2QY0B

Active dimeric structure of the catalytic domain of c1r reveals enzyme-product like contacts
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
240
structure length
236
Chain Sequence
IIGGQKAKMGNFPWQVFTNIHGRGGGALLGDRWILTAAHTLYPKEHEASLDVFLGHTNVEELMKLGNHPIRRVSVHPDYRQDESYNFEGDIALLELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGVMEEKIAHDLRFVRLPVANPQACENWLRGKNRMDVFSQNMFCAGHPSLKQDACQGDSGGVFAVRDPNTDRWVATGIVSWGIGCSRGYGFYTKVLNYVDWIKKEMEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement C1r subcomponent
publication title Revisiting the mechanism of the autoactivation of the complement protease C1r in the C1 complex: Structure of the active catalytic region of C1r.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 56
structure length 236
sequence length 240
chains with identical sequence D
ec nomenclature ec 3.4.21.41: Complement subcomponent C1r.
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qy0B01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qy0B02
2FM2A 4FUCA 1YPHE 2FODA 1GBHA 3PWBA 5EPNA 1WAYB 4J1YA 4JZIA 1C1WH 2P3UB 2OLGA 1O5CB 5AHGH 3SU3A 5FBEA 1P02A 1SB1H 4X1RU 2BTCE 1TOCB 1AN1E 1O2JA 2ALPA 3D49H 1JWTA 3GY4A 1XUIA 2AGEX 3RU4T 2P59A 3RDZA 1B5GH 3GCHC 2P3FH 3P8GA 1GBKA 1HYLA 1C1NA 3K9XB 4HFPB 1PPHE 4ISIH 2THFB 3H7OA 2BYAX 3MH5A 3GY6A 4K69A 3PLPA 2ZHWH 4WXIA 1LPGB 3KIDU 3UR9A 1FQ3A 1Z7KA 5C20A 2Q6GA 2BQ7B 1BUIA 1GGDC 2FI5E 2RCEA 3AW1A 1TNJA 1NO9H 1OWEA 4K1TA 4K8YA 4RSPA 1HGTH 4X1QU 1SGCA 1YPEH 3VXFH 1O2XA 3ZVFA 2ZNKH 4K3JA 2BY7X 2JH6D 2QXHA 1HAZB 2XBVA 2F9VA 3SNBA 3CS7A 1LHEH 1CQQA 1FIZA 3ZVDA 2ZGXH 1HAPH 2TIOA 4WH8A 1DSUA 1QA7A 1W0ZU 1BJUA 3AAUA 5EU8A 3DFLA 1SVPA 2PUQH 2C8XB 4DJZB 1BJVA 3RXHA 3URDA 1UHBA 1TFXA 1XUHA 2EC9H 2Q1JA 1BBRK 2BY6X 3GYMA 1OWDA 2Z94A 2A32A 3VFEA 1AVGH 3M36A 4MPUA 3SQEE 3TVJB 4DVAU 1P10A 1CHGA 1GHBG 2ULLA 4OS6A 1MQ5A 4YO9A 4X2WA 3U8OH 1RRKA 2A31A 1CBWC 1A4WH 1JBUH 1ELDE 1TQ0B 2FESH 1YPHC 4NA9H 4X1SU 2R2MB 1KXFA 3EQ0H 3QUMP 1KSNA 3E8LA 1BRUP 1Y3VA 4PROA 1SHHB 2CHAC 3HPTB 3B23B 3Q76A 2UUJB 4LZ1H 3D23A 1UK2A 2J9NA 3RXKA 1KLTA 1GJ7B 1Z6EA 2AS9A 1KTTB 1O5BB 1GHYH 5T6GA 4X2YA 1QCPA 5SGAE 4NZQA 1YYY1 1V2WT 1P03A 1BRBE 2AIQA 2C3SA 2Y7XA 3UTUH 1D9IA 2J92A 1GG6B 5GXPA 1P04A 2A4GA 2B7DH 1GVZA 4F4OC 1V3XA 1CSOE 1Y5AT 2ZU5A 3RXOA 1FZZA 5C5NA 2PLXA 2QXJA 1C2JA 4HGCA 4D76A 1HJAB 5J4QA 3A7XA 4GPGA 4YT6H 4BTTB 2ZQ2A 4YESB 3ZV9A 1ZMNA 4Q80A 5DG6A 4DOQA 1PPFE 3M3VA 4X6MA 3F1SB 3T5FH 4NIVA 4M7GA 4AFUA 1MBMA 1NFUA 1W13U 3HK3B 4AB9A 1O30A 3GOVB 2ZHFH 1K28D 5GCHG 3KQEA 3PMBB 3QZRA 3SORA 3A87A 1GBCA 1TGSZ 1GMDG 1CHOG 3UIRA 4A7IB 3SV7A 3WY8A 1HFDA 1C1QA 5E2OA 2QC2A 3M5NA 3VB3A 3O8CA 4OGYA 4Y6DA 2XBXA 1Z1IA 2GX4A 2OINA 1FPCH 5AVDA 1F0UA 1IQJA 1K1OA 2NU4E 1GBLA 1DT2A 1ESAA 2AFQB 2PFEA 2JETC 5LPRA 1IQHA 2R3UA 1A0LA 1RGQA 4JMYA 8ESTE 1PYTC 2NU3E 2QF3A 1O2IA 4UDWH 3RU4D 1O3KA 4U2WA 2QXIA 1LVMA 5C67A 3TPIZ 3PMJA 3L6PA 4I7YH 2ZC9H 1AFQB 5L6NH 4E05H 1S6HA 2P8OC 5DJ7A 4I8GA 3SW2B 1TBRH 1ZYOA 4GUXA 1ELGA 1GI1A 5ETXA 1H9LB 2ZU1A 4AG1A 2DUCA 5L30H 2ZDNA 4DY7B 2HNTF 3CP7A 1NU7B 3BTGE 3A7VA 3R0FA 3HGPA 3RXLA 4ZKOU 1C1MA 4B71A 2W7UA 4FU8A 3A8BA 3TJUA 2C4FH 2HNTE 4WVPE 1GDUA 4Z0KA 3P95A 5EQQA 2A5AA 5EQRA 1YCPH 5DP4A 3SGQE 5HXFA 2D2DA 2TGPZ 3ZVGA 2F83A 1YCPM 2BX4A 4X2XA 2V3OH 3O8BA 3ENSB 1BTHH 1SGDE 1ZRKA 4NG9H 3SUGA 1FY8E 1DUAA 1MTVA 1TPPA 4ZKRU 1UK4A 2Y7ZA 1A3BH 9ESTA 1NM6A 3RXBA 4UONA 2EA3A 4CRDA 1D3PB 1AB9C 4IGDA 4TPIZ 5IYTA 1KXAA 2GZ8A 3MH6A 1TNLA 4MG3A 4CHAC 2A2QH 2PTNA 2WPIS 4Y10E 5I46H 1ZTLA 1V2PT 4KP0A 1C2KA 1GHZA 1UTOA 3UR6A 1BTZA 3UWIA 1S81A 1LHDH 2HLCA 5ABWA 1NFWA 5TCCA 1SSXA 1GHAF 1E35B 1ZSJA 4GVUA 1MMJN 2TPIZ 5J4SA 1MUEB 1OWKA 4Y8ZA 5K7RA 3ITIA 2UUFB 1YPLH 3DHKH 1W8BH 4BAKB 3ZVBA 1AVXA 2PKSB 4OS5A 1SFIA 2H9HA 1MZDA 4BAQB 1KXBA 1HB0B 1RIWC 1V2MT 1ZSLA 2O8MA 1C5PA 3MH4A 1EOJA 3QN7A 1OX1A 5L2YH 1JXPA 1CA0C 1NN6A 3NCLA 1AD8H 1TWXB 3RMOH 1Y5UT 1RJXB 1XUGA 2WINI 1VCPA 2RDLA 4ZUHA 1L4ZA 2WPKS 2I6QA 4YOJA 2V6NA 2AYWA 2BD3A 2HNTC 1BMMH 5EOKA 1ZR0A 2R0KA 4F49A 1DM4B 3ZV8A 1A1RA 5GCHF 1O38A 1Z6JH 2G4TA 1H8DH 1NESE 4B2CA 4FUFA 1O2YA 3BEFB 3BG4C 1CT2E 1GMDF 1E36B 4WMDA 3ZVEA 1A5HA 2OCVB 1B7XB 1MZAA 1D6RA 1LKAA 2CF9H 2V3HH 1O3JA 3DA9B 2R2WU 1BTUA 3LGVA 1ZPBA 1YP9A 1DPOA 1Y3UA 4ZMAH 1TX6A 5DKMA 4XDEA 1NY22 4XBDA 4INLA 3GICB 3E6PH 2VVUA 3VB5A 2H9EH 3BTDE 3SNAA 1O3NA 4X0WU 1QB6A 3MYWA 5B6OA 1L1JA 3UNQA 2AEIH 3ZVAA 2IN2A 1SGYE 1CT4E 1B0FA 1EAXA 2C8ZB 2GKVE 1L1NA 2FX4A 4ESTE 3RXGA 4KTSA 1JRTA 3NKKA 2HOBA 1IQIA 5T6FA 1JIRA 4XOJA 3LH3A 5A8YA 2CMYA 1MTNB 2BDBA 3SJ9A 1TQ7B 2WYGA 1RD3B 1MTSA 1AHTH 1C2HA 1CO7E 1EATA 2ZTYA 4NIWA 3TNTA 1B0EA 2BD7A 1DSTA 2AGIX 1DANH 3BF6H 2ZKSA 3UUZA 2PSXA 4AB8A 1TMTH 2FO9A 3PWCA 4MNYA 1FMGA 3O8RA 3UFAA 1VITG 2FOFA 6GCHG 1BBRH 7GCHG 4NIYA 1SMFE 2BY8X 1P06A 1HXEH 3BTME 2AERH 2UUYA 2BVXH 1C1TA 3SZNA 4JZEH 3NXPA 3ZZ4A 1MCVA 1S84A 4K60A 2BD8A 4MLFB 2VIQA 3UQVA 1O34A 1P09A 1V2NT 2VB0A 1C5VA 1DDJA 6ESTA 3ESTA 1BTXA 1F0RA 1LHFH 4FUBA 1GMHF 3GYLB 1NRQH 2K1QA 1UTMA 4GSOA 3RP2A 1ZMLA 5EW1H 5GPIB 2Z9JA 4LK4A 5L2ZH 2PKAA 5T6DA 2ODQA 1TE0A 2BD4A 1X7AC 5A09A 4B1TA 3A7ZA 