1BRBE

Crystal structures of rat anionic trypsin complexed with the protein inhibitors appi and bpti
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKGSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPDVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex(proteinase/inhibitor)
molecule keywords TRYPSIN
publication title Crystal structures of rat anionic trypsin complexed with the protein inhibitors APPI and BPTI.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1992-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1brbE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1brbE02
3M3TA 4WMDA 1XX9A 2J2UA 2QA9E 3ATWA 4I8GA 3ENSB 4R0IA 3A86A 5I46H 3D65E 3M7TA 1KDQB 2F91A 2FOGA 5JBBS 4AYVB 3SHCH 3OSYA 1WTHD 1VJAU 1WOFA 3DFLA 3MFJA 1HAZB 4XSKU 2VJ1A 1L4ZA 1KIGH 4SGBE 4NIXA 4ASHA 2R0KA 1GVLA 1ARCA 4UD9H 2XWBI 2H6MA 3K65B 1KY9A 1O2HA 3ATMA 3RMMH 1GG6C 2OTVA 2YNBA 1F92A 1Z7KA 4I8JA 1QRZA 3E90B 3AW0A 4NIWA 2G52A 5LPRA 1O2XA 3EYDA 4YM9A 3T29A 1DICA 1L2EA 3LGTA 5IYTA 3A89A 5GIBA 1BRCE 2XNIA 4NFFA 1Z1IA 5BRRE 4HI3A 1EAXA 1SBWA 4Y7BA 4OS5A 3A84A 1TB6H 1XUIA 1BTPA 2A1DB 1YGCH 2O8LA 2AIPA 3GCHC 2RG3A 4MDSA 3A7TA 1NT1A 1HPGA 4AFQA 2ZDLA 1UVUH 4X6MA 3T28A 1TNHA 2GMTB 1GCTC 4UFFH 4BNRA 1GHWH 1EQ9A 2XCFA 2O9QA 1EASA 1RXPA 3LPRA 3WY8A 1ELTA 1TGSZ 1AUJA 2ZFQH 1GBFA 1TA6A 1WQVH 1LO6A 3HK3B 1TRYA 1GL1A 1QJ1B 3C27B 1KTTB 1OWKA 4PROA 3M5MA 3O8BA 1VZQH 2XW9A 1GBJA 2PV9B 4MPXA 1QQ4A 2Z3CA 3ODDA 4GCHF 4O3TA 1AHTH 2BVSH 1Y3VA 2CHAB 1A0LA 2ZHWH 1IQKA 2SGFE 4ABHA 2ALVA 3P17H 1O2SA 1TALA 2F9PA 4RSPA 1GL0E 4NCYA 3SV7A 1Y8TA 1TX8A 3UR9A 1BDAA 3VPKA 1C2EA 4MLFB 1UTKA 2V3HH 4CRDA 1C5QA 1S5SA 3BF6H 5T6FA 1C4Y2 2AGGX 3RXUA 3JZ1B 1RIWB 1HCGA 1CU1A 3QGNB 1PPBH 1TIOA 2BLWA 2SGDE 4A1VA 3DA9B 1LPGB 2HALA 5T6GA 2VVVA 3BTHE 1BTUA 4GLYA 4XBBA 1DE7H 2UUFB 1EB2A 1DXPA 4DIIH 1DANH 5FXLA 1V2RT 1ZTJA 1K1PA 5EG4A 4IGDA 1O2ZA 1D4PB 3RMLH 2F83A 3RM0H 1MZDA 2FXRA 3JZ2B 2GT8A 1ZLRA 4DCDA 2O8UA 1BOQA 1TMTH 1FV9A 4AG1A 1HAHH 4IC6A 1K21H 2AMPA 1TX7A 1XUKA 2GDEH 2XRCA 1SGIB 1J8AA 1F0UA 3RXIA 1ZPBA 2BD9A 2ZNKH 1BA8B 1OKXA 2FOAA 4IMQA 2VGCC 1NZQH 2FI4E 5K7RA 3GCOA 2A45B 3TJVA 1Y3YA 5ABWA 3H7TA 2AERH 1QR3E 1K1NA 1SGCA 1O5BB 3MU8A 1VGCB 4X1NU 5EGMA 1D9IA 2WPKS 1MTNB 2R2WU 3QTOH 1JBUH 3P70B 3O8RA 3TGIE 1O5FH 1C5PA 3D23A 3PO1B 1Z1JA 1C2KA 1HJ8A 3SHAH 1LVBA 1SLUB 2PW8H 2ZGJA 1ZZZA 2AEIH 1QL7A 3E3TA 3UFAA 2ZDVH 2GDDA 4Q7YA 1XUGA 5EXLA 1QFKH 2CF8H 1W0ZU 1W14U 1CA0C 2ZDKA 1EPTB 2RA3A 1Z6EA 2ZIQH 4JZDH 4ISNA 1TBRH 1ZR0A 3P6ZB 1ZYOA 1A2CH 1QA0A 4JYVH 3RC5A 1O2NA 1HDTH 3PLBA 2GCTB 2Z94A 1O3GA 3SNCA 4NIYA 1LHGH 3A85A 3C1KA 2V3OH 2BY6X 3FP7E 1YM0A 8KME2 4TPYA 1AE5A 1C5UA 1HAOH 4TYDA 2TGTA 3W95A 1NC6A 4AORA 3GDVA 1RFNA 5L2YH 2ZPQA 3V13A 3T2NA 1QL8A 3UNSA 3S7KB 3D62A 1SLXB 1V6DA 2PKSB 3TNTA 3EQ0H 1N6YA 1SGEE 4K2YA 1OWJA 2BX4A 4YTAA 2ZC9H 2VVCA 3ZVGA 1W3CA 1ELGA 1NFWA 3M61U 3RM2H 1FPCH 1UCYE 1LTOA 4MG3A 1V2VT 4YO9A 1P8VC 2J38A 1CO7E 4FUDA 4YOJA 1C1SA 3BG4B 2FOBA 2LNCA 2FWWA 3AW1A 3RXEA 1PQ5A 4FUBA 5G4BA 3CS7A 2JH5D 3ZZ8A 1RRKA 4DGJA 5T6DA 1LVYA 1TNJA 1GJCB 4TY7A 2ANMH 2PKAA 1GHAG 2C4FH 3H7OA 2NU4E 5DP6A 1P11E 1T8NA 4YZUA 2TBSA 2D1JA 1W7GH 4D7FA 2JETC 2GTBA 1FN8A 3MOCA 1DWCH 3RXKA 1FY1A 3QO6A 4B76A 5EU8A 4X0WU 1C4U2 1OOKB 1GG6B 9ESTA 2HWLB 1SGYE 3MNCA 2ZDMA 2ZTYA 3QZQA 3KF2A 1YPLH 1SGNE 1AMHA 1EP6A 1LHCH 2VH6A 4J1YA 1BCUH 2SGEE 2BDHA 1GJ8B 3A82A 1UHBA 4K5ZA 1THSH 5DG6A 3ODFA 2ZHQH 1L4DA 1KXCA 2J94A 3UWIA 4XOJA 1RJXB 5GJ4B 1J14A 1GMDG 4RKJB 1ZMLA 4Y7AA 5ETXA 3RXFA 4Y76A 5A8XA 5HM9A 4AN7A 1C9PA 2QY0B 4DIHH 1GCTB 2PSYA 3OY5U 2H9HA 1SOZA 2ZHEH 1F2SE 1KLTA 2GX4A 1SGQE 2XBXA 4ZKOU 5FPTA 3K6ZA 3BTGE 5J4SA 4NSVA 2D2DA 1YPHC 2BY5X 1P12E 1W7XH 2XBYA 3TJNA 2BDAA 1PPHE 3F9GA 1ELCA 1JOUB 3RUOA 4ZHAA 3N7OA 3PV4A 1P2NA 2BY8X 1J17T 4F49A 1FY8E 1B7XB 1NESE 1O38A 1P2QA 2GMTC 5K0HA 3K6YA 1T4VH 1GBMA 3UWJH 1H9HE 2NU3E 1TBQH 3NUMA 2FI5E 4MPUA 4YOIA 2ZFPH 3P95A 3SJKA 1ACBE 2EI8A 4X2XA 1BMLA 1GGDB 4UFEH 1IQFA 1IQIA 1C2HA 1C1WH 1TPPA 1U6QA 5H4IB 2XTTB 3RXGA 4ABDA 1A5HA 1UO6A 3AAVA 1VCQA 1XKAC 2OC8A 3BG8A 1WUNH 5A8YA 2ZU4A 5AVDA 2BX3A 2ZG0H 2AYWA 4X8TH 2CMYA 2Y81A 3IG6B 4ZKSU 1GMCG 1HXFH 1K1OA 1ZGVA 1O32A 1MBMA 2GZ9A 2CF9H 4Q7ZA 2FLRH 1HAXB 5F8XA 3A81A 3NKKA 2PGBB 1SI5H 1Z8IB 3BSQA 1Y5BT 1WU1A 3A8CA 4FU8A 2CN0H 1UJ1A 4WH8A 1THRH 5F03A 3RP2A 1MCVA 2GKVE 2OUAA 3RU4T 3ZVAA 2HLCA 1S83A 1AIXH 3MWIU 3HGPA 1TNKA 1P3CA 1JIRA 1OWHA 1O3HA 1HJAC 1YP9A 3QGJA 2VGCB 2J95A 1AN1E 3GY8A 3GY4A 4BAQB 2RA0A 2FODA 3GDSA 1TOMH 4YOGA 4D76A 2HNTF 1FJSA 2FOMB 2VWOA 3KQDA 1A7SA 1MKWK 1HAVA 2W7UA 4MVNA 4UFGH 4A1XA 4BANB 1QTFA 1O36A 3GDUA 1ZOMA 2GVFA 3BTTE 1RS0A 2Z9LA 3BTFE 1FIWA 5E2PA 4CREA 1LDTT 3SNEA 3QDZB 3ZZ3A 1WTGH 4BOHA 4AYYB 2B7DH 2CJIA 1GMDF 3B8JA 2BTCE 1GBIA 3EDXB 1C5VA 1AGJA 1V2PT 3SV8A 1DWBH 3IITA 1AVWA 1A4WH 1SLWB 1D3TB 1MTSA 3RXCA 1VGCC 2C93B 4FU7A 5DKMA 3GCTG 1F5LA 2HPQH 1MTNC 1IAUA 1O5EH 2A2QH 3E8LA 3EAJA 1K1JA 4JZEH 1AB9B 1J16A 1L1GA 1UVTH 2J9NA 4KELA 3PO1C 3FANA 1GI8B 2HRVA 2VWNA 3UY9A 3RXQA 1O39A 1BMAA 1G3EA 2FTLE 1GI5A 2XC4A 1J9CH 