 3T2NA 1S83A 2G00A 1V6DA 2ZFSA 4TWYA 2VIOA 1C5QA 3MH7A 3QUMP 3KIDU 1MKXH 1SGRE 2A7JA 2F4LA 3BEUA 2WPJS 3TJOA 3RXOA 1NRRH 1V3XA 3ATWA 3SQHE 4DJZB 1SFIA 4O03A 4CRCA 4X1RU 4D9QA 1KLIH 1NT1A 4A1TA 2FLRH 1QL8A 1AE5A 3ESTA 6GCHF 2BLWA 2H5CA 1CHOG 3BSQA 1KXEA 1ZOMA 2Q6DA 4B76A 1O2NA 5DO4H 1C2FA 4ABDA 3STJA 1HFDA 1MTUA 2EI6A 2VH0A 1BQYA 1MTNC 2FODA 4A5TS 2BD2A 1SQAA 1C2EA 1A5GH 3A8DA 3QDZB 2A31A 4Y11E 1ZMJA 2QGRA 3BV9B 3RMNH 2R3YA 4U32A 1LVBA 2ALVA 4Y8ZA 4K1TA 4NA8A 2ZFFH 2VVVA 3SW2B 4NCYA 1G9IE 2FX4A 4Y79A 3SU0A 3T62A 1YPLH 4B2CA 1O5CB 2BY7X 2XWBI 6LPRA 1Y8TA 2P94A 1EPTC 1HAHH 4NZQA 2PGBB 1H8IH 4RSPA 1RJXB 1O2IA 1C9PA 1KXDA 1BJUA 3F6UH 5GIBA 5DK1A 1TRNA 2NU1E 4KP0A 1S6HA 1SGQE 1E37B 3EQ0H 3QWCH 1GCDA 2SGQE 3FANA 1TAWA 5F8XA 1W8BH 5DP8A 1O2VA 1HNEE 3G01A 3BEFB 1A7SA 1AFEH 1DPOA 1S82A 1TALA 2DE9A 3EA7A 4MNWA 7KMEH 1UCYE 3TGIE 3BG4C 1O2PA 1SGPE 1O2SA 1G36A 2GD4B 2PHBA 3V13A 1W11U 4KGAA 2BM2A 1TMUH 3SN8A 4ABGA 3A81A 4OS6A 2ZHFH 1AQ7A 4INLA 5B6OA 1AVGH 4MDSA 3RM2H 1Y5UT 3E6PH 1TGSZ 1KLJH 1BIOA 4K1EA 3S9CA 1AE8H 1ELGA 3I78A 4Y6DA 3SU3A 1WOFA 3IWMA 5EXMA 1GJDB 3TJNA 2O9QA 1GBIA 3BTME 2C8ZB 1E35B 3DFJA 2H1UA 2CGAA 2A45B 4MPXA 1HIAB 2FEQH 1KDQB 1OP2A 2IPHA 1K2I1 1O33A 1H9IE 3IG6B 3F9EA 2AYWA 4Q2KA 2O8WA 3DT0H 3QO6A 1W12U 3A87A 4MPUA 1DXPA 1QB9A 1K1OA 1JRTA 5GCHG 2VIQA 1C5OH 1EAIA 3U1JB 1SBWA 3H09A 4GHQA 1SI5H 1P02A 2PTCE 2G4UA 2F9NA 1N8OB 3O8CA 1MKWK 1Q2WA 2ZFQH 2GZ9A 3GCHC 2XBWA 1TGCA 1NESE 4AFSA 4GHTA 1GHAF 3ATIA 4O9VA 3SNDA 3ZZ9A 1RXPA 3RXLA 2R0LA 1ESTA 3RLWH 1A5IA 1GI2A 3SNAA 3STIA 1C1MA 2OC1A 1MTNB 2JETC 1X7AC 5FPYA 4OGYA 3ENSB 3FP6E 3PTNA 3QK1A 1K28D 4TPYA 2H5DA 2RCEA 3HK6B 2G4TA 2C3SA 1O2TA 4B75A 2VGCC 1OWHA 4Y76A 5I25A 3BEIB 2H9EH 1FY3A 1WQSA 3TNTA 1SLUB 2A4QA 1TQ0B 3RXJA 3MFJA 3UTUH 1V2NT 2GZ7A 2FIRH 2ZTXA 4MQAA 1BDAA 3UNQA 2FOGA 3ZYEA 2BDIA 1BRAA 2GV6A 1GJ6A 1FPCH 2P3FH 5T3HA 4Q7XA 1CT0E 5JB8S 3DD2H 4OS7A 3AVZA 1SGNE 1PYTC 1IQHA 2ANKH 2BQWB 4DCDA 3Q76A 1LHFH 1KXBA 1EZUC 5JBCS 3B8JA 1KXAA 4KTSA 4VGCC 1AN1E 7GCHF 3A7TA 3HPTB 3U1IB 2J38A 4SGAE 5DPAA 3URDA 3GICB 4AZ2B 1Y3UA 1ELDE 3D23A 3RLYH 1LVYA 4FUFA 3LH1A 5AFZH 1ZMLA 4NIWA 1SSXA 4QT8C 1CT4E 4XE4A 3RXMA 3SHAH 1OS8A 1VR1H 5A0AE 1F5KU 4K69A 1D3TB 1ZHMA 2GMTB 2YOLA 1ZRKA 5FCRA 3KQDA 1C9TA 2WUBA 4CHAB 1H1BA 2C90B 2P95A 4X2XA 1O39A 2XBVA 6CHAB 4ISIH 4OM9A 1TNIA 4ESTE 2Y80A 3UR6A 2VVUA 2FWWA 1K1NA 1J8AA 2AIPA 1O3KA 2P93A 3VB6A 1IQKA 2GT7A 1IQJA 1QA0A 1WQVH 1B0FA 3FAOA 2H9TH 2ZU2A 1Y5BT 1SQOA 4E7NA 1GBAA 1A0JA 1C4Y2 1UK2A 3ZZ3A 1WUNH 1GMCF 3V0XA 2ZO3H 3BG4B 1BTPA 4UE7H 4B6EA 4YOIA 1HUTH 2ASUB 2FDAA 1CGJE 1E36B 1UMAH 4SGBE 1GMCG 3RUOA 1TGBA 1GVZA 4UEHH 1QHRB 2BY6X 2G81E 2ZGCA 3SOSA 1DY8A 1O3EA 4HI3A 1O2ZA 2R2WU 2A0QB 3GY7A 1FDPA 2AGGX 3MNBA 5JPMH 1TX8A 1O2HA 1WBGB 4X8SH 1XX9A 1ZTKA 1AO5A 2BHGA 2C8YB 1CVWH 2CF9H 2A4GA 4AYYB 3L6PA 3GY6A 1L4ZA 4D9RA 5HMAA 3CENA 4H4FA 3SORA 1CU1A 3UOUA 2JETB 1GJCB 3T28A 2ZQ1A 3F9FA 3TH4H 1EZQA 1DVAH 2ZP0H 1GGDC 2AMPA 1SB1H 1A3EH 1T4UH 4RKJB 3ITIA 4NSYA 2WV9A 3NUMA 1V2ST 3SO3A 4THNH 1DWBH 1E38B 5EPYA 1IQMA 3TGJE 4ABJA 1V2MT 4IMQA 3AW0A 3QLPH 1T32A 2OQ5A 1G3EA 2FTLE 1GHVH 3BTTE 2FOAA 4CRGA 2HOBA 4I8HA 5H4IB 1WTGH 3KQBA 1BB0B 2BXTH 1QRWA 2PSXA 1UK3A 1IOEA 1UO6A 2ZG0H 2QXGA 3RC6A 1AU8A 4X8VH 4INKA 2PV9B 3L33A 3T5FH 2EC9H 1GDUA 2W26A 1ESAA 1EB2A 1C1WH 4A1VA 1WTHD 2AERH 1T8NA 1ZRBA 1P04A 3MYWA 2QV1A 2Y82A 2TGDA 2OLGA 2AMQA 1DDJA 3SUDA 1LQDB 3ZZ6A 2ZGBH 3QTOH 4ABHA 1QRZA 1T8LA 4ZHLU 5EGMA 1C1PA 1KSNA 1O3NA 1K1PA 4H42U 3RMMH 1GI1A 3H7OA 1V2QT 1BTXA 3KNXA 4JZEH 1G37A 3ELAH 3PLPA 3RXCA 1MKWH 1BMLA 5C20A 2YNAA 1Z7KA 1A2CH 1GBDA 1LHGH 3GDUA 2OUAA 1EJMA 1NO9H 3LIWA 4Q7YA 1TMBH 1GG6C 2D2DA 3D65E 3SYJA 2QF3A 1XM1A 2ZNKH 4X1QU 1NFWA 2P8OB 2BVRH 3QZRA 4CBOA 1OX1A 3GYLB 1HBTH 1D4PB 4WH8A 5PTPA 1QRXA 1MBQA 2ZDMA 4UONA 3NCLA 5LH8A 1JWTA 2GP9B 4NFEA 1C4V2 4I8JA 3F9HA 1ELTA 1YF4A 5FPSA 2ZCKP 1HJ8A 3R0FA 4IW4E 1ABJH 1S5SA 1K1LA 4X1PU 2PKAB 1L4DA 3EYDA 1GJ5H 3BN9A 3BTFE 5ESBA 3FP8E 3KN2A 1CHGA 3ZVCA 1XUHA 1O2QA 3ATMA 2HRVA 3SGQE 5E0JA 2LNCA 4FUHA 3ATKA 1T8OA 3UIRA 1V2VT 1OKXA 1HJAB 1YPJH 1GBMA 5AFYH 3SU1A 5L2ZH 1O5DH 2G8TA 3Q00A 1MU8B 2STAE 1VCWA 4X1NU 1K22H 1BMMH 2M5TA 3AASA 1AZZA 2FI5E 1H8DH 1XUJA 2ZCLP 1DM4B 3LOXA 2ZFPH 1K1JA 2VJ1A 2EI7A 5JBBS 1BMAA 3DHKH 3R3GB 1LHCH 4BANB 1ZSKA 1F0TA 1UTQA 2GVFA 5TCCA 4TY6A 1SFQB 1C5TA 1KXFA 2ZWLH 1F92A 3ZVDA 1LDTT 2WPLS 1JOUB 5B6LA 2ZFTA 2XW9A 4Y8XA 3RXQA 1MAYA 1C4U2 4WXIA 3GY8A 1AFQC 1FAKH 2FLBH 3TJUA 2GT8A 1THSH 3MOCA 