3P8NA

Crystal structure of hcv ns3/ns4a protease complexed with bi 201335
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
182
structure length
182
Chain Sequence
APITAYSQQTRGLLGCIITSLTGRDKNQVDGEVQVLSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWPAPPGARSMTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGIFRAAVCTRGVAKAVDFIPVESMETTMRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combined X-ray, NMR, and kinetic analyses reveal uncommon binding characteristics of the hepatitis C virus NS3-NS4A protease inhibitor BI 201335.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HCV serine protease NS3
total genus 42
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3p8nA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3p8nA01
3DA9B 4I8HA 1A3EH 4ABGA 1ACBE 1KYNA 1WTHD 1FV9A 2UUJB 2ANMH 1ZSLA 3RXEA 4MNXA 4ABIA 3SO3A 1SBWA 2B0FA 3RXHA 1ELCA 3FZZA 1CA8B 4ABBA 1O39A 1JMOH 1SGFG 2OBQA 3NPSA 1O2VA 3LT3A 2SFAA 3KGPA 1SGIB 2GCHF 5PTPA 1TE0A 1AUJA 2SGDE 3L6PA 1HFDA 3MMGA 1DFPA 3BIUH 3A7TA 1NO9H 3BG4C 2FIRH 1GMHF 3GISB 1DICA 1E35B 1GBMA 4H42U 5EU8A 1FN6A 2ZDAH 1EAWA 3F1SB 3LH1A 2J4IA 1FY3A 3I78A 2Z9LA 4X8TH 2WV5A 1AFQB 2G5VA 1HAHH 4CBNA 3BTQE 4D9QA 1O2PA 4UDWH 1MZAA 1W0YH 2GDEH 1SGFA 2BY5X 2IJOB 1YPHE 1TQ7B 1NFWA 1V2VT 4INKA 1QTFA 3T29A 3SNAA 1PYTD 5DP4A 4CRAA 3ZVDA 3KIDU 4NWKA 4X6OA 4AZ2B 3S7KB 4M9FA 5J4QA 3RXPA 1S84A 2OBOA 1CHGA 1A0JA 1BTYA 1SQOA 1HIAB 2FOHA 3RC6A 4U2WA 4GVUA 2FI4E 2ZGHA 1NFUA 2A7HA 5GDSH 5BPEA 1LQEA 1GGDC 2FZZA 2D2DA 3GY4A 1EB1H 3IWMA 5HYOA 4DG4A 1UO6A 3CENA 2M5TA 5FX5A 1SGRE 1SOTA 3BG4B 4FUIA 1AD8H 3ZV9A 2G81E 4YT7H 3BTHE 3LKWA 1G9IE 5A0CA 1XVMA 4R8TB 1OSSA 1P2MA 1GBTA 1P57B 1O0DH 1SB1H 2Z9IA 6GCHF 2RA3A 1LVOA 1J17T 1VJ9U 4ZHMU 2H6MA 3ZZCA 2P16A 1EB2A 1TAWA 1TBZH 1E34B 2V6NA 2ZZUH 1QRWA 1YLCA 5HM9A 1O5EH 5JYIA 1C1MA 3OU0A 1NFYA 2ZCKP 2H2ZA 4CH8B 4NA7A 1SGYE 1CBWB 1DY9A 1W12U 4GAWA 3ZVBA 1ETTH 1GI1A 2XBXA 4AG1A 3LGYA 3PV5A 3QGNB 4Q7YA 3ZVCA 4TWWA 4X0WU 1O5AB 1NU9A 1GPZA 1P01A 4YOJA 2BZ6H 1FMGA 1K9OE 1B0EA 2FXRA 3M5MA 1D3DB 1NY22 3SQEE 4BXSA 4I8KA 2GP9B 1TGNA 2WINI 1T32A 2WPKS 5F8TA 3MNBA 1HDTH 4YLUA 1AWHB 1ID5H 1C5ZB 2J94A 3TH2H 1S6FA 1VITG 3C1KA 2BD3A 1HAVB 3AASA 1D9IA 4K1TA 1BRUP 3SJIA 3SHCH 1C5OH 1O2SA 1P3CA 3P6ZB 2ZECA 4AN7A 4FUCA 1GBCA 1GVLA 2YNAA 4E06H 4BTUB 2EC9H 3M7QA 1SFQB 1A1RA 4VGCC 3F68H 1XUJA 2ALPA 1GI7B 2B7DH 4ABHA 5IYTA 5EQQA 1Y3YA 1SGPE 4DOQA 5C5NA 2BD9A 1EJMA 1Z1IA 2FI5E 2A32A 3QTVH 4ABFA 5J4SA 2BD7A 2GMTB 1HNEE 1THRH 1VR1H 2WPHS 4WH6A 3QTOH 1WV7H 5TCAA 4D7FA 3D62A 4Y8ZA 1D3TB 1K1MA 3BTKE 1HCGA 1OWHA 3R0FA 3TU7H 3KEEA 1XKAC 1P06A 1EUFA 1O2IA 1YCPH 3SV7A 1G3DA 1JWTA 5T6DA 4ZKOU 1KXCA 4VGCB 5CHAC 4OS4A 1NN6A 3SV8A 5JBAS 3SGAE 3AAUA 4IC5A 4O3TA 2QAAA 1DSTA 1GI5A 2BVRH 4KTSA 1HB0B 1TONA 4GPGA 1O5BB 5E8EH 1L1JA 1JIRA 3RM2H 1F5LA 1QBNA 4B76A 1QCPA 2O8MA 4TY6A 3BEIB 5FCRA 1SC8U 3RM0H 2SGQE 1C1VH 1KXAA 2BY9X 1A0HB 5H4IB 2W3IA 2BDCA 1V3XA 4XBCA 1P8VC 3ITIA 2R2MB 1EAIA 4X2YA 6LPRA 4YO9A 3PV4A 1C9TA 5CHAB 1TALA 2Z94A 3MH4A 3SU6A 1GHVH 1TBQH 1O3EA 3K65B 4HI3A 4K5ZA 1UTNA 1C1QA 1CO7E 1RTFB 1BTXA 5C5OA 3SNCA 2ZGJA 1T8OA 3G01A 2ILNA 4X1PU 3B23B 2ZHQH 1DLEA 3NWUA 2HGTH 1A7SA 1TX6A 2OXSA 3MWIU 4DIHH 1MKXK 1DVAH 1LDTT 4WXIA 3QDZB 1O2HA 5C1YA 8KME2 2C90B 4XE4A 2GV6A 3VB5A 3S7HB 2FI3E 3RXBA 4UEHH 2B9LA 4FU7A 5DG6A 1V2JT 2ZFSA 3IITA 3TITA 1Y5UT 2QN5T 2O8TA 5L2ZH 2DE8A 2B5TB 3TIUA 3A89A 2CHAC 4NIYA 2FO9A 1HRTH 1QRXA 4RI0A 2ZGBH 2BVSH 3ATLA 3DUXH 2P8OB 1OWJA 1QJ7B 3BTGE 4ABDA 1GHAF 1BUIA 2Z9KA 2SNWA 2HNTF 2ZO3H 5F6MA 1YP9A 2QCYA 1PQ5A 1Y3VA 3RXCA 4X2VA 1S82A 2VIWA 5HGGA 3MO6A 1XXFA 1FUJA 3M7UA 5T1VA 3ATIA 5AFZH 3SU3A 4I33A 5GCHG 7ESTE 5GXPA 1EPTB 1GMCF 1QNJA 3PWBA 3PROA 1VGCB 1XKBC 1SGDE 1MTSA 4YTAA 2V3HH 8LPRA 1J16A 2TIOA 1EAUA 2Z9JA 1YCPM 1MU8B 2ZHDA 3KHVA 2Y5HA 1KDQA 3RMLH 1HAIH 5JBTA 2G8TA 4E7NA 3RU4E 4PROA 2VNTA 2ZA5A 2FODA 2VWMA 1BTWA 1C2HA 2A7JA 2WPLS 1KLTA 2WPIS 4XBDA 5LPFA 2A2QH 2SGFE 2HNTE 1BB0B 2A5AA 5FAHA 2AFQB 2OC0A 2W7UA 4AFSA 4DY7B 3D23A 1PYTC 3MYWA 1IQKA 1AFQC 1O3OA 1ZMLA 1O30A 2W3KA 3GCOA 3QUMP 3AW0A 4CRFA 2PV9B 2FOAA 3GCTG 3HK3B 2BZAA 1UK4A 4IN1A 3PMJA 1Y5AT 1QA7A 1BQYA 4AB8A 3QGJA 3KL6A 3MNCA 1T7CA 1C1PA 1FY4A 1XX9A 4OM9A 2WPMS 1EPTC 1TGCA 5FBIA 5DP9A 4MNYA 1ZLRA 2EI6A 3FP6E 3TK5A 2PUXB 1TRYA 3RMNH 3SU4A 2ZFRH 1ZGIA 1MAYA 3BIVH 1ANEA 1S6HA 1TB6H 2A5IA 1UJ1A 1GMHG 2VWOA 1SI5H 2A4QA 2NU1E 1S83A 4D9RA 2Z3DA 1GJ4H 2A7CA 3SOSA 5DP5A 1GI4A 1GWAA 1J9CH 2AGGX 3BV9B 3TJOA 2XWBI 2R2WU 1D6WA 2VWLA 2Q6GA 2FLRH 3NUMA 1S0RA 5IDKA 1C2KA 3RUOA 1SLUB 5JBBS 4R0IA 2FESH 1YGCH 4D7GA 3E0PB 1HAZB 1ANBA 3MI4A 4X2XA 3E6PH 4Y7AA 3Q3YA 4X1RU 1G30B 1B7XB 2FX4A 5L2YH 2IOTA 5HXFA 1P02A 4KELA 1N6YA 2XC0A 1BHXB 4AG2A 5EW1H 2R0LA 1A4WH 2VIVA 2BDGA 3GCHC 1O34A 2RG3A 3QN7A 1TGBA 1QURH 2CGAA 1C5SA 2OINA 4B75A 5ESBA 1P2OA 2WYGA 1SGNE 2O9QA 1NC6A 3VGCB 4BTIB 1YLDA 1MD7A 3RXMA 1GDUA 1MTVA 3AK5A 3SQHE 4OGXA 2JH6D 3LOXA 3T2NA 4UE7H 2EI8A 4NIVA 3H09A 1MZDA 1CT2E 3VXFH 3A80A 1GDQA 3W94A 3K2UA 4BAOB 5LGOA 1ZSKA 2Z9GA 4JZEH 4Y10E 2PTCE 1GBBA 4NSVA 3E8LA 