4XBCA

1.60 a resolution structure of norovirus 3cl protease complex with a covalently bound dipeptidyl inhibitor (1r,2s)-2-({n-[(benzyloxy)carbonyl]-3-cyclohexyl-l-alanyl}amino)-1-hydroxy-3-[(3s)-2-oxopyrrolidin-3-yl]propane-1-sulfonic acid (hexagonal form)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
183
structure length
174
Chain Sequence
HMAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQAGEGETALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-LIKE PROTEASE
publication title Structure-Guided Design and Optimization of Dipeptidyl Inhibitors of Norovirus 3CL Protease. Structure-Activity Relationships and Biochemical, X-ray Crystallographic, Cell-Based, and In Vivo Studies.
pubmed doi rcsb
source organism Norwalk virus (strain gi/human/united states/norwalk/1968)
molecule tags Hydrolase/hydrolase inhibitor
total genus 40
structure length 174
sequence length 183
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xbcA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xbcA01
4X8SH 4IS5A 2TGAA 4XE4A 1G3EA 1GCTC 5FCKA 2P95A 1GJCB 4MPXA 4U32A 1QTFA 3ZZ9A 3LGIA 2FS8A 1ETSH 1RRKA 1O32A 3F9HA 5G4BA 2ZU4A 3ATLA 1ARBA 2H2ZA 2ALVA 1RD3B 3GCNA 1S84A 2STAE 1GHWH 2ZTXA 5C67A 2VVCA 3GY8A 5F8ZA 2JETC 4ZUHA 3KQBA 1TYNA 4MPWA 2BXUH 2AMPA 3GCOA 1GI5A 2QF0A 2UWOA 3M37A 3G01A 4Z6AH 3DFJA 1DITH 4X2YA 1T4VH 3FP8E 1QNJA 4LK4A 2GD4B 4WVPE 1W2KH 3RM0H 1IQHA 4GPGA 4D9QA 3GY4A 4WWYA 1XKBC 1TMBH 1AZ8A 2HNTE 1EUFA 1V2KT 2GCTC 1DPOA 3HK6B 2ZPRA 3ZZ4A 2O8TA 4AFUA 2BOKA 5JB9S 3BN9A 1WTHD 2VU8E 2A1DB 2V0BA 2RG3A 1YGCH 1G36A 1ID5H 1CT4E 4ISOA 1VCWA 3SI4H 1B0EA 2C8YB 5C2ZA 1HAZB 1TBQH 4TWWA 4MPVA 2G55A 3ZV8A 1EKBB 2D2DA 1N8OC 4NSYA 5EPNA 2Y82A 3SGBE 1MH0A 2W5EA 4K60A 2WYGA 2XXLA 3M3TA 3QK1A 1XUIA 1O3KA 3GYLB 1THRH 1TQ0B 8GCHG 2A0QB 3RXEA 1Y5UT 2A5KA 1Y3UA 3GISB 3BTQE 4KP0A 1SLXB 4CRGA 2BDIA 1C2EA 4IBLH 4OS6A 1CGHA 2FDAA 4OGXA 2ZI2H 3KHVA 5AF9H 1HFDA 1RGQA 1OKXA 4Y76A 2AGIX 1W10U 3DFLA 4B73A 5I46H 3SHCH 4IN2A 1CBWC 1H8IH 4BAQB 1SI5H 1G30B 1P2NA 2J34A 1O3GA 1Y3VA 4ISNA 7GCHF 3ATKA 2FOMB 2Y7XA 3MHWU 2EC9H 1S81A 4GVUA 1XUKA 4CRCA 3RMNH 2OP9A 1TGSZ 1XM1A 4ZKNU 1MKWK 1QURH 1AKSA 1ZHRA 2GVFA 2THFB 3ENSB 3PWCA 3V12A 5DP3A 1GHZA 1ANEA 3SJIA 3SHAH 1O31A 2YOLA 3Q77A 5DPAA 4X1NU 3SU0A 4DJZB 4J1YA 2V35A 3GY5A 2BYAX 1T8LA 3SUGA 2TRMA 2TGTA 1F0TA 2ZTYA 1EPTC 1UTNA 3M7QA 3MU0A 1C1WH 4YESB 3EA7A 4ABEA 1ANBA 2EI8A 3AAVA 1AFQC 4UFDH 1Q3XA 1XKAC 2VJ1A 1UTLM 3DD2H 3E1XB 2Z9JA 1GVKB 2PV9B 3LPRA 1NFYA 1EB1H 1W13U 2ZIQH 1DWBH 1NS3A 3SN8A 4LOYH 4BAHB 3BG8A 3S7HB 2C93B 1O2HA 4NFEA 2J92A 1EASA 3T27A 4YOIA 2KAIB 4DW2U 1IQLA 2FX4A 3CS0A 3ZZAA 2QXIA 1HBTH 2WV5A 2A7JA 4BXWA 1SOZA 4UONA 5K7RA 1ZLRA 2PKAB 1UTOA 2R3UA 4U30A 1V2PT 3K65B 1RTKA 4K8BA 5L30H 3TJOA 5FXLA 1DWDH 4DOQA 2QC2A 1S6FA 1HAPH 1ESAA 1PPEE 2GZ8A 4Q7XA 1YM0A 2ESTE 3MO6A 2AH4X 3QLPH 3LC5A 4FUIA 1O3CA 2SGFE 3SUEA 2M5TA 4OS1A 1CU1A 1HAYB 3MU5A 1BRUP 2FP7B 5T6GA 3GCTG 2DE9A 4XSKU 1ELAA 2ZHEH 3SORA 4ZH8A 1GI9B 3MNCA 3PM3A 3SZNA 1V2MT 1DS2E 3Q3YA 2C8WB 1S5SA 2ZGBH 4AYVB 1DX5M 3M3SA 1INCA 1CA8B 1F7ZA 2FXRA 5EG4A 2RCEA 4YM9A 3IITA 4KTSA 4YLUA 5TJXA 1SQOA 4BAKB 2W26A 1CQQA 1P2QA 1H9HE 5GWZA 2ZFQH 2F9NA 2VIPA 4NGAH 1TB6H 2H9HA 1ZRKA 1DSTA 4CH8B 1IQMA 1O5EH 3GDSA 2ZPSA 4D7GA 1GI4A 2Q6DA 4HZHA 5EPYA 1S82A 1JIMA 1ORFA 1GI7B 3L33A 4CHAB 1A0HB 1LQEA 1UHBB 3I78A 1ZPBA 3OY5U 3SBKA 4ZKOU 1XX9A 4X1QU 5JBCS 1FQ3A 4INKA 4I7YH 1MCVA 1IQGA 5DP6A 3TH2H 3JZ2B 3SU2A 2Q6FA 1P2IA 1C9PA 1N6XA 2PGBB 3RXIA 5TCCA 4A7IB 1XUHA 1V2UT 2UUJB 4MNWA 7GCHG 3EE0B 2OC7A 3M5NA 3M5LA 4Y7AA 3HGPA 1AQ7A 1CA0B 1L0ZA 2PWXA 1ZRBA 1C2FA 3MU4A 4MG3A 1J15A 1GHVH 1OX1A 5E0JA 2J4IA 3PLPA 1W0ZU 3FVFB 1W7XH 3A8DA 2HPPH 3GCHB 2NU3E 3CP7A 4JMYA 1NM6A 5LPEA 1BTHH 3S9BA 1HCGA 1THSH 1O39A 1OWDA 3OYPA 1HXEH 1L4DA 1BJVA 3KGPA 4MDSA 4UFGH 2P59A 3SQEE 1F0UA 3W95A 4MPUA 1IQIA 5AHGH 2GDDA 4ASHA 2D1JA 2JKHA 3EQ0H 2G52A 2VWLA 5DKMA 4BTTB 1ZTJA 1ZR0A 1KXEA 1BB0B 1GJAB 1DM4B 1C5TA 3IWMA 1AVXA 4JZ1A 2BHGA 1FUJA 2TGDA 2BLQA 1FZZA 1FAKH 1FONA 1H9LB 1O35A 2PLXA 2VIWA 4FUDA 1GHAF 6ESTA 1BTUA 1F0SA 3SW2B 1PPBH 1L4ZA 2FO9A 3ZZ5A 4CBNA 1O5AB 1GBTA 1O38A 1TRNA 1AWFH 5ETXA 2PFEA 1V2QT 5FPSA 2UWPA 1PPZA 3DHKH 4ABBA 1UCYK 1OSSA 4Y79A 3SNEA 4WF8A 1TQ7B 4I8KA 4M7GA 1NRRH 3BTEE 4XBCA 1QQ4A 1YPHE 4GCHF 1C5SA 1THPB 1C4V2 4AX9H 1EAWA 1K1IA 2UUYA 2ZNKH 1P02A 1TIOA 3MI4A 5LPRA 1OP8A 5JBBS 3SJ8A 5DP9A 1C1VH 1GI3A 2PR3A 3Q3XA 1CVWH 2TBSA 2GP9B 1BTXA 2CF8H 1TNKA 1O2JA 1C1OA 1O5CB 3UNRA 2BY5X 4CHAC 4A1TA 1O2MA 1VITH 1NY22 3TVJB 2TPIZ 2P94A 2A4RA 3PV4A 3UY9A 1DLKB 1ZOMA 1TGNA 4K1EA 1RS0A 1QB1A 1P2JA 4ISLA 4X1RU 3ZZ8A 4X2VA 2ZU3A 4I32A 3ELAH 2BTCE 3NZIA 3B9FH 1M9UA 2C8XB 3K6YA 1MKXK 3SUFA 3C27B 2G5NA 1CA0C 1NPMA 4FUGA 2ZDAH 3OSYA 3BTHE 3D23A 4JK6A 4KTUA 4FU7A 2BX3A 1DXPA 1O2UA 4BAOB 4UEHH 1VCQA 2FX6A 4ZXXH 5C5OA 5L2YH 3V7TA 1QIXB 1HRTH 3UR9A 5L6NH 1GBHA 1AVGH 2PTNA 2R2MB 3BTWE 1E36B 1P04A 3MNSA 1J17T 3DA9B 1BT7A 3PO1B 2CHAB 2SGAA 4HI3A 1VGCB 1ELCA 4D76A 2TIOA 1XUFA 2QCYA 1MMJN 1NU7B 2ZFSA 2VGCB 4JZDH 4Y8ZA 5JPMH 2P93A 4JZFH 1ZZZA 2HLCA 3LJJA 4E06H 1TBZH 2FM2A 3UQOA 