4XBCA

1.60 a resolution structure of norovirus 3cl protease complex with a covalently bound dipeptidyl inhibitor (1r,2s)-2-({n-[(benzyloxy)carbonyl]-3-cyclohexyl-l-alanyl}amino)-1-hydroxy-3-[(3s)-2-oxopyrrolidin-3-yl]propane-1-sulfonic acid (hexagonal form)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
183
structure length
174
Chain Sequence
HMAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQAGEGETALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-LIKE PROTEASE
publication title Structure-Guided Design and Optimization of Dipeptidyl Inhibitors of Norovirus 3CL Protease. Structure-Activity Relationships and Biochemical, X-ray Crystallographic, Cell-Based, and In Vivo Studies.
pubmed doi rcsb
source organism Norwalk virus (strain gi/human/united states/norwalk/1968)
molecule tags Hydrolase/hydrolase inhibitor
total genus 40
structure length 174
sequence length 183
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xbcA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xbcA01
2Z9GA 3NUMA 1OP2A 3H5CB 4MDSA 3E0NB 4THNH 5FPYA 3PM3A 4CRAA 1S0QA 3RXBA 1RS0A 4WWYA 4OS4A 2W5EA 1GBDA 1HJAB 1Z71A 3A83A 3OY6U 2UWPA 3QZRA 5K0HA 5F8ZA 1CQQA 3BV9B 1TQ7B 1A61H 2F9BH 4ZXYH 2GV7A 4JK6A 1IQHA 1FJSA 1LPGB 1Z1JA 5A8YA 1G32B 3O8DA 4LXBH 4Z6AH 1C4V2 1A3BH 2VIPA 3TH3H 4B75A 1NPMA 1HUTH 4CH2B 1EAIA 1GGDC 1SQOA 3R3GB 4FUEA 5GCHG 1LVOA 4ABHA 3VXEH 4NWKA 1ELFA 1LHEH 1KYNA 1CHOG 5CMXH 1W13U 1O35A 3SU0A 1Q3XA 5CHAB 1GVLA 1P2NA 3GOVB 1GBTA 1TWXB 1ELVA 5LPRA 2BQ6B 1GJ9B 1TX6A 2B8OH 3HK6B 1QB9A 3O8CA 1O3LA 1JRSA 2ZG0H 2R0KA 4A1TA 3GY8A 2AMPA 2UWLA 1MH0A 1L4DA 1YC0A 2XRCA 1ANBA 4YESB 5F03A 3O8RA 1Y3WA 3BTFE 1SHYA 1SGIB 2WPIS 1BTWA 1P3CA 2FTMA 5EG4A 1P9UA 2ZQ2A 5EQSA 1BIOA 1K1MA 1V2RT 1ID5H 2ZGJA 4AFSA 4K1TA 1PPGE 1MTNC 2BX3A 2ZCHP 5C1XA 4YT6H 5TCAA 4X6MA 3SOSA 4IGDA 5A0CA 3BTWE 4XSKU 2O8TA 5DKMA 1QRXA 3BEIB 2ZHQH 1G37A 5LPEA 1NM6A 1INCA 2VIQA 3ZZ3A 1KDQB 3BEFB 3UNSA 3KGPA 1TMUH 2PKAB 2ODQA 2Q6FA 2Y5GA 4K60A 5EW1H 1P12E 2PGBB 3RU4D 4D76A 1V2MT 1SLVB 2FOHA 1GI0A 1VZQH 1GMDG 2ZDMA 1O3FA 3GCNA 2PKSB 1C2EA 1BITA 3V7TA 2P8OC 1C5ZB 2J92A 3TNTA 4INLA 4UEHH 3V0XA 1F2SE 1WQVH 4BAHB 1C5LH 3SU2A 1QQ4A 4X2XA 1O2JA 1QBOA 3H7OA 2Q1JA 1NRNH 1SFQB 2LPRA 4JCNA 4IBLH 2PKAA 1G2MA 2NU1E 1GJ7B 3QN7A 1BTPA 4UFEH 3H7TA 4FU7A 1CBWC 2OLGA 4SGAE 1E36B 1SLWB 4ZH8A 3RXCA 1XVMA 1QL8A 3F9GA 1ELGA 3E6PH 2A4OA 3A89A 1A2CH 2QXGA 1MUEB 2V6NA 3OYPA 3BTEE 1GVZA 1EX3A 1V2TT 1ZSKA 7LPRA 1JIMA 2BD7A 1DICA 1CHGA 3V12A 2B5TB 2A4QA 3L6PA 3PMJA 4UE7H 6GCHG 1IQJA 3RXSA 3RC5A 3SUDA 3EQ0H 3CENA 1BT7A 1TALA 6ESTA 1TONA 2O9QA 2AIPA 1C5PA 2D26C 1NN6A 1O3BA 5FPTA 1FONA 1C2IA 1OWHA 3FZZA 2ZEBA 4UD9H 1T4VH 2A7CA 1PQAA 3TGKE 1AU8A 3SJOA 3SNBA 1EB1H 1O2PA 2ZWLH 3SV9A 2ZI2H 1V2KT 1H9IE 1KXEA 4O3TA 3SNEA 2IOTA 1ZPCA 1UTKA 4Q7YA 3U1IB 5JBTA 1GCTC 3TH2H 1YYY1 3RXUA 2GVFA 1C5TA 1NFWA 3EAJA 2ASUB 1ELBA 1EAUA 2ALVA 1AUJA 5EQRA 3URCA 4Z0KA 5DP6A 1P2QA 1O3MA 4WXVA 1MD8A 1O3EA 1AFQB 3ZZAA 2BD5A 4CRGA 4A92A 4E7NA 3MOCA 4X2YA 2ZGCA 2OTVA 2FEQH 1SGTA 8GCHG 1P9SA 1QJ1B 4INKA 3M3VA 4DURA 3A80A 4O9VA 1QBVH 5GPIB 3BN9A 1J17T 2O8UA 5G4BA 4NSVA 2QXIA 1BTXA 1C9PA 1F0SA 4X2VA 2J4IA 4X6NA 4CRBA 3TJOA 4R0IA 4MNYA 3Q00A 2FIRH 4BAMB 2P59A 2Z6BD 1ELTA 1BCUH 1A3EH 3HKJB 1G3DA 1O3HA 4CH8B 4CBOA 1HAIH 1LDTT 4AYYB 1MBQA 4MG3A 3RXOA 4JZIA 1JWTA 3PROA 4U32A 5E0JA 1BHXB 4TWWA 4DGJA 1BJVA 1CGIE 2NWNA 3M3SA 4ISOA 2BVXH 2XNIA 4B76A 2VIDA 4NIVA 4TWYA 3VPKA 1AVGH 5GWZA 1NY22 2BVSH 2WPMS 2GZ7A 4D8NA 1S84A 5AFZH 3MTYA 1C2GA 4BTIB 1HAXB 2AFQB 3PLKA 4CBNA 4OS6A 4RKOB 3SORA 1CT4E 4DVAU 1P57B 1EKBB 1DY9A 1P03A 2VNTA 2BZ6H 5HM2A 1H9HE 3BIUH 5GXPA 4BTUB 1UVOA 1GJAB 3GCOA 4WH8A 1MQ5A 2NU4E 2VH0A 4MPWA 1EP6A 1KLTA 3KN2A 2QY0B 3ZZ8A 2P3FH 2ZNKH 1LQDB 2HPQH 5CHAC 2WV5A 4JZEH 1DSTA 3MU0A 3MO9A 1V3XA 2BM2A 1XKBC 3E0PB 2G8TA 3HPTB 4I8GA 1ZHRA 1L2EA 2CHAB 1GI7B 1ABJH 1H1BA 3TJNA 3PWBA 3F6UH 4Y71A 2TPIZ 1GL1A 1XUFA 1ORFA 1C2DA 3Q3YA 4ISIH 2GCHG 4JK5A 5FHTA 2F9VA 2BD8A 1FV9A 1DWDH 1BRBE 2VWOA 1AE8H 1PPBH 1SOTA 6CHAB 1BMLA 1EZSC 1EQ9A 1HFDA 1OWDA 2HVXA 3RXGA 1NTPA 1C1RA 1NZQH 1QB6A 5A8XA 2OC7A 2QV1A 2HLCA 4J2YB 4AFUA 4ESTE 5PTPA 3A8BA 1UTOA 3BTHE 3SU3A 3U69H 2F9PA 1F0TA 2FOAA 3SQEE 4GCHG 3M37A 1ZZZA 2BY9X 3GDSA 1RIWB 1E37B 2TGDA 4KP0A 2FO9A 3SUFA 1A46H 1F5KU 1OWIA 1FN8A 4MVNA 3I77A 2ZPRA 3SGQE 8KME2 1S5SA 1UK2A 1ZR0A 2V3OH 4YM9A 2VVCA 2R2MB 4NCYA 1SQTA 5J4QA 3MI4A 4O03A 1H4WA 2CV3A 1BTHH 4K8BA 4MNWA 3PB1E 3HGPA 3D65E 2FYQA 1K22H 2UUJB 1ZJDA 1C5RA 2A32A 2XYAA 4RN6A 1CGHA 1K2I1 1QTFA 3F1SB 1GBFA 3HKIB 4Y8XA 1K1IA 1IAUA 2GV6A 2SNWA 1ESBA 2ZF0H 3RXMA 1C5MD 2ZGBH 4IW4E 2A31A 1EOLA 2A2XH 2Y80A 1GDUA 1MKXK 2BB4A 1QURH 4WJG2 1C5UA 1SL3A 1VITH 2W3KA 2BDGA 2VWLA 3W95A 2Z3EA 1HAYB 2ZU4A 4RSPA 4D7FA 4D9RA 3B23B 2XCNA 3MWIU 1EAWA 2XTTB 2A5IA 5C3NA 3P8OA 2AMDA 1GHAG 2Y7XA 1UO6A 2OD3B 4X1NU 3VB3A 4ABIA 2FX4A 2VU8E 2VWMA 1LQEA 1SC8U 2ZTZA 1PJPA 1C1TA 1HCGA 3GCHB 1AGJA 1NFYA 4GHTA 7ESTE 5T6GA 1MKWK 2GKVE 5J4SA 2GZ9A 5EPNA 3ZYEA 2BOHB 3E90B 5LH8A 3UREA 2FXRA 4GAWA 1GBLA 3A81A 1QL7A 1VCQA 4KELA 3CP7A 3SN8A 4ABGA 3ATIA 1K28D 2ZFFH 