2QY0B

Active dimeric structure of the catalytic domain of c1r reveals enzyme-product like contacts
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
240
structure length
236
Chain Sequence
IIGGQKAKMGNFPWQVFTNIHGRGGGALLGDRWILTAAHTLYPKEHEASLDVFLGHTNVEELMKLGNHPIRRVSVHPDYRQDESYNFEGDIALLELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGVMEEKIAHDLRFVRLPVANPQACENWLRGKNRMDVFSQNMFCAGHPSLKQDACQGDSGGVFAVRDPNTDRWVATGIVSWGIGCSRGYGFYTKVLNYVDWIKKEMEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Revisiting the mechanism of the autoactivation of the complement protease C1r in the C1 complex: Structure of the active catalytic region of C1r.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Complement C1r subcomponent
total genus 56
structure length 236
sequence length 240
chains with identical sequence D
ec nomenclature ec 3.4.21.41: Complement subcomponent C1r.
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qy0B01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qy0B02
1NROH 1LQEA 2ESTE 2BMGB 2QA9E 1GJ8B 2GX4A 1O37A 3TLOA 2NWNA 2PKSB 3NKKA 3TGIE 1O5EH 3KIDU 4D9RA 3SI4H 4WVPE 1CGIE 1GMHF 1EPTB 1W13U 1VITF 1A5GH 2GMTC 5H4IB 2FLBH 1V3XA 2UUYA 1WV7H 4Y7BA 4GUXA 5L2YH 2AGGX 3A7WA 2FOMB 2OLGA 2Z94A 1N8OC 3VB5A 2FIRH 2ZGHA 2VINA 1V2QT 5I46H 4AYVB 2VIQA 2IN2A 3LKWA 3PMJA 1EZUC 3QTOH 2ZGBH 3DFJA 3GOVB 3M36A 1ABIH 1SMFE 4JZFH 4TPYA 1UVTH 1AE8H 3P70B 1DX5M 1C5SA 1DWDH 2HWLB 1HJ9A 4VGCC 2BVRH 2HRVA 1SSXA 2J34A 1T31A 1F2SE 2ASUB 3LT3A 5TJXA 2P94A 3SQEE 2BD3A 3PWCA 3E6PH 1P02A 1Z1JA 2VGCC 1TABE 1HAXB 1K2I1 1C5XB 4XE4A 1YPEH 1P12E 1WAYB 1CBWB 4ZKNU 1HB0B 3KQDA 5JYIA 1W14U 1TNHA 1G3BA 1HAGE 1NO9H 3DA9B 4Q7ZA 1O3FA 2EC9H 1C1UH 5HXFA 1BTYA 4ZROA 1GHVH 3T25A 3Q3XA 3EA9A 1ANBA 3V7TA 1TOCB 5ESBA 1FPCH 1O3BA 3C27B 1LQDB 3VGCB 5J4QA 4Z6AH 2EA3A 5C2ZA 1O3PB 2O8TA 5GIBA 3RXEA 1XVOA 1IOEA 2AYWA 1MKWK 1O3IA 3E1XB 3QX5H 1TBQH 1G3DA 1D3TB 2QGRA 3GDUA 3UWJH 5F6MA 4JZIA 4NZQA 1BT7A 3BTEE 1CA0B 5DP4A 1GJAB 2B5TB 4KTSA 1BRUP 3BTFE 3GICB 2QXHA 1KXEA 1QJ7B 3BG4B 4UFGH 4WF8A 1UVSH 3SU6A 2HPPH 3ZVDA 5GCHF 1DLKB 4A92A 4BAMB 4A6LA 3RU4D 4LOYH 1ZTLA 1C5OH 1YCPM 1GBHA 3BV9B 3SO3A 1N1LA 3RXCA 1EZSC 2DE9A 3RXGA 1HAOH 1QRWA 5A0CA 1G2MA 1C2GA 2Q6GA 3SUGA 5A8XA 2M5TA 1L4DA 4GAWA 3EA8A 1TMBH 3TK9A 1UCYH 2GV6A 1TRNA 2C8ZB 4DJZB 1TGSZ 4CHAC 1B0FA 1ELEE 1F0TA 2A2QH 3P8NA 3MU0A 1SLVB 1NT1A 4INHA 1QURH 2F9PA 1V2TT 2FX4A 4NFEA 2EI6A 4B74A 1ESBA 1MTSA 2TIOA 2XBXA 1L0ZA 2W5EA 1UTLM 2J4IA 2ZHFH 3HK3B 4I8GA 1J16A 1DLEA 5BPEA 3BIUH 1C1QA 3F9FA 3Q3YA 2OBQA 1ID5H 1MCTA 2HLCA 1XUJA 1K21H 2ZDLA 2FWWA 2O8MA 1CBWC 1XUKA 2R0KA 2ZU1A 1BTPA 1FPHH 1MMJN 1O2NA 1LPGB 1DITH 3BF6H 1RGQA 1P2JA 1BRBE 1IAUA 1G9IE 1SGRE 1W3CA 4Y0ZE 4WMEA 1XKAC 4F4OC 1O5AB 4YT7H 3RMLH 2VVUA 1W7XH 2FYQA 2TRMA 1HLTH 1MCVA 3LH1A 5AVDA 1GMHG 1UK2A 4X0WU 1MU6B 3RMNH 2C4FH 1DFPA 3F6UH 1E35B 2ZP0H 2OUAA 1LVYA 2BLVA 4PROA 1EASA 3UTUH 1EKBB 4CH2B 4Q80A 1NRPH 1YPMH 3HPTB 1O3GA 2WYGA 1G32B 1NU9A 2AIQA 2RA3A 1GCDA 1UVUH 1EUFA 2FI4E 1GBEA 4A5TS 1BRCE 2SNWA 1SOZA 3STJA 4B73A 1V2JT 2Y6TA 5HMAA 2IJOB 2ZTXA 4ABDA 1HDTH 3LIWA 1Y59T 1AKSA 2FZZA 5PTPA 1BRAA 2NU2E 2FI5E 1TRMA 1SFQB 1TNGA 1GCTB 