3VPKA 3GCNA 4A1TA 2C8ZB 3RP2A 3PLPA 4A6LA 2GX4A 1SLVB 2NU0E 5TCCA 3ZV8A 1TGTA 1VGCC 1H9IE 2GMTC 1H9HE 2TGDA 1TLDA 4TPIZ 3RXOA 4JZFH 2I6SA 3ATMA 2LNCA 3ESTA 1C2JA 2ZF0H 2PLXA 1P9UA 2ZWLH 3TJVA 2AERH 2VINA 3UFAA 2HVXA 3U1JB 3SUFA 3UOPA 3B8JA 3ZZ4A 1J14A 3ZYDA 4YZUA 1A5IA 1FLEE 1Z8RA 1ZTKA 2ZDNA 3GY6A 3P70B 2ZPRA 1YM0A 3VB4A 1HAOH 3R3GB 5ETXA 2PKAA 3E16B 3MNXA 1P9SA 5DP7A 1TQ0B 4CRDA 4OS1A 4WY3A 2TGTA 3BN9A 4YM9A 1K1NA 1MH0A 4IMQA 3ZZAA 2GCTC 1DS2E 5E0HA 3A81A 1C5UA 1W7XH 2PKSB 1BTPA 5B6OA 4IC6A 3DFJA 1GJ9B 4ZHLU 1MAXA 3A88A 3QZRA 2P59A 1XUIA 5GNDA 1YPHC 3HATH 4X2WA 2WV9A 1WXRA 1DY8A 4RSPA 2A45B 3UNSA 1SFIA 1GBEA 2ZGXH 2C8WB 3GOVB 4A7IB 3UWJH 7KMEH 2F4LA 1VCQA 2J9NA 1BBRH 1BZXE 3A8AA 1AN1E 3U98H 4ZXYH 1IQIA 1OP0A 5FPTA 1C1OA 3LGWA 3U9AH 7LPRA 3Q3XA 1W10U 4IW4E 1CQQA 4GHQA 3BTEE 2RDLA 1WYKA 3RMOH 3KN2A 1C5VA 1V2UT 1A46H 1GDNA 2BLOA 3E3TA 5FX6A 1BMAA 3HK6B 4AYVB 4FVDA 5T6GA 1UTLM 2XBYA 2FTLE 1F5RA 1GL0E 3NXPA 1BA8B 2OQUA 3SW2B 4UFDH 2OLGA 4LZ4B 1LHFH 1F0TA 1O3JA 1AY6H 1DWDH 4Y8XA 1V2ST 2XC5A 2PSYA 4FUGA 4GHTA 2GT7A 4MVNA 1RJXB 1WBGB 2CJIA 4UFFH 3L33A 3UUZA 1GJ7B 4JK5A 4D8NA 1BRAA 1O2WA 1DWBH 4Y0YE 4ZAEA 1RRKA 5GPIB 4Y71A 1NZQH 1TPPA 1QL7A 2P93A 1P0SH 3A87A 3SZNA 2THFB 2FS9A 2C4FH 3UR6A 1TABE 2BY6X 1F7ZA 1QFKH 2H9HA 2BOKA 1O2UA 1TNKA 2BLVA 3ODFA 3HPTB 4FU8A 1DXPA 2VH0A 2VU8E 2FP7B 1LHEH 1TA6A 1BDAA 3EA9A 1P2IA 2YOLA 1XVOA 3RLYH 1RGQA 3M61U 1M9UA 1MQ5A 1MTUA 1TFXA 1UTKA 2QY0B 1UTQA 2PW8H 1BIOA 4JZIA 1A2CH 4WVPE 3DT0H 3RXIA 1W13U 4DJZB 1O2NA 4BTTB 3U69H 3VB7A 1NRPH 6GCHG 2V0BA 3SORA 1Y59T 2HNTC 3MTYA 2R3UA 3PMAB 4A1VA 1G3EA 4WH8A 2BQ6B 4FVBA 3URCA 3SI3H 1YPMH 1RTLA 2AEIH 1O3GA 2F83A 2GGVB 3E0NB 1ABJH 2VIPA 1SQAA 2OC7A 2Y80A 2ZDVH 1BRBE 3NZIA 2Z7FE 1V2KT 2ZDLA 2ANYA 1O3NA 1HV7A 4BAHB 1NRNH 2ZC9H 1EZXC 4KKDA 1QBOA 4LXBH 4F4OC 2VVVA 1Z71A 1O3HA 5EXNA 4ISHH 5F8ZA 1KXFA 2C8XB 4K8BA 2F9UA 2G51A 1BRCE 2XNIA 1ZMJA 5EG4A 1F5KU 3URDA 4X1SU 1P2JA 3SJ8A 1AO5A 1GJ8B 2OCVB 3MU8A 3VB6A 1FAKH 1FZZA 1E37B 3N7OA 1MCTA 1IAUA 1EZQA 3GY5A 3HKJB 1O2RA 1Q31A 1GHWH 2BOHB 1SG8B 3T62A 1GMCG 2FOCA 2ZFFH 5HMAA 1WQSA 3RXRA 1FNIA 2SGPE 1C5XB 5DKMA 1D3QB 1S81A 3QO6A 4MTBA 3ZZ6A 2A0QB 2QYIA 4Y0ZE 1L2EA 4QT8C 1AWFH 1GHBF 2HLCA 1BMNH 2JKHA 4MPXA 1JRTA 1CHOF 5F03A 1FI8A 3O8RA 2V35A 3SV6A 2VWNA 3TGIE 3RU4D 4JZDH 1BBRE 5LPRA 1CVWH 4JYVH 4Y8YA 1N6XA 1O2QA 3PMBB 1ZR0A 4CHAC 1EP5A 1HLTH 1W3CA 1EQ9A 3Q00A 1LVMA 4NG9H 2AIPA 1T31A 2H9EH 2A31A 3RXVA 3ENSB 3KQEA 2AGIX 2TRMA 3HKIB 4X8SH 3HGNA 1Z1JA 5DP6A 3A7XA 1QJ1B 2VIQA 4ZH8A 3TH3H 2A4RA 2Z3EA 4OS5A 2A4GA 1C5YB 1LHCH 4AB9A 4AFUA 1XUHA 1O38A 4AFQA 1TNJA 3UPEA 1MTNC 2UWPA 2BY7X 1IHSH 2Y6TA 3ZZ7A 1QGFA 2VIDA 2OD3B 4ASHA 2PWXA 3F9GA 1NS3A 4NGAH 1AE8H 3A7WA 1WSSH 1O2ZA 3SYJA 5A8XA 1HJ8A 1Z8GA 3TK9A 1KXEA 2J34A 1B0FA 2ODYB 2HRVA 1P11E 1RS0A 3MU1A 1HAYB 3OY6U 1K1IA 4ZKRU 1EASA 1PPEE 1GI9B 1AQ7A 3K9XB 2Y82A 1O35A 1E0FD 4WF8A 3E91A 2FEQH 1A0LA 1OX1A 1ANDA 4A92A 1FPHH 3LC5A 6CHAB 3GDUA 2FYRA 1OS8A 4SGAE 3BEFB 1ORFA 2UWLA 1NM6A 1O3BA 3HGPA 1SOZA 2JH5D 4ISOA 1JRSA 3TJNA 4BAQB 1GBHA 2ESTE 4E7RG 1ZHMA 1YYY1 3DFLA 3BTME 3TGKE 5A0AE 1QL8A 2WPJS 1V2TT 2H1UA 1NTPA 3ZZ3A 2GCTB 1OP8A 3PLKA 4ZKNU 5C1UA 4YOIA 4DT7B 3I77A 1K22H 1K1OA 2ZHWH 3A84A 2FLBH 5G4BA 1P05A 3O8DA 4O9VA 2LPRA 8ESTE 3AVZA 1V2RT 3H5CB 2F9OA 2GKVE 1BMLA 1GJ6A 1V2PT 1AVXA 1BHXF 3EA7A 4FUHA 1H1BA 1IQNA 1GCTB 2BX4A 4WMEA 1UTJA 1VCWA 1EJAA 1ZJDA 5DGJA 2A5KA 3VB3A 4AORA 1TGSZ 1ANCA 1B5GH 1Z6JH 2H9TH 2JH0D 5GJ4B 3ZZDA 1EZUC 4JZ1A 1ZRBA 2PKSC 1OKXA 3SUGA 1GHAG 2ULLA 2VJ1A 1KIGH 1IOEA 5GIBA 5FXLA 2ZQ2A 4K8YA 1C9PA 2AMQA 4FUBA 4NIXA 1EOJA 3P8NA 4B73A 3JZ1B 1K1LA 1FPCH 1HPGA 1T8LA 1SL3A 1AUTC 1BOQA 4B2BA 3PO1B 1O2OA 5GCHF 3TH4H 4YLQH 1PQ8A 2CF8H 5EODA 1ZJKA 2BD8A 2AH4X 1Z8JB 3BTFE 1O2LA 3ZZ9A 5K7RA 2QXJA 1UHBA 1O5FH 2BTCE 1TNIA 4OS6A 3T25A 4WMDA 1RTKA 1A5GH 1TOMH 3SNEA 3A85A 1GJ5H 3LIWA 1F92A 4Z0KA 2J2UA 1JXPA 2G52A 3RDZA 3TGJE 2ANWA 1BJUA 3LGUA 3OYPA 1FQ3A 1P3EA 4ISLA 1ZPCA 1QB1A 5B6LA 1T8MA 2PUQH 3A86A 4YOGA 4NSYA 4ZKSU 4NZLA 2Y5GA 1KXBA 1QQ4A 2C93B 1GVZA 1MTWA 1UK3A 4O97A 1TRMA 1OOKB 1MMJN 2Y7ZA 4NCYA 3FANA 1LVYA 2AMPA 4ZXXH 3SGBE 3A7ZA 3TVJB 4B2CA 1HIAA 3S9CA 1AKSB 5JBCS 3OTPA 1D3PB 2FTMA 1HUTH 3BG8A 2GZ8A 3A83A 3TNTA 3GDVA 4CR9A 1A5HA 2I6QA 3GY7A 1ZHPA 1HJAB 1IQFA 2FYQA 1H9LB 4Y76A 2Q6FA 3KNXA 3P95A 3SUDA 4I31A 3ODDA 3ATWA 2XW9A 1MD8A 1EX3A 2ASUB 4BNRA 2VBCA 1O5DH 1AZ8A 2D8WA 1C4Y2 2IJD1 3EGKH 1C1NA 1GBJA 2KAIA 1Y5BT 5BRRE 1VCPA 3EDXB 3UQOA 2XRCA 3MH6A 1JOUB 3LPRA 2FOGA 4JYUH 1C1WH 1ELAA 5DP8A 2QF0A 4XOJA 1P2KA 3ZZ8A 4I7YH 4HFPB 2ZPQA 4ABAA 1H8IH 3VEQB 1ZTLA 3U8OH 1V2LT 2J95A 3M5NA 2PSXA 3OSYA 1GVKB 3QZQA 1IQHA 2DUCA 4BAMB 1CE5A 1V2WT 1QR3E 4O3UA 4HTCH 4MNVA 1C5PA 1UVTH 1E38B 3A8CA 3UREA 4DGJA 1Z8IB 4WXVA 1C1RA 1N8OC 1OYQA 5JPMH 1HXEH 1IHTH 5EW2H 9LPRA 1CBWC 3PTNA 1SQTA 5E2OA 2AMDA 5AHGH 1Z6EA 1C5QA 4LOYH 4X6PA 1GG6B 5A2MH 3Q76A 2BDYA 2Q6DA 2VVUA 2WZQA 2QF3A 1O3CA 2P95A 3E90B 1S85A 1C2IA 1SLWB 1O5CB 5E0GA 3S9AA 1HAVA 4HGCA 2H5CA 2TGPZ 3SJKA 2QIQA 5A09A 2UUKB 3RXLA 2P94A 2BM2A 4X8UH 2QA9E 2ZG0H 1W2KH 1BJVA 1KLIH 5EXMA 