1JIRA 2ZCKP 5DP3A 3QWCH 1M9UA 1J14A 1FIWA 5A0AE 1BTZA 1C1VH 3SV8A 4BXWA 1GJBB 1NRQH 1EUFA 1IQNA 2P3UB 2THFB 3ZZDA 3KNXA 1O2OA 2Y81A 2PSXA 1CA0B 3UIRA 3TK9A 1DXPA 1VGCB 1O33A 1AFQC 1SHHB 1NRSH 2A1DB 3A7VA 2I6QA 3FP6E 1BJUA 1O0DH 2G81E 5DP7A 1RJXB 2FTLE 2BD9A 3UQVA 5JB9S 1BA8B 3QTVH 5DPAA 4CRFA 1LKBA 3MHWU 1HAPH 2XC0A 1GI1A 3TPIZ 2FM2A 1N6YA 2FX6A 1GMHF 2H6MA 1AVXA 4BNRA 1C1QA 3E3TA 1V2WT 2AGGX 5TJXA 5T3HA 1N1LA 2C8ZB 1ZPZA 1DLEA 3A7XA 1VITG 4ZAEA 2SFAA 2PV9B 1SGEE 2CN0H 1O5CB 4IN2A 4O3UA 1SGRE 2RDLA 1WAYB 4IS5A 2ZIQH 1O3AA 3ATMA 5HXFA 1T4UH 1AB9B 1YPHE 3A8AA 3SU6A 2BD2A 4YZUA 1C1UH 5E0GA 4DY7B 1TNLA 2A7JA 1BRCE 1F5RA 2OC0A 5F8XA 1ZSLA 1IQGA 3M5MA 3SV7A 1BRUP 5EU8A 4Y10E 2TIOA 3O8BA 3BG4B 2K1QA 2XWBI 3LU9B 1QRWA 2P95A 4BAOB 1GJ4H 3SV6A 2R9PA 1Z6JH 2CJIA 2QYIA 4ABEA 3UWIA 1O2VA 1TGBA 1ZGVA 4I31A 1J15A 1GMCG 3LJJA 4JZ1A 1TNHA 1O2UA 2W3IA 3E1XB 1HAOH 3MO6A 2C3SA 3SW2B 3E16B 1ARCA 2BOKA 3GCTG 1YPMH 1THRH 1Y5AT 1JXPA 3T26A 5C2ZA 5I46H 3R0FA 3JZ1B 1MZAA 4WY3A 5T6FA 2VIVA 1SBWA 1QNJA 1O39A 1TPPA 3SQHE 4B2BA 2ZU2A 4E06H 3CS0A 5AFYH 3Q3KA 1D6RA 1ABIH 1CE5A 1BRAA 1GJDB 2GP9B 5FX6A 1EP5A 1S81A 1KLJH 4JMYA 2ZFQH 2H1UA 3RUOA 7GCHG 1Y5UT 2QF0A 1UCYE 3EA9A 4HI3A 1BBRH 2RCEA 2OC8A 1J16A 1PQ8A 4Y79A 1UK4A 3ZVDA 1U6QA 4Y76A 1XUJA 4U30A 3RMMH 1ZPBA 3A82A 4VGCB 1D4PB 1T8NA 2EC9H 4X1SU 3DD2H 4YLQH 3AVZA 2O8LA 3GISB 2W7UA 3PWCA 1HYLA 2CXVA 1H9LB 1Z6EA 2BMGB 3RXHA 5EPYA 1MAXA 1T31A 2SGDE 2QXHA 2P94A 3K6ZA 1TPAE 3P92A 1GBIA 1GJ8B 1MCTA 3M35A 1CA8B 1O34A 1FPCH 2G4TA 1B0FA 1GG6B 2DE8A 2B0FA 5F6MA 4DJZB 4NFEA 3VGCC 1G36A 2F91A 3KQEA 3U1JB 1DS2E 1SGCA 2ANKH 1SPJA 3ITIA 1DWBH 4K5ZA 2VB0A 3ATKA 2FLRH 3M61U 2HNTE 4FU8A 3KHVA 4DIIH 1FY8E 4X8SH 2C8WB 3I78A 4ABFA 1LHFH 4FUGA 1NFXA 1MTVA 1N8OB 2GCTC 1QBNA 4A6LA 1MD7A 1FIZA 2GDDA 3VFEA 1PQ5A 1V2JT 8LPRA 1O3GA 1AKSB 3ATLA 2UUYA 4OS2A 2GDEH 2RA3A 3SU5A 1KTTB 3UFAA 3HGNA 3MNBA 3ODFA 3DT0H 1EAXA 1GCDA 1HAHH 1PPEE 1F0UA 3TGIE 2ANMH 4Q2KA 2F9UA 1O3KA 4AGKA 3TGJE 4WXIA 1C5SA 2JKHA 3PLPA 2Z9IA 4DIHH 1ZRKA 4Y11E 1XX9A 1D3TB 1VR1H 2NU0E 3GCHC 3PV4A 3GY7A 2G55A 3Q3XA 2SNVA 4DG4A 1C1PA 4FUJA 1Y3VA 3U8RH 3M5OA 5BRRE 4MPVA 1A0JA 3RXKA 1BOQA 1G2LA 4TPYA 1CVWH 2O8WA 1L0ZA 1WTGH 3TJUA 3LGIA 1KDQA 3SJ9A 1S82A 2FI5E 3F68H 2J34A 3TITA 3JZ2B 1B0EA 3MFJA 3SJKA 1DLKB 1O2TA 2BDIA 2H9EH 3URDA 4BAKB 2ZCLP 1ZYOA 3A8DA 3SBKA 5L6NH 2BDAA 1TGNA 3S9BA 3VEQB 2ANWA 2VGCC 1KTSB 3F9FA 2OBOA 2ANYA 1O3NA 1A0LA 1FNIA 3BTKE 2H9HA 4KKDA 2Z9LA 2BLWA 2BXTH 5C5OA 5FXLA 2AS9A 1C1MA 2HNTF 1P2MA 5IYTA 5JBBS 3PO1B 3UNRA 3RXPA 3A88A 1ZMNA 2GMTB 3S0NA 3ZZCA 4FUFA 3EE0B 1GJ6A 1QGFA 5T6DA 1P3EA 2R2WU 3RMNH 3W94A 1G3CA 1BMMH 2VH6A 1FXYA 3P95A 2J9NA 4B74A 2BDCA 4X1RU 1YLCA 1YPLH 2FI4E 4MPXA 1WQSA 3RXAA 1Z8GA 4ABJA 4GLYA 5DK1A 1WU1A 1C1WH 1TE0A 3TJVA 1A4WH 1SLUB 5L30H 3U8TH 1BQYA 5FBIA 1RD3B 3AW0A 1O2QA 3C1KA 3DFJA 3ZYDA 1HXEH 1NC6A 3LKWA 3K6YA 1C5OH 1UTMA 1HIAB 4F4OC 2YNBA 3IWMA 5GCHF 1DE7H 2VWNA 3OSYA 3OX7U 1SGFA 2EI7A 2C8YB 1GJCB 3TVJB 1CHOF 1SB1H 3MU5A 1IQIA 2EI8A 2WYGA 1P2IA 4KTUA 2BY5X 1ACBE 5AVDA 3EA8A 1AZZA 2ZDKA 1QQUA 1WSSH 1P04A 2AGEX 2PWXA 1QY6A 3P6ZB 1HIAA 2OQ5A 1KXFA 5EXMA 1Y59T 5ETXA 4AB9A 3LOXA 3T27A 2ZGHA 4CR5A 1PYTC 4YOGA 1G3BA 1ANCA 1HJ9A 1XUKA 1XMNB 2ZDVH 2ESTE 3A85A 5HYOA 1LVMA 5FBEA 1GL0E 1C4Y2 1GHBG 1IOEA 1HJAC 2OUAA 4BAQB 1P01A 4AORA 1BZXE 4B2AA 1O3PB 5FCRA 3AAVA 4Y0YE 1KXBA 2QF3A 2XWAA 3SI4H 2ZDLA 2BVRH 3MH6A 1NT1A 1TRYA 2D8WA 4VGCC 3IITA 3I29A 2ZPQA 2XC4A 1MMJN 1FPHH 4U2WA 4HTCH 1BDAA 4K2YA 1AE5A 1NU7B 4FUIA 4WH6A 2ZU3A 4AYVB 4OGYA 2ZDNA 1TA6A 3FVFB 5DG6A 2PGQB 4CRCA 2A5KA 1WUNH 2QCYA 1FY5A 1GMDF 1LVBA 2J38A 4AZ2B 3GY3A 1QJ6B 2Z9KA 1IQEA 4H4FA 3AAUA 4UDWH 5EXLA 1UMAH 3SUEA 1AQ7A 4I33A 2XBYA 3UNQA 1UCYK 1GI8B 1O3JA 5A2MH 2SGEE 3P8NA 1W0ZU 1K9OE 1SR5C 3NZIA 4Y6DA 4IC5A 2ZHEH 1O3IA 1UTLM 1CT2E 5DP4A 1SGYE 1AY6H 1GBMA 2G00A 3GY6A 3RM2H 2ODPA 1ZSJA 1E35B 2XCFA 3SJIA 2FDAA 2JH0D 3RXJA 1P8VC 5EQQA 1EZUC 4Q80A 5FPSA 3PMHB 1CT0E 1BB0B 1EB2A 6GCHF 1SVPA 1V2UT 1FZZA 5GJ4B 2BTCE 2C90B 1A0HB 2STBE 1YPKH 1GHWH 3FP8E 3U8OH 1ZRBA 1DOJA 1O2RA 1QA0A 1QRZA 2AGIX 1TRMA 2G51A 3ZVCA 3A7YA 2A4RA 3M7TA 1TBRH 3M36A 2M5TA 3QK1A 3UR9A 5JB8S 3VB7A 3UUZA 1FY4A 3SGBE 2IJOB 2PKSC 2WUBA 3S7KB 2JH6D 2Z9JA 3GYLB 1O2YA 1OP8A 1AMHA 3TK5A 1AWHB 2TGPZ 3BTTE 3LONA 5L2ZH 1IQLA 1TNGA 3SI3H 1L1JA 3M7QA 2BDHA 2UWOA 4FUCA 1Y3XA 1ESAA 2CGAA 2W7SA 3UTUH 4BTTB 1A7SA 3SUGA 2RG3A 4FUHA 3BTGE 4KGAA 2ZPSA 3PYHA 1SQAA 1A5IA 3OU0A 3SV2H 3LGYA 2FWWA 1OPHB 3F9HA 4B1TA 4AFQA 1WYKA 3LDXH 3T62A 8GCHF 5EGMA 1DITH 2FESH 1MTUA 3VB6A 1C1NA 2BDBA 4AGJA 4ABBA 4BOHA 4ZUHA 1WV7H 1MTNB 5JBCS 3RXEA 2V3HH 1P0SH 4B71A 2VJ1A 3A84A 1UTQA 1F92A 4NWLA 4MTBA 3P17H 1RXPA 3RXLA 3QLPH 3PO1C 3MH4A 3KEEA 5JYIA 1V6DA 1TNKA 3ZZ6A 5I25A 1RTKA 1FLEE 1TRNA 1UJ1A 5C5NA 1YLDA 1YPJH 1FQ3A 5AF9H 2AYWA 4OGXA 3TNSA 4HZHA 1KSNA 4CRDA 1MQ6A 1P09A 2ZC9H 1DM4B 3A87A 4X6PA 2Y6TA 1YM0A 3LGUA 2Q6GA 3GY4A 5IDKA 1Z8JB 2FOCA 1O2HA 3S9CA 3HATH 3U98H 4CHAB 1SSXA 2HALA 1E0FD 1UVPA 3MNCA 1D9IA 1G3EA 3T25A 1DX5M 5F8TA 4I8HA 2BY8X 1SI5H 2SGAA 1CBWB 2FODA 2UUFB 2HRVA 2WPHS 1C5VA 1UK3A 3BEUA 1QFKH 1GBBA 2ZZUH 1MKXH 