6CHAC 1O33A 1EAIA 4D8NA 1XUKA 1WYKA 2F91A 3L33A 2O8TA 1AWFH 4AOQA 1DWDH 3VGCC 3G01A 8GCHG 3SGBE 2BDHA 5JBTA 4RKJB 2GCTC 1UTJA 4GAWA 1K1LA 1PPBH 1UHBB 3BEIB 3MI4A 3ELAH 1TB6H 1KLIH 1AO5A 3B8JA 1K21H 4CHAB 2ASUB 1T8OA 3URCA 1JRSA 3TNSA 2G81E 1YM0A 3SNEA 5LPEA 1BOQA 1YLDA 2G51A 4IN2A 3U98H 5JB9S 4FUGA 3U9AH 3OU0A 3K2UA 1S82A 1CU1A 1TAWA 1AMHA 3A7WA 1GVLA 4GHTA 5BRRE 1THPB 1YF4A 1NFXA 1P2MA 3SV2H 2XNIA 1CGIE 2TBSA 4IW4E 3B9FH 1P2IA 4B75A 1AFEH 1BIOA 1FY1A 3IWMA 4NFEA 2ZFTA 3A7YA 1H8IH 1AI8H 1ELCA 2STBE 2BOHB 4DGJA 5CMXH 2VVCA 3SUDA 1RFNA 1F5RA 1HXFH 2RA3A 4IN1A 1FONA 4CBNA 3PTNA 4CH8B 3LJOA 2WV4A 3S69A 2XBYA 1C5WB 5FBIA 1D3QB 1HAHH 3K6YA 1NRSH 5E0JA 7ESTE 1WSSH 5HM2A 3EA7A 1GJ9B 3LC5A 3SI3H 1L0ZA 2A4OA 2A0QB 1QJ6B 5CHAC 2SNVA 1ETTH 4Z6AH 3SNDA 2ZGHA 2ANMH 3MO9A 3P8FA 1EZQA 2Z3CA 1C2EA 1O3BA 1NRNH 1L1GA 1MD8A 3ODFA 4J2YB 2H1UA 1OOKB 1XM1A 4MPWA 3E0PB 1S0RA 2QV1A 2F9UA 4XE4A 3ZZBA 1RTFB 3RXCA 1T31A 4ZHMU 2F9BH 2G4UA 1AVWA 2YOLA 1ANCA 1QRZA 5DK1A 5DP6A 4Y11E 1QB1A 1O2VA 4FVBA 5DP5A 1GJAB 3T2NA 3E0NB 3KGPA 3MH7A 2ZA5A 1ESBA 3GY7A 2IOTA 3PYHA 2VU8E 1TBQH 4FUJA 2FTMA 3RUOA 1TA6A 3NK8A 3SGAE 1FUJA 3RU4E 2VIOA 4O3UA 4H6TA 1EB2A 1ZHRA 1O3HA 2XCFA 1QBOA 2ANWA 3PTBA 1SI5H 3ATKA 1CGJE 3LGIA 1LMWB 3ZZ8A 1KLJH 3T28A 3DUXH 1MH0A 3ODDA 3OTJE 1GVKB 4MDSA 1K1PA 4DT7B 2Y80A 2ZZUH 2O8WA 3KQCA 1ETSH 4K1EA 1F0SA 2F9PA 3LC3A 1C1OA 3M7QA 3SO3A 4Y0YE 4AFZA 3NPSA 4BTIB 1DE7H 3EAJA 3LKWA 1VCQA 3BG8A 1EXFA 1TGNA 3STJA 2GTBA 3D62A 3K65B 4Q2KA 3MU0A 1FIWA 4YLUA 2QY0B 8GCHF 4AGJA 1MAXA 4I8JA 3QGNB 1D6WA 1O2QA 1QRWA 1BTWA 4IC5A 3SBKA 4A1TA 2FI4E 1TX8A 4CRGA 2ZI2H 3BTKE 4I8LA 4O97A 1KY9A 2UWLA 4ABFA 5DP9A 2Y5FA 2VINA 3GCOA 4TPYA 1C2DA 1Y3WA 2CJIA 3BIVH 4H4FA 4NCYA 1AIXH 4SGBE 4LXBH 1ZRBA 1TNHA 4JYTA 1O2UA 3IG6B 2J4IA 2P16A 1HPGA 3N7OA 3PMAB 1D3TB 1IHTH 1KDQA 4NFFA 1UVSH 5LGOA 4NWKA 3DD2H 2BVRH 1SGRE 1K1MA 2Y81A 3RXSA 4ABEA 1WBGB 3PO1C 1F2SE 1DY8A 3E16B 1A2CH 2XRCA 1O3AA 5H4IB 4YOGA 1FN6A 1O2WA 5GJ4B 1BT7A 1O5AB 3A8CA 1GPZA 2W26A 3P8NA 5PTPA 1QJ7B 1O3FA 2HWLB 4JYUH 4XBBA 5LPFA 4DIHH 5E0GA 1W7XH 1HBTH 1ABIH 1GHAG 2GMTB 5F8XA 1G3BA 4IMZA 2PUXB 2OXSA 1H1BA 1YPGH 2BQWB 2CV3A 4U30A 1DY9A 1UK3A 1W14U 3RM0H 5DP3A 1P3EA 3SI4H 4FVDA 4WF8A 4FUDA 1UTQA 1J17T 1G3DA 1HUTH 3T62A 5JB8S 2B9LA 2PHBA 1MKWH 3AAVA 4AFQA 1QL8A 1G3CA 3ATMA 2G5VA 3GY8A 4ZHLU 1O3LA 4ISHH 5CHAB 1AUTC 3K6ZA 1T7CA 4BAMB 1SLUB 1QBNA 4Y71A 3TJOA 1LQDB 4HI3A 3STIA 1NS3A 3BN9A 4XBCA 1NT1A 1EUFA 3RXJA 1IAUA 1F7ZA 1ZTJA 1P01A 2FPZA 4LZ4B 2VH6A 1GCDA 3FP8E 3VXEH 2AMDA 4LOYH 2A2XH 2JKHA 4ABJA 2UUKB 3P6ZB 1C5YB 1S85A 1THSH 2PW8H 2BLOA 1TGCA 1W12U 2OBQA 5FPTA 1QNJA 4H6SB 1FY5A 1YPKH 1DX5M 1HAVA 1SBWA 2BLVA 2GDDA 2Z3EA 2R0LA 3GCNA 1BMLA 3TU7H 1RXPA 4FUEA 3GISB 3SHCH 3SJ8A 1SPJA 4BAHB 5F8TA 1V2RT 2GVFA 3NUMA 3SV6A 3F68H 1FJSA 3TH3H 1EPTC 1SR5C 2O8LA 1SFQB 2ZPSA 4ASHA 1MKXK 3QZQA 1UO6A 4TWWA 1DS2E 1GBTA 2GT7A 3BTFE 1IQEA 2XWBI 1O2KA 2ZU3A 4D9RA 1PPGE 1QL7A 1XKAC 2J95A 5HGGA 3LT3A 1DLKB 3E91A 3AASA 4XFQA 3TK9A 3MU1A 4NZLA 1CA8B 1KXEA 2VIWA 2BM2A 3GCHB 1THRH 2NU0E 3R3GB 2VIVA 1V2KT 3HK6B 3H7TA 3RLWH 1Z8GA 3TIUA 1WCZA 2PKAB 1EAWA 1O3DA 7KMEH 1GGDB 1QRXA 1T4UH 1OWIA 3KHVA 1Q31A 3PROA 4K1SA 1C5SA 4ABDA 1V2JT 3UNRA 3LDXH 1GDNA 4NGAH 1PQ8A 1GMHG 3SV9A 1XKBC 1LKBA 2FZZA 3E90B 3M7TA 3LONA 3EYDA 5TCAA 3Q3YA 3OYPA 2ZPQA 1G37A 1ARBA 1SGFG 3FFGA 2ZDMA 4ZHAA 3T27A 2G55A 1TLDA 5JPMH 3BTEE 1SLVB 1FAKH 3A89A 3P92A 1YPJH 1F0TA 2QXGA 4VGCC 1HAOH 3LH1A 2AMQA 5T3HA 1V2TT 1A46H 1DVAH 1CBWB 1BQYA 2F3CE 1Y3XA 3A7TA 1EZUC 3TJNA 1SGTA 5JBAS 3ATLA 3ZYEA 2GZ9A 1O5EH 4KGAA 4WY3A 2UWPA 3VPKA 1P05A 1C2MA 3GDUA 1UCYE 4JK5A 2HALA 2CHAB 5A8ZA 1G3EA 5JBCS 1XXFA 2FLRH 2TRMA 3PMHB 1BZXE 2J38A 1MTUA 5C3NA 1NZQH 2ZCHP 2BXUH 1MU8B 3MWIU 5C1UA 2J2UA 4ZKNU 3UY9A 3I77A 1OXGA 1O2HA 1ZJDA 3RXMA 1PYTD 1BTPA 3AVZA 3SOSA 1EASA 3UREA 2H9TH 1LVBA 3UOUA 1S5SA 1QB9A 3VB7A 4FUHA 1K1NA 2PTCE 3BTWE 1KTSB 3CENA 2QAAA 3E3TA 4K5ZA 5G4BA 5C1XA 1LQEA 1O2MA 1O2RA 4IS5A 4ZXXH 2C8YB 1QTFA 3GCTG 4JZFH 5DP8A 4MPXA 4AGKA 4I8KA 2FYQA 5GIBA 3UOPA 1O2OA 1XVMA 5IDKA 1ZSKA 2FMJA 2BB4A 3OSYA 4E7NA 1FY3A 1O3EA 1SLWB 3M7UA 3QWCH 5FCRA 4FU9A 1NROH 3FANA 2ANYA 2SGFE 2A5KA 1TBZH 3LPRA 1F5LA 2XXLA 2Y6TA 1SGIB 3ATIA 3M5LA 3ZZ7A 3HKJB 3KL6A 1DLEA 4NA7A 1J16A 2VWLA 4IC6A 2BD2A 2P3TB 2W7SA 4ZKSU 1XX9A 3E1XB 5DPAA 4INKA 3RXIA 4X2VA 3U1JB 3TH4H 1GI5A 1HAXB 1RTLA 2FX6A 1V2VT 4OS4A 2JETB 4FU7A 4INHA 4NA8A 2VWOA 4OS2A 1BRAA 1SOZA 1MKWK 3GDSA 1GCTC 2AIPA 2Y5HA 1C2IA 3S0NA 4A5TS 5FPYA 2XC5A 4BNRA 4DG4A 4AYYB 2WYJA 5A0BA 4TWYA 2FIRH 3RMMH 4KKDA 4AX9H 1QGFA 2P8OB 1C5OH 2AH4X 1CGHA 1DOJA 1SG8B 1A5IA 1O37A 1IQFA 1GI2A 4Y8XA 4E06H 1PQ7A 4AYVB 3S9BA 1HLTH 5F6MA 4Q7XA 1MTWA 3M3SA 2FWWA 9LPRA 1Z8RA 4MVNA 1AKSA 3M3TA 1C1RA 4TY6A 1BBRE 1GI8B 2Z9GA 1Y8TA 3LGTA 2BDCA 5FPSA 4SGAE 2FI3E 2C93B 4A92A 1GL0E 1E37B 2PGBB 4UFFH 1YLCA 2JH0D 3RXQA 1M9UA 1C1UH 1O2PA 1EJMA 4AZ2B 1GHVH 1RTKA 4E7RG 1FI8A 2A4RA 3A86A 2Z9KA 1VCWA 1EP6A 1KDQB 3RXTA 3UPEA 4B2AA 1FLEE 2O9QA 2OUAA 2BY5X 2B5TB 1MBQA 4I33A 3SJOA 1AB9B 1HDTH 4YTAA 4ISOA 2SGEE 1OPHB 4X8VH 1WUNH 4ISNA 5K0HA 2GDEH 4QT8C 1K9OE 1HCGA 2GZ7A 1O2LA 