4AYYB 1KXFA 3L33A 3TNSA 3LPRA 2ANYA 3HKJB 2ZHDA 3URDA 2BVXH 4FUIA 2BLQA 1C5UA 1O2OA 3A83A 2C3SA 2EI7A 2CGAA 2NU0E 1YGCH 3RXAA 2A4OA 4CRGA 5EQRA 2QF0A 3N7OA 5JPMH 4ABJA 3SV9A 1ZGVA 3QUMP 3TK6A 1TOMH 3U8OH 2AMPA 2OP9A 1W8BH 5AHGH 2Z9LA 1C1VH 3NK8A 1BBRE 2BD9A 4JCNA 1HXFH 1GI3A 1BMNH 3A88A 4YM9A 1XKBC 3KN2A 2OXSA 4R0IA 5DJ7A 2VNTA 4SGBE 1HAZB 3DHKH 3UPEA 2G51A 2F9VA 5FAHA 1BQYA 1C2JA 1OYQA 4AN7A 3UUZA 4JZEH 2GVFA 3BTTE 5EW1H 3PWBA 3NZIA 3A87A 1JMOH 4OS1A 3SV7A 1FNIA 2ILNA 3MMGA 2ZFSA 3A7VA 1IQFA 4WXVA 5F8XA 5CMXH 1HAVA 1UTMA 2ZPQA 1LKAA 4FXGH 1C1WH 1TB6H 3CENA 2CN0H 1NFWA 2ZPRA 5A8YA 1H9LB 1S0QA 3EYDA 3ESTA 1UHBB 1S82A 3SUDA 1ZLRA 2ZHWH 1MAYA 1WQSA 2FO9A 1HFDA 1QCPA 1PFXC 1FAKH 1DANH 1QTFA 4ZMAH 1UCYE 3ATKA 1KXAA 3TNTA 2BDYA 4YLQH 2WYJA 5LPEA 5T6FA 3SHCH 3E16B 1P11E 1CHOF 3TJNA 2BLWA 2J9NA 1MKXH 1YPLH 3ATLA 5L2ZH 1EX3A 3RXPA 4CRFA 1THRH 1BTZA 1EOLA 3JZ1B 1ZHPA 2BX3A 1ELBA 2P16A 1PYTC 2D8WA 3RMMH 3RXDA 2GP9B 1MTVA 1CE5A 2A4RA 1SFIA 1H4WA 3UQVA 2GZ9A 1QQ4A 1NRRH 1T32A 2FS9A 4Y10E 5E0JA 1MKWH 3GCHB 1C4Y2 4HFPB 3VPKA 4MNWA 4YTAA 2TGTA 3QGJA 3RU4E 4J2YB 4MNVA 3MU8A 1YLCA 4WH8A 4X1NU 1YPJH 3U98H 1DOJA 1VGCC 1E34B 4ABFA 1AWHB 1S6HA 2VWNA 2P93A 2LNCA 3S9BA 1ZRBA 1HJAC 1AY6H 4K8YA 1QRZA 2BZ6H 2VU8E 1AZ8A 2AERH 7LPRA 1EZQA 1FN6A 4VGCB 3RU4T 2CJIA 4FU7A 1G30B 3F9EA 1TGBA 2Y81A 3U8RH 1RJXB 3SNBA 1SB1H 2QYIA 3VEQB 3K6ZA 3GDVA 3MNSA 3SZNA 3A8BA 1SL3A 4NCYA 4ISNA 3SJIA 4JZ1A 4YT6H 4RKJB 1O5CB 1NZQH 2C93B 2O8LA 1GDUA 1O2ZA 4JK5A 4MPWA 3VB3A 1C1SA 1QY6A 4J1YA 5FPYA 4B2CA 1ZPZA 3UNQA 3LGTA 1GG6C 4K2YA 3RXUA 2HVXA 2A2XH 3UOUA 2HALA 3IITA 3SU2A 3FZDA 3GCHC 3BTME 2ZTYA 4MDSA 3MYWA 4H6SB 1D9IA 1ZOMA 4WWYA 5ESTE 4KP0A 2XBVA 2WPIS 4U30A 2PWXA 4AFUA 5EG4A 3PTNA 5A0BA 1VITH 3BTGE 1UMAH 2Y7XA 1BDAA 1EATA 3A7ZA 4K3JA 3MNBA 4BTIB 2P8OB 4KKDA 1RTLA 4Y11E 1A2CH 1O2GH 4NG9H 4X6PA 2R3YA 1GBIA 1AIXH 1BTUA 4DIHH 5L30H 1QJ6B 1P9UA 4NSVA 4UE7H 3MH6A 4LZ4B 3OX7U 2P95A 2XCFA 1QBVH 1SOTA 1MBMA 1QL8A 1INCA 3BTDE 3MI4A 1AN1E 5GCHG 2XBWA 1P2IA 1A3BH 3SV8A 1IHSH 1LPZB 1OWIA 1CA8B 1NTPA 3A8DA 1SGFG 4U32A 2BXUH 1TX7A 2VIVA 2XWAA 4X2VA 3LDXH 3O8RA 2A31A 4X8TH 4AG1A 2QCYA 1GVZA 5C1YA 1XUGA 5AF9H 5EGMA 1ARBA 1O2QA 2JKHA 2FM2A 3GY2A 1FV9A 3KNXA 5IDKA 1O2YA 2VH6A 2A32A 1C4U2 5FXLA 2I6SA 1C5PA 2VIWA 2ZFRH 4ASHA 2HPQH 3RXTA 4ZHLU 1C2FA 4GSOA 5A09A 4FUHA 3SGQE 5LH8A 1F5KU 4CRCA 4CH8B 2XC4A 2OC8A 3F1SB 5DPAA 1KXCA 1V2UT 1QNJA 2G5VA 4ISHH 3B8JA 1UVPA 4BAOB 1L1GA 1LVBA 3BTHE 2C90B 1VJAU 1P2MA 1YC0A 1SVPA 1Y5BT 2CF9H 3IG6B 5A0AE 1QQUA 4LK4A 1HRTH 4NFFA 1B0EA 3FP7E 2R9PA 1NFUA 5EQSA 2ULLA 4Y71A 1S85A 2GTBA 3UIRA 1TNKA 3OY5U 1V2KT 5JBTA 5JB8S 1W12U 4AFQA 1XUFA 4Z0KA 3PO1C 1W7GH 1HAHH 3QDZB 3KF2A 1V2OT 1TMUH 4B1TA 1HGTH 1HJ8A 4I8KA 4MTBA 1GBTA 2XXLA 3B23B 2A5AA 1O3MA 1C2EA 1GBFA 1PPGE 2Z9KA 3TU7H 4ABHA 1XUHA 4TWYA 2STAE 1YPKH 3TJVA 1L4ZA 1C2HA 4Q7XA 3P8GA 1Y3VA 1WYKA 3V12A 1HV7A 5LGOA 3W94A 4ZKSU 1JWTA 2PTNA 2THFB 3GDSA 1IHTH 1ELCA 3RDZA 4DT7B 4Y8YA 3S7KB 4RKOB 1UK3A 5FPTA 2Y5GA 1LO6A 1D3PB 2STBE 2ZG0H 1KTSB 2JETB 4XBCA 1WOFA 5FBEA 3JZ2B 2GDEH 3TJOA 3VXFH 1ZR0A 3OYPA 2BD4A 2ZF0H 2VB0A 2GV7A 3M3VA 1Q31A 3HGPA 1LVOA 1RTFB 1TNIA 1ZTKA 1EPTA 1SLUB 1O2RA 4X1RU 