2VVUA 1P06A 1PPHE 1BUIA 2F9NA 1GBEA 3PTNA 4ZROA 1C1SA 1HBTH 1EOJA 4DCDA 5E2OA 4LK4A 4ZMAH 1AWFH 3L33A 4TY6A 3UWJH 2H5CA 1H8IH 3MH7A 3A8CA 1V2QT 3NPSA 2HWLB 4ZHLU 3ATWA 4FVBA 1RFNA 1AZ8A 1GBKA 1GBCA 5HMAA 4YO9A 1HV7A 1AVWA 1ZGIA 2F3CE 1VCPA 1DUEA 3E8LA 2NU3E 3DFLA 1MKWH 1EPTB 1HXFH 2D2DA 1EZXC 4H6TA 2V35A 1ARBA 2GCHF 1MTWA 3F9EA 1QCPA 2WPJS 2PTNA 4UFGH 3RC4A 1V2ST 1LPZB 4J1YA 1SLXB 1L1NA 2F9OA 2V0BA 2ALPA 2WPKS 1CSOE 2P3TB 4H6SB 1ELAA 5GIBA 1P11E 1QA7A 1EPTA 1J8AA 1D3DB 5FAHA 4GCHF 1TYNA 5ESTE 2SGFE 4E05H 1W0YH 3LGTA 2BY6X 2SGPE 1GHZA 2QXJA 1TNJA 1Z1IA 3LIWA 4NA7A 2ZECA 1TX7A 1FY1A 3UY9A 3LGWA 4KTSA 1GI6A 1K1LA 1C2LA 4WMEA 4O97A 1SGDE 2I6SA 2FZZA 1IHSH 1C2KA 2WPLS 1THPB 2YOLA 2WYJA 5E0HA 3MO3A 3BTME 1O2ZA 1GJ5H 1GBHA 1GHVH 1W8BH 3P70B 3IG6B 1OX1A 1GBJA 1C2FA 3C27B 1C1OA 1P2JA 3RDZA 2CHAC 2A7HA 2KAIB 3S9AA 1D3QB 9LPRA 4PROA 2FS9A 3RXFA 2PFEA 1S83A 1W12U 2P16A 3LGVA 4NZLA 5BPEA 3BSQA 1TGTA 3ZZBA 2BY7X 6CHAC 3UOUA 1YPGH 5ABWA 1LHGH 2ZHDA 3G01A 4X8VH 4ZKRU 4AB8A 1GHAF 3SGAE 1LMWB 3QUMP 3RXIA 2KAIA 1O2WA 2OINA 1YPHC 2GZ8A 2XBXA 2Y5HA 1NU9A 1RIWC 9ESTA 4X8TH 3TLOA 2IN2A 4SGBE 1K1NA 1EATA 1KXDA 3BTQE 2CF9H 4NIXA 5EODA 2FI3E 2TBSA 2HOBA 1T7CA 1Y8TA 2EI6A 1V2OT 5DP8A 5DO4H 3NKKA 2FOFA 2A45B 1QR3E 1DPOA 2Y7ZA 1TPOA 3VB4A 1TGSZ 1KY9A 1HDTH 4AFZA 4IC6A 5SGAE 1TLDA 1DSUA 4I8KA 1AN1E 1C9TA 4R8TB 3EA7A 3M7UA 1FMGA 4MLFB 4AG2A 2ODYB 5LPFA 1UHBB 3LT3A 1GI4A 1C4U2 4X8UH 3RP2A 4Y0ZE 1UTPA 2FLBH 3PMBB 2R0LA 1O2IA 1P05A 1RTLA 2H5DA 4FU9A 3B9FH 2YNAA 1NFUA 4JYUH 1V2LT 4GUXA 3RU4T 2FP7B 1TA2A 2HPPH 1L4ZA 1O38A 4TY7A 2BDYA 1O5AB 1CGJE 1LTOA 4MQAA 2J2UA 1UHBA 3KCGH 3MYWA 3SNCA 1FAKH 1AKSA 3K9XB 1SGNE 4A7IB 2QN5T 2H2ZA 2RA0A 2STAE 1TPSA 4X2WA 1MTSA 2ZHFH 1TX8A 1DANH 4K3JA 4UFDH 3RXRA 1IQFA 1P2OA 1TBZH 2CF8H 1YKTA 1F0RA 1YCPK 1VITF 3SNDA 3WY8A 1Z8IB 1Z7KA 2QGRA 8ESTE 1C2HA 1HAVB 2CMYA 1PPCE 1Y3UA 4QT8C 4NA8A 3KQCA 1OWKA 1ZOMA 1DVAH 1JRTA 2XBWA 1YP9A 3CS7A 4F49A 1XVOA 2OXSA 4A1XA 4XDEA 5EW2H 1LO6A 2BLOA 4LOYH 3ZVGA 1XUGA 1O3OA 1HGTH 1P02A 1XKAC 1DT2A 5E2PA 4CHAC 2PUQH 1CA0C 1RGQA 1HAVA 3RM0H 5EOKA 3AW1A 3Q76A 1VGCC 1O30A 3FAOA 1QHRB 1PPZA 2HNTC 1B5GH 1GMCF 5C1YA 1VCWA 1SGQE 1TMBH 1NROH 1O2KA 2A2QH 2BX4A 1E34B 3GCTF 2SGQE 5AHGH 3NK8A 1IQKA 1ZHMA 2G5NA 2OP9A 1W7XH 3AASA 4I7YH 3STIA 3SU1A 4NIWA 2ULLA 2Z94A 3UPEA 1K1JA 1KIGH 2G4UA 3RXTA 5JBAS 5HGGA 2QC2A 3S7HB 3RMLH 1MCVA 2OC1A 2VINA 1T8LA 4NIYA 1P10A 2Y82A 4D7GA 3VXFH 7GCHF 1W2KH 4HFPB 2QIQA 1TABE 2A0QB 1EPTC 4ASHA 1AB9C 2WUCA 3LH3A 3KQBA 2BQ7B 4E7RG 4NA9H 2GGVB 1AIXH 1HAGE 1YCPH 1O2SA 1BBRE 2Z3DA 2ZGXH 2ZP0H 1Z8RA 1XXFA 2PUXB 2ZTXA 1HRTH 4MPUA 1TMTH 2IPHA 5B6OA 5C1UA 1IHTH 2XW9A 3T5FH 2ZHWH 3BG4C 2AMQA 4ISLA 1T8MA 5H4IB 4KTCA 2H9TH 4JZFH 1SMFE 2ZQ1A 1ETTH 2NU2E 4Y7AA 4K8YA 2OQUA 2FPZA 1KXCA 1TNIA 2BQWB 1W14U 1SGPE 1JBUH 1VJ9U 1W10U 3PLBA 3BTDE 4X1QU 1DUAA 4XBCA 1FY3A 1O2XA 5EXNA 1A5HA 2G52A 1ELEE 4INHA 3NXPA 4X1PU 1C5YB 2XC5A 1UVSH 3ZV8A 4ISNA 1O5DH 3M3TA 1YPEH 3S69A 1OWJA 1PPFE 1YCPM 1OKXA 2A4GA 3ZVBA 4TPIZ 1UTNA 2FOMB 3U9AH 1A5GH 6LPRA 1ZMJA 4HGCA 2D1JA 3NWUA 1ESTA 3OTJE 3LC3A 3M5NA 4WF8A 3E91A 1LCYA 3TU7H 3ESTA 3UOPA 3ZVAA 5C67A 4IN1A 4BANB 3QO6A 4YOJA 2AH4X 5GDSH 3TH4H 2WV4A 2ZFSA 4ZKOU 2PSYA 1TGCA 5A09A 1GPZA 1LHCH 1AO5A 1UVUH 2LNCA 3KF2A 1LHDH 1O3CA 1TAWA 1SFIA 4K1EA 1LKAA 2ZKSA 4NG9H 4XFQA 1VJAU 1FAXA 3M5LA 2FOEA 3T28A 1O2LA 1SOZA 1S6FA 2GTBA 2GD4B 3FZDA 4ISHH 3A7WA 2BHGA 2ZU5A 1ANEA 4B2CA 4H42U 3RLWH 1DY8A 1IQMA 3GDUA 2JETB 2BXUH 3QTOH 1MAYA 3N7OA 1JMOH 4LZ4B 1SGFG 4JYTA 5FCKA 1WTHD 1Q31A 1GG6C 2VVVA 1QIXB 3DA9B 4A1VA 1J9CH 1K1PA 3BG8A 4ZKNU 4ZKSU 2XBVA 1FDPA 1O32A 1TOMH 5C20A 4OS1A 4XBBA 1WBGB 3SU4A 1GMHG 1V2NT 1YBWA 2F83A 3ELAH 4UONA 1C5NH 3BF6H 4OS5A 4XE4A 2ILNA 1N8OC 3FANA 3VB5A 5LGOA 2FOGA 5L2YH 1T32A 1GVKB 3EGKH 3ZZ5A 1C5WB 1DDJA 1OOKB 1G9IE 4NFFA 1ELDE 4WVPE 4GSOA 3PMAB 1C5QA 3UQOA 5JPMH 4RKJB 1YF4A 2R3YA 3MMGA 3EDXB 4A5TS 1A1RA 1N6XA 2BD4A 4MNXA 3EYDA 1DWEH 1NRRH 3SO3A 1ETSH 4JYVH 2FS8A 2BD3A 3TIUA 1W11U 1HJ8A 3V13A 3TK6A 2B7DH 1V2PT 1GGDB 5JDUB 3BIVH 1NRPH 1X7AC 2QA9E 1OYTH 3QGNB 1NS3A 1BTYA 5A0BA 3DUXH 1F7ZA 1XUIA 1S85A 2EA3A 2OCVB 3OY5U 1E38B 1WCZA 1PQ7A 2VIOA 1GI2A 1C5XB 1YGCH 1GI5A 2A5AA 2XXLA 3NCLA 3D23A 4FXGH 1Q2WA 3B8JA 5E8EH 1JOUB 3ZVEA 2HGTH 1HB0B 4IMZA 1Y3YA 2C4FH 3FP7E 1ZJKA 2Q6DA 3VGCB 4BXSA 2FOBA 3P8FA 1OS8A 3RXDA 2TGAA 1BMAA 1UTJA 4WMDA 4ZHMU 3SNAA 1RRKA 3GY2A 1ZTLA 1L1GA 1QJ7B 2ZFRH 1ZLRA 2ZDAH 1UCYH 1TBQH 1TB6H 2ZFPH 4YT7H 3T2NA 2BLQA 1K1OA 3LH1A 4AOQA 4CREA 2TGTA 5DP9A 3LC5A 4AX9H 3A86A 7KMEH 1H8DH 1PYTD 2EEKA 2GCTB 5DP5A 4I8JA 4YOIA 4AN7A 1CU1A 1DWCH 1UVTH 4FUDA 4Q7ZA 2FMJA 5TCCA 2FYRA 2WINI 4YLUA 3GICB 1KLIH 2GMTC 4DT7B 1BTUA 2AIQA 3KIDU 4FUBA 1O3DA 1D6WA 1MZDA 4K1SA 2AEIH 1EXFA 1D3PB 4XBDA 1DXWA 1TOCB 1GDQA 2GT7A 1GHXH 1QL9A 1GHBF 1K21H 2P8OB 2GX4A 3ZV9A 1O31A 1TIOA 4OS7A 5DJ7A 1GI3A 2ZO3H 4NGAH 1RTFB 3FFGA 1OSSA 4I8LA 2Y5FA 1P2KA 1OWEA 2PW8H 1O5GH 3GDVA 1AFEH 1C2MA 3LPRA 4IMQA 1Y5BT 4Y7BA 1EZQA 3K2UA 1AD8H 1LPKB 2BLVA 5HM9A 2B9LA 1FI8A 3RU4E 1GDNA 1KXAA 3ZZ4A 1GI9B 1EASA 2DUCA 2PHBA 1GWAA 3GY5A 1HLTH 3MU1A 2UUKB 2C8XB 3L3TA 3RXQA 2VGCB 