1WTHD 2CF8H 2ZO3H 1G32B 1IHSH 1OYTH 2WPMS 1GJ8B 2Z7FE 2ZFRH 1INCA 1DXPA 5JBBS 3EA8A 4O3TA 4Y0ZE 1E38B 3RC6A 3QDZB 4DIIH 2PGQB 1ELAA 4R0IA 1GBBA 1F5KU 4O9VA 3SU6A 2BOKA 2XCNA 2VIPA 3A8AA 1ACBE 1J8AA 2Z9IA 1QQUA 2ZPRA 3SJIA 2NU1E 2W5EA 3QTVH 1ZHMA 1RIWB 1QIXB 2D26C 4KTUA 1TALA 2FS8A 1EKBB 3KQDA 1CA0B 1GJ5H 2ZG0H 2ZHQH 3GCTF 2GD4B 4BANB 3TGKE 1C1SA 3MU8A 2Q6FA 3ZZAA 2BLWA 1V2LT 1C4U2 3VB4A 4A6LA 3TK6A 2QIQA 3JZ2B 1IQMA 1GI0A 1GI9B 2VIDA 1C5NH 5EPYA 4B73A 1OP8A 1V2UT 5EGMA 1GG6C 2A7CA 2ALVA 1LPKB 1Y3YA 1MKXH 2V35A 5EW2H 4MTBA 4CBOA 3T29A 2GCHF 4CRFA 3EDXB 2ZIQH 3BG4B 3BTTE 2QN5T 1HJAC 4FXGH 1J14A 4ABHA 1O3PB 2BLQA 1ZZZA 1EJNA 1S6FA 2VH0A 3AW0A 2F9NA 1FPHH 4WMEA 1PQAA 1GMCF 1T8LA 1NFYA 2FOMB 2FYRA 2ILNA 2NU2E 1GJCB 5GWZA 4NWLA 1K2I1 1BTYA 4X8UH 1VZQH 3P17H 1EAUA 4X1PU 3SHAH 1HJ8A 1J9CH 3M61U 1VJAU 2IPHA 1JIMA 8LPRA 4FUIA 3V3MA 1DXWA 1HAVB 4Y76A 1AE5A 1AGJA 2AMPA 2WUCA 5BPEA 1C1PA 3FZDA 3GY3A 3A83A 1TONA 4XSKU 1TRYA 1P2QA 1G30B 3DT0H 1VITH 4DW2U 2OC1A 1QJ1B 1T4VH 1G2LA 1NC6A 3ATWA 2BQ6B 5EXNA 1QA0A 1FY4A 3SNCA 2VWNA 1YC0A 3SJKA 1P9SA 1UTLM 4IMQA 3IITA 4ZXYH 3O8DA 2VVVA 1EPTA 2SGQE 3PLBA 1TX7A 2SGDE 1CVWH 1AFQC 1A7SA 1UTPA 1BHXB 1P2OA 2M5TA 3W94A 1T8NA 3RMLH 3M35A 1NRRH 2XC0A 2A7HA 5FXLA 4UEHH 1GBFA 3BTQE 1BRCE 1J15A 2STAE 1ID5H 1ORFA 3FAOA 3UQOA 2C8WB 1W7GH 1XXDA 1FV9A 1PPZA 3S7KB 4X6OA 1IQLA 1A61H 2OD3B 3LU9B 3MO6A 2BXTH 1Z8IB 5GDSH 1ZPZA 5EODA 1O31A 5F03A 3H5CB 2SGAA 1Q3XA 6CHAB 1KIGH 2OQ5A 4AORA 2QF0A 1ETRH 3T26A 1NPMA 5FHTA 3GY5A 2ODYB 3VGCB 1DITH 1DUEA 2GCTB 2PR3A 3NZIA 1ZLRA 2VJ1A 4MPVA 1S0QA 3A8DA 4A1VA 2ESTE 1PFXC 1QBVH 2FP7B 2TGAA 2WUBA 4JZ1A 1EB1H 1UVPA 1O3MA 1HRTH 2OTVA 4R8TB 1O2TA 2ZQ1A 1E0FD 1MU6B 1QR3E 1OP2A 1TNKA 1OKXA 3QO6A 4CRAA 1C5XB 2A7JA 3LIWA 4X6PA 4D7FA 4GCHF 2ZTZA 1K1JA 1A5GH 1GHWH 1SGPE 5HMAA 4I32A 4ABGA 2GV7A 5JYIA 3F9FA 2IJOB 3V13A 1OS8A 1E34B 1QHRB 1TRMA 3ZYDA 1AY6H 3RC5A 3Q3XA 2ZCLP 1O32A 2PKSC 1GBJA 3QGJA 1O2SA 2FTLE 2XBWA 4GHQA 2FEQH 3SUFA 2G52A 1O2NA 1HIAA 1KYNA 3BEUA 3SQHE 1XVOA 1TMBH 4OS7A 3T25A 4RKOB 3SUEA 1SL3A 3A85A 2SGPE 3ZZDA 2GT8A 1ZGVA 5ESTE 2A5IA 2ZFQH 1AWHB 1GWAA 1KXCA 1O5FH 3TK5A 1O3IA 2P94A 5AFZH 5AFYH 1SQAA 4ABIA 4Y7AA 1K1IA 1LTOA 1HJ9A 1XUJA 3A84A 4Q7YA 1TPSA 2OQUA 3RC4A 3ZZCA 1FXYA 3TITA 3UWJH 5E2PA 2CXVA 1XUFA 2D1JA 1EQ9A 2VWMA 3MMGA 1PPCE 1SQOA 1ANBA 2FOCA 3A82A 3RLYH 3V12A 2QCYA 3LJJA 1YPMH 2EEKA 1H9IE 1W2KH 1XMNB 5A2MH 3EA9A 2BZ6H 3U8RH 5EQSA 5JDUB 2QGRA 1TYNA 1P12E 3MHWU 1K22H 4X8TH 3RM2H 1TNGA 1GDQA 4MNWA 1VGCC 1TA2A 1TPAE 3BSQA 1VJ9U 2I6SA 1LVYA 1SHYA 3OY5U 3FZZA 1EZXC 4YZUA 2VNTA 4OGXA 2ZFFH 2FS9A 1C5QA 2J34A 2XTTB 4CREA 3SU5A 3S9CA 1GBAA 5C2ZA 2R9PA 1HAGE 4KELA 2ZDLA 3Q77A 4A1XA 3PB1E 1SGQE 1O3CA 3HKIB 2FOAA 1UJ1A 1LHCH 4HZHA 2YNAA 1ZHPA 2A1DB 2PV9B 3W95A 3C1KA 2KAIA 1BMNH 2FXRA 2ZHDA 1GI3A 4HTCH 5EXMA 1MTNC 3KF2A 3KQBA 1GCTB 5FX5A 3SU0A 1P3CA 3TGJE 1TGTA 1O3GA 2FOGA 1GBIA 2ZDKA 1GJ6A 4BXSA 1L4DA 2GP9B 2BX3A 2TGTA 3D65E 1YKTA 5DP7A 1L2EA 1P11E 1SC8U 3SU1A 2ZU2A 2B0FA 1EJAA 1ZOMA 2WPHS 1A3EH 2HRVA 2B8OH 1AKSB 3MU4A 1IQNA 3KN2A 1P2JA 1WV7H 1GBEA 3RMNH 1BB0B 1MCTA 1TPOA 4IBLH 4BAOB 1O2ZA 1ELFA 1MAYA 1Z1JA 2BDGA 2Z9LA 3LGUA 1DICA 2OC7A 4GLYA 4YLQH 1V2OT 1BA8B 1SGNE 3Q00A 4UE7H 2BY9X 2ZDAH 2OC8A 3S9AA 1JMOH 1GI4A 1OWJA 3C27B 3BIUH 3LGYA 3PV4A 4NSYA 3VB6A 1QY6A 4ZAEA 1DWEH 2FDAA 2ANKH 2D8WA 1C5TA 4X6NA 3MNCA 3HGNA 1WU1A 3VEQB 2BVSH 2EI6A 4I8HA 1C2GA 1NTPA 3V0XA 2ZF0H 2CN0H 1O39A 4I31A 4WJG2 2TGDA 1GHBF 2RA0A 3QX5H 1OWHA 1P0SH 2VGCC 4UD9H 4TYDA 1CT0E 1UVTH 1F92A 1BMAA 2JH5D 1DWBH 3FP6E 3P8OA 3PO1B 1P8VC 4DCDA 1YBWA 1C5MD 2CGAA 2WV5A 3MTYA 4D7GA 2Q6DA 1ZMJA 1ZGIA 1WOFA 4CRBA 1LPZB 2P93A 1CE5A 3A80A 1UVOA 5A8XA 2O8UA 2HVXA 1UCYH 1GI7B 1HAYB 4JCNA 4K2YA 1C5UA 2ZFSA 1C5ZB 1O5GH 1ZPCA 1OSSA 4AG2A 1W0YH 1BITA 2W3IA 2QYIA 3HATH 3CS0A 1BHXF 3SV8A 5LH8A 5EG4A 1AE8H 1C9PA 3OY6U 4YM9A 2PSYA 3KEEA 3RXRA 4JYVH 5E0HA 4WH6A 1Z8JB 1C5RA 2H2ZA 2A45B 1A0JA 1C2LA 1S83A 2XW9A 2YNBA 1N8OC 2ZGBH 2UWOA 2EI8A 2OC0A 2Z6BD 3M5MA 1GJDB 3PLKA 1U6QA 2BHGA 4BTUB 1SOTA 2ZCKP 3RXUA 3ZZ6A 5F8ZA 2FOHA 1EX3A 4JZDH 4ABAA 3PM3A 3QLPH 4WWYA 1C1VH 8KME2 6LPRA 2HPQH 2SFAA 1TMUH 3U69H 1ANEA 1N6XA 4ISLA 1T8MA 2HPPH 1PQ5A 4O03A 1CHOF 2ZGCA 3UNSA 1SGFA 1O3OA 3GY2A 5A0CA 1NU9A 2XWAA 4CR5A 1IQKA 2NWNA 1G36A 3MNSA 2GCHG 3MNBA 3P70B 1D3DB 1O36A 3MO3A 3DFJA 1P9UA 4YT7H 3KCGH 1NRPH 1QFKH 2PWXA 1EZSC 2ZFPH 1VGCB 5HYOA 4H42U 1LO6A 2G5NA 1LDTT 1OYQA 5I25A 1GMCG 4OS1A 2XC4A 2EI7A 1W3CA 4CR9A 3Q3KA 2AGGX 2R3YA 2ZECA 3F9HA 5FAHA 7LPRA 1N6YA 4CH2B 1GJBB 1EPTB 2SNWA 3M37A 1C9TA 1ELTA 1ESTA 1TOMH 1GL1A 3ZVCA 2WPJS 1GBDA 1KXDA 1V2QT 1ANDA 4THNH 1P2KA 2ZU4A 4X1NU 2BD9A 1QL9A 1MD7A 1N1LA 3MU5A 1AU8A 3F6UH 2ODPA 4Y79A 2FOBA 3TLOA 4ZROA 2Z3DA 2ZHEH 3GDVA 2V0BA 2BZAA 2G00A 4NSVA 2DE9A 4BOHA 3FVFB 1ZTKA 1JOUB 4AN7A 2G8TA 5HM9A 2H5DA 4Q7ZA 4AFSA 2QA9E 3I78A 2HGTH 1IQGA 4U01A 1V6DA 2LPRA 4Y7BA 1SGEE 2GV6A 3F9GA 5DGJA 1P2NA 2LNCA 1A0HB 2H5CA 3NWUA 1QQ4A 1D4PB 1VR1H 4WMFA 1YGCH 3EGKH 2Y5GA 2WPLS 1HNEE 2DE8A 4JK6A 2ZTXA 5C5OA 1O0DH 3RXAA 1DFPA 1UVUH 1PJPA 1Q2WA 3MFJA 5FX6A 2GGVB 1C4Y2 1EP5A 2Y82A 1IOEA 4MQAA 2RG3A 1TNIA 1O2GH 