1TX6A 4AX9H 4X2WA 4YESB 1GVLA 1BCUH 8ESTE 4RN6A 4BXSA 3F9HA 2NU4E 2ZEBA 3M7UA 2BYAX 2G81E 3M7QA 1P3EA 1YCPH 1A0LA 4FU8A 1K1OA 4XBDA 1J14A 1KIGH 4BTTB 1ABJH 1OPHB 2TBSA 3O8DA 3RXSA 1LKBA 1GBBA 4E06H 2JH0D 3HKIB 1HAVB 1HIAA 1BIOA 2K1QA 1O32A 3BSQA 4ZHMU 1BHXB 1THSH 2EEKA 2BDAA 1IQNA 1NRQH 1KLTA 1GJBB 1PPCE 5HGGA 1CHOG 2AEIH 1W0YH 5FX6A 1TLDA 1C5NH 3A86A 3RXKA 1K1PA 1O2XA 4I32A 3ZZ9A 1K1JA 1SGFA 2H9TH 1GBKA 1K1LA 1EJAA 3SGBE 2V0BA 2BQ7B 1TA2A 1Z1IA 1VCQA 1YP9A 1F0RA 4GLYA 3L3TA 2FODA 2TGPZ 3S69A 2A45B 2HNTC 4ABAA 1Z71A 3T28A 4K1SA 3T62A 1C1OA 1UTOA 2UWPA 1C1RA 1LCYA 1AVGH 1C2IA 4X1SU 1DT2A 2Q1JA 1O3DA 1C2LA 2NU1E 3B9FH 2ZDAH 3VGCC 5E0GA 1F5RA 1ZJDA 1P06A 4I8JA 1G2LA 1DUEA 2OBOA 1ELFA 2VVCA 3H7TA 1DUAA 2QAAA 5C1UA 5LPFA 1GHWH 3U69H 2EI8A 4WMDA 4D7GA 4WJG2 3BG8A 2BY9X 2QXGA 1TPAE 3SQHE 2BY6X 4NGAH 8KME2 4THNH 1EAXA 1NY22 5AFYH 1BJVA 4QT8C 2C8YB 2D2DA 3EQ0H 1RXPA 5SGAE 1BA8B 1XM1A 3ZZAA 2BM2A 4A1XA 4IN2A 1FXYA 2WINI 5BRRE 5ABWA 3O8BA 4I8HA 2BY7X 4DOQA 4E7RG 6GCHG 6CHAB 1GI4A 1ZJKA 3SU3A 2ZCKP 3PLPA 1ELDE 2D1JA 3VFEA 1V2MT 4BAQB 2B7DH 4XSKU 1V6DA 1C5QA 3GY6A 5L6NH 2FP7B 3MU4A 2C8XB 3RXRA 1GGDC 1O2UA 1PQ8A 4ABGA 1YLDA 6ESTA 2AIPA 3RXHA 1O34A 1P57B 3EA7A 3D49H 3KQEA 1ETTH 1ZMJA 2R2WU 1SG8B 3MH7A 5EXNA 1DXPA 3K6YA 1GHYH 1TRYA 1GI1A 2A0QB 4KTUA 1OWJA 1Z7KA 3CS7A 1PPZA 2ZU4A 3TIUA 1DDJA 3LGYA 1OKXA 1GBCA 3T5FH 2FI3E 1GBLA 1QHRB 1L1NA 3QK1A 4FUGA 3ZVFA 1OXGA 3QO6A 4K60A 2QC2A 2ZU5A 1C5VA 1O3JA 1Z6JH 4X8SH 1Y3YA 4YZUA 2PSXA 1EAIA 3ZV9A 3MH4A 2Z3EA 1S81A 1HAIH 1RIWC 3FAOA 4DCDA 1ELGA 4IMZA 1O3AA 5EU8A 1SR5C 4Y8XA 1AU8A 3M35A 1GI6A 1C1PA 5CHAB 4AG2A 1DPOA 1V2VT 4ISIH 1SGIB 3M7TA 1VZQH 3Q77A 2VWMA 4GHQA 4K8BA 2JH5D 3ZYDA 4Y6DA 4HI3A 3SORA 1GG6B 2BXTH 3P8OA 2XYAA 2HOBA 1QIXB 1SLXB 1MTNC 1C5TA 5DP7A 5C3NA 2W7UA 1JRSA 3A85A 1GMCG 3PV4A 1DICA 8LPRA 1GJ7B 2Y80A 3SJKA 1FI8A 3D23A 2PR3A 3UNSA 8GCHF 1DM4B 4ZHAA 1O3NA 1Z6EA 2RDLA 3URCA 2F9NA 2FPZA 2FTMA 1UTJA 4OS2A 2BDCA 5T6DA 3ZZ6A 2R2MB 4GCHF 1RS0A 4ZXXH 2NU3E 3F68H 3D62A 5C5OA 1VITG 1D6WA 1O3LA 1EB1H 3RC4A 4BAHB 2VIDA 4ESTE 1TBRH 3SI3H 3EDXB 1CT2E 2GGVB 3STIA 3ZZ4A 1O2KA 1AUTC 5C5NA 3M3TA 1O36A 3EAJA 4O3TA 1TWXB 3RXFA 4AFZA 1GCTC 1EOJA 1AFEH 2GT8A 2CV3A 2PV9B 4IN1A 1ELTA 2VGCB 4BOHA 1SGTA 1IQIA 1SHHB 1ZZZA 3D65E 5A2MH 3C1KA 3U9AH 1ZSKA 1WUNH 1ESTA 2PW8H 3SNCA 3SU5A 4DG4A 3ZVEA 3KCGH 4RSPA 2BLOA 1J17T 3FP6E 4FUFA 3RXOA 3T29A 1L1JA 2DE8A 5DP6A 2QF3A 3U8TH 5GDSH 4B76A 2B8OH 3DD2H 4MPUA 1NFYA 1ZPCA 1F5LA 1H9HE 4Y76A 2A5IA 4FU9A 3ZYEA 1SHYA 3UR6A 5C20A 1BMAA 3A7XA 2H1UA 3RUOA 1JIMA 1GI0A 3OTJE 6GCHF 1KXBA 2GZ7A 4BNRA 1O39A 1FUJA 1W0ZU 3Q3KA 3NWUA 4Q7YA 4AZ2B 1TPSA 2ZHEH 3M61U 1IQHA 1U6QA 4FUCA 1BOQA 1KXDA 3QZQA 3GCOA 1OSSA 1SBWA 1FAXA 2UWOA 1PPEE 3RXMA 1FDPA 1MH0A 2XC0A 4OS5A 2IPHA 1PYTD 1HAPH 2SFAA 4A1TA 1ZHRA 1QB1A 4FVBA 2Y7ZA 1MD7A 2GCTB 3ZZDA 1KLJH 4H4FA 1ZHMA 2UUFB 1K22H 1ORFA 3T27A 1AUJA 1GL1A 2PHBA 4CHAB 3DFLA 3VXEH 3W95A 3ZZ8A 5EW2H 2W3IA 4MVNA 3DUXH 1UCYK 1AB9C 2PUQH 2P3FH 2OQUA 1KDQA 4UFDH 1HXEH 3OSYA 3MNXA 1LTOA 4HGCA 1CT0E 2H9HA 1EP6A 1SGYE 4FUDA 4NIYA 2J92A 2XC5A 4AFSA 4JK6A 1YCPK 4HZHA 5E2PA 1D4PB 3GY7A 3A84A 1YF4A 3LC5A 4GPGA 1SGQE 1P8VC 1O5BB 1XXFA 2J38A 