3PTBA 1AUTC 1EJMA 1EJNA 1GBAA 5FX5A 1T8OA 1G30B 4ZXXH 1LVYA 3A7ZA 3RMOH 4X0WU 1HNEE 4X6OA 2DE9A 3QZQA 4Q7XA 1NESE 3DHKH 1HPGA 1EJAA 1CO7E 3D49H 5K7RA 4Y8YA 1V2VT 1ZTKA 1S6HA 4AG1A 3MU8A 5DGJA 4ABAA 3LJOA 1QB1A 3ENSB 1OYQA 1MBMA 1GHYH 1O2GH 4MNVA 1MU6B 1MU8B 1ZHPA 1XXDA 3KL6A 3MNXA 4M7GA 1BMNH 1SG8B 1S0RA 4GVUA 2OBQA 1ZMLA 4Y8ZA 2Z7FE 4CR9A 2BZAA 1BBRK 1XM1A 2C93B 2J94A 1PFXC 2W26A 1DFPA 3GYMA 1OP0A 3RLYH 3QDZB 3SZNA 4YTAA 1FUJA 2PTCE 1ZTJA 4U01A 3HK3B 3P8GA 1WOFA 2G5VA 1ELCA 2Z3CA 3QGJA 3Q77A 1THSH 1GCTB 3RC6A 4B73A 4K69A 1C2JA 3UR6A 1AI8H 2PLXA 1O36A 2ZU1A 1TFXA 2J95A 3MH5A 4GPGA 2TRMA 1W7GH 3ODDA 4JZDH 1O2NA 3RXVA 3MNSA 4LZ1H 1ANDA 1BHXF 3D62A 4NZQA 3K65B 1O2MA 4D9QA 4ABDA 3SJ8A 2ZTYA 2GT8A 1O37A 4WMFA 5ESBA 2BYAX 2JETC 1W3CA 2AERH 4DOQA 5CE1A 1NO9H 3KQDA 4NSYA 2PR3A 1AHTH 1XUHA 3ZVFA 2O8MA 2VIWA 3ZZ9A 1ETRH 1O5BB 4UFFH 1HAZB 3V3MA 2ZA5A 3SHCH 2QAAA 5A8ZA 4DW2U 1F5LA 1O5FH 3QX5H 3ZZ7A 1TQ0B 4FVDA 3A7TA 1O5EH 1OXGA 1FN6A 4I32A 3SHAH 3STJA 3T29A 2ZFTA 4XOJA 2R3UA 4GHQA 2JH5D 1B7XB 4ZHAA 2P93A 4TYDA 3MU4A
chains in the Genus database with same CATH superfamily
2Z9GA 3NUMA 1OP2A 3H5CB 4MDSA 3E0NB 4THNH 5FPYA 3PM3A 4CRAA 1S0QA 3RXBA 1RS0A 4WWYA 4OS4A 2W5EA 1GBDA 1HJAB 1Z71A 3A83A 3OY6U 2UWPA 3QZRA 5K0HA 5F8ZA 1CQQA 3BV9B 1TQ7B 1A61H 2WV9A 2F9BH 4ZXYH 2GV7A 4JK6A 1IQHA 1FJSA 1LPGB 1Z1JA 5A8YA 1G32B 3O8DA 4LXBH 4Z6AH 1C4V2 1A3BH 2VIPA 3TH3H 4B75A 1NPMA 1HUTH 4CH2B 1EAIA 1GGDC 1SQOA 3R3GB 4FUEA 5GCHG 1LVOA 5DN6D 4ABHA 4TSFD 3VXEH 4NWKA 1ELFA 1LHEH 1KYNA 3WWFA 1CHOG 5CMXH 1W13U 1O35A 3SU0A 1Q3XA 5CHAB 1GVLA 1P2NA 3GOVB 1GBTA 1TWXB 1ELVA 5LPRA 2BQ6B 1GJ9B 1TX6A 2B8OH 2HLDD 3HK6B 1QB9A 3O8CA 1O3LA 1JRSA 2ZG0H 2R0KA 4A1TA 3GY8A 2AMPA 2UWLA 1MH0A 1L4DA 1YC0A 2XRCA 1ANBA 4YESB 5F03A 3O8RA 1Y3WA 3BTFE 1SHYA 5T1VA 1SGIB 2WPIS 1BTWA 1P3CA 3NRLA 2FTMA 2F43B 5EG4A 1P9UA 2ZQ2A 5EQSA 1BIOA 1K1MA 1V2RT 1ID5H 2ZGJA 4AFSA 2L6OA 4K1TA 1PPGE 1MTNC 2BX3A 2ZCHP 5C1XA 4YT6H 5TCAA 4P00A 4X6MA 3SOSA 4IGDA 5A0CA 3BTWE 4XSKU 2O8TA 5DKMA 1QRXA 3BEIB 2ZHQH 1G37A 5LPEA 1NM6A 1INCA 2VIQA 3ZZ3A 1KDQB 3BEFB 3UNSA 3KGPA 1TMUH 2PKAB 2ODQA 2Q6FA 2Y5GA 4K60A 5EW1H 1P12E 2PGBB 3RU4D 4D76A 2EQNA 1V2MT 1SLVB 2FOHA 1GI0A 1VZQH 1GMDG 2ZDMA 1O3FA 3GCNA 2PKSB 1C2EA 1BITA 3V7TA 2P8OC 1C5ZB 2J92A 3TNTA 4INLA 4UEHH 3V0XA 1F2SE 1WQVH 4BAHB 1C5LH 3SU2A 1QQ4A 4X2XA 1O2JA 1QBOA 3H7OA 2Q1JA 1NRNH 1SFQB 2LPRA 4JCNA 4IBLH 2PKAA 1G2MA 2NU1E 1GJ7B 3QN7A 1BTPA 4UFEH 3H7TA 2GJGA 4FU7A 2RFKC 1CBWC 2OLGA 4SGAE 2KCPA 1E36B 1SLWB 4ZH8A 3RXCA 1XVMA 1QL8A 3F9GA 1ELGA 3E6PH 2A4OA 3N99A 3A89A 4ASUD 1A2CH 2QXGA 1MUEB 3PRDA 2V6NA 3OYPA 3BTEE 1GVZA 1EX3A 1V2TT 1ZSKA 7LPRA 1JIMA 2BD7A 1DICA 1CHGA 1SKYE 3V12A 5IK2D 2B5TB 2A4QA 3L6PA 3PMJA 4UE7H 3U28C 6GCHG 1IQJA 3RXSA 3RC5A 3SUDA 3EQ0H 3CENA 1BT7A 1TALA 6ESTA 1YLNA 1TONA 2O9QA 2AIPA 1C5PA 3F2GA 2D26C 1NN6A 1O3BA 5FPTA 5EIYA 1FONA 1C2IA 1K0HA 1OWHA 3FZZA 2EY4C 2ZEBA 4UD9H 1T4VH 2A7CA 1PQAA 3TGKE 1AU8A 3KQ5A 3SJOA 2V7QD 3SNBA 1EB1H 1O2PA 2ZWLH 3SV9A 2KCOA 2ZI2H 1V2KT 3N7DA 1H9IE 1KXEA 4O3TA 3SNEA 2IOTA 1ZPCA 1UTKA 4Q7YA 3U1IB 5JBTA 1GCTC 3TH2H 1FX0B 1YYY1 3RXUA 2GVFA 1C5TA 1NFWA 3EAJA 2ASUB 1ELBA 1EAUA 2ALVA 1AUJA 5EQRA 3URCA 4XRNA 4Z0KA 5DP6A 1P2QA 1O3MA 2YMSC 4WXVA 1MD8A 1O3EA 1AFQB 3ZZAA 2BD5A 4CRGA 4A92A 4E7NA 2AHME 3MOCA 4YXWD 4X2YA 2ZGCA 2OTVA 2FEQH 1SGTA 8GCHG 1P9SA 1QJ1B 4INKA 3M3VA 4DURA 3A80A 4O9VA 1QBVH 5GPIB 3BN9A 1J17T 2O8UA 5G4BA 4NSVA 2QXIA 1BTXA 1C9PA 1F0SA 4X2VA 2J4IA 4X6NA 4CRBA 3TJOA 4R0IA 4MNYA 3Q00A 2FIRH 4BAMB 2P59A 2WHXA 2Z6BD 1ELTA 1BCUH 1A3EH 3HKJB 1G3DA 1O3HA 4CH8B 4CBOA 4FOUC 1HAIH 1LDTT 4AYYB 2KCYA 1UW7A 1MBQA 4MG3A 3RXOA 4JZIA 4OM9A 1JWTA 3PROA 4U32A 5E0JA 1BHXB 4TWWA 4DGJA 1BJVA 1CGIE 2NWNA 3M3SA 4ISOA 2BVXH 2XNIA 4B76A 2VIDA 4NIVA 4TWYA 3VPKA 1AVGH 5GWZA 1NY22 2BVSH 2WPMS 2GZ7A 4D8NA 1S84A 5AFZH 3MTYA 1C2GA 4BTIB 1HAXB 2AFQB 3PLKA 4CBNA 4OS6A 4RKOB 3SORA 1CT4E 4DVAU 1P57B 1EKBB 1DY9A 1P03A 5CDFE 2VNTA 3OE7D 2BZ6H 5HM2A 1H9HE 3BIUH 5GXPA 4BTUB 1UVOA 4FETA 1GJAB 3GCOA 2IPQX 4WH8A 1MQ5A 2NU4E 2VH0A 4MPWA 1EP6A 1KLTA 3KN2A 2QY0B 3ZZ8A 2P3FH 2ZNKH 1LQDB 2HPQH 5CHAC 2WV5A 4JZEH 1DSTA 3MU0A 3MO9A 1V3XA 1E1RD 2BM2A 5HIYA 1XKBC 3E0PB 2G8TA 3HPTB 4I8GA 1ZHRA 1L2EA 2CHAB 1GI7B 1ABJH 1H1BA 3TJNA 3PWBA 3F6UH 4Y71A 2TPIZ 1GL1A 1XUFA 1ORFA 4HG6A 1C2DA 3Q3YA 4ISIH 2GCHG 4JK5A 5FHTA 2F9VA 2BD8A 1FV9A 1DWDH 1BRBE 2VWOA 1AE8H 1PPBH 1SOTA 6CHAB 1BMLA 1EZSC 1EQ9A 1HFDA 1OWDA 2HVXA 3RXGA 3W1EA 1NTPA 1C1RA 1NZQH 1QB6A 5DSFA 5A8XA 2OC7A 2QV1A 2HLCA 4J2YB 4AFUA 4ESTE 5PTPA 3A8BA 1UTOA 3BTHE 3SU3A 3U69H 2F9PA 1F0TA 2FOAA 3SQEE 4GCHG 3M37A 1ZZZA 2BY9X 3GDSA 1RIWB 1E37B 2TGDA 4KP0A 2FO9A 3SUFA 2WZQA 1WDIA 1A46H 1F5KU 1OWIA 1FN8A 4MVNA 3I77A 2ZPRA 3SGQE 8KME2 1S5SA 1UK2A 1ZR0A 2V3OH 4YM9A 2VVCA 2R2MB 4NCYA 1SQTA 5J4QA 3MI4A 4O03A 1H4WA 2CV3A 1BTHH 4K8BA 4MNWA 3PB1E 3HGPA 3D65E 2FYQA 1K22H 2UUJB 1ZJDA 1C5RA 2A32A 2XYAA 3PV5A 4RN6A 1CGHA 1K2I1 1QTFA 3F1SB 1GBFA 3HKIB 4Y8XA 1K1IA 1IAUA 2GV6A 2SNWA 1ESBA 2ZF0H 3DSOA 3RXMA 1C5MD 2ZGBH 4IW4E 2A31A 1EOLA 3H09A 2A2XH 2Y80A 1GDUA 1MKXK 2BB4A 1QURH 4WJG2 1C5UA 1SL3A 1VITH 