1N8OC 1GHXH 1UCYK 2J9NA 1VZQH 1VITG 1ZR0A 1TPSA 4I7YH 1FIZA 1RD3B 3PWCA 1O5FH 3OTJE 1P8VC 4FVDA 5FX6A 2BDBA 3TU7H 1N6YA 4X6OA 4NIXA 3BG8A 3UQVA 1TPOA 2F9OA 1SR5C 2G52A 4IMZA 1BRCE 2JH0D 2WPIS 1GG6B 3LC3A 4YO9A 2C4FH 1P0SH 1INCA 1IQFA 4UFFH 2A4RA 1P3CA 3OSYA 2XC5A 3QGNB 1CQQA 1O3MA 2QCYA 4MPVA 1C5SA 3UFAA 2FPZA 1AKSA 1O3LA 2Y5HA 5ESTE 1KXCA 2ZU1A 1OP0A 3RXAA 1A5HA 1Z8GA 3MO6A 3RXTA 7LPRA 1HAVA 1TGTA 1ZTLA 5ETXA 4AGKA 1O2JA 3PO1C 3ZYDA 4O3UA 4FUDA 4AG1A 1QQUA 2TIOA 1TX6A 4CRAA 4GCHF 4FUGA 3SJ8A 1QTFA 3O8BA 2Z7FE 5EG4A 3UNRA 1W2KH 4CHAC 2XWAA 1ELFA 3ODFA 1TE0A 2NWNA 3TITA 1UTMA 5EXNA 1HAVB 3C1KA 1YC0A 1A1RA 4NGAH 4UD9H 1C2JA 3LJOA 1GMDG 1L1GA 3K65B 1YLDA 1UJ1A 2UUYA 4ABAA 2ZEBA 4CR9A 3CS0A 2UWOA 4IN2A 4UFGH 1P11E 4ZKNU 3GCTF 5I46H 2GDDA 1GBKA 5F8ZA 4Y10E 5JB9S 1KLTA 2FP7B 1F0RA 1KTSB 1GDQA 1CGHA 5DP5A 1U6QA 7ESTE 3OTPA 1SLWB 3RXEA 3A7XA 3Q3XA 1NFXA 2H6MA 1O2OA 2ZDLA 4WH6A 3S7HB 1ZHPA 4AORA 5ABWA 3E16B 1CHOF 2R2MB 2PKSB 2ODYB 4X6MA 3AAVA 1OWJA 2GCTC 3ZVBA 1T31A 4JZIA 1AVXA 2V35A 5A09A 1C1VH 4MNVA 1NRQH 3M3VA 1ZGIA 2CV3A 1MH0A 3RXKA 2BQ7B 1DSUA 3KCGH 3MU0A 1EKBB 1GI3A 3M7TA 1O0DH 4MG3A 3UREA 2WUCA 5T6FA 1W0ZU 2V6NA 4BAQB 3Q77A 3AK5A 2B9LA 2QC2A 5AHGH 3IITA 1XXFA 3GCNA 2WYJA 3M37A 2GCTB 2ZTZA 4E7RG 4NSVA 2RG3A 1GBCA 4AFZA 3BTGE 3VGCC 2TGPZ 2AGIX 1P2IA 2VINA 4ABFA 5CHAC 1MTSA 1E0FD 4FUJA 1SC8U 1O3BA 2PLXA 4D7FA 1FY8E 2EEKA 4FUBA 1DWDH 3TJVA 1AVWA 4CRBA 3MWIU 1B5GH 3OU0A 2ZU4A 4NZLA 3M3SA 4I8GA 1BHXB 1C2LA 1EQ9A 5EQSA 5GCHF 1DANH 4K2YA 1DFPA 3RXVA 4ZMAH 1LHDH 4CRFA 1NU9A 1TNLA 2PKAA 4ABEA 4XFQA 3A86A 1PPBH 4HZHA 2PSYA 1YCPM 1C1NA 2A32A 4Q80A 1UCYH 1DOJA 2ZZUH 2Y7ZA 4MTBA 2HPPH 4OS4A 4ZAEA 4GVUA 3SZNA 1FUJA 1TRYA 1F2SE 4GSOA 4TPIZ 1YGCH 3OYPA 5C1XA 4FXGH 5EODA 1JBUH 3M7QA 3UUZA 2Y5GA 1YPHE 1YPHC 1GJ4H 1UVPA 2VH6A 2JH6D 2WPHS 4XSKU 3SNCA 3SV8A 5EW2H 5HM2A 1D3PB 3ZVGA 2SGFE 2CJIA 1O3PB 5EQRA 1GCTB 2P3UB 1G32B 2IJOB 1GWAA 1SG8B 3OX7U 4ABBA 1O3GA 1UVTH 4CBNA 3P8NA 2R0KA 1H4WA 5A8YA 3M5LA 2R3UA 4I32A 3W95A 3F9GA 1J15A 2GTBA 2ANWA 1HAXB 1C5XB 1SGEE 3JZ2B 3RXHA 3U9AH 1O3AA 2VNTA 1QL9A 1DUAA 1GBBA 5C67A 3A88A 2O8LA 5FX5A 1WV7H 1IQIA 5K7RA 2XNIA 2BDAA 2P8OC 3F68H 1A0LA 1EATA 2GDEH 5EPNA 2FZZA 3M5NA 1GMHG 4YTAA 4ZXXH 2CHAC 5GPIB 3DFLA 3RU4D 4BAKB 2WYGA 4NIYA 4AX9H 1YLCA 4BAMB 1C5VA 3MO3A 3S9AA 1BTYA 3ATLA 5FAHA 8ESTE 4U01A 3PROA 1GHZA 1BTHH 5E8EH 2AFQB 3KL6A 1P01A 3RU4T 2UWLA 1PPCE 1C1UH 2F9UA 1O35A 4X2YA 1LPZB 1W7XH 2DE8A 1J16A 4OGXA 3SJKA 1ANCA 2HPQH 3UWIA 1QBOA 2QAAA 1TBQH 4Y0ZE 1PPEE 4ZHAA 2B8OH 1FNIA 2UWPA 3V3MA 1JMOH 3HGPA 4KTUA 1YCPH 2G51A 5LPEA 1OWIA 4DIIH 1GI9B 4AOQA 4FU8A 1NRSH 1AZ8A 4K8YA 1TNKA 3LC5A 1ZMNA 3RXIA 3A8AA 2XCNA 3ZZDA 4Y7AA 5E0GA 3WY8A 3K6YA 1TA2A 1PPFE 3VB3A 1ZYOA 2ZKSA 4FU7A 2A2QH 4WXVA 1QB6A 6GCHG 2XBXA 1O30A 1FONA 4OS2A 1OWKA 1EXFA 1XVMA 1S85A 2OQUA 5FPTA 1JRSA 1C2GA 3M36A 2G5NA 5EXLA 2HVXA 4WY3A 4MNYA 1TA6A 3NZIA 4DY7B 1O5BB 1DT2A 3VFEA 3EAJA 4U30A 1MBMA 1O2UA 3PMAB 3MHWU 3D49H 2HWLB 3A7YA 5T1VA 2PW8H 1BJVA 5IDKA 1WSSH 3SV6A 2A7CA 2I6SA 1VCPA 3TGKE 2B5TB 2ODPA 3RMLH 5L6NH 1NRPH 1N1LA 3VB4A 1XUFA 3A85A 1DE7H 5CMXH 2F9BH 3SU5A 1SPJA 1HYLA 3T25A 2ZECA 1YKTA 3EE0B 4JYVH 1GPZA 1DWCH 1DUEA 1G2MA 3NPSA 2ALPA 5L2YH 1P9SA 5K0HA 3MO9A 9ESTA 4YOGA 1TNHA 2F9PA 4WMDA 1D9IA 4X6PA 3RM0H 1V2TT 1HXFH 2A4OA 2A2XH 1ELBA 1P2QA 1UHBB 3E1XB 2SGDE 3CS7A 1MQ5A 1P09A 1NZQH 3BTQE 1FPHH 1RIWB 1UVOA 2AS9A 1C5NH 3L3TA 2IOTA 4I33A 2PFEA 5FBIA 1GI8B 1Z1IA 1O3DA 4LZ4B 2B0FA 2ZGXH 4MLFB 3SV2H 3GYMA 3ZVFA 5A0BA 1TRMA 2BX3A 2BZ6H 2Q6FA 3KQCA 3MU4A 3S7KB 1DWEH 1BBRH 1PQ8A 1VCQA 4A6LA 3PV5A 3B23B 1C2KA 1TIOA 1LPGB 1L1JA 4BXWA 1DSTA 3A83A 3A8BA 4Y71A 2CMYA 1O3IA 3U8TH 1S81A 4GAWA 3SNBA 1ANDA 1T7CA 1TABE 4OS1A 3PV4A 1AKSB 1SVPA 1FV9A 4XBCA 5GWZA 3PTBA 1HLTH 4X2VA 4GPGA 1HAZB 4Y7BA 3MH4A 1AI8H 4BXSA 1TQ7B 1ZGVA 2AIQA 4BNRA 1GJBB 4NG9H 3ZVEA 3ZZ8A 2ZDVH 5G4BA 3NKKA 2FOMB 1SGTA 2LPRA 4J2YB 4OS5A 1O37A 2J2UA 5T6GA 3SUGA 1FN8A 4O97A 3P6ZB 1C1OA 4GCHG 5T6DA 4AGJA 2VU8E 3LONA 2EA3A 1EZSC 2V0BA 4U2WA 4BTTB 4D8NA 1NTPA 1CA0C 1P2NA 4B73A 1XKAC 5C3NA 4Z6AH 2ZU5A 1TYNA 2NU4E 2OXSA 1GVKB 5JBTA 1HAPH 4CH2B 1FY5A 1P9UA 4BTIB 1EJAA 1AWHB 1P03A 5LGOA 5LPFA 1HV7A 3LDXH 1S6FA 2Z9GA 1YPGH 4B6FA 1ACBE 3MH5A 1AFQB 2KAIA 2ANYA 3RXDA 2ZPQA 1KTTB 4JZDH 1QBNA 1RS0A 1A4WH 3S0NA 2UUKB 1P2MA 1O34A 1F5LA 4AB8A 1KIGH 1A0HB 1G3DA 4XBDA 1CA8B 3LT3A 3TK5A 3A7WA 3UNSA 1ETRH 5GNDA 1PFXC 1OOKB 1GBTA 2PUXB 2D1JA 2WPKS 2QXIA 3M61U 4YLQH 3QN7A 1EZXC 4MPWA 4YT7H 3VB7A 3GY4A 