4XBCA

1.60 a resolution structure of norovirus 3cl protease complex with a covalently bound dipeptidyl inhibitor (1r,2s)-2-({n-[(benzyloxy)carbonyl]-3-cyclohexyl-l-alanyl}amino)-1-hydroxy-3-[(3s)-2-oxopyrrolidin-3-yl]propane-1-sulfonic acid (hexagonal form)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
183
structure length
174
Chain Sequence
HMAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQAGEGETALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-LIKE PROTEASE
publication title Structure-Guided Design and Optimization of Dipeptidyl Inhibitors of Norovirus 3CL Protease. Structure-Activity Relationships and Biochemical, X-ray Crystallographic, Cell-Based, and In Vivo Studies.
pubmed doi rcsb
source organism Norwalk virus (strain gi/human/united states/norwalk/1968)
total genus 40
structure length 174
sequence length 183
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xbcA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xbcA01
4BTUB 3RXVA 1NTPA 5FCKA 4Y0YE 2XCFA 3A7ZA 2O8LA 4THNH 1QL7A 5EPNA 1LPZB 5T6GA 3SO3A 4DJZB 5T6DA 1BT7A 1YLCA 2A2QH 3PMBB 4IBLH 4WH6A 1O3JA 4CRCA 5A0BA 2AERH 1P3CA 3QN7A 1L4DA 3GCHB 3PWCA 3ENSB 4YTAA 1NY22 1P09A 1MBQA 1ZSLA 1OWIA 1QRWA 2BY9X 5ETXA 1C2MA 2VIOA 1YM0A 3L3TA 7ESTE 1ZMJA 5AVDA 5F8ZA 2FPZA 4K8YA 3UNQA 1P2JA 1B7XB 4I8LA 2ZCHP 1XUIA 4X1SU 5CHAC 5A0AE 1DY8A 3JZ2B 3F1SB 3WY8A 1D3PB 2BD5A 4JZIA 1GI0A 2BY8X 5GXPA 1DSTA 4CRAA 4CBNA 1P0SH 4FUGA 5FHTA 8GCHG 2ZIQH 1NRRH 2SNVA 1YPHE 2QN5T 4NA7A 2H9HA 1SGCA 1GG6B 4CH2B 1GI9B 4Y0ZE 6ESTA 5K7RA 1LHCH 2AS9A 1KTSB 2VWOA 2AH4X 3T2NA 1O2GH 1GBJA 1ZRBA 1ZMNA 1GI6A 2G8TA 2ALPA 3UQVA 1BDAA 2PTNA 3PLBA 3PMHB 1EB2A 2GD4B 3PWBA 2O8TA 4KTSA 4K2YA 4HFPB 1FXYA 2ZTXA 2BDBA 2OQ5A 1N6YA 1O2XA 1BTZA 1IHSH 1QQUA 3S9CA 1O2KA 4DT7B 2GCHG 3BTME 2GV6A 1C5UA 1TGBA 4AYVB 3T29A 2THFB 1RTFB 4ABBA 1F0SA 5DP4A 1GHAF 1HJAC 1F5KU 1WSSH 4JYTA 3UWJH 1TPPA 1HXFH 4WMDA 1A4WH 4Y8ZA 2BVRH 2BY5X 2R0LA 4Q2KA 5FXLA 4WY3A 1HDTH 4AG1A 1IQEA 4Q7ZA 3A88A 1HAIH 4YOJA 1XVMA 4TPYA 1PPBH 2AEIH 2EC9H 2GCTC 3MNXA 3UIRA 4JZ1A 1FMGA 3PTNA 2V35A 1BTHH 1WOFA 2ANKH 5A8YA 4X6OA 3AW1A 4OS4A 2BDIA 2PKAB 3PROA 4DIHH 4XFQA 3SUDA 3TGIE 1HAOH 3BTWE 3ZVGA 1AKSB 1S0RA 2BD3A 2XC0A 3GY5A 1OOKB 1G3CA 3RC5A 1A46H 1BBRH 1O32A 3VB4A 3RXTA 1QRXA 4NWLA 1F7ZA 3SZNA 4B76A 1EPTB 2SNWA 3PYHA 2TPIZ 1O2TA 1ZZZA 1IQGA 2EI6A 3STJA 2YNBA 3P8GA 4FVDA 2HLCA 2BQWB 5LGOA 2GVFA 4DG4A 1WUNH 3LJJA 1A1RA 1MH0A 2ZG0H 2NU1E 2J92A 1ARBA 1SMFE 4D7FA 3MHWU 2UWPA 3ODFA 1AFQB 1VCQA 3F9HA 5K0HA 1GHYH 3TGJE 2P16A 2ODYB 1ELBA 4ZKSU 1GJCB 3T62A 6GCHF 1TBRH 1G37A 1YBWA 1GBHA 4B74A 2BB4A 3NPSA 4YO9A 3TJNA 2JKHA 1IHTH 1J15A 1UJ1A 4K3JA 5DP3A 1GVKB 3D62A 3SHCH 1TRYA 4U32A 1BZXE 2DE9A 1HRTH 3G01A 1KSNA 2HNTC 3ZVFA 1IQMA 1NZQH 3ZZCA 1DUAA 1BMLA 4UONA 1T4VH 4FUHA 1O30A 1KXDA 1FAXA 1TGSZ 3GYLB 1ELDE 1HAHH 1XX9A 3C1KA 1C1OA 1XMNB 3GISB 4CRDA 1LHFH 3PV4A 1Z8JB 1ZJKA 2XBVA 4MPXA 1UTQA 1TE0A 3T5FH 2HNTE 2QC2A 3A84A 1V2TT 2Z9GA 1C2KA 1O36A 3ZV9A 4ZXYH 3ZZ7A 6CHAC 1GVZA 3RXOA 3R0FA 1ABJH 1GJ8B 1GI4A 5GCHF 1YKTA 1GGDC 1KYNA 2SGFE 2WYGA 1B0EA 1O3IA 1IAUA 1C2JA 4OS7A 3TPIZ 4OGYA 2F91A 1GHBF 2ZFRH 2ZHWH 4X8TH 1AE5A 3P6ZB 3QK1A 2JETC 2FOAA 2Q1JA 1FJSA 2G81E 1HAXB 1B0FA 2A1DB 1J8AA 2XTTB 1IOEA 3PMAB 1EQ9A 1XKBC 4NWKA 5J4SA 2CF9H 4WXIA 2ANYA 2BM2A 2F9BH 1YGCH 1T7CA 3TU7H 1P2OA 3I29A 3F68H 1W2KH 1BRCE 4Y7BA 7KMEH 1ZGIA 1ETSH 3SU2A 1S0QA 1V2NT 2R0KA 1CE5A 1RGQA 5EPYA 2ZF0H 1HV7A 4YOIA 3SU6A 2QCYA 5C67A 2G5NA 4FUCA 3RM2H 3A82A 4NIVA 2VINA 3LOXA 3SGQE 3QWCH 8LPRA 1LKAA 4Z0KA 1LMWB 4Z6AH 1N8OB 2XCNA 2Z3EA 1QRZA 2G5VA 4DURA 1O2PA 3SORA 1MKXK 1XUGA 2FX6A 4AG2A 2A32A 4Y76A 1QB1A 1OPHB 1OWEA 3M5MA 4D9RA 2Y7XA 1UTMA 2J9NA 3SGAE 3KGPA 3LONA 2BD8A 4R0IA 3M35A 1CSOE 4MTBA 1GBEA 1JWTA 1TB6H 3VPKA 2OC7A 2ZDAH 4UEHH 1FI8A 2OUAA 4BNRA 1EXFA 2EI8A 2GT7A 1MUEB 1DFPA 1BRUP 1O34A 2V0BA 1GJBB 1UCYH 4NCYA 5DP5A 2PW8H 3SU0A 1K2I1 3DFLA 5JPMH 4NA9H 5F03A 5EXLA 2CHAC 1RIWB 1WBGB 3T25A 1MMJN 2FODA 3K65B 2ZFSA 1GJ9B 1Z6JH 4BAHB 4QT8C 3A7WA 1ZSJA 2AMDA 2RDLA 4BTTB 1F92A 4PROA 3EAJA 2BYAX 1H9LB 2FXRA 1CHGA 1AIXH 1A3EH 2A4QA 2UWLA 4XSKU 3TLOA 2BDYA 1O3EA 2XWAA 1GJ7B 2ZHDA 1SGIB 3A7XA 1GCTC 4ZKRU 3SNEA 1TRNA 1EZSC 1SB1H 3UTUH 2C8YB 1P06A 4IN1A 1GMCF 1QL8A 1KLJH 1GI2A 3AW0A 3FZZA 2Y5FA 4BAQB 2D8WA 3SW2B 2OC8A 4I8KA 1XXFA 4XBBA 1Q3XA 4X2WA 1C5MD 2PTCE 1C4U2 3DHKH 1DT2A 4ESTE 1TAWA 3NK8A 1C2HA 1QA0A 2Z94A 4DCDA 2STAE 1LCYA 1BMNH 1NRQH 2YOLA 1SFQB 3MH5A 1C5LH 1FV9A 2J95A 3S69A 4ZHLU 3RXSA 2A4GA 3GY2A 2WV5A 1E35B 1V2PT 5A0CA 1UTKA 1CBWC 1OXGA 1A0LA 1ANEA 1FPCH 2KAIA 1GDQA 1UK3A 5C5OA 3BIUH 3Q77A 1SGPE 1AY6H 1P2QA 3LDXH 4MVNA 1D3TB 1ELGA 1L1JA 2H2ZA 1O3BA 3LGYA 9LPRA 1ARCA 2OP9A 3M5OA 1Y3XA 1DUEA 2PGQB 4AX9H 1OYTH 3A8BA 2P3UB 3BTQE 3MNBA 3NXPA 4CH8B 4CREA 1SHYA 2ZU1A 1GCDA 4FXGH 4UFFH 3DD2H 4FUIA 1V2JT 2BLWA 2ODQA 1RTKA 1AVXA 4AZ2B 1SOZA 1NT1A 3RLWH 2W7UA 4BANB 1O2JA 1AB9B 1W3CA 1G3DA 1GL1A 1KDQA 1NN6A 1WAYB 1O2OA 1O2RA 3SV9A 1GBLA 1GDNA 4X6PA 4A7IB 1HGTH 2JH5D 1L1NA 3P92A 2GDEH 2BX4A 1XUJA 1TMTH 3BTDE 2Z6BD 2C8XB 3MU5A 3M61U 2VVCA 1UVTH 2FESH 3NUMA 