2QY0B

Active dimeric structure of the catalytic domain of c1r reveals enzyme-product like contacts
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
240
structure length
236
Chain Sequence
b'IIGGQKAKMGNFPWQVFTNIHGRGGGALLGDRWILTAAHTLYPKEHEASLDVFLGHTNVEELMKLGNHPIRRVSVHPDYRQDESYNFEGDIALLELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGVMEEKIAHDLRFVRLPVANPQACENWLRGKNRMDVFSQNMFCAGHPSLKQDACQGDSGGVFAVRDPNTDRWVATGIVSWGIGCSRGYGFYTKVLNYVDWIKKEMEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement C1r subcomponent
publication title Revisiting the mechanism of the autoactivation of the complement protease C1r in the C1 complex: Structure of the active catalytic region of C1r.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 56
structure length 236
sequence length 240
chains with identical sequence D
ec nomenclature ec 3.4.21.41: Complement subcomponent C1r.
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qy0B01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qy0B02
1ZRBA 1YM0A 1SL3A 1MBMA 5ETXA 5TCCA 2XRCA 1NT1A 4U30A 2BLWA 1EXFA 4GCHF 3PLKA 3S9AA 3O8BA 3RXIA 1W12U 3ZVAA 2Y80A 1RIWB 3A8BA 1RS0A 1A5GH 1ARCA 3QZRA 4Y79A 3RXJA 1MKWH 2SGDE 4CHAC 2PLXA 1A3EH 1UHBA 1BBRH 3F68H 3MYWA 1G37A 2BY8X 2BY6X 1SGQE 4NZQA 1P05A 4VGCB 3BTFE 3E8LA 1FY4A 3GCOA 5FX6A 2ZDKA 4UFDH 1O3EA 1N6YA 3F9GA 3S69A 5BPEA 4X8UH 4BAMB 3BN9A 1ZTLA 2EI8A 3SU6A 1SLWB 4K8YA 3HGNA 3E16B 1P2NA 4JZEH 2TIOA 3RXPA 1IQEA 1K21H 1PYTD 2G00A 2J92A 2G51A 2G8TA 3W94A 4BAOB 3MH7A 1C1RA 4OGXA 3FZZA 2YNBA 3GCHC 3DFJA 2Y5HA 2VIPA 1P09A 5F8TA 5F8XA 4NA7A 3ZVFA 1HXEH 1TBRH 1C5SA 3FAOA 1W2KH 2FI3E 4OS1A 3U8OH 1UVUH 4IC6A 5F6MA 2BOHB 1FXYA 1C5WB 4ZKNU 1BHXB 1GHBF 2Y82A 2YOLA 4BTUB 3UR6A 4NIVA 5JB9S 3S9BA 1BRBE 2I6QA 2PW8H 2KAIA 2P16A 1EAWA 1FPHH 3SJ8A 2BDHA 1GL1A 4DJZB 3GCTF 2VWOA 4ABAA 2BQWB 1UTQA 4FUCA 5AFZH 2ZDVH 1HAYB 1AFQB 4MNYA 2FOAA 4JYVH 1O2YA 4IN2A 2C93B 1YGCH 4DOQA 1HRTH 3UOPA 5C1XA 1LHDH 1LVYA 1GPZA 2FIRH 1QBVH 3VXFH 2ZHFH 1T32A 1NU7B 3MNXA 3GYLB 3BG4B 3STIA 3BV9B 3KNXA 3JZ2B 3VB6A 1O36A 1S0RA 3MO6A 1GGDB 3PWCA 2VH6A 3TGIE 1FLEE 2FYQA 2Z9GA 2WV5A 4FVDA 5A0CA 1TMTH 5FCRA 2FMJA 2V0BA 3RXDA 1ZHRA 4B74A 2FX4A 4JCNA 1GJ9B 1EAXA 1LHEH 3TITA 1JWTA 1LPGB 1UVOA 1T8NA 4OS5A 1KXAA 4HI3A 2R2MB 3RXOA 1ANCA 2XCFA 1BB0B 2VINA 1RRKA 1QTFA 4WJG2 1A1RA 2W5EA 2CN0H 1EX3A 5E8EH 1QB9A 1GJ5H 4XOJA 1UVSH 2JETC 1KXFA 5FPTA 3LJOA 1V2QT 1EATA 3KGPA 4B2CA 1BTHH 1BTPA 2HALA 3ZZ3A 1GVKB 2QF0A 1DDJA 1T8LA 5E2OA 1DT2A 1G30B 5T6GA 1S81A 1Y3WA 2GMTB 3I29A 3RXRA 3QO6A 5ESBA 4K60A 4I7YH 3TGKE 3PO1B 4YESB 1K1LA 3Q3YA 1FMGA 1GWAA 3UR9A 3RXFA 3UUZA 1SLXB 1AMHA 1C5PA 3ATIA 2OC1A 1AB9C 1TRYA 2BY5X 2QGRA 1O3GA 2G5VA 3HGPA 3ZZCA 4XBBA 1BA8B 1F2SE 4NA8A 1FY8E 4UE7H 3VEQB 1O2ZA 3B23B 1KTSB 3TK5A 3RP2A 2ZO3H 3MHWU 4KELA 2XC5A 2D8WA 1TBZH 3BTKE 3ITIA 2C8YB 2SGQE 4CRDA 2ZTXA 5A09A 2EI7A 3ELAH 3GY3A 1ZRKA 3MU1A 1HAVB 1HAOH 1XUGA 1ZSJA 2F9NA 2WPJS 1H9LB 3SQEE 4A5TS 1PJPA 2AH4X 3SORA 1H8IH 5AHGH 1C5RA 1JOUB 1T8MA 1HJAB 1O3FA 4E05H 2FLRH 1CHOF 2GCHG 2GT7A 3LJJA 5J4SA 1OWIA 1A46H 1S82A 2WPLS 4FU9A 1PQ5A 3OTJE 3P70B 5EODA 1BMAA 2OQ5A 3BTQE 1C5ZB 1O34A 1DANH 3PTBA 4XDEA 1PPCE 1SMFE 2BB4A 1K1PA 1P03A 1TNHA 1DFPA 1NS3A 1CVWH 2TGAA 1OPHB 3ZVEA 3CENA 3PWBA 4B71A 1RTLA 2FI5E 2VH0A 1V2MT 4Y0YE 5DKMA 5EPYA 3P8OA 4A1TA 3TH3H 1E35B 2FX6A 1O2OA 4X8TH 3SBKA 2A0QB 4Q80A 3ODFA 3RU4D 3M7QA 4WH6A 2ZU4A 2VJ1A 4AYVB 1EPTC 1TNJA 2WPHS 3UNRA 4GUXA 4AGJA 5DP7A 2QXHA 1SLUB 4CRCA 3V12A 3ZVDA 1TGNA 4ZROA 3NXPA 3BF6H 2ZIQH 2ANKH 1UHBB 4YOJA 2VNTA 4DW2U 1A5HA 2D2DA 3ZZ6A 1BCUH 1DUAA 3T25A 2B9LA 2ZGJA 3D65E 3HKIB 5I25A 5EW2H 5C5OA 4BNRA 5DGJA 2VIWA 1GBKA 4X0WU 1EZSC 1VCWA 3LKWA 1FAKH 1GBCA 3R0FA 4JYUH 1TOMH 1QL7A 5LPFA 4NIYA 1FN6A 4TY7A 1F0RA 1V2RT 3LT3A 2GV6A 2FZZA 6CHAB 1V2WT 3GY2A 1LHCH 4FUEA 2A5IA 3LIWA 2CV3A 3S0NA 1SGFA 2IPHA 2FTMA 1BZXE 2XC0A 3UY9A 3FVFB 2SGFE 1W8BH 1O33A 4XBDA 1O2TA 1NN6A 1IQGA 4CRGA 1O30A 2BTCE 2G55A 4ABBA 2QV1A 4AOQA 1NRQH 2RCEA 4ASHA 1ZMNA 1AQ7A 4NFFA 4FUIA 1ZOMA 1H9IE 1G3EA 2KAIB 3RMLH 5DG6A 2G4UA 1GBTA 3SI4H 1HAXB 2PV9B 2QF3A 1ESBA 1K22H 2ZHWH 2NU0E 5TCAA 3M5MA 2RA3A 1UTNA 4KGAA 1EB2A 4ISLA 3ZZAA 1THPB 1OP0A 3M3TA 2ODYB 3A87A 3S7KB 4JZ1A 4IW4E 1MQ5A 1G32B 2QCYA 1OWKA 1ORFA 2RG3A 2C3SA 2XXLA 1C1PA 2CXVA 1K1MA 1EPTA 1SQAA 4J2YB 1MAXA 2QC2A 1GI0A 1NESE 2FWWA 3A8AA 3RXLA 1ZLRA 4JK6A 3EQ0H 1FY3A 3RXKA 1W11U 2AMDA 2FO9A 1SGRE 1AE5A 4CHAB 1DXWA 4Y7BA 1TPSA 3MNSA 3AW0A 1O5AB 3U8TH 1O3MA 2UUKB 1V2KT 3UNSA 1LQEA 4BXSA 1AWHB 4K2YA 1C5LH 3K2UA 2BHGA 1O3PB 1CGIE 1M9UA 4ISNA 5EQRA 5LH8A 2Z3DA 1P12E 4LZ1H 2FYRA 1OWJA 2B7DH 3RDZA 1BTWA 4UONA 1EJNA 1HJ8A 2HGTH 1N8OC 1W10U 3RU4E 4BAKB 1GJ6A 1HAHH 1TABE 2A31A 2AGIX 4XBCA 2WV4A 2VGCB 3A7WA 4ZUHA 1DWBH 1OWDA 3TJVA 1F92A 2H5CA 5DPAA 4CRAA 3GCHB 1NFYA 1XVOA 1GHXH 2XW9A 3GY5A 1O2HA 2FS9A 2PHBA 1OSSA 3F1SB 5AVDA 2PWXA 5ABWA 3RU4T 4TPYA 4IC5A 4IGDA 4LK4A 1QR3E 2ZFRH 4WMEA 1YPJH 3QTVH 2FDAA 2GX4A 1CHGA 1A0LA 2OC7A 2AIPA 1NU9A 5AFYH 2Z9KA 2ZPRA 1DY9A 2LPRA 2ANYA 1LHGH 1EQ9A 1MH0A 2R3UA 5IDKA 3Q76A 4Y7AA 3SHAH 4FUHA 1KXCA 5E0HA 2C8ZB 1O2KA 2JKHA 2ZFFH 