1LKAA 4I8GA 2PFEA 1EKBB 2Q1JA 3M37A 1O2XA 2NU3E 2ZFPH 5T3HA 2SGEE 1SGCA 2GDDA 4IS5A 1GCTC 1CU1A 1ZGVA 2D1JA 1J8AA 1PPHE 3MU0A 1ZSJA 1EATA 2WV4A 1H4WA 1RFNA 1O31A 4J1YA 4THNH 3UTUH 2VGCB 2BQWB 7GCHG 4AYYB 2ZU1A 4YT6H 3LGIA 3SGQE 5I25A 4U32A 2A1DB 2G55A 2FS8A 8GCHF 1UHBB 1W14U 1LMWB 3TNSA 3ZZBA 1PPFE 1DXWA 1C4V2 1ZPZA 1ELFA 1FN8A 3UOUA 1RXPA 4GLYA 2PR3A 1OP2A 2GTBA 1QQUA 2GV7A 4XBBA 3SBKA 2BD5A 1F0SA 4BOHA 3M3SA 5L6NH 2FM2A 1Q2WA 1THSH 5TJXA 3LDXH 1LCYA 5FBEA 2SGAA 2SNVA 1WUNH 1O2MA 4CHAB 2BDIA 2A4OA 3IG6B 1SPJA 2BHGA 3SU0A 4KTCA 2F3CE 2F9BH 3B9FH 3KCGH 4DCDA 1WTGH 1GHBG 3DHKH 4B6FA 3PYHA 3NKKA 1GI8B 1WQVH 4J2YB 1C5LH 1W8BH 1IQLA 3QK1A 1LHDH 2G00A 1MBMA 1PQ7A 2G4TA 1ELEE 6ESTA 3AAVA 1OYTH 5A8YA 1AFEH 4CRBA 1T4UH 2ZU3A 7GCHF 5C3NA 2DE9A 2Y81A 1SHYA 4KP0A 1TX7A 2H5DA 4RKJB 1TBRH 1GJBB 1TPOA 3SNBA 1O2GH 3A8BA 2OTVA 1C5WB 5K0HA 3UR9A 1HXFH 1UCYH 1LPZB 1BCUH 1P2NA 3RC5A 1GL1A 1V2NT 1V2OT 1NRRH 3E1XB 5CE1A 2BY8X 1SGEE 1C1SA 2CV3A 1DUAA 1AZZA 5EQRA 2BMGB 3KQCA 1KSNA 2NWNA 4GCHG 4TYDA 1TOCB 3EE0B 2Z3CA 1C1UH 4FXGH 1VITH 1L4ZA 2BXTH 3SHAH 1UVOA 3MHWU 1N1LA 5I46H 1DITH 1GCDA 5F8XA 1N8OB 2KAIB 4DVAU 3GYLB 3STIA 2QXGA 1T8NA 2GT8A 4K60A 3LGTA 2EEKA 4ZROA 3SJOA 2BDAA 1ZMNA 3M36A 4YESB 4CBOA 1UVSH 3GY2A 1YPKH 4U01A 4GUXA 1ZRKA 2ZPSA 1AVGH 1PFXC 5AF9H 1Y3XA 1O32A 1V2MT 2F9NA 1O37A 2R3YA 2BD4A 3P8FA 1DDJA 2IPHA 2QXHA 3RXFA 1NPMA 1P09A 1GI6A 3LONA 4FUDA 4CR5A 4KTUA 5JB8S 5FPSA 1TNLA 2FPZA 5JDUB 1LKBA 1YPEH 3WY8A 2P8OC 1L1NA 3LU9B 4WJG2 3SZEA 1PPGE 3OX7U 3PMHB 4KGAA 2OQ5A 4DIIH 1BTHH 1Q3XA 2JETC 1MKXH 4FUEA 1QA0A 3SUEA 1GG6C 4MQAA 3PO1C 2TPIZ 5L30H 4JK6A 2STBE 2ZNKH 1DE7H 2XWAA 4ESTE 3FZDA 3PWCA 4GCHF 2NU2E 2HOBA 3RXSA 1TWXB 2NU4E 4I8LA 1UVUH 4JMYA 1XUKA 3W95A 1LTOA 1O3KA 2VGCC 5JB9S 4DW2U 3RXGA 1Y3WA 4D76A 4H4FA 5C67A 1FY1A 1P10A 2ZQ1A 1ETRH 2ZTZA 3PM3A 2ZU2A 4MDSA 1G2LA 1AVWA 3GICB 1OWKA 3H7TA 1QHRB 1PJPA 1QRZA 2HPQH 5EGMA 1YCPK 1ARBA 2XXLA 3M7TA 4UFEH 3GYMA 1GHZA 1K2I1 1FDPA 4GSOA 3T26A 3D65E 2F9PA 3S69A 5HM2A 1S0QA 1KY9A 1L4DA 1AIXH 1THPB 2ZDKA 1DWEH 2QC2A 3SU5A 3DD2H 2ZI2H 1EOLA 1FXYA 1TPSA 1O3FA 3MNSA 1ZPBA 2YNBA 3S0NA 5LH8A 3NK8A 4B6EA 2D26C 5AFYH 1G2MA 2VB0A 1DM4B 2AYWA 2QXIA 3I29A 3KQBA 1TPAE 5SGAE 1IQGA 1GBIA 5EPYA 1GJAB 3SN8A 1CA0B 1QB6A 4K2YA 5CMXH 1QBVH 2BD2A 3MU4A 1ELDE 1O2KA 1SSXA 1YKTA 1DWCH 2J92A 3Q3KA 3F9EA 1EJNA 1ELBA 2A2XH 2ANKH 1NROH 5AVDA 2O8LA 2BDHA 2C3SA 3V3MA 3O8CA 2FX6A 4F49A 2PGQB 4DURA 1FJSA 1C2EA 2GZ9A 1INCA 3M3TA 1LQDB 1CSOE 1TNGA 4B2AA 1L1GA 3LH3A 1FONA 2ZHEH 4INHA 3RLWH 4B74A 2CN0H 1UTOA 3BSQA 5GWZA 4LZ1H 1LO6A 1ABIH 3UY9A 4NFFA 1BTZA 1AB9B 3Q77A 3U1IB 3T27A 2WUBA 1ZTJA 2FOMB 1WCZA 3RC4A 4E05H 2P3FH 1GI0A 4TY7A 4Z6AH 1WAYB 1BTUA 1XMNB 2G5NA 3PTBA 3T28A 1K1PA 1BBRK 1BITA 1Z7KA 4OGYA 1HAXB 1XXDA 2IN2A 1ELTA 2BB4A 2FMJA 3F9FA 1ESBA 3P8GA 2BQ7B 1IQJA 5EOKA 5ABWA 1LHGH 1FIZA 2QV1A 1SVPA 1A3BH 4ABEA 4ZHAA 1KXDA 1GBLA 3MFJA 2CXVA 1C4U2 1H8DH 2ZDMA 1XUGA 4WMFA 3BTDE 1EAXA 5DK1A 5DPAA 1ESTA 1TMUH 1C2FA 4K3JA 3STJA 1V2QT 1J15A 1SGQE 3VGCC 1Y3UA 3EQ0H 4IN2A 1G3CA 4X1NU 1PPZA 5ESTE 4Y6DA 1G37A 4A5TS 2CMYA 1W11U 1O2YA 3SV9A 2G4UA 1DSUA 1ZOMA 3O8BA 2BLWA 1O3PB 5E2PA 2HPPH 4Q7XA 1C5TA 4AGKA 1CGIE 2PKAB 1O3IA 2JETB 4Q80A 3A8DA 4OS2A 2VVCA 4FUJA 4NWLA 3TJUA 1C5NH 4A1XA 1TNHA 2ZFTA 1NU7B 2CHAB 1AMHA 2OK5A 1CT4E 4TPYA 2R0KA 2FOEA 3FP8E 1ESAA 3QX5H 2GVFA 3GDSA 5DJ7A 1P2QA 2O8UA 1WOFA 4MLFB 1O2JA 1E36B 2Z6BD 1JIMA 4TWYA 1AKSA 4XFQA 3UNQA 3RXQA 1YBWA 1O33A 2ODQA 3MH5A 1L0ZA 3P8OA 2ZCHP 1VZQH 1EXFA 1MUEB 1EZSC 2OUAA 3PB1E 3EA8A 3M5LA 4Y11E 1WU1A 4NA8A 1DOJA 2GZ7A 2W5EA 4NA9H 3UQVA 4BAKB 1MBQA 5E0JA 1ZZZA 1ZYOA 1ARCA 2XYAA 5EPNA 2EA3A 3KQDA 4AOQA 1C2GA 2BVXH 1K28D 4CRGA 1DLKB 4NIWA 3L3TA 1FY8E 2Y5FA 3BEUA 4MPVA 2FOFA 5DP3A 2ZU5A 3QLPH 1C5RA 3RXKA 1NFXA 3V7TA 2OC8A 1C2DA 4ABJA 5EXLA 1ZHRA 2WUCA 4H6TA 1O3AA 1OPHB 1S5SA 1SMFE 1O5GH 1AB9C 1YF4A 1O2TA 2OP9A 1P04A 3F9HA 4HZHA 1MTNB 1MKWK 1DUEA 1GGDB 2R9PA 1UMAH 1PPCE 3ATKA 1A61H 1HJ9A 1TYNA 2PTNA 2ZHFH 1TX8A 1HAGE 1YC0A 3RU4T 1MU6B 2STAE 1AGJA 1IQEA 3OTJE 1BT7A 2HWLB 1F0UA 3EYDA 1UVPA 1TMTH 4IGDA 2XBVA 1W7GH 3NCLA 1D6RA 2ZIQH 5FCKA 1O3DA 1GI2A 2UUFB 2O8WA 3U8TH 1UK2A 5FPYA 1HGTH 1X7AC 3FAOA 1HBTH 3M3VA 3T5FH 4BXWA 1TRNA 1GHYH 1P12E 1VITF 3RXTA 4AFZA 3SJ9A 2XC4A 3ZVAA 3V0XA 2XTTB 1OWIA 3KF2A 3MOCA 3ZVGA 1SHHB 1GBDA 1CA0C 3PLBA 3F6UH 1AI8H 1Y8TA 1C1TA 3GCHB 3SI4H 4CRCA 4AGJA 4MPWA 1F0RA 4UFGH 2UWOA 4K69A 3TLOA 2ALVA 3LJJA 4ISIH 4IBLH 3TK6A 3H7OA 1BMMH 2F91A 3UIRA 1CGJE 2VIOA 2EI7A 3EAJA 1ELGA 4MNWA 2FWWA 1NRQH 1OXGA 3RXAA 1O36A 1VJAU 1O3LA 4XSKU 5EQSA 1GBAA 4XDEA 1UCYK 1YPLH 4X1QU 1GJDB 2ODPA 3RMMH 3GCTF 4BANB 1ETSH 3A7VA 3K6YA 3PV2A 3MH7A 1EP6A 4I8JA 3RXDA 3CS7A 1DT2A 2WHXA 1W0ZU 2ZU4A 3UNRA 4Q7ZA 2WYJA 1FIWA 2ZGCA 3ZVEA 1P03A 2BX3A 2OC1A 1DANH 4K1EA 1QL9A 4LK4A 1MKWH 1RIWB 1K1JA 2ZTXA 1HAPH 4X6NA 2BLQA 2GD4B 4Y79A 2UUYA 3M5OA 5T6FA 1GJCB 3LGVA 2XBWA 3MU5A 1XM1A 1CHOG 2W26A 4X8VH 3BTWE 4MPUA 1FY5A 3FP7E 2TGAA 2ZKSA 5LPEA 2RCEA 1DPOA 1LPGB 4M7GA 3VFEA 3JZ2B 1QJ6B 4UD9H 1V6DA 1DX5M 2B8OH 1D4PB 3MO9A 1EPTA 1K21H 1UCYE 1RD3B 