1HB0B 1OXGA 4FUIA 4MNXA 1C5ZB 1BOQA 1AUTC 3PLKA 1K21H 3GCHB 3ZZ5A 4ISLA 2GCHF 4IC6A 5C5OA 1LMWB 1UVSH 1UTNA 3LH3A 1ORFA 4HGCA 4UDWH 3E0PB 1BITA 2QF0A 3SBKA 5DP7A 4K8BA 4ZXYH 4M9FA 1OPHB 3UQOA 3EA9A 1TBZH 4ZH8A 3SGBE 3SUFA 2Q1JA 5TCAA 1N6XA 2CHAB 1V2UT 1KDQA 3QGJA 3ZVAA 3W94A 2D26C 1O2RA 3TH2H 1QIXB 3TH3H 2ZHDA 5DP6A 4BAOB 4RKOB 2QYIA 2O8MA 2HNTE 1P06A 4UFEH 3UWJH 3QZQA 7GCHG 4NA9H 1NFUA 1MZAA 3P95A 4X8TH 1NY22 1BBRE 1DX5M 1GDNA 2P3TB 8GCHG 1O5AB 1THRH 3O8DA 3LJJA 1QL7A 1HRTH 1AD8H 1F5RA 4CREA 4D7GA 2STBE 3TIUA 3PWBA 1ID5H 3RXSA 5BRRE 1ZZZA 2BDCA 2H9HA 1J14A 1MCVA 3TK6A 3SJ9A 5EQQA 3NK8A 1GBEA 1LKAA 3KQEA 3H5CB 2ESTE 4K1SA 2J95A 4TWWA 4AN7A 1W3CA 1NS3A 1O3JA 2Q6GA 2OD3B 1QB1A 3UPEA 1ARCA 3GY2A 3GDVA 5E0HA 5F03A 1ELVA 1P57B 2A5KA 2BD9A 2A1DB 2ILNA 1P2OA 2F9VA 1KYNA 1P05A 3KHVA 1ZLRA 3PV2A 4PROA 3LGWA 3SZEA 3MU8A 3RP2A 2O8TA 1HXEH 2ZCHP 5IYTA 1MQ6A 1ANEA 4XOJA 4RI0A 1GBLA 1W10U 2FS9A 1QGFA 4DVAU 1Y59T 3H7TA 2VWLA 1ELEE 2BOKA 2GX4A 4DOQA 1C5WB 1SGDE 2Z6BD 1Q3XA 5DG6A 1QJ7B 2K1QA 4F4OC 1GI7B 5LPRA 3EGKH 2Y5FA 1AB9C 3ZV9A 6CHAC 1ESBA 1O2MA 2QXHA 1LPKB 2SNVA 4YLUA 4CR5A 2VWNA 2WZQA 1QA7A 1OP8A 1PPZA 4JZFH 5DP4A 4YESB 2IJD1 1ZPBA 4HFPB 2ZHWH 1JIRA 2BZAA 3P17H 2QIQA 1GMDF 1GVLA 5TJXA 1V2LT 1EAUA 1YYY1 3RXPA 3SV7A 1B7XB 2BDYA 4B2BA 1O3CA 1O2KA 2SGEE 4FUCA 5FXLA 4B71A 1C2IA 1TMTH 4K5ZA 4WMEA 2OBQA 4WJG2 3ODDA 1EX3A 5CE1A 2AEIH 3FZZA 3JZ1B 4ASHA 1O2LA 3N7OA 5C2ZA 5CHAB 2FS8A 4Z0KA 3U8RH 3V7TA 3MNXA 1BUIA 1C5MD 2BLVA 1UVUH 8KME2 3A80A 1EASA 1EPTA 1O2YA 2BD7A 2J34A 2ZQ2A 1LO6A 4JZ1A 1CSOE 2NU2E 2OC0A 1BBRK 1AHTH 1QFKH 4FU9A 3E0NB 2ZGHA 4WMFA 2F91A 4K3JA 1GJAB 2THFB 3HKIB 2ZA5A 2Z9LA 1V2RT 5SGAE 2F3CE 2Z3DA 4TY7A 1WYKA 2RDLA 1WXRA 3E3TA 1XKBC 1EP6A 4JCNA 1DLEA 1TOMH 2XBYA 3B9FH 2FTMA 3Q3YA 5J4QA 1W0YH 2HALA 3K6ZA 9LPRA 2OP9A 4KELA 2I6QA 4ZKOU 4ISHH 3QX5H 2OINA 1UTLM 2FYQA 2FOBA 2UUJB 5EOKA 1A61H 1FJSA 3NWUA 2OC7A 3U98H 3UY9A 1C1QA 3ZZAA 1PYTD 1NFYA 1ANBA 2P59A 2TGTA 1AIXH 2IN2A 1QY6A 1BTZA 1GHWH 3C27B 2BB4A 1SL3A 1BTUA 2Y6TA 1SLVB 2XRCA 1CE5A 3PM3A 1C5LH 1DITH 4O3TA 2BD3A 1IQLA 2XC4A 1BRBE 1XXDA 4NFFA 1NU7B 1TFXA 3E8LA 1FZZA 4WVPE 1QBVH 1ZSLA 2OC8A 1FY1A 1FY4A 1LVOA 4HTCH 1SHHB 3P8FA 4AFQA 1MTWA 1TX7A 1OYTH 3GISB 1UK4A 3EDXB 3MNCA 2FX6A 3M5MA 2RA0A 2VIWA 4DG4A 1S84A 2OCVB 5HM9A 1Z6JH 3KEEA 3OY6U 2WINI 4Y0YE 3SUEA 2V3OH 1HGTH 1IHTH 1CO7E 1VGCB 3E90B 1IAUA 3LGTA 4NA7A 2JH5D 2BX4A 4JYTA 4RN6A 2ZC9H 3MNSA 4UFDH 5DJ7A 2FMJA 1SGIB 1EJNA 3I29A 1TB6H 1F0UA 4NWKA 3HATH 1D3QB 1DICA 3SI3H 2GMTC 3LGIA 1V2OT 1CBWB 1W13U 3P70B 1EOJA 3RXFA 2SGPE 1ZPCA 4IN1A 1V2KT
chains in the Genus database with same CATH superfamily
3CNRA 3SNEA 1AY6H 1TPPA 1VGCC 2WHXA 3LKWA 2SFAA 1ABIH 1O2XA 2TGAA 3SJOA 3P92A 1S0QA 3RDZA 3P8GA 2TRMA 4WF8A 4XDEA 1HIAA 4X6NA 2BD8A 1K1MA 1THPB 2D8WA 2Z94A 2SGAA 1MTVA 3ZZBA 1Y3WA 1TNJA 3SGAE 1GJ9B 1RTKA 2GKVE 3K2UA 3HGNA 3SU4A 1J17T 1LTOA 2LELA 3VGCB 1HJAC 5E2PA 1TBRH 3KGPA 2XYAA 1PPHE 3VPKA 1CT2E 3MMGA 8LPRA 1IQEA 1RGQA 3LGYA 1TPAE 3A89A 2VIVA 2ULLA 3A7VA 1L1NA 2HLCA 2VVCA 3VB5A 3ZV8A 4A7IB 4CRDA 1WAYB 1BA8B 4M7GA 1MD8A 1ZPZA 5L30H 2FESH 3GY5A 1GHAG 1O32A 2NU3E 3BTWE 1MUEB 2VBCA 3M7UA 4KTCA 4ZKRU 2O8UA 4WWYA 1YPEH 3CP7A 2Z9KA 4YM9A 2ANMH 1BRUP 3LU9B 1FXYA 1PPGE 2CXVA 4BTUB 3SJIA 3U8OH 1FI8A 2GZ8A 2TPIZ 2JJ1D 1QCPA 3PB1E 1IQGA 4E05H 1C5YB 4K60A 4KKDA 1W14U 2ZDKA 4FETA 2M2AA 2XXLA 4A1XA 1TONA 1HJ9A 4VGCB 5GXPA 3DA9B 1BCUH 2FO9A 1C5RA 1FLEE 2ZHEH 1S0RA 4IGDA 4J1YA 3SHCH 3P8OA 1C5PA 1UTJA 2W5EA 2KCAA 1AWFH 1NN6A 3VEQB 1PJPA 2A5AA 2XTTB 2J94A 1F0SA 2ZF0H 4AYVB 1A3BH 1B0EA 5C0UA 3NXPA 3GCOA 1HAIH 1EOLA 1M9UA 2FYRA 3TK9A 1CBWC 1SGFG 2XOKD 1P3EA 1YCPK 2BLQA 3UR9A 1BHXF 5C5NA 3RC4A 3SI4H 2ZU3A 1O5EH 2BYAX 5BPEA 2Y7XA 1FMGA 3BTEE 4I8KA 2J4IA 4X0WU 4JYUH 3BIVH 3PO1B 2AGEX 1MZDA 1MMJN 4AG2A 1P2JA 1K1IA 1C2DA 2OK5A 1MKXK 3PMHB 1GI0A 1ELAA 4R8TB 4DIHH 2JJ2D 2BVXH 5HYOA 1SQTA 3K9XB 5AVDA 4ABIA 1T4VH 1O5GH 1G30B 2AMDA 2C8XB 4GLYA 3SQEE 3GCTG 1E34B 4X2WA 1K9OE 4X1SU 1XUGA 1MAXA 2BD4A 3A84A 1NROH 1H9HE 2ZIQH 3MTYA 3ZZ4A 4IS5A 4Y8YA 4YOJA 1TLDA 2A7HA 4JK6A 3MI4A 1OWEA 5HXFA 5AF9H 1CA0B 2W7UA 1RRKA 5EIYA 3HK3B 3KF2A 2Z9IA 1VJ9U 3S69A 4MVNA 2ZI2H 4I8LA 4INHA 1RTLA 1ZSJA 2BY9X 2DUCA 1CGIE 2ZPRA 3PYHA 1AUJA 2QA9E 3V12A 1HAYB 1BTWA 5GDSH 3M3TA 3S9BA 1Z8RA 2YMSB 3PMJA 4YT6H 3RXUA 1GBJA 3OY5U 1HCGA 2FOCA 4DT7B 1QJ1B 3GY3A 1UTKA 2UUFB 1QNJA 1GI6A 3AAUA 1Y3XA 1P2KA 5JDUB 5FHTA 1OYQA 2A5IA 3M5OA 3SU6A 1Z8IB 2SNWA 4NWLA 3RXGA 5EU8A 1WU1A 1FIWA 