5LGOA 4INKA 2BX4A 1Q3XA 4FU7A 2W7UA 3HPTB 1E36B 1YKTA 1AI8H 1TRMA 3AW1A 4JZIA 3URDA 2A5KA 1SGPE 1OWHA 4ZKRU 2XBYA 4NGAH 1HAGE 8GCHG 2PSYA 1ZR0A 3FP8E 1A4WH 1QBNA 1V6DA 1MTUA 2H9HA 1O5EH 2UUYA 3GDUA 2ZDLA 1C9PA 3NCLA 1C1MA 2A5AA 1KXEA 1P3CA 4J1YA 4KTUA 4O3TA 2PTCE 2UUFB 1K2I1 2ZGXH 4BXWA 1MTSA 1C4Y2 4FU8A 1Z6JH 4ABDA 2ZHQH 4NWKA 4CH8B 1AVGH 4TWYA 2BD3A 3P95A 2Z7FE 3U69H 1O3BA 2BM2A 4A6LA 4DURA 2BDIA 2ZPQA 4QT8C 1CBWC 3BTDE 2GZ7A 1L1GA 1IQJA 3E90B 2JETB 2RDLA 4B75A 3PMAB 4X2VA 4O3UA 1WTGH 2CHAB 3DUXH 2XCNA 1C5QA 1TE0A 3AASA 5CHAC 2UWOA 3BEIB 1QJ6B 1TMBH 1P57B 2QA9E 2Z9LA 2W3KA 3NK8A 1C5NH 4WXIA 1C2LA 1MTWA 3ZVCA 1YPHC 2FXRA 1FPCH 4JYTA 4SGBE 1DXPA 3NUMA 5DK1A 1E37B 2HNTC 3OSYA 4LXBH 4THNH 1SFIA 3GY7A 2BVRH 1FN8A 2ZCLP 7GCHG 3RXSA 3D23A 4ISIH 3GY6A 3SO3A 1F7ZA 2ZPSA 2Z3CA 1ZGVA 2ANMH 2XBWA 3LC5A 2PFEA 1TPOA 4KTSA 4D9RA 1P9SA 2Z6BD 3EAJA 3H7OA 1AB9B 3RXQA 1SGEE 1LVBA 4YLUA 4Y10E 3U98H 3MO9A 3RXBA 1EZQA 3OY6U 3T28A 1GJCB 1SGTA 1VITH 3U8RH 5ESTE 4AFSA 3F9FA 1IQKA 1FZZA 4Y76A 1GDNA 1RTKA 1DPOA 1KY9A 3PB1E 3PMJA 1A7SA 4NIXA 1NFXA 2O8TA 3RLWH 1FJSA 4X6NA 5FPYA 1NY22 1NRRH 1EKBB 4FUGA 3UQVA 2AMQA 4MPXA 2AERH 1SGYE 4K3JA 4X6PA 3K65B 3M5NA 1QIXB 4ABHA 1WBGB 1YBWA 1MKXK 4ABJA 1YCPK 3A83A 1AGJA 1T7CA 1SGCA 1BIOA 1HPGA 4GAWA 5GDSH 1EJAA 1G2LA 5HM2A 4B73A 1SB1H 1ETRH 3DFLA 4UDWH 3P17H 1MTVA 2ZU1A 3SV6A 1HAZB 1PPFE 1ELTA 3QX5H 1MCVA 3I78A 1YPLH 1CU1A 5JYIA 5BRRE 1SOTA 1MU8B 1LPKB 1CSOE 2HNTF 1RTFB 2GV7A 3VB3A 1S5SA 1L1JA 1V2PT 3A85A 1P8VC 2A7JA 2FS8A 2PSXA 4TYDA 3ZZ7A 4AB9A 4D8NA 5JBAS 1CA8B 3SUFA 1GJBB 3STJA 1GMCG 4WWYA 1GBEA 1YF4A 1EPTB 1ZMLA 2P94A 2ZDNA 2ZQ2A 3MU8A 1KIGH 1O2SA 2HLCA 2IN2A 2STAE 2HOBA 3IITA 3TLOA 1GI6A 4PROA 1TIOA 2VIOA 1NFUA 5A0AE 9ESTA 2XWAA 2BXUH 3JZ1B 3T2NA 2IOTA 2Z9IA 2H9EH 4GVUA 4BTIB 4YT6H 4HFPB 2B5TB 3QGJA 5E0JA 4XE4A 2F9UA 2PUQH 2GZ9A 1O3LA 1F0TA 1Z8JB 1AZ8A 2GCTC 3M7TA 2AIQA 4Y6DA 3ZZDA 1DWDH 2OC8A 3BTGE 3NZIA 5LPEA 1BOQA 3T29A 1P11E 4IBLH 4H4FA 4NG9H 2WPKS 2TGTA 1MCTA 2A1DB 3SV2H 3CP7A 3ATKA 4ABFA 1CT0E 2C8WB 4RKOB 1Q2WA 2PKSC 1SBWA 4Z6AH 1K1JA 1QB6A 1GI2A 1VGCC 2H1UA 1WAYB 1ELEE 1LVMA 3MI4A 1C5MD 2P8OC 3AAVA 1BTXA 2QXJA 3SOSA 3SUEA 3P8FA 4YOGA 4AGKA 1SOZA 4D76A 4INLA 2FOCA 3EA7A 3EGKH 1TNIA 1Z8IB 4IMZA 1BMMH 1TGSZ 2ALPA 1FUJA 1AVXA 1P9UA 1GCTC 4ESTE 2V3OH 1WQSA 1ZJKA 1D3TB 2JH5D 3ODDA 3ZZ9A 5HXFA 3QN7A 1UTJA 1XX9A 3GDSA 1XUHA 1F0SA 4TY6A 1TNGA 3A81A 2BLVA 3SU0A 1Y8TA 1CT4E 2AGGX 2VVUA 1TAWA 2OBOA 3PM3A 1O2PA 2GT8A 3QUMP 2C4FH 4ABEA 4F4OC 3A84A 1UCYH 2VIQA 2ILNA 4D9QA 5DO4H 4WVPE 2P59A 5C67A 1C1OA 1H8DH 2H6MA 2SGPE 4I8HA 1XM1A 3QK1A 3M37A 1WUNH 2WPMS 7KMEH 1GHAG 2O8LA 3OX7U 3S9CA 1LHFH 1VCQA 2ZG0H 2GCHF 1O2QA 2VIVA 1FAXA 5EGMA 1HDTH 2A4OA 3H5CB 1W13U 1GJ8B 3A86A 3SNCA 2FOGA 4K1SA 1H4WA 2OTVA 3SJIA 3BTTE 1O35A 3SNBA 2ZQ1A 5TJXA 1MTNB 1SQTA 1GI9B 1N8OB 3KEEA 1N1LA 2OBQA 5FCKA 4GLYA 5LPRA 1KYNA 4FUBA 1DE7H 1GJ7B 5C20A 4MDSA 4JZDH 2CF9H 2WPIS 1O5GH 1QGFA 1NROH 1PFXC 2ZFQH 1ZTKA 3URCA 5EQQA 1GMHG 1O3OA 1WCZA 3RC5A 3ENSB 3SHCH 3O8CA 1WYKA 1S6HA 1J15A 1ID5H 4JZFH 1YPMH 1C9TA 4UFEH 2QXIA 1TX6A 2ZGBH 3OY5U 1QJ7B 2ALVA 3A80A 1RGQA 4I8JA 5EXMA 3SU1A 2BX3A 7LPRA 1C1VH 1P10A 3RC4A 4D7GA 5C1UA 1ELGA 1NRPH 4HTCH 4B76A 4WF8A 2ZFSA 3GY4A 3QZQA 4DCDA 3WY8A 4KTCA 1EOLA 5A8XA 3U9AH 3TH4H 1NM6A 1Z1JA 4AORA 1DVAH 1HNEE 1SI5H 1V2LT 1RXPA 5HM9A 3SV8A 1HFDA 3BSQA 3PTNA 4NCYA 1UTLM 4D7FA 3KIDU 1GJ4H 5GIBA 2AYWA 1UTOA 3OU0A 3N7OA 4ISOA 4MNXA 3SU5A 3SV7A 2UUJB 3RM2H 1IQMA 1LQDB 1PPHE 1GMDG 1GDUA 1O5FH 1G2MA 2BQ6B 1DY8A 3ATLA 1V2ST 1NO9H 3K6ZA 1JIRA 3RXUA 4FUDA 3IWMA 4X8SH 1F5LA 1UTMA 1O3IA 1YPKH 1C5OH 2CJIA 2BD5A 2V6NA 3KHVA 1TGBA 6ESTA 1YPEH 1MZDA 5DP8A 3CS0A 3RMNH 1DSTA 1NRSH 1P2JA 2BD4A 3HK3B 2A45B 3E1XB 3BIUH 1EB1H 1SPJA 3BTHE 2FESH 1ZJDA 1S83A 1A3BH 1CBWB 1PPBH 5L6NH 1O2NA 1GGDC 4AX9H 2BDAA 3G01A 2BVXH 2QN5T 3V13A 3RUOA 2TBSA 1ZHMA 3L3TA 3EDXB 3FANA 5CHAB 5A0BA 1C4V2 2A2QH 1EOJA 1U6QA 4MNWA 1ELVA 3SGQE 2Y6TA 5SGAE 3TGJE 2DE9A 1FY1A 1BBRE 1GI3A 3A7YA 5T6FA 3SJ9A 4MTBA 4UD9H 2ZHDA 3C1KA 2FTLE 3PLBA 1ABJH 1JRSA 2Q1JA 3KN2A 1QURH 2A4RA 3EA8A 1DOJA 4Q2KA 4UFGH 1BUIA 3GICB 5GJ4B 1GHWH 1BJVA 4B1TA 1TA6A 1IQNA 1Y5UT 2IJOB 1UVPA 3P8NA 5DP6A 3VFEA 1O2VA 2Z9JA 4YTAA 1O5CB 3LH3A 3KCGH 4YT7H 5L30H 4DIIH 4H6TA 2R0KA 5EXNA 2CF8H 1GBIA 1SHYA 1NPMA 4I8LA 3A7VA 1MD7A 2WUCA 3F6UH 1C5UA 1BTZA 2R9PA 1FONA 1AO5A 1GCDA 4R8TB 4X2YA 1T8OA 2A4QA 3UIRA 1BBRK 3NKKA 1C2MA 2ESTE 3KQDA 2SGEE 1O3KA 1IQIA 1C1TA 2SNVA 1WV7H 3A8DA 2GMTC 4OS4A 1C2DA 1FQ3A 4O9VA 2O9QA 1P2OA 4WH8A 1IQLA 1KTTB 1DWEH 2ZFPH 1S0QA 3MU5A 1EAUA 1GJDB 3GCNA 1GBAA 2ZWLH 1D6WA 4E06H 1WQVH 3BTEE 3Q77A 3PMHB 1FNIA 4RKJB 3PLPA 4Y8XA 3P6ZB 1YPGH 3UNQA 6GCHG 1V2OT 2VU8E 3CS7A 2XC4A 1O31A 1WU1A 2J4IA 3IG6B 4NWLA 3SW2B 1TX7A 7ESTE 3KL6A 3DT0H 1A2CH 1YPHE 3E91A 1DLKB 5GWZA 1DITH 4AFQA 1SSXA 2AFQB 1XUFA 1T4VH 2GGVB 1UMAH 1GL0E 2BD8A 1KLJH 2HNTE 5FBEA 3RXAA 4Z0KA 1C2IA 1C5TA 2SNWA 4Q7XA 1WTHD 1OYQA 2LNCA 5GPIB 1AFEH 1LMWB 1L1NA 4CBNA 1Z71A 2PR3A 5H4IB 1V2VT 2F9VA 1NZQH 1O39A 8GCHF 4MPVA 3UQOA 2EC9H 1TQ7B 2YNAA 4F49A 4H42U 1QCPA 2ODQA 3MH5A 4X1RU 2G81E 3ZV9A 1TPPA 2OUAA 4HGCA 