4ZMAH 3OY5U 2ZFQH 1CT0E 3ZZ5A 1JBUH 4AX9H 1AE5A 3ZYEA 1SGTA 2VH6A 1QIXB 5A0BA 4RN6A 2BYAX 3FVFB 4IMZA 1NRSH 1YPGH 2BDBA 1SR5C 2C8YB 4O03A 1ELVA 1KDQB 1UTMA 3V13A 4K1SA 3S9BA 1G36A 6CHAC 1PQAA 3ELAH 1NESE 3CS0A 2FDAA 1CGHA 4SGBE 1IQMA 2PGBB 1KTTB 1G3BA 1TA2A 3V12A 1C2MA 4INLA 1HJAC 4NFEA 1GBKA 3U8RH 3MO3A 1GMDG 2P3UB 3GY8A 5C1XA 2ZTYA 3ZVFA 3CP7A 4FUFA 4U30A 1NT1A 4X6MA 2XCNA 8GCHG 3RXUA 1U6QA 5C2ZA 4RKOB 4JCNA 5C20A 4JYTA 1T4VH 1AU8A 1G32B 3SNDA 2AS9A 3C27B 4B1TA 3QWCH 1QB9A 4Y7BA 2W7SA 1LPKB 1SLXB 1GBFA 3BF6H 2AGEX 1GI3A 4MG3A 3SV2H 1OWEA 4CREA 1KLJH 1OWDA 1FAXA 2Y7XA 5FHTA 3P17H 2AIQA 4CH2B 4B71A 1O3MA 4FU9A 4OS7A 4WWYA 2XCFA 2J38A 3UWIA 1TMBH 2ZCLP 4ZUHA 1F2SE 4UONA 1C2LA 1HYLA 3A82A 1PPBH 3FFGA 2RA0A 1YPJH 2BXUH 2GCHG 2TBSA 2ZEBA 3AW1A 1XUFA 2K1QA 2ZP0H 3K6ZA 3RXJA 5DO4H 1LVBA 2FOBA 4NZQA 1TIOA 2CF9H 3TPIZ 3SU2A 3BTTE 3GY3A 1GMDF 2QGRA 3M35A 1UTPA 9ESTA 4I32A 3SU1A 1AHTH 1MQ6A 1QY6A 3LJOA 1C5MD 4Q2KA 1RIWC 2PHBA 5A8ZA 3D49H 4ISNA 3VXEH 3A7YA 2P3TB 4H6SB 3P92A 1MCVA 2HALA 3LC3A 2F9VA 1GHXH 2V3OH 1KTSB
chains in the Genus database with same CATH superfamily
3DA9B 4I8HA 1A3EH 4ABGA 1ACBE 1KYNA 1WTHD 1FV9A 2UUJB 2ANMH 1ZSLA 3RXEA 4MNXA 4ABIA 3SO3A 1SBWA 2B0FA 3RXHA 1ELCA 3FZZA 3KYFA 1CA8B 4ABBA 1O39A 1JMOH 1SGFG 2OBQA 3NPSA 1O2VA 3LT3A 2SFAA 3KGPA 1SGIB 2GCHF 3F2HA 5PTPA 1TE0A 1E1QD 1AUJA 2SGDE 3L6PA 5EJLA 1HFDA 3MMGA 1DFPA 3BIUH 3A7TA 1NO9H 3BG4C 2FIRH 1GMHF 3GISB 1DICA 1E35B 1GBMA 4H42U 5EU8A 1FN6A 2ZDAH 1EAWA 3F1SB 3LH1A 2J4IA 1FY3A 3I78A 2Z9LA 2LELA 4X8TH 2WV5A 1AFQB 2G5VA 1HAHH 4CBNA 3BTQE 4D9QA 1O2PA 4UDWH 1MZAA 1W0YH 2GDEH 1K0HA 1SGFA 2BY5X 2IJOB 1YPHE 1TQ7B 1NFWA 1V2VT 5HIYA 4INKA 1QTFA 3T29A 3SNAA 1PYTD 5DP4A 4CRAA 3ZVDA 3KIDU 4NWKA 4X6OA 4AZ2B 3S7KB 4M9FA 5J4QA 3RXPA 1S84A 2OBOA 1CHGA 1A0JA 1BTYA 1SQOA 1HIAB 2FOHA 3RC6A 4U2WA 4GVUA 2FI4E 2ZGHA 1NFUA 2A7HA 5GDSH 5BPEA 1LQEA 1GGDC 2FZZA 2D2DA 3GY4A 1EB1H 3IWMA 5HYOA 4DG4A 1UO6A 2QF4A 3CENA 2M5TA 5FX5A 1SGRE 1SOTA 3BG4B 4FUIA 1AD8H 3ZV9A 2G81E 4YT7H 3BTHE 3LKWA 1G9IE 5A0CA 1XVMA 4R8TB 1OSSA 1P2MA 1GBTA 1P57B 1O0DH 1SB1H 2Z9IA 6GCHF 2RA3A 1LVOA 1J17T 1VJ9U 4ZHMU 2H6MA 3ZZCA 2P16A 1EB2A 1TAWA 1TBZH 1E34B 2V6NA 2ZZUH 1QRWA 1YLCA 5HM9A 1O5EH 5JYIA 1C1MA 3OU0A 1NFYA 2ZCKP 2H2ZA 4CH8B 4NA7A 1SGYE 1CBWB 1DY9A 1W12U 1WDIA 4GAWA 3ZVBA 1ETTH 1GI1A 2XBXA 4AG1A 3LGYA 3PV5A 3QGNB 4Q7YA 3ZVCA 4TWWA 4X0WU 1O5AB 1NU9A 1GPZA 1P01A 4YOJA 2BZ6H 1FMGA 1K9OE 1B0EA 2FXRA 3M5MA 1D3DB 1NY22 3SQEE 4BXSA 4I8KA 2GP9B 1TGNA 2WINI 1T32A 2WPKS 5F8TA 3MNBA 1HDTH 4YLUA 1AWHB 1ID5H 2XNDD 1C5ZB 2J94A 3TH2H 1S6FA 1VITG 3C1KA 2BD3A 1HAVB 3AASA 1D9IA 4K1TA 1BRUP 3SJIA 3SHCH 1C5OH 1O2SA 1P3CA 3P6ZB 2ZECA 4AN7A 4FUCA 2PP6A 1GBCA 1GVLA 2XOKD 2YNAA 4E06H 4BTUB 2EC9H 3M7QA 1SFQB 1A1RA 4VGCC 3F68H 1XUJA 2ALPA 1GI7B 1YWUA 2B7DH 2QE7D 4ABHA 5IYTA 5EQQA 1Y3YA 1SGPE 5EJZA 4DOQA 5C5NA 2BD9A 1EJMA 1Z1IA 2FI5E 2A32A 3QTVH 4ABFA 2L74A 5J4SA 2BD7A 2GMTB 1HNEE 1THRH 1VR1H 3EE7A 2WPHS 4WH6A 3QTOH 1WV7H 5TCAA 4D7FA 3D62A 4Y8ZA 1D3TB 1K1MA 3BTKE 1HCGA 1OWHA 3R0FA 3TU7H 3KEEA 1XKAC 1P06A 1EUFA 1O2IA 1YCPH 3SV7A 1G3DA 1JWTA 5T6DA 4ZKOU 1KXCA 4VGCB 5CHAC 4OS4A 1NN6A 3SV8A 5JBAS 3SGAE 3AAUA 4IC5A 4O3TA 2QAAA 1DSTA 1GI5A 2BVRH 4KTSA 1HB0B 1TONA 4GPGA 1O5BB 5E8EH 5F53A 1L1JA 1JIRA 3RM2H 1F5LA 1QBNA 5HKKD 4B76A 1EFRD 1QCPA 2O8MA 4TY6A 3BEIB 5FCRA 1SC8U 3RM0H 2SGQE 1C1VH 1KXAA 2BY9X 1A0HB 5H4IB 2W3IA 2BDCA 1V3XA 4XBCA 1P8VC 3ITIA 2R2MB 1EAIA 4X2YA 6LPRA 4YO9A 3PV4A 1C9TA 5CHAB 1TALA 2Z94A 3MH4A 2HLDD 3SU6A 1GHVH 2EQNA 1TBQH 1O3EA 3K65B 4HI3A 4K5ZA 1UTNA 1C1QA 1CO7E 1RTFB 1BTXA 4P02A 5C5OA 3SNCA 2ZGJA 1T8OA 3G01A 2ILNA 4X1PU 3B23B 2ZHQH 1DLEA 3NWUA 2HGTH 1A7SA 1TX6A 2OXSA 3MWIU 4DIHH 1MKXK 1DVAH 1LDTT 4XD7D 4WXIA 3QDZB 1O2HA 5C1YA 8KME2 2C90B 4XE4A 2GV6A 3VB5A 3S7HB 2FI3E 3RXBA 4UEHH 2B9LA 4FU7A 5DG6A 1V2JT 2ZFSA 3IITA 3TITA 1Y5UT 2QN5T 2O8TA 5L2ZH 2DE8A 2B5TB 3TIUA 3A89A 2CHAC 4NIYA 2FO9A 1HRTH 2F43B 5FL7D 1QRXA 4RI0A 2ZGBH 2BVSH 3ATLA 3DUXH 3FN8A 2P8OB 1OWJA 1QJ7B 3BTGE 4ABDA 1GHAF 1BUIA 2Z9KA 2SNWA 2HNTF 2ZO3H 5F6MA 1YP9A 2QCYA 1PQ5A 1Y3VA 3RXCA 4X2VA 1S82A 2VIWA 5HGGA 3MO6A 1XXFA 1FUJA 3M7UA 5T1VA 3ATIA 5AFZH 3SU3A 4I33A 5GCHG 7ESTE 5GXPA 1EPTB 1GMCF 1QNJA 3PWBA 3PROA 1VGCB 1XKBC 3WW7A 1SGDE 3F2GA 1MTSA 4YTAA 2V3HH 8LPRA 1J16A 2TIOA 1EAUA 2Z9JA 1YCPM 3CNRA 1MU8B 2ZHDA 3KHVA 2Y5HA 1KDQA 3RMLH 1HAIH 5JBTA 2G8TA 4E7NA 3RU4E 4PROA 2VNTA 2ZA5A 3MQKC 2FODA 2VWMA 1BTWA 1C2HA 2A7JA 2WPLS 1KLTA 2WPIS 4XBDA 5LPFA 2A2QH 1S6LA 2SGFE 2HNTE 1BB0B 2A5AA 5FAHA 2AFQB 2OC0A 2W7UA 4AFSA 4DY7B 3D23A 1PYTC 3MYWA 1IQKA 1AFQC 1O3OA 1ZMLA 2AHME 1O30A 2W3KA 3GCOA 3QUMP 3AW0A 4CRFA 2PV9B 2FOAA 3GCTG 3HK3B 2BZAA 1UK4A 4IN1A 3PMJA 1Y5AT 1QA7A 1BQYA 4AB8A 3QGJA 3KL6A 3MNCA 1T7CA 1C1PA 1FY4A 1XX9A 4OM9A 2WPMS 1EPTC 1TGCA 5FBIA 5DP9A 4MNYA 3N99A 1ZLRA 2EI6A 3FP6E 3TK5A 2PUXB 1TRYA 3RMNH 3SU4A 2ZFRH 2KFWA 1ZGIA 1MAYA 3BIVH 1ANEA 1S6HA 1TB6H 2A5IA 1UJ1A 1GMHG 2VWOA 1SI5H 2A4QA 5C0UA 2NU1E 1S83A 4D9RA 2Z3DA 1GJ4H 2A7CA 3SOSA 5DP5A 1OHHD 2KCYA 1GI4A 1GWAA 1J9CH 2AGGX 3BV9B 3TJOA 2XWBI 2R2WU 1D6WA 