2V3OH 3I77A 4TYDA 2SGDE 1WTHD 3SHAH 1F92A 3ZVCA 1LHCH 2Q6DA 2OINA 4X2XA 1H8IH 1LMWB 1FJSA 1Z8JB 4UDWH 2GKVE 4UFEH 2FOHA 4LXBH 1LVMA 3RXVA 2OC1A 3ZVAA 2VIPA 2WPKS 3AAUA 1EAUA 1GI5A 1UTKA 2FOCA 3A81A 5F03A 2H6MA 2FMJA 4ZAEA 3AW0A 1T8NA 5TCAA 4O3UA 4ZKRU 9ESTA 7ESTE 1ANEA 1GI9B 2UUKB 4KTCA 1O5GH 3ENSB 2ODYB 1TNLA 1O3KA 3RXLA 1ZRKA 1LDTT 2O9QA 1NC6A 3FP8E 2ZO3H 1DXWA 1AB9B 2JH6D 2O8UA 3PO1B 2PGBB 3ATIA 3BEFB 4DVAU 5CHAC 1H8DH 1KY9A 3KQCA 1JXPA 1A1RA 4IGDA 1E37B 2HNTF 3GY8A 3MO6A 2WUCA 1O2SA 1YM0A 3H5CB 4H42U 1J8AA 3SJ9A 1PJPA 3EE0B 4IC6A 1OX1A 1KYNA 2XWBI 5DP3A 1JBUH 3FZZA 1XVMA 1NN6A 1GBJA 1OWKA 4WMFA 1HPGA 2H9EH 5F8ZA 2SGFE 3UR9A 1KTTB 3RLYH 4B71A 2AH4X 1AI8H 1UJ1A 2AGEX 3GCTF 4GHTA 1C5RA 3LGVA 5EODA 1UHBA 1GHBF 4JYUH 1IQKA 3MU1A 1SGDE 1QGFA 4D76A 1Y3WA 3K65B 3H7OA 3ZVBA 1D3DB 3KHVA 2BZAA 3IWMA 1AVWA 2ZHQH 3R3GB 1DY8A 3MO3A 3SNEA 4NA8A 1C9TA 1V2NT 3KEEA 4A1VA 1C2MA 3SUEA 4XFQA 1SI5H 1C4V2 1DE7H 2Z6BD 3QWCH 1O2TA 1Z8IB 3RP2A 1SGEE 3A82A 1K9OE 3F9GA 1G3CA 1PQAA 3SGAE 4D8NA 3NCLA 3UWIA 3M5LA 1BTHH 2P59A 4NWKA 1O2PA 3MTYA 1TE0A 2ANMH 3SJ8A 3RM0H 7GCHF 2F3CE 1P05A 2ODQA 3E0NB 1XX9A 1XUIA 2BX4A 2Y5FA 4X8UH 4DW2U 1Y8TA 2ZQ1A 2FESH 1MAXA 1Y3UA 1GHZA 1YKTA 2PKSC 3LONA 4X1QU 5CE1A 3S9AA 1O31A 2A5KA 2YOLA 1E0FD 4INLA 2F91A 3VB7A 1YPHE 1ZMNA 1PPHE 1EB2A 4ZH8A 1OWEA 1OYTH 1AZZA 2G55A 1BHXF 3RXBA 1LPKB 2Z3DA 3BEUA 2PKAB 1ACBE 3GY5A 3M5NA 1P10A 2XBYA 3A8AA 3K2UA 2ZDNA 4BTUB 1N8OB 1C1MA 2G4UA 1IQMA 3S0NA 2A4QA 1WTGH 1PPBH 5E0HA 4AORA 4X8VH 1GDNA 1DWBH 1VCPA 1Q3XA 2FYRA 4Y0YE 2O8WA 1TQ0B 1NM6A 1P04A 5GJ4B 8GCHG 5EQQA 1JOUB 1FIWA 2ZNKH 1AHTH 1JRTA 1OOKB 3VB6A 2GCHF 4GCHG 1GI7B 3AASA 4E05H 2BQWB 1OWDA 2PUXB 3ZZCA 1O3HA 3HK6B 4JYVH 1V2RT 4INKA 1HIAB 1QJ1B 1SGPE 3ODDA 5FCRA 2PSYA 3LU9B 1TX8A 4B2BA 1O2MA 1THPB 2RA0A 4X6NA 1GL0E 1UO6A 1QL9A 3A80A 3E3TA 2QXIA 3R0FA 4NWLA 2VVVA 3NPSA 1KLIH 4AGJA 1GHXH 1AVXA 3NUMA 1ETSH 1RIWB 5G4BA 5DKMA 2R3UA 1MQ6A 4X2YA 3QTVH 1H9IE 2W7SA 3KGPA 1EPTC 2ZU3A 1XXDA 1SC8U 2FOGA 1P01A 3SUFA 1NFXA 4OS4A 3P17H 5EXMA 1L2EA 2BVSH 2FLRH 2ZGCA 2ZI2H 1NESE 3LC3A 1NPMA 1MTUA 3RLWH 3DT0H 4KELA 2BD2A 1AMHA 1QB6A 2Y5HA 2ZC9H 2ZGJA 1D3QB 3SNDA 2BQ6B 1MU8B 2FOBA 3MWIU 1LHGH 1GBAA 4R8TB 2F83A 5ETXA 3OU0A 4CBOA 1GGDB 2V35A 2P8OC 1D6RA 1DSTA 1O38A 3SV2H 1O3OA 1V2PT 2VWLA 3PYHA 4DIIH 1AD8H 3SU4A 1M9UA 5DO4H 1TONA 4WH6A 1DSUA 2Z9JA 3MH5A 3PMBB 3TVJB 4DURA 2GT7A 2UUJB 1FY8E 2HGTH 5T3HA 1GJ6A 1BJUA 1N6XA 4I7YH 1BITA 1AKSB 1QFKH 2BDHA 2ZPSA 2ZCHP 3SBKA 2GDDA 2TPIZ 2XW9A 1KSNA 1CHGA 2BD5A 3FFGA 1ARCA 3K9XB 1PPFE 3E8LA 4WY3A 1YBWA 1P3CA 4K1EA 1BTWA 1GPZA 2FOFA 1O5FH 2A7HA 1O5DH 2G8TA 3VB4A 2I6QA 1FN8A 2YNBA 1MZDA 1TGNA 1B7XB 4YOGA 2BTCE 2A4GA 4X6MA 1EXFA 3BG4C 4CR5A 1T8MA 3O8CA 1SGCA 1BMMH 1ANCA 1ELAA 3LOXA 4YLUA 1IQJA 1ELVA 4JZDH 3OY6U 1FY3A 1MTNB 3U1IB 1EQ9A 3KQBA 2HNTE 7GCHG 4BAKB 1K1IA 3ZZ7A 1FQ3A 4IS5A 1O35A 3AVZA 1T7CA 2ZFTA 2Z9GA 1A0JA 4Y8ZA 3UNRA 3MFJA 2ZFPH 2ZQ2A 1CU1A 2JETC 2ZWLH 5DP5A 5JBAS 2ZIQH 1QA7A 3A7TA 4ZUHA 2WPJS 2J95A 4WXIA 1C1NA 2R0LA 1GVKB 3FVFB 1WBGB 4XDEA 5C67A 1G37A 1GJ5H 1QBNA 5EOKA 3QZRA 4B75A 1GBDA 1LHDH 3G01A 1MKXK 2G00A 1YPGH 1TBZH 3E90B 3SJOA 1OP8A 1TFXA 2XTTB 1F0UA 5FX5A 1RD3B 2FX6A 