3SJKA 1Y59T 1GI1A 4MNVA 4O97A 4YOIA 1MD8A 2CGAA 1B0FA 3VGCC 5HYOA 2PUXB 4I33A 2A7HA 4I32A 2BMGB 5FPSA 1TYNA 3E0NB 2D1JA 2GCTB 3UOUA 4ABIA 5HMAA 4ZKOU 3MH6A 4NA9H 2XNIA 1K9OE 4CRBA 2G4TA 5FBIA 3PROA 3MNCA 1XUIA 3D62A 4YM9A 2TRMA 1C1SA 2W7SA 1RFNA 1F5RA 4CR5A 1IHTH 3EYDA 1HBTH 1O5BB 3LOXA 4AFZA 1ANEA 5EG4A 3ZYDA 4K69A 2PKSB 4B2BA 1ELBA 1C2KA 4ZHLU 1BJUA 1VGCB 1TLDA 4X6MA 2ZKSA 1J8AA 1ELFA 2P8OB 1FI8A 1C4U2 1Y5BT 1Z1IA 3ZZ5A 3TIUA 3SUDA 1QY6A 1O0DH 4ZH8A 3RXCA 1QA0A 7GCHF 1YYY1 2XYAA 3V7TA 1EUFA 1HIAA 1OP2A 2BDYA 1FV9A 1YCPM 1FDPA 2ZU2A 3SNEA 1GCTB 2ULLA 1A5IA 1HB0B 3SV9A 1Y3UA 1EZXC 4DIHH 2ZGCA 3M5LA 2A7CA 2ZCKP 1O3JA 5EXLA 3UWIA 2OD3B 1ANBA 1UK3A 2PKAA 1UTKA 3MO3A 5EPNA 4LZ4B 4A92A 1QA7A 1GBJA 2OC0A 2FOHA 1X7AC 2BLOA 3MWIU 3TJNA 2EI6A 2BLQA 2ZU3A 3MOCA 1SHHB 4ISHH 4KKDA 1V2JT 1VITG 1YLCA 1TBQH 3BEUA 1LKBA 4WY3A 3K9XB 4IMQA 1YP9A 3MU4A 1ZPCA 1QRZA 1DX5M 1IHSH 2WYGA 1UO6A 1PQAA 1F5KU 1TWXB 3MH4A 3U1IB 1OP8A 2NU1E 3LDXH 3HKJB 3Q3XA 4X1QU 4DY7B 3F9HA 2H5DA 2OP9A 5GCHG 2FOEA 4X8VH 2BD2A 1VJAU 2EEKA 2FM2A 4CREA 4B2AA 1TALA 3FP6E 4K5ZA 2WINI 1GBDA 1TOCB 2HWLB 3MMGA 4MLFB 1B0EA 1GI8B 1O2XA 2UWLA 1IQHA 1OX1A 1UTPA 2ZDMA 3T62A 4E7RG 2Q6FA 4Y0ZE 2DUCA 1BRUP 3AVZA 2TPIZ 2C8XB 3U1JB 1GMCF 4X2WA 2V3HH 1ZTJA 2RA0A 3SJOA 3T5FH 1TA2A 2BDBA 2J2UA 3NWUA 4OS7A 1KLTA 1ETTH 4LOYH 4BANB 3ZVBA 4XSKU 4GCHG 1QRWA 1HV7A 5C1YA 3P8GA 1O2WA 1EASA 5IYTA 2BD7A 3RXVA 3QDZB 4RN6A 3VXEH 1WSSH 2P95A 2XWBI 1FIZA 2FP7B 2VGCC 3ATMA 2F9OA 1S6FA 4ABGA 1D6RA 5CE1A 1ZGIA 1KXDA 3SGBE 2QIQA 1BTUA 1GHYH 2AMPA 3O8DA 1E38B 4MG3A 4U32A 3ZV8A 1CA0C 1ZZZA 3FP7E 1W0ZU 2BZ6H 4DT7B 3M5OA 1G36A 4GHQA 4X1PU 1GBMA 1P2IA 3V0XA 1C1QA 4A7IB 4DVAU 1GI4A 1NC6A 2V35A 1G9IE 1UK2A 3H7TA 1MU6B 3QWCH 1SLVB 1BRCE 2OXSA 4TPIZ 1XKBC 2J95A 5C5NA 3BTME 1PPZA 1XXDA 1C5VA 1GG6C 1TMUH 4U2WA 1D3DB 3BG8A 5A8YA 1CQQA 1SVPA 4NIWA 2BOKA 4JK5A 4MPWA 3LONA 3KF2A 5DP9A 1W7GH 3SUGA 1L2EA 3A8CA 2FOFA 1GHBG 1MQ6A 2PGQB 1MBQA 3KQCA 1O2MA 1QJ1B 3LGYA 3M35A 1ACBE 4Y8ZA 3D49H 1Z7KA 5T6DA 1DICA 1KSNA 4MQAA 4YZUA 1C5XB 4TWWA 5B6OA 1MAYA 2QY0B 3ATWA 3LGTA 3GCTG 1P2MA 4HZHA 2VB0A 1GDQA 3S7HB 1JRTA 1SG8B 4X6OA 1QHRB 2C90B 2FOBA 3UPEA 3RXMA 1T4UH 2GVFA 5A2MH 5C2ZA 3LGIA 1O5DH 1O32A 3TVJB 1OWEA 3SU2A 4UEHH 1JBUH 3I77A 2F9BH 1O2LA 2XBXA 3A88A 3RLYH 4WXVA 5FX5A 3QLPH 2ZTZA 1C5YB 1IQFA 1G3DA 2D26C 2K1QA 3SZNA 5A8ZA 3GISB 4AB8A 2HPPH 3SN8A 1D4PB 1HUTH 3T26A 1GBBA 1TB6H 1XUKA 2BXTH 1GHAF 3TH2H 1OXGA 3PV4A 1TONA 1LPZB 5I46H 1GJAB 3GOVB 2M5TA 1AHTH 2CHAC 1HXFH 1P0SH 4Y71A 5F03A 5JBTA 3VB7A 3GYMA 1GI7B 1UK4A 1Y3XA 4NFEA 2Z3EA 1BRAA 3M3SA 2ZCHP 1NRNH 5T3HA 4CRFA 1KLIH 3E6PH 1GHZA 1IOEA 3TK9A 3SU4A 1SGIB 5AF9H 1INCA 3P92A 1QRXA 4JMYA 4DG4A 3DD2H 2QXGA 4FUJA 3SNDA 2ZF0H 2ZHEH 1LCYA 5FXLA 2FPZA 2ZNKH 4AG1A 2OQUA 1YC0A 1MZAA 1GMHF 1NFWA 1SQOA 3TNTA 8ESTE 2ZA5A 1ARBA 5L2YH 5JDUB 2GDEH 1A61H 1DLEA 1BQYA 3TK6A 2QAAA 1B5GH 3A82A 3MNBA 1RIWC 2XTTB 3K6YA 1HIAB 2DE8A 1G3BA 2BD9A 2GDDA 4MVNA 3SU3A 1KDQA 3LC3A 2A2XH 1SR5C 3EE0B 5K7RA 1VCPA 3LU9B 6LPRA 1AD8H 2B0FA 4BTTB 2OLGA 2GD4B 4ZAEA 2O8WA 1N6XA 4CH2B 4VGCC 2J94A 1C1UH 4Y8YA 2VIDA 2PKAB 3A89A 3UFAA 2J34A 2UWPA 1EJMA 2W3IA 4UFFH 4DGJA 3A7XA 1QQ4A 2Q6DA 2ZZUH 5FHTA 4AG2A 1E0FD 1MKXH 3TNSA 1BMLA 1JIMA 1YCPH 4FXGH 2H2ZA 1GVLA 2VWMA 1GMDF 2AEIH 3DA9B 4GPGA 2AGEX 1IAUA 1ZSLA 3SGAE 3ZZBA 1TQ0B 3LGUA 1ZPBA 3M3VA 2Z94A 2ZEBA 1P3EA 4K1EA 2VWNA 3E0PB 4Q7ZA 1QL8A 1SFQB 3RM0H 2GP9B 1HYLA 1DM4B 2J9NA 3OYPA 4IS5A 3RXTA 2BYAX 1QNJA 1D3QB 2BZAA 1CGJE 1HLTH 3VGCB 1AKSA 1P2QA 1O37A 4CR9A 1CHOG 1XUJA 4WMDA 1K1IA 1KXBA 3RXGA 4X1SU 2ZC9H 2P3TB 2W26A 1AZZA 4X1NU 3SNAA 2EA3A 5K0HA 4Y11E 1TGCA 3ZYEA 5F8ZA 4MPUA 1J16A 1O2GH 3TJUA 1C2GA 2A4GA 3F9EA 3LGWA 2F83A 5E2PA 1AUJA 4INHA 1E34B 1AFQC 3NPSA 4K1TA 1QL9A 1RD3B 4NZLA 2ZI2H 3RXHA 1DSUA 4BOHA 4ZMAH 1THRH 1ZYOA 4ZHAA 2Y5GA 1AIXH 1TPAE 4X2XA 2HVXA 5HGGA 2THFB 1PYTC 4AN7A 1K1NA 2ZP0H 3Q3KA 4WMFA 1O3HA 3M7UA 3BG4C 3QGNB 1VZQH 8LPRA 5GXPA 1TGTA 1PPEE 2FEQH 1BT7A 2F9PA 1YLDA 1Z8RA 4BAHB 3PMBB 2VVVA 1WOFA 1CT2E 2R2WU 2ZFTA 2AS9A 5EQSA 1SGFG 3BEFB 1O38A 3GDVA 3E3TA 4A1VA 3LGVA 4K8BA 1ZPZA 3PYHA 4FVBA 1CE5A 2ZTYA 2TGDA 4FUFA 2P3FH 3FFGA 4AYYB 1H1BA 2A32A 3A7ZA 1O3NA 1THSH 3BIVH 3RXEA 1BTYA 1W3CA 1QBOA 3QTOH 4GHTA 1S85A 3M36A 1LTOA 2G5NA 1D9IA 1BHXF 2SGAA 2VVCA 1P01A 1Q31A 1C1WH 4OS2A 2ASUB 1ZHPA 1XMNB 3BTWE 1W7XH 4I8GA 3RMOH 1GBLA 1W14U 2FLBH 4O03A 5JPMH 2I6SA 1BDAA 1O2JA 1PPGE 1JXPA 3O8RA 1Z8GA 1MKWK 1SGDE 1G3CA 6GCHF 1DWCH 3SI3H 2NWNA 3MTYA 1A0HB 1TX8A 3PO1C 5DP4A 1EAIA 1VR1H 3EA9A 5DP3A 3HK6B 1GVZA 3R3GB 9LPRA 1ABIH 4YO9A 3B8JA 3TPIZ 1T31A 3Q00A 1O2UA 1Y3YA 2FODA 2BY7X 4AFUA 1JMOH 1ESTA 1L4ZA 1W0YH 4OGYA 1Z6EA 1AN1E 4XFQA 1D3PB 1MMJN 1AY6H 4Q7YA 5EOKA 4U01A 1SGNE 3LPRA 1AU8A 1NTPA 1P2KA 1O3CA 2OINA 4IN1A 1DS2E 2O8UA 3FZDA 2JH6D 2R0LA 3ZVGA 1B7XB 1QQUA 2P93A 1J9CH 1QFKH 5L2ZH 4YLQH 1OYTH 4ZKSU 1LO6A 1O3DA 2J38A 1MTNC 1GI5A 3RMMH 3M61U 1ZMJA 2ODPA 1PQ7A 5G4BA 4M7GA 1EP6A 1HJAC 1O2IA 3TU7H 4BAQB 4AZ2B 1O2RA 2OCVB 3UREA 1AWFH 3B9FH 1FIWA 1ESAA 1V2UT 2Y7ZA 2Q6GA 3KQEA 1OKXA 1XXFA 2GTBA 4NSYA 1EZUC 1O3AA 1LVOA 4H6SB 4RSPA 1CA0B 1OOKB 5J4QA 2HPQH 