3NZIA 3R3GB 1A0HB 1YF4A 2RG3A 4A5TS 5IDKA 1S81A 1UTJA 1TWXB 2GTBA 4YOGA 1TMUH 2ZKSA 2ZHFH 1IQNA 3CP7A 2NWNA 1SC8U 5E2PA 2ZU3A 2ZEBA 2R9PA 3SNCA 5F8TA 1DLEA 1C9PA 2OBOA 2AFQB 3SJKA 4OS6A 5E2OA 1F0UA 3NWUA 2O8WA 5A2MH 1AMHA 3DT0H 2WYJA 3EA8A 4I31A 4O3UA 3VFEA 1LQEA 2C8WB 2WV4A 3V0XA 5B6OA 5C20A 3M7UA 1D6RA 1OWKA 2VJ1A 1PJPA 1S5SA 1TFXA 5CHAB 2G4TA 5JDUB 1TOMH 1HAVA 1P05A 2SFAA 4Y71A 3HATH 2ALVA 3K2UA 1G2LA 5HM2A 1AZZA 1O3FA 2AIQA 2DUCA 1LQDB 2VVVA 2RA0A 1GMHG 2BX3A 2SGQE 4U30A 3VB3A 5FPYA 4JK5A 2PKSC 1T8LA 5AHGH 4KTUA 1C5XB 4WWYA 1EAUA 4U2WA 1EOJA 2ZO3H 1K1PA 3OX7U 3W94A 1FAKH 1DM4B 1W8BH 2PUXB 1ZRKA 2OCVB 2ZU4A 2GZ7A 1XKAC 1BHXB 1DANH 2FI4E 4H42U 4ZKOU 2G52A 5TJXA 1OWJA 2C4FH 4TY7A 4X1RU 2QGRA 1C5VA 1KY9A 1Z1IA 1TIOA 1SGEE 4GLYA 3M3SA 3FP7E 2W5EA 3OY5U 1CGIE 5EQQA 3M5NA 3Q00A 3O8CA 1O3LA 1GMCG 4CHAC 5L2YH 1HLTH 3LIWA 1EOLA 1CT0E 2FYRA 1EUFA 1TX8A 2VIPA 3NKKA 4GAWA 3M3TA 1DDJA 3SV7A 5GJ4B 2VU8E 1T8OA 1YYY1 5F8XA 4Y8YA 1PQAA 1GJDB 1ETRH 1JIRA 3LH1A 2BVXH 3M7QA 2OC0A 1W7XH 3FFGA 3MYWA 3HPTB 4BAMB 1HAZB 1TA2A 3FP8E 2TGPZ 1YLDA 3ZYEA 4Y8XA 1LVMA 2R2MB 1PPHE 2BZAA 2TBSA 3URDA 4DW2U 2ZU2A 1VGCB 4FUEA 2ZDKA 1LTOA 1OS8A 1BBRE 2WINI 3VXFH 1ID5H 3B23B 1O5DH 1P57B 3RUOA 3U8OH 5C1XA 3MMGA 3GY8A 4CRGA 4FUFA 1QB6A 1V2WT 3P8FA 5JBAS 3M3VA 1D4PB 1PPCE 1DICA 1HCGA 1QBNA 1O2SA 2PWXA 1ANCA 1MU8B 2PSXA 2Y7ZA 1XUKA 3RMLH 1MTVA 3ELAH 1O3DA 1TGTA 1VITG 1MKWH 2H5DA 1SL3A 1VCPA 2GGVB 4X8SH 1C4V2 1ZYOA 3IG6B 4JMYA 3HGNA 4ABEA 2B0FA 1BIOA 3E6PH 1O2WA 4JYUH 2RCEA 3M5LA 1GBCA 1FN6A 3BG4B 4CRBA 3CENA 3U69H 4FU9A 2UUYA 1K1NA 3U9AH 3EE0B 2GV7A 1ORFA 2BXUH 1FIZA 1E0FD 1WQSA 5DGJA 1O2LA 4WMEA 1OX1A 2GMTC 2SGPE 2VWNA 4A6LA 3A7VA 4YLQH 1BMAA 3EA9A 2P3TB 1YCPH 3GCNA 3ATKA 1P01A 3D23A 3T27A 2VIQA 1D6WA 3IWMA 3LC5A 3ZVEA 1O2UA 1C1QA 1X7AC 1Q2WA 1EX3A 1DITH 1UTNA 1WU1A 1SVPA 1Z71A 6CHAB 5EOKA 4NG9H 1OKXA 1ESAA 1O2MA 3PM3A 1UVPA 2ZWLH 1WV7H 1Y3YA 3QDZB 4VGCB 1F5RA 4I7YH 1N1LA 4JZEH 4X0WU 1GMDF 4HZHA 1S6HA 1TBZH 3VGCB 2J38A 1D9IA 4OS5A 4AFSA 2W7SA 1GHXH 3KNXA 1Z7KA 2QYIA 3GCOA 3MH4A 5F6MA 1OYQA 3PMJA 4MPUA 4R8TB 1ZHPA 2ANWA 2WUCA 1C9TA 3ODDA 5I25A 3BTFE 1Y3WA 3GY6A 4AB9A 1J14A 4O97A 1YCPM 4OGXA 1EJNA 1GVLA 3LC3A 2ZPQA 2FS9A 2J4IA 3UUZA 1EP5A 1O5BB 1P02A 1NRNH 4BXWA 1EAIA 2ZHQH 4RKJB 1EZQA 1B5GH 1V2UT 2EA3A 5GDSH 1AWHB 3TH4H 1V2ST 2UUKB 4GVUA 1HIAA 2OINA 3SNAA 1S85A 2P3FH 4BAOB 2H9EH 1NFWA 4MNYA 3TGKE 2XBYA 1YPKH 1QBOA 1JRTA 1ESBA 1XUFA 1YPMH 2BQ7B 5FPTA 3SHAH 3KIDU 2BQ6B 4KTCA 1UHBA 5EXNA 1SHHB 1YPJH 3M7TA 2A7JA 1GDUA 3AAUA 3BTHE 2B5TB 2F9OA 3PLPA 3RXUA 1C5PA 6LPRA 4FU8A 3RXFA 2PSYA 1P12E 4ZROA 8ESTE 1UTPA 1KXBA 1HAYB 1O2HA 2ZGCA 1DWDH 3RMNH 1O35A 2ZP0H 5E0GA 1IQKA 1O3GA 2FP7B 3V12A 1AUJA 2BDHA 1F0TA 5G4BA 1TGCA 4UDWH 2BY6X 1O3NA 2CHAB 1P2IA 1TQ0B 2QXHA 3ZVAA 1G36A 1Z6EA 1FIWA 4MLFB 1FLEE 1F0RA 4Y7AA 2FYQA 4NFEA 2OD3B 1SQAA 1AD8H 1THPB 2FM2A 1O31A 3O8BA 2KAIB 1EZXC 5TCAA 3EA7A 3ZZ8A 1O3OA 1G32B 2F83A 1OP0A 2HALA 1H4WA 3QTVH 3T26A 1BTUA 4KGAA 1O2ZA 4AFZA 4E05H 5CMXH 3LH3A 3U1JB 2SGAA 1IQJA 1K1JA 1QB9A 1Z8RA 1KLIH 1PPFE 1QJ6B 2BLOA 1BRBE 3SU3A 3SNBA 1BTXA 1HAGE 2ANMH 4GHQA 2ZDVH 4BAKB 4WJG2 1CO7E 1VITH 2BD7A 3E90B 1C1RA 3GY3A 1CA0C 3AVZA 1TMBH 4DOQA 4IMZA 3RXQA 2EI7A 1P9UA 4A1XA 2IN2A 1TONA 1V2MT 3RU4E 3EGKH 1G3BA 2J94A 2UUJB 1FY3A 1CBWB 2BXTH 1AFEH 3A80A 1MQ6A 1SLXB 3RC6A 1RTLA 2H9TH 4D8NA 2BDAA 1KXCA 4BXSA 3MU1A 3GICB 2UWOA 5AFZH 3RXHA 5DG6A 1AVGH 1MD7A 4HTCH 4I8JA 1QBVH 3FANA 2BVSH 3EDXB 2AGEX 3RXBA 1K1LA 1ZSKA 2ASUB 1TRMA 1MAXA 2QAAA 4I33A 1FY5A 4RN6A 1Z8IB 3UPEA 3I78A 1KXFA 3SV8A 4X8UH 1C2LA 2ZNKH 5GPIB 1CU1A 1DLKB 1GMDG 3F9GA 3ZYDA 1O5CB 4YESB 2ZQ2A 2Z9KA 5PTPA 4XBCA 1QNJA 4O3TA 2FOMB 2J34A 1W12U 4LXBH 1RRKA 4RSPA 2QY0B 4GPGA 5EGMA 1GI1A 1GJ4H 1CVWH 1E38B 2ZHEH 1MZAA 2XBWA 1AN1E 1MTNC 1W10U 4FUJA 2BDCA 4H6SB 1CA8B 3FVFB 1GMHF 3UNRA 3RXJA 4AFUA 2ZTYA 4AN7A 1V2KT 1PPZA 1GI3A 3TJOA 1GBMA 2R2WU 2XC5A 4NFFA 2GKVE 5DKMA 4NIWA 1PQ8A 3QLPH 2P93A 5ESBA 3RP2A 2V3OH 4GSOA 3ITIA 2WUBA 3SQHE 1PQ5A 3QZRA 3E8LA 1O38A 3OY6U 3SUGA 4UFGH 1HPGA 1BTPA 5GIBA 2ZECA 1UK2A 1S83A 1C1TA 1DXWA 2PV9B 1AE8H 2QA9E 4K8BA 5HGGA 1LPGB 3ZZ4A 1AKSA 1K21H 3MH6A 3QX5H 1DWBH 1OP2A 7LPRA 1XXDA 1QQ4A 5LH8A 1C5YB 4X1QU 4INHA 2VGCC 2P95A 2Z9IA 1C5WB 4X1NU 1FUJA 1GBFA 1Y8TA 2BD4A 4YZUA 1DWEH 3K6YA 1Y5BT 1C1WH 2FOGA 1WCZA 3E0PB 2XXLA 1O2VA 3ZZBA 1NS3A 1T8NA 4NZLA 4D76A 1BQYA 4KKDA 1CGJE 1Y59T 1SOTA 3RU4D 1K1OA 4I8GA 3SU5A 3SUEA 3QZQA 1ELEE 1O33A 4A1TA 1V2QT 4IC5A 2Z3CA 3LJOA 4D9QA 4CHAB 1TQ7B 1THSH 3RXEA 1CGHA 5JB9S 1YP9A 1C2EA 3BF6H 4TWWA 2VWMA 1D3QB 1O2NA 1H9HE 1FNIA 2ZCKP 2A45B 3RXGA 3KF2A 1SI5H 1OP8A 1V6DA 1ELFA 3GY4A 2P8OC 5ABWA 3GCTF 5EG4A 1VITF 2QF0A 2FS8A 3B8JA 2M5TA 1K9OE 4FUBA 4DIIH 2A31A 4O9VA 1AHTH 4X2XA 5DP6A 2A5AA 2G55A 1FPHH 2TGDA 3BTGE 2QXGA 4MDSA 1LVBA 2G51A 2F3CE 3KHVA 3UQOA 5FBIA 1H8DH 1AWFH 2C93B 1K28D 2D1JA 2XRCA 1V2LT 1RD3B 4B2CA 3HK6B 1J9CH 2FI5E 3H7TA 3RXKA 2Y82A 4Y6DA 4XOJA 2FLBH 4DY7B 1WTHD 1H9IE 5C1UA 3GDUA 1TNIA 1BOQA 1LVYA 2V6NA 5HXFA 4U01A 1AZ8A 1TPAE 3UR9A 1NPMA 2C90B 4K69A 1C2GA 1XVOA 3MNCA 3E91A 1BHXF 2WPIS 3QTOH 2VH6A 3E0NB 4WF8A 