4NWLA 1RTLA 1RTFB 1DWEH 1HAGE 3SI4H 1CA8B 4YT6H 4XFQA 1Q3XA 1EPTC 1YCPH 2PUQH 5EW2H 3LJOA 3RXPA 4B2CA 1AFQB 5EPNA 4D8NA 3Q3XA 4XBDA 5DP3A 1EOJA 3KQBA 2Q1JA 4MTBA 4K8YA 1HB0B 5A0BA 2EI7A 2PWXA 3CS0A 1BMNH 1FNIA 2AMDA 3U8RH 1OYQA 1O5DH 4U2WA 5FCKA 1HJ9A 3M37A 2W3IA 1GMCF 4E7NA 3AVZA 1XUJA 3SV6A 4FUIA 1UTPA 4K8BA 3RXDA 3ZVBA 1V2ST 2WPLS 1HRTH 1K1MA 1Y3WA 1CT4E 3V7TA 1MQ5A 3BTDE 3PMJA 4OS6A 3GY3A 4Z6AH 1ZSJA 1H4WA 2BDYA 1SQAA 1CE5A 1PQ7A 3O8CA 2BZ6H 3UIRA 1BRAA 1D6RA 4AB9A 1TGBA 4IW4E 1HFDA 4I8KA 1GJ7B 3P8NA 5DP4A 1DOJA 1QNJA 3ZVFA 1QGFA 7ESTE 1W13U 2ZO3H 3SNAA 3BG4C 1FMGA 4I33A 4YLUA 2ANWA 1GJ5H 3M36A 3PM3A 1GJ9B 3RXRA 2A4RA 5DPAA 4BAHB 2RDLA 1XM1A 2A4OA 2AIQA 5DJ7A 3RXBA 1YCPK 2W26A 1O33A 1GI2A 5C5OA 2YNAA 1GDNA 1MQ6A 1SGDE 5E0JA 1DLEA 4ZHLU 3OU0A 2XYAA 2SNWA 2ZZUH 3P8OA 1SGFA 3SQHE 3GCTF 4U01A 2ODYB 5L2ZH 1F0TA 2ALPA 3Q3YA 7GCHF 1P9UA 4INKA 1P2KA 1P2IA 3ZVDA 1W2KH 4OS2A 4ZMAH 4GHTA 1UTOA 2OC1A 3NCLA 4UONA 5HM2A 3VB3A 1O5AB 3RXMA 1FN6A 3GY2A 1BBRE 2BXTH 2OC0A 1YPJH 2FLBH 2P8OB 3PMBB 4HFPB 3T5FH 1QB9A 5EPYA 3EE0B 5EW1H 4J2YB 1D3DB 1ELDE 1C5SA 1ZMNA 4XBCA 3K2UA 4ZXYH 1P9SA 3PWCA 2STBE 1FAXA 2OBQA 1ZRKA 8GCHG 1PQ8A 3BTEE 1WAYB 1P06A 3V3MA 3HKIB 2FDAA 3M5OA 5GDSH 1FZZA 1TNLA 1CGHA 2FYRA 2ZFSA 1C5XB 1WSSH 1WQSA 2UUYA 1CBWB 1X7AC 3M5NA 5I25A 2K1QA 2J34A 3LONA 3MH6A 2QYIA 1VJ9U 4K1SA 1VCWA 2BMGB 5JBCS 1AVGH 1C2LA 3Q76A 3RU4D 1AKSA 1P04A 2M5TA 2A32A 5C1XA 2BLOA 2ZKSA 1BT7A 1TGTA 4O97A 1AZZA 1TMBH 2BOKA 1ETTH 2NU0E 3PB1E 1GI4A 3M5LA 1UTQA 2G8TA 2QIQA 3R3GB 1Y5UT 1YCPM 1O2RA 2A5KA 2ZU1A 1P01A 1GGDC 1OS8A 4FUGA 4Z0KA 2HPPH 1ID5H 3STJA 4BTTB 2ZP0H 2FOFA 4MPWA 3A88A 1PPCE 5A2MH 1JWTA 1ABJH 1HJAB 1F7ZA 2Y80A 1Z8GA 1F0SA 2BLQA 2VIWA 1NTPA 4H6TA 2JH0D 4I8HA 1J15A 1AQ7A 1BJVA 5HXFA 3AAUA 5FPYA 1NU9A 3UTUH 6CHAB 3SUDA 2FZZA 8ESTE 1GDUA 4LXBH 4DOQA 1NFYA 1YPHE 1AZ8A 5JBAS 3UQOA 4NZQA 1W11U 1V2MT 3SORA 1GBEA 3CENA 1N6XA 5E0HA 4KGAA 3RLWH 3E1XB 1CHOG 1LVOA 5FPSA 1EX3A 2JH6D 2UUJB 2VIVA 3E0PB 4ISHH 3CP7A 4CRGA 1KXEA 1FQ3A 1AI8H 2Y6TA 2QC2A 3SU3A 1NROH 2P95A 1ELEE 2ZA5A 3MU5A 3QX5H 1QRWA 8GCHF 1IHTH 2SGQE 1TABE 4WMFA 2TIOA 1T32A 2JKHA 4H4FA 2ZDAH 2QXJA 1G3CA 1ANDA 3A7YA 4X1RU 4A5TS 2EEKA 1EAWA 2FO9A 3STIA 5AHGH 2G55A 5T3HA 4DY7B 1PPGE 4A1TA 1MMJN 3SJ8A 2BD4A 1C2FA 3MO3A 2AH4X 2ZI2H 2ZCHP 3U69H 3QLPH 1C1TA 2ZDNA 1GMHF 1AB9C 3GY5A 2Q6DA 5GWZA 4INHA 1QA7A 1DXWA 1C9TA 1MD8A 2ZCLP 2DUCA 5ESBA 3QWCH 2Y5HA 1XMNB 1BTWA 1NRRH 2F3CE 1ANCA 2BLVA 3ZZDA 2ZGBH 3LGYA 1YPKH 1FY4A 1JIMA 1NFUA 4GUXA 3RXAA 2Y7ZA 4Y11E 3ZZ4A 2FS8A 2P94A 4ZAEA 5DP9A 3ATKA 2BD3A 5LGOA 1OP0A 2GZ7A 3PLKA 4NG9H 2THFB 1AFQC 2Z9JA 2QF3A 1SGFG 3E0NB 1IOEA 2QXHA 2FOHA 2GZ8A 1TX6A 2FI3E 2EA3A 2V6NA 3UR6A 1MTVA 3FP8E 1M9UA 1FUJA 1HNEE 4AGJA 3RC4A 1HAPH 1B5GH 3LH3A 3OYPA 4NSYA 3EA9A 1G30B 1PYTC 2A4QA 2BVRH 3LC5A 4KKDA 5DK1A 1SPJA 1EZXC 2B0FA 2VWLA 4OS7A 2A7CA 4SGAE 2PKAB 1PYTD 3MNSA 2C3SA 2B5TB 1UK3A 4H42U 1OSSA 2VU8E 1N8OB 2QGRA 4CH8B 3SBKA 1YPEH 1PFXC 2Y5FA 3T27A 1ORFA 1TNGA 2PSXA 4O9VA 1OWIA 4AFSA 1QIXB 4ZHMU 3KEEA 1QY6A 1ZHMA 2BDIA 4I8LA 2GV7A 1CHOF 1TGNA 3MMGA 1P05A 3TJUA 3TK6A 3BIVH 2BD5A 1K1LA 3SN8A 3A8AA 3V0XA 3M7UA 3VGCB 1KXBA 2Z6BD 1UCYK 3BEUA 3ZYEA 3TK9A 1MTUA 3MTYA 4B2BA 5C20A 1SSXA 1C2DA 1KTSB 3H5CB 3S9BA 2XBVA 2PHBA 1ZSLA 1OXGA 2GCHG 3O8DA 3U1JB 1UHBB 1O37A 1E36B 2ILNA 1OP8A 2GGVB 5JPMH 1K9OE 1BRUP 4JZIA 3U8TH 1IQLA 1C5WB 2YOLA 1QQUA 1P0SH 3D49H 4ABFA 2C8WB 4YT7H 4UDWH 3DT0H 1YKTA 4UFDH 4JYTA 1A5GH 4IBLH 2Z3DA 3ATIA 5BPEA 2OBOA 2WPJS 1FY3A 3NXPA 2AGEX 1L0ZA 2OLGA 4ABEA 3PMHB 2QF0A 1C2MA 4FUHA 2XBWA 2P8OC 1QBVH 1O5CB 3L3TA 1G9IE 1O2WA 3GISB 1KSNA 2J4IA 2FM2A 2IJOB 1XXFA 4ZKNU 3TIUA 3RXOA 5LH8A 3TH3H 1PJPA 1F5RA 2TGDA 1V2WT 1G2LA 3ZZ5A 1S81A 1KLIH 1GI1A 1E37B 3ZZ6A 1AO5A 2A4GA 2WUCA 1IQGA 2IOTA 1MKWH 2BDBA 2H5DA 1CBWC 1EZUC 1E0FD 1LPZB 1QCPA 5FBEA 2HNTC 4E7RG 3SU0A 4K60A 1O2MA 3PMAB 4MNVA 1ANBA 1GHBG 1XVMA 1C1NA 4LOYH 4X1QU 5TJXA 1DITH 4QT8C 4X8VH 4FUCA 1CGJE 1TBZH 5DGJA 5EODA 1SR5C 3VB6A 7KMEH 4D9QA 4X2VA 5DP5A 1ESAA 1C5TA 1P02A 1A1RA 3VB7A 1DY9A 2ESTE 4MPVA 2BD8A 1TQ7B 3Q3KA 3SW2B 1C1QA 1TA2A 3QUMP 1QB1A 1Y3UA 4INLA 3M7QA 1QRXA 3SO3A 2KAIA 1AY6H 1O3IA 4ABIA 4GSOA 3SV2H 1LKBA 5JB9S 1MCTA 1O3KA 1S6HA 2EI6A 1SMFE 1IQJA 2UWPA 1ABIH 3NWUA 1GJ6A 5C67A 3A7XA 4WH6A 2H1UA 3A7ZA 5TCAA 1O3NA 4VGCB 1HAVB 1RTKA 2GCHF 1TGCA 1QBNA 3A7WA 4B75A 4Y79A 2ZFTA 4ZUHA 1BITA 3MH7A 1QJ6B 1K2I1 4WWYA 3SU5A 2HOBA 1WYKA 3UQVA 2J92A 2QXIA 5A8ZA 3NPSA 2SGAA 6CHAC 1WBGB 4DG4A 4XDEA 2VH0A 1EP5A 3SQEE 1T4UH 1EUFA 3RU4E 3KQCA 2D26C 5F6MA 5FCRA 3QK1A 1ESTA 5FX6A 4IS5A 3E91A 1EB1H 1SVPA 3LOXA 1T7CA 2ZHFH 5E8EH 1O34A 3PTBA 2NWNA 4YESB 1FLEE 2I6QA 3KN2A 3I78A 2Z3EA 2PR3A 2FX4A 2SNVA 1AD8H 2ZECA 5AF9H 1ELFA 1NFXA 2GP9B 4CR9A 4Y71A 4CRFA 3TK5A 2ZGXH 3U9AH 4B2AA 1SOTA 1V2TT 1HBTH 1QURH 4ISLA 7GCHG 1NS3A 1GBBA 1GI9B 4GPGA 2QAAA 3A8BA 4Y10E 2PGQB 5E0GA 1E35B 2ZPSA 2BZAA 1YF4A 4CRCA 1QHRB 1C5YB 1TE0A 2Z7FE 1B0FA 3HATH 1FI8A 2WUBA 3LH1A 1MAXA 1TRNA 1EZSC 1IQNA 1GBLA 2ZWLH 5CMXH 1GHBF 4NWKA 2FIRH 2BM2A 3BTKE 3MI4A 1A3EH 2FS9A 4AGKA 2BY9X 1ZPZA 