2SGAA 1GHAG 1RRKA 2ZGXH 3GISB 1GBMA 1VJ9U 1LHEH 1AE5A 3RM2H 2J2UA 1HUTH 4GVUA 5GWZA 2BDBA 3E91A 5E2OA 2GMTB 2F9OA 3I78A 4ZKOU 2ZFFH 1ETRH 2A7JA 1CVWH 1Y5AT 4K1TA 2AGIX 2VJ1A 1W2KH 4TPIZ 4AOQA 1AFQB 2W26A 1QA0A 9LPRA 1J9CH 3PM3A 5FPSA 1HBTH 2Z9IA 1C2KA 4A7IB 4BXWA 3P6ZB 5EPNA 5JBBS 2DUCA 1A5IA 1F0SA 3Q76A 4XBBA 4Y7AA 5FCKA 1G36A 1A61H 1ANDA 2VWOA 1NRSH 1WU1A 1O3EA 1C5LH 4AB9A 3SU0A 4NA7A 3LJOA 4M7GA 1O3CA 1K1MA 5A8ZA 1UK4A 2YNAA 4DGJA 1OS8A 2H5CA 5DG6A 3GCTG 5T6GA 4E7NA 5JBCS 1KDQB 1A5HA 1TYNA 1DY9A 7KMEH 1GHBG 3TH4H 4OS6A 2PGQB 4Q2KA 5IYTA 1TNJA 4ABEA 2H2ZA 2ZTZA 2ZZUH 1GJDB 1QL7A 2GCTC 2FXRA 2KAIA 3S9CA 3SU1A 2ALVA 4K69A 5GPIB 1UTNA 1WSSH 2V3HH 1DWCH 3TK5A 2SGEE 1FIZA 1BB0B 2AMDA 3TH3H 3V3MA 1G3EA 2D26C 1GWAA 2CHAC 3ZZ3A 1V2LT 5F8TA 3T2NA 4K5ZA 1P03A 1SPJA 2ZU2A 5FHTA 2LPRA 2CF8H 2CXVA 2B0FA 2TGDA 4TY6A 2F9UA 2BOHB 1FY5A 1EJNA 1BMLA 4TY7A 2B9LA 1GMDG 4AB8A 3AW1A 1FY1A 1GDQA 3NXPA 4SGAE 1GJCB 1ZYOA 4FVDA 4MG3A 3SOSA 2VIOA 4MNYA 4X6OA 3LGIA 1S83A 1P2QA 4H6TA 1SGNE 3TITA 2P3UB 2XRCA 4Y79A 1HYLA 4NSYA 5J4SA 1AO5A 2FTLE 1SLWB 4IW4E 1BUIA 1RFNA 3QLPH 1Y5UT 1P0SH 3MHWU 2ANKH 4D9QA 1FZZA 1CGHA 1W11U 1HJAB 2Y82A 3UFAA 2H5DA 1FMGA 2ZECA 4CREA 4IC5A 1B5GH 3GY3A 5I25A 1K1NA 1C9PA 4D7FA 1VGCB 1FONA 1LHFH 1WCZA 3ZZ5A 3P8FA 3LGWA 3CP7A 1T4VH 4AGKA 3BTKE 3A7YA 1GJ9B 2WPMS 1C5YB 3AAVA 1QBOA 1E36B 1UTQA 3UREA 1GJ4H 3Q00A 1FY4A 3S7HB 2XNIA 1A46H 1P09A 1TIOA 1O33A 1H1BA 2PLXA 1Y3XA 3RMOH 2PFEA 3ATMA 4MNXA 1MZAA 3UOPA 4MLFB 1O2VA 3MO9A 2BDIA 3M37A 2OD3B 2RG3A 5JB9S 4LZ1H 4NA9H 2QN5T 3PMHB 4FUEA 1ESAA 2BY5X 5HYOA 4OGXA 1TPOA 4CR9A 2CHAB 1ZMLA 1YPHC 3RXIA 1GHAF 1SQOA 4ISOA 1TPPA 4I8LA 5DGJA 1WQVH 3TH2H 1EZXC 2ZA5A 5C1XA 5GXPA 2V6NA 4O9VA 1OWHA 1MD8A 2ZDMA 1FLEE 3PTBA 2A1DB 3PB1E 5HM2A 3BN9A 1MQ5A 2IOTA 2C8WB 1F7ZA 1QRXA 3RC6A 2SGQE 1IQGA 5EPYA 1NRNH 3ZV8A 2P3TB 1C5MD 1ZGIA 1P2KA 2PKAA 1P9SA 2BDGA 1HAYB 1EJMA 1ZTJA 3PMAB 6LPRA 3EGKH 1GI8B 2GD4B 2G4TA 1HNEE 5JDUB 1ZSLA 2Z3CA 1NS3A 1DVAH 1K28D 2Q6FA 3U1JB 5K0HA 4MPVA 1C1TA 1OP2A 3M5OA 2G52A 4UD9H 3KL6A 4IBLH 5DK1A 2WPLS 4NIXA 1JIRA 1T8OA 3ATWA 2ANWA 4CRBA 4F49A 3CS0A 1DS2E 1CSOE 2OC7A 4ABBA 1N6YA 3RXJA 3PROA 4ISLA 1YYY1 2FOEA 4MPXA 1TGTA 3ZZBA 1BBRH 2BHGA 1A7SA 2OQ5A 2CMYA 3BTQE 1DWEH 1CO7E 2BD7A 1VCWA 1MTWA 2ALPA 3LGUA 1C5ZB 3V0XA 2VH0A 2QV1A 2W3KA 1GMCF 2ZKSA 1BZXE 2FOAA 4JYTA 1A3EH 4O03A 1W10U 2WV4A 1BBRK 1S5SA 3BTWE 1CGJE 5TCCA 3E0PB 3FANA 3UQOA 5DP8A 1CA0C 1AFQC 1CT4E 1P2OA 2FEQH 1S0RA 4JMYA 1PQ7A 1TALA 3SN8A 2QY0B 1E38B 2OC0A 1Q2WA 2J94A 2ZCLP 3L6PA 2QXJA 6CHAC 2OTVA 2UWLA 4XOJA 1GMDF 3LH3A 3P92A 4MQAA 4B2AA 2ZFQH 3ELAH 4CRDA 1OP0A 1XMNB 1BTXA 3ODFA 4YOJA 1VR1H 1RTKA 5AFZH 1S84A 4ZXYH 2Z7FE 2BB4A 2SNVA 2WPHS 5E8EH 2ZDKA 2QIQA 4I31A 1X7AC 1QR3E 4IMQA 3QGNB 1A4WH 1MBQA 2XCNA 1IQLA 3GCNA 3RC5A 4HTCH 3TGKE 2GCHG 2FS8A 2G5NA 1V2ST 1O30A 4FUBA 4FUJA 3SV6A 3P95A 1AGJA 2ODPA 2ZDVH 1EAWA 1O2HA 4DY7B 5K7RA 4OGYA 2PTCE 1TAWA 3PLKA 2WV5A 3I29A 1Z8RA 1NU7B 4NIWA 4KGAA 1S6FA 1UTPA 4UONA 1EP5A 1HCGA 1ZPBA 3GYLB 4NZLA 4YO9A 2FDAA 1T8LA 3WY8A 1TA6A 5DP9A 1C5WB 1CQQA 2BY8X 1SQTA 3HGNA 3V13A 1O2LA 3LJJA 3GY4A 2TGAA 4NIVA 3UY9A 5B6OA 1IQEA 3PLBA 1ZSJA 2F9BH 4UEHH 1PQ5A 1O2JA 4X1PU 3M5MA 3MOCA 3M3SA 2SGPE 1TQ7B 1C2DA 3BEIB 1O2WA 4I33A 1TMTH 4CBNA 4ABIA 1Z8GA 3T26A 2WUBA 3SW2B 1MUEB 1P2NA 3ZVGA 2A7CA 3GYMA 4O97A 3RXQA 1SQAA 3TGJE 1V2WT 3QN7A 3BIVH 3TPIZ 4TWWA 1TGCA 1AQ7A 1GI2A 1AWFH 4OS7A 3SNAA 1QB9A 3MU5A 2KAIB 3A89A 3HATH 4YOIA 4BANB 1UVOA 5LPRA 4CRAA 1J15A 2BD8A 5EXLA 5FBIA 2AS9A 3MNCA 2GZ8A 1O2IA 1T4UH 1O0DH 5HM9A 1A0HB 2BOKA 3A8CA 4UFFH 4U2WA 2OCVB 4U01A 2RCEA 3ITIA 2AFQB 2AMQA 3TJUA