5GPIB 1KIGH 1LHFH 4A92A 1GHBF 1QBVH 3ZVGA 3C1KA 1SGYE 2QIQA 3TK5A 3T2NA 4O3TA 1CT2E 2Q6GA 2Z9KA 1O3IA 3RC4A 2GV6A 1NRQH 2F9BH 3DT0H 1T8OA 3H7OA 1T31A 3ZVFA 2NU1E 1FY5A 1ZSLA 1H8DH 1B5GH 2SGEE 3EA8A 4JYUH 2HGTH 1AMHA 1MU8B 1RIWB 1LDTT 1S0RA 4X2WA 1IOEA 3AW0A 1HDTH 1KDQB 4X6PA 1EZUC 5E0GA 3MFJA 3GICB 2F3CE 1W3CA 2XNIA 1Z1IA 3N7OA 3UIRA 1UVTH 3AAUA 1KYNA 1CHGA 1O33A 1P3EA 4GUXA 3F9EA 4ZROA 1K1NA 1Q31A 3KQEA 1A46H 3TH3H 3MO3A 4Y8XA 2VWOA 1A3EH 1SMFE 3PMAB 5LPFA 5PTPA 3T5FH 4ZKSU 1ESTA 9ESTA 4I31A 1SGNE 3ATIA 4AN7A 3M5MA 1TMUH 3VEQB 1FIZA 1AHTH 4B2AA 3U1JB 1FMGA 2ZHFH 4K2YA 2BDHA 1A4WH 4O3UA 1C1QA 2F91A 1YPGH 7ESTE 3A86A 2CF9H 3GYMA 2PTCE 2VIOA 2FOCA 4GCHG 1JRTA 4ABFA 3L6PA 1SLUB 3EGKH 2XWAA 1EPTA 3WY8A 3RMLH 5ESBA 4BXSA 4JK5A 1DUAA 2IJOB 1C4U2 4OS7A 3GOVB 3RXMA 2ZZUH 1LCYA 4ABDA 3RXCA 3PO1C 1GJ4H 5FAHA 2A5IA 1SVPA 2CHAC 1VGCC 4OGYA 4X0WU 4CR5A 1AB9B 1BJUA 3RUOA 2VGCC 1C1MA 1SPJA 4NIYA 4FVBA 1FN6A 2OC8A 2FOHA 2BD5A 3A85A 3Q76A 1G3DA 1LHEH 2JH0D 4UDWH 3T25A 2OQ5A 2P3TB 1F0RA 2O8UA 2GZ7A 3MOCA 3KL6A 1O3DA 4AB9A 2ODQA 4X1SU 4ISHH 1Q2WA 1GBIA 2SNWA 1GJ6A 3STIA 2FTMA 3K2UA 1IQFA 1SG8B 2D26C 3AASA 3RU4T 3UUZA 2ZECA 1SLWB 1VJ9U 2GTBA 1NFWA 1UTQA 1EAIA 3BIVH 1XVOA 1EZSC 2A45B 2VH0A 3LGYA 3HKJB 3E3TA 5LGOA 1QBNA 1C2DA 1RIWC 2VIQA 2G81E 1EJAA 3F9FA 6GCHG 3MNXA 2A5AA 3F6UH 4DG4A 1C5WB 3FZZA 1DDJA 5A0CA 4X8VH 1O36A 2HOBA 4UFFH 1LPKB 2UUKB 1U6QA 3STJA 2Z3CA 3URCA 2ZTZA 6CHAB 3M3VA 1IQNA 2BDBA 1GHBG 1ABJH 2I6SA 5HMAA 3SI3H 2PGQB 1QQUA 1ARCA 1HIAA 2B7DH 5EXMA 2P3UB 1GDUA 1L1GA 5H4IB 3D62A 5F03A 2R0KA 2ZQ2A 1ZMNA 1P3CA 1ELTA 1AI8H 4E05H 1D3PB 2FOFA 1GMHG 1EJNA 1FIWA 1ZSKA 2A4GA 5E2OA 1TGTA 2V3OH 2A7HA 3SU3A 3NKKA 2BLVA 3PROA 1O2TA 5BPEA 2BXTH 4CH2B 1CHOG 3R3GB 3URDA 1L1NA 1J14A 1DFPA 1BBRH 3GY2A 4DCDA 3OY6U 1C5PA 1TLDA 1ZMJA 3F9GA 3P95A 3ZVAA 5A8YA 3MTYA 1MTUA 3M61U 3MH7A 2LPRA 1P57B 2VH6A 1J16A 2RDLA 2ANYA 4X8TH 2WINI 1AUTC 3A7ZA 1QY6A 3SU6A 3QN7A 2DE8A 3S9CA 1OOKB 4IMZA 5CMXH 1QRWA 4ISIH 2ASUB 5HM2A 4NWLA 1TX7A 1AE8H 1O2LA 4IN1A 4OS4A 1KXAA 2VVVA 1FN8A 2KAIA 3TITA 2WPKS 3OX7U 4KTCA 4HFPB 5I25A 2RA3A 1Y3YA 1D3TB 1YPJH 1GBKA 1NZQH 4J2YB 1V2RT 1OWKA 2AGEX 1F5RA 5JB8S 4O9VA 1IQEA 1DSUA 3ZZ6A 3NPSA 1P9UA 1SC8U 1SGDE 5GXPA 2ZU2A 5J4QA 5HYOA 5DJ7A 2AIPA 3BEIB 1GJ7B 1EAUA 3E6PH 2FMJA 1ELBA 1A1RA 3L3TA 3TGJE 1OP2A 3QGJA 3FP7E 4XOJA 1C1TA 1H1BA 1BHXB 3TPIZ 4B74A 1BTZA 1PPCE 1W11U 1AD8H 1DE7H 2BY6X 5FHTA 2G00A 1P0SH 1UVSH 1FY1A 3BTGE 2IPHA 4K1TA 1EZXC 4IGDA 2C90B 3O8CA 4GSOA 3P92A 1TPOA 2B5TB 6CHAC 2ZFTA 1T8NA 2GCHG 1CSOE 3MU8A 3D65E 1GBMA 2P8OB 3BF6H 2FPZA 1PQ8A 3TGKE 1LO6A 1TNLA 1CT0E 3TNTA 1MBQA 1GGDB 3SJKA 1P2KA 1UCYE 3PB1E 2JH5D 1D6WA 1YC0A 1FY8E 5FPYA 2Z6BD 5AFZH 2ODPA 2J95A 2BZ6H 1O2VA 4I8GA 2K1QA 1BTWA 1AKSB 5GCHF 5A09A 2XCFA 2ZC9H 3IG6B 1C5YB 1OPHB 3E0PB 1ZGIA 1V2NT 4LXBH 3H5CB 2ANMH 1EP6A 2A2XH 1P11E 3A7YA 2R3YA 3NWUA 3QZRA 2H6MA 1W12U 1KY9A 1LKAA 2FOGA 1L1JA 2WUCA 2WV4A 1NROH 2FOEA 1YPMH 2PSYA 1FXYA 2GT7A 2ZDNA 3LC3A 3LOXA 5GIBA 1DY8A 4AGJA 2CJIA 1IAUA 1OXGA 4ZMAH 1TX8A 3HK3B 3A81A 1EJMA 3P8NA 1QHRB 3E91A 1TBRH 1GI6A 1TMTH 5EGMA 1P2OA 3ATMA 1QL9A 3ZZ3A 5TCAA 3RC6A 2ANKH 2GKVE 1MUEB 1GBCA 4HTCH 3RXPA 4B71A 1FAXA 2PW8H 2ZDVH 3ZZDA 2ZGCA 1OWEA 1TA2A 1L2EA 3A7VA 1WAYB 4HGCA 4NA7A 4H6SB 1OYTH 5A0AE 1OWJA 1PYTC 1Y3XA 4XFQA 1KLJH 4LZ1H 1O5FH 2XCNA 3A8CA 1GMDF 3LT3A 1DANH 4CRFA 1DUEA 1YLDA 4NIVA 5C20A 1TE0A 3SNDA 1NFUA 4FUJA 1ZMLA 1O3NA 1Z8RA 3QGNB 3VB4A 1Y59T 3NUMA 4SGAE 2WPJS 2BY9X 1G32B 2ZKSA 1XXFA 4FXGH 3HGNA 2QGRA 4DIIH 2XC5A 1ELFA 1GCDA 2NU2E 1YCPM 1GI8B 1KLIH 5FX6A 4B2BA 2OCVB 1O2IA 2GGVB 1C1SA 2QF3A 2QV1A 4TYDA 1IHTH 2P8OC 3RXKA 1TRMA 2LNCA 1FY3A 2UWLA 3QWCH 5C1YA 3QUMP 4RN6A 2CXVA 1V2VT 4BANB 1AZZA 1GGDC 3ZZBA 1ZSJA 2HNTF 3UWIA 2WPIS 3A89A 3EA9A 2I6QA 4WH6A 1MAYA 1P12E 3P6ZB 2BD9A 5T6FA 3VGCB 1WU1A 1V3XA 2QXHA 3BTFE 5T6DA 1E34B 5HXFA 2H5DA 3P8OA 1C1NA 1QJ1B 3W94A 1ABIH 3MH5A 3BTKE 3KF2A 2BD3A 1HAOH 1O3AA 3BEFB 5AFYH 1O30A 1O2QA 1HGTH 1NU9A 3SJ9A 1C4Y2 1GBLA 1EX3A 3BIUH 2ZPQA 1NN6A 1ELVA 2ZG0H 4A1VA 1AWHB 3EYDA 3KN2A 4FU9A 3A8AA 4THNH 2OTVA 1LVBA 2C8ZB 1A0JA 2PUQH 2F9VA 4K5ZA 4H42U 2R0LA 1UVUH 1O2KA 3UOUA 1EZQA 4R8TB 1DOJA 4CREA 4KELA 1BRAA 4OS5A 1HAXB 1D3DB 1DWCH 3NCLA 9LPRA 1ELDE 1D9IA 1LPGB 1O5DH 3BV9B 4A6LA 1GL1A 4SGBE 2BQ7B 4A1XA 1UMAH 3HATH 4AFZA 4YOJA 1QL7A 4CBOA 1QJ6B 1QA0A 1GI1A 3KEEA 3A8BA 2TGPZ 2FOAA 3TNSA 1ACBE 4GLYA 5GCHG 2GV7A 3RMMH 4X6NA 1GJ5H 1FNIA 4YZUA 2OD3B 1UK4A 1F5LA 2B8OH 1A5HA 1Z6JH 2BDYA 1BZXE 4AORA 3QDZB 3LGUA 1LVYA 1CGIE 3DUXH 5ESTE 1C5UA 3KQDA 3P8FA 3SO3A 2RA0A 5CE1A 3ODFA 1YCPH 1OWIA 7KMEH 4INLA 4MQAA 1V2WT 1HYLA 3SQHE 2FI4E 1D3QB 5DGJA 2EI7A 3V0XA 3F1SB 1C2LA 1SBWA 1O2PA 4WJG2 2QYIA 1GMCF 2VIVA 1UTKA 5C3NA 2ZU1A 1Y8TA 3GCHC 1C1PA 5F8XA 1ESBA 4U01A 5IYTA 1O3HA 1HJAB 2ZDLA 4TY6A 4MVNA 1UVOA 1RXPA 2ZGHA 2ZP0H 3UNSA 1K28D 2WPLS 3NXPA 4FU8A 1JOUB 4DVAU 1K2I1 2BDGA 1P06A 3TJNA 1T8MA 4Y6DA 5EXLA 2QA9E 3H7TA 3SNCA 1WUNH 3OU0A 4YOGA 4TWYA 1QRXA 3SNAA 2W3KA 2FLRH 4YT7H 1UJ1A 1W14U 2DUCA 1LHDH 1B0FA 1MZAA 1DT2A 2AMQA 2GMTB 4YO9A 2FYQA 4Y11E 3A80A 1WCZA 2O9QA 1C5OH 3GY6A 2FIRH 2ANWA 2SNVA 1Z8JB 