2FOHA 5FCKA 1JXPA 2KCOA 3LPRA 2B7DH 1YM0A 2CN0H 2GGVB 4FUEA 1TGNA 1UHBA 2P16A 2YNBA 2VWMA 2OBOA 1ZJDA 3LGVA 2PGQB 1JIMA 3A8CA 4B2AA 3PMBB 3DUXH 4ZKSU 1O2WA 2WSSD 2XCFA 1BZXE 1ZHRA 1LKBA 4LK4A 1C1TA 2BY5X 1D6WA 2WV4A 3BF6H 3TVJB 2ODQA 3U69H 1O3OA 3Q3KA 3PLBA 4AFUA 1XUIA 2HNTF 3T26A 1Y3YA 2L74A 1LHEH 3MU5A 3M35A 4LZ1H 1TOCB 2EI8A 2PTNA 5FBEA 1GL1A 1EPTB 1UTPA 3ZZCA 1RTFB 1GCTC 1GL0E 2QN5T 5C94A 1O31A 1NPMA 1RIWC 4LXBH 2GCHG 4H6SB 2V3HH 2FXRA 4BOHA 2QXJA 4E06H 2PUQH 1YLNA 1Y3VA 1IQNA 1GHBF 4H6TA 5F8TA 2CF8H 3UOPA 2WV5A 1SOZA 1ZJKA 2C8WB 1FN6A 3GDSA 1Z1JA 3RMOH 4DURA 4JK5A 2ZPSA 4F49A 4DW2U 1ETTH 1G3BA 3AW1A 4TYDA 5C1YA 1G2LA 1GI5A 2J92A 1XVOA 3T29A 3ZZ7A 2QY0B 5DP9A 1SMFE 1Z6EA 2HGTH 1GHYH 3WWBA 1ELCA 2PWXA 4ISNA 2H2ZA 1LVMA 2QF4A 2KFWA 1ZTJA 1O38A 3TPIZ 2OTVA 2VB0A 3LGUA 5A2MH 3BTDE 2NU0E 3GOVB 1PQ5A 1Y5AT 4A92A 2HNTC 5JBAS 3FP7E 3T27A 1YPMH 1TWXB 1HPGA 2BMGB 1VJAU 1GJ8B 3BIUH 1T8MA 1TNGA 1PQAA 1DY9A 1V2PT 3TLOA 2JIZD 2Z9JA 3A82A 3HKJB 4I31A 2BDHA 4GUXA 3FOAA 1O3HA 1EAWA 3I77A 3RXRA 1MCTA 4IBLH 1OSSA 1D6RA 1GMHF 4ZHMU 4BAHB 1FAXA 1BMNH 1QQ4A 1Z8JB 1WCZA 4P00A 4ZROA 3O8RA 3BTHE 1AGJA 3VXFH 1C2HA 1S6LA 1EB1H 2W3KA 2FOEA 2RA3A 1C5UA 2PKSC 1NM6A 5GJ4B 2JKHA 1GBHA 1BT7A 4FVBA 1QR3E 1EP5A 1ARBA 3RC5A 2F83A 2TBSA 5EJZA 2BVSH 4AB9A 3RXBA 2W3IA 1AB9B 3SV9A 1V2WT 3FZDA 2HVYB 1SGFA 1SHYA 4HG6A 1W7GH 4R0IA 1O36A 4CH8B 2ZTYA 5CDFE 2BTCE 1P12E 1SOTA 1XMNB 4Q7ZA 2LP6A 2AH4X 1VITF 5C1UA 2ZDNA 1GJ7B 1KY9A 4JMYA 1HAGE 2Y81A 1UTOA 3BTKE 3E91A 1SLXB 1O3FA 1IHSH 1Z71A 5A0CA 5DP3A 4F55A 4B74A 1C1RA 1F7ZA 1VITH 4XBBA 3TNSA 1D3DB 1P10A 1ETSH 2BOHB 1NRNH 2C93B 3URCA 1LCYA 2VGCB 3FFGA 5HKKD 4B1TA 4D76A 1EUFA 1L2EA 1MU6B 5DGJA 2ZDAH 4DGJA 2BLOA 2GV7A 2BXUH 2PR3A 4ISOA 2BD5A 8GCHF 1YP9A 1OWDA 1MABB 1SGYE 4ZUHA 5JYIA 1QURH 1DS2E 1GHBG 1GBFA 4Q4LA 3SU2A 1C1SA 3A7ZA 4IC5A 1Q31A 5J4SA 5FL7D 3FKSD 3RU4E 1DLKB 4LOYH 1O2GH 2R9PA 2FOFA 2V7QD 3FVFB 1EAXA 1SGCA 1G3CA 2ZGJA 1XUKA 2XC0A 2VIPA 2Z3CA 3QTVH 1L0ZA 4NIVA 2G55A 1LQEA 2FI4E 2ZFRH 3D62A 6ESTA 1AMHA 1A46H 5A8XA 3MH6A 1YPKH 2Z3EA 1RFNA 1YBWA 1YY3A 4X8UH 2WPMS 5E2OA 2ZHQH 1V2JT 3F0PA 2BY8X 5A8ZA 1GI4A 3N7EA 1HDTH 1GGDB 1DXWA 1J9CH 3GS9A 1C2MA 1PQ7A 3MU1A 3N7DA 1FQ3A 1H9LB 3EA8A 4YZUA 2BDGA 5HGGA 5EW1H 2G5VA 2VIDA 2FM2A 1QJ6B 2KZ4A 3F1SB 2KAIB 2FI3E 2VWOA 3VXEH 2BQ6B 5DKMA 5F6MA 1NC6A 1MD7A 1HAOH 2W7SA 3T2NA 1S83A 2G00A 1V6DA 2ZFSA 4TWYA 2VIOA 1C5QA 3MH7A 3QUMP 3KIDU 1MKXH 1SGRE 2A7JA 2F4LA 3N99A 3BEUA 2WPJS 3TJOA 3RXOA 1NRRH 1V3XA 3ATWA 3SQHE 4DJZB 1SFIA 4O03A 4CRCA 4X1RU 4D9QA 1KLIH 1NT1A 4A1TA 2FLRH 1QL8A 1AE5A 3ESTA 6GCHF 2BLWA 2H5CA 1CHOG 3BSQA 1KXEA 1ZOMA 2Q6DA 4B76A 1O2NA 5DO4H 1C2FA 4ABDA 3STJA 1VKYA 1HFDA 1MTUA 2EI6A 2VH0A 1BQYA 1MTNC 2FODA 4A5TS 2BD2A 1SQAA 1C2EA 1A5GH 3A8DA 3QDZB 2A31A 4Y11E 1ZMJA 2QGRA 3BV9B 3RMNH 2R3YA 4U32A 1LVBA 2ALVA 4Y8ZA 4K1TA 4NA8A 2ZFFH 2VVVA 3SW2B 4NCYA 1G9IE 2FX4A 4Y79A 3SU0A 3T62A 1YPLH 4B2CA 1O5CB 2BY7X 2W6ID 2XWBI 6LPRA 1Y8TA 2P94A 1EPTC 1HAHH 4NZQA 2PGBB 1H8IH 4RSPA 1RJXB 1O2IA 2WPDD 1C9PA 1KXDA 1BJUA 3F6UH 5GIBA 5DK1A 1TRNA 2NU1E 4KP0A 1S6HA 1SGQE 1E37B 3EQ0H 3QWCH 1GCDA 2SGQE 2V3MA 3FANA 1TAWA 5F8XA 1W8BH 5DP8A 1O2VA 1HNEE 3G01A 3BEFB 1A7SA 1AFEH 1DPOA 1S82A 1TALA 2DE9A 2KCYA 3EA7A 4MNWA 7KMEH 1UCYE 3TGIE 3BG4C 1O2PA 1SGPE 1O2SA 1G36A 2GD4B 2PHBA 3V13A 1W11U 4KGAA 2BM2A 1TMUH 3SN8A 4ABGA 3A81A 4OS6A 2ZHFH 1AQ7A 4INLA 5B6OA 1AVGH 1WDIA 4MDSA 3RM2H 1Y5UT 3E6PH 1TGSZ 1KLJH 1BIOA 4YXWD 4K1EA 3S9CA 1AE8H 1ELGA 3I78A 4Y6DA 3SU3A 1WOFA 3IWMA 5EXMA 1GJDB 5KECA 3TJNA 2KX4A 2O9QA 1GBIA 3BTME 2C8ZB 1E35B 3DFJA 2H1UA 2CGAA 2A45B 4MPXA 1HIAB 2FEQH 1COWD 1KDQB 1OP2A 2IPHA 1K2I1 1O33A 2CK3D 1H9IE 3IG6B 3F9EA 2AYWA 4Q2KA 2O8WA 3DT0H 3QO6A 1W12U 3A87A 4MPUA 1DXPA 1NBME 1QB9A 1K1OA 1JRTA 3F2HA 5GCHG 2VIQA 1C5OH 1EAIA 3U1JB 1SBWA 3H09A 4GHQA 1SI5H 1P02A 2PTCE 2G4UA 2F9NA 1N8OB 4ASUD 3O8CA 1MKWK 1Q2WA 2ZFQH 2GZ9A 3GCHC 2XBWA 1TGCA 1NESE 4AFSA 4GHTA 1GHAF 3ATIA 4O9VA 3SNDA 3ZZ9A 2EY4C 1RXPA 3RXLA 2R0LA 1ESTA 3RLWH 1A5IA 1BMFD 1GI2A 3SNAA 3STIA 1C1MA 2OC1A 1MTNB 2JETC 1X7AC 5FPYA 1QZ8A 4OGYA 3ENSB 3FP6E 3PTNA 3QK1A 1K28D 4TPYA 2H5DA 2RCEA 3HK6B 2G4TA 2C3SA 1O2TA 4B75A 2VGCC 1OWHA 4Y76A 5I25A 3BEIB 2H9EH 1FY3A 1WQSA 2HLDD 3TNTA 1SLUB 2A4QA 1TQ0B 3RXJA 3MFJA 3UTUH 1V2NT 2GZ7A 2FIRH 2ZTXA 4MQAA 1BDAA 3UNQA 2FOGA 3ZYEA 2BDIA 1BRAA 2GV6A 1GJ6A 1FPCH 2P3FH 5T3HA 4Q7XA 4P02A 1CT0E 5JB8S 3DD2H 4OS7A 3AVZA 1SGNE 1PYTC 1IQHA 4AC9A 2ANKH 2BQWB 4DCDA 3Q76A 1LHFH 1KXBA 1EZUC 5JBCS 