1H9LB 4WF8A 5HGGA 1YC0A 1DSUA 1S84A 3ESTA 1NRSH 3SJIA 1A46H 2R9PA 1O3LA 1BTZA 1C2GA 1UTLM 4HZHA 1T31A 2ANKH 3A80A 3LKWA 1SLVB 3F6UH 2XWAA 3MO6A 4KTCA 1YPGH 1KYNA 2A7JA 2G4UA 5J4QA 1O2QA 1DPOA 1SQOA 4E05H 1O2PA 4D9RA 2G51A 1XVOA 1DY8A 1ELVA 2BOHB 2TGPZ 5DP8A 1C5NH 2O8TA 3VXEH 1D3PB 5C1UA 3GCNA 3RXVA 1O3EA 2A2XH 2H5CA 3S9AA 1EJNA 1O2UA 3G01A 1NPMA 2OCVB 5EXMA 6LPRA 1DFPA 1G37A 4WXIA 4X2YA 1EKBB 3TNSA 1HIAA 2ULLA 3MU4A 2P93A 1T8LA 1ZMJA 1TPOA 1LQEA 3MO9A 1VR1H 4FUJA 1JRTA 2BXUH 3TLOA 2ZHDA 1N8OC 1Q31A 2HVXA 1UK4A 2ZQ1A 1BHXF 4BAMB 1Z8RA 1OP2A 1G36A 5AFZH 1C5OH 2ZTZA 2OQUA 1BTYA 3T62A 1MU8B 4JCNA 4NGAH 1GBTA 5FHTA 4JK5A 2G81E 1K28D 1GVKB 3LJJA 4B73A 2F9NA 1FIZA 1TMUH 2NU1E 1ETSH 3HGNA 2W7SA 3VGCC 4I7YH 3RXHA 1Z8JB 4HTCH 1TOCB 3RXTA 2VIOA 1O2YA 6GCHG 1KXFA 4LK4A 3VEQB 1TYNA 4CHAB 3TJOA 3U98H 3E6PH 1Z6JH 1BTXA 4BTUB 1C5MD 4K1TA 3ZZAA 3TPIZ 1GWAA 1UVSH 2OD3B 4NIVA 4LZ1H 1BTHH 2BD7A 2P3TB 3SZNA 3SV9A 1KLJH 1LQDB 1GPZA 4Y8ZA 1S6FA 1H1BA 1Y5AT 4LZ4B 1LPKB 1MZAA 5GXPA 5EOKA 5EXNA 1C1RA 1TFXA 3GY6A 2Q6GA 3T25A 1THPB 3E16B 3RLYH 1KDQA 1O3PB 3MU0A 4AOQA 1BJUA 1HXEH 4U32A 1QBOA 1C5LH 2WINI 1QL9A 1XKBC 3VFEA 1NM6A 1EOLA 2Q6FA 3BTME 3KHVA 1AKSB 2BHGA 1BBRK 2ZFFH 1NRPH 2G4TA 1ELBA 1C5ZB 4F4OC 1NN6A 1EXFA 1AWHB 1OWEA 2FESH 5CE1A 2WPHS 1DUEA 1VCPA 3B23B 2R0LA 4UE7H 3TGJE 1GBCA 2PTCE 2CV3A 5JBTA 1LHFH 3TH2H 1GMHG 4Y0ZE 2PTNA 1SHHB 3DFJA 2TRMA 6ESTA 2FOEA 3A83A 1XUFA 2C90B 1O35A 2P3UB 1UMAH 2G00A 1C5RA 1PPFE 3MH4A 2BQ7B 1O2TA 3Q00A 2XXLA 1V2NT 4JZFH 1CT0E 4Y6DA 1Y59T 3FAOA 4AFZA 3HKJB 1MH0A 3RXJA 2OC7A 4KP0A 1O3BA 3F9HA 3ZZ9A 3SNBA 5ESTE 2WV4A 3ZV8A 2A5IA 3QZRA 3HK6B 2FTMA 3SI3H 1MKXH 2Z9IA 1SGRE 1DT2A 5FBIA 1ZSKA 1JXPA 2UUKB 1SG8B 3SGQE 4O3UA 4Q80A 2ZF0H 4JMYA 1YBWA 1UTNA 1GJAB 2BD2A 2ZQ2A 3B9FH 2BQ6B 1K1IA 5JYIA 2VIDA 2F9VA 3PYHA 1C1MA 1BQYA 1SGTA 2TGAA 3P8FA 6GCHF 1SFQB 3ZVEA 1PPEE 2HGTH 1VITH 2OXSA 2ZGHA 4JZ1A 4VGCC 3S9CA 2ASUB 1TPSA 2EC9H 4R8TB 2QCYA 3ATLA 1C2IA 3UREA 4I31A 3SU6A 1KXDA 2VB0A 1QB6A 1CVWH 1HAIH 2IPHA 1GHYH 3FFGA 3EA8A 1N1LA 2HNTE 3M35A 2P16A 2ZU2A 1C1VH 1DVAH 2XC0A 1GHVH 1GHZA 3ITIA 2IN2A 1G32B 2A0QB 2Y5GA 1O2VA 2A31A 4NA8A 3KL6A 1NRNH 4HGCA 3TH4H 2VNTA 3OY6U 2OP9A 1V2OT 2WPMS 1LHEH 5CHAB 1ZJDA 3MNBA 3UUZA 2W3KA 3TITA 1EJMA 4WY3A 1IQMA 4FXGH 1F5KU 1H9IE 1BMMH 1O3AA 1SFIA 1LKAA 2VINA 1C1OA 2G5VA 1TAWA 1ZGIA 1MKXK 3FZZA 1EZQA 1GBHA 3T26A 4WMEA 1A3BH 2FYQA 3SUGA 2ZGCA 3S7HB 4H6SB 1AE8H 2BDGA 1S0RA 3OTJE 4ABBA 1GBAA 3L6PA 4WXVA 2C8ZB 4Y8YA 1BHXB 3IWMA 1V2UT 3A7VA 3I29A 4E06H 5HMAA 4DURA 4MNWA 1MBQA 1GVZA 4FU9A 4BTIB 1UCYH 1UVPA 1B0EA 4CBOA 4IN2A 2G5NA 2AS9A 3PTNA 1QJ7B 2FMJA 1XUHA 1V3XA 1O2LA 4JYUH 1OPHB 2AMQA 1FAKH 2DE9A 1D6WA 1HYLA 1AFEH 4UEHH 1O3CA 1DM4B 3ZVCA 3BN9A 4B71A 5TCCA 4ABAA 3VB4A 1A0HB 3SGAE 3M3VA 1ESBA 1GHXH 2BQWB 1EPTA 2VIQA 4ABJA 1GDQA 3LGUA 4OGXA 4ZROA 1GI7B 2GT7A 3LGVA 3QTVH 4TWWA 1FDPA 2R3UA 2WV5A 2FPZA 2FEQH 4O03A 1UK2A 4MNXA 4TWYA 1GBDA 2UWOA 3UPEA 1ZRBA 4U30A 4KTSA 1EJAA 2V0BA 3F68H 1C1PA 4ZKRU 4OS4A 1UVOA 3BEIB 1NU7B 2QN5T 2Y7XA 4K1EA 4FVBA 4FVDA 3ZV9A 4X6NA 2BB4A 1W10U 4Q7XA 1P2OA 1SQTA 3I77A 4AB8A 3SU2A 1P57B 4K69A 1HV7A 1HGTH 8LPRA 2ZEBA 3NK8A 1S82A 2ZPRA 4ISIH 1HLTH 1ZTLA 1V2JT 2BYAX 4WJG2 4GVUA 2ANYA 2VIPA 3VB5A 4DT7B 4AG2A 3UOPA 1Q2WA 1AU8A 1GCDA 1OYTH 1O5GH 3GYMA 1ZJKA 1CT2E 4THNH 4BAOB 1BB0B 2H9EH 3PROA 1O3MA 2P59A 4IMZA 1W8BH 3GY7A 2F9OA 5FX5A 2ZCKP 2F9BH 2ZTXA 3ZYDA 5C2ZA 1GI6A 2VWMA 4BAKB 5A0AE 2Y82A 3EA7A 5L30H 1A61H 1S0QA 2PLXA 4CHAC 4AX9H 1WV7H 5JDUB 1V2KT 3SU1A 3SJ9A 2ODPA 2OQ5A 4Q2KA 1GBKA 1ARBA 4CRBA 3UNRA 5DP7A 1CHGA 3URDA 1W12U 3LGIA 1GJ4H 3BEFB 1DX5M 1AUTC 5AFYH 1LMWB 1P03A 1CSOE 3BIUH 4NZLA 4X6PA 2SFAA 4RN6A 3QN7A 3GOVB 2WYJA 2PFEA 2OINA 3LIWA 2H2ZA 1A0JA 4K3JA 1V2LT 1C1UH 4NA7A 1VITG 5F8ZA 3GCHB 1IQHA 1K22H 1TQ0B 4IC5A 2CGAA 4NFEA 2R2MB 1NO9H 1O3OA 2PUXB 1IQEA 1O2JA 1LVMA 1E34B 5LPEA 2VVUA 1LHDH 2QXGA 2Z9KA 2I6SA 2ZU3A 1Z71A 5EQRA 4DJZB 2O8WA 5JB8S 1YLDA 4Y8XA 5C3NA 1BUIA 2KAIB 4FUEA 3F9FA 3F1SB 1FONA 1P2JA 4XE4A 4A92A 2B9LA 1A5IA 1P3EA 5HYOA 3S69A 1O30A 1LCYA 1XXDA 2H9TH 1PQAA 9LPRA 1EAIA 1UTJA 4KTUA 3KQEA 4A6LA 1DS2E 1L1JA 1ELAA 5GCHG 1ZHRA 3W94A 2BY7X 3M3SA 1C2JA 3RMNH 3DD2H 2ODQA 4CR5A 2ZU5A 1GJDB 1IHSH 1KXAA 3F9EA 2FOCA 2AGIX 1L1NA 4DVAU 4B74A 2CHAC 1GHAF 3SNDA 2C8YB 3U8OH 1O2GH 1Y3XA 3P92A 1E38B 3DHKH 3SU4A 1G3DA 1GI0A 3V12A 3ZZBA 4X6OA 1WCZA 2C8XB 1PPZA 4X8UH 3UNQA 4JK6A 4TPIZ 5LPFA 1TLDA 4I32A 3EGKH 4CBNA 3SJOA 1S85A 1JMOH 1TRMA 1SC8U 3DUXH 3MU1A 1CQQA 1T8MA 3PLPA 3LC3A 5DO4H 1YPMH 3BTQE 1RIWC 5EQQA 4FUFA 4GHQA 1TONA 2FX6A 3VXFH 1V2QT 2W5EA 4MNYA 1HAYB 1NRQH 2V35A 2ZFRH 1O0DH 4OS1A 3KGPA 3TU7H 1DSTA 3P8GA 3GICB 3BV9B 1P2MA 3U1IB 1P10A 4AZ2B 4YLQH 4IN1A 3KNXA 4ESTE 2LPRA 5B6OA 1DUAA 1ETRH 1VITF 5SGAE 1TNIA 2GD4B 5A0CA 1O3FA 4ABGA 3URCA 7LPRA 3MH5A 3MYWA 1SL3A 5CHAC 3KCGH 2AFQB 2D8WA 5C5NA 1MU6B 1H8DH 3SUEA 1FXYA 1O31A 3ELAH 3NZIA 3FVFB 3A87A 2WYGA 1DLKB 1NY22 2SGPE 5E2OA 1CA0B 2B8OH 3KIDU 1O2OA 3LT3A 3MNXA 1INCA 1C4V2 1RD3B 1BRBE 4DW2U 4A7IB 1RGQA 2BVXH 1SB1H 4ZXXH 1O2IA 1YLCA 3GYLB 3S0NA 5PTPA 