chains in the Genus database with same CATH superfamily
1NROH 1LQEA 2ESTE 2BMGB 2QA9E 1GJ8B 2GX4A 1O37A 3TLOA 2NWNA 2PKSB 3NKKA 3TGIE 1O5EH 3KIDU 4D9RA 3SI4H 4WVPE 1CGIE 1GMHF 4TSFD 1EPTB 1W13U 1VITF 1A5GH 2GMTC 5H4IB 2FLBH 1V3XA 2UUYA 1WV7H 4Y7BA 4GUXA 5L2YH 2AGGX 3A7WA 2FOMB 2OLGA 2Z94A 1N8OC 3VB5A 2FIRH 2ZGHA 2VINA 1V2QT 5I46H 3OEED 4AYVB 2VIQA 2IN2A 3LKWA 3PMJA 1EZUC 3QTOH 2ZGBH 3DFJA 3GOVB 3M36A 1ABIH 1OHHD 1SMFE 4JZFH 4TPYA 1UVTH 1AE8H 3P70B 1DX5M 1C5SA 1DWDH 2HWLB 1HJ9A 4VGCC 2BVRH 2HRVA 1SSXA 2J34A 1T31A 1F2SE 2KZ4A 2ASUB 3LT3A 5TJXA 2P94A 3SQEE 2BD3A 3PWCA 3E6PH 1P02A 1Z1JA 2VGCC 1TABE 1HAXB 1K2I1 1C5XB 4XE4A 1YPEH 1P12E 1WAYB 1CBWB 4ZKNU 1HB0B 2JJ2D 3KQDA 5JYIA 1W14U 1TNHA 1G3BA 1HAGE 1NO9H 3DA9B 4Q7ZA 1O3FA 2EC9H 1C1UH 5HXFA 1BTYA 1NBME 4ZROA 1GHVH 3T25A 3Q3XA 3EA9A 1ANBA 3V7TA 1TOCB 4F55A 1YWUA 5ESBA 1FPCH 1O3BA 3C27B 1LQDB 2JDID 3VGCB 5J4QA 4Z6AH 2EA3A 5C2ZA 1O3PB 2W6JD 2O8TA 5GIBA 3RXEA 1XVOA 1IOEA 2AYWA 1MKWK 1O3IA 3E1XB 3QX5H 1TBQH 1G3DA 1D3TB 2QGRA 3GDUA 3UWJH 5F6MA 4JZIA 4ASUD 4NZQA 1BT7A 3BTEE 1CA0B 5DP4A 1GJAB 2B5TB 4KTSA 2QF4A 1BRUP 3BTFE 3GICB 2QXHA 1KXEA 1QJ7B 3BG4B 4UFGH 4WF8A 1UVSH 3SU6A 2HPPH 3ZVDA 5GCHF 1DLKB 4A92A 4BAMB 4A6LA 3RU4D 4LOYH 1ZTLA 1C5OH 1YCPM 1GBHA 3BV9B 3SO3A 1N1LA 2HLDD 3RXCA 1EZSC 2DE9A 3RXGA 1HAOH 1QRWA 5A0CA 1G2MA 3SYJA 1C2GA 2Q6GA 3SUGA 5A8XA 2M5TA 1L4DA 4GAWA 3EA8A 1TMBH 3TK9A 1UCYH 2GV6A 1TRNA 2C8ZB 4DJZB 1TGSZ 4CHAC 1B0FA 1ELEE 1F0TA 2A2QH 3P8NA 3MU0A 1SLVB 1NT1A 4INHA 4YXWD 1QURH 2F9PA 1V2TT 2FX4A 4NFEA 2M2AA 2EI6A 4B74A 1ESBA 1MTSA 2TIOA 1L0ZA 2W5EA 2XBXA 1UTLM 2J4IA 2ZHFH 3HK3B 3OFND 1J16A 1DLEA 4I8GA 5BPEA 2J5UA 3BIUH 1C1QA 3F9FA 3Q3YA 2OBQA 1ID5H 1MCTA 2HLCA 2V7QD 1XUJA 1K21H 2ZDLA 2V3MA 2FWWA 2O8MA 1CBWC 1XUKA 2R0KA 2ZU1A 1BTPA 1FPHH 1MMJN 1O2NA 1LPGB 1DITH 3BF6H 1RGQA 1P2JA 1BRBE 1IAUA 1G9IE 1SGRE 1W3CA 4Y0ZE 4WMEA 1XKAC 4F4OC 1O5AB 4YT7H 3RMLH 2VVUA 1W7XH 2FYQA 2TRMA 1HLTH 1MCVA 3LH1A 5AVDA 1GMHG 1UK2A 4X0WU 1MU6B 3RMNH 2C4FH 1DFPA 3F6UH 1E35B 2ZP0H 2OUAA 1LVYA 2BLVA 4PROA 1EASA 3UTUH 1EKBB 4CH2B 4Q80A 1NRPH 2LP6A 1YPMH 3F0OA 3HPTB 1SKYE 1O3GA 2WYGA 1G32B 1NU9A 2AIQA 2RA3A 1GCDA 1UVUH 1EUFA 2FI4E 1GBEA 4A5TS 1BRCE 2SNWA 1SOZA 3STJA 4B73A 1V2JT 2Y6TA 4FOUC 2IJOB 5HMAA 2ZTXA 4ABDA 1HDTH 3LIWA 1Y59T 1AKSA 2FZZA 5PTPA 1BRAA 2NU2E 2FI5E 1TRMA 1SFQB 1TNGA 1GCTB 4AYYB 2WHXA 1KXFA 3L33A 3TNSA 3GS9A 3LPRA 2ANYA 3HKJB 2ZHDA 3URDA 2BVXH 4FUIA 2BLQA 1C5UA 1O2OA 3A83A 2C3SA 2EI7A 2CGAA 1COWD 2NU0E 1YGCH 2RDEA 3RXAA 2A4OA 4CRGA 5EQRA 2QF0A 3N7OA 5JPMH 4ABJA 3SV9A 1ZGVA 3QUMP 3TK6A 1TOMH 3U8OH 2AMPA 2OP9A 1W8BH 5AHGH 5C94A 2Z9LA 1C1VH 3NK8A 1BBRE 2BD9A 4JCNA 1HXFH 1GI3A 1BMNH 3A88A 4YM9A 1XKBC 3KN2A 2OXSA 4R0IA 5DJ7A 2VNTA 4SGBE 1HAZB 3DHKH 3UPEA 