2W3KA 2BDGA 2VWLA 3W95A 2Z3EA 1HAYB 2ZU4A 4RSPA 4D7FA 4D9RA 3B23B 2XCNA 3MWIU 1EAWA 2XTTB 2A5IA 5C3NA 3P8OA 2AMDA 1GHAG 2Y7XA 1UO6A 2OD3B 4X1NU 3VB3A 4ABIA 2FX4A 2VU8E 2VWMA 1LQEA 3F2HA 1SC8U 2ZTZA 1PJPA 1C1TA 1HCGA 3GCHB 1AGJA 1NFYA 4GHTA 7ESTE 5T6GA 1MKWK 2GKVE 5J4SA 2GZ9A 5EPNA 3ZYEA 2BOHB 3E90B 5LH8A 3UREA 2HVYB 2FXRA 4GAWA 1GBLA 3A81A 3OEHD 1QL7A 1VCQA 4KELA 2XNDD 3CP7A 3SN8A 4ABGA 3ATIA 1K28D 2ZFFH 1JIRA 2ZCKP 5DP3A 3QWCH 1M9UA 1J14A 1FIWA 5A0AE 1BTZA 1C1VH 3SV8A 4BXWA 4AC9A 1GJBB 1NRQH 1EUFA 1IQNA 2P3UB 2THFB 2QF4A 3KNXA 1O2OA 3ZZDA 2Y81A 2PSXA 1CA0B 3UIRA 1MABB 3TK9A 1DXPA 1VGCB 1O33A 1AFQC 1SHHB 1NRSH 2A1DB 3A7VA 2I6QA 3FP6E 1BJUA 1O0DH 2G81E 5DP7A 1RJXB 2FTLE 2BD9A 3UQVA 5JB9S 1BA8B 3QTVH 5DPAA 4CRFA 1LKBA 3MHWU 1HAPH 2XC0A 1GI1A 3TPIZ 2FM2A 1N6YA 2FX6A 1GMHF 2H6MA 1AVXA 4BNRA 1C1QA 3E3TA 1V2WT 2WPDD 2AGGX 5TJXA 5T3HA 1N1LA 2C8ZB 1ZPZA 1DLEA 3A7XA 1VITG 4ZAEA 2SFAA 2PV9B 1SGEE 2CN0H 1O5CB 4IN2A 4O3UA 1H8HD 1SGRE 2RDLA 1WAYB 4IS5A 2ZIQH 1O3AA 3ATMA 5HXFA 1T4UH 1AB9B 1YPHE 3A8AA 3SU6A 2BD2A 2VBCA 4YZUA 1C1UH 5E0GA 4DY7B 1TNLA 2A7JA 1BRCE 1F5RA 2OC0A 5F8XA 1ZSLA 3PRBA 1IQGA 3M5MA 3SV7A 1BRUP 5EU8A 2WSSD 4Y10E 2TIOA 3O8BA 3BG4B 2K1QA 2XWBI 3LU9B 1QRWA 2P95A 4BAOB 1GJ4H 3SV6A 2R9PA 1Z6JH 2CJIA 2QYIA 4ABEA 3UWIA 1O2VA 1TGBA 1ZGVA 4I31A 1J15A 1GMCG 3LJJA 4JZ1A 1TNHA 1O2UA 2W3IA 3E1XB 1HAOH 3MO6A 2C3SA 3SW2B 3E16B 1ARCA 2BOKA 3GCTG 1YPMH 1THRH 1Y5AT 1JXPA 4Q63A 3T26A 5C2ZA 5I46H 3FKSD 3R0FA 3JZ1B 1MZAA 4Z1MD 4WY3A 5T6FA 2VIVA 1SBWA 1QNJA 1O39A 1TPPA 3SQHE 4B2BA 2ZU2A 4E06H 3CS0A 5AFYH 3Q3KA 1D6RA 1ABIH 1CE5A 1BRAA 1GJDB 2GP9B 5FX6A 1EP5A 1S81A 1KLJH 4JMYA 2ZFQH 2H1UA 3RUOA 7GCHG 1Y5UT 2QF0A 1UCYE 3EA9A 4HI3A 1BBRH 2RCEA 2OC8A 1J16A 1PQ8A 4Y79A 1UK4A 3ZVDA 1U6QA 4Y76A 1XUJA 4U30A 3RMMH 1ZPBA 3A82A 4VGCB 3UB0A 1D4PB 1T8NA 2EC9H 4X1SU 3DD2H 4YLQH 3AVZA 2O8LA 3GISB 5C94A 2W7UA 3PWCA 4I86A 1HYLA 2CXVA 1H9LB 1Z6EA 2BMGB 3RXHA 5EPYA 1MAXA 1T31A 2SGDE 2QXHA 2P94A 3K6ZA 1TPAE 3P92A 1GBIA 1GJ8B 1MCTA 2JJ2D 1CA8B 3M35A 1O34A 1FPCH 2G4TA 1B0FA 1GG6B 2DE8A 2B0FA 5F6MA 4DJZB 4NFEA 3VGCC 1G36A 2F91A 3KQEA 3U1JB 1DS2E 1SGCA 2V3MA 2ANKH 1SPJA 3ITIA 1DWBH 4K5ZA 2VB0A 3ATKA 2FLRH 3M61U 2HNTE 4FU8A 3KHVA 4DIIH 1FY8E 4X8SH 2C8WB 3I78A 4ABFA 1LHFH 4FUGA 1NFXA 1MTVA 1N8OB 2GCTC 1QBNA 4A6LA 1MD7A 1FIZA 2GDDA 3VFEA 1PQ5A 1V2JT 8LPRA 1O3GA 1AKSB 2J98B 3ATLA 3WWBA 2UUYA 4OS2A 2GDEH 2RA3A 2JDID 3SU5A 3AK5A 1KTTB 3UFAA 3HGNA 3MNBA 3ODFA 3DT0H 2K0QA 1EAXA 1GCDA 1HAHH 1PPEE 1F0UA 3TGIE 2ANMH 4Q2KA 2F9UA 1O3KA 4AGKA 3TGJE 4WXIA 1C5SA 2JKHA 3PLPA 2Z9IA 4DIHH 1ZRKA 3GS9A 4Y11E 1XX9A 1D3TB 1VR1H 2NU0E 3GCHC 3PV4A 2J98A 2G55A 3GY7A 3ZIAD 3Q3XA 2SNVA 4DG4A 1C1PA 4FUJA 1Y3VA 2LP6A 3U8RH 3M5OA 5BRRE 4MPVA 1A0JA 3RXKA 1BOQA 1G2LA 4TPYA 1CVWH 2O8WA 1L0ZA 1WTGH 3TJUA 2W6ID 3LGIA 1QZ8A 1KDQA 4B6EA 2IJD1 3OAAD 3SJ9A 1S82A 2FI5E 3F68H 2J34A 3TITA 3JZ2B 1B0EA 3MFJA 3SJKA 1DLKB 1O2TA 2BDIA 2H9EH 3URDA 4BAKB 2ZCLP 1ZYOA 3A8DA 3SBKA 5L6NH 2BDAA 1TGNA 3S9BA 3VEQB 2ANWA 2VGCC 1KTSB 3F9FA 2OBOA 2ANYA 1O3NA 1A0LA 1FNIA 3BTKE 2H9HA 4KKDA 2Z9LA 2BLWA 2BXTH 5C5OA 2RDEA 5FXLA 2AS9A 1C1MA 2HNTF 1P2MA 5IYTA 5JBBS 3PO1B 3UNRA 3RXPA 3A88A 1ZMNA 2GMTB 3S0NA 3ZZCA 4FUFA 3EE0B 1GJ6A 1QGFA 5T6DA 1P3EA 2R2WU 3RMNH 3W94A 3OTPA 1G3CA 1BMMH 2VH6A 1FXYA 3P95A 2KFWA 2J9NA 4B74A 2BDCA 3KYGA 1YLCA 1YPLH 4X1RU 2FI4E 4MPXA 1WQSA 3RXAA 1Z8GA 4ABJA 4GLYA 5DK1A 1WU1A 1C1WH 1TE0A 3TJVA 1A4WH 1SLUB 5L30H 3U8TH 1BQYA 5FBIA 1RD3B 3AW0A 1O2QA 3C1KA 3DFJA 3ZYDA 1HXEH 1NC6A 3LKWA 3K6YA 1C5OH 1UTMA 1HIAB 4F4OC 2YNBA 3FO8D 3IWMA 5CHBA 4ACAA 5GCHF 1DE7H 2VWNA 3OSYA 3OX7U 1SGFA 2EI7A 2C8YB 1GJCB 3TVJB 1CHOF 1SB1H 3MU5A 1IQIA 2EI8A 2WYGA 1P2IA 4KTUA 2BY5X 1ACBE 5AVDA 3EA8A 1AZZA 2ZDKA 2KX4A 2AGEX 1QQUA 1P04A 1WSSH 2PWXA 1NBME 1QY6A 3P6ZB 1HIAA 2OQ5A 1KXFA 5EXMA 1KMHB 1Y59T 5ETXA 4AB9A 5KECA 3LOXA 1E1QD 3T27A 2ZGHA 4CR5A 1PYTC 4YOGA 1G3BA 1ANCA 1HJ9A 1XUKA 1XMNB 4XD7D 2ZDVH 2ESTE 3A85A 5HYOA 1LVMA 5FBEA 1GL0E 1C4Y2 1GHBG 1IOEA 1HJAC 2OUAA 4BAQB 1P01A 4AORA 1BZXE 4B2AA 1O3PB 5FCRA 3AAVA 4Y0YE 1KXBA 2QF3A 2XWAA 3SI4H 2ZDLA 2BVRH 3MH6A 1NT1A 1TRYA 2D8WA 4VGCC 3IITA 3I29A 2ZPQA 2XC4A 1MMJN 5EJ1A 1FPHH 4U2WA 4HTCH 1BDAA 3F0PA 4K2YA 1AE5A 1NU7B 4FUIA 4WH6A 2ZU3A 3F2FA 4OGYA 4AYVB 4F48B 2ZDNA 5C0UA 1TA6A 3FVFB 5DG6A 2PGQB 4CRCA 2A5KA 1WUNH 2QCYA 1FY5A 1GMDF 1LVBA 2J38A 4AZ2B 3GY3A 1QJ6B 2Z9KA 2PP6A 1IQEA 4H4FA 3AAUA 4UDWH 5EXLA 1UMAH 3SUEA 1AQ7A 4I33A 2XBYA 3UNQA 1UCYK 1GI8B 1O3JA 5A2MH 2SGEE 3P8NA 1W0ZU 1K9OE 1SR5C 3NZIA 4Y6DA 4IC5A 1SQRA 1O3IA 2ZHEH 1UTLM 1CT2E 5DP4A 1SGYE 4F55A 1AY6H 1GBMA 2G00A 3GY6A 3RM2H 2ODPA 1ZSJA 1E35B 2XCFA 3SJIA 2FDAA 2JH0D 3RXJA 1P8VC 5EQQA 1EZUC 4Q80A 5FPSA 3PMHB 1CT0E 1BB0B 1EB2A 4DT4A 6GCHF 1SVPA 1V2UT 1FZZA 5GJ4B 2BTCE 2C90B 1A0HB 2STBE 1YPKH 1GHWH 3FP8E 3U8OH 1EFRD 1ZRBA 1DOJA 1O2RA 1QA0A 1QRZA 2AGIX 1TRMA 2G51A 3ZVCA 3A7YA 2A4RA 3M7TA 1TBRH 3M36A 2M5TA 3QK1A 3UR9A 5JB8S 3VB7A 3UUZA 1FY4A 3SGBE 2IJOB 2PKSC 3KYFA 2WUBA 3S7KB 3F0OA 2JH6D 2Z9JA 3GYLB 1O2YA 1OP8A 1AMHA 3TK5A 1AWHB 2TGPZ 3BTTE 3LONA 5L2ZH 1IQLA 1TNGA 3SI3H 1L1JA 3M7QA 2BDHA 2UWOA 4FUCA 1VKYA 