3B8JA 1KXAA 4KTSA 4VGCC 1AN1E 7GCHF 1E1RD 3A7TA 3HPTB 3U1IB 2J38A 4SGAE 5DPAA 3URDA 3GICB 4AZ2B 4Z1MD 1Y3UA 1ELDE 3D23A 3RLYH 1LVYA 4FUFA 3LH1A 5AFZH 1ZMLA 4NIWA 1SSXA 4QT8C 1CT4E 4XE4A 3RXMA 3SHAH 1OS8A 1VR1H 5A0AE 1F5KU 3KQ5A 4K69A 1D3TB 1ZHMA 2GMTB 2YOLA 1ZRKA 5FCRA 3KQDA 1C9TA 2WUBA 4CHAB 1H1BA 2C90B 2P95A 4FOUC 4X2XA 1O39A 2XBVA 6CHAB 4ISIH 4OM9A 1TNIA 4ESTE 2Y80A 3UR6A 2VVUA 2FWWA 1K1NA 1J8AA 2AIPA 1O3KA 2P93A 3VB6A 1IQKA 2GT7A 1IQJA 1QA0A 1WQVH 1B0FA 3FAOA 2H9TH 2ZU2A 1Y5BT 1SQOA 4E7NA 1GBAA 1A0JA 1C4Y2 1UK2A 3ZZ3A 1WUNH 1GMCF 3V0XA 2ZO3H 3BG4B 1BTPA 5EJLA 4DT4A 4UE7H 4B6EA 4YOIA 2KCPA 1HUTH 2ASUB 2FDAA 1CGJE 1E36B 1UMAH 4SGBE 3WW7A 1GMCG 3RUOA 1TGBA 1GVZA 4UEHH 1QHRB 2BY6X 2G81E 2ZGCA 3SOSA 1DY8A 1O3EA 4HI3A 1O2ZA 2R2WU 2A0QB 3GY7A 1FDPA 2AGGX 3MNBA 5JPMH 1TX8A 1O2HA 1WBGB 4X8SH 1XX9A 1ZTKA 1AO5A 2BHGA 2C8YB 1CVWH 2CF9H 2A4GA 4AYYB 3L6PA 3GY6A 1L4ZA 4D9RA 5HMAA 3CENA 4H4FA 3SORA 1CU1A 2RFKC 3UOUA 2JETB 1GJCB 3T28A 2ZQ1A 1E79D 3F9FA 3TH4H 1EZQA 1DVAH 2ZP0H 1GGDC 2AMPA 1SB1H 1A3EH 1T4UH 4RKJB 3ITIA 4NSYA 2WV9A 3NUMA 1V2ST 3SO3A 4THNH 1DWBH 1E38B 5EPYA 1IQMA 3UAIC 4ABJA 1V2MT 4IMQA 3AW0A 3TGJE 3QLPH 1T32A 2OQ5A 1G3EA 2FTLE 1GHVH 3BTTE 2FOAA 4CRGA 2HOBA 4I8HA 5H4IB 1WTGH 3KQBA 1BB0B 2BXTH 1QRWA 2PSXA 1UK3A 1IOEA 1UO6A 2ZG0H 2QXGA 3RC6A 1AU8A 4X8VH 4INKA 2PV9B 3L33A 3T5FH 2EC9H 1GDUA 2W26A 4TSFD 1ESAA 1EB2A 1C1WH 4A1VA 1WTHD 2AERH 1T8NA 1ZRBA 1P04A 3MYWA 5HIYA 2QV1A 2Y82A 2TGDA 2OLGA 2AMQA 1DDJA 3SUDA 1LQDB 3ZZ6A 2ZGBH 3VG8A 3QTOH 4ABHA 1QRZA 1T8LA 4ZHLU 5EGMA 1C1PA 1KSNA 1O3NA 1K1PA 4H42U 3RMMH 1GI1A 3H7OA 1V2QT 1BTXA 3KNXA 4JZEH 1G37A 3ELAH 3PLPA 3RXCA 1MKWH 1BMLA 5C20A 2YNAA 1Z7KA 2IPQX 1A2CH 1GBDA 1LHGH 3GDUA 2OUAA 1EJMA 1NO9H 3LIWA 4Q7YA 1TMBH 1GG6C 2D2DA 3D65E 3SYJA 2QF3A 1XM1A 2ZNKH 4X1QU 2XNDD 1NFWA 2P8OB 2BVRH 3QZRA 4CBOA 1OX1A 3GYLB 1HBTH 1OHHD 1D4PB 1NBMD 4WH8A 5PTPA 1QRXA 1MBQA 2ZDMA 4UONA 3NCLA 5LH8A 1JWTA 2GP9B 4NFEA 1C4V2 4I8JA 3F9HA 1ELTA 1YF4A 2PP6A 5FPSA 2ZCKP 1HJ8A 3R0FA 2JDID 4IW4E 1ABJH 1S5SA 1K1LA 4X1PU 4ZCNA 1SQRA 2PKAB 1L4DA 3EYDA 5KGOA 1GJ5H 3BN9A 3BTFE 5ESBA 4I86A 3FP8E 3KN2A 1CHGA 3ZVCA 1XUHA 1O2QA 3ATMA 2HRVA 3SGQE 5E0JA 2LNCA 4FUHA 3ATKA 1T8OA 3UIRA 1V2VT 1OKXA 1HJAB 1YPJH 1GBMA 5AFYH 3SU1A 5L2ZH 1O5DH 2G8TA 3Q00A 1MU8B 2STAE 1VCWA 2W6JD 1K22H 4X1NU 1BMMH 2M5TA 3AASA 1AZZA 2FI5E 1H8DH 1XUJA 2ZCLP 1DM4B 3LOXA 2ZFPH 1K1JA 2VJ1A 2EI7A 5JBBS 1BMAA 3DHKH 3R3GB 1LHCH 4BANB 1ZSKA 1F0TA 1UTQA 2F43B 2GVFA 5TCCA 4TY6A 1SFQB 1C5TA 1KXFA 2ZWLH 1F92A 3ZVDA 1LDTT 2WPLS 1JOUB 5B6LA 2ZFTA 2XW9A 4Y8XA 3RXQA 1MAYA 1C4U2 4WXIA 3GY8A 1AFQC 1FAKH 2FLBH 3TJUA 2GT8A 1THSH 3MOCA 1N8OC 1GHXH 1UCYK 2J9NA 1VZQH 1VITG 1ZR0A 1TPSA 4I7YH 1FIZA 1RD3B 3PWCA 1O5FH 3OTJE 1P8VC 4FVDA 5FX6A 2BDBA 3TU7H 1N6YA 4X6OA 4NIXA 3BG8A 3UQVA 1TPOA 2F9OA 1SR5C 2G52A 4IMZA 1BRCE 2JH0D 2WPIS 1GG6B 3LC3A 4YO9A 2C4FH 1P0SH 1INCA 1IQFA 4UFFH 2A4RA 1P3CA 3OSYA 2XC5A 3ZIAD 3QGNB 1CQQA 1O3MA 2QCYA 4MPVA 1C5SA 3OEHD 2FPZA 3UFAA 1AKSA 1O3LA 2Y5HA 5ESTE 1KXCA 2ZU1A 1OP0A 3RXAA 1A5HA 1Z8GA 3MO6A 3RXTA 7LPRA 1HAVA 1TGTA 1ZTLA 5ETXA 4AGKA 1O2JA 3PO1C 3ZYDA 4O3UA 4FUDA 4AG1A 1QQUA 2K0QA 2TIOA 1TX6A 4CRAA 4GCHF 4FUGA 3SJ8A 1QTFA 3O8BA 2Z7FE 5EG4A 3UNRA 1W2KH 4CHAC 2XWAA 1ELFA 3ODFA 1TE0A 2NWNA 3TITA 1UTMA 1K0HA 5EXNA 1HAVB 3C1KA 1YC0A 1A1RA 4NGAH 4UD9H 1C2JA 3LJOA 1GMDG 1L1GA 3K65B 1YLDA 1UJ1A 2UUYA 4ABAA 2ZEBA 4CR9A 1UW7A 2UWOA 3CS0A 4IN2A 4UFGH 1P11E 4ZKNU 3GCTF 5I46H 2GDDA 1GBKA 5F8ZA 4Y10E 5JB9S 1KLTA 2FP7B 1F0RA 1KTSB 1GDQA 1CGHA 5DP5A 1U6QA 7ESTE 3OTPA 1SLWB 3RXEA 3A7XA 2L6OA 3Q3XA 1NFXA 2H6MA 1O2OA 2ZDLA 4WH6A 3S7HB 1ZHPA 4AORA 5ABWA 3E16B 1CHOF 2R2MB 2PKSB 2ODYB 4X6MA 3AAVA 1OWJA 2GCTC 3ZVBA 1T31A 4JZIA 1AVXA 2V35A 5A09A 1C1VH 4MNVA 1NRQH 3M3VA 1ZGIA 2CV3A 1MH0A 3RXKA 2BQ7B 1DSUA 3KCGH 3MU0A 1EKBB 1GI3A 3M7TA 1O0DH 4MG3A 2K8IA 3UREA 2WUCA 5T6FA 1W0ZU 2V6NA 4BAQB 3Q77A 3AK5A 2B9LA 2QC2A 5AHGH 3IITA 1XXFA 3GCNA 2WYJA 3M37A 2GCTB 2ZTZA 4E7RG 4NSVA 2RG3A 1GBCA 4AFZA 3BTGE 3VGCC 2TGPZ 2AGIX 3DCLA 1P2IA 2VINA 4ABFA 5CHAC 1MTSA 1E0FD 4FUJA 1SC8U 1O3BA 2PLXA 4D7FA 1FY8E 2EEKA 4FUBA 1DWDH 3TJVA 1AVWA 4CRBA 3MWIU 1B5GH 3OU0A 2ZU4A 4NZLA 3M3SA 4I8GA 1BHXB 1C2LA 1EQ9A 5EQSA 5GCHF 1DANH 4K2YA 1DFPA 3RXVA 4ZMAH 1LHDH 4CRFA 1NU9A 1TNLA 2PKAA 4ABEA 4XFQA 3A86A 1PPBH 4HZHA 2PSYA 1YCPM 1C1NA 2A32A 4Q80A 1UCYH 1DOJA 2ZZUH 2Y7ZA 4MTBA 2HPPH 4OS4A 4ZAEA 4GVUA 3SZNA 1FUJA 1TRYA 1F2SE 4GSOA 1W0KD 4TPIZ 1YGCH 4RT1A 3OYPA 3KYGA 5C1XA 4FXGH 5EODA 1JBUH 