3LH1A 2NWNA 1SGIB 4NWKA 2AGGX 5EW1H 4XDEA 3BSQA 2ALPA 4MTBA 3QTVH 4IC5A 1TNIA 2BMGB 3M5OA 3A7TA 2GZ9A 2BVRH 1P2MA 4TY7A 3SV8A 5A0BA 1C2KA 6LPRA 3BTME 2CMYA 1RFNA 1XMNB 2BD7A 3QTOH 4WMFA 1D6RA 3RXHA 4A5TS 1Z6EA 4WY3A 1FLEE 1EOJA 1C5VA 2BQ6B 2P16A 4IMQA 5DP4A 3V3MA 2R9PA 5SGAE 3FANA 1MQ5A 3SOSA 5K0HA 1ZPCA 3P70B 3RXQA 1VITF 4GHTA 1AFEH 2HNTC 2VWMA 3LGVA 3SJOA 1GHAG 1MAXA 2BX4A 1BOQA 3RXJA 3VB7A 1HAVB 1SGTA 4E7RG 1Y3WA 2IN2A 3JZ1B 2A31A 3TIUA 1SR5C 4FUEA 1C5ZB 1VJAU 1FI8A 3TJVA 3E16B 3RXBA 2FZZA 4BTIB 3QX5H 2OC0A 2J38A 4D7FA 2ZA5A 1V6DA 1SHHB 1QCPA 1HJAC 3E0NB 3RLWH 4NA8A 4YT6H 1JWTA 1O2ZA 3SGAE 5J4SA 3LGTA 1O3MA 3SV9A 4DURA 4D9RA 1QA7A 1MD8A 3T29A 1N8OB 3M36A 1O3PB 1KLTA 1BTPA 2FYRA 1C1RA 5EQRA 1OWHA 4ZKRU 1JMOH 3PMHB 5HM9A 2XYAA 2ZF0H 1GBAA 3U9AH 1C2MA 1O2XA 5DP7A 3RXRA 1BMNH 4KGAA 4B75A 5IDKA 4XBDA 3VXFH 1TONA 1PFXC 1E0FD 2BDAA 1GBEA 4ESTE 1GMCG 4OS2A 1O2GH 4R0IA 1NC6A 2VINA 1O34A 1YLCA 2SGDE 1JXPA 2A32A 1P9SA 4WMEA 1DXWA 1G3CA 3ZZ7A 1ZTLA 2ZCKP 2H5CA 2HWLB 1NFXA 3CENA 3UREA 1BA8B 3A7WA 5FCRA 2YNBA 1TPPA 3BEUA 4Y10E 3ZVCA 1DVAH 1BDAA 1C2IA 1GDQA 1DICA 1GVLA 2GDEH 4ZHMU 1AUJA 1LVMA 2BDCA 2Q1JA 3LONA 3S9AA 2ZDKA 2FOBA 1HJ8A 2BZAA 3UFAA 3VFEA 1W0YH 4Q7YA 2P3FH 1IQKA 1SQTA 1RTFB 4UFEH 2WUBA 1NO9H 3S69A 1ZPZA 1EPTB 1N6YA 5EW2H 1T32A 1YPLH 1S85A 2PHBA 3FAOA 2XWBI 1AFQB 3LKWA 1O3FA 1O2SA 3LU9B 4AFQA 2VVUA 3GCTF 4Y8YA 5C1UA 1O5BB 3OTJE 1SSXA 2AIQA 3MH6A 1NRSH 3BTTE 3TJUA 1BHXF 5JDUB 1MZDA 1LQDB 5DP5A 1ZTKA 4DGJA 3UQVA 3O8DA 5JYIA 2G8TA 1GG6B 1ZHMA 2IOTA 1KTTB 3E90B 1TA6A 1P09A 1SOTA 1J9CH 1D4PB 1GWAA 4Y0YE 3RXSA 3U8TH 1O2YA 1ELEE 3M7TA 1WSSH 2ZCHP 2G5VA 3KNXA 4AGKA 3T26A 1MKWH 1PPGE 2O8WA 2VIDA 4NSVA 1HNEE 1VITG 1AB9C 3A7XA 1DLEA 1V2OT 4X6MA 4XBBA 2F83A 3RXAA 2R2WU 3SU5A 3QO6A 3LIWA 1TPAE 4NIXA 1TX6A 3U8RH 1KXFA 1WBGB 2ODYB 4RSPA 1ZGVA 4WH8A 1C1UH 2OBOA 1MD7A 2EI6A 1PPFE 1P01A 1KXDA 3A88A 3RU4E 4X8UH 4K3JA 2PKAA 1ZHPA 5DG6A 3U98H 4AB8A 1HUTH 1H9IE 1O37A 5EOKA 1TAWA 2W7SA 1BBRK 1FV9A 4K69A 2ZFFH 1TNHA 4FUHA 1UO6A 4Q80A 1K9OE 3RMOH 2FWWA 1BCUH 1HIAB 1BIOA 1LMWB 2ZHWH 1TABE 2Z9IA 4Q2KA 3PLKA 2BY8X 1BRCE 3K6ZA 2B0FA 4Q7ZA 2ZHDA 2FLBH 2Z3EA 3UR6A 4PROA 2F9UA 1Z7KA 2Z7FE 1J8AA 1AN1E 1NTPA 5AVDA 1AVWA 2Y81A 4AG2A 1MTSA 1O3JA 1K1OA 1OYQA 1T4UH 3UWJH 4X2XA 1WOFA 4ABHA 2VNTA 4X6OA 3ODDA 4E7NA 3BG4B 3LJOA 1AO5A 3RXDA 3SV6A 1QRZA 2XRCA 2BM2A 3PTBA 1GBFA 7LPRA 1MTVA 3T62A 4QT8C 3ZV9A 4I8HA 1RTLA 1UK2A 2SFAA 2ZO3H 5BRRE 1F5KU 3EDXB 3SNBA 3MNBA 3PLBA 2O8LA 1C9TA 1P03A 2Y80A 1FJSA 4FUFA 1GG6C 1UHBA 3MYWA 1GBJA 1QGFA 2CN0H 4ABIA 4WMDA 3ZVDA 4RKJB 2ZWLH 2ZGJA 1TALA 1GPZA 2BVSH 5A8ZA 4CR9A 2H9EH 5C5NA 3PMBB 4UD9H 1XVMA 1F2SE 1NRPH 4ABJA 2EEKA 3GDVA 2Z9GA 5EODA 2A7CA 2OBQA 1HAHH 1A5IA 8LPRA 1C2JA 1TGCA 4NG9H 2XBXA 5EQSA 3PWBA 1QB6A 5CHAB 3D49H 1JIRA 1V2LT 4TPYA 3RDZA 3S7KB 1MTNB 1SGCA 2QAAA 1SL3A 1HJ9A 1UK3A 2Y6TA 2FODA 8ESTE 4I33A 3K9XB 1YPHC 1O2OA 4BTUB 1JRSA 1S6HA 1C5RA 1UVPA 5JBAS 3RU4D 2Y5GA 2OC1A 3B8JA 1SGPE 1KXBA 2JH6D 2XTTB 3P17H 3TLOA 1SGFA 4Y7BA 2BD2A 3I29A 1GJ8B 1ELGA 3BTDE 2C4FH 1GVZA 4AOQA 4FVDA 3M35A 1A3BH 1BMAA 1PPHE 3RXFA 2XW9A 1HB0B 1HV7A 1O5GH 2ZGXH 2PKSB 4VGCB 3VB6A 2XC0A 5B6OA 2FESH 3HKIB 2AMDA 2W3IA 1CE5A 1BMMH 1GJBB 5E8EH 1BQYA 3SV2H 5F8TA 1JBUH 5FBEA 1ETRH 3ZYDA 3EAJA 3V13A 2AERH 1LTOA 3TGIE 1K1JA 4U2WA 2XBWA 1EQ9A 1AY6H 1O2NA 1SFQB 3A82A 2BLOA 5EU8A 5EQQA 5C1XA 4NCYA 3AW1A 1ZYOA 1YYY1 1RJXB 2STBE 3BG4C 2OLGA 1MQ6A 3F68H 4BOHA 2G51A 2CGAA 2WYJA 1GJDB 3MMGA 2GT8A 2SGQE 4YLQH 1OP0A 3RM2H 1ANDA 4KKDA 2WPHS 1XXDA 2OUAA 1ZJKA 4ZHAA 1TGBA 1KSNA 2H1UA 3UTUH 4IW4E 3A87A 1SGEE 4B1TA 1VR1H 1FPHH 3GDUA 3Q3KA 2Y5FA 3UPEA 2GX4A 4TPIZ 5DP8A 2OQUA 4CRBA 1UCYH 1SQAA 3B23B 4WXIA 1LVOA 4DT7B 1TFXA 4B76A 1G9IE 3GY7A 4MNYA 5LH8A 3LDXH 4I8LA 1GDNA 1Z1JA 1EP5A 5CHAC 4YTAA 3U69H 2J9NA 3O8RA 1MTNC 3MH4A 2C3SA 2AS9A 1V2TT 1KXCA 1G3BA 2HPQH 5DK1A 1SGQE 1PQ5A 2BB4A 3FP6E 4INHA 4O97A 5FX5A 2NU0E 4MNXA 1EATA 1O3BA 1C5XB 4ABAA 1GBBA 2Y7ZA 4FUCA 3TH4H 2J94A 1LHGH 3GY3A 3E8LA 2QXGA 2OXSA 1E38B 2V3HH 1LPZB 1PQAA 3Q00A 1W8BH 4AG1A 4CRAA 1GI2A 4UE7H 3RC5A 1WYKA 1DWEH 2ZQ1A 4K8YA 1PQ7A 2QN5T 3SUDA 2PKSC 2F9OA 1UTPA 4VGCC 3P8GA 4NA9H 4ZXYH 1MKXH 4CRDA 1QB9A 2BY7X 1FPCH 1S83A 3A83A 4JYVH 2Z3DA 3RXGA 1GI0A 5DO4H 1QBOA 2V6NA 2XC4A 3ESTA 1Z71A 1N1LA 4ZAEA 1P05A 4MLFB 1HAGE 2EA3A 4AFSA 4GAWA 2QXJA 1GHYH 3ZVBA 1BUIA 2FTLE 4ZHLU 1SGFG 1YBWA 4H4FA 1QFKH 2BVXH 4JYTA 3SV7A 1K21H 4X1PU 1HAIH 3A84A 2VB0A 1FDPA 1G2MA 5E2PA 2ULLA 2QY0B 1EAXA 4DY7B 3S0NA 1VZQH 2H9TH 3LGWA 2A4OA 1TNJA 2J2UA 1AIXH 4WXVA 3ATWA 1YKTA 5E0HA 1G37A 4JZEH 4NIWA 1WV7H 3TK6A 2HRVA 1DY9A 3U8OH 4K1SA 3HPTB 1KDQA 1K1LA 2D8WA 1K1PA 2ZEBA 1ETTH 4O03A 2HVXA 2ZFPH 1C5NH 1WQSA 3M7UA 3RXTA 3VB5A 3TK9A 1TNGA 3VGCC 1A2CH 1EB2A 3ITIA 1GHXH 2O8MA 1TPSA 3VB3A 4AYYB 2F9PA 3VPKA 1C5MD 1GMDG 1O2RA 1YCPK 1GL0E 1TWXB 1YPEH 1QR3E 3KQCA 8KME2 1BRBE 1LHCH 1HAVA 3PMJA 2G4UA 1AGJA 3RXVA 4NZLA 3QZQA 2G4TA 2ZHQH 5GDSH 2FI5E 1ANCA 5T3HA 6GCHF 4F49A 1K1MA 1V2ST 3T28A 1TOMH 1SGRE 3CS7A 2XBYA 3U1IB 2HALA 4JZIA 3ZZCA 1ZJDA 1SHYA 1FY4A 2PUXB 3KCGH 4BAMB 1A61H 2ILNA 2CV3A 1QJ7B 5EXNA 3SU1A 3KIDU 3RP2A 5A2MH 