4X1PU 1G2MA 3A8DA 1OWDA 1O3JA 5F8TA 1W0YH 3BTWE 1TWXB 5A09A 1YYY1 1EAUA 3TGKE 4ZH8A 4GAWA 3R0FA 1ZHPA 1T8OA 1CGIE 3OX7U 2QV1A 3MHWU 1UTMA 5GCHF 1HIAB 1SGPE 5IDKA 2P3FH 5EQSA 2Z9GA 3RXLA 3AASA 2GCTC 3LDXH 4X8SH 3SOSA 1ZPCA 2O8MA 2XC5A 1G3BA 1GJBB 4D7GA 1FY5A 3PWBA 5L6NH 2BDCA 1BIOA 1F0RA 3K9XB 3RXSA 4BXSA 1P09A 3ZZ7A 3SUFA 2RCEA 3LGWA 4NA9H 4X1SU 5GPIB 1FPHH 3TVJB 2PKSC 1DWDH 3FZDA 1EATA 4OGYA 3Q77A 2STAE 1TPAE 4CRAA 5FAHA 4TY6A 1D3QB 1MTWA 1O3DA 1BZXE 3RMOH 2NU2E 1H8IH 1ANEA 1BBRH 1OX1A 4BXWA 2A5AA 4GCHG 2WPIS 2CXVA 3LU9B 2DE8A 4B1TA 4RKOB 4M7GA 1JRSA 2A7HA 5C1YA 1HUTH 4AFUA 1ZTKA 3L33A 3RC6A 3RDZA 2XCNA 4WVPE 1AWFH 3SGBE 3HPTB 1GI3A 2R3YA 4X2WA 2JETB 3FP6E 2UWLA 1MAYA 2FP7B 4CH2B 1DDJA 4ISOA 2GV6A 1AVXA 1SHYA 2F9UA 4Y0YE 4MQAA 1O2KA 1MUEB 2TPIZ 3ZZCA 3UOUA 1MD7A
chains in the Genus database with same CATH superfamily
3M3TA 4WMDA 1XX9A 2J2UA 2QA9E 3ATWA 4I8GA 3ENSB 4R0IA 3A86A 5I46H 3D65E 3M7TA 1KDQB 2F91A 2FOGA 5JBBS 4AYVB 3SHCH 3OSYA 1WTHD 1VJAU 1WOFA 3DFLA 2IPQX 3MFJA 2JIZD 1HAZB 4XSKU 2VJ1A 1L4ZA 1KIGH 4SGBE 4NIXA 4ASHA 2R0KA 1GVLA 1ARCA 4UD9H 2XWBI 2H6MA 3K65B 1KY9A 1UW7A 1O2HA 3ATMA 4I86A 3RMMH 1GG6C 2OTVA 2YNBA 1F92A 1Z7KA 4I8JA 1QRZA 3E90B 3AW0A 4NIWA 2G52A 5LPRA 1O2XA 3EYDA 4YM9A 3T29A 1DICA 1QZ8A 1L2EA 3LGTA 5IYTA 3A89A 5GIBA 1BRCE 2XNIA 4NFFA 1Z1IA 5BRRE 3N7EA 4HI3A 1EAXA 1SBWA 4Y7BA 4OS5A 3A84A 1TB6H 1XUIA 1BTPA 2A1DB 1YGCH 2O8LA 2AIPA 3GCHC 2RG3A 4MDSA 3A7TA 1NT1A 1HPGA 4AFQA 2ZDLA 1UVUH 4X6MA 3T28A 5DN6D 1TNHA 2GMTB 1GCTC 4UFFH 4BNRA 1GHWH 1EQ9A 2V7QD 2XCFA 2O9QA 1EASA 1RXPA 3LPRA 3WY8A 1ELTA 1TGSZ 1AUJA 2ZFQH 1GBFA 1TA6A 1WQVH 1LO6A 3HK3B 1TRYA 1GL1A 1QJ1B 3C27B 1KTTB 1OWKA 4PROA 3M5MA 3O8BA 1VZQH 2XW9A 1GBJA 3KYGA 2KR7A 2PV9B 4MPXA 1QQ4A 2Z3CA 3ODDA 4GCHF 4O3TA 1AHTH 2BVSH 1Y3VA 2CHAB 1A0LA 2ZHWH 1IQKA 2SGFE 4ABHA 2ALVA 3P17H 1O2SA 1TALA 2F9PA 4RSPA 5KECA 1GL0E 4NCYA 3SV7A 1Y8TA 1TX8A 3UR9A 1BDAA 3VPKA 1C2EA 4MLFB 1UTKA 2V3HH 4CRDA 1C5QA 1S5SA 3BF6H 5T6FA 1C4Y2 2AGGX 3RXUA 3JZ1B 1RIWB 1HCGA 1CU1A 3QGNB 1PPBH 4Q4LA 1TIOA 2BLWA 2SGDE 4A1VA 3DA9B 1FX0B 1LPGB 2HALA 5T6GA 2VVVA 3BTHE 1BTUA 4GLYA 4XBBA 1DE7H 2UUFB 1EB2A 1DXPA 4DIIH 1DANH 5FXLA 1V2RT 1ZTJA 1K1PA 5EG4A 4IGDA 1O2ZA 1D4PB 2OK5A 2F83A 3RM0H 1MZDA 2FXRA 3JZ2B 2GT8A 1ZLRA 5HIZA 3RMLH 4DCDA 2O8UA 1BOQA 1TMTH 1FV9A 4AG1A 1HAHH 4IC6A 1K21H 2AMPA 1TX7A 1XUKA 2GDEH 2XRCA 1SGIB 1J8AA 1F0UA 3RXIA 1ZPBA 2BD9A 2ZNKH 1BA8B 1OKXA 2FOAA 4IMQA 2VGCC 1NZQH 2FI4E 1WXRA 5K7RA 3GCOA 2A45B 3TJVA 1Y3YA 5ABWA 3H7TA 2AERH 1QR3E 1K1NA 1SGCA 1O5BB 3MU8A 1VGCB 4X1NU 2J98B 5EGMA 1D9IA 2WPKS 1MTNB 2R2WU 3QTOH 1JBUH 3P70B 2WV9A 3O8RA 3TGIE 1O5FH 1C5PA 3D23A 3PO1B 1Z1JA 1C2KA 1HJ8A 3SHAH 1LVBA 1SLUB 2PW8H 2ZGJA 1ZZZA 2AEIH 1QL7A 3E3TA 3UFAA 2ZDVH 2GDDA 4Q7YA 1XUGA 1K0HA 5EXLA 2KZ4A 1QFKH 2CF8H 1W0ZU 1W14U 1CA0C 2ZDKA 1EPTB 2RA3A 1Z6EA 2ZIQH 3OTPA 4ISNA 4JZDH 1TBRH 1ZR0A 3P6ZB 1ZYOA 1A2CH 1QA0A 4JYVH 3RC5A 1O2NA 1HDTH 3PLBA 2GCTB 2Z94A 1O3GA 3SNCA 4NIYA 1LHGH 3A85A 3C1KA 2V3OH 2BY6X 3FKSD 1YM0A 3FP7E 8KME2 4TPYA 1AE5A 1C5UA 1HAOH 4TYDA 2TGTA 3W95A 1NC6A 2J97A 4AORA 3GDVA 1RFNA 5L2YH 2ZPQA 3V13A 3T2NA 1QL8A 3UNSA 3S7KB 5C94A 3D62A 1SLXB 1V6DA 2PKSB 3TNTA 3EQ0H 1N6YA 1SGEE 4K2YA 1OWJA 2BX4A 4YTAA 2ZC9H 2VVCA 3F0PA 3ZVGA 1W3CA 3N99A 2XNDD 1ELGA 1NFWA 3M61U 3RM2H 1FPCH 1UCYE 1LTOA 4MG3A 1V2VT 4YO9A 1P8VC 2J38A 1CO7E 4FUDA 4YOJA 1C1SA 3BG4B 2FOBA 2LNCA 2FWWA 3AW1A 3RXEA 1PQ5A 4FUBA 5G4BA 3CS7A 2JH5D 3ZZ8A 3OEED 1RRKA 1MABB 4DGJA 5T6DA 1LVYA 1TNJA 1GJCB 4TY7A 2ANMH 2PKAA 1GHAG 2C4FH 3H7OA 2NU4E 5DP6A 1P11E 1T8NA 4YZUA 2TBSA 2D1JA 1W7GH 3F2HA 4D7FA 1VKYA 2JETC 2GTBA 1FN8A 3MOCA 1DWCH 3RXKA 1FY1A 5CDFE 3QO6A 4B76A 5EU8A 4X0WU 1C4U2 1OOKB 1GG6B 9ESTA 2HWLB 1SGYE 3MNCA 2ZDMA 2ZTYA 3QZQA 3KF2A 1YPLH 1SGNE 1AMHA 3FO8D 1EP6A 1LHCH 2VH6A 4J1YA 1BCUH 2SGEE 2BDHA 1GJ8B 3A82A 1UHBA 4K5ZA 1THSH 5DG6A 3ODFA 2ZHQH 1L4DA 1KXCA 2J94A 3UWIA 4XOJA 1RJXB 5GJ4B 1J14A 1GMDG 4RKJB 1ZMLA 4Y7AA 5ETXA 3RXFA 4Y76A 5A8XA 5HM9A 4AN7A 1C9PA 2QY0B 4DIHH 1GCTB 2PSYA 3OY5U 2H9HA 1SOZA 2ZHEH 1F2SE 1KLTA 3FN8A 4P02A 2GX4A 1SGQE 2XBXA 4ZKOU 5FPTA 3K6ZA 3BTGE 5J4SA 4NSVA 2D2DA 1YPHC 2BY5X 1P12E 1W7XH 2XBYA 3TJNA 2BDAA 1PPHE 4Q63A 3F9GA 1ELCA 1JOUB 3RUOA 4ZHAA 3N7OA 3PV4A 1P2NA 2BY8X 1J17T 4F49A 3N7DA 1FY8E 1B7XB 1NESE 1O38A 1P2QA 2GMTC 3WWBA 5K0HA 3K6YA 1T4VH 1GBMA 3UWJH 1H9HE 2NU3E 1TBQH 3NUMA 2FI5E 4MPUA 4YOIA 2ZFPH 3P95A 3SJKA 2WSSD 1ACBE 2EI8A 4X2XA 1BMLA 1GGDB 4UFEH 1IQFA 1IQIA 4P00A 1C2HA 1C1WH 1TPPA 1U6QA 3KQ5A 5H4IB 2XTTB 3RXGA 4ABDA 1A5HA 1UO6A 3AAVA 1VCQA 1XKAC 2OC8A 3BG8A 5EJZA 1WUNH 5A8YA 2KX4A 3FOAA 2ZU4A 5AVDA 2BX3A 2ZG0H 4TSFD 2AYWA 4X8TH 2CMYA 2Y81A 3IG6B 4ZKSU 1GMCG 5F53A 1HXFH 1K1OA 1ZGVA 1O32A 1MBMA 2GZ9A 2CF9H 4Q7ZA 2FLRH 1HAXB 5F8XA 3A81A 3NKKA 1SI5H 2PGBB 1Z8IB 3BSQA 1Y5BT 1WU1A 3A8CA 4FU8A 2CN0H 1UJ1A 4WH8A 1THRH 5F03A 3UB0A 3RP2A 1MCVA 2GKVE 2OUAA 3RU4T 3ZVAA 2HLCA 1S83A 1AIXH 3MWIU 3HGPA 1TNKA 1P3CA 1JIRA 1OWHA 1O3HA 1HJAC 1YP9A 3QGJA 2VGCB 2J95A 1AN1E 3GY8A 3GY4A 4BAQB 2RA0A 2FODA 3GDSA 1TOMH 4DT4A 4YOGA 4D76A 