2VWLA 2Q6GA 2FLRH 3NUMA 1S0RA 5IDKA 1C2KA 3RUOA 1SLUB 5JBBS 4R0IA 2FESH 1YGCH 4D7GA 3E0PB 2LP6A 1HAZB 1ANBA 3MI4A 4X2XA 3E6PH 4Y7AA 3Q3YA 4X1RU 1G30B 1B7XB 2FX4A 4ASUD 5L2YH 2IOTA 5HXFA 1P02A 4KELA 1N6YA 2XC0A 2KCOA 1BHXB 4AG2A 5EW1H 2R0LA 4TSFD 1A4WH 2VIVA 2BDGA 3DSGA 3GCHC 1O34A 2RG3A 3QN7A 1TGBA 1QURH 2CGAA 1C5SA 2OINA 4B75A 5ESBA 1P2OA 2WYGA 1SGNE 2O9QA 1NC6A 3VGCB 4BTIB 1YLDA 1MD7A 3RXMA 1GDUA 1MTVA 3AK5A 3SQHE 4OGXA 2JH6D 3LOXA 2CK3D 3T2NA 4UE7H 2EI8A 4NIVA 3H09A 1MZDA 1CT2E 3VXFH 3A80A 1GDQA 3W94A 3K2UA 4BAOB 5LGOA 1ZSKA 2Z9GA 4JZEH 4Y10E 2PTCE 1GBBA 4NSVA 3E8LA 3VPKA 3GCNA 3DSOA 4A1TA 2C8ZB 3RP2A 3PLPA 4A6LA 2GX4A 1SLVB 2NU0E 5TCCA 3ZV8A 1TGTA 1VGCC 1H9IE 2GMTC 1H9HE 2TGDA 1W0KD 1TLDA 4TPIZ 3RXOA 4JZFH 2I6SA 3ATMA 2LNCA 3ESTA 1C2JA 2ZF0H 2PLXA 1P9UA 2ZWLH 3TJVA 2AERH 2VINA 3UFAA 2HVXA 3U1JB 3SUFA 3UOPA 3B8JA 3ZZ4A 1J14A 2YMSD 2KR7A 3ZYDA 4YZUA 1A5IA 1FLEE 1Z8RA 1ZTKA 2ZDNA 3GY6A 3P70B 2ZPRA 1YM0A 3VB4A 1HAOH 3R3GB 5ETXA 2PKAA 3E16B 3MNXA 1P9SA 5DP7A 1TQ0B 4CRDA 4OS1A 4WY3A 2TGTA 3BN9A 4YM9A 1K1NA 1MH0A 4IMQA 3ZZAA 2GCTC 1DS2E 1COWD 5E0HA 3A81A 1C5UA 1W7XH 2PKSB 1BTPA 5B6OA 4IC6A 3DFJA 1GJ9B 4ZHLU 1MAXA 3A88A 3QZRA 2P59A 1XUIA 5GNDA 1YPHC 3HATH 4X2WA 2WV9A 1WXRA 1DY8A 4RSPA 2A45B 3UNSA 3N7EA 1SFIA 1GBEA 2ZGXH 2C8WB 3GOVB 4A7IB 2F4LA 3UWJH 7KMEH 1VCQA 2J9NA 3FOAA 1BBRH 1BZXE 3A8AA 1AN1E 3U98H 4ZXYH 1IQIA 1OP0A 5FPTA 1C1OA 1QZ8A 3LGWA 3F3BA 4ZCNA 3U9AH 7LPRA 3Q3XA 1W10U 4IW4E 1CQQA 4GHQA 3BTEE 2RDLA 1WYKA 3RMOH 3KN2A 1C5VA 1V2UT 1A46H 1GDNA 2BLOA 3E3TA 5FX6A 1BMAA 3HK6B 4AYVB 4FVDA 5T6GA 1UTLM 2XBYA 2FTLE 4F55A 1F5RA 1GL0E 3NXPA 1BA8B 2OQUA 3SW2B 4UFDH 2OLGA 4LZ4B 1LHFH 1F0TA 1O3JA 1AY6H 1DWDH 4Y8XA 3FO8D 1V2ST 2XC5A 2PSYA 4FUGA 4GHTA 2GT7A 4MVNA 1RJXB 1WBGB 2CJIA 1YY3A 4UFFH 3L33A 3UUZA 1GJ7B 4JK5A 4D8NA 1BRAA 1O2WA 1DWBH 4Y0YE 4ZAEA 1RRKA 5GPIB 4Y71A 1NZQH 1SQRA 1TPPA 1QL7A 2WPDD 2P93A 1P0SH 3A87A 3SZNA 2THFB 2FS9A 2C4FH 3UR6A 1TABE 2BY6X 1F7ZA 1QFKH 2H9HA 2BOKA 1O2UA 1TNKA 2BLVA 3ODFA 3HPTB 4AC9A 4FU8A 1DXPA 1YLNA 2VH0A 2FP7B 2VU8E 1LHEH 1TA6A 1BDAA 3EA9A 1P2IA 2YOLA 1XVOA 2L6OA 3RLYH 1RGQA 3M61U 1M9UA 1MQ5A 1MTUA 1TFXA 1UTKA 2QY0B 1UTQA 2PW8H 1BIOA 4JZIA 1A2CH 4WVPE 3DT0H 3RXIA 4DT4A 1W13U 3UAIC 4DJZB 1O2NA 4BTTB 3U69H 3VB7A 1NRPH 6GCHG 2V0BA 3SORA 1Y59T 2HNTC 3MTYA 2R3UA 3PMAB 4A1VA 1G3EA 4WH8A 2BQ6B 4FVBA 3URCA 3SI3H 1YPMH 1RTLA 2AEIH 1O3GA 2F83A 2GGVB 1BMFD 3E0NB 1ABJH 2VIPA 1SQAA 2OC7A 2Y80A 2ZDVH 1BRBE 3NZIA 2Z7FE 1V2KT 2ZDLA 2ANYA 1O3NA 1HV7A 4BAHB 1NRNH 2ZC9H 1EZXC 4KKDA 1QBOA 4LXBH 4F4OC 1FX0B 2VVVA 1Z71A 1O3HA 5EXNA 4ISHH 3OEHD 1KXFA 5F8ZA 2C8XB 4K8BA 2F9UA 2G51A 1BRCE 2XNIA 1ZMJA 5EG4A 1F5KU 3URDA 3NRLA 4X1SU 1P2JA 3SJ8A 1AO5A 1GJ8B 2OCVB 3MU8A 3VB6A 1FAKH 1FZZA 1E37B 3N7OA 1MCTA 1IAUA 1EZQA 3GY5A 3HKJB 1O2RA 1Q31A 1GHWH 3ZIAD 2BOHB 1SG8B 3T62A 1GMCG 2FOCA 2ZFFH 5HMAA 1WQSA 3RXRA 1FNIA 2SGPE 1C5XB 5DKMA 2J98B 1D3QB 1S81A 3QO6A 4MTBA 3ZZ6A 2A0QB 2QYIA 4Y0ZE 1L2EA 4QT8C 1AWFH 1GHBF 2HLCA 1BMNH 2JKHA 4MPXA 1JRTA 1CHOF 5F03A 1FI8A 3O8RA 2V35A 3SV6A 2VWNA 3FKSD 3TGIE 3RU4D 4JZDH 1BBRE 5LPRA 1CVWH 4JYVH 4Y8YA 1N6XA 1O2QA 3PMBB 1ZR0A 4CHAC 1EP5A 1HLTH 1W3CA 1EQ9A 3Q00A 1LVMA 4NG9H 2AIPA 1T31A 2H9EH 2A31A 3RXVA 3ENSB 3KQEA 2AGIX 2TRMA 3HKIB 4X8SH 3HGNA 1Z1JA 5DP6A 3A7XA 1QJ1B 2VIQA 4ZH8A 3TH3H 2A4RA 2Z3EA 4OS5A 2A4GA 1C5YB 4YXWD 1LHCH 4AB9A 4AFUA 1XUHA 2YMSC 1O38A 4AFQA 1TNJA 3UPEA 1MTNC 2UWPA 2BY7X 1IHSH 2Y6TA 3ZZ7A 1QGFA 2VIDA 2OD3B 4ASHA 2PWXA 3F9GA 1NS3A 4NGAH 1AE8H 3A7WA 1WSSH 1O2ZA 3SYJA 5A8XA 1HJ8A 1Z8GA 3TK9A 1KXEA 2J34A 1B0FA 2ODYB 2HRVA 1P11E 1RS0A 3VG8A 3MU1A 1HAYB 3OY6U 1K1IA 4ZKRU 1EASA 1PPEE 1GI9B 1AQ7A 1UW7A 2Y82A 1O35A 3K9XB 1E0FD 4WF8A 3E91A 2FEQH 1A0LA 1OX1A 1ANDA 4A92A 1KMHB 2EY4C 1FPHH 3LC5A 4XRNA 6CHAB 2RDEA 3GDUA 2FYRA 1OS8A 4SGAE 3BEFB 1ORFA 2UWLA 1NM6A 1O3BA 3HGPA 1SOZA 2JH5D 4ISOA 1JRSA 3TJNA 4BAQB 1GBHA 2ESTE 4E7RG 1ZHMA 5KECA 1YYY1 3DFLA 3BTME 3TGKE 5A0AE 1QL8A 2WPJS 1V2TT 3F2FA 2H1UA 1NTPA 3ZZ3A 2GCTB 1OP8A 3PLKA 4ZKNU 1W0JD 5C1UA 4YOIA 4DT7B 3I77A 1K22H 1K1OA 2ZHWH 3A84A 2FLBH 5G4BA 1P05A 3O8DA 4O9VA 2LPRA 8ESTE 3AVZA 1V2RT 3H5CB 2F9OA 2GKVE 1BMLA 1GJ6A 1V2PT 1AVXA 1BHXF 3EA7A 4FUHA 1H1BA 1IQNA 1GCTB 2BX4A 4WMEA 1UTJA 1VCWA 1EJAA 1ZJDA 5DGJA 2A5KA 3VB3A 4AORA 1TGSZ 1ANCA 1B5GH 1Z6JH 2H9TH 2JH0D 5GJ4B 3ZZDA 1EZUC 4JZ1A 1ZRBA 2PKSC 1OKXA 3SUGA 1GHAG 2ULLA 2VJ1A 1KIGH 1IOEA 5GIBA 5FXLA 2ZQ2A 4K8YA 1C9PA 2AMQA 4FUBA 4NIXA 1EOJA 3P8NA 4B73A 3JZ1B 1K1LA 1FPCH 1HPGA 4FETA 1T8LA 1SL3A 1AUTC 1BOQA 4B2BA 3PO1B 1O2OA 5GCHF 3TH4H 4F48B 4YLQH 1PQ8A 5IK2D 2CF8H 2JIZD 1ZJKA 2BD8A 5EODA 2AH4X 1Z8JB 3BTFE 1O2LA 3ZZ9A 5K7RA 2QXJA 1UHBA 1O5FH 2W6ID 2BTCE 1TNIA 4OS6A 3T25A 4WMDA 1RTKA 1A5GH 1TOMH 3SNEA 3A85A 1GJ5H 3LIWA 1F92A 4Z0KA 2J2UA 1JXPA 2G52A 3RDZA 3TGJE 2ANWA 1BJUA 3LGUA 3OYPA 1FQ3A 1P3EA 4ISLA 1ZPCA 1QB1A 5B6LA 1T8MA 2PUQH 3A86A 4YOGA 4NSYA 4ZKSU 2J98A 4NZLA 2Y5GA 1KXBA 1QQ4A 2C93B 1GVZA 1MTWA 1UK3A 4O97A 1TRMA 1OOKB 1MMJN 2Y7ZA 4NCYA 3FANA 1LVYA 2AMPA 4ZXXH 3SGBE 3A7ZA 3TVJB 4B2CA 1HIAA 3S9CA 3DCLA 1AKSB 5JBCS 2KCPA 3OTPA 