1KTSB 4NZQA 5GJ4B 3UNQA 1GCTB 1HXFH 1NESE 2ZU5A 5FPTA 1E35B 2VWNA 3SGQE 2SGPE 5JBTA 1QL8A 1Y5AT 2A2QH 2Z94A 1WQVH 4MNVA 1GMHF 2ZFRH 1YPKH 3NK8A 2FS9A 2PSXA 1P10A 4JCNA 2XBVA 2YNAA 3AVZA 1P8VC 2AEIH 2JETB 1E37B 1CHOF 2ZDMA 2AYWA 1CGJE 1TRYA 3RXLA 3R0FA 8GCHF 3RXOA 4H6TA 1O3EA 1AE5A 2FEQH 1BTYA 4GHQA 4Y71A 1K22H 3LH3A 3RLYH 4IC6A 4FUBA 2B9LA 5A8XA 1XUJA 2BD4A 3FFGA 1A0LA 3I77A 2W7UA 4D8NA 4LZ4B 1PYTD 1YF4A 1SLVB 1SB1H 1IQJA 2Z9LA 1GJ9B 1O3LA 1EXFA 3UOPA 5HGGA 1F92A 2GCTB 1O2WA 3PTNA 1OS8A 1PJPA 1VCPA 2BQWB 3MWIU 1C2GA 1NT1A 4DIHH 1Z8IB 1G2LA 1BMLA 1GBDA 1BBRE 1C5QA 3O8BA 2A4QA 1BITA 5F6MA 3ZYEA 1T7CA 2UUFB 1NRNH 1LKBA 4NFFA 4RKOB 2NU4E 3VXEH 1EOLA 1H4WA 1MTWA 4B2CA 3TU7H 1UTJA 1YP9A 4I8JA 1UTMA 1SFIA 1O3OA 2Y5HA 2WPMS 1HLTH 1S0QA 3MU1A 1O0DH 2OINA 1TOCB 1V2JT 5FBIA 1Y5BT 2BOHB 4ABGA 4F4OC 1X7AC 3RXUA 1W7GH 1A7SA 2GMTC 5ABWA 1C5LH 2FI3E 1WTGH 2BLWA 1C2HA 3ZVEA 4BNRA 1CBWB 1XUGA 3PYHA 1Z8GA 1MCTA 2ZCLP 1B7XB 2BD8A 1MBMA 3SU4A 4AZ2B 1A5GH 1CO7E 4Z0KA 1HPGA 3MO9A 2AFQB 3FZDA 4Y0ZE 1AU8A 2GCHF 1MU6B 5L2ZH 1IHSH
chains in the Genus database with same CATH superfamily
4X8SH 5C0UA 4IS5A 2TGAA 4XE4A 1G3EA 1GCTC 5FCKA 2P95A 1GJCB 4MPXA 4U32A 1QTFA 3ZZ9A 3LGIA 3PRDA 2FS8A 1ETSH 1RRKA 1O32A 3F9HA 5G4BA 2ZU4A 3ATLA 5EJLA 1ARBA 2H2ZA 2ALVA 1RD3B 3GCNA 1S84A 2STAE 1GHWH 2ZTXA 5C0TA 5C67A 2VVCA 3GY8A 5F8ZA 2JETC 4ZUHA 3KQBA 1TYNA 2K8IA 4MPWA 2BXUH 3PV2A 2AMPA 3GCOA 1GI5A 2QF0A 2UWOA 3M37A 3G01A 4Z6AH 3DFJA 1DITH 4X2YA 1T4VH 3FP8E 1QNJA 4LK4A 2GD4B 4WVPE 1W2KH 3RM0H 1IQHA 4GPGA 4D9QA 3GY4A 4WWYA 1XKBC 1TMBH 1AZ8A 2HNTE 1EUFA 1V2KT 2GCTC 1DPOA 3HK6B 2ZPRA 3ZZ4A 2O8TA 4AFUA 2BOKA 5JB9S 3BN9A 1WTHD 2VU8E 2A1DB 2V0BA 2RG3A 1YGCH 1G36A 1ID5H 1CT4E 4ISOA 1VCWA 3OFND 3SI4H 1B0EA 2C8YB 5C2ZA 1HAZB 1TBQH 4TWWA 2KX4A 4MPVA 2G55A 3ZV8A 1EKBB 2D2DA 1N8OC 4NSYA 5EPNA 2Y82A 3SGBE 1MH0A 2W5EA 4K60A 2WYGA 2XXLA 3M3TA 3QK1A 1XUIA 1O3KA 3GYLB 1THRH 1TQ0B 8GCHG 2A0QB 4FETA 3RXEA 1Y5UT 2A5KA 1Y3UA 3GISB 3BTQE 4KP0A 1SLXB 4CRGA 2BDIA 1C2EA 5IK2D 4IBLH 4OS6A 1CGHA 2FDAA 4OGXA 2ZI2H 3KHVA 5AF9H 1HFDA 1RGQA 1OKXA 4Y76A 2AGIX 1W10U 3DFLA 4B73A 5I46H 3SHCH 4IN2A 1CBWC 1H8IH 4BAQB 3F3BA 1SI5H 1G30B 1P2NA 2J34A 1O3GA 1Y3VA 4ISNA 3OAAD 7GCHF 3ATKA 2FOMB 2Y7XA 3MHWU 2EC9H 1S81A 4GVUA 1XUKA 4CRCA 3RMNH 2OP9A 1TGSZ 1XM1A 4ZKNU 1MKWK 1QURH 1AKSA 1ZHRA 2GVFA 2THFB 3ENSB 3PWCA 3V12A 5DP3A 1GHZA 1ANEA 3SJIA 5DN6D 3SHAH 1O31A 2YOLA 3Q77A 5DPAA 4X1NU 3SU0A 4DJZB 4J1YA 2V35A 3GY5A 2BYAX 1T8LA 3SUGA 2TRMA 3F2FA 2TGTA 1F0TA 2WZQA 2ZTYA 1EPTC 1UTNA 3M7QA 3MU0A 1C1WH 4YESB 3EA7A 4ABEA 1ANBA 2EI8A 3AAVA 1AFQC 2JJ2D 4UFDH 1Q3XA 1XKAC 2VJ1A 1UTLM 3DD2H 3E1XB 2Z9JA 1GVKB 2PV9B 3LPRA 1NFYA 1EB1H 1W13U 2ZIQH 1DWBH 1NS3A 3SN8A 4LOYH 4BAHB 3BG8A 3S7HB 4I86A 2C93B 1O2HA 4NFEA 2J92A 1EASA 3T27A 4YOIA 2KAIB 4DW2U 1IQLA 2FX4A 3CS0A 3ZZAA 2QXIA 1HBTH 2WV5A 2A7JA 4BXWA 1SOZA 4UONA 5K7RA 1ZLRA 2PKAB 1UTOA 2R3UA 4U30A 1V2PT 3F0OA 3K65B 1RTKA 4K8BA 5L30H 3TJOA 5FXLA 1DWDH 4DOQA 2QC2A 1S6FA 1HAPH 1ESAA 1PPEE 2GZ8A 4Q7XA 1YM0A 2ESTE 3MO6A 2AH4X 3QLPH 3GS9A 3LC5A 4FUIA 1O3CA 2SGFE 3SUEA 2M5TA 4OS1A 1CU1A 1HAYB 3MU5A 1BRUP 2FP7B 5T6GA 3GCTG 2DE9A 4XSKU 1ELAA 2ZHEH 3SORA 4ZH8A 1GI9B 3MNCA 3PM3A 3SZNA 1V2MT 2QE7D 1DS2E 3Q3YA 2C8WB 1S5SA 2ZGBH 4AYVB 2LP6A 1DX5M 3M3SA 1INCA 1CA8B 4AC9A 1F7ZA 2FXRA 5EG4A 2RCEA 4YM9A 3IITA 4KTSA 4YLUA 5TJXA 1SQOA 4BAKB 2W26A 1CQQA 1P2QA 1H9HE 5GWZA 2ZFQH 2F9NA 2VIPA 4NGAH 1TB6H 2H9HA 1ZRKA 1DSTA 4CH8B 1IQMA 1O5EH 3GDSA 2ZPSA 4D7GA 1GI4A 2IPQX 2Q6DA 4HZHA 5EPYA 1S82A 1JIMA 1ORFA 1GI7B 3L33A 4CHAB 1A0HB 1LQEA 1UHBB 3I78A 1ZPBA 3OY5U 3SBKA 4ZKOU 1XX9A 4X1QU 5JBCS 1FQ3A 4INKA 4I7YH 1MCVA 1IQGA 5DP6A 3TH2H 3JZ2B 3SU2A 2Q6FA 1P2IA 1C9PA 1N6XA 2PGBB 3RXIA 5TCCA 4A7IB 1XUHA 1V2UT 2UUJB 4MNWA 7GCHG 3EE0B 2OC7A 3M5NA 3M5LA 4Y7AA 3HGPA 1AQ7A 1CA0B 1L0ZA 2PWXA 1ZRBA 1C2FA 3MU4A 4MG3A 1J15A 1GHVH 1OX1A 5E0JA 2J4IA 3PLPA 1W0ZU 3FVFB 1W7XH 3A8DA 2HPPH 3GCHB 2NU3E 3CP7A 4JMYA 1NM6A 5LPEA 1BTHH 3S9BA 1HCGA 4P00A 1THSH 3UAIC 3AK5A 1O39A 5KECA 1OWDA 3OYPA 1HXEH 1L4DA 1BJVA 3KGPA 4MDSA 3CNRA 2P59A 4UFGH 3EE7A 3SQEE 1F0UA 3W95A 4MPUA 1IQIA 5AHGH 2GDDA 4ASHA 2D1JA 2JKHA 3EQ0H 2G52A 2VWLA 5DKMA 4BTTB 1ZTJA 2IJD1 1ZR0A 1KXEA 1BB0B 1GJAB 1DM4B 1C5TA 3IWMA 1AVXA 2WSSD 2BHGA 4JZ1A 1FUJA 2TGDA 2BLQA 1FZZA 1FAKH 1FONA 1H9LB 1O35A 2PLXA 2VIWA 4FUDA 1GHAF 6ESTA 1BTUA 1F0SA 3SW2B 1PPBH 2F4LA 2J5UA 1L4ZA 2FO9A 3ZZ5A 4CBNA 1O5AB 1GBTA 1O38A 1TRNA 1AWFH 5ETXA 2PFEA 1V2QT 5FPSA 2UWPA 1PPZA 3DHKH 4ABBA 1UCYK 1OSSA 4Y79A 3SNEA 4WF8A 1TQ7B 4I8KA 3DSOA 4M7GA 1NRRH 3BTEE 1K0HA 4XBCA 1QQ4A 1YPHE 4GCHF 1C5SA 1THPB 1C4V2 4AX9H 1EAWA 1K1IA 2UUYA 2ZNKH 1P02A 1TIOA 3MI4A 5LPRA 1OP8A 5JBBS 3SJ8A 5DP9A 1C1VH 1GI3A 2EY4C 2YMSD 2PR3A 3Q3XA 1CVWH 2TBSA 2GP9B 1BTXA 2CF8H 1TNKA 1O2JA 2PP6A 1C1OA 1O5CB 3UNRA 2BY5X 4CHAC 4A1TA 3SYJA 1O2MA 1VITH 1NY22 3TVJB 2TPIZ 2P94A 2A4RA 3PV4A 3UY9A 1DLKB 1ZOMA 1TGNA 4K1EA 4RI0A 1RS0A 1QB1A 1P2JA 4ISLA 4X1RU 3ZZ8A 4X2VA 2ZU3A 4I32A 3ELAH 2BTCE 3NZIA 3B9FH 1M9UA 2C8XB 3K6YA 1MKXK 3SUFA 3C27B 2G5NA 1CA0C 1NPMA 4FUGA 2ZDAH 3OSYA 3BTHE 3D23A 4JK6A 4KTUA 1E1RD 4FU7A 