3M7QA 3UUZA 2Y5GA 1YPHE 1YPHC 1GJ4H 1UVPA 2VH6A 2JH6D 2WPHS 4XSKU 3SNCA 3SV8A 5EW2H 5HM2A 1D3PB 3ZVGA 2SGFE 2CJIA 1O3PB 2J97A 5EQRA 2EQNA 1GCTB 2P3UB 1G32B 2IJOB 1GWAA 1SG8B 3OX7U 4ABBA 1O3GA 3DSPA 1UVTH 4CBNA 3P8NA 2R0KA 1H4WA 5A8YA 3M5LA 2R3UA 4I32A 2J5UA 3W95A 3F9GA 1J15A 2GTBA 2ANWA 1HAXB 1C5XB 1SGEE 3JZ2B 3RXHA 3U9AH 1O3AA 2VNTA 1QL9A 1DUAA 1GBBA 5C67A 3A88A 2O8LA 2GJGA 5FX5A 1WV7H 1IQIA 5K7RA 2XNIA 2BDAA 2P8OC 3F68H 1A0LA 1EATA 2GDEH 5EPNA 2FZZA 3M5NA 1GMHG 4YTAA 4ZXXH 2CHAC 5GPIB 3DFLA 3RU4D 4BAKB 2WYGA 4NIYA 4AX9H 1YLCA 4BAMB 1C5VA 3MO3A 3S9AA 1BTYA 3ATLA 5FAHA 8ESTE 4U01A 3PROA 1GHZA 1BTHH 5E8EH 2AFQB 3KL6A 1P01A 3RU4T 2UWLA 1PPCE 1C1UH 2F9UA 1O35A 4X2YA 1LPZB 1W7XH 2DE8A 1J16A 4OGXA 3SJKA 1ANCA 2HPQH 3UWIA 1QBOA 2QAAA 1TBQH 4Y0ZE 1PPEE 4ZHAA 2B8OH 1FNIA 2UWPA 3V3MA 1JMOH 3HGPA 4KTUA 5DSFA 1YCPH 2G51A 5LPEA 1OWIA 4DIIH 1GI9B 4AOQA 4FU8A 1NRSH 1AZ8A 4K8YA 1TNKA 3LC5A 1ZMNA 3RXIA 3A8AA 2XCNA 3ZZDA 3PRDA 4Y7AA 5E0GA 3WY8A 3K6YA 1TA2A 1PPFE 3VB3A 1ZYOA 2ZKSA 4FU7A 2A2QH 4WXVA 1QB6A 6GCHG 3UB0A 2XBXA 1O30A 1FONA 4OS2A 1OWKA 1EXFA 1XVMA 1S85A 2OQUA 5FPTA 1JRSA 1C2GA 3M36A 2G5NA 5EXLA 2HVXA 5EJ1A 4WY3A 4MNYA 1TA6A 2YMSD 3NZIA 4DY7B 1O5BB 1DT2A 3VFEA 3EAJA 4U30A 1MBMA 1O2UA 3PMAB 3MHWU 2KM0A 2HWLB 3D49H 3A7YA 3NRLA 5T1VA 2PW8H 1BJVA 5IDKA 1WSSH 3SV6A 2A7CA 2I6SA 1VCPA 3TGKE 2B5TB 2ODPA 3RMLH 5L6NH 1NRPH 1N1LA 3VB4A 1XUFA 3A85A 1DE7H 5CMXH 3U28C 2F9BH 3SU5A 1SPJA 1HYLA 3T25A 2ZECA 1YKTA 3EE0B 4JYVH 1GPZA 1DWCH 1DUEA 1H8HD 1G2MA 3NPSA 2ALPA 4ACBA 5L2YH 1P9SA 5K0HA 3MO9A 9ESTA 4YOGA 1TNHA 2F9PA 4WMDA 1D9IA 4X6PA 3RM0H 1V2TT 1HXFH 2A4OA 4Q63A 2A2XH 1ELBA 3PRBA 1P2QA 1UHBB 3E1XB 2SGDE 3CS7A 1MQ5A 1P09A 1NZQH 3BTQE 1FPHH 1RIWB 1UVOA 2AS9A 1C5NH 3L3TA 3F0OA 2IOTA 4I33A 2PFEA 5FBIA 1GI8B 1Z1IA 1O3DA 4LZ4B 2B0FA 2ZGXH 4MLFB 3SV2H 3GYMA 3ZVFA 5A0BA 1TRMA 2BX3A 2BZ6H 2Q6FA 2QF5A 3KQCA 3MU4A 5C17A 3F3BA 3S7KB 1DWEH 1BBRH 1PQ8A 1VCQA 4A6LA 3PV5A 3B23B 1C2KA 1TIOA 1LPGB 1L1JA 4BXWA 1DSTA 3A83A 3A8BA 4Y71A 2CMYA 1O3IA 3U8TH 1S81A 4GAWA 3SNBA 1ANDA 1EFRD 1T7CA 1TABE 4OS1A 3PV4A 1AKSB 4RT0A 1SVPA 1FV9A 4XBCA 5GWZA 3PTBA 1HLTH 4X2VA 4GPGA 1HAZB 4Y7BA 3MH4A 1AI8H 4BXSA 1TQ7B 1ZGVA 2AIQA 4BNRA 1GJBB 4NG9H 3ZVEA 3ZZ8A 2ZDVH 5G4BA 3NKKA 2FOMB 1SGTA 2LPRA 4J2YB 4OS5A 1O37A 1YWUA 2J2UA 5T6GA 3SUGA 1FN8A 4O97A 2RDEA 3P6ZB 1C1OA 4GCHG 5T6DA 4AGJA 2VU8E 3LONA 2EA3A 1EZSC 2V0BA 4U2WA 4BTTB 4D8NA 1NTPA 1CA0C 1P2NA 4B73A 1XKAC 5C3NA 4Z6AH 2ZU5A 1TYNA 2NU4E 2OXSA 1GVKB 5JBTA 1HAPH 4CH2B 1FY5A 1P9UA 4BTIB 1EJAA 1AWHB 1P03A 5LGOA 5LPFA 1HV7A 3LDXH 1S6FA 2Z9GA 1YPGH 4B6FA 1ACBE 3MH5A 1AFQB 2KAIA 2ANYA 3RXDA 2ZPQA 1KTTB 4JZDH 1QBNA 1RS0A 1A4WH 3S0NA 2UUKB 1P2MA 1O34A 1F5LA 4XD7D 4AB8A 1KIGH 1A0HB 1G3DA 3DSOA 4XBDA 3WWFA 1CA8B 3LT3A 3FO8D 3TK5A 3A7WA 3UNSA 1ETRH 1W0JD 5GNDA 1PFXC 1OOKB 1GBTA 2PUXB 2D1JA 2WPKS 2QXIA 3M61U 4YLQH 3QN7A 1EZXC 4MPWA 4YT7H 3OAAD 3VB7A 3GY4A 1HB0B 1OXGA 4FUIA 4MNXA 1C5ZB 1BOQA 1AUTC 3PLKA 1K21H 3GCHB 3ZZ5A 4ISLA 2GCHF 4IC6A 5C5OA 1LMWB 1UVSH 1UTNA 3LH3A 1ORFA 4HGCA 4UDWH 3E0PB 1BITA 2QF0A 3SBKA 5DP7A 4K8BA 4ZXYH 4M9FA 1OPHB 3UQOA 3EA9A 1TBZH 4ZH8A 3SGBE 3SUFA 3KYFA 2Q1JA 5TCAA 1N6XA 2CHAB 1V2UT 1KDQA 3QGJA 3F2GA 3ZVAA 3W94A 2D26C 1O2RA 3TH2H 1QIXB 3TH3H 2ZHDA 5DP6A 4BAOB 4RKOB 2QYIA 2O8MA 2HNTE 1P06A 4UFEH 3UWJH 3QZQA 7GCHG 4NA9H 1NFUA 1MZAA 3P95A 4X8TH 1NY22 1BBRE 1DX5M 1GDNA 2P3TB 8GCHG 1O5AB 1THRH 3O8DA 3LJJA 1QL7A 1HRTH 1AD8H 1KMHB 1F5RA 4CREA 4D7GA 2STBE 3TIUA 3PWBA 1ID5H 3RXSA 1SKYE 1ZZZA 2BDCA 5BRRE 2H9HA 1E1QD 1J14A 1MCVA 3TK6A 3SJ9A 5EQQA 3NK8A 1GBEA 1LKAA 3KQEA 3H5CB 2ESTE 4K1SA 2J95A 4TWWA 4AN7A 1W3CA 1NS3A 1O3JA 2Q6GA 2OD3B 1QB1A 3UPEA 1ARCA 3GY2A 3GDVA 5E0HA 5F03A 1ELVA 1P57B 2A5KA 2BD9A 2A1DB 2ILNA 1P2OA 2F9VA 2J98B 1KYNA 1P05A 3KHVA 1ZLRA 3PV2A 4PROA 3LGWA 3SZEA 3MU8A 3RP2A 2O8TA 1HXEH 2ZCHP 5IYTA 1MQ6A 1ANEA 4RI0A 4XOJA 1GBLA 1W10U 2FS9A 1QGFA 1H8ED 4DVAU 1Y59T 3H7TA 2VWLA 1ELEE 2BOKA 2GX4A 4DOQA 1C5WB 1SGDE 2Z6BD 1Q3XA 5DG6A 1QJ7B 2K1QA 4F4OC 1GI7B 5LPRA 3EGKH 2Y5FA 1AB9C 3ZV9A 5IK2D 6CHAC 1ESBA 1O2MA 2QXHA 1LPKB 2SNVA 4YLUA 4CR5A 2VWNA 2WZQA 3OE7D 1QA7A 1OP8A 1PPZA 3F2FA 4JZFH 5DP4A 4YESB 2IJD1 1ZPBA 4HFPB 2ZHWH 1JIRA 2BZAA 3P17H 2QIQA 1GMDF 1GVLA 5TJXA 1V2LT 1EAUA 1YYY1 3RXPA 3SV7A 1B7XB 2BDYA 4B2BA 1O3CA 1O2KA 2SGEE 5C0TA 4FUCA 5FXLA 4B71A 1C2IA 1TMTH 4K5ZA 4WMEA 2OBQA 4WJG2 3ODDA 1EX3A 5CE1A 2AEIH 3FZZA 3JZ1B 4ASHA 1O2LA 3N7OA 5C2ZA 4TT3D 5CHAB 2FS8A 4Z0KA 3U8RH 3V7TA 3MNXA 1BUIA 1C5MD 