1VJ9U 1TNKA 5CMXH 1L4DA 3T27A 1P04A 1L0ZA 5JB8S 1J17T 3L6PA 2Y7XA 5EU8A 4E7NA 1EP5A 1K1OA 1MUEB 5FAHA 2G52A 5EW1H 1PQ8A 1ETSH 5PTPA 1FY5A 4ZHMU 2BVSH 4GSOA 1TFXA 4A1XA 5JBCS 2HRVA 2BY9X 2FOMB 5C3NA 1GG6B 1H9HE 4ZXXH 2PTNA 1AE8H 2BDCA 2VWLA 4ZXYH 1HAIH 1UVTH 5E0GA 1XKAC 1GBFA 2WYJA 1V2TT 2R3YA 1UJ1A 1P02A 1KDQB 2CMYA 3MU0A 1ELCA 2NU2E 1XVMA 2GZ8A 3DHKH 1QB1A 3TJOA 2F3CE 1Y3VA 3SQHE 1HGTH 1S84A 1F0UA 1A0JA 2Y5FA 2BQ7B 3LH1A 1V2NT 1AUTC 1LDTT 2H9TH 1C2FA 2SFAA 2ZU5A 3A7TA 1C2JA 3VB4A 1ELDE 1TRNA 2XBVA 1CO7E 4OS6A 2F91A 3HATH 1UCYE 3UWJH 4R0IA 1ELAA 3V3MA 2NU4E 2FI4E 6CHAC 3UTUH 1OS8A 1RJXB 1VITF 3L33A 2QYIA 1C1NA 1ANDA 4SGAE 2P3UB 4CBOA 1CGHA 3RC6A 2JH0D 1AVWA 2WUBA 1HAVA 2BDGA 4I31A 3ZZ4A 3AAUA 2Y81A 1GHVH 1DUEA 2NU3E 2ZGHA 1AKSB 1TNLA 2PGBB 3ESTA 2STBE 1C2EA 1LKAA 4NSVA 4KP0A 2ZDAH 1ZSKA 1GBHA 3KQBA 3VB5A 1UCYK 1P06A 2O8MA 5GCHF 3ZZ8A 5JBBS 1SC8U 5DJ7A 1HAPH 5DP5A 3VPKA 1HCGA 1C2HA 1J14A 3MFJA 1K28D 8KME2 3GY8A 1Y5AT 1BITA 2GKVE 1HJ9A 2TGPZ 2ANWA 4I8KA 2ZECA 1V3XA 3W95A 3C27B 2B8OH 1BMNH
chains in the Genus database with same CATH superfamily
1ZRBA 1YM0A 1SL3A 3KYFA 1MBMA 5ETXA 5TCCA 2XRCA 1NT1A 4U30A 2BLWA 1EXFA 4GCHF 3PLKA 3S9AA 3O8BA 3RXIA 1W12U 3ZVAA 2Y80A 1RIWB 3A8BA 1RS0A 1A5GH 1ARCA 3QZRA 4Y79A 3RXJA 1MKWH 2SGDE 4CHAC 2PLXA 1A3EH 1UHBA 5EJ1A 1BBRH 3F68H 3MYWA 1G37A 2BY8X 2BY6X 1SGQE 4NZQA 1P05A 4VGCB 3BTFE 3E8LA 1FY4A 3GCOA 5FX6A 2ZDKA 4UFDH 1O3EA 1N6YA 3F9GA 3S69A 5BPEA 4X8UH 4BAMB 3BN9A 1ZTLA 2EI8A 3SU6A 1SLWB 4B6EA 4K8YA 3HGNA 3E16B 1P2NA 4JZEH 2TIOA 3RXPA 1IQEA 1K21H 1PYTD 2G00A 2J92A 2G51A 2G8TA 3W94A 4BAOB 3MH7A 1C1RA 4OGXA 3FZZA 3KQ5A 2YNBA 3GCHC 3DFJA 2Y5HA 2VIPA 1P09A 5F8TA 5F8XA 4NA7A 3ZVFA 1HXEH 1TBRH 1C5SA 3FAOA 1W2KH 2FI3E 4OS1A 3U8OH 2L74A 1UVUH 4IC6A 5F6MA 2BOHB 1FXYA 1C5WB 4ZKNU 1BHXB 1GHBF 2Y82A 2YOLA 4BTUB 3UR6A 4NIVA 5JB9S 3S9BA 1BRBE 2I6QA 2PW8H 2KAIA 2P16A 1EAWA 1FPHH 5HKKD 3SJ8A 2BDHA 1GL1A 2PP6A 2WV9A 2VWOA 3GCTF 4DJZB 4ABAA 2BQWB 1UTQA 4FUCA 5AFZH 2ZDVH 1HAYB 1AFQB 4MNYA 2FOAA 4JYVH 1O2YA 4IN2A 2C93B 1YGCH 4DOQA 1HRTH 3UOPA 5C1XA 1LHDH 1LVYA 1WXRA 1GPZA 2FIRH 1QBVH 3VXFH 2ZHFH 1T32A 4I86A 1NU7B 3MNXA 3GYLB 3BG4B 3STIA 3BV9B 3KNXA 3JZ2B 2AHME 3VB6A 1O36A 1S0RA 3MO6A 1GGDB 3PWCA 2VH6A 3TGIE 1FLEE 2FYQA 2KM0A 2Z9GA 2WV5A 4FVDA 5A0CA 1TMTH 4RI0A 5FCRA 2FMJA 2V0BA 3RXDA 1ZHRA 4B74A 2FX4A 4JCNA 1GJ9B 1EAXA 1LHEH 3TITA 1JWTA 1LPGB 5GNDA 1UVOA 2YMSD 1T8NA 4OS5A 1KXAA 4HI3A 2R2MB 3RXOA 1ANCA 2XCFA 1BB0B 2VINA 1RRKA 1QTFA 4WJG2 4YXWD 1A1RA 2W5EA 2CN0H 1EX3A 5E8EH 1QB9A 1GJ5H 4XOJA 1UVSH 2JETC 1KXFA 5FPTA 3LJOA 1V2QT 1EATA 3KGPA 4B2CA 1BTHH 2WHXA 1BTPA 2HALA 3ZZ3A 1GVKB 2QF0A 1DDJA 1T8LA 5E2OA 1DT2A 1G30B 5T6GA 1S81A 1Y3WA 2GMTB 3I29A 3RXRA 3QO6A 5ESBA 4K60A 3UB0A 3TGKE 4I7YH 3PO1B 4YESB 1K1LA 3Q3YA 1FMGA 1GWAA 3UR9A 3RXFA 3UUZA 1SLXB 1AMHA 1C5PA 3ATIA 2OC1A 1AB9C 1TRYA 2BY5X 2QGRA 1O3GA 2G5VA 3HGPA 3ZZCA 4XBBA 1BA8B 1F2SE 1E79D 4NA8A 1FY8E 4UE7H 3OAAD 3VEQB 1O2ZA 3B23B 1KTSB 3TK5A 3RP2A 2ZO3H 3MHWU 4TSFD 4KELA 2XC5A 2D8WA 1TBZH 3BTKE 3ITIA 2C8YB 2SGQE 4CRDA 2ZTXA 5A09A 2EI7A 5DSFA 3ELAH 3GY3A 1ZRKA 3MU1A 1HAVB 1HAOH 1XUGA 1ZSJA 2F9NA 2WPJS 1H9LB 3SQEE 5EIYA 4A5TS 1PJPA 2AH4X 1E1QD 3SORA 1H8IH 5AHGH 1C5RA 1JOUB 4XD7D 1T8MA 1HJAB 1O3FA 4E05H 2FLRH 1CHOF 2GCHG 2GT7A 3LJJA 5J4SA 1OWIA 1A46H 1S82A 2WPLS 4FU9A 1PQ5A 3CNRA 3OTJE 3P70B 5EODA 1BMAA 2OQ5A 5EJLA 3BTQE 1C5ZB 1O34A 1DANH 3PTBA 4XDEA 1PPCE 1SMFE 2BB4A 1VKYA 1K1PA 1P03A 1TNHA 1DFPA 1NS3A 1CVWH 2TGAA 1OPHB 3ZVEA 3PV5A 3CENA 3PWBA 4B71A 4ZCNA 1RTLA 2FI5E 2VH0A 1V2MT 4Y0YE 5DKMA 5EPYA 3P8OA 4A1TA 3TH3H 1E35B 2FX6A 1O2OA 4X8TH 3SBKA 2A0QB 4Q80A 3ODFA 3RU4D 3M7QA 4WH6A 2ZU4A 1W0KD 2VJ1A 4AYVB 1EPTC 1TNJA 2WPHS 3UNRA 4GUXA 4AGJA 5DP7A 2QXHA 1SLUB 4CRCA 3V12A 3ZVDA 1TGNA 4ZROA 1OHHD 5T1VA 3NXPA 3BF6H 2ZIQH 2ANKH 1UHBB 4YOJA 2VNTA 2J98A 4DW2U 1A5HA 2D2DA 3ZZ6A 1BCUH 1DUAA 3T25A 2B9LA 2ZGJA 3D65E 3HKIB 5I25A 5EW2H 5C5OA 4BNRA 5DGJA 2VIWA 1GBKA 4X0WU 1EZSC 1VCWA 3LKWA 1W0JD 1FAKH 1GBCA 3R0FA 4JYUH 1TOMH 1QL7A 5LPFA 4NIYA 1FN6A 4TY7A 1F0RA 4FOUC 1V2RT 3LT3A 3DSGA 2GV6A 2FZZA 6CHAB 1V2WT 3GY2A 1LHCH 4FUEA 2A5IA 1H8HD 3LIWA 2CV3A 3S0NA 1SGFA 2IPHA 2FTMA 1BZXE 2XC0A 3UY9A 3FVFB 2SGFE 1W8BH 1O33A 4XBDA 1UW7A 1O2TA 1NN6A 1IQGA 4CRGA 1O30A 2BTCE 2G55A 4ABBA 2QV1A 4AOQA 1NRQH 2RCEA 4ASHA 1ZMNA 1AQ7A 4NFFA 4FUIA 1ZOMA 1H9IE 2J97A 1G3EA 2KAIB 3RMLH 5DG6A 2G4UA 1GBTA 3SI4H 1HAXB 2PV9B 2QF3A 1ESBA 1K22H 2ZHWH 2NU0E 5B6LA 5TCAA 3M5MA 2RA3A 1UTNA 4KGAA 2OK5A 1EB2A 4ISLA 3ZZAA 1THPB 1OP0A 3M3TA 2ODYB 3A87A 3S7KB 4JZ1A 4IW4E 1MQ5A 1G32B 2QCYA 1OWKA 1ORFA 2RG3A 2C3SA 5EJZA 2XXLA 1C1PA 1S6LA 2CXVA 2KZ4A 1K1MA 1EPTA 1SQAA 4J2YB 1MAXA 2QC2A 1GI0A 1NESE 2FWWA 3A8AA 3RXLA 1ZLRA 4JK6A 3EQ0H 1FY3A 3RXKA 1W11U 2AMDA 2FO9A 1SGRE 1AE5A 4CHAB 1DXWA 4Y7BA 1TPSA 3MNSA 3AW0A 1O5AB 3U8TH 1O3MA 2UUKB 1V2KT 3UNSA 1LQEA 4BXSA 1AWHB 4K2YA 1C5LH 3K2UA 2BHGA 1O3PB 1CGIE 1M9UA 4ISNA 5EQRA 5LH8A 2Z3DA 1P12E 1FX0B 4LZ1H 2FYRA 1OWJA 2B7DH 3RDZA 1BTWA 4UONA 1EJNA 1HJ8A 2HGTH 1N8OC 1W10U 3RU4E 4BAKB 1GJ6A 1HAHH 1TABE 1BMFD 2A31A 2AGIX 4XBCA 2WV4A 2VGCB 3A7WA 4ZUHA 1DWBH 1OWDA 