1Y3XA 1ESAA 2CGAA 2W7SA 3UTUH 4BTTB 1A7SA 3SUGA 5GNDA 2RG3A 4FUHA 3BTGE 4KGAA 2ZPSA 3PYHA 1SQAA 1A5IA 2KZ4A 3OU0A 4M9FA 3SV2H 3LGYA 2FWWA 1OPHB 3F9HA 4B1TA 4AFQA 1WYKA 3LDXH 3T62A 8GCHF 5EGMA 1DITH 2FESH 1MTUA 3VB6A 1C1NA 2BDBA 4AGJA 4ABBA 4BOHA 2W6JD 4ZUHA 1WV7H 1MTNB 5JBCS 3RXEA 2V3HH 1P0SH 4B71A 2VJ1A 3A84A 1UTQA 1F92A 4NWLA 4MTBA 3SYJA 3P17H 1RXPA 3RXLA 3QLPH 3PO1C 3MH4A 3KEEA 5JYIA 1V6DA 1TNKA 3ZZ6A 5I25A 1RTKA 1FLEE 1TRNA 1UJ1A 5C5NA 1YLDA 1YPJH 1FQ3A 5AF9H 2AYWA 4OGXA 3TNSA 4HZHA 1KSNA 4CRDA 1MQ6A 1P09A 2ZC9H 1DM4B 3A87A 4X6PA 1WXRA 2Y6TA 1YM0A 3LGUA 2Q6GA 3GY4A 5IDKA 1Z8JB 2FOCA 1O2HA 3S9CA 3HATH 3U98H 2L74A 4CHAB 1SSXA 2HALA 1E0FD 1UVPA 3MNCA 1D9IA 1G3EA 3T25A 1DX5M 5F8TA 1NBMD 2F4LA 4I8HA 2BY8X 1SI5H 2SGAA 1CBWB 2FODA 2UUFB 2HRVA 2WPHS 1C5VA 1UK3A 3BEUA 1QFKH 1GBBA 2ZZUH 1MKXH 2VVUA 1P06A 1BMFD 1PPHE 1BUIA 2F9NA 1GBEA 3PTNA 4ZROA 1C1SA 1HBTH 1EOJA 4DCDA 5E2OA 4LK4A 4ZMAH 1AWFH 3L33A 4TY6A 3UWJH 2H5CA 1H8IH 3MH7A 3A8CA 1V2QT 3NPSA 5C0TA 2HWLB 4ZHLU 3ATWA 4FVBA 1RFNA 1AZ8A 1GBKA 1GBCA 5HMAA 4YO9A 5FL7D 1HV7A 1AVWA 1ZGIA 2KM0A 2F3CE 1VCPA 1DUEA 3E8LA 2NU3E 3DFLA 1MKWH 4RI0A 1EPTB 1HXFH 2D2DA 3OEED 1EZXC 4H6TA 1OHHD 2V35A 1ARBA 2GCHF 1MTWA 3F9EA 1QCPA 2WPJS 2PTNA 4UFGH 3RC4A 1V2ST 1LPZB 1W0KD 4J1YA 1SLXB 1L1NA 2F9OA 2V0BA 2ALPA 2WPKS 1CSOE 2P3TB 4H6SB 1ELAA 5GIBA 1P11E 1QA7A 1EPTA 1J8AA 1D3DB 5FAHA 4GCHF 1TYNA 5ESTE 2SGFE 4E05H 1W0YH 3LGTA 2BY6X 2SGPE 3WW7A 1GHZA 2QXJA 1TNJA 1Z1IA 3LIWA 4NA7A 2ZECA 1TX7A 2QF5A 1FY1A 3UY9A 3LGWA 4KTSA 1GI6A 1K1LA 1C2LA 2JJ1D 4WMEA 4O97A 1SGDE 2I6SA 2FZZA 1IHSH 1C2KA 2WPLS 1THPB 2YOLA 2WYJA 5E0HA 3MO3A 3BTME 1O2ZA 1GJ5H 1GBHA 1GHVH 1W8BH 3P70B 3IG6B 1OX1A 1GBJA 1C2FA 3C27B 1C1OA 1P2JA 3RDZA 2CHAC 2A7HA 2KAIB 3S9AA 1D3QB 9LPRA 4PROA 4Q4LA 2FS9A 3RXFA 2PFEA 1S83A 1W12U 2P16A 3LGVA 4NZLA 5BPEA 3BSQA 1TGTA 3ZZBA 2BY7X 6CHAC 3UOUA 1YPGH 5ABWA 1LHGH 3EE7A 2ZHDA 1YY3A 3G01A 4X8VH 4ZKRU 4AB8A 1GHAF 3SGAE 1LMWB 3QUMP 3RXIA 2KAIA 1O2WA 2OINA 1YPHC 2GZ8A 2XBXA 2Y5HA 1NU9A 1RIWC 9ESTA 4X8TH 3TLOA 2IN2A 4SGBE 1K1NA 1EATA 1KXDA 3BTQE 2CF9H 4NIXA 5EODA 2FI3E 2TBSA 2XOKD 2HOBA 1T7CA 1Y8TA 2EI6A 1V2OT 5DP8A 5DO4H 3NKKA 2FOFA 2A45B 1QR3E 1DPOA 2Y7ZA 1TPOA 3VB4A 1TGSZ 1KY9A 1HDTH 4AFZA 4IC6A 5SGAE 1TLDA 1DSUA 4I8KA 1AN1E 1C9TA 4R8TB 3EA7A 3M7UA 1FMGA 4MLFB 4AG2A 2ODYB 5LPFA 1UHBB 3LT3A 1GI4A 1C4U2 1COWD 1H8ED 4X8UH 3RP2A 4Y0ZE 2J5UA 1UTPA 2FLBH 3PMBB 2R0LA 1O2IA 1P05A 1RTLA 2H5DA 4FU9A 3B9FH 2YNAA 1NFUA 4JYUH 1V2LT 4GUXA 3RU4T 2FP7B 3DSGA 1TA2A 2HPPH 1L4ZA 1O38A 4TY7A 2BDYA 1O5AB 1CGJE 1LTOA 4MQAA 2J2UA 1UHBA 3KCGH 3MYWA 3SNCA 1FAKH 1AKSA 3K9XB 1SGNE 4A7IB 2QN5T 2H2ZA 2RA0A 2STAE 1TPSA 3UAIC 4X2WA 1MTSA 2ZHFH 1TX8A 1DANH 4K3JA 4UFDH 3RXRA 1IQFA 1P2OA 1TBZH 2CF8H 1YKTA 1F0RA 1YCPK 1VITF 3SNDA 3WY8A 1Z8IB 1Z7KA 3MQKC 2QGRA 8ESTE 1C2HA 1HAVB 2CMYA 1PPCE 1Y3UA 4QT8C 4NA8A 3KQCA 1OWKA 1ZOMA 1DVAH 1JRTA 2XBWA 1YP9A 3CS7A 4F49A 1XVOA 4ZCNA 2OXSA 4A1XA 4XDEA 5EW2H 3DCLA 1LO6A 2BLOA 3OFND 4LOYH 3ZVGA 1XUGA 1O3OA 1HGTH 1P02A 1XKAC 1DT2A 5E2PA 5KGOA 4CHAC 2PUQH 1CA0C 1RGQA 1HAVA 3RM0H 5EOKA 3AW1A 3Q76A 1VGCC 1O30A 3FAOA 1QHRB 1PPZA 2HNTC 1B5GH 1GMCF 5C1YA 5C17A 1VCWA 1SGQE 1TMBH 1NROH 1O2KA 2A2QH 2BX4A 1E34B 3GCTF 2SGQE 1W0JD 5AHGH 3NK8A 1IQKA 1ZHMA 2G5NA 2OP9A 1W7XH 3AASA 4I7YH 3STIA 3SU1A 4NIWA 2ULLA 2Z94A 3UPEA 2JIZD 1K1JA 1KIGH 2G4UA 3RXTA 5JBAS 5HGGA 2QC2A 3S7HB 3RMLH 1MCVA 2OC1A 2VINA 1T8LA 4NIYA 1P10A 2Y82A 4D7GA 3VXFH 7GCHF 1W2KH 4HFPB 2QIQA 1TABE 2A0QB 1EPTC 4ASHA 1AB9C 2WUCA 3LH3A 3KQBA 2BQ7B 4E7RG 4NA9H 2GGVB 3DSPA 1AIXH 1HAGE 1YCPH 1O2SA 1BBRE 2Z3DA 2ZGXH 2ZP0H 1Z8RA 1XXFA 2PUXB 2ZTXA 1HRTH 4MPUA 1TMTH 2IPHA 5B6OA 5C1UA 1IHTH 2XW9A 3T5FH 2ZHWH 3BG4C 2AMQA 4ISLA 1T8MA 5H4IB 4KTCA 2H9TH 4JZFH 1SMFE 2ZQ1A 1ETTH 2NU2E 4Y7AA 4K8YA 3VG8A 2OQUA 2FPZA 1KXCA 1TNIA 4TT3D 2BQWB 1W14U 1SGPE 1JBUH 1VJ9U 5B6LA 1W10U 3PLBA 3BTDE 4X1QU 1DUAA 4XBCA 1FY3A 1O2XA 5EXNA 1A5HA 2G52A 1ELEE 4INHA 3NXPA 4X1PU 1C5YB 2XC5A 1UVSH 3ZV8A 2KCAA 4ISNA 1O5DH 3M3TA 1YPEH 4P02A 3S69A 1OWJA 1PPFE 1YCPM 1OKXA 2A4GA 3ZVBA 4TPIZ 1UTNA 2FOMB 3U9AH 1A5GH 6LPRA 1ZMJA 4HGCA 2D1JA 3NWUA 1ESTA 3OTJE 3LC3A 3M5NA 4WF8A 3E91A 1LCYA 3TU7H 3ESTA 3UOPA 3ZVAA 5C67A 3FN8A 4IN1A 4BANB 3QO6A 4YOJA 2AH4X 5GDSH 3TH4H 2WV4A 2ZFSA 5HKKD 4ZKOU 2PSYA 1TGCA 5A09A 1GPZA 1LHCH 1AO5A 1UVUH 2LNCA 3KF2A 1LHDH 1O3CA 1TAWA 1SFIA 4K1EA 1LKAA 2ZKSA 4NG9H 4XFQA 1VJAU 1FAXA 3M5LA 2FOEA 3T28A 1O2LA 1SOZA 1S6FA 2GTBA 2GD4B 3FZDA 4ISHH 3A7WA 2BHGA 2ZU5A 1ANEA 4RT0A 4B2CA 4H42U 3RLWH 1DY8A 1IQMA 3GDUA 2JETB 2BXUH 3QTOH 1MAYA 5F53A 3N7OA 1JMOH 4LZ4B 1SGFG 4JYTA 5FCKA 1WTHD 1Q31A 1GG6C 5EJLA 2VVVA 1QIXB 3DA9B 4A1VA 1J9CH 1K1PA 3BG8A 4ZKNU 4ZKSU 2XBVA 1FDPA 1O32A 1TOMH 5C20A 4OS1A 4XBBA 3FOAA 1WBGB 3SU4A 1GMHG 1V2NT 1YBWA 2F83A 3ELAH 4UONA 1C5NH 3BF6H 4OS5A 4XE4A 2ILNA 1N8OC 3FANA 3VB5A 5LGOA 2FOGA 5L2YH 1T32A 1GVKB 3EGKH 3ZZ5A 1C5WB 1DDJA 1OOKB 1G9IE 4NFFA 1ELDE 4WVPE 4GSOA 3PMAB 1C5QA 3UQOA 5JPMH 4RKJB 1YF4A 2R3YA 3MMGA 3EDXB 4A5TS 1A1RA 1N6XA 2BD4A 1S6LA 4MNXA 3EYDA 1DWEH 1NRRH 3SO3A 1ETSH 4JYVH 2FS8A 2BD3A 3TIUA 1W11U 1HJ8A 3V13A 5KEDA 3TK6A 