3FP7E 3RXEA 3ZZ3A 2ZEBA 5A0AE 2C90B 2P95A 1EOLA 1O5DH 1O35A 1FNIA 3S7HB 2ZWLH 1RS0A 2BDIA 1P57B 5EXLA 4MNVA 3ZZ5A 2BMGB 3A81A 2W3KA 2VGCB 2ZDVH 4VGCB 1MQ6A 1W10U 1ZJKA 1V2ST 1TIOA 1GJ4H 1C2FA 1FDPA 1GBMA 1G9IE 2OP9A 5ESBA 1BDAA 1PPEE 5E8EH 1DWCH 1TABE 1W11U 3LOXA 1UMAH 3MNXA 4RN6A 1HIAB 1C4V2 4YOIA 3QTOH 4ABBA 3U8TH 2ZGJA 1HV7A 1TGBA 2GMTC 1YCPK 4GCHG 2J94A 2XYAA 2F9OA 4CRCA 1ELVA 4B74A 3BTHE 1ABJH 1HAIH 2BD5A 1UTNA 2OBOA 4WXVA 5FCKA 1WQVH 1OP0A 3EE0B 1GHXH 3TH2H 3SU4A 3RXPA 1ARCA 3RXVA 4NIXA 2BDYA 3V7TA 1N8OB 4UFEH 1UTKA 3SN8A 3M5OA 4UFGH 3KNXA 1LVOA 1GI6A 1H9HE 4MNXA 2ZP0H 1FAXA 3RXDA 1ELBA 4U32A 2FLBH 4D9QA 1BCUH 2H6MA 1ELEE 1H4WA 1AZ8A 1Y5BT 3QK1A 3OX7U 3L3TA 1C5LH 4TY7A 3TJVA 1SQTA 1LCYA 2FOEA 1UCYK 3F9EA 3RXFA 3I29A 5C1YA 1AQ7A 3BV9B 2A4QA 4ZH8A 3TGIE 1G2MA 3ZZ9A 4B76A 1AUJA 3U1IB 1AZZA 1WTGH 3A88A 3SU2A 1TRNA 1FN8A 1WQSA 4X8SH 5CE1A 3JZ1B 5DO4H 1SLXB 1Z71A 3MOCA 3LGWA 5AF9H 4Y8YA 2KAIB 4K8BA 4BXWA 1Y59T 5TJXA 4UFDH 4B2BA 2BDAA 4KTCA 1T32A 1VITF 4DURA 6GCHF 1QURH 7GCHF 1LHGH
chains in the Genus database with same CATH superfamily
2FM2A 4FUCA 1YPHE 2FODA 1GBHA 3PWBA 5EPNA 1WAYB 4J1YA 4JZIA 2QF4A 1C1WH 2P3UB 4RT0A 2OLGA 1O5CB 5AHGH 3SU3A 5FBEA 2RFKC 1P02A 1SB1H 4X1RU 2BTCE 1TOCB 1AN1E 1O2JA 2ALPA 3D49H 1JWTA 3GY4A 1XUIA 2AGEX 3F3BA 3RU4T 2P59A 3RDZA 1B5GH 3GCHC 2P3FH 3P8GA 1GBKA 1HYLA 1C1NA 3K9XB 4HFPB 1PPHE 4ISIH 2THFB 3H7OA 2BYAX 3MH5A 2M2AA 3GY6A 4K69A 3PLPA 2ZHWH 4WXIA 1LPGB 3KIDU 3UR9A 1FQ3A 1Z7KA 5C20A 2Q6GA 4I86A 2BQ7B 1BUIA 1GGDC 2FI5E 2RCEA 3AW1A 1TNJA 1NO9H 1OWEA 4K1TA 4K8YA 4RSPA 1HGTH 4X1QU 1OHHD 1SGCA 1YPEH 4YXWD 3VXFH 1O2XA 3ZVFA 2ZNKH 4K3JA 2BY7X 2JH6D 2QXHA 1HAZB 2XBVA 2F9VA 3SNBA 3CS7A 1LHEH 1CQQA 1FIZA 3ZVDA 2ZGXH 1HAPH 2TIOA 4WH8A 1DSUA 1QA7A 1W0ZU 1BJUA 3AAUA 5EU8A 3DFLA 1SVPA 2PUQH 2C8XB 4DJZB 1BJVA 3RXHA 3URDA 1UHBA 1TFXA 1XUHA 2EC9H 2Q1JA 1BBRK 2BY6X 3GYMA 1OWDA 2Z94A 2A32A 3VFEA 1AVGH 3M36A 4MPUA 3SQEE 3TVJB 2KCOA 4DVAU 1P10A 1CHGA 1GHBG 3N7EA 1WXRA 2ULLA 4OS6A 1MQ5A 4YO9A 2AHME 2HVYB 4X2WA 3U8OH 1RRKA 2A31A 1CBWC 1A4WH 1JBUH 1ELDE 2GJGA 1TQ0B 2FESH 1YPHC 4NA9H 4X1SU 2R2MB 1KXFA 3EQ0H 3QUMP 1KSNA 3E8LA 1BRUP 1Y3VA 4PROA 1SHHB 2CHAC 3HPTB 3B23B 3Q76A 2UUJB 4LZ1H 3D23A 1UK2A 2QE7D 2J9NA 5DSFA 3RXKA 1KLTA 1GJ7B 1Z6EA 2AS9A 1KTTB 1O5BB 1GHYH 5T6GA 4X2YA 1QCPA 5SGAE 4NZQA 1YYY1 5C0TA 1V2WT 1P03A 1BRBE 2AIQA 2C3SA 2Y7XA 3UTUH 1D9IA 2J92A 3KYGA 1GG6B 5GXPA 1P04A 2A4GA 2B7DH 1GVZA 4F4OC 1FX0B 1KMHB 3ZIAD 1V3XA 1CSOE 1Y5AT 2ZU5A 3RXOA 1FZZA 5C5NA 2PLXA 2QXJA 1C2JA 4HGCA 4D76A 1HJAB 5J4QA 3A7XA 4GPGA 4YT6H 4BTTB 2ZQ2A 4YESB 3ZV9A 1ZMNA 4Q80A 5DG6A 4DOQA 1PPFE 3M3VA 4X6MA 3F1SB 3T5FH 4NIVA 4M7GA 4AFUA 1MBMA 1NFUA 1W13U 3HK3B 4AB9A 1O30A 3GOVB 2ZHFH 1K28D 5GCHG 3KQEA 3PMBB 3QZRA 3SORA 3A87A 1GBCA 1TGSZ 1GMDG 1CHOG 3UIRA 4A7IB 3SV7A 3FN8A 1NBMD 3WY8A 1HFDA 1C1QA 5E2OA 2QC2A 3M5NA 3VB3A 3O8CA 4OGYA 4Y6DA 2XBXA 1Z1IA 2GX4A 2OINA 1FPCH 5AVDA 1F0UA 1IQJA 1K1OA 2NU4E 1GBLA 1DT2A 1ESAA 2AFQB 2PFEA 2JETC 5LPRA 1IQHA 2R3UA 1A0LA 1RGQA 4JMYA 8ESTE 1PYTC 2NU3E 2QF3A 3W1EA 1O2IA 4UDWH 3RU4D 1O3KA 4U2WA 2QXIA 1LVMA 5C67A 3TPIZ 3PMJA 3L6PA 4I7YH 2ZC9H 1AFQB 5L6NH 4E05H 1S6HA 2P8OC 5DJ7A 4I8GA 3SW2B 1TBRH 1ZYOA 4GUXA 1ELGA 1GI1A 5ETXA 1H9LB 2ZU1A 4AG1A 2DUCA 5L30H 2ZDNA 4DY7B 2HNTF 3CP7A 1S6LA 1NU7B 3BTGE 3A7VA 3R0FA 3HGPA 3RXLA 4ZKOU 1C1MA 4B71A 2W7UA 4FU8A 3A8BA 3TJUA 2C4FH 2HNTE 4WVPE 1GDUA 2JIZD 4Z0KA 3P95A 5EQQA 2A5AA 5EQRA 1YCPH 5DP4A 3SGQE 5HXFA 1W0KD 2D2DA 2KM0A 2TGPZ 2F83A 3ZVGA 1YCPM 2BX4A 3OEHD 4X2XA 2V3OH 3O8BA 3ENSB 1BTHH 1SGDE 1ZRKA 4NG9H 3SUGA 1FY8E 1DUAA 5CHBA 1MTVA 1TPPA 4ZKRU 1UK4A 2Y7ZA 1A3BH 9ESTA 1NM6A 3RXBA 4UONA 2EA3A 4CRDA 1D3PB 2YMSC 1AB9C 4IGDA 4TPIZ 5IYTA 1KXAA 2GZ8A 3MH6A 1TNLA 4MG3A 4CHAC 2A2QH 2PTNA 2WPIS 4Y10E 5I46H 1ZTLA 1V2PT 4KP0A 1C2KA 1GHZA 1UTOA 3UR6A 1BTZA 5EIYA 4FOUC 3UWIA 1S81A 1LHDH 2HLCA 5ABWA 1NFWA 5TCCA 1SSXA 1GHAF 1E35B 1ZSJA 4GVUA 1MMJN 2TPIZ 5J4SA 1MUEB 1OWKA 4Y8ZA 5K7RA 3ITIA 2UUFB 1YPLH 3DHKH 1W8BH 1E79D 4BAKB 3ZVBA 1AVXA 2PKSB 4OS5A 1SFIA 2H9HA 1MZDA 4BAQB 1KXBA 1HB0B 1RIWC 1V2MT 1ZSLA 2O8MA 4RI0A 1C5PA 2HLDD 3MH4A 1EOJA 3QN7A 1SQRA 1OX1A 5L2YH 1JXPA 1CA0C 1NN6A 3NCLA 1AD8H 1TWXB 3OFND 2JJ1D 3RMOH 2V7QD 1Y5UT 1RJXB 1XUGA 2WINI 1VCPA 2RDLA 4F48B 4ZUHA 1L4ZA 2WPKS 2I6QA 4YOJA 2V6NA 2AYWA 2BD3A 2HNTC 1BMMH 5EOKA 1ZR0A 2R0KA 4F49A 1DM4B 3ZV8A 1A1RA 5GCHF 1O38A 1Z6JH 2G4TA 1H8DH 1NESE 4B2CA 4FUFA 1O2YA 3BEFB 3BG4C 1CT2E 1GMDF 1E36B 4WMDA 3ZVEA 1A5HA 2OCVB 1B7XB 1MZAA 1D6RA 1LKAA 2CF9H 2V3HH 1O3JA 5C94A 3DA9B 2CK3D 2R2WU 1BTUA 3LGVA 1ZPBA 1YP9A 1DPOA 1Y3UA 4ZMAH 1TX6A 5DKMA 4XDEA 1NY22 4XBDA 4INLA 3GICB 3E6PH 2VVUA 3VB5A 2H9EH 3BTDE 3SNAA 1O3NA 4X0WU 1QB6A 3MYWA 5B6OA 1L1JA 3UNQA 2L74A 2AEIH 3ZVAA 2IN2A 1SGYE 1CT4E 1B0FA 1EAXA 2C8ZB 2GKVE 1L1NA 2FX4A 4ESTE 3RXGA 4KTSA 1JRTA 3NKKA 2HOBA 1IQIA 5T6FA 1JIRA 4XOJA 3LH3A 5A8YA 3DSGA 2CMYA 1MTNB 2BDBA 3SJ9A 1TQ7B 2WYGA 1RD3B 1MTSA 1AHTH 1C2HA 1CO7E 1EATA 2ZTYA 4NIWA 3TNTA 1B0EA 2BD7A 1DSTA 2AGIX 1DANH 3BF6H 2ZKSA 3UUZA 2PSXA 4AB8A 1TMTH 2FO9A 3N99A 3PWCA 4MNYA 1FMGA 3O8RA 3UFAA 1VITG 2FOFA 6GCHG 1BBRH 7GCHG 