2G51A 2F9VA 5FAHA 1BQYA 1C2JA 1OYQA 4AN7A 3UUZA 4JZEH 2GVFA 3BTTE 5EW1H 3PWBA 3NZIA 3A87A 1JMOH 4OS1A 3SV7A 1FNIA 2ILNA 3MMGA 2ZFSA 3A7VA 1IQFA 4WXVA 5F8XA 5CMXH 1HAVA 1UTMA 3FKSD 2ZPQA 5C0TA 1LKAA 4FXGH 1C1WH 1TB6H 3CENA 2CN0H 1NFWA 2ZPRA 5A8YA 1H9LB 1S0QA 3EYDA 3ESTA 1UHBB 1S82A 3SUDA 1ZLRA 3WWFA 2ZHWH 1MAYA 1WQSA 2FO9A 2J97A 1HFDA 1QCPA 1PFXC 1FAKH 1DANH 1QTFA 4ZMAH 1UCYE 3ATKA 1KXAA 3TNTA 2BDYA 4YLQH 2WYJA 3N7EA 5LPEA 5T6FA 3SHCH 3E16B 1P11E 1CHOF 3TJNA 2BLWA 2J9NA 3OAAD 1MKXH 1YPLH 5DN6D 3ATLA 5L2ZH 1EX3A 2L74A 3RXPA 4CRFA 1THRH 1BTZA 1EOLA 3JZ1B 1ZHPA 2BX3A 1ELBA 2P16A 1PYTC 2D8WA 3RMMH 3RXDA 2GP9B 1MTVA 1CE5A 2A4RA 1SFIA 1H4WA 3UQVA 2GZ9A 1QQ4A 1NRRH 1T32A 2FS9A 4Y10E 5E0JA 1MKWH 3GCHB 1C4Y2 4HFPB 3VPKA 4MNWA 4YTAA 2TGTA 3QGJA 3RU4E 4J2YB 4MNVA 3MU8A 1YLCA 4WH8A 4X1NU 1YPJH 3U98H 1DOJA 1VGCC 1E34B 4ABFA 1AWHB 1S6HA 2VWNA 2P93A 2LNCA 3S9BA 1ZRBA 1WXRA 1HJAC 1AY6H 4K8YA 1QRZA 2BZ6H 2VU8E 1AZ8A 2AERH 7LPRA 1EZQA 1FN6A 4VGCB 3RU4T 5HIZA 2CJIA 4FU7A 1G30B 3F9EA 1TGBA 2Y81A 3U8RH 1RJXB 3SNBA 1SB1H 2QYIA 3VEQB 3K6ZA 3GDVA 3MNSA 3SZNA 3A8BA 1SL3A 4NCYA 4ISNA 3SJIA 4JZ1A 2KX4A 2J98A 5KECA 4YT6H 4RKJB 1O5CB 1NZQH 2C93B 2O8LA 1GDUA 1O2ZA 2F43B 4JK5A 4MPWA 3VB3A 1C1SA 1QY6A 4J1YA 5FPYA 4B2CA 1ZPZA 3UNQA 1WDIA 3LGTA 1GG6C 4K2YA 4Q63A 3RXUA 2HVXA 2A2XH 3UOUA 2HALA 3IITA 3SU2A 3FZDA 3GCHC 3BTME 2ZTYA 4MDSA 3MYWA 4H6SB 1D9IA 1ZOMA 4WWYA 5ESTE 4KP0A 2XBVA 2WPIS 4U30A 2PWXA 4AFUA 5EG4A 3PTNA 5A0BA 1VITH 3BTGE 1UMAH 2Y7XA 1BDAA 1EATA 3A7ZA 4K3JA 3MNBA 4BTIB 2P8OB 4KKDA 1RTLA 4Y11E 1A2CH 1O2GH 4NG9H 4X6PA 2R3YA 1GBIA 1AIXH 1BTUA 4DIHH 5L30H 1QJ6B 1W0KD 1P9UA 5FL7D 4NSVA 4UE7H 3MH6A 4LZ4B 3OX7U 4RI0A 2P95A 2XCFA 1QBVH 1SOTA 1MBMA 1QL8A 1INCA 3BTDE 3MI4A 1AN1E 5GCHG 2XBWA 1P2IA 1A3BH 3SV8A 1IHSH 1LPZB 1OWIA 1CA8B 1NTPA 3A8DA 1SGFG 4U32A 2BXUH 1TX7A 2VIVA 2XWAA 4Q4LA 4X2VA 3LDXH 3O8RA 2A31A 4X8TH 4AG1A 4B6EA 2QCYA 1GVZA 5C1YA 1XUGA 5AF9H 5EGMA 1ARBA 1O2QA 2JKHA 2FM2A 3GY2A 1FV9A 5KEDA 3KNXA 5IDKA 1O2YA 2VH6A 2A32A 1C4U2 5FXLA 2I6SA 1C5PA 2VIWA 2ZFRH 4ASHA 2HPQH 3RXTA 2YMSC 4ZHLU 1C2FA 4GSOA 5A09A 4FUHA 3SGQE 5LH8A 1F5KU 4CRCA 4CH8B 2XC4A 3SZEA 2OC8A 3F1SB 5DPAA 2WV9A 1KXCA 1V2UT 1QNJA 2G5VA 4ISHH 3B8JA 1UVPA 4BAOB 1L1GA 1LVBA 3BTHE 2C90B 1VJAU 1P2MA 1YC0A 1SVPA 1Y5BT 2CF9H 3IG6B 5A0AE 1QQUA 4LK4A 1HRTH 4NFFA 1B0EA 3FP7E 2R9PA 1NFUA 1QZ8A 5EQSA 2ULLA 4Y71A 1S85A 2GTBA 3UIRA 1TNKA 3OY5U 1V2KT 5JBTA 5JB8S 1W12U 4AFQA 1XUFA 4Z0KA 3PO1C 1W7GH 1HAHH 3QDZB 3KF2A 1V2OT 1TMUH 4B1TA 1HGTH 1HJ8A 4I8KA 4MTBA 1GBTA 3EE7A 2XXLA 3B23B 2A5AA 1H8HD 1O3MA 1C2EA 1GBFA 1PPGE 2Z9KA 3TU7H 4ABHA 1XUHA 4TWYA 2STAE 1YPKH 3TJVA 1L4ZA 1C2HA 4Q7XA 3P8GA 1Y3VA 1WYKA 3V12A 1HV7A 5LGOA 3W94A 4ZKSU 1JWTA 2PTNA 2THFB 3GDSA 1IHTH 1ELCA 3RDZA 4DT7B 4Y8YA 3S7KB 4RKOB 1UK3A 5FPTA 2Y5GA 1LO6A 1D3PB 2STBE 2ZG0H 1SQRA 1KTSB 2JETB 4XBCA 1WOFA 5FBEA 3JZ2B 2GDEH 2XOKD 3TJOA 3VXFH 1ZR0A 3OYPA 2BD4A 2ZF0H 2VB0A 2GV7A 3M3VA 1Q31A 2XNDD 3HGPA 1LVOA 1RTFB 3OEHD 1TNIA 1ZTKA 1EPTA 1SLUB 1O2RA 4X1RU 1TX6A 4AX9H 4X2WA 4YESB 1GVLA 1BCUH 8ESTE 5C0UA 4RN6A 4BXSA 3F9HA 2NU4E 2ZEBA 3M7UA 2BYAX 2G81E 3M7QA 1P3EA 1YCPH 1A0LA 4FU8A 1FX0B 1K1OA 3W1EA 4XBDA 1J14A 1KIGH 