4AB8A 3GDSA 4Q80A 2IJOB 3KN2A 3A8AA 4GUXA 2W3IA 5TCCA 3T28A 3SJOA 5E0JA 3RXCA 1OWHA 1DE7H 1P2NA 3TITA 3HKIB 2ZU5A 2VH0A 3P17H 1RIWC 3VXEH 1C2DA 1PPGE 1F2SE 2VIWA 3UOUA 2FOFA 2XWBI 1ZJDA 3QGNB 2LPRA 1K1IA 4JZDH 2Q6FA 3TJVA 2GX4A 2Z7FE 5EODA 3EQ0H 2YNAA 1SGNE 3BTEE 1ABIH 4JK6A 1UVSH 3A8DA 2NU3E 2D26C 2Z9LA 2OLGA 2NU2E 1LVOA 4ABDA 4B1TA 1SGTA 2FEQH 1UO6A 4YT7H 2Z3DA 2FX4A 1HIAB 1FONA 1P9SA 4M7GA 4NIXA 3GYMA 3SN8A 2ZGBH 5T3HA 3P70B 3F6UH 2CF8H 2G00A 1QFKH 7GCHG 1UHBB 2QV1A 1IQLA 3L6PA 3VEQB 4A1VA 2BLQA 1U6QA 3FAOA 1ZPBA 4UE7H 3UR6A 3ATMA 5FAHA 1C5RA 3UREA 2BD9A 2FLRH 1GI5A 4F4OC 1HJAB 4ZAEA 5L2ZH 2AGGX 1GHVH 5AF9H 1SGQE 4B2AA 5FCRA 2H6MA 1KXAA 3OTJE 4K1TA 3LKWA 4X1PU 2QF3A 3QUMP 1BJVA 2GCTB 1G30B 1V2VT 2QXIA 4CR5A 1PYTD 3SI4H 1GBAA 4B73A 1BBRK 2JH6D 2OXSA 3BEIB 3ZVCA 1HFDA 3CS0A 3Q3XA 1ZPCA 1ZOMA 4H4FA 5ESTE 1Z8GA 1ANDA 4BTIB 1O2QA 3ZZ5A 3MO3A 2AGIX 1XUHA 2FWWA 3PO1C 2HNTF 2CXVA 4NSYA 1J16A 3TK9A 1TNKA 4K1EA 3BEUA 4IMQA 1ANBA 2GT8A 1EKBB 3DUXH 1T8MA 2BMGB 2Y81A 3KQBA 5EU8A 3C27B 5DPAA 3MU4A 1O0DH 4ABIA 3KEEA 2K1QA 3HK3B 5DO4H 3OSYA 2O8UA 2Y6TA 3ZV8A 3MNSA 3SQEE 1YPEH 2HGTH 3F9FA 3SBKA 2J2UA 3LT3A 2FOEA 4LZ4B 1CHOF 1MCVA 1ELVA 3BTTE 4AYYB 1DY9A 1VJAU 4MNVA 1EJMA 3GCTG 4LZ1H 3STIA 3FP6E 1JOUB 1HNEE 2STBE 3BG8A 2SGDE 1TLDA 3TIUA 3RDZA 1L1GA 2ZPSA 1FY4A 1GI7B 1P8VC 2CV3A 1TNHA 1ZHMA 2GZ8A 2PLXA 2BZ6H 2HOBA 1IQFA 1JMOH 3P8OA 5JB8S 3MH7A 4XE4A 1XM1A 5FX5A 2ZDMA 3MU8A 1C4Y2 2G4UA 1UTLM 1ZGVA 1NC6A 1KTTB 1T4UH 3P8NA 1MU6B 4MPWA 2HRVA 1TNGA 2PUQH 3SNDA 3TNTA 4SGAE 1NFUA 4E06H 4I8HA 1DOJA 2B8OH 1W0YH 1YPHC 1O3HA 4Y79A 2OTVA 3PB1E 2I6QA 5FX6A 3UOPA 2VNTA 3OYPA 2BOKA 1JXPA 1TOCB 1CA0B 1ZHRA 4AORA 4TY6A 1GGDB 4IS5A 5L6NH 1C5QA 4IC6A 4HGCA 4IGDA 3Q3KA 4ABGA 3GY7A 4X2VA 1IQIA 1RS0A 2A4OA 1C1MA 5EXMA 2BOHB 3A81A 1FZZA 1GHZA 3GOVB 1PFXC 1Y3VA 2JETB 5J4QA 1SLVB 2WPMS 3KL6A 5LPRA 1GHWH 2Z9JA 2BD2A 4D7GA 2C8ZB 3A83A 1ZTKA 2ZFTA 3HKJB 3D49H 5FPSA 3F9EA 3U98H 2ZGJA 3TK6A 1TX6A 1NFYA 1NFXA 1L0ZA 1MTUA 5DP9A 1QY6A 5FBEA 4ISNA 1DXPA 3KQDA 5GWZA 3LGWA 3JZ1B 4YT6H 3ESTA 1DVAH 4ZXXH 5I46H 1A5HA 1C1SA 1EZUC 4NSVA 1GI8B 3W95A 2BY7X 5EQRA 2ZFQH 8KME2 4OS1A 1D3DB 1W0ZU 4GCHF 5C5NA 3A8CA 1G2MA 2ESTE 1EASA 3B9FH 4BOHA 3TJUA 4NGAH 1GPZA 1AQ7A 3S0NA 4Y11E 4I32A 1SPJA 4LOYH 2FZZA 2ZZUH 1SGDE 1TPSA 3TH3H 4ZMAH 4ISLA 4MPVA 5EW1H 1UCYK 2ZCLP 1O3CA 4INLA 1MTNB 4WVPE 2ZC9H 3V13A 1UVUH 3M36A 3BIVH 3SOSA 2I6SA 4UFDH 1QR3E 1C5SA 4E7NA 1VGCC 2DE8A 4CBOA 1NESE 4A92A 2Y80A 1UCYE 4F49A 3LGTA 3Q76A 5CE1A 1MTSA 2F9VA 4K1SA 1M9UA 3BV9B 1HAPH 1P11E 3BSQA 3MO6A 2C3SA 3HGPA 3M37A 2TRMA 3ATIA 1MAYA 4SGBE 1Z1JA 3Q3YA 5EW2H 3RM0H 2PR3A 5JBBS 1Y3UA 4ZUHA 2AIPA 2FOHA 2H1UA 3GCHC 5LPEA 1NU7B 1GCTB 5C1YA 3A89A 1V3XA 3O8DA 4AOQA 1TBQH 1ZLRA 4UFEH 1NU9A 1K1MA 3A7TA 5HMAA 1P2KA 2CJIA 3SU4A 4B71A 1N6XA 3BG4C 3ZZDA 3ATWA 1CHOG 1GBKA 1SBWA 2GDDA 1W13U 2XNIA 2F9UA 3S9BA 1G3EA 1J17T 4NIYA 2VGCB 3K6ZA 1BTWA 5JYIA 1AU8A 4ZKNU 1TGNA 1SFIA 2XBXA 2FMJA 1C5ZB 2BTCE 2W26A 4Q7XA 3LGIA 1H8IH 4FUDA 5L30H 1LDTT 2W3KA 1FDPA 1UTOA 1KDQB 2FTMA 3LPRA 2PGBB 2FOCA 1HUTH 1UK4A 2F9NA 1GG6C 3SJIA 4B75A 1FY8E 1A5GH 1C2FA 2FIRH 5E8EH 2A2XH 1ACBE 1THRH 5H4IB 3PLKA 5C3NA 1DPOA 1GBBA 4TPIZ 4VGCC 1MCTA 1BA8B 1EJAA 4HI3A 1H1BA 1W14U 2VB0A 3RC4A 1DX5M 2CMYA 2TGTA 1O3AA 2AYWA 3QGJA 3VGCC 3ZVDA 2VIVA 5HYOA 3V3MA 2R3UA 4WXVA 1W11U 1ZTLA 1OSSA 3E1XB 4GHTA 3RXRA 4TWYA 3MFJA 3D65E 5LPFA 2ZTZA 2P8OB 1JBUH 2XW9A 3ZZAA 1GJ6A 2Y5GA 3ZZ3A 1O2YA 3UFAA 2A5KA 1GL0E 3SU1A 1S84A 1ZTJA 2P59A 3ATLA 4FVBA 1INCA 3ZZ6A 1BRAA 1SSXA 1HAVB 2BDGA 3UY9A 2ZFPH 3SV2H 1O5GH 1C5NH 4JZFH 4KELA 1Y5AT 1HB0B 1C1NA 4X6MA 1ESTA 2VIDA 2V3HH 5IYTA 1BITA 2AMPA 2HWLB 3RMOH 3A86A 1TNJA 2ZFFH 5DP7A 1HBTH 3A87A 4ZH8A 3RMMH 1V2RT 3H5CB 1EB1H 1FQ3A 3GDVA 1A7SA 1SG8B 1RJXB 2ZQ1A 1EPTC 1GBTA 4IW4E 4GCHG 1DWCH 3K9XB 1O5FH 1GHAG 1SQTA 3BTKE 1NM6A 5T6FA 1BTYA 1O3MA 1YPLH 1O2IA 4XDEA 1BCUH 1A0JA 2A4RA 4YLUA 3AASA 4IN2A 1VZQH 2Q6DA 1V2OT 2TGAA 3I77A 7GCHF 3RXIA 4CRFA 1HYLA 1AGJA 3IITA 1C1PA 2FTLE 2ZDLA 1LPKB 3TH2H 1P2MA 3RLYH 1AFQC 2FOBA 1ELTA 3SJ8A 1EATA 4TYDA 5A09A 2PKAA 3NCLA 3DA9B 1ETTH 3ZZ9A 1E37B 1UMAH 1CQQA 4X8VH 3MI4A 2PKSB 3H7OA 2EEKA 2FI3E 1O5EH 3MTYA 1K22H 3V7TA 1G9IE 3SJ9A 4K60A 2OC1A 2IOTA 1A5IA 2A7CA 1EPTA 1GJAB 2WPHS 1QGFA 2Q6GA 2OQUA 3RXDA 3RXLA 3S9AA 2O9QA 3SGBE 1E36B 4AGJA 1SLUB 3SUFA 2F9PA 2UUFB 4Y10E 5JBCS 3SV6A 2NU0E 4WMFA 1PPEE 2B7DH 3AAVA 1ZPZA 1QCPA 4O03A 4ABAA 2XC4A 1MBMA 2ILNA 1C5OH 1QA7A 2PFEA 1E34B 1A3BH 4WH8A 4ASHA 3BN9A 4MQAA 2A7HA 1VJ9U 3U8TH 1DS2E 5A8ZA 6GCHG 3CS7A 1CT2E 2Y5HA 3P95A 2H5CA 5DP8A 1O3KA 2NU4E 2HPPH 1EP6A 1RFNA 1SQOA 2ZDNA 4H6TA 1PYTC 3L33A 5DK1A 4ZHAA 3TVJB 2A0QB 1LO6A 1HJ8A 3VB5A 2AMQA 1SR5C 3LU9B 1Q31A 1LHGH 3QO6A 4K5ZA 4B2BA 5EQSA 4DGJA 1C1UH 1JRSA 4ISOA 3PO1B 1SGYE 4XBDA 2GZ9A 1EAXA 1CT4E 5GCHG 1JIMA 1WQVH 3UWIA 1AUTC 1ZMLA 2CN0H 2PHBA 2ZGHA 1IQHA 1LKBA 1AO5A 1N8OC 4MNWA 1GHBG 3EYDA 4NA8A 5BRRE 1MKWK 3LGUA 5SGAE 2VWLA 3RU4T 1ELAA 5AFYH 2D2DA 3O8RA 5DJ7A 3FZDA 1L4ZA 1P04A 4ABJA 1QURH 2A5IA 4X2YA 1MKXH 1A2CH 1A61H 1F5LA 3URCA 3TNSA 1MZDA 1SGFG 3KCGH 4INKA 5JBTA 4MNXA 2QXJA 2ODPA 1BB0B 1KLTA 