4Q4LA 1D3PB 2FTMA 1HUTH 3BG8A 2GZ8A 3A83A 3TNTA 3GDVA 4CR9A 1A5HA 2I6QA 3GY7A 2JJ1D 1ZHPA 1HJAB 1IQFA 2FYQA 1H9LB 4Y76A 2Q6FA 3KNXA 3P95A 3SUDA 4I31A 3ODDA 3ATWA 2XW9A 1MD8A 1EX3A 2ASUB 2VBCA 4BNRA 1O5DH 1AZ8A 2D8WA 1C4Y2 2IJD1 3EGKH 1C1NA 1GBJA 2KAIA 1Y5BT 5BRRE 1VCPA 3EDXB 3UQOA 2XRCA 3MH6A 1JOUB 3LPRA 2FOGA 4JYUH 1C1WH 2RFKC 1ELAA 5DP8A 2QF0A 4XOJA 1P2KA 3ZZ8A 4I7YH 4HFPB 2ZPQA 4ABAA 1H8IH 3VEQB 1ZTLA 3U8OH 1V2LT 2J95A 3M5NA 2PSXA 3OSYA 1GVKB 3QZQA 1IQHA 2DUCA 4BAMB 1CE5A 1V2WT 1QR3E 3WWFA 4O3UA 4HTCH 4MNVA 1C5PA 1UVTH 1NBME 1E38B 3A8CA 3UREA 4DGJA 4ACAA 1Z8IB 4WXVA 1C1RA 1N8OC 1OYQA 5JPMH 1HXEH 1IHTH 5EW2H 2JDID 9LPRA 1CBWC 3PTNA 1SQTA 5E2OA 2AMDA 5AHGH 1Z6EA 1C5QA 4LOYH 4X6PA 1GG6B 5A2MH 3Q76A 2BDYA 2Q6DA 2VVUA 2WZQA 2QF3A 1O3CA 2P95A 3E90B 4Q63A 1S85A 1C2IA 1SLWB 1O5CB 5E0GA 3S9AA 1HAVA 4HGCA 3WWBA 2H5CA 2TGPZ 3SJKA 2QIQA 3OFND 2UUKB 3RXLA 2P94A 1H8ED 5A09A 2BM2A 2KX4A 4X8UH 2QA9E 2ZG0H 1W2KH 1BJVA 1KLIH 5EXMA 1LKAA 4I8GA 2PFEA 1EKBB 2Q1JA 3M37A 1O2XA 2NU3E 2ZFPH 5T3HA 2SGEE 1SGCA 2GDDA 4IS5A 1GCTC 1CU1A 1ZGVA 2D1JA 1J8AA 1PPHE 3MU0A 1ZSJA 1EATA 2WV4A 1H4WA 1RFNA 1O31A 4J1YA 4THNH 2W6JD 3UTUH 2VGCB 2BQWB 7GCHG 4AYYB 2ZU1A 4YT6H 3LGIA 3SGQE 5I25A 4U32A 2A1DB 2G55A 2FS8A 8GCHF 1UHBB 1W14U 1LMWB 3TNSA 3ZZBA 1PPFE 1DXWA 1C4V2 1ZPZA 1ELFA 1FN8A 3UOUA 1RXPA 4GLYA 3N7DA 2PR3A 1OP2A 2GTBA 1QQUA 2GV7A 4XBBA 3SBKA 2BD5A 1F0SA 4BOHA 3M3SA 5L6NH 2FM2A 1Q2WA 1THSH 5TJXA 3LDXH 1LCYA 5FBEA 2SGAA 2SNVA 2YMSB 1WUNH 1O2MA 4CHAB 2BDIA 2A4OA 3GS9A 3IG6B 1SPJA 2BHGA 3SU0A 4KTCA 2F3CE 2F9BH 3B9FH 3KCGH 4DCDA 1WTGH 1GHBG 3DHKH 2V7QD 4B6FA 3PYHA 3NKKA 1GI8B 1WQVH 3OE7D 4J2YB 1C5LH 1W8BH 1IQLA 3QK1A 1LHDH 2G00A 1MBMA 1H8HD 1PQ7A 2G4TA 1ELEE 6ESTA 3AAVA 1OYTH 5A8YA 1AFEH 4CRBA 1T4UH 2ZU3A 7GCHF 5C3NA 2DE9A 2Y81A 1SHYA 4KP0A 1TX7A 2H5DA 4RKJB 1TBRH 1GJBB 1TPOA 3SNBA 1O2GH 3A8BA 2OTVA 1C5WB 2J5UA 5K0HA 3UR9A 1HXFH 1UCYH 1LPZB 1BCUH 1P2NA 3RC5A 1GL1A 1V2NT 1V2OT 1NRRH 3E1XB 5CE1A 2BY8X 1SGEE 1C1SA 2CV3A 1DUAA 1AZZA 5EQRA 2BMGB 3KQCA 1KSNA 2NWNA 4GCHG 4TYDA 1TOCB 3EE0B 2Z3CA 1C1UH 4FXGH 1VITH 1L4ZA 2BXTH 3SHAH 1UVOA 3MHWU 1N1LA 5I46H 1DITH 1GCDA 5F8XA 1N8OB 2KAIB 4DVAU 3GYLB 3STIA 2QXGA 1T8NA 2GT8A 4K60A 3LGTA 2EEKA 4ZROA 3SJOA 2BDAA 1E79D 1ZMNA 3M36A 4YESB 4CBOA 1UVSH 3GY2A 1YPKH 4U01A 4GUXA 1ZRKA 2ZPSA 1AVGH 1PFXC 5AF9H 1Y3XA 1O32A 1V2MT 2F9NA 1O37A 2R3YA 2BD4A 3P8FA 1DDJA 2IPHA 2QXHA 3RXFA 1NPMA 1P09A 1GI6A 3LONA 4FUDA 4CR5A 4KTUA 5JB8S 5FPSA 1TNLA 3KYGA 2FPZA 5JDUB 1LKBA 1YPEH 3WY8A 2P8OC 1L1NA 3LU9B 4WJG2 3SZEA 1PPGE 3OX7U 3PMHB 4KGAA 2OQ5A 4DIIH 1BTHH 1Q3XA 2JETC 1MKXH 2V3MA 4FUEA 1QA0A 3SUEA 1GG6C 4MQAA 4Z1MD 3PO1C 2TPIZ 5L30H 4JK6A 2STBE 2ZNKH 1DE7H 2XWAA 4ESTE 3FZDA 3PWCA 4GCHF 2NU2E 2HOBA 3RXSA 1TWXB 2NU4E 4I8LA 1UVUH 4JMYA 1XUKA 3W95A 1LTOA 1O3KA 2VGCC 5JB9S 4ACBA 4DW2U 3RXGA 1Y3WA 4D76A 4H4FA 5C67A 1FY1A 1P10A 2ZQ1A 1ETRH 2ZTZA 3PM3A 2ZU2A 4MDSA 1G2LA 1AVWA 3GICB 1OWKA 5EJ1A 3H7TA 1QHRB 1PJPA 1QRZA 2HPQH 5EGMA 1YCPK 1ARBA 2XXLA 3M7TA 4UFEH 3GYMA 1GHZA 1K2I1 1FDPA 4GSOA 3T26A 3D65E 2F9PA 3S69A 5HM2A 1S0QA 1KY9A 1L4DA 4TT3D 1AIXH 1THPB 2ZDKA 1DWEH 2QC2A 3SU5A 3DD2H 2ZI2H 1EOLA 1FXYA 1TPSA 1O3FA 3MNSA 1E1RD 1ZPBA 2YNBA 3S0NA 5LH8A 3NK8A 4B6EA 2D26C 3PRBA 5AFYH 1G2MA 2AYWA 1DM4B 2VB0A 2QXIA 3F0OA 3I29A 3KQBA 1TPAE 2KCAA 5SGAE 1IQGA 1GBIA 5EPYA 1GJAB 3SN8A 1CA0B 1QB6A 4K2YA 5CMXH 1QBVH 2BD2A 3MU4A 1ELDE 1O2KA 1SSXA 1YKTA 1DWCH 2J92A 3Q3KA 3F9EA 1EJNA 1ELBA 2A2XH 2ANKH 1NROH 5AVDA 2O8LA 2BDHA 2C3SA 3V3MA 3O8CA 2FX6A 4F49A 2PGQB 4DURA 1FJSA 1C2EA 2GZ9A 1INCA 3M3TA 5KEDA 1LQDB 1CSOE 1TNGA 4B2AA 1L1GA 3LH3A 1FONA 2ZHEH 4INHA 3RLWH 4B74A 2CN0H 1UTOA 3BSQA 5GWZA 4LZ1H 1LO6A 1ABIH 3UY9A 4NFFA 1BTZA 1AB9B 3Q77A 3U1IB 3T27A 2WUBA 1ZTJA 2FOMB 1WCZA 3RC4A 4E05H 2P3FH 1GI0A 4TY7A 4Z6AH 1WAYB 1BTUA 1XMNB 2G5NA 3PTBA 3T28A 1K1PA 1BBRK 1BITA 1Z7KA 4OGYA 1HAXB 1XXDA 2IN2A 1ELTA 2BB4A 2FMJA 3F9FA 1ESBA 3P8GA 2BQ7B 1IQJA 5EOKA 5ABWA 1LHGH 1FIZA 2QV1A 1SVPA 1A3BH 4ABEA 5C17A 4ZHAA 1KXDA 1GBLA 3MFJA 2CXVA 1C4U2 1H8DH 2ZDMA 1XUGA 4WMFA 3BTDE 1EAXA 5DK1A 5DPAA 1ESTA 1TMUH 1C2FA 4K3JA 3STJA 1V2QT 1J15A 1SGQE 3VGCC 1Y3UA 3EQ0H 4IN2A 1G3CA 4X1NU 1PPZA 5ESTE 4Y6DA 1G37A 4A5TS 2CMYA 1W11U 1O2YA 3SV9A 2G4UA 1DSUA 1ZOMA 3O8BA 2BLWA 1O3PB 5E2PA 2HPPH 4Q7XA 1C5TA 4AGKA 1CGIE 2PKAB 1O3IA 2JETB 4Q80A 3A8DA 4OS2A 2VVCA 4FUJA 1NBMD 4NWLA 3TJUA 1C5NH 4A1XA 1TNHA 2ZFTA 1NU7B 2CHAB 1AMHA 2OK5A 1CT4E 4TPYA 2R0KA 2FOEA 3FP8E 1ESAA 3QX5H 2GVFA 3GDSA 5DJ7A 1P2QA 2O8UA 1WOFA 4MLFB 1O2JA 1E36B 2Z6BD 1JIMA 4TWYA 1AKSA 4XFQA 3UNQA 2K8IA 3RXQA 1YBWA 1O33A 2ODQA 3MH5A 2J97A 1L0ZA 3P8OA 2ZCHP 1VZQH 1EXFA 2QF5A 1MUEB 1EZSC 2OUAA 3PB1E 3EA8A 3M5LA 4Y11E 1WU1A 4NA8A 1DOJA 2GZ7A 3OEED 2W5EA 4NA9H 3UQVA 3U28C 4BAKB 1MBQA 5E0JA 1ZZZA 1ZYOA 1ARCA 2XYAA 5EPNA 2EA3A 3KQDA 4AOQA 1C2GA 2BVXH 1K28D 4CRGA 1DLKB 4NIWA 3L3TA 3KQ5A 1FY8E 2Y5FA 3BEUA 4MPVA 2FOFA 5DP3A 2ZU5A 3QLPH 1C5RA 3RXKA 1NFXA 3V7TA 2OC8A 1C2DA 4ABJA 5EXLA 1ZHRA 5EIYA 2WUCA 4H6TA 1O3AA 1OPHB 1S5SA 1SMFE 1O5GH 1AB9C 1YF4A 1O2TA 2OP9A 1P04A 3F9HA 4HZHA 1MTNB 1MKWK 1DUEA 