2B7DH 1V2PT 1GGDB 5JDUB 3BIVH 1NRPH 1X7AC 2QA9E 1OYTH 3QGNB 1NS3A 1BTYA 5A0BA 2YMSD 3DUXH 1F7ZA 1XUIA 1S85A 2EA3A 2OCVB 3OY5U 1E38B 1WCZA 1PQ7A 2VIOA 1GI2A 1C5XB 1YGCH 1GI5A 2A5AA 2XXLA 3NCLA 3D23A 4FXGH 1Q2WA 3B8JA 5E8EH 1JOUB 3ZVEA 2HGTH 1HB0B 4IMZA 1Y3YA 2C4FH 3FP7E 1ZJKA 2Q6DA 3VGCB 4BXSA 2FOBA 3P8FA 1OS8A 3RXDA 2TGAA 1BMAA 1UTJA 4WMDA 4ZHMU 3SNAA 1RRKA 3GY2A 1ZTLA 1L1GA 1QJ7B 5HIZA 2ZFRH 1ZLRA 2ZDAH 1UCYH 1TBQH 1TB6H 2ZFPH 4YT7H 3T2NA 2BLQA 1K1OA 3LH1A 4AOQA 4CREA 2TGTA 5DP9A 3LC5A 4AX9H 3A86A 7KMEH 1H8DH 1PYTD 2EEKA 2GCTB 5DP5A 4I8JA 4YOIA 4AN7A 1CU1A 1DWCH 1UVTH 4FUDA 4Q7ZA 3N7EA 2FMJA 5TCCA 2FYRA 2WINI 4YLUA 3GICB 1KLIH 2GMTC 4DT7B 1BTUA 2AIQA 3KIDU 4FUBA 1O3DA 1D6WA 1MZDA 2M2AA 4K1SA 2AEIH 2K8IA 1EXFA 4B6FA 1D3PB 4XBDA 1DXWA 1TOCB 1GDQA 2GT7A 1GHXH 1QL9A 1GHBF 1K21H 2P8OB 4ACBA 2GX4A 3ZV9A 1O31A 1TIOA 4OS7A 5DJ7A 1GI3A 3F3BA 2ZO3H 4NGAH 1RTFB 3FFGA 1OSSA 4I8LA 2Y5FA 1P2KA 1OWEA 2PW8H 1O5GH 1E79D 1AFEH 1C2MA 3GDVA 3LPRA 4IMQA 2J97A 3PV2A 1Y5BT 4Y7BA 1EZQA 3K2UA 1AD8H 1LPKB 2BLVA 5HM9A 2B9LA 1FI8A 3RU4E 1GDNA 1KXAA 3ZZ4A 1GI9B 1YWUA 1EASA 2DUCA 2PHBA 1GWAA 3GY5A 1HLTH 4RT1A 3MU1A 2UUKB 2C8XB 3L3TA 3RXQA 2VGCB 3PTBA 1AUTC 1EJMA 1EJNA 1GBAA 5FX5A 1T8OA 1G30B 5EJZA 4ZXXH 1LVYA 3A7ZA 3RMOH 4X0WU 1HNEE 4X6OA 2DE9A 3QZQA 4Q7XA 1NESE 3DHKH 1HPGA 2LELA 1EJAA 1CO7E 3D49H 5K7RA 4Y8YA 1V2VT 1ZTKA 1S6HA 4AG1A 3MU8A 5DGJA 4ABAA 3LJOA 1QB1A 3ENSB 2OK5A 1OYQA 1MBMA 1GHYH 1O2GH 4MNVA 1MU6B 1MU8B 1ZHPA 1XXDA 3KL6A 3MNXA 4M7GA 1BMNH 1SG8B 1S0RA 4GVUA 2OBQA 1ZMLA 4Y8ZA 2Z7FE 2KR7A 2BZAA 1BBRK 1XM1A 2C93B 4CR9A 2J94A 1PFXC 2W26A 1DFPA 3GYMA 1OP0A 3RLYH 3QDZB 3SZNA 4YTAA 1FUJA 2PTCE 1ZTJA 4U01A 3HK3B 3P8GA 1WOFA 2G5VA 1ELCA 2Z3CA 3QGJA 3Q77A 1THSH 1GCTB 3RC6A 4B73A 4K69A 1C2JA 3UR6A 1AI8H 2PLXA 1O36A 2ZU1A 1TFXA 2J95A 3MH5A 4GPGA 2TRMA 1W7GH 3ODDA 2YMSB 4JZDH 1O2NA 3RXVA 3MNSA 4LZ1H 1ANDA 1BHXF 3D62A 4NZQA 3K65B 1O2MA 4D9QA 4ABDA 3SJ8A 3CNRA 2CK3D 2ZTYA 2GT8A 1O37A 4WMFA 5ESBA 2BYAX 2JETC 3SZEA 1W3CA 2AERH 4DOQA 5CE1A 1NO9H 3KQDA 4NSYA 2PR3A 1AHTH 1XUHA 3ZVFA 2O8MA 2VIWA 3ZZ9A 1ETRH 1O5BB 4UFFH 1HAZB 3V3MA 2ZA5A 3SHCH 2QAAA 5A8ZA 4DW2U 1F5LA 1O5FH 3QX5H 3ZZ7A 1TQ0B 4FVDA 3A7TA 1O5EH 1OXGA 1FN6A 4I32A 3SHAH 2QE7D 3STJA 3T29A 2ZFTA 4XOJA 2R3UA 4GHQA 2JH5D 1B7XB 4ZHAA 2P93A 4TYDA 3MU4A
chains in the Genus database with same CATH topology
2Z9GA 3NUMA 1OP2A 3H5CB 4MDSA 3E0NB 4THNH 5FPYA 3PM3A 4CRAA 1S0QA 3RXBA 1RS0A 4WWYA 4OS4A 2W5EA 1GBDA 1HJAB 1Z71A 3A83A 3OY6U 2UWPA 3QZRA 5K0HA 5F8ZA 1CQQA 3BV9B 1TQ7B 1A61H 2F9BH 4ZXYH 2GV7A 4JK6A 1IQHA 1FJSA 1LPGB 1Z1JA 5A8YA 1G32B 3O8DA 4LXBH 4Z6AH 1C4V2 1A3BH 2VIPA 3TH3H 4B75A 1NPMA 1HUTH 4CH2B 1EAIA 1GGDC 1SQOA 3R3GB 4FUEA 5GCHG 1LVOA 4ABHA 3VXEH 4NWKA 1ELFA 1LHEH 1KYNA 1CHOG 5CMXH 1W13U 1O35A 3SU0A 1Q3XA 5CHAB 1GVLA 1P2NA 3GOVB 1GBTA 1TWXB 1ELVA 5LPRA 2BQ6B 1GJ9B 1TX6A 2B8OH 3HK6B 1QB9A 3O8CA 1O3LA 1JRSA 2ZG0H 2R0KA 4A1TA 3GY8A 2AMPA 2UWLA 1MH0A 1L4DA 1YC0A 2XRCA 1ANBA 4YESB 5F03A 3O8RA 1Y3WA 3BTFE 1SHYA 1SGIB 2WPIS 1BTWA 1P3CA 2FTMA 5EG4A 1P9UA 2ZQ2A 5EQSA 1BIOA 1K1MA 1V2RT 1ID5H 2ZGJA 4AFSA 4K1TA 1PPGE 1MTNC 2BX3A 2ZCHP 5C1XA 4YT6H 5TCAA 4X6MA 3SOSA 4IGDA 5A0CA 3BTWE 4XSKU 2O8TA 5DKMA 1QRXA 3BEIB 2ZHQH 1G37A 5LPEA 1NM6A 1INCA 2VIQA 3ZZ3A 1KDQB 3BEFB 3UNSA 3KGPA 1TMUH 2PKAB 2ODQA 2Q6FA 2Y5GA 4K60A 5EW1H 1P12E 2PGBB 3RU4D 4D76A 1V2MT 1SLVB 2FOHA 1GI0A 1VZQH 1GMDG 2ZDMA 1O3FA 3GCNA 2PKSB 1C2EA 1BITA 3V7TA 2P8OC 1C5ZB 2J92A 3TNTA 4INLA 4UEHH 3V0XA 1F2SE 1WQVH 4BAHB 1C5LH 3SU2A 1QQ4A 4X2XA 1O2JA 1QBOA 3H7OA 2Q1JA 1NRNH 1SFQB 2LPRA 4JCNA 4IBLH 2PKAA 1G2MA 2NU1E 1GJ7B 3QN7A 1BTPA 4UFEH 3H7TA 4FU7A 1CBWC 2OLGA 4SGAE 1E36B 1SLWB 4ZH8A 3RXCA 1XVMA 1QL8A 3F9GA 1ELGA 3E6PH 2A4OA 3A89A 1A2CH 2QXGA 1MUEB 2V6NA 3OYPA 3BTEE 1GVZA 1EX3A 1V2TT 1ZSKA 7LPRA 1JIMA 2BD7A 1DICA 1CHGA 3V12A 2B5TB 2A4QA 3L6PA 3PMJA 4UE7H 6GCHG 1IQJA 3RXSA 3RC5A 3SUDA 3EQ0H 3CENA 1BT7A 1TALA 6ESTA 1TONA 2O9QA 2AIPA 1C5PA 2D26C 1NN6A 1O3BA 5FPTA 1FONA 1C2IA 1OWHA 3FZZA 2ZEBA 4UD9H 1T4VH 2A7CA 1PQAA 3TGKE 1AU8A 3SJOA 3SNBA 1EB1H 1O2PA 2ZWLH 3SV9A 2ZI2H 1V2KT 1H9IE 1KXEA 4O3TA 3SNEA 2IOTA 1ZPCA 1UTKA 4Q7YA 3U1IB 5JBTA 1GCTC 3TH2H 1YYY1 3RXUA 2GVFA 1C5TA 1NFWA 3EAJA 2ASUB 1ELBA 1EAUA 2ALVA 1AUJA 5EQRA 3URCA 4Z0KA 5DP6A 1P2QA 1O3MA 4WXVA 1MD8A 1O3EA 1AFQB 3ZZAA 2BD5A 4CRGA 4A92A 4E7NA 3MOCA 4X2YA 2ZGCA 2OTVA 2FEQH 1SGTA 8GCHG 1P9SA 1QJ1B 4INKA 3M3VA 4DURA 3A80A 4O9VA 1QBVH 5GPIB 3BN9A 1J17T 2O8UA 5G4BA 4NSVA 2QXIA 1BTXA 1C9PA 1F0SA 4X2VA 2J4IA 4X6NA 4CRBA 3TJOA 4R0IA 4MNYA 3Q00A 2FIRH 4BAMB 2P59A 2Z6BD 1ELTA 1BCUH 1A3EH 3HKJB 1G3DA 1O3HA 4CH8B 4CBOA 1HAIH 1LDTT 4AYYB 1MBQA 4MG3A 3RXOA 4JZIA 1JWTA 3PROA 4U32A 5E0JA 1BHXB 4TWWA 4DGJA 1BJVA 1CGIE 2NWNA 3M3SA 4ISOA 2BVXH 2XNIA 4B76A 2VIDA 4NIVA 4TWYA 3VPKA 1AVGH 5GWZA 1NY22 2BVSH 2WPMS 2GZ7A 4D8NA 1S84A 5AFZH 3MTYA 1C2GA 4BTIB 1HAXB 2AFQB 3PLKA 4CBNA 4OS6A 4RKOB 3SORA 1CT4E 4DVAU 1P57B 1EKBB 1DY9A 1P03A 2VNTA 2BZ6H 5HM2A 1H9HE 3BIUH 5GXPA 4BTUB 1UVOA 1GJAB 3GCOA 4WH8A 1MQ5A 2NU4E 2VH0A 4MPWA 1EP6A 1KLTA 3KN2A 2QY0B 3ZZ8A 2P3FH 2ZNKH 1LQDB 2HPQH 5CHAC 2WV5A 4JZEH 1DSTA 