3TJVA 1F92A 2H5CA 5DPAA 4CRAA 3GCHB 1NFYA 1XVOA 1GHXH 2XW9A 3GY5A 1O2HA 2FS9A 2PHBA 1OSSA 3F1SB 5AVDA 2IPQX 2PWXA 2JIZD 5ABWA 3RU4T 4TPYA 4IC5A 4IGDA 4LK4A 1QR3E 2ZFRH 4WMEA 1YPJH 3QTVH 2FDAA 2GX4A 1CHGA 1A0LA 2OC7A 2AIPA 1NU9A 5AFYH 2Z9KA 2ZPRA 1DY9A 2LPRA 2ANYA 1LHGH 1SQRA 1EQ9A 1MH0A 2R3UA 5IDKA 3Q76A 4Y7AA 3SHAH 4FUHA 1KXCA 5E0HA 2C8ZB 1O2KA 2JKHA 2IJD1 2ZFFH 5LGOA 1YY3A 4INKA 2BX4A 1Q3XA 4FU7A 2W7UA 3HPTB 1E36B 1YKTA 1AI8H 1TRMA 3AW1A 4JZIA 3URDA 2A5KA 1SGPE 1OWHA 4ZKRU 2XBYA 4NGAH 1HAGE 8GCHG 2PSYA 1ZR0A 3FP8E 1A4WH 1QBNA 1V6DA 1MTUA 2H9HA 1O5EH 2UUYA 3GDUA 2ZDLA 1C9PA 2JJ2D 3NCLA 1C1MA 2A5AA 1KXEA 1P3CA 4J1YA 4KTUA 4ACBA 4O3TA 2PTCE 2UUFB 1K2I1 2ZGXH 1QZ8A 4BXWA 1MTSA 1C4Y2 4FU8A 1Z6JH 4ABDA 2ZHQH 4NWKA 4CH8B 1AVGH 4TWYA 2BD3A 3P95A 2Z7FE 3U69H 1O3BA 2BM2A 4A6LA 4DURA 2BDIA 2ZPQA 4QT8C 1CBWC 3BTDE 2GZ7A 1L1GA 1IQJA 3E90B 2JETB 2RDLA 4B75A 3PMAB 4X2VA 4XRNA 4O3UA 2KX4A 1WTGH 2CHAB 3DUXH 2XCNA 1C5QA 1TE0A 3AASA 5CHAC 2UWOA 3BEIB 1QJ6B 1TMBH 1P57B 2QA9E 2Z9LA 2W3KA 3NK8A 1C5NH 2EY4C 4WXIA 1C2LA 1MTWA 3ZVCA 1YPHC 2FXRA 1K0HA 1FPCH 4JYTA 4SGBE 1DXPA 3NUMA 5DK1A 1E37B 2HNTC 3OSYA 4LXBH 3OEHD 1SFIA 3GY7A 4THNH 2BVRH 1FN8A 2J98B 2ZCLP 7GCHG 3RXSA 3D23A 4ISIH 3GY6A 2EQNA 1F7ZA 3SO3A 2ZPSA 2Z3CA 1ZGVA 2ANMH 2XBWA 3LC5A 2PFEA 1TPOA 4KTSA 4D9RA 1P9SA 2Z6BD 3EAJA 3H7OA 1AB9B 3RXQA 1SGEE 1LVBA 4YLUA 4Y10E 3U98H 3MO9A 3RXBA 1EZQA 3OY6U 3T28A 1GJCB 3EE7A 1SGTA 1VITH 3U8RH 5ESTE 4AFSA 3F9FA 1IQKA 1FZZA 4Y76A 1GDNA 1RTKA 1DPOA 1KY9A 3PB1E 3PMJA 1A7SA 4NIXA 1NFXA 2O8TA 3RLWH 1FJSA 4X6NA 5FPYA 1NY22 1NRRH 1EKBB 4FUGA 3UQVA 2AMQA 4MPXA 2AERH 1SGYE 2XNDD 4K3JA 4X6PA 3K65B 3M5NA 1QIXB 4ABHA 1WBGB 1YBWA 1MKXK 4ABJA 1YCPK 3A83A 1AGJA 1T7CA 1SGCA 1BIOA 1HPGA 4GAWA 5GDSH 1EJAA 1G2LA 5HM2A 4B73A 1SB1H 1ETRH 3DFLA 4UDWH 3P17H 1MTVA 2KCPA 2ZU1A 3SV6A 2K8IA 1HAZB 1PPFE 1ELTA 3QX5H 1MCVA 3I78A 1YPLH 1CU1A 5JYIA 5BRRE 1SOTA 1MU8B 4F55A 5IK2D 1LPKB 1CSOE 2HNTF 1RTFB 2GV7A 3VB3A 1S5SA 1L1JA 1V2PT 3A85A 1P8VC 2A7JA 2FS8A 2PSXA 4TYDA 3ZZ7A 4AB9A 4D8NA 5JBAS 1CA8B 3SUFA 1GJBB 3STJA 1GMCG 4WWYA 1GBEA 1YF4A 1EPTB 1ZMLA 2P94A 2ZDNA 2ZQ2A 3MU8A 1KIGH 1O2SA 2HLCA 2IN2A 2STAE 2HOBA 3IITA 3TLOA 1GI6A 4PROA 1TIOA 2VIOA 1NFUA 5A0AE 9ESTA 2XWAA 2BXUH 5KGOA 3JZ1B 5HIYA 3T2NA 2IOTA 2Z9IA 2H9EH 4GVUA 4BTIB 4YT6H 4HFPB 2B5TB 3QGJA 5E0JA 4XE4A 2F9UA 2PUQH 2GZ9A 1O3LA 1F0TA 1Z8JB 1AZ8A 2GCTC 3M7TA 2AIQA 4Y6DA 3ZZDA 1DWDH 2OC8A 3BTGE 3NZIA 5LPEA 1BOQA 3T29A 1P11E 3F2GA 4IBLH 4H4FA 4NG9H 2WPKS 2TGTA 1MCTA 2A1DB 2V3MA 3SV2H 3CP7A 3ATKA 4ABFA 4DT4A 1CT0E 2C8WB 4RKOB 1Q2WA 2PKSC 1SBWA 4Z6AH 1K1JA 1QB6A 1GI2A 1VGCC 2H1UA 1WAYB 1ELEE 1LVMA 3MI4A 1C5MD 2P8OC 3MQKC 3AAVA 1BTXA 2QXJA 3SOSA 3SUEA 3P8FA 4YOGA 4AGKA 1SOZA 4D76A 4INLA 2FOCA 3EA7A 3EGKH 1TNIA 1Z8IB 4IMZA 1BMMH 1TGSZ 2ALPA 1FUJA 3ZIAD 1AVXA 1P9UA 1GCTC 4ESTE 2V3OH 4TT3D 1WQSA 1ZJKA 1D3TB 2JH5D 3ODDA 3ZZ9A 5HXFA 3QN7A 1UTJA 1XX9A 1EFRD 2QE7D 3GDSA 1XUHA 1F0SA 4TY6A 2WPDD 1TNGA 3A81A 2BLVA 3OFND 3SU0A 1Y8TA 1CT4E 2AGGX 2VVUA 1TAWA 2OBOA 3PM3A 1O2PA 2GT8A 3QUMP 2C4FH 4ABEA 4F4OC 3A84A 1UCYH 2VIQA 2ILNA 2YMSB 4D9QA 5DO4H 4WVPE 2P59A 5C67A 1C1OA 1H8DH 2H6MA 2SGPE 4P02A 4I8HA 1XM1A 3QK1A 3M37A 5HIZA 1WUNH 2WPMS 7KMEH 1GHAG 2O8LA 2LELA 3OX7U 4F48B 3S9CA 1LHFH 1VCQA 2KCOA 2GCHF 2ZG0H 1O2QA 2VIVA 1FAXA 5EGMA 3WWBA 1HDTH 2A4OA 3H5CB 1W13U 1GJ8B 3A86A 4HG6A 3SNCA 2FOGA 4K1SA 1H4WA 2OTVA 3SJIA 3BTTE 1O35A 3SNBA 2ZQ1A 5TJXA 1MTNB 1SQTA 1GI9B 1N8OB 3KEEA 1N1LA 2OBQA 5FCKA 4GLYA 5LPRA 1KYNA 4FUBA 1DE7H 1GJ7B 5C20A 4MDSA 4JZDH 2CF9H 2WPIS 1O5GH 1QGFA 1NROH 1PFXC 2ZFQH 1ZTKA 3URCA 5EQQA 1GMHG 1O3OA 1WCZA 3RC5A 3ENSB 3SHCH 3O8CA 1WYKA 1S6HA 1J15A 1ID5H 4JZFH 1YPMH 1C9TA 4UFEH 2QXIA 1TX6A 2ZGBH 3OY5U 3F3BA 1QJ7B 2ALVA 3A80A 1RGQA 4I8JA 5EXMA 3SU1A 2BX3A 7LPRA 1C1VH 1P10A 3RC4A 4D7GA 5C1UA 1ELGA 1NRPH 4HTCH 4B76A 4WF8A 2ZFSA 3GY4A 3WW7A 3QZQA 4DCDA 1E1RD 3WY8A 4KTCA 1EOLA 4M9FA 5A8XA 3U9AH 3TH4H 1NM6A 1Z1JA 4AORA 1DVAH 1HNEE 1SI5H 1V2LT 1RXPA 5HM9A 3SV8A 1HFDA 3BSQA 3PTNA 3NRLA 4NCYA 1UTLM 4D7FA 3KIDU 1GJ4H 5GIBA 2AYWA 1UTOA 3OU0A 3N7OA 4ISOA 4MNXA 3SU5A 3SV7A 2UUJB 3RM2H 1IQMA 1LQDB 1PPHE 1GMDG 1GDUA 1O5FH 1G2MA 2BQ6B 1KMHB 1DY8A 3ATLA 1V2ST 1NO9H 3K6ZA 1JIRA 3RXUA 3SYJA 4FUDA 3IWMA 4X8SH 1F5LA 1UTMA 1O3IA 1YPKH 1C5OH 2CJIA 2BD5A 2V7QD 2V6NA 3KHVA 1TGBA 3F2FA 6ESTA 1YPEH 1MZDA 5DP8A 3CS0A 3RMNH 1DSTA 1NRSH 1P2JA 2BD4A 3HK3B 2A45B 3E1XB 3BIUH 1EB1H 1SPJA 3BTHE 2FESH 1ZJDA 1S83A 5C0TA 1A3BH 1CBWB 1PPBH 5L6NH 1YLNA 1O2NA 1GGDC 4AX9H 2BDAA 3G01A 2BVXH 2QN5T 3V13A 4B6FA 3RUOA 2TBSA 3SZEA 1ZHMA 3L3TA 3EDXB 3FANA 5CHAB 5A0BA 1C4V2 2A2QH 1EOJA 1U6QA 2KFWA 4MNWA 1ELVA 3SGQE 2Y6TA 5SGAE 3TGJE 2DE9A 1FY1A 1BBRE 1GI3A 3A7YA 5T6FA 3SJ9A 4MTBA 4UD9H 2ZHDA 3C1KA 2FTLE 3PLBA 1ABJH 1JRSA 2Q1JA 3KN2A 1QURH 2A4RA 3EA8A 1DOJA 4Q2KA 4UFGH 1BUIA 3GICB 5GJ4B 1GHWH 1BJVA 4B1TA 1TA6A 1IQNA 1Y5UT 2IJOB 1UVPA 3P8NA 5DP6A 3VFEA 1O2VA 2Z9JA 4YTAA 1O5CB 3LH3A 3KCGH 4YT7H 5L30H 4DIIH 4H6TA 2R0KA 5EXNA 2CF8H 4RT0A 1GBIA 1SHYA 1NPMA 4I8LA 3A7VA 5KEDA 1MD7A 2WUCA 3F6UH 1C5UA 1BTZA 2R9PA 1FONA 1AO5A 1GCDA 4R8TB 4X2YA 1T8OA 5C17A 2A4QA 3UIRA 1BBRK 