3SI3H 1T32A 2WPKS 3MU0A 8GCHF 1HJ9A 1BMMH 2R3YA 1WTGH 1QJ7B 1SGRE 1YCPK 3TK5A 5C2ZA 1GJ5H 3VB7A 1C5TA 1L2EA 3U1IB 4UD9H 1C2IA 1DSUA 4ABHA 3RXPA 2VVUA 2GMTB 1MQ5A 3MOCA 4OS2A 1GWAA 1O37A 1QTFA 3KQEA 3U8RH 3PTBA 1TABE 1YC0A 1VR1H 4FU7A 4X6NA 1FY1A 2JH0D 4CR9A 1O5AB 1GBIA 2ULLA 2XYAA 2ZI2H 1ZR0A 1LHEH 2GCHF 4J2YB 4J1YA 2ZPRA 1P10A 3N7OA 4RKOB 1YPGH 2SGEE 3E3TA 1AVWA 1QJ1B 2GP9B 4AGKA 3DFJA 1WYKA 1FN8A 1ELCA 3ZVBA 2B9LA 1W7GH 1P03A 2O8MA 4KP0A 3UNSA 3BEFB 1MD8A 5E0HA 1SLWB 2BHGA 1BUIA 2ZGXH 2WPLS 2IPHA 1NRSH 5HM9A 1HXEH 3MO9A 4JCNA 4ISHH 4Q7YA 1SGFA 1O39A 1QL9A 1NRPH 2CGAA 1NROH 1TYNA 1QIXB 2FO9A 4ISIH 1KIGH 3E16B 3A7YA 4E7RG 3S7HB 2QIQA 5A8XA 2ZA5A 2WPJS 1TPOA 1TA6A 3A85A 3MWIU 1TALA 3LGVA 3RXMA 1VCWA 4ZHMU 3KQCA 1TNLA 2HVXA 4LK4A 1GBDA 1LHDH 2TIOA 9ESTA 2OBQA 2LNCA 3VB6A 4ABFA 1O3PB 4YM9A 4MG3A 1UVOA 2FDAA 2BLVA 1RXPA 1T31A 3OU0A 2RA3A 1S82A 1NO9H 1QHRB 3RXAA 1MTWA 2HPQH 1BJUA 1C1VH 1S6FA 1KXEA 1AB9C 2P94A 4JYVH 4AFQA 1Y5UT 1OWDA 1TX7A 3S7KB 1AI8H 5BPEA 1PQ7A 1EAWA 4DVAU 1P3EA 4NZQA
chains in the Genus database with same CATH superfamily
4BTUB 3RXVA 1NTPA 5FCKA 4Y0YE 2XCFA 3A7ZA 2O8LA 4THNH 1QL7A 5EPNA 1LPZB 5T6GA 3SO3A 4DJZB 5T6DA 1BT7A 1YLCA 2A2QH 2HVYB 3PMBB 4IBLH 4WH6A 1O3JA 4CRCA 5A0BA 2AERH 1P3CA 3QN7A 1L4DA 3GCHB 3PWCA 3ENSB 4YTAA 1NY22 1P09A 1MBQA 1ZSLA 1OWIA 1QRWA 2BY9X 5ETXA 1C2MA 2VIOA 1YM0A 3L3TA 7ESTE 1ZMJA 5AVDA 2WZQA 5F8ZA 2FPZA 4K8YA 3UNQA 1P2JA 1B7XB 4I8LA 2JIZD 2ZCHP 1XUIA 4X1SU 3DCLA 5CHAC 5A0AE 1DY8A 2IJD1 3JZ2B 3F1SB 3WY8A 1D3PB 2BD5A 4JZIA 1GI0A 2BY8X 5GXPA 1DSTA 4CRAA 4CBNA 1KMHB 1P0SH 4FUGA 5FHTA 8GCHG 2ZIQH 1NRRH 2SNVA 1YPHE 2QN5T 4NA7A 2H9HA 1SGCA 1GG6B 4CH2B 1GI9B 4Y0ZE 6ESTA 5K7RA 1LHCH 2AS9A 1KTSB 2VWOA 2AH4X 3T2NA 1O2GH 1GBJA 1ZRBA 1ZMNA 1GI6A 2G8TA 2ALPA 3UQVA 1BDAA 2PTNA 3PLBA 3PMHB 1EB2A 2GD4B 3PWBA 2O8TA 4KTSA 4K2YA 4HFPB 1FXYA 2ZTXA 2BDBA 2OQ5A 1N6YA 1O2XA 1BTZA 1IHSH 1QQUA 3S9CA 1O2KA 4DT7B 2GCHG 3BTME 2GV6A 1C5UA 1TGBA 4AYVB 3T29A 2THFB 1RTFB 4ABBA 1F0SA 5DP4A 3PRBA 1GHAF 1HJAC 1F5KU 1WSSH 2QE7D 4JYTA 3UWJH 1TPPA 1HXFH 4WMDA 1A4WH 4Y8ZA 2BVRH 2BY5X 2R0LA 4Q2KA 5FXLA 1K0HA 4WY3A 1HDTH 4AG1A 1IQEA 4Q7ZA 3A88A 1HAIH 4YOJA 1XVMA 4TPYA 1PPBH 2AEIH 2EC9H 2GCTC 3MNXA 3UIRA 4JZ1A 1FMGA 3PTNA 2V35A 1BTHH 1WOFA 2ANKH 2V3MA 5A8YA 4X6OA 3AW1A 4OS4A 2BDIA 2PKAB 2XNDD 3PROA 4DIHH 4XFQA 3SUDA 3TGIE 1HAOH 3BTWE 3ZVGA 1AKSB 1S0RA 2BD3A 2XC0A 3GY5A 1OOKB 1G3CA 3RC5A 1A46H 1BBRH 1O32A 3VB4A 3RXTA 1QRXA 4NWLA 1F7ZA 3SZNA 4B76A 1EPTB 2SNWA 3PYHA 2TPIZ 1O2TA 1ZZZA 1IQGA 2EI6A 2PP6A 3STJA 5CDFE 2YNBA 3P8GA 4FVDA 2HLCA 2BQWB 5LGOA 2GVFA 2JJ1D 4DG4A 1WUNH 3LJJA 1A1RA 1MH0A 2KCAA 2ZG0H 2NU1E 2J92A 1ARBA 1SMFE 4D7FA 3MHWU 2UWPA 3ODFA 1AFQB 1VCQA 3F9HA 4Q63A 2KCYA 1GHYH 5K0HA 3TGJE 2P16A 2ODYB 1ELBA 4ZKSU 1GJCB 3T62A 6GCHF 1TBRH 1G37A 1YBWA 1GBHA 4B74A 2BB4A 3NPSA 1FX0B 4YO9A 3TJNA 2JKHA 1IHTH 2KCOA 1J15A 1UJ1A 4K3JA 5DP3A 1GVKB 3D62A 3SHCH 1TRYA 4U32A 1BZXE 2DE9A 1HRTH 3G01A 1KSNA 2HNTC 3ZVFA 1IQMA 1NZQH 3ZZCA 1DUAA 1BMLA 1BMFD 4UONA 1T4VH 4FUHA 1O30A 1KXDA 1FAXA 1TGSZ 5EJLA 3GYLB 1ELDE 1HAHH 1XX9A 3C1KA 1C1OA 1XMNB 3GISB 4CRDA 1LHFH 3PV4A 1Z8JB 1ZJKA 2XBVA 4MPXA 1UTQA 1TE0A 3T5FH 2HNTE 2QC2A 3A84A 1V2TT 2Z9GA 1C2KA 1O36A 3ZV9A 4ZXYH 3ZZ7A 6CHAC 1GVZA 3RXOA 3R0FA 1ABJH 1GJ8B 1GI4A 5GCHF 1YKTA 1GGDC 1KYNA 2SGFE 2WYGA 3F3BA 1B0EA 1O3IA 1IAUA 1C2JA 1NBME 4OS7A 3TPIZ 4OGYA 2F91A 1GHBF 1OHHD 2ZFRH 2ZHWH 4X8TH 1AE5A 3P6ZB 3QK1A 2JETC 2FOAA 2Q1JA 1FJSA 2G81E 1HAXB 1B0FA 2A1DB 2XOKD 1J8AA 2XTTB 1IOEA 3PMAB 1EQ9A 1XKBC 4NWKA 5J4SA 2CF9H 4WXIA 2ANYA 2BM2A 2F9BH 1YGCH 1T7CA 3TU7H 1P2OA 2RDEA 3I29A 3F68H 1W2KH 1BRCE 4Y7BA 7KMEH 1ZGIA 1ETSH 3SU2A 1S0QA 1V2NT 2R0KA 1CE5A 1RGQA 5EPYA 2ZF0H 1HV7A 4YOIA 3SU6A 2QCYA 5C67A 2G5NA 4FUCA 3RM2H 3A82A 4NIVA 2VINA 3LOXA 3SGQE 3QWCH 8LPRA 1LKAA 4Z0KA 1LMWB 4Z6AH 1N8OB 2XCNA 2Z3EA 1QRZA 2G5VA 4DURA 1O2PA 3SORA 1MKXK 1XUGA 2FX6A 4FETA 4AG2A 2A32A 4Y76A 1QB1A 4TSFD 1OPHB 1OWEA 1YLNA 3M5MA 4D9RA 3OTPA 2Y7XA 1UTMA 2J9NA 3SGAE 3KGPA 3LONA 2BD8A 4R0IA 3M35A 1CSOE 4MTBA 1GBEA 1JWTA 1TB6H 3VPKA 2OC7A 2ZDAH 2F43B 4UEHH 1FI8A 2OUAA 3UAIC 1EXFA 2EI8A 4BNRA 2GT7A 1MUEB 1DFPA 1BRUP 1O34A 2V0BA 1GJBB 1UCYH 4NCYA 5DP5A 2PW8H 3SU0A 1K2I1 3DFLA 5JPMH 4NA9H 5F03A 5EXLA 3OAAD 2CHAC 1RIWB 1E1RD 1WBGB 1MMJN 2FODA 3K65B 3T25A 2ZFSA 1GJ9B 1Z6JH 4BAHB 4QT8C 3A7WA 1ZSJA 2AMDA 2RDLA 4BTTB 1F92A 4P02A 4PROA 3EAJA 2BYAX 1H9LB 2FXRA 1CHGA 1AIXH 1A3EH 2A4QA 2UWLA 4XSKU 3TLOA 2BDYA 1O3EA 2XWAA 1GJ7B 2ZHDA 1QZ8A 1SGIB 3A7XA 1GCTC 4ZKRU 3SNEA 1TRNA 1EZSC 2M2AA 1SB1H 3UTUH 2C8YB 1P06A 4IN1A 1GMCF 1QL8A 1KLJH 5GNDA 1GI2A 3AW0A 3FZZA 2Y5FA 4BAQB 2D8WA 3SW2B 2OC8A 4I8KA 1XXFA 4XBBA 1Q3XA 4X2WA 1C5MD 2PTCE 1C4U2 3DHKH 1DT2A 4ESTE 1TAWA 3NK8A 1C2HA 1QA0A 2Z94A 4DCDA 2STAE 1LCYA 1BMNH 1NRQH 5HIZA 2YOLA 1SFQB 3MH5A 1C5LH 1UW7A 1FV9A 2J95A 3S69A 4ZHLU 3RXSA 2A4GA 3GY2A 2WV5A 1E35B 1V2PT 5A0CA 1UTKA 1CBWC 1OXGA 3CNRA 1A0LA 1ANEA 1FPCH 2KAIA 3PV5A 1GDQA 1UK3A 5C5OA 3BIUH 3Q77A 1SGPE 1AY6H 1P2QA 3LDXH 4MVNA 1D3TB 1ELGA 1L1JA 2H2ZA 1O3BA 3LGYA 9LPRA 1ARCA 2OP9A 2V7QD 1Y3XA 1DUEA 2PGQB 3M5OA 4AX9H 1OYTH 