1GGDB 2R9PA 5CHBA 1UMAH 1PPCE 3ATKA 1A61H 1HJ9A 1TYNA 4RT1A 2PTNA 2ZHFH 2HVYB 1TX8A 1HAGE 1YC0A 3RU4T 1MU6B 2STAE 4P00A 1AGJA 1IQEA 3OTJE 1BT7A 2HWLB 1F0UA 3EYDA 1UVPA 1TMTH 4IGDA 2XBVA 1W7GH 3NCLA 1D6RA 2ZIQH 5FCKA 1O3DA 1GI2A 2UUFB 2O8WA 3U8TH 2KM0A 1UK2A 5FPYA 1HGTH 1X7AC 3FAOA 1HBTH 3M3VA 2WSSD 3T5FH 1TRNA 1GHYH 1P12E 4BXWA 4RT0A 1VITF 3RXTA 4AFZA 3SJ9A 2XC4A 3ZVAA 3V0XA 2XTTB 5C94A 1OWIA 3KF2A 3MOCA 3ZVGA 1SHHB 1GBDA 1CA0C 3PLBA 3F6UH 1AI8H 1Y8TA 1C1TA 3GCHB 3SI4H 4CRCA 4AGJA 4MPWA 1F0RA 4UFGH 4I86A 2UWOA 4K69A 3TLOA 2ALVA 3LJJA 4ISIH 4IBLH 3TK6A 3H7OA 1BMMH 2F91A 3UIRA 1CGJE 2VIOA 2EI7A 3EAJA 1ELGA 4MNWA 2FWWA 1NRQH 1OXGA 3RXAA 1O36A 1VJAU 1O3LA 4XSKU 5EQSA 1GBAA 4XDEA 1UCYK 1YPLH 4X1QU 1GJDB 2ODPA 3RMMH 3GCTF 4BANB 1ETSH 3A7VA 3K6YA 3PV2A 3MH7A 1EP6A 4I8JA 3RXDA 3CS7A 1DT2A 2WHXA 1W0ZU 2ZU4A 3UNRA 4Q7ZA 2WYJA 1FIWA 2ZGCA 3ZVEA 1P03A 2BX3A 2OC1A 1DANH 4K1EA 1QL9A 4LK4A 1MKWH 1RIWB 1K1JA 3F0PA 2ZTXA 2GJGA 4X6NA 1HAPH 2BLQA 2GD4B 4Y79A 2UUYA 3M5OA 5T6FA 1GJCB 3LGVA 2XBWA 3W1EA 3MU5A 1XM1A 1CHOG 2W26A 4X8VH 3BTWE 4MPUA 1FY5A 3FP7E 2TGAA 2ZKSA 5LPEA 2RCEA 1DPOA 1LPGB 4M7GA 3VFEA 3JZ2B 1SKYE 1QJ6B 4UD9H 1V6DA 1DX5M 2B8OH 1D4PB 3MO9A 1EPTA 1K21H 1UCYE 1RD3B 4ZMAH 3OY5U 2ZFQH 1CT0E 3ZZ5A 1JBUH 5KGOA 4AX9H 2JJ2D 1AE5A 3ZYEA 1SGTA 1QIXB 2VH6A 5A0BA 4RN6A 2BYAX 3FVFB 4IMZA 1NRSH 1YPGH 2BDBA 1SR5C 2C8YB 4O03A 1MABB 1ELVA 1KDQB 1UTMA 3V13A 4K1SA 3S9BA 1G36A 2KZ4A 6CHAC 1PQAA 3ELAH 1NESE 3CS0A 2FDAA 1CGHA 3UB0A 4SGBE 1IQMA 2PGBB 1KTTB 1G3BA 1TA2A 3V12A 5HIZA 1C2MA 4INLA 1HJAC 4NFEA 1GBKA 3U8RH 3MO3A 4FOUC 1GMDG 2P3UB 3GY8A 5C1XA 2ZTYA 3ZVFA 5DSFA 2M2AA 3CP7A 4FUFA 4U30A 1NT1A 4X6MA 2XCNA 8GCHG 3RXUA 1U6QA 5C2ZA 4RKOB 4JCNA 5C20A 4JYTA 1T4VH 3PRDA 1AU8A 5DN6D 1G32B 3SNDA 2AS9A 3C27B 4B1TA 3QWCH 1QB9A 4Y7BA 2W7SA 1LPKB 1VKYA 1SLXB 1GBFA 3BF6H 2AGEX 1GI3A 4MG3A 3SV2H 1OWEA 4CREA 1KLJH 1OWDA 1FAXA 2Y7XA 5FHTA 3P17H 2AIQA 4CH2B 4B71A 1O3MA 4FU9A 4OS7A 4WWYA 2XCFA 2J38A 3UWIA 1TMBH 2ZCLP 4ZUHA 1F2SE 4UONA 1C2LA 1HYLA 3A82A 1PPBH 3FFGA 2RA0A 1YPJH 2BXUH 2GCHG 2TBSA 2K0QA 2ZEBA 4HG6A 3AW1A 1XUFA 2K1QA 2ZP0H 3K6ZA 3DSPA 3RXJA 5DO4H 1LVBA 2FOBA 4NZQA 1TIOA 5CDFE 2CF9H 3TPIZ 3SU2A 3BTTE 3GY3A 1GMDF 2QGRA 3M35A 1UTPA 9ESTA 4I32A 3SU1A 1AHTH 1MQ6A 1QY6A 3LJOA 1C5MD 4Q2KA 2IPQX 1RIWC 2PHBA 5C0TA 5A8ZA 3D49H 4ISNA 3VXEH 3A7YA 2P3TB 4H6SB 3OAAD 3P92A 1MCVA 2HALA 3LC3A 2F9VA 1GHXH 2V3OH 1KTSB
chains in the Genus database with same CATH topology
3DA9B 4I8HA 1A3EH 4ABGA 1ACBE 1KYNA 1WTHD 1FV9A 2UUJB 2ANMH 1ZSLA 3RXEA 4MNXA 4ABIA 3SO3A 1SBWA 2B0FA 3RXHA 1ELCA 3FZZA 1CA8B 4ABBA 1O39A 1JMOH 1SGFG 2OBQA 3NPSA 1O2VA 3LT3A 2SFAA 3KGPA 1SGIB 2GCHF 5PTPA 3F2HA 1TE0A 1E1QD 1AUJA 2SGDE 3L6PA 1HFDA 3MMGA 1DFPA 3BIUH 3A7TA 1NO9H 3BG4C 2FIRH 1GMHF 3GISB 1DICA 1E35B 1GBMA 4H42U 5EU8A 1FN6A 2ZDAH 1EAWA 3F1SB 3LH1A 2J4IA 1FY3A 3I78A 2Z9LA 4X8TH 2LELA 2WV5A 1AFQB 2G5VA 1HAHH 4CBNA 3BTQE 4D9QA 1O2PA 4UDWH 1MZAA 1W0YH 2GDEH 1SGFA 2BY5X 2IJOB 1YPHE 1TQ7B 1NFWA 1V2VT 4INKA 1QTFA 3T29A 3SNAA 1PYTD 5DP4A 4CRAA 3ZVDA 3KIDU 4NWKA 4X6OA 4AZ2B 3S7KB 4M9FA 5J4QA 3RXPA 1S84A 2OBOA 1CHGA 1A0JA 1BTYA 1SQOA 1HIAB 2FOHA 3RC6A 4U2WA 4GVUA 2FI4E 2ZGHA 1NFUA 2A7HA 5GDSH 5BPEA 1LQEA 1GGDC 2FZZA 2D2DA 3GY4A 1EB1H 3IWMA 5HYOA 4DG4A 1UO6A 2QF4A 3CENA 2M5TA 5FX5A 1SGRE 1SOTA 3BG4B 4FUIA 1AD8H 3ZV9A 2G81E 4YT7H 3BTHE 3LKWA 1G9IE 5A0CA 1XVMA 4R8TB 1OSSA 1P2MA 1GBTA 1P57B 1O0DH 1SB1H 2Z9IA 6GCHF 2RA3A 1LVOA 1J17T 1VJ9U 4ZHMU 2H6MA 3ZZCA 2P16A 1EB2A 1TAWA 1TBZH 1E34B 2V6NA 2ZZUH 1QRWA 1YLCA 5HM9A 1O5EH 5JYIA 1C1MA 3OU0A 1NFYA 2ZCKP 2H2ZA 4CH8B 4NA7A 1SGYE 1CBWB 1DY9A 1W12U 4GAWA 3ZVBA 1ETTH 1GI1A 2XBXA 4AG1A 3LGYA 3PV5A 3QGNB 4Q7YA 3ZVCA 4TWWA 4X0WU 1O5AB 1NU9A 1GPZA 1P01A 4YOJA 2BZ6H 1FMGA 1K9OE 1B0EA 2FXRA 3M5MA 1D3DB 1NY22 3SQEE 4BXSA 4I8KA 2GP9B 1TGNA 2WINI 1T32A 2WPKS 5F8TA 3MNBA 1HDTH 4YLUA 1AWHB 1ID5H 2XNDD 1C5ZB 2J94A 3TH2H 1S6FA 1VITG 3C1KA 2BD3A 1HAVB 3AASA 1D9IA 4K1TA 1BRUP 3SJIA 3SHCH 1C5OH 1O2SA 1P3CA 3P6ZB 2ZECA 4AN7A 4FUCA 1GBCA 1GVLA 2XOKD 2YNAA 4E06H 4BTUB 2EC9H 3M7QA 1SFQB 1A1RA 4VGCC 3F68H 1XUJA 2ALPA 1GI7B 2B7DH 4ABHA 2QE7D 5IYTA 5EQQA 1Y3YA 1SGPE 4DOQA 5C5NA 2BD9A 1EJMA 1Z1IA 2FI5E 2A32A 3QTVH 4ABFA 5J4SA 2BD7A 2GMTB 1HNEE 1THRH 1VR1H 2WPHS 4WH6A 3QTOH 1WV7H 5TCAA 4D7FA 3D62A 4Y8ZA 1D3TB 1K1MA 3BTKE 1HCGA 1OWHA 3R0FA 3TU7H 3KEEA 1XKAC 1P06A 1EUFA 1O2IA 1YCPH 3SV7A 1G3DA 1JWTA 5T6DA 4ZKOU 1KXCA 4VGCB 5CHAC 4OS4A 1NN6A 3SV8A 5JBAS 3SGAE 3AAUA 4IC5A 4O3TA 2QAAA 1DSTA 1GI5A 2BVRH 4KTSA 1HB0B 1TONA 4GPGA 1O5BB 5E8EH 5F53A 1L1JA 1JIRA 3RM2H 1F5LA 1QBNA 5HKKD 4B76A 1EFRD 1QCPA 2O8MA 4TY6A 3BEIB 5FCRA 1SC8U 3RM0H 2SGQE 1C1VH 1KXAA 2BY9X 1A0HB 5H4IB 2W3IA 2BDCA 1V3XA 4XBCA 1P8VC 3ITIA 2R2MB 1EAIA 4X2YA 6LPRA 4YO9A 3PV4A 1C9TA 5CHAB 1TALA 2Z94A 3MH4A 2HLDD 3SU6A 1GHVH 1TBQH 1O3EA 3K65B 4HI3A 4K5ZA 1UTNA 1C1QA 1CO7E 1RTFB 1BTXA 5C5OA 3SNCA 2ZGJA 1T8OA 3G01A 2ILNA 4X1PU 3B23B 2ZHQH 1DLEA 3NWUA 2HGTH 1A7SA 1TX6A 2OXSA 3MWIU 4DIHH 1MKXK 1DVAH 1LDTT 4XD7D 4WXIA 3QDZB 1O2HA 5C1YA 8KME2 2C90B 4XE4A 2GV6A 3VB5A 3S7HB 2FI3E 