2BX3A 1DXPA 4DT4A 1O2UA 4BAOB 4UEHH 1VCQA 2J98A 2FX6A 3N99A 4ZXXH 5C5OA 5L2YH 3V7TA 1QIXB 1HRTH 1S6LA 3UR9A 5L6NH 1GBHA 1AVGH 2PTNA 2R2MB 3BTWE 1E36B 1P04A 3MNSA 1J17T 3DA9B 1BT7A 3PO1B 3H09A 5FL7D 2CHAB 2SGAA 2K0QA 4HI3A 1VGCB 5C17A 1ELCA 4D76A 2TIOA 1XUFA 2QCYA 1MMJN 1NU7B 2ZFSA 2VGCB 4JZDH 4Y8ZA 5JPMH 2P93A 4JZFH 1ZZZA 2HLCA 3LJJA 5KEDA 4E06H 1TBZH 2FM2A 3UQOA 5GPIB 1KIGH 1LHFH 4A92A 1GHBF 1QBVH 3FOAA 3ZVGA 3C1KA 1SGYE 2QIQA 3TK5A 3T2NA 4O3TA 1CT2E 2Q6GA 2Z9KA 1O3IA 3RC4A 2EQNA 2GV6A 4ACAA 3OEHD 1NRQH 2F9BH 3DT0H 1T8OA 3H7OA 1T31A 3ZVFA 2NU1E 1FY5A 1ZSLA 1H8DH 1B5GH 2SGEE 3EA8A 4JYUH 2HGTH 1AMHA 1MU8B 1RIWB 1LDTT 1S0RA 4X2WA 1IOEA 3AW0A 1HDTH 1KDQB 4X6PA 1EZUC 5E0GA 3MFJA 3GICB 2F3CE 4RT1A 1W3CA 2XNIA 1Z1IA 3N7OA 3UIRA 1UVTH 3AAUA 1KYNA 1CHGA 1O33A 1P3EA 4GUXA 3F9EA 4ZROA 1K1NA 1Q31A 3KQEA 1A46H 3TH3H 3MO3A 4Y8XA 2VWOA 1A3EH 1SMFE 3PMAB 5LPFA 5PTPA 3T5FH 4ZKSU 1ESTA 9ESTA 4I31A 1SGNE 3ATIA 4AN7A 3M5MA 1TMUH 3VEQB 1FIZA 1AHTH 4B2AA 3U1JB 1FMGA 2ZHFH 4K2YA 2BDHA 1A4WH 4Q63A 4O3UA 1C1QA 2F91A 1YPGH 7ESTE 3A86A 1E1QD 2CF9H 3GYMA 2PTCE 2VIOA 2FOCA 4GCHG 1JRTA 4ABFA 2WPDD 3L6PA 1SLUB 3EGKH 2XWAA 1EPTA 3NRLA 3RMLH 5ESBA 3WY8A 4BXSA 4JK5A 1DUAA 2IJOB 1C4U2 4OS7A 4B6FA 3GOVB 5EJZA 3RXMA 2ZZUH 1LCYA 4ABDA 3RXCA 3PO1C 1GJ4H 5FAHA 2A5IA 1SVPA 2CHAC 5EIYA 1VGCC 4OGYA 4X0WU 4CR5A 5HIZA 1AB9B 1BJUA 2RFKC 3RUOA 2JJ1D 1C1MA 2VGCC 1SPJA 4NIYA 4FVBA 1FN6A 2OC8A 2FOHA 2BD5A 3A85A 3Q76A 1G3DA 1LHEH 2JH0D 3WWBA 2W6ID 4UDWH 3T25A 2OQ5A 2P3TB 1F0RA 2O8UA 2GZ7A 3MOCA 3KL6A 1O3DA 4OM9A 4AB9A 2ODQA 4X1SU 4ISHH 1Q2WA 1GBIA 2SNWA 1GJ6A 3STIA 2FTMA 3K2UA 1IQFA 1SG8B 2D26C 3AASA 3RU4T 3UUZA 1BMFD 2ZECA 1SLWB 1VJ9U 2GTBA 1NFWA 1UTQA 1EAIA 3BIVH 1XVOA 1EZSC 2A45B 2VH0A 3LGYA 3HKJB 3E3TA 5LGOA 1QBNA 1C2DA 1RIWC 2VIQA 2G81E 4F48B 1EJAA 3F9FA 6GCHG 3MNXA 2A5AA 3F6UH 4DG4A 1C5WB 3FZZA 1DDJA 5A0CA 4X8VH 1O36A 2HOBA 4UFFH 1LPKB 2UUKB 1U6QA 3STJA 2Z3CA 2JDID 3URCA 2ZTZA 6CHAB 3M3VA 1IQNA 2BDBA 1GHBG 1ABJH 2I6SA 5HMAA 3SI3H 2PGQB 1QQUA 1ARCA 1HIAA 4XD7D 2B7DH 5EXMA 2P3UB 1GDUA 1UW7A 1L1GA 5H4IB 3D62A 5F03A 2R0KA 2ZQ2A 1ZMNA 1P3CA 1ELTA 2W6JD 1AI8H 4E05H 1D3PB 2FOFA 1GMHG 1EJNA 1FIWA 1ZSKA 2A4GA 5E2OA 1TGTA 2V3OH 2A7HA 3SU3A 3NKKA 2BLVA 3PROA 1O2TA 5BPEA 2KR7A 2BXTH 4CH2B 1CHOG 3R3GB 3URDA 1L1NA 1J14A 1DFPA 1BBRH 3GY2A 4DCDA 3OY6U 1C5PA 1TLDA 5CDFE 1ZMJA 3F9GA 3P95A 3ZVAA 5A8YA 3MTYA 1MTUA 3M61U 1W0JD 3MH7A 2LPRA 1P57B 2VH6A 1J16A 2RDLA 2ANYA 4X8TH 2WINI 1AUTC 3A7ZA 1QY6A 3SU6A 3QN7A 2DE8A 3S9CA 1OOKB 4IMZA 5CMXH 1QRWA 4ISIH 2ASUB 5HM2A 4NWLA 1TX7A 1AE8H 1O2LA 4IN1A 4OS4A 1KXAA 2VVVA 1FN8A 2KAIA 3TITA 2WPKS 3OX7U 4KTCA 4HFPB 5I25A 2RA3A 1Y3YA 1D3TB 1YPJH 1GBKA 1H8ED 1NZQH 4J2YB 3ZIAD 1V2RT 1OWKA 1WDIA 2AGEX 3N7EA 1F5RA 5JB8S 4O9VA 1IQEA 1DSUA 3ZZ6A 3NPSA 1P9UA 1SC8U 1SGDE 5GXPA 2ZU2A 5J4QA 5HYOA 5DJ7A 2AIPA 3BEIB 1GJ7B 1EAUA 3E6PH 2FMJA 1ELBA 1A1RA 3L3TA 3TGJE 1OP2A 3QGJA 3FP7E 4XOJA 1C1TA 1H1BA 1BHXB 4TT3D 3TPIZ 4B74A 1BTZA 1PPCE 1W11U 1AD8H 1DE7H 2BY6X 3N7DA 5FHTA 2G00A 1P0SH 1UVSH 1FY1A 3BTGE 2IPHA 4K1TA 1EZXC 4IGDA 1YLNA 2C90B 3O8CA 4GSOA 3P92A 1TPOA 2B5TB 6CHAC 2ZFTA 1T8NA 2GCHG 2L6OA 1CSOE 3MU8A 3D65E 1GBMA 2P8OB 3BF6H 2FPZA 1PQ8A 3TGKE 1LO6A 1TNLA 1CT0E 5B6LA 3TNTA 1MBQA 1GGDB 3SJKA 1P2KA 1UCYE 1H8HD 3PB1E 2JH5D 1D6WA 1YC0A 1FY8E 5FPYA 2Z6BD 1SKYE 5AFZH 2ODPA 2J95A 2BZ6H 1O2VA 4I8GA 2K1QA 1BTWA 1AKSB 5GCHF 5A09A 2XCFA 2ZC9H 3IG6B 3DCLA 1C5YB 1OPHB 3E0PB 1ZGIA 1V2NT 4LXBH 3H5CB 2ANMH 1EP6A 2A2XH 1P11E 3A7YA 2R3YA 3NWUA 3QZRA 2H6MA 1W12U 1KY9A 2VBCA 1LKAA 2FOGA 1L1JA 2WUCA 2WV4A 1NROH 3PV5A 2FOEA 1YPMH 2PSYA 1FXYA 2GT7A 2ZDNA 3LC3A 3LOXA 5GIBA 1DY8A 4AGJA 2CJIA 1IAUA 1OXGA 4ZMAH 1TX8A 1VKYA 3HK3B 3A81A 1EJMA 3P8NA 5C94A 1QHRB 3E91A 1TBRH 1GI6A 1TMTH 5EGMA 1P2OA 3ATMA 1QL9A 3ZZ3A 5TCAA 3RC6A 2ANKH 2GKVE 1MUEB 1GBCA 4HTCH 3RXPA 4B71A 1FAXA 2PW8H 2ZDVH 3ZZDA 2ZGCA 1OWEA 1TA2A 1L2EA 3A7VA 1WAYB 4HGCA 4NA7A 4H6SB 1OYTH 5A0AE 2CK3D 1OWJA 1PYTC 1Y3XA 4XFQA 1KLJH 4LZ1H 1O5FH 2XCNA 3A8CA 1GMDF 3LT3A 1DANH 4CRFA 1DUEA 1YLDA 4NIVA 2AHME 5C20A 1TE0A 5KGOA 3SNDA 1NFUA 4FUJA 1ZMLA 1O3NA 1Z8RA 3QGNB 3VB4A 1Y59T 3NUMA 4SGAE 2WPJS 2BY9X 1G32B 2ZKSA 1XXFA 4FXGH 3HGNA 2QGRA 4DIIH 2XC5A 1ELFA 5F53A 1GCDA 2NU2E 1YCPM 1GI8B 1KLIH 5FX6A 4B2BA 2OCVB 4ASUD 1O2IA 2GGVB 1C1SA 2QF3A 2QV1A 4TYDA 1IHTH 2P8OC 3RXKA 1TRMA 2LNCA 1FY3A 2UWLA 3QWCH 5C1YA 3QUMP 4RN6A 2CXVA 1V2VT 5HIYA 4BANB 1AZZA 1GGDC 3ZZBA 1ZSJA 2HNTF 5HKKD 3UWIA 2WPIS 3A89A 3EA9A 2I6QA 4WH6A 1MAYA 1P12E 3P6ZB 2BD9A 5T6FA 3VGCB 1WU1A 1V3XA 2QXHA 3BTFE 5T6DA 1E34B 5HXFA 2H5DA 3P8OA 1C1NA 1QJ1B 3W94A 1ABIH 3MH5A 3BTKE 3KF2A 2BD3A 1HAOH 1O3AA 3BEFB 5AFYH 1O30A 1O2QA 1HGTH 1NU9A 3SJ9A 1C4Y2 1GBLA 1EX3A 3BIUH 2ZPQA 1NN6A 1ELVA 2ZG0H 4A1VA 1AWHB 3EYDA 3KN2A 4FU9A 3A8AA 4THNH 2OTVA 1LVBA 2C8ZB 1A0JA 2PUQH 2F9VA 4K5ZA 4H42U 2R0LA 1UVUH 1O2KA 4HG6A 3UOUA 1EZQA 4R8TB 1DOJA 4CREA 4KELA 1BRAA 4OS5A 1HAXB 1D3DB 1DWCH 3NCLA 9LPRA 1ELDE 1D9IA 1LPGB 1O5DH 3DSGA 3BV9B 4A6LA 1GL1A 4SGBE 2BQ7B 4A1XA 1UMAH 3HATH 4AFZA 4YOJA 1QL7A 4CBOA 1QJ6B 1QA0A 1GI1A 3KEEA 3A8BA 2TGPZ 2FOAA 3TNSA 1ACBE 4GLYA 2KCYA 5GCHG 2GV7A 