3A8BA 2P3UB 3BTQE 3MNBA 3NXPA 4CH8B 4CREA 1SHYA 2ZU1A 1GCDA 4FXGH 4UFFH 3DD2H 4FUIA 2GJGA 1V2JT 2BLWA 2ODQA 1RTKA 1AVXA 4AZ2B 1SOZA 1NT1A 3RLWH 2W7UA 4BANB 1O2JA 1AB9B 1W3CA 1G3DA 1GL1A 4P00A 1KDQA 1NN6A 1WAYB 1O2OA 1O2RA 3SV9A 1GBLA 1GDNA 4X6PA 4A7IB 1HGTH 2JH5D 1L1NA 3P92A 2GDEH 2BX4A 1XUJA 1TMTH 3BTDE 2Z6BD 2C8XB 3MU5A 3M61U 2VVCA 3WWBA 1UVTH 2FESH 3NUMA 3NZIA 3R3GB 1A0HB 1YF4A 2RG3A 4A5TS 5IDKA 1S81A 1UTJA 1TWXB 2GTBA 4YOGA 1TMUH 2ZKSA 2ZHFH 1IQNA 3CP7A 2NWNA 1SC8U 5E2PA 2ZU3A 2ZEBA 2R9PA 3SNCA 5F8TA 1DLEA 1C9PA 4ASUD 2OBOA 2AFQB 3SJKA 4OS6A 5E2OA 1F0UA 3NWUA 2O8WA 5A2MH 1AMHA 3DT0H 2WYJA 3EA8A 4I31A 4O3UA 3VFEA 1LQEA 2C8WB 2WV4A 3V0XA 5B6OA 5C20A 4HG6A 3M7UA 1D6RA 1OWKA 4DT4A 2VJ1A 1PJPA 1S5SA 1TFXA 5CHAB 2G4TA 5JDUB 1TOMH 1HAVA 1P05A 2L74A 2SFAA 4Y71A 3HATH 2ALVA 3K2UA 1G2LA 5HM2A 1AZZA 1O3FA 2AIQA 2DUCA 1LQDB 2VVVA 2J98A 2RA0A 1GMHG 2BX3A 2SGQE 4U30A 3VB3A 1YWUA 5FPYA 4JK5A 2PKSC 1T8LA 5AHGH 4KTUA 1C5XB 4WWYA 1EAUA 4U2WA 1EOJA 2ZO3H 1K1PA 3OX7U 3W94A 1FAKH 1DM4B 1W8BH 1EFRD 2PUXB 1ZRKA 2OCVB 2ZU4A 2GZ7A 1XKAC 1BHXB 1DANH 2FI4E 4H42U 4ZKOU 2G52A 5TJXA 1OWJA 2C4FH 4TY7A 4X1RU 2QGRA 1C5VA 1KY9A 1Z1IA 1TIOA 1SGEE 4GLYA 3M3SA 5C17A 3FP7E 2W5EA 3OY5U 1CGIE 5EQQA 3M5NA 3Q00A 3O8CA 1O3LA 1GMCG 4CHAC 5L2YH 1HLTH 3LIWA 1EOLA 1CT0E 2FYRA 1EUFA 1TX8A 2VIPA 3NKKA 4GAWA 3M3TA 1DDJA 3KYGA 3SV7A 5GJ4B 2VU8E 1T8OA 1YYY1 5F8XA 4Y8YA 1PQAA 1GJDB 1ETRH 1JIRA 3LH1A 2BVXH 2J5UA 3M7QA 2OC0A 1W7XH 3FFGA 3MYWA 3HPTB 4BAMB 1HAZB 1TA2A 3FP8E 2TGPZ 1H8HD 1YLDA 4Y8XA 3ZYEA 1LVMA 2R2MB 1PPHE 2BZAA 2TBSA 3URDA 4DW2U 2ZU2A 1VGCB 4FUEA 2ZDKA 1LTOA 1OS8A 1BBRE 2WINI 3VXFH 1ID5H 3B23B 1O5DH 1P57B 3RUOA 3U8OH 5C1XA 1E1QD 3MMGA 3GY8A 4CRGA 4FUFA 1QB6A 1V2WT 3P8FA 5JBAS 3M3VA 3MQKC 1D4PB 1PPCE 1VKYA 1W0KD 1DICA 1HCGA 4B6FA 1QBNA 1O2SA 2PWXA 1ANCA 1MU8B 2PSXA 2Y7ZA 1XUKA 3RMLH 1SQRA 1MTVA 3ELAH 1O3DA 1TGTA 1VITG 1MKWH 2H5DA 1SL3A 1VCPA 2GGVB 4X8SH 1C4V2 1ZYOA 3IG6B 4JMYA 3HGNA 4F55A 4ABEA 2B0FA 1BIOA 3E6PH 1O2WA 4JYUH 2RCEA 3M5LA 1GBCA 4XD7D 1FN6A 3BG4B 4CRBA 4OM9A 3CENA 5EJZA 3U69H 2KCPA 4FU9A 2UUYA 1K1NA 3U9AH 3EE0B 2GV7A 1ORFA 2BXUH 1FIZA 1E0FD 1WQSA 2QF5A 5DGJA 1O2LA 4WMEA 1OX1A 2GMTC 2SGPE 2VWNA 4A6LA 3A7VA 4YLQH 1BMAA 3EA9A 2P3TB 1YCPH 3GCNA 3WW7A 3ATKA 1P01A 3D23A 3T27A 2VIQA 1D6WA 3IWMA 3LC5A 3ZVEA 1O2UA 1C1QA 1X7AC 1Q2WA 1EX3A 1DITH 1UTNA 1WU1A 1SVPA 1Z71A 6CHAB 5EOKA 3H09A 4NG9H 1OKXA 1ESAA 1O2MA 3PM3A 1UVPA 2ZWLH 1WV7H 1Y3YA 3QDZB 4VGCB 1F5RA 4I7YH 1N1LA 4JZEH 4X0WU 1GMDF 4HZHA 1S6HA 1TBZH 3VGCB 2J38A 1D9IA 4OS5A 4AFSA 2W7SA 1GHXH 3KNXA 1Z7KA 2QYIA 3GCOA 3MH4A 5F6MA 1OYQA 3PMJA 4MPUA 4R8TB 1ZHPA 2ANWA 2WUCA 1C9TA 1W0JD 3ODDA 5I25A 2WPDD 3BTFE 1Y3WA 3GY6A 4AB9A 1J14A 4O97A 1YCPM 4OGXA 1EJNA 1GVLA 3LC3A 2ZPQA 2YMSB 2FS9A 2J4IA 3UUZA 1EP5A 1O5BB 1P02A 1NRNH 4BXWA 1EAIA 2QF4A 2ZHQH 4RKJB 1EZQA 1B5GH 1V2UT 2EA3A 5GDSH 1AWHB 3TH4H 1V2ST 2UUKB 4GVUA 1HIAA 2OINA 3SNAA 1S85A 2P3FH 4BAOB 2H9EH 1NFWA 4MNYA 3TGKE 2XBYA 1YPKH 1QBOA 1JRTA 1ESBA 1XUFA 1YPMH 2BQ7B 5FPTA 3SHAH 3KIDU 2BQ6B 4KTCA 1UHBA 5EXNA 1SHHB 1YPJH 3M7TA 2A7JA 1GDUA 3AAUA 3BTHE 2B5TB 2F9OA 3PLPA 3RXUA 1C5PA 6LPRA 4FU8A 3RXFA 2PSYA 1P12E 4ZROA 8ESTE 5KECA 1UTPA 1KXBA 1HAYB 1O2HA 2ZGCA 1DWDH 3RMNH 1O35A 2ZP0H 5E0GA 1IQKA 1O3GA 2FP7B 3V12A 1AUJA 2BDHA 1F0TA 5G4BA 1TGCA 4UDWH 2BY6X 1O3NA 2CHAB 1P2IA 1TQ0B 2QXHA 3ZVAA 1G36A 1Z6EA 1FIWA 4MLFB 1FLEE 1F0RA 4Y7AA 2FYQA 4NFEA 2OD3B 1SQAA 1AD8H 1THPB 2FM2A 1O31A 3O8BA 2KAIB 1EZXC 5TCAA 3EA7A 3ZZ8A 1O3OA 1G32B 2F83A 1OP0A 2HALA 1H4WA 3QTVH 2OK5A 3T26A 1BTUA 4KGAA 1O2ZA 5T1VA 4AFZA 4E05H 5CMXH 3LH3A 3U1JB 2SGAA 1IQJA 1K1JA 1QB9A 1Z8RA 1KLIH 1PPFE 1QJ6B 2BLOA 1BRBE 3SU3A 3SNBA 1BTXA 1HAGE 2ANMH 4GHQA 2ZDVH 4BAKB 4WJG2 1CO7E 1VITH 2BD7A 3E90B 2EQNA 1C1RA 3GY3A 1CA0C 3AVZA 1TMBH 4DOQA 4IMZA 3RXQA 2EI7A 1P9UA 4A1XA 2IN2A 1TONA 1V2MT 3RU4E 3EGKH 1G3BA 2J94A 2UUJB 1FY3A 3NRLA 1CBWB 2BXTH 1AFEH 3A80A 1MQ6A 1SLXB 3RC6A 1RTLA 2H9TH 4D8NA 2BDAA 1SKYE 1KXCA 4BXSA 3MU1A 3GICB 2UWOA 5AFZH 3RXHA 5DG6A 1AVGH 1MD7A 2W6ID 4HTCH 4I8JA 4RT1A 1QBVH 4ACAA 3FANA 2BVSH 3EDXB 2AGEX 3RXBA 1K1LA 1ZSKA 2ASUB 3FKSD 1TRMA 1MAXA 2QAAA 4I33A 1FY5A 4RN6A 1Z8IB 3UPEA 3I78A 1KXFA 3SV8A 4X8UH 1C2LA 2ZNKH 5GPIB 1CU1A 1DLKB 1GMDG 3F9GA 3ZYDA 1O5CB 1YY3A 4YESB 2ZQ2A 2Z9KA 5PTPA 4XBCA 1QNJA 4O3TA 2CK3D 2FOMB 2J34A 1W12U 4LXBH 1RRKA 4RSPA 2QY0B 4GPGA 5EGMA 1GI1A 1GJ4H 1CVWH 3GS9A 1E38B 2ZHEH 1MZAA 2XBWA 1AN1E 1MTNC 1W10U 4FUJA 2BDCA 4H6SB 1CA8B 3FVFB 1GMHF 3UNRA 3RXJA 4AFUA 2ZTYA 4AN7A 1V2KT 1H8ED 1PPZA 1GI3A 3TJOA 3N99A 1GBMA 2R2WU 2XC5A 4NFFA 2GKVE 5DKMA 4NIWA 1PQ8A 3EE7A 3QLPH 2P93A 5C94A 5ESBA 3RP2A 2V3OH 4GSOA 3ITIA 3DSGA 2WUBA 3SQHE 1PQ5A 3QZRA 3DSOA 3E8LA 1O38A 5B6LA 3OY6U 2WHXA 3SUGA 4UFGH 1HPGA 1BTPA 5GIBA 2ZECA 1UK2A 1S83A 5HKKD 1C1TA 1DXWA 2PV9B 1AE8H 2QA9E 4K8BA 5HGGA 1LPGB 3ZZ4A 1AKSA 2LP6A 1K21H 3MH6A 3PRDA 1DWBH 1OP2A 3QX5H 7LPRA 1XXDA 1QQ4A 5LH8A 1C5YB 4X1QU 4INHA 2VGCC 2P95A 2Z9IA 1C5WB 5HIYA 3OFND 1FUJA 1GBFA 4X1NU 1Y8TA 2BD4A 4YZUA 1DWEH 3K6YA 1Y5BT 1C1WH 2FOGA 1WCZA 3E0PB 1E79D 2XXLA 1O2VA 3ZZBA 1NS3A 1T8NA 4NZLA 4D76A 1BQYA 4KKDA 