2BLVA 1UVUH 8KME2 3A80A 1EASA 1EPTA 1O2YA 2BD7A 2J34A 2KR7A 2ZQ2A 1LO6A 4JZ1A 1CSOE 2NU2E 2OC0A 1BBRK 1AHTH 1QFKH 4FU9A 3E0NB 2ZGHA 4WMFA 2F91A 4K3JA 5CHBA 1GJAB 2THFB 3HKIB 2ZA5A 2Z9LA 1V2RT 5SGAE 2F3CE 2Z3DA 4TY7A 1WYKA 5DN6D 2RDLA 1WXRA 3E3TA 1XKBC 1EP6A 4JCNA 1DLEA 1TOMH 2XBYA 3B9FH 2FTMA 3Q3YA 5J4QA 1W0YH 2HALA 3K6ZA 3EE7A 9LPRA 2OP9A 4KELA 2I6QA 4ZKOU 4ISHH 3QX5H 2OINA 1UTLM 2FYQA 2YMSC 4F48B 2FOBA 2UUJB 5EOKA 1A61H 1FJSA 3NWUA 2OC7A 3U98H 3UY9A 1C1QA 3ZZAA 4ACAA 1PYTD 1NFYA 1ANBA 2P59A 2TGTA 1AIXH 2IN2A 1QY6A 1BTZA 1GHWH 3C27B 2BB4A 1SL3A 1BTUA 2Y6TA 1SLVB 2XRCA 1CE5A 3OFND 3PM3A 5F53A 1C5LH 1DITH 4O3TA 2BD3A 1IQLA 2XC4A 1BRBE 1XXDA 4NFFA 1NU7B 1TFXA 3E8LA 1FZZA 4WVPE 1QBVH 1ZSLA 2OC8A 1FY1A 1FY4A 1LVOA 4HTCH 1SHHB 3P8FA 4AFQA 1MTWA 1TX7A 1OYTH 3GISB 1UK4A 3EDXB 3MNCA 5KEDA 2FX6A 3M5MA 2RA0A 2VIWA 5HIZA 4DG4A 1S84A 2OCVB 5HM9A 1Z6JH 2QE7D 3KEEA 3OY6U 2WINI 3OEED 3FN8A 4Y0YE 3SUEA 2V3OH 1HGTH 1IHTH 1CO7E 1VGCB 2AHME 3E90B 1IAUA 3LGTA 4NA7A 2JH5D 2BX4A 4JYTA 4RN6A 2ZC9H 3MNSA 4UFDH 5DJ7A 2FMJA 3MQKC 1SGIB 1EJNA 3I29A 1TB6H 1F0UA 4NWKA 4XRNA 2J98A 3HATH 1D3QB 1DICA 3DSGA 2GMTC 3LGIA 3SI3H 1V2OT 1CBWB 1W13U 3P70B 1EOJA 3RXFA 2SGPE 1ZPCA 4IN1A 1V2KT 1FX0B 3W1EA
chains in the Genus database with same CATH topology
3SNEA 1AY6H 1TPPA 1VGCC 3LKWA 2WHXA 2SFAA 1ABIH 1O2XA 2TGAA 3SJOA 3P92A 1S0QA 3RDZA 3P8GA 2TRMA 4WF8A 4XDEA 1HIAA 4X6NA 2BD8A 1K1MA 1THPB 2D8WA 2Z94A 2SGAA 1MTVA 3ZZBA 1Y3WA 1TNJA 3SGAE 1GJ9B 1RTKA 2GKVE 3K2UA 3HGNA 3SU4A 1J17T 1LTOA 2LELA 3VGCB 1HJAC 5E2PA 1TBRH 3KGPA 2XYAA 1PPHE 3VPKA 1CT2E 3MMGA 8LPRA 1IQEA 1RGQA 3LGYA 1TPAE 3A89A 2VIVA 2ULLA 3A7VA 1L1NA 2HLCA 2VVCA 3VB5A 3ZV8A 4A7IB 4CRDA 1WAYB 1BA8B 4M7GA 1MD8A 1ZPZA 5L30H 2FESH 3GY5A 1GHAG 1O32A 2NU3E 3BTWE 1MUEB 4KTCA 3M7UA 2VBCA 4ZKRU 2O8UA 4WWYA 1YPEH 3CP7A 2Z9KA 4YM9A 2ANMH 1BRUP 3LU9B 1FXYA 1PPGE 2CXVA 4BTUB 3SJIA 3U8OH 1FI8A 2GZ8A 2TPIZ 2JJ1D 1QCPA 3PB1E 1IQGA 4E05H 1C5YB 4K60A 4KKDA 1W14U 2ZDKA 4FETA 2M2AA 2XXLA 4A1XA 1TONA 1HJ9A 4VGCB 5GXPA 3DA9B 1BCUH 2FO9A 1C5RA 1FLEE 2ZHEH 1S0RA 4IGDA 4J1YA 3SHCH 3P8OA 1C5PA 1UTJA 2W5EA 2KCAA 1AWFH 1NN6A 3VEQB 1PJPA 2A5AA 2XTTB 2J94A 1F0SA 2ZF0H 4AYVB 1A3BH 1B0EA 5C0UA 3NXPA 3GCOA 1HAIH 1EOLA 1M9UA 2FYRA 3TK9A 1CBWC 1SGFG 2XOKD 1P3EA 1YCPK 2BLQA 3UR9A 1BHXF 5C5NA 3RC4A 3SI4H 2ZU3A 1O5EH 2BYAX 5BPEA 2Y7XA 1FMGA 3BTEE 4I8KA 2J4IA 4X0WU 4JYUH 3BIVH 3PO1B 2AGEX 1MZDA 1MMJN 4AG2A 1P2JA 1K1IA 1C2DA 2OK5A 1MKXK 3PMHB 1GI0A 1ELAA 4R8TB 4DIHH 2JJ2D 2BVXH 5HYOA 1SQTA 3K9XB 5AVDA 4ABIA 1T4VH 1O5GH 1G30B 2AMDA 2C8XB 4GLYA 3SQEE 3GCTG 1E34B 4X2WA 1K9OE 4X1SU 1XUGA 1MAXA 2BD4A 3A84A 1NROH 1H9HE 2ZIQH 3MTYA 3ZZ4A 4IS5A 4Y8YA 4YOJA 1TLDA 2A7HA 4JK6A 3MI4A 1OWEA 5HXFA 5AF9H 1CA0B 2W7UA 1RRKA 3HK3B 3KF2A 2Z9IA 1VJ9U 3S69A 4MVNA 2ZI2H 4I8LA 4INHA 1RTLA 1ZSJA 2BY9X 2DUCA 1CGIE 2ZPRA 3PYHA 1AUJA 2QA9E 3V12A 1HAYB 1BTWA 5GDSH 3M3TA 3S9BA 1Z8RA 2YMSB 3PMJA 4YT6H 3RXUA 1GBJA 3OY5U 1HCGA 2FOCA 4DT7B 1QJ1B 3GY3A 1UTKA 2UUFB 1QNJA 1GI6A 3AAUA 1Y3XA 1P2KA 5JDUB 5FHTA 1OYQA 2A5IA 3M5OA 3SU6A 1Z8IB 2SNWA 4NWLA 3RXGA 5EU8A 1WU1A 1FIWA 2FOHA 5FCKA 1JXPA 3LPRA 2KCOA 2B7DH 1YM0A 2CN0H 2GGVB 4FUEA 1TGNA 1UHBA 2P16A 2YNBA 2VWMA 2OBOA 1ZJDA 3LGVA 2PGQB 1JIMA 3A8CA 4B2AA 3PMBB 3DUXH 4ZKSU 1O2WA 2WSSD 2XCFA 1BZXE 1ZHRA 1LKBA 4LK4A 1C1TA 2WV4A 2BY5X 1D6WA 3BF6H 3TVJB 2ODQA 3U69H 1O3OA 3Q3KA 3PLBA 4AFUA 1XUIA 2HNTF 3T26A 1Y3YA 1LHEH 3MU5A 3M35A 4LZ1H 1TOCB 2EI8A 2PTNA 5FBEA 1GL1A 1EPTB 1UTPA 3ZZCA 1RTFB 1GCTC 1GL0E 2QN5T 1O31A 1NPMA 1RIWC 4LXBH 2GCHG 4H6SB 2V3HH 2FXRA 4BOHA 2QXJA 4E06H 2PUQH 1Y3VA 1IQNA 1GHBF 4H6TA 5F8TA 2CF8H 3UOPA 2WV5A 1SOZA 1ZJKA 2C8WB 1FN6A 3GDSA 1Z1JA 3RMOH 4DURA 4JK5A 2ZPSA 4F49A 4DW2U 1ETTH 1G3BA 3AW1A 4TYDA 5C1YA 1G2LA 1GI5A 2J92A 1XVOA 3T29A 3ZZ7A 2QY0B 5DP9A 1SMFE 1Z6EA 2HGTH 1GHYH 3WWBA 1ELCA 2PWXA 4ISNA 2H2ZA 1LVMA 2QF4A 2KFWA 1ZTJA 1O38A 3TPIZ 2OTVA 2VB0A 3LGUA 5A2MH 3BTDE 2NU0E 3GOVB 1PQ5A 1Y5AT 4A92A 2HNTC 5JBAS 3FP7E 3T27A 1YPMH 1TWXB 1HPGA 2BMGB 1VJAU 1GJ8B 3BIUH 1T8MA 1TNGA 1PQAA 1DY9A 1V2PT 3TLOA 2JIZD 2Z9JA 3A82A 3HKJB 4I31A 2BDHA 4GUXA 3FOAA 1O3HA 1EAWA 3I77A 3RXRA 1MCTA 4IBLH 1OSSA 1D6RA 1GMHF 4ZHMU 4BAHB 1FAXA 1BMNH 1QQ4A 1Z8JB 1WCZA 4ZROA 3O8RA 3BTHE 1AGJA 3VXFH 1C2HA 1S6LA 1EB1H 2W3KA 2FOEA 2RA3A 1C5UA 2PKSC 1NM6A 5GJ4B 2JKHA 1GBHA 1BT7A 4FVBA 1QR3E 1EP5A 1ARBA 3RC5A 2F83A 2TBSA 2BVSH 4AB9A 3RXBA 2W3IA 1AB9B 3SV9A 1V2WT 3FZDA 1SGFA 1SHYA 1W7GH 4R0IA 1O36A 4CH8B 2ZTYA 5CDFE 2BTCE 1P12E 1SOTA 