3RMMH 4X6NA 2KCAA 1GJ5H 1FNIA 4YZUA 2OD3B 3U28C 1UK4A 1F5LA 2B8OH 1A5HA 1Z6JH 2BDYA 1BZXE 4AORA 3QDZB 3VG8A 3LGUA 1LVYA 1CGIE 3DUXH 5ESTE 1C5UA 3KQDA 3P8FA 3SO3A 2RA0A 5CE1A 3ODFA 1YCPH 1OWIA 7KMEH 4INLA 4MQAA 1V2WT 1HYLA 3SQHE 2FI4E 2GJGA 1D3QB 5DGJA 2EI7A 3V0XA 3F1SB 1C2LA 1SBWA 1O2PA 4WJG2 2QYIA 1GMCF 2VIVA 1UTKA 5C3NA 3OEED 2ZU1A 1Y8TA 3GCHC 1C1PA 5F8XA 1ESBA 4U01A 5IYTA 1O3HA 1HJAB 2ZDLA 4TY6A 4MVNA 1UVOA 1RXPA 2ZGHA 2ZP0H 3UNSA 1K28D 2KCOA 2WPLS 3NXPA 4FU8A 1JOUB 4DVAU 1NBME 1K2I1 2BDGA 1P06A 3TJNA 1T8MA 4Y6DA 5EXLA 2QA9E 4XRNA 3H7TA 3SNCA 3SZEA 1WUNH 3OU0A 4YOGA 4F55A 1YWUA 4TWYA 1QRXA 3SNAA 2W3KA 2FLRH 4YT7H 1UJ1A 1W14U 2DUCA 1LHDH 1B0FA 1MZAA 1DT2A 2AMQA 2GMTB 4YO9A 2FYQA 4Y11E 3A80A 1WCZA 2O9QA 1C5OH 3GY6A 2FIRH 2ANWA 2SNVA 1Z8JB 3LH1A 2NWNA 1SGIB 4NWKA 2AGGX 5EW1H 4XDEA 3BSQA 2ALPA 4MTBA 3QTVH 4IC5A 2J97A 1TNIA 2BMGB 4P02A 5GNDA 3M5OA 3A7TA 2GZ9A 2BVRH 1P2MA 4TY7A 3SV8A 5A0BA 1C2KA 6LPRA 3BTME 2CMYA 1RFNA 1XMNB 2BD7A 3QTOH 4FOUC 4WMFA 1D6RA 3RXHA 4A5TS 1Z6EA 4WY3A 1FLEE 3F2GA 1EOJA 1C5VA 2BQ6B 2P16A 4IMQA 5DP4A 3V3MA 2R9PA 5SGAE 3FANA 1MQ5A 3SOSA 5K0HA 1ZPCA 3P70B 1E79D 3RXQA 1VITF 4GHTA 1AFEH 2HNTC 2VWMA 3LGVA 3SJOA 1GHAG 1MAXA 2BX4A 1BOQA 3RXJA 3VB7A 1HAVB 1SGTA 4E7RG 2QF5A 1Y3WA 2IN2A 3KQ5A 3JZ1B 2A31A 3TIUA 1SR5C 4FUEA 1C5ZB 1VJAU 1FI8A 3TJVA 3E16B 3RXBA 2FZZA 4BTIB 3QX5H 2OC0A 2J38A 4D7FA 2ZA5A 1V6DA 1SHHB 1QCPA 1HJAC 3E0NB 3RLWH 4NA8A 3MQKC 4YT6H 1JWTA 1O2ZA 3SGAE 5J4SA 3LGTA 1MABB 1NBMD 1O3MA 3SV9A 4DURA 4D9RA 1QA7A 1MD8A 3T29A 1N8OB 3M36A 1O3PB 1KLTA 1BTPA 2FYRA 1C1RA 2KM0A 5EQRA 1OWHA 4ZKRU 1JMOH 3PMHB 5EJ1A 5HM9A 2XYAA 2ZF0H 1GBAA 1W0KD 1C2MA 3U9AH 1O2XA 5DP7A 3RXRA 1BMNH 4KGAA 4B75A 5IDKA 4XBDA 2QF4A 3VXFH 1TONA 1PFXC 1E0FD 2BDAA 1GBEA 4ESTE 1GMCG 4OS2A 1O2GH 4R0IA 1NC6A 2YMSB 2VINA 1O34A 1YLCA 2SGDE 1JXPA 2A32A 1P9SA 4WMEA 1DXWA 1G3CA 3ZZ7A 1ZTLA 2ZCKP 3F0PA 2H5CA 2HWLB 1NFXA 3CENA 3UREA 2HVYB 1BA8B 3A7WA 5FCRA 2YNBA 1TPPA 3BEUA 4Y10E 3ZVCA 1DVAH 1BDAA 1C2IA 1GDQA 1DICA 1GVLA 2GDEH 2KCPA 1AUJA 1LVMA 2BDCA 4ZHMU 2Q1JA 3LONA 3S9AA 2ZDKA 2FOBA 1HJ8A 2BZAA 3UFAA 3VFEA 1W0YH 4Q7YA 2P3FH 1IQKA 1SQTA 3FKSD 1RTFB 4UFEH 2WUBA 1NO9H 3S69A 1ZPZA 3F2HA 1EPTB 1N6YA 5EW2H 1T32A 1YPLH 1S85A 2PHBA 3FAOA 2XWBI 1AFQB 3LKWA 1O3FA 1KMHB 1O2SA 3LU9B 4AFQA 2VVUA 3GCTF 4Y8YA 5C1UA 1O5BB 3OTJE 1SSXA 2AIQA 3MH6A 1NRSH 3BTTE 3TJUA 1BHXF 5JDUB 1MZDA 1LQDB 5DP5A 1ZTKA 4DGJA 3UQVA 3O8DA 5JYIA 2G8TA 1GG6B 1ZHMA 2IOTA 1KTTB 3E90B 1TA6A 1P09A 1SOTA 1J9CH 3DSPA 1D4PB 1GWAA 4Y0YE 3RXSA 1QZ8A 2XOKD 3U8TH 1O2YA 1ELEE 3M7TA 1WSSH 2ZCHP 2G5VA 3KNXA 4AGKA 3T26A 1MKWH 1PPGE 2O8WA 2VIDA 4NSVA 1HNEE 1VITG 1AB9C 2WV9A 1DLEA 3A7XA 1OHHD 1V2OT 4X6MA 4XBBA 2F83A 3RXAA 2R2WU 3SU5A 3QO6A 3LIWA 1TPAE 4NIXA 1TX6A 3U8RH 1KXFA 1WBGB 2ODYB 4RSPA 1ZGVA 4WH8A 1C1UH 2OBOA 1MD7A 2EI6A 1PPFE 1P01A 1KXDA 3A88A 3RU4E 4X8UH 4K3JA 2PKAA 1ZHPA 5DG6A 3U98H 4AB8A 1HUTH 1H9IE 1O37A 5EOKA 1TAWA 2YMSC 2W7SA 1BBRK 2OK5A 1FV9A 4K69A 2ZFFH 1TNHA 4FUHA 1UO6A 4Q80A 1K9OE 3RMOH 2FWWA 1BCUH 1HIAB 1BIOA 1LMWB 2ZHWH 1TABE 2Z9IA 4Q2KA 3PLKA 2BY8X 4YXWD 1BRCE 3K6ZA 2B0FA 4Q7ZA 2ZHDA 2FLBH 2Z3EA 3UR6A 4PROA 2F9UA 1Z7KA 3UB0A 2Z7FE 1J8AA 1AN1E 1NTPA 5AVDA 1AVWA 2Y81A 4AG2A 1MTSA 1O3JA 1K1OA 1OYQA 1T4UH 3UWJH 4X2XA 1WOFA 4ABHA 2VNTA 4X6OA 2L74A 3ODDA 4E7NA 3BG4B 3LJOA 1AO5A 3RXDA 3SV6A 1QRZA 2XRCA 2BM2A 3PTBA 1GBFA 7LPRA 1MTVA 3T62A 4QT8C 3ZV9A 4I8HA 1RTLA 1UK2A 2SFAA 2ZO3H 5BRRE 1F5KU 3EDXB 3SNBA 2V7QD 3MNBA 3PLBA 2O8LA 1C9TA 1P03A 2LELA 2Y80A 1FJSA 4FUFA 1GG6C 1UHBA 3MYWA 1GBJA 1QGFA 2CN0H 4ABIA 4WMDA 3ZVDA 4RKJB 2ZWLH 2ZGJA 1TALA 1GPZA 3PRBA 2BVSH 5A8ZA 4CR9A 2H9EH 5C5NA 3PMBB 4UD9H 1XVMA 1F2SE 1NRPH 4ABJA 2EEKA 3GDVA 2Z9GA 5EODA 4ZCNA 2A7CA 2OBQA 1HAHH 1A5IA 8LPRA 1C2JA 1TGCA 4NG9H 2XBXA 5EQSA 3PWBA 1QB6A 5CHAB 3D49H 1JIRA 1V2LT 4TPYA 3RDZA 3S7KB 1MTNB 1SGCA 2QAAA 1SL3A 1HJ9A 1UK3A 2Y6TA 2FODA 8ESTE 4I33A 3K9XB 3W1EA 1YPHC 1O2OA 4BTUB 4Q4LA 1JRSA 1S6HA 1C5RA 1UVPA 5JBAS 3RU4D 2Y5GA 2OC1A 3B8JA 1SGPE 1KXBA 2JH6D 2XTTB 3P17H 3TLOA 1SGFA 4Y7BA 2BD2A 3I29A 1GJ8B 1ELGA 3BTDE 2C4FH 1GVZA 4AOQA 4FVDA 3M35A 1A3BH 1BMAA 1PPHE 3RXFA 2XW9A 1HB0B 1HV7A 1O5GH 2ZGXH 2PKSB 4VGCB 3VB6A 2XC0A 5B6OA 2FESH 3HKIB 2AMDA 2W3IA 1CE5A 1BMMH 1GJBB 5E8EH 1BQYA 3SV2H 5F8TA 1JBUH 5DSFA 5FBEA 3WWFA 1ETRH 3ZYDA 3EAJA 3V13A 2AERH 1LTOA 3TGIE 1K1JA 2HLDD 4U2WA 2XBWA 1EQ9A 1AY6H 1O2NA 1SFQB 3A82A 2BLOA 5EU8A 5EQQA 5C1XA 4NCYA 3AW1A 1ZYOA 1YYY1 1RJXB 2STBE 3BG4C 2OLGA 1MQ6A 4M9FA 3F68H 4BOHA 2G51A 2CGAA 2WYJA 1GJDB 3MMGA 2GT8A 2SGQE 4YLQH 1OP0A 3RM2H 1ANDA 4KKDA 4TSFD 2WPHS 1XXDA 2OUAA 1ZJKA 4ZHAA 1TGBA 1KSNA 2H1UA 1WXRA 3UTUH 4IW4E 3A87A 1SGEE 4B1TA 1VR1H 1FPHH 3GDUA 3Q3KA 2Y5FA 3UPEA 2GX4A 4TPIZ 5DP8A 2OQUA 4CRBA 1UCYH 1SQAA 3B23B 4WXIA 1LVOA 4DT7B 1TFXA 4B76A 1G9IE 3GY7A 4MNYA 5LH8A 3LDXH 4I8LA 1GDNA 1Z1JA 1EP5A 5CHAC 4YTAA 3U69H 2J9NA 3O8RA 1MTNC 3MH4A 2C3SA 2AS9A 1V2TT 1KXCA 1G3BA 3FN8A 2HPQH 5DK1A 1SGQE 1PQ5A 2BB4A 3FP6E 4INHA 4O97A 5FX5A 2NU0E 4MNXA 1EATA 1O3BA 1C5XB 4ABAA 1GBBA 4Z1MD 2Y7ZA 1YY3A 4FUCA 3TH4H 2J94A 1LHGH 3GY3A 3E8LA 2QXGA 2OXSA 1E38B 2V3HH 1LPZB 2KZ4A 