3KYGA 3NKKA 1C2MA 2ESTE 3KQDA 2SGEE 1O3KA 1IQIA 1C1TA 2SNVA 1WV7H 3A8DA 2GMTC 4OS4A 1C2DA 1FQ3A 4O9VA 2O9QA 1P2OA 4WH8A 1IQLA 1KTTB 1DWEH 2KCAA 2ZFPH 1S0QA 3MU5A 1EAUA 2JDID 1GJDB 3GCNA 1GBAA 2ZWLH 1D6WA 4E06H 1WQVH 3BTEE 3Q77A 3PMHB 3N7DA 1FNIA 4RKJB 3PLPA 3DSPA 4Y8XA 3P6ZB 1YPGH 3UNQA 6GCHG 1V2OT 2VU8E 3CS7A 2XC4A 1O31A 2KR7A 1WU1A 2J4IA 3IG6B 4NWLA 3SW2B 1TX7A 7ESTE 3KL6A 3DT0H 2XOKD 1A2CH 1YPHE 3E91A 1DLKB 5GWZA 1DITH 4AFQA 1SSXA 2AFQB 1XUFA 1T4VH 2GGVB 1UMAH 1GL0E 4ACAA 2BD8A 1KLJH 2HNTE 5FBEA 3RXAA 4Z0KA 3DSOA 1C2IA 2W6JD 1C5TA 2SNWA 3PRDA 4Q7XA 1WTHD 1OYQA 2LNCA 5GPIB 1AFEH 1LMWB 1L1NA 4CBNA 1Z71A 2PR3A 5H4IB 1V2VT 2F9VA 4Q4LA 1NZQH 1O39A 8GCHF 4MPVA 3UQOA 2EC9H 1TQ7B 2YNAA 4F49A 4H42U 1QCPA 2ODQA 3MH5A 4X1RU 2G81E 3ZV9A 1TPPA 2OUAA 4HGCA 3SJKA 1Y59T 1GI1A 4MNVA 4O97A 4YOIA 1MD8A 2CGAA 1B0FA 3VGCC 5HYOA 2WSSD 2PUXB 4I33A 2A7HA 4I32A 2M2AA 2BMGB 5FPSA 1TYNA 3E0NB 2D1JA 2GCTB 3UOUA 4ABIA 5HMAA 4ZKOU 3MH6A 4NA9H 2XNIA 1K9OE 2RFKC 4CRBA 2G4TA 5FBIA 3PROA 3MNCA 1XUIA 3D62A 4YM9A 2TRMA 1C1SA 2W7SA 1RFNA 1F5RA 4CR5A 1IHTH 3EYDA 2CK3D 1HBTH 1O5BB 3LOXA 4AFZA 1YWUA 1ANEA 5EG4A 3ZYDA 4K69A 2PKSB 4B2BA 1ELBA 1C2KA 4ZHLU 1BJUA 1VGCB 1TLDA 4X6MA 2ZKSA 1J8AA 1ELFA 2P8OB 1FI8A 2RDEA 1C4U2 1Y5BT 1Z1IA 3ZZ5A 3TIUA 3SUDA 1QY6A 1O0DH 4ZH8A 3RXCA 1QA0A 7GCHF 1YYY1 2XYAA 3V7TA 1EUFA 1HIAA 1OP2A 2BDYA 1FV9A 1YCPM 1FDPA 2ZU2A 3SNEA 1GCTB 2ULLA 1A5IA 1HB0B 3SV9A 1Y3UA 1EZXC 4DIHH 2ZGCA 3M5LA 2A7CA 2ZCKP 1O3JA 5EXLA 3UWIA 2OD3B 1ANBA 1UK3A 2PKAA 1UTKA 3MO3A 5EPNA 4LZ4B 4A92A 1QA7A 1GBJA 2OC0A 2FOHA 1X7AC 2BLOA 3MWIU 3VG8A 3TJNA 2EI6A 2BLQA 2ZU3A 3MOCA 3FN8A 1SHHB 4ISHH 4KKDA 1V2JT 1VITG 1YLCA 1TBQH 3BEUA 1LKBA 4WY3A 3K9XB 4IMQA 3W1EA 1YP9A 3MU4A 1ZPCA 1QRZA 1DX5M 1IHSH 2WYGA 1UO6A 1PQAA 1F5KU 1TWXB 3MH4A 3U1IB 1OP8A 2NU1E 3LDXH 3HKJB 3Q3XA 4X1QU 2F43B 3F9HA 4DY7B 2H5DA 2OP9A 5GCHG 2FOEA 4X8VH 2BD2A 1VJAU 2EEKA 2FM2A 4CREA 4B2AA 1TALA 3FP6E 4K5ZA 2WINI 1GBDA 1TOCB 2HWLB 3MMGA 4MLFB 1B0EA 1GI8B 1MABB 1O2XA 2UWLA 1IQHA 1OX1A 1UTPA 2ZDMA 3T62A 5C0UA 1H8ED 4E7RG 2Q6FA 4Y0ZE 2DUCA 1BRUP 3AVZA 2TPIZ 2C8XB 3U1JB 1GMCF 4X2WA 2V3HH 1ZTJA 2RA0A 3SJOA 3T5FH 1TA2A 2BDBA 2J2UA 3NWUA 3UAIC 4OS7A 1KLTA 1ETTH 4LOYH 4BANB 3ZVBA 4XSKU 4GCHG 1QRWA 1HV7A 3PRBA 5C1YA 3P8GA 1O2WA 1EASA 5IYTA 2BD7A 3RXVA 3QDZB 4RN6A 3VXEH 1WSSH 2P95A 2XWBI 1FIZA 2FP7B 2VGCC 3ATMA 2F9OA 1S6FA 3GS9A 1D6RA 4ABGA 1ZGIA 5CE1A 1KXDA 3SGBE 2QIQA 1BTUA 1GHYH 2AMPA 3AK5A 3O8DA 1E38B 4MG3A 4U32A 3ZV8A 1CA0C 1ZZZA 3FP7E 1W0ZU 2BZ6H 4DT7B 3M5OA 1G36A 4GHQA 4X1PU 1GBMA 1P2IA 3V0XA 1C1QA 4A7IB 4DVAU 1GI4A 4FETA 1NC6A 2V35A 1G9IE 1UK2A 3H7TA 1MU6B 3QWCH 1SLVB 1BRCE 2OXSA 4TPIZ 2J95A 1XKBC 5C5NA 3BTME 1PPZA 1XXDA 1C5VA 1GG6C 1TMUH 4U2WA 1D3DB 3BG8A 5A8YA 2J5UA 1CQQA 1SVPA 4NIWA 2BOKA 4JK5A 4MPWA 3LONA 3FO8D 3KF2A 5DP9A 1W7GH 3SUGA 1L2EA 3A8CA 2FOFA 1GHBG 1MQ6A 2PGQB 1MBQA 3KQCA 1O2MA 1QJ1B 3LGYA 3M35A 1ACBE 4Y8ZA 3D49H 1Z7KA 5T6DA 1DICA 1KSNA 4MQAA 4YZUA 1C5XB 4TWWA 5B6OA 1MAYA 2QY0B 3ATWA 3LGTA 3GCTG 1P2MA 4HZHA 2VB0A 1GDQA 3S7HB 1JRTA 1SG8B 4X6OA 1QHRB 2KCYA 2C90B 2FOBA 3UPEA 3RXMA 1T4UH 2GVFA 5A2MH 5C2ZA 3LGIA 1O5DH 1O32A 3TVJB 1OWEA 3SU2A 4UEHH 1JBUH 3I77A 2F9BH 1O2LA 2XBXA 3A88A 3RLYH 4WXVA 5FX5A 3QLPH 2ZTZA 1C5YB 1IQFA 1G3DA 2D26C 2K1QA 3SZNA 5A8ZA 3GISB 4AB8A 2HPPH 3SN8A 3OEED 1D4PB 1HUTH 3T26A 1GBBA 1TB6H 1XUKA 2BXTH 1GHAF 3PV2A 3TH2H 3OTPA 1OXGA 3PV4A 1TONA 1LPZB 5I46H 1GJAB 3GOVB 2M5TA 1AHTH 2CHAC 1HXFH 1P0SH 4Y71A 5F03A 5JBTA 3VB7A 2LP6A 3GYMA 1GI7B 1UK4A 1Y3XA 4NFEA 2Z3EA 1BRAA 3M3SA 2ZCHP 1NRNH 5T3HA 4CRFA 1KLIH 3E6PH 1GHZA 1IOEA 3TK9A 3SU4A 1SGIB 5AF9H 1INCA 3P92A 1QRXA 4JMYA 4DG4A 3DD2H 2QXGA 4FUJA 3SNDA 2ZF0H 2ZHEH 1LCYA 5FXLA 2FPZA 2ZNKH 4AG1A 2OQUA 1YC0A 1MZAA 1GMHF 1NFWA 1SQOA 3TNTA 8ESTE 2ZA5A 1ARBA 5L2YH 3FOAA 5JDUB 2GDEH 1A61H 1DLEA 1BQYA 3TK6A 2QAAA 1B5GH 3A82A 3MNBA 1RIWC 2XTTB 3K6YA 1HIAB 2DE8A 1G3BA 2BD9A 2GDDA 4MVNA 3SU3A 1KDQA 3LC3A 2A2XH 1SR5C 3EE0B 5K7RA 1VCPA 3LU9B 6LPRA 1AD8H 2B0FA 4BTTB 2OLGA 2GD4B 4ZAEA 2O8WA 1N6XA 4CH2B 4VGCC 2J94A 1C1UH 4Y8YA 2VIDA 2PKAB 3A89A 3UFAA 2J34A 2UWPA 1EJMA 2W3IA 2WZQA 4UFFH 4DGJA 3A7XA 1QQ4A 2Q6DA 2ZZUH 5FHTA 4AG2A 1E0FD 1MKXH 3TNSA 3OE7D 1BMLA 1JIMA 1YCPH 4FXGH 2H2ZA 3FKSD 1GVLA 2VWMA 1GMDF 2AEIH 3DA9B 4GPGA 4AC9A 2AGEX 1IAUA 1ZSLA 3SGAE 3ZZBA 1TQ0B 3LGUA 1ZPBA 3M3VA 2Z94A 2ZEBA 1P3EA 4K1EA 3WWFA 2VWNA 3E0PB 4Q7ZA 1QL8A 1SFQB 3RM0H 2GP9B 1HYLA 1DM4B 2J9NA 3OYPA 4IS5A 3RXTA 2BYAX 2VBCA 4P00A 1QNJA 1D3QB 2BZAA 1CGJE 1HLTH 3VGCB 1AKSA 1P2QA 4OM9A 1O37A 4CR9A 1CHOG 1XUJA 4WMDA 1K1IA 1KXBA 4Q63A 3RXGA 4X1SU 2ZC9H 2P3TB 2W26A 1AZZA 4X1NU 3SNAA 2EA3A 5K0HA 4Y11E 1TGCA 3ZYEA 5F8ZA 4MPUA 1J16A 1O2GH 3TJUA 1C2GA 2A4GA 3F9EA 3LGWA 3N7EA 2F83A 5E2PA 1AUJA 4INHA 1E34B 1AFQC 3NPSA 4K1TA 1QL9A 1RD3B 4NZLA 2ZI2H 3RXHA 1DSUA 4BOHA 3H09A 4RT1A 2QF5A 4ZMAH 1THRH 1ZYOA 4ZHAA 2Y5GA 1AIXH 1TPAE 4X2XA 2HVXA 5HGGA 2THFB 1PYTC 4AN7A 1K1NA 2ZP0H 3Q3KA 4WMFA 1O3HA 3M7UA 3BG4C 3QGNB 1VZQH 8LPRA 5GXPA 3F2HA 1TGTA 1PPEE 2FEQH 1BT7A 2F9PA 1YLDA 1Z8RA 4BAHB 3PMBB 2VVVA 2K0QA 1WOFA 4Z1MD 1CT2E 2R2WU 2ZFTA 2AS9A 5EQSA 1SGFG 3BEFB 1O38A 