2HNTF 4YXWD 1FJSA 2FOMB 2VWOA 3KQDA 1A7SA 1MKWK 1HAVA 2W7UA 4MVNA 4UFGH 3WWFA 4A1XA 4BANB 1QTFA 1O36A 3F3BA 3GDUA 1ZOMA 2GVFA 3BTTE 1RS0A 2Z9LA 3BTFE 1FIWA 5E2PA 2QE7D 4CREA 1LDTT 3SNEA 3QDZB 3ZZ3A 1WTGH 4BOHA 4AYYB 2B7DH 2CJIA 1GMDF 3B8JA 2BTCE 1GBIA 3EDXB 1C5VA 1H8HD 1AGJA 1V2PT 3SV8A 1DWBH 3IITA 1AVWA 1A4WH 1SLWB 1D3TB 1MTSA 3RXCA 1VGCC 2C93B 4FU7A 5DKMA 3GCTG 1F5LA 2HPQH 1MTNC 1IAUA 1O5EH 2A2QH 3E8LA 3EAJA 1K1JA 4JZEH 1AB9B 1J16A 1L1GA 1UVTH 2J9NA 4KELA 3SYJA 3PO1C 3FANA 1GI8B 1COWD 2HRVA 2VWNA 3UY9A 3RXQA 1O39A 1BMAA 1G3EA 2FTLE 1GI5A 2KM0A 2XC4A 1J9CH 4NWLA 1RTLA 1RTFB 1DWEH 1HAGE 3SI4H 1CA8B 4YT6H 4XFQA 2EY4C 1Q3XA 1EPTC 1YCPH 2PUQH 4OM9A 5EW2H 3LJOA 3RXPA 4B2CA 1AFQB 5EPNA 4D8NA 3Q3XA 4XBDA 5DP3A 1EOJA 3KQBA 2Q1JA 4MTBA 4K8YA 1HB0B 5A0BA 2EI7A 2PWXA 3CS0A 1BMNH 1FNIA 2AMDA 3U8RH 1OYQA 1O5DH 4U2WA 5FCKA 1HJ9A 3M37A 2W3IA 1GMCF 4E7NA 3AVZA 1XUJA 3SV6A 4FUIA 1UTPA 4K8BA 3RXDA 3ZVBA 1V2ST 2PP6A 2WPLS 1HRTH 1K1MA 1Y3WA 1CT4E 3V7TA 1MQ5A 3BTDE 3PMJA 4OS6A 3GY3A 4Z6AH 1ZSJA 1H4WA 2BDYA 1SQAA 1CE5A 1PQ7A 3O8CA 2BZ6H 3UIRA 1BRAA 1D6RA 3F0OA 4AB9A 1TGBA 4IW4E 1HFDA 4I8KA 1GJ7B 3P8NA 5DP4A 1DOJA 1QNJA 3ZVFA 1QGFA 7ESTE 1W13U 2ZO3H 3SNAA 3BG4C 1FMGA 4I33A 4YLUA 2ANWA 1GJ5H 1E1RD 3M36A 1GJ9B 3PM3A 3RXRA 2A4RA 5DPAA 4BAHB 2RDLA 1XM1A 2A4OA 2AIQA 5DJ7A 3RXBA 1YCPK 2W26A 4ACBA 1O33A 1GI2A 5C5OA 2YNAA 1GDNA 1MQ6A 1SGDE 5E0JA 1DLEA 4ZHLU 3OU0A 2XYAA 2SNWA 2ZZUH 3P8OA 1SGFA 3SQHE 3GCTF 4U01A 2ODYB 5L2ZH 1F0TA 2ALPA 3Q3YA 7GCHF 1P9UA 4INKA 1P2KA 3OE7D 5C0UA 1P2IA 3ZVDA 1W2KH 4OS2A 4ZMAH 4GHTA 3EE7A 1UTOA 2OC1A 3NCLA 2WPDD 5HM2A 3VB3A 4UONA 1O5AB 3RXMA 1FN6A 3GY2A 1BBRE 2BXTH 2OC0A 1YPJH 2FLBH 2P8OB 3PMBB 4HFPB 3T5FH 1QB9A 5EPYA 3EE0B 5EW1H 4J2YB 1D3DB 1ELDE 1C5SA 1ZMNA 4XBCA 3K2UA 4ZXYH 1P9SA 3PWCA 2STBE 1FAXA 2OBQA 1ZRKA 8GCHG 1PQ8A 3BTEE 3PV2A 5CHBA 1WAYB 1P06A 3V3MA 3HKIB 2FDAA 3M5OA 2F4LA 5GDSH 1FZZA 1TNLA 1CGHA 2FYRA 2ZFSA 1C5XB 1WSSH 1WQSA 2UUYA 1CBWB 1X7AC 3M5NA 5I25A 2KCYA 2K1QA 2J34A 3LONA 3MH6A 1KMHB 2QYIA 1VJ9U 4FETA 4K1SA 1VCWA 2BMGB 5JBCS 1AVGH 1C2LA 3Q76A 3RU4D 1AKSA 1P04A 2M5TA 2A32A 5C1XA 2BLOA 2ZKSA 1BT7A 1TGTA 4O97A 1AZZA 1TMBH 2BOKA 1ETTH 2NU0E 4HG6A 3PB1E 4FOUC 1GI4A 3M5LA 1UTQA 2G8TA 2QIQA 3R3GB 1Y5UT 1YCPM 1O2RA 3DSGA 2A5KA 2ZU1A 1P01A 5IK2D 1GGDC 1OS8A 3DSPA 4FUGA 4Z0KA 2HPPH 1ID5H 3STJA 4BTTB 2ZP0H 2FOFA 4MPWA 3A88A 1PPCE 5A2MH 1JWTA 2QF4A 1ABJH 1HJAB 1F7ZA 2Y80A 1Z8GA 1F0SA 2BLQA 2VIWA 1NTPA 4H6TA 2JH0D 4I8HA 1J15A 1AQ7A 1BJVA 5HXFA 3AAUA 5FPYA 1NU9A 2KFWA 3UTUH 6CHAB 3SUDA 2FZZA 8ESTE 2M2AA 1GDUA 4LXBH 4DOQA 1NFYA 1YPHE 1AZ8A 5JBAS 3UQOA 4NZQA 1W11U 2WHXA 1V2MT 3SORA 1GBEA 3ZIAD 3CENA 1N6XA 5E0HA 4KGAA 3RLWH 3E1XB 1CHOG 1LVOA 5FPSA 1EX3A 2JH6D 2UUJB 2VIVA 3E0PB 4ISHH 3CP7A 4CRGA 1KXEA 1FQ3A 1AI8H 3SZEA 2Y6TA 2QC2A 3SU3A 1NROH 1BMFD 2P95A 1ELEE 2ZA5A 3MU5A 3QX5H 1QRWA 4B6FA 8GCHF 1IHTH 2SGQE 1TABE 4WMFA 2TIOA 1T32A 2JKHA 4H4FA 2ZDAH 2QXJA 1G3CA 1ANDA 3A7YA 4X1RU 4A5TS 2EEKA 1EAWA 2FO9A 3STIA 5AHGH 2G55A 5T3HA 4DY7B 1PPGE 4A1TA 1MMJN 3SJ8A 2BD4A 1C2FA 3MO3A 2AH4X 2ZI2H 2ZCHP 3U69H 3QLPH 1C1TA 2ZDNA 3KYFA 1GMHF 1AB9C 3GY5A 2Q6DA 5GWZA 4INHA 1YY3A 1QA7A 1DXWA 1C9TA 1MD8A 2ZCLP 2DUCA 5ESBA 3QWCH 2Y5HA 1XMNB 1BTWA 1NRRH 2F3CE 1ANCA 3F2FA 2BLVA 3ZZDA 3VG8A 2ZGBH 3LGYA 1YPKH 1FY4A 1JIMA 1NFUA 4GUXA 3RXAA 2Y7ZA 4Y11E 3ZZ4A 2FS8A 2P94A 3NRLA 4ZAEA 5DP9A 3ATKA 2BD3A 5LGOA 1OP0A 2GZ7A 3PLKA 4NG9H 2THFB 1AFQC 2Z9JA 2QF3A 1SGFG 3E0NB 1IOEA 2QXHA 2FOHA 2GZ8A 1TX6A 2FI3E 2EA3A 2V6NA 3UR6A 1MTVA 3FP8E 1M9UA 1FUJA 1HNEE 4AGJA 1SKYE 3RC4A 1HAPH 1B5GH 3LH3A 3OYPA 4NSYA 3EA9A 1G30B 1PYTC 2A4QA 2BVRH 3LC5A 4KKDA 5DK1A 1SPJA 1EZXC 2B0FA 2VWLA 4OS7A 1W0KD 2A7CA 2PKAB 4SGAE 1PYTD 3MNSA 2C3SA 2B5TB 1UK3A 4H42U 1OSSA 2VU8E 1N8OB 2QGRA 4CH8B 2YMSB 3SBKA 1YPEH 1PFXC 2Y5FA 3T27A 1ORFA 1TNGA 2W6JD 2PSXA 4O9VA 1OWIA 4AFSA 1QIXB 4ZHMU 3KEEA 1QY6A 1ZHMA 2BDIA 4I8LA 2GV7A 1CHOF 1TGNA 3MMGA 1P05A 3TJUA 3TK6A 3BIVH 2BD5A 1K1LA 3SN8A 3A8AA 3V0XA 3M7UA 3VGCB 1KXBA 2Z6BD 1UCYK 3BEUA 3ZYEA 3TK9A 1MTUA 3MTYA 4B2BA 5C20A 1SSXA 1C2DA 1KTSB 3H5CB 3S9BA 2XBVA 3UAIC 2PHBA 1ZSLA 1OXGA 2GCHG 3O8DA 3U1JB 1UHBB 1O37A 1E36B 2ILNA 1OP8A 2GGVB 5JPMH 1K9OE 1BRUP 4JZIA 3U8TH 1IQLA 1C5WB 2YOLA 1QQUA 1P0SH 3D49H 4ABFA 2C8WB 4YT7H 4UDWH 3DT0H 1YKTA 4UFDH 4JYTA 1A5GH 4IBLH 2Z3DA 3ATIA 3PV5A 5BPEA 2OBOA 2WPJS 1FY3A 3NXPA 2AGEX 1L0ZA 2OLGA 4ABEA 3PMHB 2QF0A 3DSOA 1C2MA 4FUHA 2XBWA 2P8OC 3GS9A 4AC9A 1QBVH 1O5CB 3L3TA 1G9IE 1O2WA 3GISB 1KSNA 2J4IA 2FM2A 2IJOB 1XXFA 4ZKNU 3TIUA 3RXOA 5LH8A 3TH3H 1PJPA 1F5RA 5EJLA 2TGDA 1V2WT 1G2LA 4M9FA 3ZZ5A 4F48B 1S81A 1KLIH 1GI1A 1E37B 3ZZ6A 1AO5A 2A4GA 2WUCA 1IQGA 2IOTA 1MKWH 2BDBA 2H5DA 4XRNA 1CBWC 1EZUC 1E0FD 1LPZB 1QCPA 5FBEA 2HNTC 4E7RG 3SU0A 4K60A 1O2MA 3PMAB 4MNVA 1ANBA 1NBMD 1GHBG 3PRBA 1XVMA 1C1NA 4LOYH 4X1QU 5TJXA 1DITH 4QT8C 4X8VH 4FUCA 1CGJE 1TBZH 5DGJA 5EODA 1SR5C 3VB6A 7KMEH 4D9QA 4X2VA 5DP5A 1ESAA 1C5TA 1P02A 1A1RA 3VB7A 1DY9A 2ESTE 4MPVA 2BD8A 1TQ7B 3Q3KA 3SW2B 1C1QA 1TA2A 3QUMP 1QB1A 1Y3UA 4INLA 3M7QA 1QRXA 3SO3A 3DCLA 2KAIA 1AY6H 1O3IA 