3RXBA 4UEHH 2B9LA 4FU7A 5DG6A 1V2JT 2ZFSA 3IITA 3TITA 1Y5UT 2QN5T 2O8TA 5L2ZH 2DE8A 2B5TB 3TIUA 3A89A 2CHAC 4NIYA 2FO9A 1HRTH 2F43B 5FL7D 1QRXA 4RI0A 2ZGBH 2BVSH 3ATLA 3DUXH 3FN8A 2P8OB 1OWJA 1QJ7B 3BTGE 4ABDA 1GHAF 1BUIA 2Z9KA 2SNWA 2HNTF 2ZO3H 5F6MA 1YP9A 2QCYA 1PQ5A 1Y3VA 3RXCA 4X2VA 1S82A 2VIWA 5HGGA 3MO6A 1XXFA 1FUJA 3M7UA 5T1VA 3ATIA 5AFZH 3SU3A 4I33A 5GCHG 7ESTE 5GXPA 1EPTB 1GMCF 1QNJA 3PWBA 3PROA 1VGCB 1XKBC 3WW7A 1SGDE 3F2GA 1MTSA 4YTAA 2V3HH 8LPRA 1J16A 2TIOA 1EAUA 2Z9JA 1YCPM 1MU8B 2ZHDA 3KHVA 2Y5HA 1KDQA 3RMLH 1HAIH 5JBTA 2G8TA 4E7NA 3RU4E 4PROA 2VNTA 2ZA5A 2FODA 2VWMA 1BTWA 1C2HA 2A7JA 2WPLS 1KLTA 2WPIS 4XBDA 5LPFA 2A2QH 2SGFE 1S6LA 2HNTE 1BB0B 2A5AA 5FAHA 2AFQB 2OC0A 2W7UA 4AFSA 4DY7B 3D23A 1PYTC 3MYWA 1IQKA 1AFQC 1O3OA 1ZMLA 2AHME 1O30A 2W3KA 3GCOA 3QUMP 3AW0A 4CRFA 2PV9B 2FOAA 3GCTG 3HK3B 2BZAA 1UK4A 4IN1A 3PMJA 1Y5AT 1QA7A 1BQYA 4AB8A 3QGJA 3KL6A 3MNCA 1T7CA 1C1PA 1FY4A 1XX9A 4OM9A 2WPMS 1EPTC 1TGCA 5FBIA 5DP9A 4MNYA 3N99A 1ZLRA 2EI6A 3FP6E 3TK5A 2PUXB 1TRYA 3RMNH 3SU4A 2ZFRH 1ZGIA 2KFWA 1MAYA 3BIVH 1ANEA 1S6HA 1TB6H 2A5IA 1UJ1A 1GMHG 2VWOA 1SI5H 2A4QA 5C0UA 2NU1E 1S83A 4D9RA 2Z3DA 1GJ4H 2A7CA 3SOSA 5DP5A 1OHHD 2KCYA 1GI4A 1GWAA 1J9CH 2AGGX 3BV9B 3TJOA 2XWBI 2R2WU 1D6WA 2VWLA 2Q6GA 2FLRH 3NUMA 1S0RA 5IDKA 1C2KA 3RUOA 1SLUB 5JBBS 4R0IA 2FESH 1YGCH 4D7GA 3E0PB 1HAZB 1ANBA 3MI4A 4X2XA 3E6PH 4Y7AA 3Q3YA 4X1RU 1G30B 1B7XB 2FX4A 5L2YH 4ASUD 2IOTA 5HXFA 1P02A 4KELA 1N6YA 2XC0A 2KCOA 1BHXB 4AG2A 5EW1H 2R0LA 4TSFD 1A4WH 2VIVA 2BDGA 3GCHC 1O34A 2RG3A 3QN7A 1TGBA 1QURH 2CGAA 1C5SA 2OINA 4B75A 5ESBA 1P2OA 2WYGA 1SGNE 2O9QA 1NC6A 3VGCB 4BTIB 1YLDA 1MD7A 3RXMA 1GDUA 1MTVA 3AK5A 3SQHE 4OGXA 2JH6D 3LOXA 3T2NA 2CK3D 4UE7H 2EI8A 4NIVA 3H09A 1MZDA 1CT2E 3VXFH 3A80A 1GDQA 3W94A 3K2UA 4BAOB 5LGOA 1ZSKA 2Z9GA 4JZEH 4Y10E 2PTCE 1GBBA 4NSVA 3E8LA 3VPKA 3GCNA 4A1TA 3DSOA 2C8ZB 3RP2A 3PLPA 4A6LA 2GX4A 1SLVB 2NU0E 5TCCA 3ZV8A 1TGTA 1VGCC 1H9IE 2GMTC 1H9HE 2TGDA 1W0KD 1TLDA 4TPIZ 3RXOA 4JZFH 2I6SA 3ATMA 2LNCA 3ESTA 1C2JA 2ZF0H 2PLXA 1P9UA 2ZWLH 3TJVA 2AERH 2VINA 3UFAA 2HVXA 3U1JB 3SUFA 3UOPA 3B8JA 3ZZ4A 1J14A 2YMSD 2KR7A 3ZYDA 4YZUA 1A5IA 1FLEE 1Z8RA 1ZTKA 2ZDNA 3GY6A 3P70B 2ZPRA 1YM0A 3VB4A 1HAOH 3R3GB 5ETXA 2PKAA 3E16B 3MNXA 1P9SA 5DP7A 1TQ0B 4CRDA 4OS1A 4WY3A 2TGTA 3BN9A 4YM9A 1K1NA 1MH0A 4IMQA 3ZZAA 2GCTC 1DS2E 1COWD 5E0HA 3A81A 1C5UA 1W7XH 2PKSB 1BTPA 5B6OA 4IC6A 3DFJA 1GJ9B 4ZHLU 1MAXA 3A88A 3QZRA 2P59A 1XUIA 5GNDA 1YPHC 3HATH 4X2WA 2WV9A 1WXRA 1DY8A 4RSPA 2A45B 3UNSA 3N7EA 1SFIA 1GBEA 2ZGXH 2C8WB 3GOVB 4A7IB 3UWJH 7KMEH 2F4LA 1VCQA 2J9NA 3FOAA 1BBRH 1BZXE 3A8AA 1AN1E 3U98H 4ZXYH 1IQIA 1OP0A 5FPTA 1C1OA 3LGWA 3F3BA 4ZCNA 3U9AH 7LPRA 3Q3XA 1W10U 4IW4E 1CQQA 4GHQA 3BTEE 2RDLA 1WYKA 3RMOH 3KN2A 1C5VA 1V2UT 1A46H 1GDNA 2BLOA 3E3TA 5FX6A 1BMAA 3HK6B 4AYVB 4FVDA 5T6GA 1UTLM 2XBYA 2FTLE 4F55A 1F5RA 1GL0E 3NXPA 1BA8B 2OQUA 3SW2B 4UFDH 2OLGA 4LZ4B 1LHFH 1F0TA 1O3JA 1AY6H 1DWDH 4Y8XA 3FO8D 1V2ST 2XC5A 2PSYA 4FUGA 4GHTA 2GT7A 4MVNA 1RJXB 1WBGB 2CJIA 4UFFH 3L33A 3UUZA 1GJ7B 4JK5A 4D8NA 1BRAA 1O2WA 1DWBH 4Y0YE 4ZAEA 1RRKA 5GPIB 4Y71A 1NZQH 1TPPA 1QL7A 2WPDD 2P93A 1P0SH 3A87A 3SZNA 2THFB 2FS9A 2C4FH 3UR6A 1TABE 2BY6X 1F7ZA 1QFKH 2H9HA 2BOKA 1O2UA 1TNKA 2BLVA 3ODFA 3HPTB 4FU8A 1DXPA 2VH0A 2VU8E 2FP7B 1LHEH 1TA6A 1BDAA 3EA9A 1P2IA 2YOLA 1XVOA 2L6OA 3RLYH 1RGQA 3M61U 1M9UA 1MQ5A 1MTUA 1TFXA 1UTKA 2QY0B 1UTQA 2PW8H 1BIOA 4JZIA 1A2CH 4WVPE 3DT0H 3RXIA 4DT4A 1W13U 4DJZB 1O2NA 4BTTB 3U69H 3VB7A 1NRPH 6GCHG 2V0BA 3SORA 1Y59T 2HNTC 3MTYA 2R3UA 3PMAB 4A1VA 1G3EA 4WH8A 2BQ6B 4FVBA 3URCA 3SI3H 1YPMH 1RTLA 2AEIH 1O3GA 2F83A 2GGVB 3E0NB 1BMFD 1ABJH 2VIPA 1SQAA 2OC7A 2Y80A 2ZDVH 1BRBE 3NZIA 2Z7FE 1V2KT 2ZDLA 2ANYA 1O3NA 1HV7A 4BAHB 1NRNH 2ZC9H 1EZXC 4KKDA 1QBOA 4LXBH 4F4OC 2VVVA 1FX0B 1Z71A 1O3HA 5EXNA 4ISHH 5F8ZA 1KXFA 3OEHD 2C8XB 4K8BA 2F9UA 2G51A 1BRCE 2XNIA 1ZMJA 5EG4A 1F5KU 3URDA 4X1SU 3NRLA 1P2JA 3SJ8A 1AO5A 1GJ8B 2OCVB 3MU8A 3VB6A 1FAKH 1FZZA 1E37B 3N7OA 1MCTA 1IAUA 1EZQA 3GY5A 3HKJB 1O2RA 1Q31A 1GHWH 3ZIAD 2BOHB 1SG8B 3T62A 1GMCG 2FOCA 2ZFFH 5HMAA 1WQSA 3RXRA 1FNIA 2SGPE 1C5XB 5DKMA 1D3QB 1S81A 3QO6A 4MTBA 3ZZ6A 2A0QB 2QYIA 4Y0ZE 1L2EA 4QT8C 1AWFH 1GHBF 2HLCA 1BMNH 2JKHA 4MPXA 1JRTA 1CHOF 5F03A 1FI8A 3O8RA 2V35A 3SV6A 2VWNA 3FKSD 3TGIE 3RU4D 4JZDH 1BBRE 5LPRA 1CVWH 4JYVH 4Y8YA 1N6XA 1O2QA 3PMBB 1ZR0A 4CHAC 1EP5A 1HLTH 1W3CA 1EQ9A 3Q00A 1LVMA 4NG9H 2AIPA 1T31A 2H9EH 2A31A 3RXVA 3ENSB 3KQEA 2AGIX 2TRMA 3HKIB 4X8SH 3HGNA 1Z1JA 5DP6A 3A7XA 1QJ1B 2VIQA 4ZH8A 3TH3H 2A4RA 2Z3EA 4OS5A 2A4GA 1C5YB 4YXWD 1LHCH 4AB9A 4AFUA 1XUHA 2YMSC 1O38A 4AFQA 1TNJA 3UPEA 1MTNC 2UWPA 2BY7X 1IHSH 2Y6TA 3ZZ7A 1QGFA 2VIDA 2OD3B 4ASHA 2PWXA 3F9GA 1NS3A 4NGAH 1AE8H 3A7WA 1WSSH 1O2ZA 3SYJA 5A8XA 1HJ8A 1Z8GA 3TK9A 1KXEA 2J34A 1B0FA 2ODYB 2HRVA 1P11E 1RS0A 3VG8A 3MU1A 1HAYB 3OY6U 1K1IA 4ZKRU 1EASA 1PPEE 1GI9B 1AQ7A 3K9XB 2Y82A 1O35A 1E0FD 4WF8A 3E91A 2FEQH 1A0LA 1OX1A 1ANDA 4A92A 1KMHB 1FPHH 3LC5A 6CHAB 3GDUA 2FYRA 1OS8A 4SGAE 3BEFB 1ORFA 2UWLA 1NM6A 1O3BA 3HGPA 1SOZA 2JH5D 4ISOA 1JRSA 3TJNA 4BAQB 1GBHA 2ESTE 4E7RG