1PQAA 2WHXA 3FO8D 3Q00A 1W8BH 5T1VA 4AG1A 2KFWA 4CRAA 1GI2A 4UE7H 3RC5A 1WYKA 1DWEH 2ZQ1A 4K8YA 1PQ7A 2QN5T 3SUDA 2PKSC 2F9OA 1UTPA 4VGCC 3P8GA 4NA9H 4ZXYH 1MKXH 4CRDA 1QB9A 2BY7X 1FPCH 1S83A 3A83A 4JYVH 2Z3DA 3RXGA 1GI0A 5DO4H 1QBOA 2V6NA 2XC4A 3ESTA 1Z71A 1N1LA 4ZAEA 1P05A 4MLFB 1HAGE 2EA3A 4AFSA 4GAWA 2QXJA 1GHYH 3ZVBA 5CHBA 4B6EA 1BUIA 2FTLE 4ZHLU 1SGFG 1YBWA 4H4FA 1QFKH 2BVXH 4JYTA 3SV7A 1K21H 2RDEA 4X1PU 1HAIH 2JIZD 3A84A 2VB0A 1FDPA 1G2MA 1EFRD 5E2PA 2ULLA 2QY0B 1EAXA 4DY7B 3S0NA 1VZQH 2H9TH 3LGWA 2A4OA 1TNJA 1FX0B 2J2UA 1AIXH 4WXVA 3ATWA 1YKTA 5E0HA 1G37A 4RT0A 4JZEH 4NIWA 1WV7H 3TK6A 2HRVA 1DY9A 2F43B 3U8OH 4K1SA 3HPTB 1KDQA 3OTPA 1K1LA 2D8WA 1K1PA 2ZEBA 1ETTH 4O03A 2HVXA 2ZFPH 1C5NH 1WQSA 3M7UA 3RXTA 3VB5A 3TK9A 1TNGA 3VGCC 1A2CH 1EB2A 3ITIA 1GHXH 2O8MA 1TPSA 2V3MA 3VB3A 4AYYB 2F9PA 3VPKA 1C5MD 1GMDG 1O2RA 1YCPK 1GL0E 1TWXB 1YPEH 1QR3E 3KQCA 8KME2 1BRBE 1LHCH 1HAVA 3PMJA 2G4UA 1AGJA 3RXVA 4NZLA 3QZQA 2G4TA 2ZHQH 5GDSH 2FI5E 1ANCA 5T3HA 6GCHF 4F49A 1K1MA 1V2ST 3T28A 1TOMH 1SGRE 3CS7A 2XBYA 3U1IB 2HALA 4JZIA 3ZZCA 1ZJDA 1SHYA 1FY4A 2PUXB 3KCGH 4BAMB 1A61H 2ILNA 2CV3A 1QJ7B 5EXNA 3SU1A 3KIDU 3RP2A 5A2MH 1KTSB 4NZQA 5GJ4B 3UNQA 1GCTB 1HXFH 1NESE 2ZU5A 5FPTA 1E35B 2VWNA 3SGQE 2SGPE 5JBTA 1QL8A 1Y5AT 2A2QH 2Z94A 1WQVH 4MNVA 1GMHF 2ZFRH 1YPKH 3NK8A 2FS9A 2PSXA 1P10A 4JCNA 2XBVA 2YNAA 3AVZA 1P8VC 2J98B 2AEIH 2JETB 1E37B 1CHOF 2ZDMA 2AYWA 1CGJE 1TRYA 3RXLA 3R0FA 8GCHF 3RXOA 4H6TA 1O3EA 1AE5A 2FEQH 1BTYA 4GHQA 4Y71A 1K22H 3LH3A 3RLYH 4IC6A 2M2AA 3OE7D 4FUBA 1COWD 2B9LA 5A8XA 1XUJA 2BD4A 3FFGA 1A0LA 3I77A 2W7UA 4D8NA 4LZ4B 1PYTD 1YF4A 1SLVB 1SB1H 1IQJA 2Z9LA 1GJ9B 1O3LA 1EXFA 3UOPA 5HGGA 1F92A 2GCTB 1O2WA 3PTNA 1OS8A 1PJPA 1VCPA 2BQWB 3MWIU 3KYFA 1C2GA 1NT1A 4DIHH 1Z8IB 1G2LA 1BMLA 1GBDA 1BBRE 3KYGA 1C5QA 3O8BA 2A4QA 1BITA 5F6MA 3ZYEA 4ACBA 1T7CA 2UUFB 1NRNH 1LKBA 4NFFA 4RKOB 2NU4E 3VXEH 1EOLA 1H4WA 1MTWA 4B2CA 3TU7H 1UTJA 1YP9A 4I8JA 3WW7A 1UTMA 1SFIA 1O3OA 2Y5HA 2WPMS 1HLTH 1S0QA 3MU1A 1O0DH 2OINA 1TOCB 1V2JT 5FBIA 1Y5BT 2BOHB 2XNDD 4ABGA 4F4OC 1X7AC 3RXUA 1W7GH 1A7SA 2GMTC 5ABWA 1C5LH 2FI3E 1SQRA 1WTGH 2BLWA 1C2HA 3ZVEA 4BNRA 1CBWB 1XUGA 3PYHA 1Z8GA 1MCTA 2ZCLP 1B7XB 2BD8A 1MBMA 3SU4A 4AZ2B 1A5GH 1CO7E 4Z0KA 1HPGA 3MO9A 2AFQB 3FZDA 4Y0ZE 1AU8A 2GCHF 1MU6B 5L2ZH 1IHSH
chains in the Genus database with same CATH topology
4X8SH 4IS5A 2TGAA 4XE4A 1G3EA 1GCTC 5FCKA 2P95A 1GJCB 4MPXA 4U32A 1QTFA 3ZZ9A 3LGIA 2FS8A 1ETSH 1RRKA 1O32A 3F9HA 5G4BA 2ZU4A 3ATLA 1ARBA 2H2ZA 2ALVA 1RD3B 3GCNA 1S84A 2STAE 1GHWH 2ZTXA 5C67A 2VVCA 3GY8A 5F8ZA 2JETC 4ZUHA 3KQBA 1TYNA 4MPWA 2BXUH 2AMPA 3GCOA 1GI5A 2QF0A 2UWOA 3M37A 3G01A 4Z6AH 3DFJA 1DITH 4X2YA 1T4VH 3FP8E 1QNJA 4LK4A 2GD4B 4WVPE 1W2KH 3RM0H 1IQHA 4GPGA 4D9QA 3GY4A 4WWYA 1XKBC 1TMBH 1AZ8A 2HNTE 1EUFA 1V2KT 2GCTC 1DPOA 3HK6B 2ZPRA 3ZZ4A 2O8TA 4AFUA 2BOKA 5JB9S 3BN9A 1WTHD 2VU8E 2A1DB 2V0BA 2RG3A 1YGCH 1G36A 1ID5H 1CT4E 4ISOA 1VCWA 3SI4H 1B0EA 2C8YB 5C2ZA 1HAZB 1TBQH 4TWWA 4MPVA 2G55A 3ZV8A 1EKBB 2D2DA 1N8OC 4NSYA 5EPNA 2Y82A 3SGBE 1MH0A 2W5EA 4K60A 2WYGA 2XXLA 3M3TA 3QK1A 1XUIA 1O3KA 3GYLB 1THRH 1TQ0B 8GCHG 2A0QB 3RXEA 1Y5UT 2A5KA 1Y3UA 3GISB 3BTQE 4KP0A 1SLXB 4CRGA 2BDIA 1C2EA 4IBLH 4OS6A 1CGHA 2FDAA 4OGXA 2ZI2H 3KHVA 5AF9H 1HFDA 1RGQA 1OKXA 4Y76A 2AGIX 1W10U 3DFLA 4B73A 5I46H 3SHCH 4IN2A 1CBWC 1H8IH 4BAQB 1SI5H 1G30B 1P2NA 2J34A 1O3GA 1Y3VA 4ISNA 7GCHF 3ATKA 2FOMB 2Y7XA 3MHWU 2EC9H 1S81A 4GVUA 1XUKA 4CRCA 3RMNH 2OP9A 1TGSZ 1XM1A 4ZKNU 1MKWK 1QURH 1AKSA 1ZHRA 2GVFA 2THFB 3ENSB 3PWCA 3V12A 5DP3A 1GHZA 1ANEA 3SJIA 3SHAH 1O31A 2YOLA 3Q77A 5DPAA 4X1NU 3SU0A 4DJZB 4J1YA 2V35A 3GY5A 2BYAX 1T8LA 3SUGA 2TRMA 2TGTA 1F0TA 2ZTYA 1EPTC 1UTNA 3M7QA 3MU0A 1C1WH 4YESB 3EA7A 4ABEA 1ANBA 2EI8A 3AAVA 1AFQC 4UFDH 1Q3XA 1XKAC 2VJ1A 1UTLM 3DD2H 3E1XB 2Z9JA 1GVKB 2PV9B 3LPRA 1NFYA 1EB1H 1W13U 2ZIQH 1DWBH 1NS3A 3SN8A 4LOYH 4BAHB 3BG8A 3S7HB 2C93B 1O2HA 4NFEA 2J92A 1EASA 3T27A 4YOIA 2KAIB 4DW2U 1IQLA 2FX4A 3CS0A 3ZZAA 2QXIA 1HBTH 2WV5A 2A7JA 4BXWA 1SOZA 4UONA 5K7RA 1ZLRA 2PKAB 1UTOA 2R3UA 4U30A 1V2PT 3K65B 1RTKA 4K8BA 5L30H 3TJOA 5FXLA 1DWDH 4DOQA 2QC2A 1S6FA 1HAPH 1ESAA 1PPEE 2GZ8A 4Q7XA 1YM0A 2ESTE 3MO6A 2AH4X 3QLPH 3LC5A 4FUIA 1O3CA 2SGFE 3SUEA 2M5TA 4OS1A 1CU1A 1HAYB 3MU5A 1BRUP 2FP7B 5T6GA 3GCTG 2DE9A 4XSKU 1ELAA 2ZHEH 3SORA 4ZH8A 1GI9B 3MNCA 3PM3A 3SZNA 1V2MT 1DS2E 3Q3YA 2C8WB 1S5SA 2ZGBH 4AYVB 1DX5M 3M3SA 1INCA 1CA8B 1F7ZA 2FXRA 5EG4A 2RCEA 4YM9A 3IITA 4KTSA 4YLUA 5TJXA 1SQOA 4BAKB 2W26A 1CQQA 1P2QA 1H9HE 5GWZA 2ZFQH 2F9NA 2VIPA 4NGAH 1TB6H 2H9HA 1ZRKA 1DSTA 4CH8B 1IQMA 1O5EH 3GDSA 2ZPSA 4D7GA 1GI4A 2Q6DA 4HZHA 5EPYA 1S82A 1JIMA 1ORFA 1GI7B 3L33A 4CHAB 1A0HB 1LQEA 1UHBB 3I78A 1ZPBA 3OY5U 3SBKA 4ZKOU 1XX9A 4X1QU 5JBCS 1FQ3A 4INKA 4I7YH 1MCVA 1IQGA 5DP6A 3TH2H 3JZ2B 3SU2A 2Q6FA 1P2IA 1C9PA 1N6XA 2PGBB 3RXIA 5TCCA 4A7IB 1XUHA 1V2UT 2UUJB 4MNWA 7GCHG 3EE0B 2OC7A 3M5NA 3M5LA 4Y7AA 3HGPA 1AQ7A 1CA0B 1L0ZA 2PWXA 1ZRBA 1C2FA 3MU4A 4MG3A 1J15A 1GHVH 1OX1A 5E0JA 2J4IA 3PLPA 1W0ZU 3FVFB 1W7XH 3A8DA 2HPPH 3GCHB 2NU3E 3CP7A 4JMYA 1NM6A 5LPEA 1BTHH 3S9BA 1HCGA 1THSH 1O39A 1OWDA 3OYPA 1HXEH 