2GJGA 4ABIA 5DSFA 4GSOA 3SV2H 1LKBA 5JB9S 1MCTA 1O3KA 1S6HA 2EI6A 1SMFE 1IQJA 2UWPA 1ABIH 3NWUA 1GJ6A 5C67A 3A7XA 2KCOA 4WH6A 2H1UA 3A7ZA 5TCAA 1O3NA 4VGCB 1HAVB 1RTKA 2GCHF 1TGCA 1QBNA 3A7WA 4B75A 4Y79A 2LELA 2ZFTA 4ZUHA 1BITA 3MH7A 1QJ6B 1K2I1 4WWYA 3SU5A 2HOBA 1WYKA 3UQVA 2J92A 2QXIA 5A8ZA 3NPSA 2SGAA 6CHAC 1WBGB 4DG4A 4XDEA 2VH0A 1EP5A 3SQEE 1T4UH 1EUFA 3RU4E 3KQCA 2D26C 5F6MA 5FCRA 3QK1A 1ESTA 4ZCNA 5FX6A 4IS5A 3E91A 1EB1H 1SVPA 3LOXA 1T7CA 2ZHFH 5E8EH 1O34A 4Z1MD 3PTBA 2NWNA 4YESB 5HKKD 1FLEE 2I6QA 3KN2A 3I78A 2Z3EA 2PR3A 2FX4A 2SNVA 1AD8H 2ZECA 5AF9H 1ELFA 1NFXA 1S6LA 2GP9B 4CR9A 4Y71A 4CRFA 3TK5A 2ZGXH 1E1QD 3U9AH 4B2AA 1SOTA 1V2TT 1HBTH 1QURH 4ISLA 7GCHG 1NS3A 1GBBA 1GI9B 4GPGA 2QAAA 3AK5A 3A8BA 4Y10E 2PGQB 5E0GA 1E35B 2ZPSA 2RDEA 2BZAA 4ACAA 1YF4A 4CRCA 1QHRB 1C5YB 1TE0A 2Z7FE 1B0FA 3HATH 1FI8A 2WUBA 3LH1A 1MAXA 1TRNA 3W1EA 1EZSC 1IQNA 1GBLA 2ZWLH 5CMXH 1GHBF 4NWKA 2FIRH 2BM2A 3BTKE 3MI4A 1A3EH 2FS9A 4AGKA 2BY9X 1ZPZA 1H9LB 4WF8A 5HGGA 1YC0A 1DSUA 1S84A 3ESTA 1NRSH 3SJIA 1A46H 2R9PA 1O3LA 1BTZA 1C2GA 1UTLM 4HZHA 1T31A 2ANKH 3A80A 3LKWA 1SLVB 3F6UH 2XWAA 3MO6A 4KTCA 1YPGH 1KYNA 2A7JA 3H09A 2G4UA 5J4QA 1O2QA 1DPOA 1SQOA 4E05H 1O2PA 4D9RA 2G51A 1XVOA 1DY8A 1ELVA 2BOHB 2TGPZ 5DP8A 1C5NH 2O8TA 3VXEH 1D3PB 5C1UA 3GCNA 3RXVA 1O3EA 2A2XH 2H5CA 3S9AA 1EJNA 1O2UA 3G01A 1NPMA 2OCVB 5EXMA 6LPRA 1DFPA 1G37A 4WXIA 4X2YA 1EKBB 3TNSA 1HIAA 2ULLA 3MU4A 2P93A 1T8LA 1ZMJA 1TPOA 1LQEA 3MO9A 1VR1H 4FUJA 1JRTA 2BXUH 3TLOA 2ZHDA 1N8OC 1Q31A 2YMSC 2HVXA 1UK4A 2ZQ1A 1BHXF 4BAMB 1Z8RA 1OP2A 2YMSD 1G36A 5AFZH 1C5OH 2ZTZA 5T1VA 2OQUA 1BTYA 3T62A 1MU8B 4JCNA 4NGAH 1GBTA 5FHTA 4JK5A 2G81E 1K28D 1GVKB 3LJJA 4B73A 2F9NA 1FIZA 1TMUH 2NU1E 1ETSH 3HGNA 2W7SA 3VGCC 4I7YH 3RXHA 1Z8JB 4HTCH 1TOCB 3RXTA 2VIOA 1O2YA 5HIYA 1KXFA 4LK4A 3VEQB 6GCHG 1TYNA 4CHAB 3TJOA 3U98H 3E6PH 1Z6JH 1BTXA 4BTUB 1C5MD 4K1TA 2CK3D 3ZZAA 3TPIZ 1GWAA 1UVSH 5EIYA 2OD3B 4NIVA 4LZ1H 1BTHH 2BD7A 2P3TB 3SZNA 3SV9A 1KLJH 1LQDB 1GPZA 4Y8ZA 1S6FA 1H1BA 1Y5AT 4LZ4B 1LPKB 1MZAA 5GXPA 5EOKA 5EXNA 1C1RA 1TFXA 3GY6A 2Q6GA 3T25A 1THPB 3E16B 3RLYH 1KDQA 1O3PB 3MU0A 4AOQA 1BJUA 1HXEH 4U32A 1QBOA 1C5LH 2WINI 1QL9A 1XKBC 3VFEA 1NM6A 1EOLA 2Q6FA 3OEHD 3BTME 4RI0A 3KHVA 1AKSB 2BHGA 1BBRK 2ZFFH 1NRPH 2G4TA 1ELBA 1C5ZB 4F4OC 1NN6A 1EXFA 1AWHB 1OWEA 2FESH 5CE1A 2WPHS 1DUEA 1VCPA 3B23B 2R0LA 4UE7H 2XOKD 3TGJE 1GBCA 2PTCE 2CV3A 5JBTA 1LHFH 3TH2H 1GMHG 4Y0ZE 2PTNA 2RFKC 1SHHB 3DFJA 2TRMA 6ESTA 2FOEA 3A83A 2AHME 1XUFA 2C90B 1O35A 2P3UB 1UMAH 2G00A 1C5RA 1PPFE 3MH4A 2BQ7B 1O2TA 3Q00A 2XXLA 1V2NT 4JZFH 1CT0E 4Y6DA 1Y59T 3FAOA 4AFZA 3HKJB 1MH0A 3RXJA 2OC7A 4KP0A 4F55A 1O3BA 3F9HA 3ZZ9A 3SNBA 5ESTE 2WV4A 3ZV8A 2A5IA 3QZRA 3HK6B 2FTMA 3SI3H 1MKXH 2Z9IA 1SGRE 1DT2A 5FBIA 1ZSKA 2WZQA 1JXPA 2UUKB 1SG8B 3SGQE 4O3UA 4Q80A 2ZF0H 4JMYA 1YBWA 1UTNA 1GJAB 2BD2A 2ZQ2A 3B9FH 2BQ6B 1K1IA 5JYIA 2VIDA 2F9VA 3PYHA 1C1MA 1BQYA 1SGTA 2JJ2D 2TGAA 3P8FA 6GCHF 1SFQB 3ZVEA 1PPEE 2HGTH 1VITH 2OXSA 2ZGHA 4JZ1A 4VGCC 3S9CA 2ASUB 3CNRA 1TPSA 2EC9H 4R8TB 2QCYA 3ATLA 1C2IA 3UREA 4I31A 3SU6A 1KXDA 2VB0A 1QB6A 1CVWH 1NBME 1W0JD 1HAIH 2IPHA 1GHYH 3FFGA 3EA8A 1N1LA 2HNTE 3M35A 2P16A 2ZU2A 1C1VH 1DVAH 2XC0A 1GHVH 1GHZA 3ITIA 2IN2A 1G32B 2A0QB 2Y5GA 1O2VA 2A31A 4NA8A 3KL6A 1NRNH 5EJ1A 4HGCA 3TH4H 2VNTA 3OY6U 2OP9A 1V2OT 2WPMS 1LHEH 5CHAB 1ZJDA 3MNBA 3UUZA 2W3KA 3TITA 1EJMA 4WY3A 1IQMA 4FXGH 1F5KU 1H9IE 1BMMH 1O3AA 1SFIA 1LKAA 2VINA 1C1OA 2G5VA 2HVYB 1TAWA 1ZGIA 1MKXK 3FZZA 1EZQA 2LP6A 1GBHA 3T26A 4WMEA 1A3BH 2FYQA 3SUGA 2K0QA 2ZGCA 3S7HB 4H6SB 1AE8H 2BDGA 1SQRA 1S0RA 3OTJE 4ASUD 4ABBA 1GBAA 3L6PA 4WXVA 2C8ZB 4Y8YA 1BHXB 3IWMA 1V2UT 3A7VA 3I29A 4E06H 5C17A 5HMAA 4DURA 2J98A 4MNWA 1MBQA 1GVZA 4FU9A 2J5UA 5KEDA 4BTIB 1UCYH 1UVPA 1B0EA 4CBOA 4IN2A 2G5NA 2AS9A 3PTNA 1QJ7B 2FMJA 1XUHA 1V3XA 1O2LA 4JYUH 1OPHB 2AMQA 1FAKH 2DE9A 1D6WA 1HYLA 1AFEH 4UEHH 1O3CA 1DM4B 3ZVCA 3BN9A 4B71A 5TCCA 4ABAA 3VB4A 1A0HB 3SGAE 3M3VA 1ESBA 1GHXH 2BQWB 1EPTA 2VIQA 4ABJA 1GDQA 3LGUA 4OGXA 4ZROA 1GI7B 2GT7A 3LGVA 3QTVH 4TWWA 1FDPA 2R3UA 2WV5A 2FPZA 2FEQH 4O03A 1UK2A 4MNXA 4TWYA 1GBDA 2UWOA 3UPEA 1ZRBA 4U30A 4KTSA 1EJAA 2JDID 2V0BA 3F68H 1C1PA 4ZKRU 4OS4A 1UVOA 3BEIB 1NU7B 2QN5T 2Y7XA 4K1EA 4FVBA 4FVDA 3ZV9A 4X6NA 2BB4A 1W10U 4Q7XA 1P2OA 1SQTA 3I77A 4AB8A 3SU2A 1P57B 4K69A 1HV7A 1HGTH 8LPRA 2ZEBA 3NK8A 1S82A 2ZPRA 4ISIH 1HLTH 1ZTLA 1V2JT 2BYAX 4WJG2 4GVUA 2ANYA 2VIPA 3VB5A 4DT7B 4AG2A 2IJD1 3UOPA 1Q2WA 1AU8A 1GCDA 1OYTH 5B6LA 1O5GH 3GYMA 1ZJKA 1CT2E 4THNH 4BAOB 1BB0B 2H9EH 3PROA 1O3MA 2P59A 5KGOA 4IMZA 1W8BH 3GY7A 2F9OA 5FX5A 2ZCKP 4B6EA 2F9BH 2ZTXA 3ZYDA 5C2ZA 1GI6A 2VWMA 4BAKB 5A0AE 2Y82A 3EA7A 5L30H 1A61H 1S0QA 2PLXA 4CHAC 4AX9H 1WV7H 2F43B 1V2KT 5JDUB 3SU1A 3SJ9A 2ODPA 2OQ5A 4Q2KA 3U28C 1GBKA 1ARBA 4CRBA 3UNRA 5DP7A 1CHGA 3URDA 1W12U 3LGIA 1GJ4H 3BEFB 1DX5M 1AUTC 5AFYH 2KCAA 1LMWB 1P03A 1CSOE 3BIUH 4NZLA 4X6PA 2SFAA 4RN6A 1WDIA 2HLDD 3GOVB 3QN7A 1EFRD 2WYJA 2PFEA 2OINA 3LIWA 2H2ZA 1A0JA 4K3JA 1V2LT 1C1UH 4NA7A 1VITG 5F8ZA 3GCHB 1IQHA 3OAAD 1K22H 1TQ0B 2QF5A 4IC5A 2CGAA 4NFEA 2W6ID 