1NBMD 3GDVA 3E3TA 4A1VA 3LGVA 4K8BA 1ZPZA 3PYHA 4FVBA 1CE5A 2ZTYA 2TGDA 4FUFA 2P3FH 3FFGA 4AYYB 1H1BA 2A32A 3A7ZA 1O3NA 1THSH 3BIVH 3RXEA 1BTYA 1W3CA 1QBOA 3QTOH 4GHTA 1S85A 3M36A 1LTOA 2G5NA 1D9IA 1BHXF 2SGAA 2VVCA 1P01A 1Q31A 1C1WH 4OS2A 2ASUB 1ZHPA 1XMNB 3BTWE 1W7XH 2L6OA 2W6ID 4I8GA 1GBLA 1W14U 2FLBH 4O03A 3RMOH 5JPMH 2I6SA 1BDAA 2HLDD 3N99A 1O2JA 1PPGE 1JXPA 3O8RA 1Z8GA 1MKWK 1SGDE 5FL7D 1G3CA 6GCHF 1DWCH 3SI3H 2NWNA 3MTYA 1A0HB 1TX8A 3PO1C 5DP4A 1EAIA 1VR1H 3EA9A 5DP3A 3HK6B 1GVZA 3R3GB 9LPRA 1ABIH 4YO9A 2YMSC 3B8JA 3TPIZ 1T31A 3Q00A 1O2UA 1Y3YA 2FODA 2BY7X 4AFUA 1JMOH 1ESTA 1L4ZA 1W0YH 4OGYA 1Z6EA 1AN1E 4XFQA 1D3PB 1MMJN 1AY6H 4Q7YA 5EOKA 4U01A 1SGNE 3LPRA 1AU8A 1NTPA 1P2KA 1O3CA 2OINA 4IN1A 1DS2E 2O8UA 3FZDA 2JH6D 2R0LA 3ZVGA 1B7XB 1QQUA 1SKYE 2P93A 1J9CH 1QFKH 5L2ZH 4YLQH 1OYTH 4ZKSU 1LO6A 1COWD 1O3DA 2J38A 2F4LA 1MTNC 1GI5A 3RMMH 3M61U 1ZMJA 2ODPA 3F0OA 1PQ7A 5G4BA 4M7GA 1EP6A 1HJAC 1O2IA 3TU7H 4BAQB 4AZ2B 1O2RA 2OCVB 3UREA 1AWFH 3B9FH 1FIWA 1ESAA 1V2UT 2Y7ZA 2Q6GA 3KQEA 1OKXA 1XXFA 2GTBA 4NSYA 1EZUC 3U28C 1O3AA 1LVOA 4H6SB 4RSPA 1CA0B 1OOKB 5J4QA 2HPQH 1VJ9U 1TNKA 5CMXH 1L4DA 3T27A 1P04A 1L0ZA 5JB8S 1J17T 3L6PA 2Y7XA 5EU8A 4E7NA 1EP5A 1K1OA 1MUEB 5FAHA 2G52A 5EW1H 1PQ8A 1ETSH 5PTPA 1FY5A 4ZHMU 2BVSH 4GSOA 4ASUD 1TFXA 4A1XA 5JBCS 2HRVA 2BY9X 2FOMB 5C3NA 1GG6B 1H9HE 4ZXXH 2PTNA 1AE8H 2BDCA 2VWLA 4ZXYH 1HAIH 1UVTH 5E0GA 1XKAC 1GBFA 1NBME 2WYJA 1V2TT 5CDFE 2R3YA 1UJ1A 1P02A 1KDQB 2CMYA 3MU0A 1ELCA 2NU2E 1XVMA 2GZ8A 3DHKH 1QB1A 3TJOA 2F3CE 1Y3VA 3SQHE 1HGTH 1S84A 1F0UA 1A0JA 1WDIA 2Y5FA 2BQ7B 3LH1A 1V2NT 2HVYB 1AUTC 2QF4A 1LDTT 2H9TH 2JJ1D 1C2FA 2SFAA 2ZU5A 3A7TA 3DCLA 1C2JA 3VB4A 1ELDE 1TRNA 2XBVA 5C94A 1CO7E 4OS6A 2F91A 3HATH 1UCYE 3UWJH 4R0IA 1ELAA 3V3MA 2NU4E 2FI4E 6CHAC 3UTUH 1OS8A 1RJXB 1VITF 2GJGA 3L33A 2QYIA 1C1NA 1ANDA 4SGAE 2P3UB 4CBOA 1CGHA 5F53A 3RC6A 2JH0D 1AVWA 2WUBA 1HAVA 2BDGA 4I31A 3ZZ4A 3AAUA 2Y81A 1GHVH 1DUEA 2NU3E 2ZGHA 1AKSB 1TNLA 2PGBB 3ESTA 2STBE 1C2EA 1LKAA 5KECA 4NSVA 4KP0A 2ZDAH 1ZSKA 1GBHA 3KQBA 3VB5A 1UCYK 1P06A 2O8MA 5GCHF 3ZZ8A 5JBBS 1SC8U 5DJ7A 1HAPH 5CHBA 5DP5A 5DN6D 3VPKA 1HCGA 1C2HA 1J14A 3MFJA 1K28D 8KME2 3GY8A 1Y5AT 1BITA 2GKVE 1HJ9A 2TGPZ 3F0PA 2ANWA 4I8KA 2ZECA 1V3XA 3W95A 3C27B 2B8OH 1BMNH
chains in the Genus database with same CATH topology
1ZRBA 1YM0A 1SL3A 1MBMA 5ETXA 5TCCA 2XRCA 1NT1A 4U30A 2BLWA 1EXFA 4GCHF 3PLKA 3S9AA 3O8BA 3RXIA 1W12U 3ZVAA 2Y80A 1RIWB 3A8BA 1RS0A 1A5GH 1ARCA 3QZRA 4Y79A 3RXJA 1MKWH 2SGDE 4CHAC 2PLXA 1A3EH 1UHBA 1BBRH 3F68H 3MYWA 1G37A 2BY8X 2BY6X 1SGQE 4NZQA 1P05A 4VGCB 3BTFE 3E8LA 1FY4A 3GCOA 5FX6A 2ZDKA 4UFDH 1O3EA 1N6YA 3F9GA 3S69A 5BPEA 4X8UH 4BAMB 3BN9A 1ZTLA 2EI8A 3SU6A 1SLWB 4K8YA 3HGNA 3E16B 1P2NA 4JZEH 2TIOA 3RXPA 1IQEA 1K21H 1PYTD 2G00A 2J92A 2G51A 2G8TA 3W94A 4BAOB 3MH7A 1C1RA 4OGXA 3FZZA 2YNBA 3GCHC 3DFJA 2Y5HA 2VIPA 1P09A 5F8TA 5F8XA 4NA7A 3ZVFA 1HXEH 1TBRH 1C5SA 3FAOA 1W2KH 2FI3E 4OS1A 3U8OH 1UVUH 4IC6A 5F6MA 2BOHB 1FXYA 1C5WB 4ZKNU 1BHXB 1GHBF 2Y82A 2YOLA 4BTUB 3UR6A 4NIVA 5JB9S 3S9BA 1BRBE 2I6QA 2PW8H 2KAIA 2P16A 1EAWA 1FPHH 3SJ8A 2BDHA 1GL1A 4DJZB 3GCTF 2VWOA 4ABAA 2BQWB 1UTQA 4FUCA 5AFZH 2ZDVH 1HAYB 1AFQB 4MNYA 2FOAA 4JYVH 1O2YA 4IN2A 2C93B 1YGCH 4DOQA 1HRTH 3UOPA 5C1XA 1LHDH 1LVYA 1GPZA 2FIRH 1QBVH 3VXFH 2ZHFH 1T32A 1NU7B 3MNXA 3GYLB 3BG4B 3STIA 3BV9B 3KNXA 3JZ2B 3VB6A 1O36A 1S0RA 3MO6A 1GGDB 3PWCA 2VH6A 3TGIE 1FLEE 2FYQA 2Z9GA 2WV5A 4FVDA 5A0CA 1TMTH 5FCRA 2FMJA 2V0BA 3RXDA 1ZHRA 4B74A 2FX4A 4JCNA 1GJ9B 1EAXA 1LHEH 3TITA 1JWTA 1LPGB 1UVOA 1T8NA 4OS5A 1KXAA 4HI3A 2R2MB 3RXOA 1ANCA 2XCFA 1BB0B 2VINA 1RRKA 1QTFA 4WJG2 1A1RA 2W5EA 2CN0H 1EX3A 5E8EH 1QB9A 1GJ5H 4XOJA 1UVSH 2JETC 1KXFA 5FPTA 3LJOA 1V2QT 1EATA 3KGPA 4B2CA 1BTHH 1BTPA 2HALA 3ZZ3A 1GVKB 2QF0A 1DDJA 1T8LA 5E2OA 1DT2A 1G30B 5T6GA 1S81A 1Y3WA 2GMTB 3I29A 3RXRA 3QO6A 5ESBA 4K60A 4I7YH 3TGKE 3PO1B 4YESB 1K1LA 3Q3YA 1FMGA 1GWAA 3UR9A 3RXFA 3UUZA 1SLXB 1AMHA 1C5PA 3ATIA 2OC1A 1AB9C 1TRYA 2BY5X 2QGRA 1O3GA 2G5VA 3HGPA 3ZZCA 4XBBA 1BA8B 1F2SE 4NA8A 1FY8E 4UE7H 3VEQB 1O2ZA 3B23B 1KTSB 3TK5A 3RP2A 2ZO3H 3MHWU 4KELA 2XC5A 2D8WA 1TBZH 3BTKE 3ITIA 2C8YB 2SGQE 4CRDA 2ZTXA 5A09A 2EI7A 3ELAH 3GY3A 1ZRKA 3MU1A 1HAVB 1HAOH 1XUGA 1ZSJA 2F9NA 2WPJS 1H9LB 3SQEE 4A5TS 1PJPA 2AH4X 3SORA 1H8IH 5AHGH 1C5RA 1JOUB 1T8MA 1HJAB 1O3FA 4E05H 2FLRH 1CHOF 2GCHG 2GT7A 3LJJA 5J4SA 1OWIA 1A46H 1S82A 2WPLS 4FU9A 1PQ5A 3OTJE 3P70B 5EODA 1BMAA 2OQ5A 3BTQE 1C5ZB 1O34A 1DANH 3PTBA 4XDEA 1PPCE 1SMFE 2BB4A 1K1PA 1P03A 1TNHA 1DFPA 1NS3A 1CVWH 2TGAA 1OPHB 3ZVEA 3CENA 3PWBA 4B71A 1RTLA 2FI5E 2VH0A 1V2MT 4Y0YE 5DKMA 5EPYA 3P8OA 4A1TA 3TH3H 1E35B 2FX6A 1O2OA 4X8TH 3SBKA 2A0QB 4Q80A 3ODFA 3RU4D 3M7QA 4WH6A 2ZU4A 2VJ1A 4AYVB 1EPTC 1TNJA 2WPHS 3UNRA 4GUXA 4AGJA 5DP7A 2QXHA 1SLUB 4CRCA 3V12A 3ZVDA 1TGNA 4ZROA 3NXPA 3BF6H 2ZIQH 2ANKH 1UHBB 4YOJA 2VNTA 4DW2U 1A5HA 2D2DA 3ZZ6A 1BCUH 1DUAA 3T25A 2B9LA 2ZGJA 3D65E 3HKIB 5I25A 5EW2H 5C5OA 4BNRA 5DGJA 2VIWA 1GBKA 4X0WU 1EZSC 1VCWA 3LKWA 1FAKH 1GBCA 3R0FA 4JYUH 1TOMH 1QL7A 5LPFA 4NIYA 1FN6A 4TY7A 1F0RA 1V2RT 3LT3A 2GV6A 2FZZA 6CHAB 1V2WT 3GY2A 1LHCH 4FUEA 2A5IA 