3MU0A 3MO9A 1V3XA 2BM2A 1XKBC 3E0PB 2G8TA 3HPTB 4I8GA 1ZHRA 1L2EA 2CHAB 1GI7B 1ABJH 1H1BA 3TJNA 3PWBA 3F6UH 4Y71A 2TPIZ 1GL1A 1XUFA 1ORFA 1C2DA 3Q3YA 4ISIH 2GCHG 4JK5A 5FHTA 2F9VA 2BD8A 1FV9A 1DWDH 1BRBE 2VWOA 1AE8H 1PPBH 1SOTA 6CHAB 1BMLA 1EZSC 1EQ9A 1HFDA 1OWDA 2HVXA 3RXGA 1NTPA 1C1RA 1NZQH 1QB6A 5A8XA 2OC7A 2QV1A 2HLCA 4J2YB 4AFUA 4ESTE 5PTPA 3A8BA 1UTOA 3BTHE 3SU3A 3U69H 2F9PA 1F0TA 2FOAA 3SQEE 4GCHG 3M37A 1ZZZA 2BY9X 3GDSA 1RIWB 1E37B 2TGDA 4KP0A 2FO9A 3SUFA 1A46H 1F5KU 1OWIA 1FN8A 4MVNA 3I77A 2ZPRA 3SGQE 8KME2 1S5SA 1UK2A 1ZR0A 2V3OH 4YM9A 2VVCA 2R2MB 4NCYA 1SQTA 5J4QA 3MI4A 4O03A 1H4WA 2CV3A 1BTHH 4K8BA 4MNWA 3PB1E 3HGPA 3D65E 2FYQA 1K22H 2UUJB 1ZJDA 1C5RA 2A32A 2XYAA 4RN6A 1CGHA 1K2I1 1QTFA 3F1SB 1GBFA 3HKIB 4Y8XA 1K1IA 1IAUA 2GV6A 2SNWA 1ESBA 2ZF0H 3RXMA 1C5MD 2ZGBH 4IW4E 2A31A 1EOLA 2A2XH 2Y80A 1GDUA 1MKXK 2BB4A 1QURH 4WJG2 1C5UA 1SL3A 1VITH 2W3KA 2BDGA 2VWLA 3W95A 2Z3EA 1HAYB 2ZU4A 4RSPA 4D7FA 4D9RA 3B23B 2XCNA 3MWIU 1EAWA 2XTTB 2A5IA 5C3NA 3P8OA 2AMDA 1GHAG 2Y7XA 1UO6A 2OD3B 4X1NU 3VB3A 4ABIA 2FX4A 2VU8E 2VWMA 1LQEA 1SC8U 2ZTZA 1PJPA 1C1TA 1HCGA 3GCHB 1AGJA 1NFYA 4GHTA 7ESTE 5T6GA 1MKWK 2GKVE 5J4SA 2GZ9A 5EPNA 3ZYEA 2BOHB 3E90B 5LH8A 3UREA 2FXRA 4GAWA 1GBLA 3A81A 1QL7A 1VCQA 4KELA 3CP7A 3SN8A 4ABGA 3ATIA 1K28D 2ZFFH 1JIRA 2ZCKP 5DP3A 3QWCH 1M9UA 1J14A 1FIWA 5A0AE 1BTZA 1C1VH 3SV8A 4BXWA 1GJBB 1NRQH 1EUFA 1IQNA 2P3UB 2THFB 3ZZDA 3KNXA 1O2OA 2Y81A 2PSXA 1CA0B 3UIRA 3TK9A 1DXPA 1VGCB 1O33A 1AFQC 1SHHB 1NRSH 2A1DB 3A7VA 2I6QA 3FP6E 1BJUA 1O0DH 2G81E 5DP7A 1RJXB 2FTLE 2BD9A 3UQVA 5JB9S 1BA8B 3QTVH 5DPAA 4CRFA 1LKBA 3MHWU 1HAPH 2XC0A 1GI1A 3TPIZ 2FM2A 1N6YA 2FX6A 1GMHF 2H6MA 1AVXA 4BNRA 1C1QA 3E3TA 1V2WT 2AGGX 5TJXA 5T3HA 1N1LA 2C8ZB 1ZPZA 1DLEA 3A7XA 1VITG 4ZAEA 2SFAA 2PV9B 1SGEE 2CN0H 1O5CB 4IN2A 4O3UA 1SGRE 2RDLA 1WAYB 4IS5A 2ZIQH 1O3AA 3ATMA 5HXFA 1T4UH 1AB9B 1YPHE 3A8AA 3SU6A 2BD2A 4YZUA 1C1UH 5E0GA 4DY7B 1TNLA 2A7JA 1BRCE 1F5RA 2OC0A 5F8XA 1ZSLA 1IQGA 3M5MA 3SV7A 1BRUP 5EU8A 4Y10E 2TIOA 3O8BA 3BG4B 2K1QA 2XWBI 3LU9B 1QRWA 2P95A 4BAOB 1GJ4H 3SV6A 2R9PA 1Z6JH 2CJIA 2QYIA 4ABEA 3UWIA 1O2VA 1TGBA 1ZGVA 4I31A 1J15A 1GMCG 3LJJA 4JZ1A 1TNHA 1O2UA 2W3IA 3E1XB 1HAOH 3MO6A 2C3SA 3SW2B 3E16B 1ARCA 2BOKA 3GCTG 1YPMH 1THRH 1Y5AT 1JXPA 3T26A 5C2ZA 5I46H 3R0FA 3JZ1B 1MZAA 4WY3A 5T6FA 2VIVA 1SBWA 1QNJA 1O39A 1TPPA 3SQHE 4B2BA 2ZU2A 4E06H 3CS0A 5AFYH 3Q3KA 1D6RA 1ABIH 1CE5A 1BRAA 1GJDB 2GP9B 5FX6A 1EP5A 1S81A 1KLJH 4JMYA 2ZFQH 2H1UA 3RUOA 7GCHG 1Y5UT 2QF0A 1UCYE 3EA9A 4HI3A 1BBRH 2RCEA 2OC8A 1J16A 1PQ8A 4Y79A 1UK4A 3ZVDA 1U6QA 4Y76A 1XUJA 4U30A 3RMMH 1ZPBA 3A82A 4VGCB 1D4PB 1T8NA 2EC9H 4X1SU 3DD2H 4YLQH 3AVZA 2O8LA 3GISB 2W7UA 3PWCA 1HYLA 2CXVA 1H9LB 1Z6EA 2BMGB 3RXHA 5EPYA 1MAXA 1T31A 2SGDE 2QXHA 2P94A 3K6ZA 1TPAE 3P92A 1GBIA 1GJ8B 1MCTA 3M35A 1CA8B 1O34A 1FPCH 2G4TA 1B0FA 1GG6B 2DE8A 2B0FA 5F6MA 4DJZB 4NFEA 3VGCC 1G36A 2F91A 3KQEA 3U1JB 1DS2E 1SGCA 2ANKH 1SPJA 3ITIA 1DWBH 4K5ZA 2VB0A 3ATKA 2FLRH 3M61U 2HNTE 4FU8A 3KHVA 4DIIH 1FY8E 4X8SH 2C8WB 3I78A 4ABFA 1LHFH 4FUGA 1NFXA 1MTVA 1N8OB 2GCTC 1QBNA 4A6LA 1MD7A 1FIZA 2GDDA 3VFEA 1PQ5A 1V2JT 8LPRA 1O3GA 1AKSB 3ATLA 2UUYA 4OS2A 2GDEH 2RA3A 3SU5A 1KTTB 3UFAA 3HGNA 3MNBA 3ODFA 3DT0H 1EAXA 1GCDA 1HAHH 1PPEE 1F0UA 3TGIE 2ANMH 4Q2KA 2F9UA 1O3KA 4AGKA 3TGJE 4WXIA 1C5SA 2JKHA 3PLPA 2Z9IA 4DIHH 1ZRKA 4Y11E 1XX9A 1D3TB 1VR1H 2NU0E 3GCHC 3PV4A 3GY7A 2G55A 3Q3XA 2SNVA 4DG4A 1C1PA 4FUJA 1Y3VA 3U8RH 3M5OA 5BRRE 4MPVA 1A0JA 3RXKA 1BOQA 1G2LA 4TPYA 1CVWH 2O8WA 1L0ZA 1WTGH 3TJUA 3LGIA 1KDQA 3SJ9A 1S82A 2FI5E 3F68H 2J34A 3TITA 3JZ2B 1B0EA 3MFJA 3SJKA 1DLKB 1O2TA 2BDIA 2H9EH 3URDA 4BAKB 2ZCLP 1ZYOA 3A8DA 3SBKA 5L6NH 2BDAA 1TGNA 3S9BA 3VEQB 2ANWA 2VGCC 1KTSB 3F9FA 2OBOA 2ANYA 1O3NA 1A0LA 1FNIA 3BTKE 2H9HA 4KKDA 2Z9LA 2BLWA 2BXTH 5C5OA 5FXLA 2AS9A 1C1MA 2HNTF 1P2MA 5IYTA 5JBBS 3PO1B 3UNRA 3RXPA 3A88A 1ZMNA 2GMTB 3S0NA 3ZZCA 4FUFA 3EE0B 1GJ6A 1QGFA 5T6DA 1P3EA 2R2WU 3RMNH 3W94A 1G3CA 1BMMH 2VH6A 1FXYA 3P95A 2J9NA 4B74A 2BDCA 4X1RU 1YLCA 1YPLH 2FI4E 4MPXA 1WQSA 3RXAA 1Z8GA 4ABJA 4GLYA 5DK1A 1WU1A 1C1WH 1TE0A 3TJVA 1A4WH 1SLUB 5L30H 3U8TH 1BQYA 5FBIA 1RD3B 3AW0A 1O2QA 3C1KA 3DFJA 3ZYDA 1HXEH 1NC6A 3LKWA 3K6YA 1C5OH 1UTMA 1HIAB 4F4OC 2YNBA 3IWMA 5GCHF 1DE7H 2VWNA 3OSYA 3OX7U 1SGFA 2EI7A 2C8YB 1GJCB 3TVJB 1CHOF 1SB1H 3MU5A 1IQIA 2EI8A 2WYGA 1P2IA 4KTUA 2BY5X 1ACBE 5AVDA 3EA8A 1AZZA 2ZDKA 1QQUA 1WSSH 1P04A 2AGEX 2PWXA 1QY6A 3P6ZB 1HIAA 2OQ5A 1KXFA 5EXMA 1Y59T 5ETXA 4AB9A 3LOXA 3T27A 2ZGHA 4CR5A 1PYTC 4YOGA 1G3BA 1ANCA 1HJ9A 1XUKA 1XMNB 2ZDVH 2ESTE 3A85A 5HYOA 1LVMA 5FBEA 1GL0E 1C4Y2 1GHBG 1IOEA 1HJAC 2OUAA 4BAQB 1P01A 4AORA 1BZXE 4B2AA 1O3PB 5FCRA 3AAVA 4Y0YE 1KXBA 2QF3A 2XWAA 3SI4H 2ZDLA 2BVRH 3MH6A 1NT1A 1TRYA 2D8WA 4VGCC 3IITA 3I29A 2ZPQA 2XC4A 1MMJN 1FPHH 4U2WA 4HTCH 1BDAA 4K2YA 1AE5A 1NU7B 4FUIA 4WH6A 2ZU3A 4AYVB 4OGYA 2ZDNA 1TA6A 3FVFB 5DG6A 2PGQB 4CRCA 2A5KA 1WUNH 2QCYA 1FY5A 1GMDF 1LVBA 2J38A 4AZ2B 3GY3A 1QJ6B 2Z9KA 1IQEA 4H4FA 3AAUA 4UDWH 5EXLA 1UMAH 3SUEA 1AQ7A 4I33A 2XBYA 3UNQA 1UCYK 1GI8B 1O3JA 5A2MH 2SGEE 3P8NA 1W0ZU 1K9OE 1SR5C 3NZIA 4Y6DA 4IC5A 2ZHEH 1O3IA 1UTLM