2R2MB 1NO9H 1O3OA 2PUXB 1IQEA 1O2JA 1LVMA 1E34B 5LPEA 2VVUA 1LHDH 2QXGA 2Z9KA 2I6SA 2ZU3A 5FL7D 1Z71A 5EQRA 4DJZB 2O8WA 2L74A 5JB8S 1YLDA 4Y8XA 5C3NA 1BUIA 2KAIB 4FUEA 3F9FA 3F1SB 1FONA 1H8ED 3MQKC 1P2JA 2V3MA 4XE4A 4A92A 2B9LA 2K8IA 4RT1A 1A5IA 1P3EA 5HYOA 3S69A 1O30A 1LCYA 1XXDA 2H9TH 1PQAA 9LPRA 1EAIA 1UTJA 4KTUA 3KQEA 4A6LA 1DS2E 1L1JA 1ELAA 5GCHG 1ZHRA 3W94A 2BY7X 3M3SA 1C2JA 3RMNH 3DD2H 2ODQA 4CR5A 2ZU5A 1GJDB 1IHSH 1KXAA 3F9EA 3OFND 2FOCA 2AGIX 1L1NA 4DVAU 4B74A 2CHAC 1GHAF 3SNDA 2C8YB 3U8OH 1O2GH 1Y3XA 3P92A 1E38B 3DHKH 3SU4A 1G3DA 1GI0A 3V12A 3ZZBA 4X6OA 1WCZA 2C8XB 1PPZA 4X8UH 3UNQA 4JK6A 4TPIZ 5LPFA 1TLDA 2JJ1D 4I32A 3EGKH 4CBNA 3SJOA 1S85A 1JMOH 1TRMA 1SC8U 3DUXH 3MU1A 1CQQA 1T8MA 3PLPA 3LC3A 5DO4H 1YPMH 3BTQE 1RIWC 5EQQA 1OHHD 4FUFA 4GHQA 5GNDA 1TONA 2FX6A 3VXFH 1V2QT 2W5EA 4MNYA 1HAYB 1NRQH 2V35A 2ZFRH 1O0DH 1YLNA 3KGPA 4OS1A 3TU7H 1DSTA 3P8GA 3GICB 3BV9B 1P2MA 3U1IB 1P10A 4AZ2B 4YLQH 4IN1A 3KNXA 4ESTE 2LPRA 5B6OA 1DUAA 1ETRH 1VITF 5SGAE 1TNIA 2VBCA 2GD4B 5A0CA 1O3FA 4ABGA 3URCA 7LPRA 3MH5A 3MYWA 1SL3A 5CHAC 3KCGH 2AFQB 2D8WA 5C5NA 1MU6B 1YWUA 1H8DH 3SUEA 1FXYA 1O31A 3ELAH 3NZIA 3FVFB 4RT0A 2EQNA 4TT3D 3A87A 2WYGA 1DLKB 1NY22 2SGPE 5E2OA 1CA0B 2B8OH 3KIDU 1O2OA 3LT3A 3MNXA 1INCA 1C4V2 1RD3B 1BRBE 3PRDA 4A7IB 4DW2U 1RGQA 2BVXH 1SB1H 4ZXXH 1O2IA 1YLCA 3GYLB 3S0NA 5PTPA 4X1PU 1G2MA 3A8DA 2L6OA 1OWDA 1O3JA 5F8TA 1W0YH 3BTWE 1TWXB 5A09A 1YYY1 1EAUA 3TGKE 4ZH8A 4GAWA 3R0FA 1E79D 1ZHPA 1T8OA 1CGIE 4XD7D 3OX7U 2QV1A 3MHWU 1UTMA 5GCHF 1HIAB 1SGPE 5IDKA 2P3FH 5EQSA 2Z9GA 3RXLA 3AASA 2GCTC 3LDXH 4X8SH 3SOSA 1ZPCA 2O8MA 2XC5A 1G3BA 1GJBB 4D7GA 1FY5A 3PWBA 5L6NH 2BDCA 1BIOA 1F0RA 3K9XB 3RXSA 2KCPA 4BXSA 1P09A 3ZZ7A 3SUFA 2RCEA 3LGWA 4NA9H 4X1SU 5GPIB 1FPHH 3TVJB 2PKSC 1DWDH 3FZDA 1EATA 4OGYA 3Q77A 2STAE 5C0TA 1TPAE 4CRAA 5FAHA 4TY6A 1D3QB 1MTWA 1O3DA 1BZXE 3RMOH 2NU2E 1H8IH 1ANEA 1BBRH 1OX1A 4BXWA 2A5AA 4GCHG 2WPIS 2CXVA 3LU9B 2DE8A 4B1TA 4RKOB 4M7GA 1JRSA 2A7HA 5C1YA 1HUTH 4AFUA 1ZTKA 3L33A 3RC6A 3RDZA 2XCNA 4WVPE 1AWFH 3SGBE 3HPTB 1GI3A 2R3YA 3F2GA 4X2WA 2JETB 3FP6E 2UWLA 1MAYA 2FP7B 4CH2B 1DDJA 4ISOA 2GV6A 1AVXA 1SHYA 2F9UA 4Y0YE 4MQAA 1O2KA 1MUEB 3WW7A 2TPIZ 3ZZCA 3UOUA 1MD7A
chains in the Genus database with same CATH topology
3M3TA 4WMDA 1XX9A 2J2UA 2QA9E 3ATWA 4I8GA 3ENSB 4R0IA 3A86A 5I46H 3D65E 3M7TA 1KDQB 2F91A 2FOGA 5JBBS 4AYVB 3SHCH 3OSYA 1WTHD 1VJAU 1WOFA 3DFLA 3MFJA 1HAZB 4XSKU 2VJ1A 1L4ZA 1KIGH 4SGBE 4NIXA 4ASHA 2R0KA 1GVLA 1ARCA 4UD9H 2XWBI 2H6MA 3K65B 1KY9A 1O2HA 3ATMA 3RMMH 1GG6C 2OTVA 2YNBA 1F92A 1Z7KA 4I8JA 1QRZA 3E90B 3AW0A 4NIWA 2G52A 5LPRA 1O2XA 3EYDA 4YM9A 3T29A 1DICA 1L2EA 3LGTA 5IYTA 3A89A 5GIBA 1BRCE 2XNIA 4NFFA 1Z1IA 5BRRE 4HI3A 1EAXA 1SBWA 4Y7BA 4OS5A 3A84A 1TB6H 1XUIA 1BTPA 2A1DB 1YGCH 2O8LA 2AIPA 3GCHC 2RG3A 4MDSA 3A7TA 1NT1A 1HPGA 4AFQA 2ZDLA 1UVUH 4X6MA 3T28A 1TNHA 2GMTB 1GCTC 4UFFH 4BNRA 1GHWH 1EQ9A 2XCFA 2O9QA 1EASA 1RXPA 3LPRA 3WY8A 1ELTA 1TGSZ 1AUJA 2ZFQH 1GBFA 1TA6A 1WQVH 1LO6A 3HK3B 1TRYA 1GL1A 1QJ1B 3C27B 1KTTB 1OWKA 4PROA 3M5MA 3O8BA 1VZQH 2XW9A 1GBJA 2PV9B 4MPXA 1QQ4A 2Z3CA 3ODDA 4GCHF 4O3TA 1AHTH 2BVSH 1Y3VA 2CHAB 1A0LA 2ZHWH 1IQKA 2SGFE 4ABHA 2ALVA 3P17H 1O2SA 1TALA 2F9PA 4RSPA 1GL0E 4NCYA 3SV7A 1Y8TA 1TX8A 3UR9A 1BDAA 3VPKA 1C2EA 4MLFB 1UTKA 2V3HH 4CRDA 1C5QA 1S5SA 3BF6H 5T6FA 1C4Y2 2AGGX 3RXUA 3JZ1B 1RIWB 1HCGA 1CU1A 3QGNB 1PPBH 1TIOA 2BLWA 2SGDE 4A1VA 3DA9B 1LPGB 2HALA 5T6GA 2VVVA 3BTHE 1BTUA 4GLYA 4XBBA 1DE7H 2UUFB 1EB2A 1DXPA 4DIIH 1DANH 5FXLA 1V2RT 1ZTJA 1K1PA 5EG4A 4IGDA 1O2ZA 1D4PB 3RMLH 2F83A 3RM0H 1MZDA 2FXRA 3JZ2B 2GT8A 1ZLRA 4DCDA 2O8UA 1BOQA 1TMTH 1FV9A 4AG1A 1HAHH 4IC6A 1K21H 2AMPA 1TX7A 1XUKA 2GDEH 2XRCA 1SGIB 1J8AA 1F0UA 3RXIA 1ZPBA 2BD9A 2ZNKH 1BA8B 1OKXA 2FOAA 4IMQA 2VGCC 1NZQH 2FI4E 5K7RA 3GCOA 2A45B 3TJVA 1Y3YA 5ABWA 3H7TA 2AERH 1QR3E 1K1NA 1SGCA 1O5BB 3MU8A 1VGCB 4X1NU 5EGMA 1D9IA 2WPKS 1MTNB 2R2WU 3QTOH 1JBUH 3P70B 3O8RA 3TGIE 1O5FH 1C5PA 3D23A 3PO1B 1Z1JA 1C2KA 1HJ8A 3SHAH 1LVBA 1SLUB 2PW8H 2ZGJA 1ZZZA 2AEIH 1QL7A 3E3TA 3UFAA 2ZDVH 2GDDA 4Q7YA 1XUGA 5EXLA 1QFKH 2CF8H 1W0ZU 1W14U 1CA0C 2ZDKA 1EPTB 2RA3A 1Z6EA 2ZIQH 4JZDH 4ISNA 1TBRH 1ZR0A 3P6ZB 1ZYOA 1A2CH 1QA0A 4JYVH 3RC5A 1O2NA 1HDTH 3PLBA 2GCTB 2Z94A 1O3GA 3SNCA 4NIYA 1LHGH 3A85A 3C1KA 2V3OH 2BY6X 3FP7E 1YM0A 8KME2 4TPYA 1AE5A 1C5UA 1HAOH 4TYDA 2TGTA 3W95A 1NC6A 4AORA 3GDVA 1RFNA 5L2YH 2ZPQA 3V13A 3T2NA 1QL8A 3UNSA 3S7KB 3D62A 1SLXB 1V6DA 2PKSB 3TNTA 3EQ0H 1N6YA 1SGEE 4K2YA 1OWJA 2BX4A 4YTAA 2ZC9H 2VVCA 3ZVGA 1W3CA 1ELGA 1NFWA 3M61U 3RM2H 1FPCH 1UCYE 1LTOA 4MG3A 1V2VT 4YO9A 1P8VC 2J38A 1CO7E 4FUDA 4YOJA 1C1SA 3BG4B 2FOBA 2LNCA 2FWWA 3AW1A 3RXEA 1PQ5A 4FUBA 5G4BA 3CS7A 2JH5D 3ZZ8A 1RRKA 4DGJA 5T6DA 1LVYA 1TNJA 1GJCB 4TY7A 2ANMH 2PKAA 1GHAG 2C4FH 3H7OA 2NU4E 5DP6A 1P11E 1T8NA 4YZUA 2TBSA 2D1JA 1W7GH 4D7FA 2JETC 2GTBA 1FN8A 3MOCA 1DWCH 3RXKA 1FY1A 3QO6A 4B76A 5EU8A 4X0WU 1C4U2 1OOKB 1GG6B 9ESTA 2HWLB 1SGYE 3MNCA 2ZDMA 2ZTYA 3QZQA 3KF2A 1YPLH 1SGNE 1AMHA 1EP6A 1LHCH 2VH6A 4J1YA 1BCUH 2SGEE 2BDHA 1GJ8B 3A82A 1UHBA 4K5ZA 1THSH 