1L4DA 1BJVA 3KGPA 4MDSA 4UFGH 2P59A 3SQEE 1F0UA 3W95A 4MPUA 1IQIA 5AHGH 2GDDA 4ASHA 2D1JA 2JKHA 3EQ0H 2G52A 2VWLA 5DKMA 4BTTB 1ZTJA 1ZR0A 1KXEA 1BB0B 1GJAB 1DM4B 1C5TA 3IWMA 1AVXA 4JZ1A 2BHGA 1FUJA 2TGDA 2BLQA 1FZZA 1FAKH 1FONA 1H9LB 1O35A 2PLXA 2VIWA 4FUDA 1GHAF 6ESTA 1BTUA 1F0SA 3SW2B 1PPBH 1L4ZA 2FO9A 3ZZ5A 4CBNA 1O5AB 1GBTA 1O38A 1TRNA 1AWFH 5ETXA 2PFEA 1V2QT 5FPSA 2UWPA 1PPZA 3DHKH 4ABBA 1UCYK 1OSSA 4Y79A 3SNEA 4WF8A 1TQ7B 4I8KA 4M7GA 1NRRH 3BTEE 4XBCA 1QQ4A 1YPHE 4GCHF 1C5SA 1THPB 1C4V2 4AX9H 1EAWA 1K1IA 2UUYA 2ZNKH 1P02A 1TIOA 3MI4A 5LPRA 1OP8A 5JBBS 3SJ8A 5DP9A 1C1VH 1GI3A 2PR3A 3Q3XA 1CVWH 2TBSA 2GP9B 1BTXA 2CF8H 1TNKA 1O2JA 1C1OA 1O5CB 3UNRA 2BY5X 4CHAC 4A1TA 1O2MA 1VITH 1NY22 3TVJB 2TPIZ 2P94A 2A4RA 3PV4A 3UY9A 1DLKB 1ZOMA 1TGNA 4K1EA 1RS0A 1QB1A 1P2JA 4ISLA 4X1RU 3ZZ8A 4X2VA 2ZU3A 4I32A 3ELAH 2BTCE 3NZIA 3B9FH 1M9UA 2C8XB 3K6YA 1MKXK 3SUFA 3C27B 2G5NA 1CA0C 1NPMA 4FUGA 2ZDAH 3OSYA 3BTHE 3D23A 4JK6A 4KTUA 4FU7A 2BX3A 1DXPA 1O2UA 4BAOB 4UEHH 1VCQA 2FX6A 4ZXXH 5C5OA 5L2YH 3V7TA 1QIXB 1HRTH 3UR9A 5L6NH 1GBHA 1AVGH 2PTNA 2R2MB 3BTWE 1E36B 1P04A 3MNSA 1J17T 3DA9B 1BT7A 3PO1B 2CHAB 2SGAA 4HI3A 1VGCB 1ELCA 4D76A 2TIOA 1XUFA 2QCYA 1MMJN 1NU7B 2ZFSA 2VGCB 4JZDH 4Y8ZA 5JPMH 2P93A 4JZFH 1ZZZA 2HLCA 3LJJA 4E06H 1TBZH 2FM2A 3UQOA 5GPIB 1KIGH 1LHFH 4A92A 1GHBF 1QBVH 3ZVGA 3C1KA 1SGYE 2QIQA 3TK5A 3T2NA 4O3TA 1CT2E 2Q6GA 2Z9KA 1O3IA 3RC4A 2GV6A 1NRQH 2F9BH 3DT0H 1T8OA 3H7OA 1T31A 3ZVFA 2NU1E 1FY5A 1ZSLA 1H8DH 1B5GH 2SGEE 3EA8A 4JYUH 2HGTH 1AMHA 1MU8B 1RIWB 1LDTT 1S0RA 4X2WA 1IOEA 3AW0A 1HDTH 1KDQB 4X6PA 1EZUC 5E0GA 3MFJA 3GICB 2F3CE 1W3CA 2XNIA 1Z1IA 3N7OA 3UIRA 1UVTH 3AAUA 1KYNA 1CHGA 1O33A 1P3EA 4GUXA 3F9EA 4ZROA 1K1NA 1Q31A 3KQEA 1A46H 3TH3H 3MO3A 4Y8XA 2VWOA 1A3EH 1SMFE 3PMAB 5LPFA 5PTPA 3T5FH 4ZKSU 1ESTA 9ESTA 4I31A 1SGNE 3ATIA 4AN7A 3M5MA 1TMUH 3VEQB 1FIZA 1AHTH 4B2AA 3U1JB 1FMGA 2ZHFH 4K2YA 2BDHA 1A4WH 4O3UA 1C1QA 2F91A 1YPGH 7ESTE 3A86A 2CF9H 3GYMA 2PTCE 2VIOA 2FOCA 4GCHG 1JRTA 4ABFA 3L6PA 1SLUB 3EGKH 2XWAA 1EPTA 3WY8A 3RMLH 5ESBA 4BXSA 4JK5A 1DUAA 2IJOB 1C4U2 4OS7A 3GOVB 3RXMA 2ZZUH 1LCYA 4ABDA 3RXCA 3PO1C 1GJ4H 5FAHA 2A5IA 1SVPA 2CHAC 1VGCC 4OGYA 4X0WU 4CR5A 1AB9B 1BJUA 3RUOA 2VGCC 1C1MA 1SPJA 4NIYA 4FVBA 1FN6A 2OC8A 2FOHA 2BD5A 3A85A 3Q76A 1G3DA 1LHEH 2JH0D 4UDWH 3T25A 2OQ5A 2P3TB 1F0RA 2O8UA 2GZ7A 3MOCA 3KL6A 1O3DA 4AB9A 2ODQA 4X1SU 4ISHH 1Q2WA 1GBIA 2SNWA 1GJ6A 3STIA 2FTMA 3K2UA 1IQFA 1SG8B 2D26C 3AASA 3RU4T 3UUZA 2ZECA 1SLWB 1VJ9U 2GTBA 1NFWA 1UTQA 1EAIA 3BIVH 1XVOA 1EZSC 2A45B 2VH0A 3LGYA 3HKJB 3E3TA 5LGOA 1QBNA 1C2DA 1RIWC 2VIQA 2G81E 1EJAA 3F9FA 6GCHG 3MNXA 2A5AA 3F6UH 4DG4A 1C5WB 3FZZA 1DDJA 5A0CA 4X8VH 1O36A 2HOBA 4UFFH 1LPKB 2UUKB 1U6QA 3STJA 2Z3CA 3URCA 2ZTZA 6CHAB 3M3VA 1IQNA 2BDBA 1GHBG 1ABJH 2I6SA 5HMAA 3SI3H 2PGQB 1QQUA 1ARCA 1HIAA 2B7DH 5EXMA 2P3UB 1GDUA 1L1GA 5H4IB 3D62A 5F03A 2R0KA 2ZQ2A 1ZMNA 1P3CA 1ELTA 1AI8H 4E05H 1D3PB 2FOFA 1GMHG 1EJNA 1FIWA 1ZSKA 2A4GA 5E2OA 1TGTA 2V3OH 2A7HA 3SU3A 3NKKA 2BLVA 3PROA 1O2TA 5BPEA 2BXTH 4CH2B 1CHOG 3R3GB 3URDA 1L1NA 1J14A 1DFPA 1BBRH 3GY2A 4DCDA 3OY6U 1C5PA 1TLDA 1ZMJA 3F9GA 3P95A 3ZVAA 5A8YA 3MTYA 1MTUA 3M61U 3MH7A 2LPRA 1P57B 2VH6A 1J16A 2RDLA 2ANYA 4X8TH 2WINI 1AUTC 3A7ZA 1QY6A 3SU6A 3QN7A 2DE8A 3S9CA 1OOKB 4IMZA 5CMXH 1QRWA 4ISIH 2ASUB 5HM2A 4NWLA 1TX7A 1AE8H 1O2LA 4IN1A 4OS4A 1KXAA 2VVVA 1FN8A 2KAIA 3TITA 2WPKS 3OX7U 4KTCA 4HFPB 5I25A 2RA3A 1Y3YA 1D3TB 1YPJH 1GBKA 1NZQH 4J2YB 1V2RT 1OWKA 2AGEX 1F5RA 5JB8S 4O9VA 1IQEA 1DSUA 3ZZ6A 3NPSA 1P9UA 1SC8U 1SGDE 5GXPA 2ZU2A 5J4QA 5HYOA 5DJ7A 2AIPA 3BEIB 1GJ7B 1EAUA 3E6PH 2FMJA 1ELBA 1A1RA 3L3TA 3TGJE 1OP2A 3QGJA 3FP7E 4XOJA 1C1TA 1H1BA 1BHXB 3TPIZ 4B74A 1BTZA 1PPCE 1W11U 1AD8H 1DE7H 2BY6X 5FHTA 2G00A 1P0SH 1UVSH 1FY1A 3BTGE 2IPHA 4K1TA 1EZXC 4IGDA 2C90B 3O8CA 4GSOA 3P92A 1TPOA 2B5TB 6CHAC 2ZFTA 1T8NA 2GCHG 1CSOE 3MU8A 3D65E 1GBMA 2P8OB 3BF6H 2FPZA 1PQ8A 3TGKE 1LO6A 1TNLA 1CT0E 3TNTA 1MBQA 1GGDB 3SJKA 1P2KA 1UCYE 3PB1E 2JH5D 1D6WA 1YC0A 1FY8E 5FPYA 2Z6BD 5AFZH 2ODPA 2J95A 2BZ6H 1O2VA 4I8GA 2K1QA 1BTWA 1AKSB 5GCHF 5A09A 2XCFA 2ZC9H 3IG6B 1C5YB 1OPHB 3E0PB 1ZGIA 1V2NT 4LXBH 3H5CB 2ANMH 1EP6A 2A2XH 1P11E 3A7YA 2R3YA 3NWUA 3QZRA 2H6MA 1W12U 1KY9A 1LKAA 2FOGA 1L1JA 2WUCA 2WV4A 1NROH 2FOEA 1YPMH 2PSYA 1FXYA 2GT7A 2ZDNA 3LC3A 3LOXA 5GIBA 1DY8A 4AGJA 2CJIA 1IAUA 1OXGA 4ZMAH 1TX8A 3HK3B 3A81A 1EJMA 3P8NA 1QHRB 3E91A 1TBRH 1GI6A 1TMTH 5EGMA 1P2OA 3ATMA 1QL9A 3ZZ3A 5TCAA 3RC6A 2ANKH 2GKVE 1MUEB 1GBCA 4HTCH 3RXPA 4B71A 1FAXA 2PW8H 2ZDVH 3ZZDA 2ZGCA 1OWEA 1TA2A 1L2EA 3A7VA 1WAYB 4HGCA 4NA7A 4H6SB 1OYTH 5A0AE 1OWJA 1PYTC 1Y3XA 4XFQA 1KLJH 4LZ1H 1O5FH 2XCNA 3A8CA 1GMDF 3LT3A 1DANH 4CRFA 1DUEA 1YLDA 4NIVA 5C20A 1TE0A 3SNDA 1NFUA 4FUJA 1ZMLA 1O3NA 1Z8RA 3QGNB 3VB4A 1Y59T 3NUMA 4SGAE 2WPJS 2BY9X 1G32B 2ZKSA 1XXFA 4FXGH 3HGNA 2QGRA 4DIIH 2XC5A 1ELFA 1GCDA 2NU2E 1YCPM 1GI8B 1KLIH 5FX6A 4B2BA 2OCVB 1O2IA 2GGVB 1C1SA 2QF3A 2QV1A 4TYDA 1IHTH 2P8OC 3RXKA 1TRMA 2LNCA 1FY3A 2UWLA 3QWCH 5C1YA 3QUMP 4RN6A 2CXVA 1V2VT 4BANB 1AZZA 1GGDC 3ZZBA 1ZSJA 2HNTF 3UWIA 2WPIS 3A89A 3EA9A 2I6QA 4WH6A 1MAYA 1P12E 3P6ZB 2BD9A 5T6FA