4NIYA 1SMFE 2BY8X 4ACBA 1P06A 1HXEH 3BTME 2AERH 2UUYA 2BVXH 1C1TA 3SZNA 4JZEH 3NXPA 3ZZ4A 1MCVA 1S84A 4K60A 2BD8A 4MLFB 2VIQA 3UQVA 1O34A 1P09A 1V2NT 2VB0A 1C5VA 1DDJA 6ESTA 3ESTA 1BTXA 1F0RA 1YLNA 1LHFH 4FUBA 1GMHF 3GYLB 1NRQH 2K1QA 1UTMA 1E1RD 4GSOA 3RP2A 1ZMLA 5EW1H 5GPIB 2Z9JA 4LK4A 5L2ZH 2PKAA 4ASUD 5T6DA 2KCAA 2ODQA 1TE0A 2BD4A 1X7AC 5A09A 4B1TA 3A7ZA 6CHAC 1O33A 1EAIA 4D8NA 1XUKA 1WYKA 2F91A 3L33A 2O8TA 1AWFH 4AOQA 5KECA 4ACAA 1QZ8A 1DWDH 3VGCC 3G01A 8GCHG 3SGBE 2BDHA 5JBTA 4RKJB 4B6FA 2GCTC 1UTJA 4GAWA 1K1LA 1PPBH 1UHBB 3BEIB 3MI4A 5HIYA 4DT4A 3ELAH 1TB6H 1KLIH 4OM9A 1AO5A 3B8JA 1K21H 4CHAB 2ASUB 1T8OA 3KQ5A 1JRSA 3URCA 3TNSA 2G81E 1YM0A 3SNEA 5LPEA 1BOQA 1YLDA 2G51A 4IN2A 3U98H 5JB9S 4FUGA 3U9AH 3OU0A 3K2UA 1S82A 1CU1A 1TAWA 1AMHA 3A7WA 1GVLA 4GHTA 5BRRE 1THPB 1YF4A 1NFXA 1P2MA 3SV2H 2XNIA 1CGIE 2TBSA 4IW4E 3B9FH 1P2IA 4B75A 1AFEH 1BIOA 2W6ID 1FY1A 3IWMA 4NFEA 2ZFTA 3A7YA 5HIZA 1H8IH 1AI8H 1ELCA 2STBE 2BOHB 4DGJA 5CMXH 2VVCA 3SUDA 1RFNA 1F5RA 1HXFH 2RA3A 4IN1A 1FONA 4CBNA 3PTNA 4CH8B 3LJOA 2WV4A 3S69A 2XBYA 1C5WB 5FBIA 1D3QB 1HAHH 3K6YA 1NRSH 5E0JA 7ESTE 1WSSH 5HM2A 3EA7A 2VBCA 1GJ9B 3LC5A 3SI3H 1L0ZA 2A4OA 5C17A 2A0QB 1QJ6B 5CHAC 2SNVA 1ETTH 4Z6AH 3SNDA 3H09A 2ZGHA 2ANMH 3MO9A 3P8FA 1EZQA 2Z3CA 1C2EA 1O3BA 2WPDD 1NRNH 4ZCNA 1L1GA 1MD8A 3ODFA 4J2YB 2H1UA 1OOKB 1XM1A 4MPWA 3E0PB 1S0RA 2QV1A 2F9UA 4XE4A 3ZZBA 1RTFB 3RXCA 1BMFD 3WW7A 1T31A 4ZHMU 2F9BH 1NBME 3PV5A 2G4UA 1AVWA 2YOLA 1ANCA 1QRZA 5DK1A 5DP6A 4Y11E 1QB1A 1O2VA 4FVBA 5DP5A 1GJAB 3T2NA 3E0NB 3KGPA 3AK5A 3MH7A 2ZA5A 1ESBA 3GY7A 2IOTA 3PYHA 2VU8E 1TBQH 4FUJA 2FTMA 3RUOA 1TA6A 3NK8A 3SGAE 1FUJA 3RU4E 2VIOA 4O3UA 4H6TA 1EB2A 1ZHRA 1O3HA 2XCFA 1QBOA 3OE7D 2ANWA 3PTBA 1SI5H 3ATKA 1CGJE 3LGIA 1LMWB 3ZZ8A 1KLJH 3T28A 3DUXH 1MH0A 3ODDA 3OTJE 1GVKB 4MDSA 1K1PA 4DT7B 2Y80A 2ZZUH 2O8WA 3DSOA 3KQCA 1ETSH 4K1EA 2KCPA 1F0SA 2F9PA 3LC3A 1C1OA 3M7QA 3SO3A 4Y0YE 4AFZA 3NPSA 4BTIB 1DE7H 3EAJA 3LKWA 1EFRD 1VCQA 3BG8A 1EXFA 1TGNA 3STJA 2GTBA 3D62A 2LP6A 3K65B 4Q2KA 3MU0A 3F2FA 1FIWA 4YLUA 2QY0B 8GCHF 4AGJA 1MAXA 4I8JA 3QGNB 1D6WA 1O2QA 1QRWA 1BTWA 4IC5A 3SBKA 4A1TA 2FI4E 1TX8A 4CRGA 2ZI2H 3BTKE 4XD7D 2PP6A 4I8LA 4O97A 1KY9A 2UWLA 4ABFA 5DP9A 2Y5FA 2VINA 3GCOA 4TPYA 1C2DA 1Y3WA 2CJIA 3BIVH 4H4FA 4NCYA 1AIXH 4SGBE 4LXBH 1ZRBA 1TNHA 4JYTA 1O2UA 3IG6B 2J4IA 2P16A 1HPGA 2XOKD 3N7OA 3PMAB 1D3TB 1IHTH 1KDQA 4NFFA 1UVSH 5LGOA 2WHXA 4NWKA 3DD2H 2BVRH 1SGRE 1K1MA 2Y81A 3RXSA 4ABEA 1WBGB 3PO1C 1F2SE 1DY8A 3E16B 1A2CH 2XRCA 1O3AA 3SZEA 5H4IB 4YOGA 1FN6A 1O2WA 5GJ4B 4Z1MD 1BT7A 1O5AB 3A8CA 1GPZA 2W26A 3P8NA 5PTPA 1QJ7B 1O3FA 2HWLB 4JYUH 4XBBA 5LPFA 4DIHH 5E0GA 1W7XH 1HBTH 1ABIH 4HG6A 1GHAG 2GMTB 5F8XA 1G3BA 4IMZA 2PUXB 2OXSA 1H1BA 1YPGH 2BQWB 2CV3A 4U30A 1DY9A 1UK3A 1W14U 3NRLA 3RM0H 5DP3A 1P3EA 3SI4H 4FVDA 4WF8A 4FUDA 1UTQA 1J17T 1G3DA 1HUTH 3T62A 5JB8S 2B9LA 2PHBA 3FO8D 1MKWH 3AAVA 4AFQA 1QL8A 1G3CA 3ATMA 2G5VA 3GY8A 4ZHLU 1O3LA 4ISHH 5CHAB 1AUTC 3K6ZA 1T7CA 4BAMB 1SLUB 1QBNA 4Y71A 3TJOA 1LQDB 4HI3A 3STIA 1NS3A 3BN9A 4XBCA 1NT1A 3SYJA 1EUFA 3RXJA 1IAUA 1F7ZA 1ZTJA 1P01A 2FPZA 4LZ4B 2VH6A 1GCDA 3FP8E 3MQKC 3VXEH 2AMDA 4LOYH 2A2XH 2JKHA 4ABJA 2UUKB 3P6ZB 1C5YB 1S85A 1THSH 2PW8H 2BLOA 1TGCA 1W12U 2OBQA 5FPTA 1QNJA 4H6SB 1FY5A 1YPKH 1DX5M 1HAVA 1SBWA 2BLVA 2GDDA 2Z3EA 2R0LA 3GCNA 1BMLA 3TU7H 3WWFA 1RXPA 4FUEA 3GISB 3SHCH 3SJ8A 1SPJA 4BAHB 5DN6D 5F8TA 1V2RT 2GVFA 3NUMA 3SV6A 3F68H 1FJSA 3TH3H 1EPTC 1SR5C 2O8LA 1SFQB 2ZPSA 1H8ED 4ASHA 3KYFA 1MKXK 3QZQA 1UO6A 4TWWA 4Q4LA 1DS2E 1GBTA 2GT7A 3BTFE 1IQEA 2XWBI 1O2KA 2ZU3A 4D9RA 1PPGE 1QL7A 1XKAC 2J95A 5HGGA 3LT3A 1DLKB 3E91A 3AASA 4XFQA 2OK5A 3TK9A 3MU1A 4NZLA 1CA8B 1KXEA 2VIWA 2BM2A 3GCHB 1THRH 2NU0E 3R3GB 2KFWA 2VIVA 1V2KT 3HK6B 3H7TA 4P02A 3RLWH 1Z8GA 3TIUA 1WCZA 2PKAB 1EAWA 1O3DA 7KMEH 1GGDB 3F2HA 1QRXA 1T4UH 1OWIA 3KHVA 1Q31A 3PROA 4K1SA 1C5SA 4ABDA 1V2JT 3UNRA 3LDXH 1GDNA 4NGAH 1PQ8A 1GMHG 3SV9A 1XKBC 1LKBA 2FZZA 3E90B 3M7TA 3LONA 2W6JD 3EYDA 5TCAA 3Q3YA 3OYPA 2ZPQA 1G37A 1ARBA 1SGFG 3FFGA 2ZDMA 4ZHAA 3T27A 2G55A 1TLDA 5JPMH 3BTEE 1SLVB 1FAKH 3A89A 3P92A 1YPJH 1F0TA 2QXGA 4VGCC 1HAOH 3LH1A 2AMQA 5T3HA 1V2TT 1A46H 1DVAH 1CBWB 1BQYA 2F3CE 1Y3XA 3A7TA 1EZUC 3TJNA 1SGTA 5JBAS 3ATLA 3ZYEA 2GZ9A 1O5EH 4KGAA 4WY3A 2UWPA 3VPKA 1P05A 1C2MA 3GDUA 1UCYE 4JK5A 2HALA 2CHAB 5A8ZA 1G3EA 5JBCS 1XXFA 2FLRH 2TRMA 3PMHB 1BZXE 2J38A 1MTUA 5C3NA 1NZQH 2ZCHP 2BXUH 1MU8B 3MWIU 5C1UA 2J2UA 4ZKNU 3UY9A 3I77A 1OXGA 1O2HA 1ZJDA 3RXMA 1PYTD 1BTPA 3AVZA 3SOSA 1EASA 3UREA 2H9TH 1LVBA 3UOUA 1S5SA 1QB9A 3VB7A 4FUHA 1K1NA 2PTCE 4F55A 3BTWE 1KTSB 3CENA 2QAAA 3E3TA 4K5ZA 5G4BA 5C1XA 1LQEA 5EJZA 1O2MA 1O2RA 4IS5A 4ZXXH 2C8YB 2QF5A 1QTFA 3GCTG 4JZFH 5DP8A 4MPXA 4AGKA 4I8KA 2FYQA 5GIBA 3UOPA 1O2OA 1XVMA 5IDKA 1ZSKA 2FMJA 2BB4A 3OSYA 4E7NA 1FY3A 1O3EA 1SLWB 3M7UA 3QWCH 5FCRA 4FU9A 1NROH 2J98A 2ANYA 2SGFE 2A5KA 3FANA 1TBZH 3LPRA 1F5LA 2XXLA 2Y6TA 1SGIB 3ATIA 3M5LA 3ZZ7A 3HKJB 3KL6A 1DLEA 4NA7A 1J16A 2VWLA 4IC6A 2BD2A 2P3TB 2W7SA 4ZKSU 1XX9A 3E1XB 5DPAA 4INKA 3RXIA 4X2VA 3U1JB 3TH4H 1GI5A 1HAXB 1RTLA 2FX6A 1V2VT 4OS4A 2IPQX 2JETB 4FU7A 2YMSD 4INHA 4NA8A 