5DG6A 3ODFA 2ZHQH 1L4DA 1KXCA 2J94A 3UWIA 4XOJA 1RJXB 5GJ4B 1J14A 1GMDG 4RKJB 1ZMLA 4Y7AA 5ETXA 3RXFA 4Y76A 5A8XA 5HM9A 4AN7A 1C9PA 2QY0B 4DIHH 1GCTB 2PSYA 3OY5U 2H9HA 1SOZA 2ZHEH 1F2SE 1KLTA 2GX4A 1SGQE 2XBXA 4ZKOU 5FPTA 3K6ZA 3BTGE 5J4SA 4NSVA 2D2DA 1YPHC 2BY5X 1P12E 1W7XH 2XBYA 3TJNA 2BDAA 1PPHE 3F9GA 1ELCA 1JOUB 3RUOA 4ZHAA 3N7OA 3PV4A 1P2NA 2BY8X 1J17T 4F49A 1FY8E 1B7XB 1NESE 1O38A 1P2QA 2GMTC 5K0HA 3K6YA 1T4VH 1GBMA 3UWJH 1H9HE 2NU3E 1TBQH 3NUMA 2FI5E 4MPUA 4YOIA 2ZFPH 3P95A 3SJKA 1ACBE 2EI8A 4X2XA 1BMLA 1GGDB 4UFEH 1IQFA 1IQIA 1C2HA 1C1WH 1TPPA 1U6QA 5H4IB 2XTTB 3RXGA 4ABDA 1A5HA 1UO6A 3AAVA 1VCQA 1XKAC 2OC8A 3BG8A 1WUNH 5A8YA 2ZU4A 5AVDA 2BX3A 2ZG0H 2AYWA 4X8TH 2CMYA 2Y81A 3IG6B 4ZKSU 1GMCG 1HXFH 1K1OA 1ZGVA 1O32A 1MBMA 2GZ9A 2CF9H 4Q7ZA 2FLRH 1HAXB 5F8XA 3A81A 3NKKA 2PGBB 1SI5H 1Z8IB 3BSQA 1Y5BT 1WU1A 3A8CA 4FU8A 2CN0H 1UJ1A 4WH8A 1THRH 5F03A 3RP2A 1MCVA 2GKVE 2OUAA 3RU4T 3ZVAA 2HLCA 1S83A 1AIXH 3MWIU 3HGPA 1TNKA 1P3CA 1JIRA 1OWHA 1O3HA 1HJAC 1YP9A 3QGJA 2VGCB 2J95A 1AN1E 3GY8A 3GY4A 4BAQB 2RA0A 2FODA 3GDSA 1TOMH 4YOGA 4D76A 2HNTF 1FJSA 2FOMB 2VWOA 3KQDA 1A7SA 1MKWK 1HAVA 2W7UA 4MVNA 4UFGH 4A1XA 4BANB 1QTFA 1O36A 3GDUA 1ZOMA 2GVFA 3BTTE 1RS0A 2Z9LA 3BTFE 1FIWA 5E2PA 4CREA 1LDTT 3SNEA 3QDZB 3ZZ3A 1WTGH 4BOHA 4AYYB 2B7DH 2CJIA 1GMDF 3B8JA 2BTCE 1GBIA 3EDXB 1C5VA 1AGJA 1V2PT 3SV8A 1DWBH 3IITA 1AVWA 1A4WH 1SLWB 1D3TB 1MTSA 3RXCA 1VGCC 2C93B 4FU7A 5DKMA 3GCTG 1F5LA 2HPQH 1MTNC 1IAUA 1O5EH 2A2QH 3E8LA 3EAJA 1K1JA 4JZEH 1AB9B 1J16A 1L1GA 1UVTH 2J9NA 4KELA 3PO1C 3FANA 1GI8B 2HRVA 2VWNA 3UY9A 3RXQA 1O39A 1BMAA 1G3EA 2FTLE 1GI5A 2XC4A 1J9CH 4NWLA 1RTLA 1RTFB 1DWEH 1HAGE 3SI4H 1CA8B 4YT6H 4XFQA 1Q3XA 1EPTC 1YCPH 2PUQH 5EW2H 3LJOA 3RXPA 4B2CA 1AFQB 5EPNA 4D8NA 3Q3XA 4XBDA 5DP3A 1EOJA 3KQBA 2Q1JA 4MTBA 4K8YA 1HB0B 5A0BA 2EI7A 2PWXA 3CS0A 1BMNH 1FNIA 2AMDA 3U8RH 1OYQA 1O5DH 4U2WA 5FCKA 1HJ9A 3M37A 2W3IA 1GMCF 4E7NA 3AVZA 1XUJA 3SV6A 4FUIA 1UTPA 4K8BA 3RXDA 3ZVBA 1V2ST 2WPLS 1HRTH 1K1MA 1Y3WA 1CT4E 3V7TA 1MQ5A 3BTDE 3PMJA 4OS6A 3GY3A 4Z6AH 1ZSJA 1H4WA 2BDYA 1SQAA 1CE5A 1PQ7A 3O8CA 2BZ6H 3UIRA 1BRAA 1D6RA 4AB9A 1TGBA 4IW4E 1HFDA 4I8KA 1GJ7B 3P8NA 5DP4A 1DOJA 1QNJA 3ZVFA 1QGFA 7ESTE 1W13U 2ZO3H 3SNAA 3BG4C 1FMGA 4I33A 4YLUA 2ANWA 1GJ5H 3M36A 3PM3A 1GJ9B 3RXRA 2A4RA 5DPAA 4BAHB 2RDLA 1XM1A 2A4OA 2AIQA 5DJ7A 3RXBA 1YCPK 2W26A 1O33A 1GI2A 5C5OA 2YNAA 1GDNA 1MQ6A 1SGDE 5E0JA 1DLEA 4ZHLU 3OU0A 2XYAA 2SNWA 2ZZUH 3P8OA 1SGFA 3SQHE 3GCTF 4U01A 2ODYB 5L2ZH 1F0TA 2ALPA 3Q3YA 7GCHF 1P9UA 4INKA 1P2KA 1P2IA 3ZVDA 1W2KH 4OS2A 4ZMAH 4GHTA 1UTOA 2OC1A 3NCLA 4UONA 5HM2A 3VB3A 1O5AB 3RXMA 1FN6A 3GY2A 1BBRE 2BXTH 2OC0A 1YPJH 2FLBH 2P8OB 3PMBB 4HFPB 3T5FH 1QB9A 5EPYA 3EE0B 5EW1H 4J2YB 1D3DB 1ELDE 1C5SA 1ZMNA 4XBCA 3K2UA 4ZXYH 1P9SA 3PWCA 2STBE 1FAXA 2OBQA 1ZRKA 8GCHG 1PQ8A 3BTEE 1WAYB 1P06A 3V3MA 3HKIB 2FDAA 3M5OA 5GDSH 1FZZA 1TNLA 1CGHA 2FYRA 2ZFSA 1C5XB 1WSSH 1WQSA 2UUYA 1CBWB 1X7AC 3M5NA 5I25A 2K1QA 2J34A 3LONA 3MH6A 2QYIA 1VJ9U 4K1SA 1VCWA 2BMGB 5JBCS 1AVGH 1C2LA 3Q76A 3RU4D 1AKSA 1P04A 2M5TA 2A32A 5C1XA 2BLOA 2ZKSA 1BT7A 1TGTA 4O97A 1AZZA 1TMBH 2BOKA 1ETTH 2NU0E 3PB1E 1GI4A 3M5LA 1UTQA 2G8TA 2QIQA 3R3GB 1Y5UT 1YCPM 1O2RA 2A5KA 2ZU1A 1P01A 1GGDC 1OS8A 4FUGA 4Z0KA 2HPPH 1ID5H 3STJA 4BTTB 2ZP0H 2FOFA 4MPWA 3A88A 1PPCE 5A2MH 1JWTA 1ABJH 1HJAB 1F7ZA 2Y80A 1Z8GA 1F0SA 2BLQA 2VIWA 1NTPA 4H6TA 2JH0D 4I8HA 1J15A 1AQ7A 1BJVA 5HXFA 3AAUA 5FPYA 1NU9A 3UTUH 6CHAB 3SUDA 2FZZA 8ESTE 1GDUA 4LXBH 4DOQA 1NFYA 1YPHE 1AZ8A 5JBAS 3UQOA 4NZQA 1W11U 1V2MT 3SORA 1GBEA 3CENA 1N6XA 5E0HA 4KGAA 3RLWH 3E1XB 1CHOG 1LVOA 5FPSA 1EX3A 2JH6D 2UUJB 2VIVA 3E0PB 4ISHH 3CP7A 4CRGA 1KXEA 1FQ3A 1AI8H 2Y6TA 2QC2A 3SU3A 1NROH 2P95A 1ELEE 2ZA5A 3MU5A 3QX5H 1QRWA 8GCHF 1IHTH 2SGQE 1TABE 4WMFA 2TIOA 1T32A 2JKHA 4H4FA 2ZDAH 2QXJA 1G3CA 1ANDA 3A7YA 4X1RU 4A5TS 2EEKA 1EAWA 2FO9A 3STIA 5AHGH 2G55A 5T3HA 4DY7B 1PPGE 4A1TA 1MMJN 3SJ8A 2BD4A 1C2FA 3MO3A 2AH4X 2ZI2H 2ZCHP 3U69H 3QLPH 1C1TA 2ZDNA 1GMHF 1AB9C 3GY5A 2Q6DA 5GWZA 4INHA 1QA7A 1DXWA 1C9TA 1MD8A 2ZCLP 2DUCA 5ESBA 3QWCH 2Y5HA 1XMNB 1BTWA 1NRRH 2F3CE 1ANCA 2BLVA 3ZZDA 2ZGBH 3LGYA 1YPKH 1FY4A 1JIMA 1NFUA 4GUXA 3RXAA 2Y7ZA 4Y11E 3ZZ4A 2FS8A 2P94A 4ZAEA 5DP9A 3ATKA 2BD3A 5LGOA 1OP0A 2GZ7A 3PLKA 4NG9H 2THFB 1AFQC 2Z9JA 2QF3A 1SGFG 3E0NB 1IOEA 2QXHA 2FOHA 2GZ8A 1TX6A 2FI3E 2EA3A 2V6NA 3UR6A 1MTVA 3FP8E 1M9UA 1FUJA 1HNEE 4AGJA 3RC4A 1HAPH 1B5GH 3LH3A 3OYPA 4NSYA 3EA9A 1G30B 1PYTC 2A4QA 2BVRH 3LC5A 4KKDA 5DK1A 1SPJA 1EZXC 2B0FA 2VWLA 4OS7A 2A7CA 4SGAE 2PKAB 1PYTD 3MNSA 2C3SA 2B5TB 1UK3A 4H42U 1OSSA 2VU8E 1N8OB 2QGRA 4CH8B 3SBKA 1YPEH 1PFXC 2Y5FA 3T27A 1ORFA 1TNGA 2PSXA 4O9VA 1OWIA 4AFSA 1QIXB 4ZHMU 3KEEA 1QY6A 1ZHMA 2BDIA 4I8LA 2GV7A 1CHOF 1TGNA 3MMGA 1P05A 3TJUA 3TK6A 3BIVH 2BD5A 1K1LA 3SN8A 3A8AA 3V0XA 3M7UA 3VGCB 1KXBA 2Z6BD 1UCYK 3BEUA 3ZYEA 3TK9A 1MTUA 3MTYA 4B2BA 5C20A 1SSXA 1C2DA 1KTSB 3H5CB 3S9BA 2XBVA 2PHBA 1ZSLA 1OXGA 2GCHG 3O8DA 3U1JB 1UHBB 1O37A 1E36B 2ILNA 1OP8A 2GGVB 5JPMH 1K9OE 1BRUP 4JZIA 3U8TH 1IQLA 1C5WB 2YOLA 1QQUA 1P0SH 3D49H 4ABFA 2C8WB 4YT7H