1XMNB 4Q7ZA 2AH4X 1VITF 5C1UA 2ZDNA 1GJ7B 1KY9A 4JMYA 1HAGE 2Y81A 1UTOA 3BTKE 3E91A 1SLXB 1O3FA 1IHSH 1Z71A 5A0CA 5DP3A 4F55A 4B74A 1C1RA 1F7ZA 1VITH 4XBBA 3TNSA 1D3DB 1P10A 1ETSH 2BOHB 1NRNH 2C93B 3URCA 1LCYA 2VGCB 3FFGA 5HKKD 4B1TA 4D76A 1EUFA 1L2EA 1MU6B 5DGJA 2ZDAH 4DGJA 2BLOA 2GV7A 2BXUH 2PR3A 4ISOA 2BD5A 8GCHF 1YP9A 1OWDA 1MABB 1SGYE 4ZUHA 5JYIA 1QURH 1DS2E 1GHBG 1GBFA 4Q4LA 3SU2A 1C1SA 3A7ZA 4IC5A 1Q31A 5J4SA 5FL7D 3FKSD 3RU4E 1DLKB 4LOYH 1O2GH 2R9PA 2FOFA 3FVFB 2V7QD 1EAXA 1SGCA 1G3CA 2ZGJA 1XUKA 2XC0A 2VIPA 2Z3CA 3QTVH 1L0ZA 4NIVA 2G55A 1LQEA 2FI4E 2ZFRH 3D62A 6ESTA 1AMHA 1A46H 5A8XA 3MH6A 1YPKH 2Z3EA 1RFNA 1YBWA 5E2OA 4X8UH 2WPMS 2ZHQH 1V2JT 3F0PA 2BY8X 5A8ZA 1GI4A 3N7EA 1HDTH 1GGDB 1DXWA 1J9CH 3GS9A 1C2MA 1PQ7A 3MU1A 3N7DA 1FQ3A 1H9LB 3EA8A 4YZUA 2BDGA 5HGGA 5EW1H 2G5VA 2VIDA 2FM2A 1QJ6B 2KZ4A 3F1SB 2KAIB 2FI3E 2VWOA 3VXEH 2BQ6B 5DKMA 5F6MA 1NC6A 1MD7A 1HAOH 2W7SA 3T2NA 1S83A 2G00A 1V6DA 2ZFSA 4TWYA 2VIOA 1C5QA 3MH7A 3QUMP 3KIDU 1MKXH 1SGRE 2A7JA 2F4LA 3N99A 3BEUA 2WPJS 3TJOA 3RXOA 1NRRH 1V3XA 3ATWA 3SQHE 4DJZB 1SFIA 4O03A 4CRCA 4X1RU 4D9QA 1KLIH 1NT1A 4A1TA 2FLRH 1QL8A 1AE5A 3ESTA 6GCHF 2BLWA 2H5CA 1CHOG 3BSQA 1KXEA 1ZOMA 2Q6DA 4B76A 1O2NA 5DO4H 1C2FA 4ABDA 3STJA 1HFDA 1MTUA 2EI6A 2VH0A 1BQYA 1MTNC 2FODA 4A5TS 2BD2A 1SQAA 1C2EA 1A5GH 3A8DA 3QDZB 2A31A 4Y11E 1ZMJA 2QGRA 3BV9B 3RMNH 2R3YA 4U32A 1LVBA 2ALVA 4Y8ZA 4K1TA 4NA8A 2ZFFH 2VVVA 3SW2B 4NCYA 1G9IE 2FX4A 4Y79A 3SU0A 3T62A 1YPLH 4B2CA 1O5CB 2BY7X 2XWBI 2W6ID 6LPRA 1Y8TA 2P94A 1EPTC 1HAHH 4NZQA 2PGBB 1H8IH 4RSPA 1RJXB 1O2IA 2WPDD 1C9PA 1KXDA 1BJUA 3F6UH 5GIBA 5DK1A 1TRNA 2NU1E 4KP0A 1S6HA 1SGQE 1E37B 3EQ0H 3QWCH 1GCDA 2SGQE 3FANA 1TAWA 5F8XA 1W8BH 5DP8A 1O2VA 1HNEE 3G01A 3BEFB 1A7SA 1AFEH 1DPOA 1S82A 1TALA 2DE9A 3EA7A 4MNWA 7KMEH 2KCYA 1UCYE 3TGIE 3BG4C 1O2PA 1SGPE 1O2SA 1G36A 2GD4B 2PHBA 3V13A 1W11U 4KGAA 2BM2A 1TMUH 3SN8A 4ABGA 3A81A 4OS6A 2ZHFH 1AQ7A 4INLA 5B6OA 1AVGH 4MDSA 3RM2H 1Y5UT 3E6PH 1TGSZ 1KLJH 1BIOA 4YXWD 4K1EA 3S9CA 1AE8H 1ELGA 3I78A 4Y6DA 3SU3A 1WOFA 3IWMA 5EXMA 1GJDB 3TJNA 2O9QA 1GBIA 3BTME 2C8ZB 1E35B 3DFJA 2H1UA 2CGAA 2A45B 4MPXA 1HIAB 2FEQH 1KDQB 1OP2A 2IPHA 1COWD 1K2I1 1O33A 2CK3D 1H9IE 3IG6B 3F9EA 2AYWA 4Q2KA 2O8WA 3DT0H 3QO6A 1W12U 3A87A 4MPUA 1DXPA 1NBME 1QB9A 1K1OA 1JRTA 5GCHG 3F2HA 2VIQA 1C5OH 1EAIA 3U1JB 1SBWA 3H09A 4GHQA 1SI5H 1P02A 2PTCE 2G4UA 2F9NA 1N8OB 4ASUD 3O8CA 1MKWK 1Q2WA 2ZFQH 2GZ9A 3GCHC 2XBWA 1TGCA 1NESE 4AFSA 4GHTA 1GHAF 3ATIA 4O9VA 3SNDA 3ZZ9A 1RXPA 3RXLA 2R0LA 1ESTA 3RLWH 1A5IA 1BMFD 1GI2A 3SNAA 3STIA 1C1MA 2OC1A 1MTNB 2JETC 1X7AC 5FPYA 4OGYA 3ENSB 3FP6E 3PTNA 3QK1A 1K28D 4TPYA 2H5DA 2RCEA 3HK6B 2G4TA 2C3SA 1O2TA 4B75A 2VGCC 1OWHA 4Y76A 5I25A 3BEIB 2H9EH 1FY3A 1WQSA 3TNTA 2HLDD 1SLUB 2A4QA 1TQ0B 3RXJA 3MFJA 3UTUH 1V2NT 2GZ7A 2FIRH 2ZTXA 4MQAA 1BDAA 3UNQA 2FOGA 3ZYEA 2BDIA 1BRAA 2GV6A 1GJ6A 1FPCH 2P3FH 5T3HA 4Q7XA 1CT0E 5JB8S 3DD2H 4OS7A 3AVZA 1SGNE 1PYTC 1IQHA 2ANKH 2BQWB 4DCDA 3Q76A 1LHFH 1KXBA 1EZUC 5JBCS 3B8JA 1KXAA 4KTSA 4VGCC 1AN1E 7GCHF 1E1RD 3A7TA 3HPTB 3U1IB 2J38A 4SGAE 5DPAA 3URDA 3GICB 4AZ2B 4Z1MD 1Y3UA 1ELDE 3D23A 3RLYH 1LVYA 4FUFA 3LH1A 5AFZH 1ZMLA 4NIWA 1SSXA 4QT8C 1CT4E 4XE4A 3RXMA 3SHAH 1OS8A 1VR1H 5A0AE 1F5KU 4K69A 1D3TB 1ZHMA 2GMTB 2YOLA 1ZRKA 5FCRA 3KQDA 1C9TA 2WUBA 4CHAB 1H1BA 2C90B 2P95A 4X2XA 1O39A 2XBVA 6CHAB 4ISIH 4OM9A 1TNIA 4ESTE 2Y80A 3UR6A 2VVUA 2FWWA 1K1NA 1J8AA 2AIPA 1O3KA 2P93A 3VB6A 1IQKA 2GT7A 1IQJA 1QA0A 1WQVH 1B0FA 3FAOA 2H9TH 2ZU2A 1Y5BT 1SQOA 4E7NA 1GBAA 1A0JA 1C4Y2 1UK2A 3ZZ3A 1WUNH 1GMCF 3V0XA 2ZO3H 3BG4B 1BTPA 4DT4A 4UE7H 4B6EA 4YOIA 2KCPA 1HUTH 2ASUB 2FDAA 1CGJE 1E36B 1UMAH 4SGBE 3WW7A 1GMCG 3RUOA 1TGBA 1GVZA 4UEHH 1QHRB 2BY6X 2G81E 2ZGCA 3SOSA 1DY8A 1O3EA 4HI3A 1O2ZA 2R2WU 2A0QB 3GY7A 1FDPA 2AGGX 3MNBA 5JPMH 1TX8A 1O2HA 1WBGB 4X8SH 1XX9A 1ZTKA 1AO5A 2BHGA 2C8YB 1CVWH 2CF9H 2A4GA 4AYYB 3L6PA 3GY6A 1L4ZA 4D9RA 5HMAA 3CENA 4H4FA 3SORA 1CU1A 3UOUA 2JETB 1GJCB 3T28A 2ZQ1A 1E79D 3F9FA 3TH4H 1EZQA 1DVAH 2ZP0H 1GGDC 2AMPA 1SB1H 1A3EH 1T4UH 4RKJB 3ITIA 4NSYA 2WV9A 3NUMA 1V2ST 3SO3A 4THNH 1DWBH 1E38B 5EPYA 1IQMA 3TGJE 4ABJA 1V2MT 4IMQA 3AW0A 3QLPH 1T32A 2OQ5A 1G3EA 2FTLE 1GHVH 3BTTE 2FOAA 4CRGA 2HOBA 4I8HA 5H4IB 1WTGH 3KQBA 1BB0B 2BXTH 1QRWA 2PSXA 1UK3A 1IOEA 1UO6A 2ZG0H 2QXGA 3RC6A 1AU8A 4X8VH 4INKA 2PV9B 3L33A 3T5FH 2EC9H 1GDUA 2W26A 4TSFD 1ESAA 1EB2A 1C1WH 4A1VA 1WTHD 2AERH 1T8NA 1ZRBA 1P04A 3MYWA 2QV1A 2Y82A 2TGDA 2OLGA 2AMQA 1DDJA 3SUDA 1LQDB 3ZZ6A 2ZGBH 3VG8A 3QTOH