2VWOA 4OS2A 1BRAA 1SOZA 1MKWK 3GDSA 1GCTC 2AIPA 2Y5HA 1C2IA 3S0NA 4A5TS 5FPYA 2XC5A 4BNRA 4DG4A 4AYYB 5B6LA 2WYJA 5A0BA 4TWYA 2FIRH 3RMMH 4KKDA 4AX9H 1QGFA 2P8OB 1C5OH 2AH4X 1CGHA 1DOJA 1SG8B 1A5IA 1O37A 1IQFA 1GI2A 4Y8XA 4E06H 1PQ7A 4AYVB 3S9BA 1HLTH 5F6MA 2K0QA 1MTWA 3M3SA 2FWWA 4Q7XA 9LPRA 1Z8RA 4MVNA 1AKSA 3M3TA 1C1RA 4TY6A 3PRBA 1BBRE 4TT3D 1GI8B 2Z9GA 1Y8TA 3LGTA 2BDCA 5FPSA 4SGAE 2FI3E 2C93B 4A92A 1GL0E 1E37B 2PGBB 4UFFH 1YLCA 2JH0D 3RXQA 1M9UA 1C1UH 1O2PA 1EJMA 2KX4A 4AZ2B 2WZQA 1GHVH 1RTKA 4E7RG 1FI8A 2A4RA 3A86A 5IK2D 2Z9KA 1VCWA 1EP6A 1KDQB 3RXTA 3UPEA 4B2AA 1FLEE 2O9QA 2OUAA 2BY5X 2B5TB 1MBQA 4I33A 3SJOA 2YMSB 1AB9B 1HDTH 4YTAA 4ISOA 2SGEE 1OPHB 4X8VH 1WUNH 4ISNA 5K0HA 2GDEH 4QT8C 1K9OE 1HCGA 2GZ7A 1O2LA 1WTHD 2CF8H 2ZO3H 1G32B 1IHSH 1OYTH 2WPMS 1GJ8B 2Z7FE 2ZFRH 1INCA 1DXPA 5JBBS 3UB0A 3EA8A 4O3TA 4Y0ZE 1E38B 3RC6A 3QDZB 4DIIH 2PGQB 1ELAA 4R0IA 1GBBA 1F5KU 4O9VA 3SU6A 2BOKA 2K8IA 2XCNA 2VIPA 3A8AA 1ACBE 1J8AA 2Z9IA 1QQUA 2ZPRA 3SJIA 2NU1E 2W5EA 3QTVH 1ZHMA 1RIWB 1QIXB 2D26C 4KTUA 1TALA 2FS8A 1EKBB 3KQDA 1CA0B 1GJ5H 2ZG0H 2ZHQH 3GCTF 1UW7A 2GD4B 4BANB 3TGKE 1C1SA 3MU8A 3WWBA 2Q6FA 3ZZAA 2BLWA 3F2GA 1V2LT 1C4U2 3VB4A 4A6LA 3TK6A 2QIQA 3JZ2B 5KEDA 1IQMA 1GI0A 1GI9B 2VIDA 1C5NH 5EPYA 4B73A 1OP8A 1V2UT 5EGMA 1GG6C 2A7CA 2ALVA 1LPKB 1Y3YA 1MKXH 2V35A 5EW2H 2JJ2D 4MTBA 4CBOA 3T29A 2GCHF 4CRFA 3EDXB 2ZIQH 3BG4B 3BTTE 2QN5T 1HJAC 4FXGH 1J14A 4ABHA 1O3PB 2BLQA 1H8HD 1ZZZA 3GS9A 1EJNA 1S6FA 2VH0A 3AW0A 2F9NA 1FPHH 4WMEA 1PQAA 1GMCF 5FL7D 3F0PA 1T8LA 1NFYA 2FOMB 2FYRA 2ILNA 2NU2E 1GJCB 5GWZA 4NWLA 1K2I1 1BTYA 4X8UH 1VZQH 3P17H 1EAUA 4X1PU 3FOAA 1HJ8A 3SHAH 1J9CH 3M61U 1VJAU 2IPHA 1JIMA 8LPRA 4FUIA 3V3MA 1DXWA 1HAVB 4Y76A 1AE5A 2L6OA 3N7DA 1AGJA 2AMPA 2WUCA 5BPEA 1C1PA 3FZDA 3GY3A 3A83A 1TONA 4XSKU 1TRYA 1P2QA 1G30B 3DT0H 1VITH 4DW2U 2OC1A 1QJ1B 1T4VH 1G2LA 1NC6A 3ATWA 2BQ6B 5EXNA 1QA0A 1FY4A 3SNCA 2VWNA 1YC0A 3SJKA 1P9SA 1UTLM 4IMQA 3IITA 4ZXYH 3O8DA 2VVVA 1EPTA 2SGQE 3PLBA 1TX7A 2J5UA 2SGDE 1CVWH 1AFQC 1A7SA 1UTPA 3DSPA 1BHXB 1P2OA 2M5TA 3W94A 1W0JD 1T8NA 3RMLH 3M35A 3CNRA 1NRRH 2XC0A 2A7HA 5FXLA 4UEHH 1GBFA 3BTQE 1BRCE 1J15A 2STAE 1ID5H 1ORFA 3FAOA 3UQOA 2C8WB 1W7GH 1XXDA 1FV9A 1PPZA 3S7KB 4X6OA 1IQLA 1A61H 2OD3B 3LU9B 3MO6A 2BXTH 3PV2A 1Z8IB 5GDSH 1ZPZA 5EODA 1O31A 5F03A 3H5CB 2SGAA 1Q3XA 6CHAB 1KIGH 2OQ5A 4AORA 2QF0A 1ETRH 3T26A 1NPMA 5FHTA 3GY5A 2ODYB 3VGCB 1DITH 1DUEA 2GCTB 2PR3A 3NZIA 1ZLRA 2VJ1A 4MPVA 1S0QA 3A8DA 4A1VA 2ESTE 1PFXC 1QBVH 2FP7B 2TGAA 2WUBA 2LELA 5KGOA 4JZ1A 1EB1H 1UVPA 1O3MA 1HRTH 2OTVA 4R8TB 1O2TA 2ZQ1A 1E0FD 1MU6B 1QR3E 1OP2A 1TNKA 1OKXA 3QO6A 4CRAA 1C5XB 2A7JA 3LIWA 4X6PA 4AC9A 4D7FA 4GCHF 2ZTZA 1K1JA 1A5GH 1GHWH 1SGPE 5HMAA 4I32A 4ABGA 2GV7A 5JYIA 3F9FA 2IJOB 3V13A 1OS8A 1E34B 1QHRB 1TRMA 3ZYDA 1AY6H 3RC5A 3Q3XA 2ZCLP 1O32A 2PKSC 1GBJA 3QGJA 1O2SA 2FTLE 2XBWA 4GHQA 2FEQH 3SUFA 2G52A 1O2NA 1HIAA 1KYNA 3BEUA 3SQHE 1XVOA 1TMBH 4OS7A 3T25A 4RKOB 3SUEA 1SL3A 3A85A 2SGPE 3ZZDA 2GT8A 1ZGVA 5ESTE 1YY3A 2A5IA 2ZFQH 1AWHB 1GWAA 1KXCA 1O5FH 3TK5A 1O3IA 2P94A 5AFZH 5AFYH 1SQAA 4ABIA 4Y7AA 1K1IA 1LTOA 1HJ9A 1XUJA 3A84A 4Q7YA 1TPSA 2OQUA 3RC4A 3ZZCA 1FXYA 3TITA 3UWJH 5E2PA 2CXVA 1XUFA 2D1JA 1EQ9A 2VWMA 3MMGA 1PPCE 1SQOA 1ANBA 2FOCA 3A82A 3RLYH 3V12A 2QCYA 3LJJA 1YPMH 2EEKA 1H9IE 1YWUA 1W2KH 1XMNB 5A2MH 3EA9A 2BZ6H 3U8RH 5EQSA 5JDUB 2QGRA 1VKYA 1TYNA 1P12E 4M9FA 3MHWU 1K22H 4X8TH 2J98B 3RM2H 1TNGA 1GDQA 4MNWA 1VGCC 1TA2A 1TPAE 3BSQA 1VJ9U 2I6SA 1LVYA 1SHYA 3OY5U 3FZZA 1EZXC 4YZUA 2VNTA 4OGXA 2ZFFH 2FS9A 1C5QA 2J34A 2XTTB 4CREA 3SU5A 3S9CA 1GBAA 5C2ZA 2R9PA 1HAGE 4KELA 2ZDLA 3Q77A 4A1XA 3PB1E 1SGQE 1O3CA 3HKIB 2FOAA 1UJ1A 1LHCH 4HZHA 2YNAA 1ZHPA 2A1DB 2PV9B 3W95A 3C1KA 2KAIA 1BMNH 2FXRA 4P00A 2ZHDA 1GI3A 4HTCH 5EXMA 1MTNC 3KF2A 3KQBA 1GCTB 5FX5A 5T1VA 3SU0A 1P3CA 2EQNA 3TGJE 1TGTA 1O3GA 2FOGA 1GBIA 2ZDKA 1GJ6A 4BXSA 1L4DA 2GP9B 2BX3A 2TGTA 3D65E 1YKTA 5DP7A 1L2EA 1P11E 1SC8U 3SU1A 2ZU2A 2B0FA 1EJAA 1ZOMA 2WPHS 1A3EH 2HRVA 2B8OH 1AKSB 3MU4A 1IQNA 3KN2A 1P2JA 1WV7H 1GBEA 3RMNH 1BB0B 1MCTA 1TPOA 4IBLH 4BAOB 1O2ZA 1ELFA 1WDIA 4TSFD 1MAYA 1Z1JA 2BDGA 2Z9LA 4B6EA 3LGUA 1DICA 2OC7A 4GLYA 4YLQH 1V2OT 1BA8B 1SGNE 3Q00A 1MABB 4UE7H 2BY9X 2ZDAH 2OC8A 3S9AA 1JMOH 1GI4A 1OWJA 3C27B 3BIUH 3LGYA 3PV4A 4NSYA 3VB6A 1QY6A 4ZAEA 1DWEH 2FDAA 2ANKH 2D8WA 1C5TA 4X6NA 3MNCA 3HGNA 1WU1A 3VEQB 2BVSH 2EI6A 4I8HA 1C2GA 1NTPA 3V0XA 2ZF0H 2CN0H 1O39A 4I31A 4WJG2 2TGDA 1GHBF 2RA0A 3QX5H 3UAIC 1OWHA 1P0SH 2VGCC 4UD9H 4TYDA 1CT0E 1UVTH 1F92A 1BMAA 2JH5D 1DWBH 3FP6E 3P8OA 3PO1B 1P8VC 4DCDA 1YBWA 1C5MD 2CGAA 2WV5A 3F0OA 3MTYA 4D7GA 2Q6DA 1ZMJA 1ZGIA 1WOFA 4CRBA 1LPZB 5CDFE 2P93A 1CE5A 3A80A 1UVOA 1K0HA 5A8XA 2O8UA 2HVXA 1UCYH 1GI7B 1HAYB 4JCNA 4K2YA 1C5UA 2ZFSA 1C5ZB 1O5GH 1ZPCA 1OSSA 4AG2A 1W0YH 1BITA 2W3IA 2QYIA 3HATH 3CS0A 1BHXF 3SV8A 5LH8A 5EG4A 1AE8H 1C9PA 3OY6U 4YM9A 2PSYA 3KEEA 3RXRA 4JYVH 3PRDA 4WH6A 5E0HA 1Z8JB 1C5RA 2H2ZA 2A45B 1A0JA 1C2LA 1S83A 2XW9A 2WSSD 2YNBA 1N8OC 2ZGBH 2UWOA 2EI8A 2OC0A 2Z6BD 3M5MA 1GJDB 3PLKA 1U6QA 2BHGA 4BTUB 1SOTA 2ZCKP 3RXUA 3ZZ6A 2J97A 3VG8A 5F8ZA 2FOHA 1EX3A 4JZDH 4ABAA 3PM3A 