1CGJE 1NBMD 1Y59T 3AK5A 1SOTA 3RU4D 1K1OA 4I8GA 3SU5A 3SUEA 3QZQA 1ELEE 1O33A 4A1TA 1V2QT 4IC5A 2Z3CA 3LJOA 4D9QA 4CHAB 1TQ7B 1THSH 3RXEA 1CGHA 5JB9S 1YP9A 1C2EA 3KYFA 3BF6H 4TWWA 2VWMA 1WDIA 1D3QB 1O2NA 1H9HE 1FNIA 4XRNA 2ZCKP 2A45B 3RXGA 3KF2A 1SI5H 1OP8A 1V6DA 1ELFA 3GY4A 2P8OC 5ABWA 3GCTF 5EG4A 1VITF 2QF0A 2FS8A 3B8JA 2M5TA 1K9OE 4FUBA 5C0UA 4DIIH 2A31A 4O9VA 1AHTH 4X2XA 2YMSD 5DP6A 2A5AA 2G55A 1FPHH 2TGDA 3BTGE 2QXGA 4MDSA 1LVBA 2G51A 2F3CE 5DN6D 3KHVA 3UQOA 5FBIA 1H8DH 1AWFH 2C93B 1K28D 2D1JA 2XRCA 1V2LT 1RD3B 4B2CA 3HK6B 1J9CH 2FI5E 3H7TA 3RXKA 2HLDD 2Y82A 2KX4A 4Y6DA 4XOJA 2FLBH 4DY7B 1WTHD 1H9IE 5C1UA 3GDUA 1TNIA 1BOQA 1LVYA 2V6NA 5HXFA 4U01A 1AZ8A 1TPAE 3UR9A 1NPMA 2C90B 4K69A 1C2GA 1XVOA 3MNCA 3E91A 1BHXF 2WPIS 3QTOH 4RI0A 2VH6A 3E0NB 3OEED 4WF8A 4AB8A 3GDSA 1S6LA 4Q80A 2IJOB 3KN2A 3A8AA 4GUXA 2W3IA 5TCCA 3T28A 3SJOA 5E0JA 3RXCA 1OWHA 1DE7H 1P2NA 3TITA 3HKIB 2ZU5A 2VH0A 3P17H 1RIWC 3VXEH 1C2DA 3U28C 1PPGE 1F2SE 2VIWA 3UOUA 2FOFA 2XWBI 1ZJDA 3QGNB 2LPRA 1K1IA 4JZDH 2Q6FA 3TJVA 2GX4A 2Z7FE 5EODA 3EQ0H 4F48B 2YNAA 1SGNE 3BTEE 1ABIH 4JK6A 1UVSH 3FN8A 3A8DA 2NU3E 2D26C 2Z9LA 2OLGA 2NU2E 1LVOA 4YXWD 4ABDA 4B1TA 1SGTA 2FEQH 1UO6A 4YT7H 2Z3DA 2FX4A 1HIAB 1FONA 1P9SA 4M7GA 4NIXA 3GYMA 3SN8A 2ZGBH 5T3HA 3P70B 3F6UH 2CF8H 2G00A 1QFKH 7GCHG 3F2GA 1UHBB 2QV1A 1IQLA 3L6PA 3VEQB 4A1VA 2BLQA 1U6QA 3FAOA 1ZPBA 4UE7H 3F2FA 3UR6A 3ATMA 5FAHA 1C5RA 2JJ2D 3UREA 2BD9A 2FLRH 1GI5A 4F4OC 1HJAB 4ZAEA 5L2ZH 2AGGX 1GHVH 5AF9H 1SGQE 4B2AA 5FCRA 2H6MA 1KXAA 3OTJE 4K1TA 3LKWA 4X1PU 2QF3A 3QUMP 1BJVA 2GCTB 1G30B 1V2VT 2QXIA 3W1EA 4CR5A 2F4LA 1PYTD 3SI4H 1GBAA 2AHME 4B73A 1BBRK 2JH6D 2OXSA 5DSFA 3BEIB 3ZVCA 1HFDA 3CS0A 3Q3XA 1ZPCA 1ZOMA 4H4FA 5ESTE 1Z8GA 1ANDA 4BTIB 1O2QA 3ZZ5A 3MO3A 2AGIX 1XUHA 2FWWA 3OEHD 3OE7D 3PO1C 2HNTF 2CXVA 4NSYA 1J16A 3TK9A 1TNKA 4K1EA 4B6EA 3BEUA 4IMQA 1ANBA 2GT8A 1EKBB 3DUXH 1T8MA 2BMGB 2Y81A 3KQBA 5EU8A 3C27B 5DPAA 3MU4A 1O0DH 4ABIA 3KEEA 4Z1MD 2K1QA 3HK3B 5DO4H 3OSYA 2O8UA 2Y6TA 3ZV8A 3MNSA 3SQEE 1YPEH 2HGTH 3F9FA 3SBKA 2J2UA 3LT3A 2FOEA 4LZ4B 1CHOF 1MCVA 4ZCNA 1ELVA 3BTTE 4AYYB 1DY9A 1VJAU 4MNVA 1EJMA 3FOAA 3GCTG 4LZ1H 3STIA 3FP6E 1JOUB 1HNEE 2STBE 3BG8A 2SGDE 1TLDA 3TIUA 3RDZA 1L1GA 2ZPSA 1FY4A 1GI7B 4M9FA 1P8VC 4TT3D 2CV3A 1TNHA 1ZHMA 2GZ8A 2PLXA 2BZ6H 2HOBA 1IQFA 1JMOH 1MABB 3P8OA 5JB8S 3MH7A 4XE4A 1XM1A 5FX5A 2ZDMA 3MU8A 1C4Y2 2G4UA 1UTLM 1ZGVA 2K0QA 1NC6A 2K8IA 1KTTB 1T4UH 3P8NA 1MU6B 4MPWA 2HRVA 1TNGA 2J97A 2PUQH 3SNDA 3TNTA 4SGAE 1NFUA 3ZIAD 4E06H 4I8HA 1DOJA 5F53A 2B8OH 1W0YH 1YPHC 1O3HA 4Y79A 2OTVA 3PB1E 2I6QA 5FX6A 3UOPA 2VNTA 3OYPA 2BOKA 1JXPA 1TOCB 1CA0B 1ZHRA 4AORA 4TY6A 1GGDB 4IS5A 5L6NH 1C5QA 4IC6A 4HGCA 4IGDA 3Q3KA 4ABGA 3GY7A 4X2VA 1IQIA 1RS0A 2A4OA 1C1MA 3N7DA 5EXMA 2BOHB 3A81A 1FZZA 1GHZA 3GOVB 1PFXC 1Y3VA 2JETB 5J4QA 1SLVB 2WPMS 3KL6A 5LPRA 1GHWH 2Z9JA 2BD2A 4D7GA 2C8ZB 3A83A 1ZTKA 2ZFTA 3HKJB 3D49H 5FPSA 3F9EA 3U98H 2ZGJA 3TK6A 1TX6A 1NFYA 1NFXA 1L0ZA 1MTUA 5DP9A 1QY6A 5FBEA 4ISNA 1DXPA 3KQDA 5GWZA 3LGWA 3JZ1B 4YT6H 3ESTA 1DVAH 4ZXXH 5I46H 1A5HA 1C1SA 1EZUC 4NSVA 1GI8B 3W95A 2BY7X 5EQRA 2ZFQH 8KME2 4OS1A 1D3DB 1W0ZU 4GCHF 5C5NA 3A8CA 1G2MA 2ESTE 4Q4LA 1EASA 3B9FH 4BOHA 3TJUA 4NGAH 1GPZA 1AQ7A 3S0NA 4Y11E 4I32A 1SPJA 4LOYH 2FZZA 2ZZUH 1SGDE 1TPSA 3TH3H 4ZMAH 2WV9A 4ISLA 4MPVA 5CHBA 5EW1H 1UCYK 2ZCLP 1O3CA 4INLA 1MTNB 4WVPE 2ZC9H 3V13A 1UVUH 3M36A 3BIVH 3SOSA 2I6SA 4UFDH 1QR3E 1C5SA 3F2HA 4E7NA 1VGCC 2DE8A 4CBOA 1NESE 4A92A 2Y80A 1UCYE 4F49A 3LGTA 3Q76A 5CE1A 1MTSA 2F9VA 4K1SA 1M9UA 3BV9B 1HAPH 1P11E 3BSQA 3MO6A 2C3SA 3F0OA 3HGPA 2KR7A 3M37A 2TRMA 3ATIA 1MAYA 4SGBE 1Z1JA 3Q3YA 5EW2H 3RM0H 2PR3A 5JBBS 1Y3UA 4ZUHA 2AIPA 2FOHA 2H1UA 3GCHC 5LPEA 3DSPA 1NU7B 1GCTB 5C1YA 3VG8A 3A89A 1V3XA 3O8DA 4AOQA 1TBQH 1ZLRA 4UFEH 1NU9A 1K1MA 3A7TA 5HMAA 1P2KA 5EJ1A 2CJIA 3SU4A 4B71A 1N6XA 3BG4C 3ZZDA 3ATWA 1CHOG 1GBKA 1SBWA 2GDDA 1W13U 2XNIA 2F9UA 3S9BA 1G3EA 1J17T 4NIYA 2VGCB 3K6ZA 1BTWA 5JYIA 1AU8A 4ZKNU 1TGNA 1SFIA 2XBXA 2FMJA 1C5ZB 2BTCE 2W26A 4Q7XA 3LGIA 1H8IH 4FUDA 5L30H 1WXRA 1LDTT 2W3KA 1FDPA 1UTOA 1KDQB 2FTMA 3LPRA 2PGBB 2FOCA 1HUTH 1UK4A 2F9NA 1GG6C 3SJIA 4B75A 1FY8E 1A5GH 1C2FA 2FIRH 5E8EH 2A2XH 1ACBE 1THRH 5H4IB 3PLKA 5C3NA 1DPOA 1GBBA 4TPIZ 4VGCC 3SZEA 4AC9A 1MCTA 1BA8B 1EJAA 4HI3A 1H1BA 1W14U 2VB0A 3RC4A 1DX5M 2CMYA 2TGTA 1O3AA 2AYWA 3QGJA 3VGCC 3ZVDA 2VIVA 5HYOA 3V3MA 2R3UA 4WXVA 1W11U 1ZTLA 1OSSA 3E1XB 4GHTA 3RXRA 4TWYA 3MFJA 3D65E 5LPFA 2ZTZA 2P8OB 1JBUH 2XW9A 3ZZAA 1GJ6A 2Y5GA 3ZZ3A 5EIYA 2YMSC 1O2YA 3UFAA 2JDID 2A5KA 1GL0E 3SU1A 1S84A 1ZTJA 2P59A 3ATLA 4FVBA 1INCA 3ZZ6A 1BRAA 1SSXA 1HAVB 2BDGA 3UY9A 2ZFPH 3SV2H 1O5GH 1C5NH 4JZFH 4KELA 1Y5AT 1HB0B 1C1NA 4X6MA 2J98B 2EY4C 1ESTA 2VIDA 2V3HH 5IYTA 1BITA 2AMPA 2HWLB 3RMOH 3A86A 1TNJA 2ZFFH 5DP7A 1HBTH 3A87A 4ZH8A 3RMMH 1V2RT 3H5CB 1EB1H 1FQ3A 3GDVA 1A7SA 1SG8B 1RJXB 2ZQ1A 1EPTC 1GBTA 4IW4E 5FL7D 4GCHG 2KZ4A 1DWCH 3K9XB 1O5FH 1GHAG 1SQTA 3BTKE 1NM6A 5T6FA 1BTYA 1O3MA 1YPLH 2VBCA 1O2IA 4XDEA 1BCUH 1A0JA 2A4RA 4YLUA 3AASA 4IN2A 1VZQH 2Q6DA 1V2OT 2TGAA 3I77A 7GCHF 3RXIA 4CRFA 1HYLA 1AGJA 3IITA 1C1PA 2FTLE 2ZDLA 1LPKB 