3LIWA 2CV3A 3S0NA 1SGFA 2IPHA 2FTMA 1BZXE 2XC0A 3UY9A 3FVFB 2SGFE 1W8BH 1O33A 4XBDA 1O2TA 1NN6A 1IQGA 4CRGA 1O30A 2BTCE 2G55A 4ABBA 2QV1A 4AOQA 1NRQH 2RCEA 4ASHA 1ZMNA 1AQ7A 4NFFA 4FUIA 1ZOMA 1H9IE 1G3EA 2KAIB 3RMLH 5DG6A 2G4UA 1GBTA 3SI4H 1HAXB 2PV9B 2QF3A 1ESBA 1K22H 2ZHWH 2NU0E 5TCAA 3M5MA 2RA3A 1UTNA 4KGAA 1EB2A 4ISLA 3ZZAA 1THPB 1OP0A 3M3TA 2ODYB 3A87A 3S7KB 4JZ1A 4IW4E 1MQ5A 1G32B 2QCYA 1OWKA 1ORFA 2RG3A 2C3SA 2XXLA 1C1PA 2CXVA 1K1MA 1EPTA 1SQAA 4J2YB 1MAXA 2QC2A 1GI0A 1NESE 2FWWA 3A8AA 3RXLA 1ZLRA 4JK6A 3EQ0H 1FY3A 3RXKA 1W11U 2AMDA 2FO9A 1SGRE 1AE5A 4CHAB 1DXWA 4Y7BA 1TPSA 3MNSA 3AW0A 1O5AB 3U8TH 1O3MA 2UUKB 1V2KT 3UNSA 1LQEA 4BXSA 1AWHB 4K2YA 1C5LH 3K2UA 2BHGA 1O3PB 1CGIE 1M9UA 4ISNA 5EQRA 5LH8A 2Z3DA 1P12E 4LZ1H 2FYRA 1OWJA 2B7DH 3RDZA 1BTWA 4UONA 1EJNA 1HJ8A 2HGTH 1N8OC 1W10U 3RU4E 4BAKB 1GJ6A 1HAHH 1TABE 2A31A 2AGIX 4XBCA 2WV4A 2VGCB 3A7WA 4ZUHA 1DWBH 1OWDA 3TJVA 1F92A 2H5CA 5DPAA 4CRAA 3GCHB 1NFYA 1XVOA 1GHXH 2XW9A 3GY5A 1O2HA 2FS9A 2PHBA 1OSSA 3F1SB 5AVDA 2PWXA 5ABWA 3RU4T 4TPYA 4IC5A 4IGDA 4LK4A 1QR3E 2ZFRH 4WMEA 1YPJH 3QTVH 2FDAA 2GX4A 1CHGA 1A0LA 2OC7A 2AIPA 1NU9A 5AFYH 2Z9KA 2ZPRA 1DY9A 2LPRA 2ANYA 1LHGH 1EQ9A 1MH0A 2R3UA 5IDKA 3Q76A 4Y7AA 3SHAH 4FUHA 1KXCA 5E0HA 2C8ZB 1O2KA 2JKHA 2ZFFH 5LGOA 4INKA 2BX4A 1Q3XA 4FU7A 2W7UA 3HPTB 1E36B 1YKTA 1AI8H 1TRMA 3AW1A 4JZIA 3URDA 2A5KA 1SGPE 1OWHA 4ZKRU 2XBYA 4NGAH 1HAGE 8GCHG 2PSYA 1ZR0A 3FP8E 1A4WH 1QBNA 1V6DA 1MTUA 2H9HA 1O5EH 2UUYA 3GDUA 2ZDLA 1C9PA 3NCLA 1C1MA 2A5AA 1KXEA 1P3CA 4J1YA 4KTUA 4O3TA 2PTCE 2UUFB 1K2I1 2ZGXH 4BXWA 1MTSA 1C4Y2 4FU8A 1Z6JH 4ABDA 2ZHQH 4NWKA 4CH8B 1AVGH 4TWYA 2BD3A 3P95A 2Z7FE 3U69H 1O3BA 2BM2A 4A6LA 4DURA 2BDIA 2ZPQA 4QT8C 1CBWC 3BTDE 2GZ7A 1L1GA 1IQJA 3E90B 2JETB 2RDLA 4B75A 3PMAB 4X2VA 4O3UA 1WTGH 2CHAB 3DUXH 2XCNA 1C5QA 1TE0A 3AASA 5CHAC 2UWOA 3BEIB 1QJ6B 1TMBH 1P57B 2QA9E 2Z9LA 2W3KA 3NK8A 1C5NH 4WXIA 1C2LA 1MTWA 3ZVCA 1YPHC 2FXRA 1FPCH 4JYTA 4SGBE 1DXPA 3NUMA 5DK1A 1E37B 2HNTC 3OSYA 4LXBH 4THNH 1SFIA 3GY7A 2BVRH 1FN8A 2ZCLP 7GCHG 3RXSA 3D23A 4ISIH 3GY6A 3SO3A 1F7ZA 2ZPSA 2Z3CA 1ZGVA 2ANMH 2XBWA 3LC5A 2PFEA 1TPOA 4KTSA 4D9RA 1P9SA 2Z6BD 3EAJA 3H7OA 1AB9B 3RXQA 1SGEE 1LVBA 4YLUA 4Y10E 3U98H 3MO9A 3RXBA 1EZQA 3OY6U 3T28A 1GJCB 1SGTA 1VITH 3U8RH 5ESTE 4AFSA 3F9FA 1IQKA 1FZZA 4Y76A 1GDNA 1RTKA 1DPOA 1KY9A 3PB1E 3PMJA 1A7SA 4NIXA 1NFXA 2O8TA 3RLWH 1FJSA 4X6NA 5FPYA 1NY22 1NRRH 1EKBB 4FUGA 3UQVA 2AMQA 4MPXA 2AERH 1SGYE 4K3JA 4X6PA 3K65B 3M5NA 1QIXB 4ABHA 1WBGB 1YBWA 1MKXK 4ABJA 1YCPK 3A83A 1AGJA 1T7CA 1SGCA 1BIOA 1HPGA 4GAWA 5GDSH 1EJAA 1G2LA 5HM2A 4B73A 1SB1H 1ETRH 3DFLA 4UDWH 3P17H 1MTVA 2ZU1A 3SV6A 1HAZB 1PPFE 1ELTA 3QX5H 1MCVA 3I78A 1YPLH 1CU1A 5JYIA 5BRRE 1SOTA 1MU8B 1LPKB 1CSOE 2HNTF 1RTFB 2GV7A 3VB3A 1S5SA 1L1JA 1V2PT 3A85A 1P8VC 2A7JA 2FS8A 2PSXA 4TYDA 3ZZ7A 4AB9A 4D8NA 5JBAS 1CA8B 3SUFA 1GJBB 3STJA 1GMCG 4WWYA 1GBEA 1YF4A 1EPTB 1ZMLA 2P94A 2ZDNA 2ZQ2A 3MU8A 1KIGH 1O2SA 2HLCA 2IN2A 2STAE 2HOBA 3IITA 3TLOA 1GI6A 4PROA 1TIOA 2VIOA 1NFUA 5A0AE 9ESTA 2XWAA 2BXUH 3JZ1B 3T2NA 2IOTA 2Z9IA 2H9EH 4GVUA 4BTIB 4YT6H 4HFPB 2B5TB 3QGJA 5E0JA 4XE4A 2F9UA 2PUQH 2GZ9A 1O3LA 1F0TA 1Z8JB 1AZ8A 2GCTC 3M7TA 2AIQA 4Y6DA 3ZZDA 1DWDH 2OC8A 3BTGE 3NZIA 5LPEA 1BOQA 3T29A 1P11E 4IBLH 4H4FA 4NG9H 2WPKS 2TGTA 1MCTA 2A1DB 3SV2H 3CP7A 3ATKA 4ABFA 1CT0E 2C8WB 4RKOB 1Q2WA 2PKSC 1SBWA 4Z6AH 1K1JA 1QB6A 1GI2A 1VGCC 2H1UA 1WAYB 1ELEE 1LVMA 3MI4A 1C5MD 2P8OC 3AAVA 1BTXA 2QXJA 3SOSA 3SUEA 3P8FA 4YOGA 4AGKA 1SOZA 4D76A 4INLA 2FOCA 3EA7A 3EGKH 1TNIA 1Z8IB 4IMZA 1BMMH 1TGSZ 2ALPA 1FUJA 1AVXA 1P9UA 1GCTC 4ESTE 2V3OH 1WQSA 1ZJKA 1D3TB 2JH5D 3ODDA 3ZZ9A 5HXFA 3QN7A 1UTJA 1XX9A 3GDSA 1XUHA 1F0SA 4TY6A 1TNGA 3A81A 2BLVA 3SU0A 1Y8TA 1CT4E 2AGGX 2VVUA 1TAWA 2OBOA 3PM3A 1O2PA 2GT8A 3QUMP 2C4FH 4ABEA 4F4OC 3A84A 1UCYH 2VIQA 2ILNA 4D9QA 5DO4H 4WVPE 2P59A 5C67A 1C1OA 1H8DH 2H6MA 2SGPE 4I8HA 1XM1A 3QK1A 3M37A 1WUNH 2WPMS 7KMEH 1GHAG 2O8LA 3OX7U 3S9CA 1LHFH 1VCQA 2ZG0H 2GCHF 1O2QA 2VIVA 1FAXA 5EGMA 1HDTH 2A4OA 3H5CB 1W13U 1GJ8B 3A86A 3SNCA 2FOGA 4K1SA 1H4WA 2OTVA 3SJIA 3BTTE 1O35A 3SNBA 2ZQ1A 5TJXA 1MTNB 1SQTA 1GI9B 1N8OB 3KEEA 1N1LA 2OBQA 5FCKA 4GLYA 5LPRA 1KYNA 4FUBA 1DE7H 1GJ7B 5C20A 4MDSA 4JZDH 2CF9H 2WPIS 1O5GH 1QGFA 1NROH 1PFXC 2ZFQH 1ZTKA 3URCA 5EQQA 1GMHG 1O3OA 1WCZA 3RC5A 3ENSB 3SHCH 3O8CA 1WYKA 1S6HA 1J15A 1ID5H 4JZFH 1YPMH 1C9TA 4UFEH 2QXIA 1TX6A 2ZGBH 3OY5U 1QJ7B 2ALVA 3A80A 1RGQA 4I8JA 5EXMA 3SU1A 2BX3A 7LPRA 1C1VH 1P10A 3RC4A 4D7GA 5C1UA 1ELGA 1NRPH 4HTCH 4B76A 4WF8A 2ZFSA 3GY4A 3QZQA 4DCDA 3WY8A 4KTCA 1EOLA 5A8XA 3U9AH 3TH4H 1NM6A 1Z1JA 4AORA 1DVAH 1HNEE 1SI5H 1V2LT 1RXPA 5HM9A 3SV8A 1HFDA 3BSQA 3PTNA 4NCYA 1UTLM 4D7FA 3KIDU 1GJ4H 5GIBA 2AYWA 1UTOA 3OU0A 3N7OA 4ISOA 4MNXA 3SU5A 3SV7A 2UUJB 3RM2H 1IQMA 1LQDB 1PPHE 1GMDG 1GDUA 1O5FH 1G2MA 2BQ6B 1DY8A 3ATLA 1V2ST 1NO9H 3K6ZA 1JIRA 3RXUA 4FUDA 3IWMA 4X8SH 1F5LA 1UTMA 1O3IA 1YPKH 1C5OH 2CJIA 2BD5A 2V6NA 3KHVA 1TGBA 6ESTA 1YPEH 1MZDA 5DP8A 3CS0A 3RMNH 1DSTA 1NRSH 1P2JA 2BD4A 3HK3B 2A45B 3E1XB 3BIUH 1EB1H 1SPJA 3BTHE 2FESH 1ZJDA 1S83A 1A3BH 1CBWB 1PPBH 5L6NH 1O2NA 1GGDC 4AX9H 2BDAA 3G01A 2BVXH