3QLPH 4WWYA 1C1VH 8KME2 6LPRA 2HPQH 2SFAA 1TMUH 3OEED 1ANEA 3U69H 1N6XA 4ISLA 1T8MA 2HPPH 1PQ5A 4O03A 1CHOF 2ZGCA 3UNSA 1SGFA 1O3OA 3GY2A 5A0CA 1NU9A 2XWAA 4CR5A 1IQKA 2NWNA 1G36A 3MNSA 2GCHG 3MNBA 3P70B 1D3DB 1O36A 3MO3A 3DFJA 1P9UA 3DCLA 4YT7H 3KCGH 1NRPH 1QFKH 2PWXA 3U28C 1EZSC 2ZFPH 1VGCB 5HYOA 4H42U 1LO6A 2G5NA 1LDTT 1OYQA 5I25A 1GMCG 4OS1A 2XC4A 3EE7A 2EI7A 1W3CA 2F4LA 4CR9A 3Q3KA 2AGGX 2R3YA 2ZECA 3F9HA 5FAHA 7LPRA 1N6YA 5C0UA 4CH2B 1GJBB 2IJD1 1EPTB 2SNWA 3M37A 1C9TA 1ELTA 1ESTA 1TOMH 1GL1A 3ZVCA 2WPJS 1GBDA 1KXDA 1V2QT 1ANDA 4THNH 1P2KA 2ZU4A 4X1NU 2BD9A 1QL9A 1MD7A 1N1LA 3MU5A 2WV9A 1AU8A 3F6UH 2ODPA 4Y79A 2FOBA 3TLOA 4ZROA 2Z3DA 2V3MA 2ZHEH 3GDVA 2V0BA 2BZAA 2G00A 4NSVA 2DE9A 4RT1A 4XRNA 4BOHA 3FVFB 1ZTKA 1JOUB 4AN7A 2G8TA 5HM9A 2H5DA 4Q7ZA 4AFSA 2QA9E 3I78A 2HGTH 1IQGA 4U01A 4Q63A 1V6DA 2LPRA 4Y7BA 1SGEE 2GV6A 3F9GA 5DGJA 1P2NA 2LNCA 1A0HB 2H5CA 3NWUA 1QQ4A 1D4PB 1VR1H 4WMFA 1YGCH 3EGKH 2Y5GA 2WPLS 1HNEE 2DE8A 4JK6A 2ZTXA 5C5OA 1O0DH 3RXAA 1DFPA 1UVUH 1PJPA 1Q2WA 3MFJA 5FX6A 2GGVB 1C4Y2 1EP5A 2Y82A 1IOEA 4MQAA 2RG3A 1TNIA 1O2GH 3FP7E 3RXEA 3ZZ3A 2ZEBA 5A0AE 2C90B 2KZ4A 2P95A 1EOLA 1O5DH 1O35A 1FNIA 3S7HB 1E1QD 1RS0A 2BDIA 2ZWLH 1P57B 5EXLA 4MNVA 3ZZ5A 2BMGB 2KCYA 3A81A 2W3KA 2VGCB 2EY4C 2JDID 2ZDVH 4VGCB 5EJLA 1MQ6A 1W10U 1ZJKA 1V2ST 1TIOA 1GJ4H 1C2FA 1FDPA 2F43B 1GBMA 1G9IE 2OP9A 5ESBA 1BDAA 1PPEE 5E8EH 1DWCH 1TABE 1W11U 3LOXA 1UMAH 2KR7A 3MNXA 4RN6A 1HIAB 1C4V2 4YOIA 3QTOH 4ABBA 3U8TH 2ZGJA 1HV7A 1TGBA 2GMTC 1YCPK 4GCHG 2J94A 2XYAA 2F9OA 4CRCA 1ELVA 4B74A 3BTHE 1ABJH 1HAIH 2BD5A 1UTNA 2OBOA 4WXVA 5FCKA 1WQVH 1OP0A 3EE0B 1GHXH 3TH2H 3SU4A 2RDEA 3RXPA 1ARCA 3RXVA 5EJ1A 4NIXA 2BDYA 3V7TA 1N8OB 4UFEH 1UTKA 3SN8A 3M5OA 4UFGH 3KNXA 1LVOA 1GI6A 1H9HE 4MNXA 2ZP0H 1FAXA 3RXDA 1COWD 1ELBA 4U32A 2FLBH 4D9QA 1BCUH 2H6MA 1ELEE 1H4WA 1AZ8A 5HKKD 1Y5BT 3QK1A 3OX7U 3L3TA 1C5LH 4TY7A 3TJVA 1SQTA 1LCYA 2FOEA 3OAAD 1UCYK 5F53A 3F9EA 3RXFA 3I29A 5C1YA 1AQ7A 3BV9B 2A4QA 4ZH8A 3TGIE 1G2MA 3ZZ9A 2XNDD 5GNDA 4B76A 1AUJA 3U1IB 3FKSD 1AZZA 1WTGH 3A88A 3SU2A 1TRNA 1FN8A 1WQSA 4X8SH 5CE1A 3JZ1B 5DO4H 1SLXB 1Z71A 3MOCA 3LGWA 5AF9H 4Y8YA 4FETA 2KAIB 4K8BA 4BXWA 1Y59T 5TJXA 4UFDH 4B2BA 2BDAA 4KTCA 1T32A 1VITF 4DURA 1SKYE 6GCHF 1QURH 7GCHF 1LHGH 3OTPA
chains in the Genus database with same CATH topology
2FM2A 4FUCA 1YPHE 2FODA 1GBHA 3PWBA 5EPNA 1WAYB 4J1YA 4JZIA 1C1WH 2P3UB 2OLGA 1O5CB 5AHGH 3SU3A 5FBEA 1P02A 1SB1H 4X1RU 2BTCE 1TOCB 1AN1E 1O2JA 2ALPA 3D49H 1JWTA 3GY4A 1XUIA 2AGEX 3RU4T 2P59A 3RDZA 1B5GH 3GCHC 2P3FH 3P8GA 1GBKA 1HYLA 1C1NA 3K9XB 4HFPB 1PPHE 4ISIH 2THFB 3H7OA 2BYAX 3MH5A 3GY6A 4K69A 3PLPA 2ZHWH 4WXIA 1LPGB 3KIDU 3UR9A 1FQ3A 1Z7KA 5C20A 2Q6GA 2BQ7B 1BUIA 1GGDC 2FI5E 2RCEA 3AW1A 1TNJA 1NO9H 1OWEA 4K1TA 4K8YA 4RSPA 1HGTH 4X1QU 1SGCA 1YPEH 3VXFH 1O2XA 3ZVFA 2ZNKH 4K3JA 2BY7X 2JH6D 2QXHA 1HAZB 2XBVA 2F9VA 3SNBA 3CS7A 1LHEH 1CQQA 1FIZA 3ZVDA 2ZGXH 1HAPH 2TIOA 4WH8A 1DSUA 1QA7A 1W0ZU 1BJUA 3AAUA 5EU8A 3DFLA 1SVPA 2PUQH 2C8XB 4DJZB 1BJVA 3RXHA 3URDA 1UHBA 1TFXA 1XUHA 2EC9H 2Q1JA 1BBRK 2BY6X 3GYMA 1OWDA 2Z94A 2A32A 3VFEA 1AVGH 3M36A 4MPUA 3SQEE 3TVJB 4DVAU 1P10A 1CHGA 1GHBG 2ULLA 4OS6A 1MQ5A 4YO9A 4X2WA 3U8OH 1RRKA 2A31A 1CBWC 1A4WH 1JBUH 1ELDE 1TQ0B 2FESH 1YPHC 4NA9H 4X1SU 2R2MB 1KXFA 3EQ0H 3QUMP 1KSNA 3E8LA 1BRUP 1Y3VA 4PROA 1SHHB 2CHAC 3HPTB 3B23B 3Q76A 2UUJB 4LZ1H 3D23A 1UK2A 2J9NA 3RXKA 1KLTA 1GJ7B 1Z6EA 2AS9A 1KTTB 1O5BB 1GHYH 5T6GA 4X2YA 1QCPA 5SGAE 4NZQA 1YYY1 1V2WT 1P03A 1BRBE 2AIQA 2C3SA 2Y7XA 3UTUH 1D9IA 2J92A 1GG6B 5GXPA 1P04A 2A4GA 2B7DH 1GVZA 4F4OC 1V3XA 1CSOE 1Y5AT 2ZU5A 3RXOA 1FZZA 5C5NA 2PLXA 2QXJA 1C2JA 4HGCA 4D76A 1HJAB 5J4QA 3A7XA 4GPGA 4YT6H 4BTTB 2ZQ2A 4YESB 3ZV9A 1ZMNA 4Q80A 5DG6A 4DOQA 1PPFE 3M3VA 4X6MA 3F1SB 3T5FH 4NIVA 4M7GA 4AFUA 1MBMA 1NFUA 1W13U 3HK3B 4AB9A 1O30A 3GOVB 2ZHFH 1K28D 5GCHG 3KQEA 3PMBB 3QZRA 3SORA 3A87A 1GBCA 1TGSZ 1GMDG 1CHOG 3UIRA 4A7IB 3SV7A 3WY8A 1HFDA 1C1QA 5E2OA 2QC2A 3M5NA 3VB3A 3O8CA 4OGYA 4Y6DA 2XBXA 1Z1IA 2GX4A 2OINA 1FPCH 5AVDA 1F0UA 1IQJA 1K1OA 2NU4E 1GBLA 1DT2A 1ESAA 2AFQB 2PFEA 2JETC 5LPRA 1IQHA 2R3UA 1A0LA 1RGQA 4JMYA 8ESTE 1PYTC 2NU3E 2QF3A 1O2IA 4UDWH 3RU4D 1O3KA 4U2WA 2QXIA 1LVMA 5C67A 3TPIZ 3PMJA 3L6PA 4I7YH 2ZC9H 1AFQB 5L6NH 4E05H 1S6HA 2P8OC 5DJ7A 4I8GA 3SW2B 1TBRH 1ZYOA 4GUXA 1ELGA 1GI1A 5ETXA 1H9LB 2ZU1A 4AG1A 2DUCA 5L30H 2ZDNA 4DY7B 2HNTF 3CP7A 1NU7B 3BTGE 3A7VA 3R0FA 3HGPA 3RXLA 4ZKOU 1C1MA 4B71A 2W7UA 4FU8A 3A8BA 3TJUA 2C4FH 2HNTE 4WVPE 1GDUA 4Z0KA 3P95A 5EQQA 2A5AA 5EQRA 1YCPH 5DP4A 3SGQE 5HXFA 2D2DA 2TGPZ 3ZVGA 2F83A 1YCPM 2BX4A 4X2XA 2V3OH 3O8BA 3ENSB 1BTHH 1SGDE 1ZRKA 4NG9H 3SUGA 1FY8E 1DUAA 1MTVA 1TPPA 4ZKRU 1UK4A 2Y7ZA 1A3BH 9ESTA 1NM6A 3RXBA 4UONA 2EA3A 4CRDA 1D3PB 1AB9C 4IGDA 4TPIZ 5IYTA 1KXAA 2GZ8A 3MH6A 1TNLA 4MG3A 4CHAC 2A2QH 2PTNA 2WPIS 4Y10E 5I46H 1ZTLA 1V2PT 4KP0A 1C2KA 1GHZA 1UTOA 3UR6A 1BTZA 3UWIA 1S81A 1LHDH 2HLCA 5ABWA 1NFWA 5TCCA 1SSXA 1GHAF 1E35B 1ZSJA 4GVUA 1MMJN 2TPIZ 5J4SA 1MUEB 1OWKA 4Y8ZA 5K7RA 3ITIA 2UUFB 1YPLH 3DHKH 1W8BH 4BAKB 3ZVBA 1AVXA 2PKSB 4OS5A 1SFIA 2H9HA 1MZDA 4BAQB 1KXBA 1HB0B 1RIWC 1V2MT 1ZSLA 2O8MA 1C5PA 