3TH2H 1P2MA 4FOUC 3RLYH 1AFQC 2FOBA 1ELTA 3SJ8A 1EATA 4TYDA 5A09A 2PKAA 3NCLA 3DA9B 2KM0A 1ETTH 3ZZ9A 1E37B 1UMAH 2LELA 1CQQA 4X8VH 3MI4A 2PKSB 3H7OA 3SYJA 2EEKA 2FI3E 4ACBA 1O5EH 3MTYA 1K22H 3V7TA 1G9IE 3SJ9A 4K60A 2OC1A 2IOTA 1A5IA 2A7CA 1EPTA 1GJAB 2WPHS 1QGFA 2Q6GA 2OQUA 3RXDA 3RXLA 3S9AA 2O9QA 3SGBE 1E36B 4AGJA 1SLUB 3SUFA 2F9PA 2UUFB 4Y10E 5JBCS 3SV6A 2NU0E 4WMFA 1PPEE 2B7DH 3AAVA 1ZPZA 1QCPA 4O03A 4ABAA 2XC4A 1MBMA 2ILNA 1C5OH 1QA7A 2PFEA 1E34B 1A3BH 4WH8A 4ASHA 3BN9A 4MQAA 2A7HA 1VJ9U 3U8TH 1DS2E 5A8ZA 6GCHG 3CS7A 1CT2E 2Y5HA 3P95A 2H5CA 5DP8A 1O3KA 2NU4E 2HPPH 1EP6A 1RFNA 1SQOA 2ZDNA 4H6TA 1PYTC 3L33A 5DK1A 4ZHAA 3TVJB 2A0QB 1LO6A 1HJ8A 5KEDA 3F0PA 3VB5A 2AMQA 1SR5C 3LU9B 1Q31A 1LHGH 3QO6A 4K5ZA 4B2BA 5EQSA 4DGJA 1C1UH 1JRSA 4ISOA 3PO1B 1SGYE 4XBDA 2GZ9A 1EAXA 1CT4E 5GCHG 1JIMA 1WQVH 3UWIA 1AUTC 1ZMLA 2CN0H 2PHBA 2ZGHA 1IQHA 1LKBA 1AO5A 1N8OC 4MNWA 1GHBG 3EYDA 4NA8A 5BRRE 1MKWK 5KGOA 3LGUA 5SGAE 2VWLA 3RU4T 1ELAA 5AFYH 2D2DA 3O8RA 5DJ7A 3FZDA 1L4ZA 1P04A 3N7EA 4ABJA 1QURH 2A5IA 3WWFA 5C0TA 4X2YA 1MKXH 1A2CH 1A61H 1F5LA 3URCA 3TNSA 1MZDA 1SGFG 3KCGH 4INKA 4RT0A 4MNXA 5JBTA 2QXJA 2ODPA 1BB0B 1KLTA 3SI3H 1T32A 2WPKS 3MU0A 8GCHF 2RFKC 1HJ9A 1BMMH 2R3YA 1WTGH 1QJ7B 1SGRE 1YCPK 3TK5A 5C2ZA 1GJ5H 3VB7A 2W6JD 1C5TA 1L2EA 3U1IB 4UD9H 1C2IA 1DSUA 4ABHA 3RXPA 2VVUA 2GMTB 1MQ5A 3MOCA 4OS2A 1GWAA 1O37A 3KQ5A 1QTFA 3KQEA 3PV2A 3U8RH 3PTBA 1TABE 1YC0A 1VR1H 4FU7A 4X6NA 1FY1A 2JH0D 4CR9A 1O5AB 3UB0A 1GBIA 2ULLA 2XYAA 2ZI2H 2KFWA 1ZR0A 1LHEH 2GCHF 4J2YB 4J1YA 2ZPRA 1P10A 3N7OA 4RKOB 1YPGH 2SGEE 3E3TA 1AVWA 2IPQX 2GP9B 1QJ1B 4AGKA 3DFJA 1WYKA 1FN8A 1ELCA 3ZVBA 2B9LA 1W7GH 1P03A 2O8MA 4KP0A 3UNSA 3BEFB 1MD8A 5E0HA 1SLWB 2BHGA 1BUIA 2ZGXH 2WPLS 2IPHA 1NRSH 5IK2D 5HM9A 3FO8D 1HXEH 3MO9A 4JCNA 4ISHH 4Q7YA 1SGFA 1O39A 1QL9A 1NRPH 2CGAA 1NROH 1TYNA 1QIXB 2FO9A 4ISIH 1KIGH 3E16B 3A7YA 4E7RG 3S7HB 2QIQA 5A8XA 2ZA5A 2WPJS 1TPOA 1TA6A 3A85A 3MWIU 1TALA 3LGVA 3RXMA 1VCWA 4ZHMU 3KQCA 1TNLA 1COWD 2HVXA 4LK4A 4I86A 1GBDA 1LHDH 2TIOA 2WSSD 9ESTA 2OBQA 2LNCA 3VB6A 4ABFA 1O3PB 4YM9A 4MG3A 1UVOA 2L6OA 2FDAA 2BLVA 1RXPA 1T31A 3OU0A 2RA3A 1S82A 1NO9H 1QHRB 3RXAA 1MTWA 2HPQH 1BJUA 1C1VH 1S6FA 1KXEA 1AB9C 2P94A 4JYVH 4AFQA 1Y5UT 1OWDA 1TX7A 3S7KB 1AI8H 5BPEA 1PQ7A 1EAWA 4DVAU 1P3EA 4NZQA
chains in the Genus database with same CATH topology
4BTUB 3RXVA 1NTPA 5FCKA 4Y0YE 2XCFA 3A7ZA 2O8LA 4THNH 1QL7A 5EPNA 1LPZB 5T6GA 3SO3A 4DJZB 5T6DA 1BT7A 1YLCA 2A2QH 3PMBB 4IBLH 4WH6A 1O3JA 4CRCA 5A0BA 2AERH 1P3CA 3QN7A 1L4DA 3GCHB 3PWCA 3ENSB 4YTAA 1NY22 1P09A 1MBQA 1ZSLA 1OWIA 1QRWA 2BY9X 5ETXA 1C2MA 2VIOA 1YM0A 3L3TA 7ESTE 1ZMJA 5AVDA 5F8ZA 2FPZA 4K8YA 3UNQA 1P2JA 1B7XB 4I8LA 2ZCHP 1XUIA 4X1SU 5CHAC 5A0AE 1DY8A 3JZ2B 3F1SB 3WY8A 1D3PB 2BD5A 4JZIA 1GI0A 2BY8X 5GXPA 1DSTA 4CRAA 4CBNA 1P0SH 4FUGA 5FHTA 8GCHG 2ZIQH 1NRRH 2SNVA 1YPHE 2QN5T 4NA7A 2H9HA 1SGCA 1GG6B 4CH2B 1GI9B 4Y0ZE 6ESTA 5K7RA 1LHCH 2AS9A 1KTSB 2VWOA 2AH4X 3T2NA 1O2GH 1GBJA 1ZRBA 1ZMNA 1GI6A 2G8TA 2ALPA 3UQVA 1BDAA 2PTNA 3PLBA 3PMHB 1EB2A 2GD4B 3PWBA 2O8TA 4KTSA 4K2YA 4HFPB 1FXYA 2ZTXA 2BDBA 2OQ5A 1N6YA 1O2XA 1BTZA 1IHSH 1QQUA 3S9CA 1O2KA 4DT7B 2GCHG 3BTME 2GV6A 1C5UA 1TGBA 4AYVB 3T29A 2THFB 1RTFB 4ABBA 1F0SA 5DP4A 1GHAF 1HJAC 1F5KU 1WSSH 4JYTA 3UWJH 1TPPA 1HXFH 4WMDA 1A4WH 4Y8ZA 2BVRH 2BY5X 2R0LA 4Q2KA 5FXLA 4WY3A 1HDTH 4AG1A 1IQEA 4Q7ZA 3A88A 1HAIH 4YOJA 1XVMA 4TPYA 1PPBH 2AEIH 2EC9H 2GCTC 3MNXA 3UIRA 4JZ1A 1FMGA 3PTNA 2V35A 1BTHH 1WOFA 2ANKH 5A8YA 4X6OA 3AW1A 4OS4A 2BDIA 2PKAB 3PROA 4DIHH 4XFQA 3SUDA 3TGIE 1HAOH 3BTWE 3ZVGA 1AKSB 1S0RA 2BD3A 2XC0A 3GY5A 1OOKB 1G3CA 3RC5A 1A46H 1BBRH 1O32A 3VB4A 3RXTA 1QRXA 4NWLA 1F7ZA 3SZNA 4B76A 1EPTB 2SNWA 3PYHA 2TPIZ 1O2TA 1ZZZA 1IQGA 2EI6A 3STJA 2YNBA 3P8GA 4FVDA 2HLCA 2BQWB 5LGOA 2GVFA 4DG4A 1WUNH 3LJJA 1A1RA 1MH0A 2ZG0H 2NU1E 2J92A 1ARBA 1SMFE 4D7FA 3MHWU 2UWPA 3ODFA 1AFQB 1VCQA 3F9HA 5K0HA 1GHYH 3TGJE 2P16A 2ODYB 1ELBA 4ZKSU 1GJCB 3T62A 6GCHF 1TBRH 1G37A 1YBWA 1GBHA 4B74A 2BB4A 3NPSA 4YO9A 3TJNA 2JKHA 1IHTH 1J15A 1UJ1A 4K3JA 5DP3A 1GVKB 3D62A 3SHCH 1TRYA 4U32A 1BZXE 2DE9A 1HRTH 3G01A 1KSNA 2HNTC 3ZVFA 1IQMA 1NZQH 3ZZCA 1DUAA 1BMLA 4UONA 1T4VH 4FUHA 1O30A 1KXDA 1FAXA 1TGSZ 3GYLB 1ELDE 1HAHH 1XX9A 3C1KA 1C1OA 1XMNB 3GISB 4CRDA 1LHFH 3PV4A 1Z8JB 1ZJKA 2XBVA 4MPXA 1UTQA 1TE0A 3T5FH 2HNTE 2QC2A 3A84A 1V2TT 2Z9GA 1C2KA 1O36A 3ZV9A 4ZXYH 3ZZ7A 6CHAC 1GVZA 3RXOA 3R0FA 1ABJH 1GJ8B 1GI4A 5GCHF 1YKTA 1GGDC 1KYNA 2SGFE 2WYGA 1B0EA 1O3IA 1IAUA 1C2JA 4OS7A 3TPIZ 4OGYA 2F91A 1GHBF 2ZFRH 2ZHWH 4X8TH 1AE5A 3P6ZB 3QK1A 2JETC 2FOAA 2Q1JA 1FJSA 2G81E 1HAXB 1B0FA 2A1DB 1J8AA 2XTTB 1IOEA 3PMAB 1EQ9A 1XKBC 4NWKA 5J4SA 2CF9H 4WXIA 2ANYA 2BM2A 2F9BH 1YGCH 1T7CA 3TU7H 1P2OA 3I29A 3F68H 1W2KH 1BRCE 4Y7BA 7KMEH 1ZGIA 1ETSH 3SU2A 1S0QA 1V2NT 2R0KA 1CE5A 1RGQA 5EPYA 2ZF0H 1HV7A 4YOIA 3SU6A 2QCYA 5C67A 2G5NA 4FUCA 3RM2H 3A82A 4NIVA 2VINA 3LOXA 3SGQE 3QWCH 8LPRA 1LKAA 4Z0KA 1LMWB 4Z6AH 1N8OB 2XCNA 2Z3EA 1QRZA 2G5VA 4DURA 1O2PA 3SORA 1MKXK 1XUGA 2FX6A 4AG2A 2A32A 4Y76A 1QB1A 1OPHB 1OWEA 3M5MA 4D9RA 2Y7XA 1UTMA 2J9NA 3SGAE 3KGPA 3LONA 2BD8A 4R0IA 3M35A 1CSOE 