3MH4A 1EOJA 3QN7A 1OX1A 5L2YH 1JXPA 1CA0C 1NN6A 3NCLA 1AD8H 1TWXB 3RMOH 1Y5UT 1RJXB 1XUGA 2WINI 1VCPA 2RDLA 4ZUHA 1L4ZA 2WPKS 2I6QA 4YOJA 2V6NA 2AYWA 2BD3A 2HNTC 1BMMH 5EOKA 1ZR0A 2R0KA 4F49A 1DM4B 3ZV8A 1A1RA 5GCHF 1O38A 1Z6JH 2G4TA 1H8DH 1NESE 4B2CA 4FUFA 1O2YA 3BEFB 3BG4C 1CT2E 1GMDF 1E36B 4WMDA 3ZVEA 1A5HA 2OCVB 1B7XB 1MZAA 1D6RA 1LKAA 2CF9H 2V3HH 1O3JA 3DA9B 2R2WU 1BTUA 3LGVA 1ZPBA 1YP9A 1DPOA 1Y3UA 4ZMAH 1TX6A 5DKMA 4XDEA 1NY22 4XBDA 4INLA 3GICB 3E6PH 2VVUA 3VB5A 2H9EH 3BTDE 3SNAA 1O3NA 4X0WU 1QB6A 3MYWA 5B6OA 1L1JA 3UNQA 2AEIH 3ZVAA 2IN2A 1SGYE 1CT4E 1B0FA 1EAXA 2C8ZB 2GKVE 1L1NA 2FX4A 4ESTE 3RXGA 4KTSA 1JRTA 3NKKA 2HOBA 1IQIA 5T6FA 1JIRA 4XOJA 3LH3A 5A8YA 2CMYA 1MTNB 2BDBA 3SJ9A 1TQ7B 2WYGA 1RD3B 1MTSA 1AHTH 1C2HA 1CO7E 1EATA 2ZTYA 4NIWA 3TNTA 1B0EA 2BD7A 1DSTA 2AGIX 1DANH 3BF6H 2ZKSA 3UUZA 2PSXA 4AB8A 1TMTH 2FO9A 3PWCA 4MNYA 1FMGA 3O8RA 3UFAA 1VITG 2FOFA 6GCHG 1BBRH 7GCHG 4NIYA 1SMFE 2BY8X 1P06A 1HXEH 3BTME 2AERH 2UUYA 2BVXH 1C1TA 3SZNA 4JZEH 3NXPA 3ZZ4A 1MCVA 1S84A 4K60A 2BD8A 4MLFB 2VIQA 3UQVA 1O34A 1P09A 1V2NT 2VB0A 1C5VA 1DDJA 6ESTA 3ESTA 1BTXA 1F0RA 1LHFH 4FUBA 1GMHF 3GYLB 1NRQH 2K1QA 1UTMA 4GSOA 3RP2A 1ZMLA 5EW1H 5GPIB 2Z9JA 4LK4A 5L2ZH 2PKAA 5T6DA 2ODQA 1TE0A 2BD4A 1X7AC 5A09A 4B1TA 3A7ZA 6CHAC 1O33A 1EAIA 4D8NA 1XUKA 1WYKA 2F91A 3L33A 2O8TA 1AWFH 4AOQA 1DWDH 3VGCC 3G01A 8GCHG 3SGBE 2BDHA 5JBTA 4RKJB 2GCTC 1UTJA 4GAWA 1K1LA 1PPBH 1UHBB 3BEIB 3MI4A 3ELAH 1TB6H 1KLIH 1AO5A 3B8JA 1K21H 4CHAB 2ASUB 1T8OA 3URCA 1JRSA 3TNSA 2G81E 1YM0A 3SNEA 5LPEA 1BOQA 1YLDA 2G51A 4IN2A 3U98H 5JB9S 4FUGA 3U9AH 3OU0A 3K2UA 1S82A 1CU1A 1TAWA 1AMHA 3A7WA 1GVLA 4GHTA 5BRRE 1THPB 1YF4A 1NFXA 1P2MA 3SV2H 2XNIA 1CGIE 2TBSA 4IW4E 3B9FH 1P2IA 4B75A 1AFEH 1BIOA 1FY1A 3IWMA 4NFEA 2ZFTA 3A7YA 1H8IH 1AI8H 1ELCA 2STBE 2BOHB 4DGJA 5CMXH 2VVCA 3SUDA 1RFNA 1F5RA 1HXFH 2RA3A 4IN1A 1FONA 4CBNA 3PTNA 4CH8B 3LJOA 2WV4A 3S69A 2XBYA 1C5WB 5FBIA 1D3QB 1HAHH 3K6YA 1NRSH 5E0JA 7ESTE 1WSSH 5HM2A 3EA7A 1GJ9B 3LC5A 3SI3H 1L0ZA 2A4OA 2A0QB 1QJ6B 5CHAC 2SNVA 1ETTH 4Z6AH 3SNDA 2ZGHA 2ANMH 3MO9A 3P8FA 1EZQA 2Z3CA 1C2EA 1O3BA 1NRNH 1L1GA 1MD8A 3ODFA 4J2YB 2H1UA 1OOKB 1XM1A 4MPWA 3E0PB 1S0RA 2QV1A 2F9UA 4XE4A 3ZZBA 1RTFB 3RXCA 1T31A 4ZHMU 2F9BH 2G4UA 1AVWA 2YOLA 1ANCA 1QRZA 5DK1A 5DP6A 4Y11E 1QB1A 1O2VA 4FVBA 5DP5A 1GJAB 3T2NA 3E0NB 3KGPA 3MH7A 2ZA5A 1ESBA 3GY7A 2IOTA 3PYHA 2VU8E 1TBQH 4FUJA 2FTMA 3RUOA 1TA6A 3NK8A 3SGAE 1FUJA 3RU4E 2VIOA 4O3UA 4H6TA 1EB2A 1ZHRA 1O3HA 2XCFA 1QBOA 2ANWA 3PTBA 1SI5H 3ATKA 1CGJE 3LGIA 1LMWB 3ZZ8A 1KLJH 3T28A 3DUXH 1MH0A 3ODDA 3OTJE 1GVKB 4MDSA 1K1PA 4DT7B 2Y80A 2ZZUH 2O8WA 3KQCA 1ETSH 4K1EA 1F0SA 2F9PA 3LC3A 1C1OA 3M7QA 3SO3A 4Y0YE 4AFZA 3NPSA 4BTIB 1DE7H 3EAJA 3LKWA 1VCQA 3BG8A 1EXFA 1TGNA 3STJA 2GTBA 3D62A 3K65B 4Q2KA 3MU0A 1FIWA 4YLUA 2QY0B 8GCHF 4AGJA 1MAXA 4I8JA 3QGNB 1D6WA 1O2QA 1QRWA 1BTWA 4IC5A 3SBKA 4A1TA 2FI4E 1TX8A 4CRGA 2ZI2H 3BTKE 4I8LA 4O97A 1KY9A 2UWLA 4ABFA 5DP9A 2Y5FA 2VINA 3GCOA 4TPYA 1C2DA 1Y3WA 2CJIA 3BIVH 4H4FA 4NCYA 1AIXH 4SGBE 4LXBH 1ZRBA 1TNHA 4JYTA 1O2UA 3IG6B 2J4IA 2P16A 1HPGA 3N7OA 3PMAB 1D3TB 1IHTH 1KDQA 4NFFA 1UVSH 5LGOA 4NWKA 3DD2H 2BVRH 1SGRE 1K1MA 2Y81A 3RXSA 4ABEA 1WBGB 3PO1C 1F2SE 1DY8A 3E16B 1A2CH 2XRCA 1O3AA 5H4IB 4YOGA 1FN6A 1O2WA 5GJ4B 1BT7A 1O5AB 3A8CA 1GPZA 2W26A 3P8NA 5PTPA 1QJ7B 1O3FA 2HWLB 4JYUH 4XBBA 5LPFA 4DIHH 5E0GA 1W7XH 1HBTH 1ABIH 1GHAG 2GMTB 5F8XA 1G3BA 4IMZA 2PUXB 2OXSA 1H1BA 1YPGH 2BQWB 2CV3A 4U30A 1DY9A 1UK3A 1W14U 3RM0H 5DP3A 1P3EA 3SI4H 4FVDA 4WF8A 4FUDA 1UTQA 1J17T 1G3DA 1HUTH 3T62A 5JB8S 2B9LA 2PHBA 1MKWH 3AAVA 4AFQA 1QL8A 1G3CA 3ATMA 2G5VA 3GY8A 4ZHLU 1O3LA 4ISHH 5CHAB 1AUTC 3K6ZA 1T7CA 4BAMB 1SLUB 1QBNA 4Y71A 3TJOA 1LQDB 4HI3A 3STIA 1NS3A 3BN9A 4XBCA 1NT1A 1EUFA 3RXJA 1IAUA 1F7ZA 1ZTJA 1P01A 2FPZA 4LZ4B 2VH6A 1GCDA 3FP8E 3VXEH 2AMDA 4LOYH 2A2XH 2JKHA 4ABJA 2UUKB 3P6ZB 1C5YB 1S85A 1THSH 2PW8H 2BLOA 1TGCA 1W12U 2OBQA 5FPTA 1QNJA 4H6SB 1FY5A 1YPKH 1DX5M 1HAVA 1SBWA 2BLVA 2GDDA 2Z3EA 2R0LA 3GCNA 1BMLA 3TU7H 1RXPA 4FUEA 3GISB 3SHCH 3SJ8A 1SPJA 4BAHB 5F8TA 1V2RT 2GVFA 3NUMA 3SV6A 3F68H 1FJSA 3TH3H 1EPTC 1SR5C 2O8LA 1SFQB 2ZPSA 4ASHA 1MKXK 3QZQA 1UO6A 4TWWA 1DS2E 1GBTA 2GT7A 3BTFE 1IQEA 2XWBI 1O2KA 2ZU3A 4D9RA 1PPGE 1QL7A 1XKAC 2J95A 5HGGA 3LT3A 1DLKB 3E91A 3AASA 4XFQA 3TK9A 3MU1A 4NZLA 1CA8B 1KXEA 2VIWA 2BM2A 3GCHB 1THRH 2NU0E 3R3GB 2VIVA 1V2KT 3HK6B 3H7TA 3RLWH 1Z8GA 3TIUA 1WCZA 2PKAB 1EAWA 1O3DA 7KMEH 1GGDB 1QRXA 1T4UH 1OWIA 3KHVA 1Q31A 3PROA 4K1SA 1C5SA 4ABDA 1V2JT 3UNRA 3LDXH 1GDNA 4NGAH 1PQ8A 1GMHG 3SV9A 1XKBC 1LKBA 2FZZA 3E90B 3M7TA 3LONA 3EYDA 5TCAA 3Q3YA 3OYPA 2ZPQA 1G37A 1ARBA 1SGFG 3FFGA 2ZDMA 4ZHAA 3T27A 2G55A 1TLDA 5JPMH 3BTEE 1SLVB 1FAKH 3A89A 3P92A 1YPJH 1F0TA 2QXGA 4VGCC 1HAOH 3LH1A 2AMQA 5T3HA 1V2TT 1A46H 1DVAH 1CBWB 1BQYA 2F3CE 1Y3XA 3A7TA 1EZUC 3TJNA 1SGTA 5JBAS 3ATLA 3ZYEA 2GZ9A 1O5EH 4KGAA 4WY3A 2UWPA 3VPKA 1P05A 1C2MA 3GDUA 1UCYE 4JK5A 2HALA 2CHAB 5A8ZA 1G3EA 5JBCS 1XXFA 2FLRH 2TRMA 3PMHB 1BZXE 2J38A 1MTUA 5C3NA 1NZQH 2ZCHP 2BXUH 1MU8B 3MWIU 5C1UA 2J2UA 4ZKNU 3UY9A 3I77A 1OXGA 1O2HA 1ZJDA 3RXMA 1PYTD 1BTPA 3AVZA 3SOSA 1EASA 3UREA