4MTBA 1GBEA 1JWTA 1TB6H 3VPKA 2OC7A 2ZDAH 4UEHH 1FI8A 2OUAA 4BNRA 1EXFA 2EI8A 2GT7A 1MUEB 1DFPA 1BRUP 1O34A 2V0BA 1GJBB 1UCYH 4NCYA 5DP5A 2PW8H 3SU0A 1K2I1 3DFLA 5JPMH 4NA9H 5F03A 5EXLA 2CHAC 1RIWB 1WBGB 3T25A 1MMJN 2FODA 3K65B 2ZFSA 1GJ9B 1Z6JH 4BAHB 4QT8C 3A7WA 1ZSJA 2AMDA 2RDLA 4BTTB 1F92A 4PROA 3EAJA 2BYAX 1H9LB 2FXRA 1CHGA 1AIXH 1A3EH 2A4QA 2UWLA 4XSKU 3TLOA 2BDYA 1O3EA 2XWAA 1GJ7B 2ZHDA 1SGIB 3A7XA 1GCTC 4ZKRU 3SNEA 1TRNA 1EZSC 1SB1H 3UTUH 2C8YB 1P06A 4IN1A 1GMCF 1QL8A 1KLJH 1GI2A 3AW0A 3FZZA 2Y5FA 4BAQB 2D8WA 3SW2B 2OC8A 4I8KA 1XXFA 4XBBA 1Q3XA 4X2WA 1C5MD 2PTCE 1C4U2 3DHKH 1DT2A 4ESTE 1TAWA 3NK8A 1C2HA 1QA0A 2Z94A 4DCDA 2STAE 1LCYA 1BMNH 1NRQH 2YOLA 1SFQB 3MH5A 1C5LH 1FV9A 2J95A 3S69A 4ZHLU 3RXSA 2A4GA 3GY2A 2WV5A 1E35B 1V2PT 5A0CA 1UTKA 1CBWC 1OXGA 1A0LA 1ANEA 1FPCH 2KAIA 1GDQA 1UK3A 5C5OA 3BIUH 3Q77A 1SGPE 1AY6H 1P2QA 3LDXH 4MVNA 1D3TB 1ELGA 1L1JA 2H2ZA 1O3BA 3LGYA 9LPRA 1ARCA 2OP9A 3M5OA 1Y3XA 1DUEA 2PGQB 4AX9H 1OYTH 3A8BA 2P3UB 3BTQE 3MNBA 3NXPA 4CH8B 4CREA 1SHYA 2ZU1A 1GCDA 4FXGH 4UFFH 3DD2H 4FUIA 1V2JT 2BLWA 2ODQA 1RTKA 1AVXA 4AZ2B 1SOZA 1NT1A 3RLWH 2W7UA 4BANB 1O2JA 1AB9B 1W3CA 1G3DA 1GL1A 1KDQA 1NN6A 1WAYB 1O2OA 1O2RA 3SV9A 1GBLA 1GDNA 4X6PA 4A7IB 1HGTH 2JH5D 1L1NA 3P92A 2GDEH 2BX4A 1XUJA 1TMTH 3BTDE 2Z6BD 2C8XB 3MU5A 3M61U 2VVCA 1UVTH 2FESH 3NUMA 3NZIA 3R3GB 1A0HB 1YF4A 2RG3A 4A5TS 5IDKA 1S81A 1UTJA 1TWXB 2GTBA 4YOGA 1TMUH 2ZKSA 2ZHFH 1IQNA 3CP7A 2NWNA 1SC8U 5E2PA 2ZU3A 2ZEBA 2R9PA 3SNCA 5F8TA 1DLEA 1C9PA 2OBOA 2AFQB 3SJKA 4OS6A 5E2OA 1F0UA 3NWUA 2O8WA 5A2MH 1AMHA 3DT0H 2WYJA 3EA8A 4I31A 4O3UA 3VFEA 1LQEA 2C8WB 2WV4A 3V0XA 5B6OA 5C20A 3M7UA 1D6RA 1OWKA 2VJ1A 1PJPA 1S5SA 1TFXA 5CHAB 2G4TA 5JDUB 1TOMH 1HAVA 1P05A 2SFAA 4Y71A 3HATH 2ALVA 3K2UA 1G2LA 5HM2A 1AZZA 1O3FA 2AIQA 2DUCA 1LQDB 2VVVA 2RA0A 1GMHG 2BX3A 2SGQE 4U30A 3VB3A 5FPYA 4JK5A 2PKSC 1T8LA 5AHGH 4KTUA 1C5XB 4WWYA 1EAUA 4U2WA 1EOJA 2ZO3H 1K1PA 3OX7U 3W94A 1FAKH 1DM4B 1W8BH 2PUXB 1ZRKA 2OCVB 2ZU4A 2GZ7A 1XKAC 1BHXB 1DANH 2FI4E 4H42U 4ZKOU 2G52A 5TJXA 1OWJA 2C4FH 4TY7A 4X1RU 2QGRA 1C5VA 1KY9A 1Z1IA 1TIOA 1SGEE 4GLYA 3M3SA 3FP7E 2W5EA 3OY5U 1CGIE 5EQQA 3M5NA 3Q00A 3O8CA 1O3LA 1GMCG 4CHAC 5L2YH 1HLTH 3LIWA 1EOLA 1CT0E 2FYRA 1EUFA 1TX8A 2VIPA 3NKKA 4GAWA 3M3TA 1DDJA 3SV7A 5GJ4B 2VU8E 1T8OA 1YYY1 5F8XA 4Y8YA 1PQAA 1GJDB 1ETRH 1JIRA 3LH1A 2BVXH 3M7QA 2OC0A 1W7XH 3FFGA 3MYWA 3HPTB 4BAMB 1HAZB 1TA2A 3FP8E 2TGPZ 1YLDA 3ZYEA 4Y8XA 1LVMA 2R2MB 1PPHE 2BZAA 2TBSA 3URDA 4DW2U 2ZU2A 1VGCB 4FUEA 2ZDKA 1LTOA 1OS8A 1BBRE 2WINI 3VXFH 1ID5H 3B23B 1O5DH 1P57B 3RUOA 3U8OH 5C1XA 3MMGA 3GY8A 4CRGA 4FUFA 1QB6A 1V2WT 3P8FA 5JBAS 3M3VA 1D4PB 1PPCE 1DICA 1HCGA 1QBNA 1O2SA 2PWXA 1ANCA 1MU8B 2PSXA 2Y7ZA 1XUKA 3RMLH 1MTVA 3ELAH 1O3DA 1TGTA 1VITG 1MKWH 2H5DA 1SL3A 1VCPA 2GGVB 4X8SH 1C4V2 1ZYOA 3IG6B 4JMYA 3HGNA 4ABEA 2B0FA 1BIOA 3E6PH 1O2WA 4JYUH 2RCEA 3M5LA 1GBCA 1FN6A 3BG4B 4CRBA 3CENA 3U69H 4FU9A 2UUYA 1K1NA 3U9AH 3EE0B 2GV7A 1ORFA 2BXUH 1FIZA 1E0FD 1WQSA 5DGJA 1O2LA 4WMEA 1OX1A 2GMTC 2SGPE 2VWNA 4A6LA 3A7VA 4YLQH 1BMAA 3EA9A 2P3TB 1YCPH 3GCNA 3ATKA 1P01A 3D23A 3T27A 2VIQA 1D6WA 3IWMA 3LC5A 3ZVEA 1O2UA 1C1QA 1X7AC 1Q2WA 1EX3A 1DITH 1UTNA 1WU1A 1SVPA 1Z71A 6CHAB 5EOKA 4NG9H 1OKXA 1ESAA 1O2MA 3PM3A 1UVPA 2ZWLH 1WV7H 1Y3YA 3QDZB 4VGCB 1F5RA 4I7YH 1N1LA 4JZEH 4X0WU 1GMDF 4HZHA 1S6HA 1TBZH 3VGCB 2J38A 1D9IA 4OS5A 4AFSA 2W7SA 1GHXH 3KNXA 1Z7KA 2QYIA 3GCOA 3MH4A 5F6MA 1OYQA 3PMJA 4MPUA 4R8TB 1ZHPA 2ANWA 2WUCA 1C9TA 3ODDA 5I25A 3BTFE 1Y3WA 3GY6A 4AB9A 1J14A 4O97A 1YCPM 4OGXA 1EJNA 1GVLA 3LC3A 2ZPQA 2FS9A 2J4IA 3UUZA 1EP5A 1O5BB 1P02A 1NRNH 4BXWA 1EAIA 2ZHQH 4RKJB 1EZQA 1B5GH 1V2UT 2EA3A 5GDSH 1AWHB 3TH4H 1V2ST 2UUKB 4GVUA 1HIAA 2OINA 3SNAA 1S85A 2P3FH 4BAOB 2H9EH 1NFWA 4MNYA 3TGKE 2XBYA 1YPKH 1QBOA 1JRTA 1ESBA 1XUFA 1YPMH 2BQ7B 5FPTA 3SHAH 3KIDU 2BQ6B 4KTCA 1UHBA 5EXNA 1SHHB 1YPJH 3M7TA 2A7JA 1GDUA 3AAUA 3BTHE 2B5TB 2F9OA 3PLPA 3RXUA 1C5PA 6LPRA 4FU8A 3RXFA 2PSYA 1P12E 4ZROA 8ESTE 1UTPA 1KXBA 1HAYB 1O2HA 2ZGCA 1DWDH 3RMNH 1O35A 2ZP0H 5E0GA 1IQKA 1O3GA 2FP7B 3V12A 1AUJA 2BDHA 1F0TA 5G4BA 1TGCA 4UDWH 2BY6X 1O3NA 2CHAB 1P2IA 1TQ0B 2QXHA 3ZVAA 1G36A 1Z6EA 1FIWA 4MLFB 1FLEE 1F0RA 4Y7AA 2FYQA 4NFEA 2OD3B 1SQAA 1AD8H 1THPB 2FM2A 1O31A 3O8BA 2KAIB 1EZXC 5TCAA 3EA7A 3ZZ8A 1O3OA 1G32B 2F83A 1OP0A 2HALA 1H4WA 3QTVH 3T26A 1BTUA 4KGAA 1O2ZA 4AFZA 4E05H 5CMXH 3LH3A 3U1JB 2SGAA 1IQJA 1K1JA 1QB9A 1Z8RA 1KLIH 1PPFE 1QJ6B 2BLOA 1BRBE 3SU3A 3SNBA 1BTXA 1HAGE 2ANMH 4GHQA 2ZDVH 4BAKB 4WJG2 1CO7E 1VITH 2BD7A 3E90B 1C1RA 3GY3A 1CA0C 3AVZA 1TMBH 4DOQA 4IMZA 3RXQA 2EI7A 1P9UA 4A1XA 2IN2A 1TONA 1V2MT 3RU4E 3EGKH 1G3BA 2J94A 2UUJB 1FY3A 1CBWB 2BXTH 1AFEH 3A80A 1MQ6A 1SLXB 3RC6A 1RTLA 2H9TH 4D8NA 2BDAA 1KXCA 4BXSA 3MU1A 3GICB 2UWOA 5AFZH 3RXHA 5DG6A 1AVGH 1MD7A 4HTCH 4I8JA 1QBVH 3FANA 2BVSH 3EDXB 2AGEX 3RXBA 1K1LA 1ZSKA 2ASUB 1TRMA 1MAXA 2QAAA 4I33A 1FY5A 4RN6A 1Z8IB 3UPEA 3I78A 1KXFA 3SV8A 4X8UH 1C2LA 2ZNKH 5GPIB 1CU1A 1DLKB 1GMDG 3F9GA 3ZYDA 1O5CB 4YESB 2ZQ2A 2Z9KA 5PTPA 4XBCA 1QNJA 4O3TA 2FOMB 2J34A 1W12U 4LXBH 1RRKA 4RSPA 2QY0B 4GPGA 5EGMA 1GI1A 1GJ4H 1CVWH 1E38B 2ZHEH 1MZAA