4BTTB 1ABJH 1OPHB 2TBSA 3O8DA 3RXSA 1LKBA 1GBBA 4E06H 2JH0D 3HKIB 1E1RD 1HAVB 1HIAA 1BIOA 2K1QA 1O32A 3BSQA 4ZHMU 1BHXB 1THSH 2EEKA 2BDAA 1IQNA 1NRQH 1KLTA 1GJBB 1PPCE 5HGGA 1CHOG 2AEIH 1W0YH 5FX6A 1TLDA 1C5NH 3A86A 3RXKA 1K1PA 1O2XA 4I32A 3ZZ9A 1K1JA 1SGFA 2H9TH 1GBKA 1K1LA 1EJAA 3SGBE 2V0BA 2BQ7B 1TA2A 1Z1IA 1VCQA 1YP9A 1F0RA 4GLYA 3L3TA 2FODA 2TGPZ 3S69A 2A45B 2HNTC 4ABAA 1Z71A 3T28A 4K1SA 3T62A 1C1OA 1UTOA 2UWPA 1C1RA 1LCYA 1AVGH 1C2IA 4X1SU 1DT2A 2Q1JA 1O3DA 1C2LA 2NU1E 3B9FH 2ZDAH 3VGCC 5E0GA 1F5RA 1ZJDA 1P06A 4I8JA 1G2LA 1DUEA 2OBOA 1ELFA 2VVCA 3H7TA 1DUAA 2QAAA 5C1UA 5LPFA 1GHWH 3U69H 2EI8A 4WMDA 4D7GA 4WJG2 3BG8A 2BY9X 2QXGA 1TPAE 3SQHE 2BY6X 4NGAH 8KME2 4THNH 1EAXA 1NY22 5AFYH 1BJVA 4QT8C 2C8YB 2D2DA 3AK5A 2YMSD 3EQ0H 1RXPA 2YMSB 5SGAE 1BA8B 1XM1A 3ZZAA 2BM2A 4A1XA 4IN2A 1FXYA 2WINI 5BRRE 5ABWA 3O8BA 4I8HA 2BY7X 4DOQA 3MQKC 4E7RG 6GCHG 6CHAB 1GI4A 1ZJKA 3SU3A 2ZCKP 3PLPA 1ELDE 2D1JA 3VFEA 1V2MT 4BAQB 2B7DH 4XSKU 3PRDA 1V6DA 1C5QA 3GY6A 5L6NH 2FP7B 3MU4A 2C8XB 3RXRA 1GGDC 1O2UA 1PQ8A 4ABGA 1YLDA 6ESTA 2AIPA 3RXHA 1O34A 1P57B 3EA7A 3D49H 3KQEA 1ETTH 1ZMJA 2R2WU 1SG8B 3MH7A 5EXNA 1DXPA 3K6YA 3UB0A 1GHYH 1TRYA 3DSPA 1GI1A 2A0QB 2K0QA 1OWJA 1Z7KA 3CS7A 4KTUA 1PPZA 2ZU4A 3TIUA 1DDJA 3LGYA 1OKXA 2JJ1D 1GBCA 3T5FH 2FI3E 5EJZA 1GBLA 1QHRB 1L1NA 3QK1A 4FUGA 3ZVFA 1OXGA 3QO6A 3DSOA 4K60A 2QC2A 2ZU5A 1C5VA 1O3JA 1Z6JH 4X8SH 1Y3YA 4YZUA 2PSXA 1EAIA 3ZV9A 3MH4A 2Z3EA 1S81A 1HAIH 1RIWC 3FAOA 4DCDA 1ELGA 4IMZA 1O3AA 2KCOA 5EU8A 1SR5C 4Y8XA 2WPDD 1AU8A 3F2HA 3M35A 1GI6A 1C1PA 5CHAB 4AG2A 1DPOA 1V2VT 4ISIH 1SGIB 3M7TA 1VZQH 3Q77A 2VWMA 4GHQA 4K8BA 2JH5D 3ZYDA 4OM9A 3VG8A 4Y6DA 4HI3A 3SORA 1GG6B 4ZCNA 2BXTH 3P8OA 2XYAA 2HOBA 1QIXB 1SLXB 1MTNC 1C5TA 5DP7A 5C3NA 2W7UA 1JRSA 3A85A 1GMCG 3PV4A 5GNDA 1BMFD 1DICA 8LPRA 1GJ7B 2Y80A 3SJKA 1FI8A 3D23A 2PR3A 3UNSA 8GCHF 1DM4B 4M9FA 1O3NA 4ZHAA 1Z6EA 2RDLA 3URCA 2K8IA 2F9NA 2FPZA 2FTMA 1UTJA 4OS2A 5HKKD 2BDCA 5T6DA 3ZZ6A 2R2MB 4GCHF 1RS0A 4ZXXH 2NU3E 3F68H 3D62A 5C5OA 1VITG 1D6WA 1O3LA 1EB1H 3RC4A 4BAHB 2VIDA 4ESTE 1TBRH 3SI3H 3EDXB 1CT2E 2GGVB 3STIA 3ZZ4A 1O2KA 1AUTC 5C5NA 3M3TA 1O36A 3EAJA 4O3TA 1TWXB 3RXFA 2OK5A 4AFZA 1GCTC 1EOJA 1AFEH 2GT8A 2CV3A 2PV9B 4IN1A 1ELTA 2VGCB 4BOHA 1SGTA 1IQIA 1SHHB 1ZZZA 3D65E 5A2MH 3C1KA 3U9AH 1ZSKA 1WUNH 1ESTA 2PW8H 3N99A 3SNCA 3SU5A 4DG4A 3ZVEA 3KCGH 4RSPA 3H09A 2BLOA 1J17T 3FP6E 4FUFA 3RXOA 3T29A 1L1JA 2DE8A 5DP6A 2QF3A 3U8TH 5GDSH 4B76A 2B8OH 3DD2H 4MPUA 1NFYA 1ZPCA 1F5LA 1H9HE 4Y76A 2A5IA 4FU9A 3ZYEA 1SHYA 3UR6A 5C20A 1BMAA 3A7XA 2H1UA 3RUOA 1JIMA 1GI0A 3OTJE 6GCHF 1KXBA 2GZ7A 4BNRA 1O39A 1FUJA 1W0ZU 2QF5A 3Q3KA 3NWUA 2F4LA 4Q7YA 4AZ2B 1TPSA 2ZHEH 3M61U 1IQHA 1U6QA 4FUCA 1BOQA 1KXDA 3QZQA 3GCOA 1OSSA 1SBWA 1FAXA 2UWOA 1PPEE 3RXMA 1FDPA 1MH0A 2XC0A 4OS5A 4Z1MD 2IPHA 1PYTD 1HAPH 2SFAA 4A1TA 1ZHRA 1QB1A 4FVBA 2Y7ZA 1MD7A 2GCTB 3ZZDA 1KLJH 4H4FA 1ZHMA 2UUFB 1K22H 1ORFA 3FOAA 3T27A 1AUJA 1GL1A 2PHBA 3F2FA 4CHAB 1YY3A 3DFLA 3VXEH 3W95A 3ZZ8A 5EW2H 2W3IA 4MVNA 3DUXH 1UCYK 1AB9C 2PUQH 2P3FH 2OQUA 1KDQA 4UFDH 3DSGA 1HXEH 3OSYA 3MNXA 1LTOA 4HGCA 1CT0E 2H9HA 1EP6A 1SGYE 4I86A 4FUDA 4NIYA 2J92A 2XC5A 4AFSA 4JK6A 1YCPK 4HZHA 5E2PA 2J98B 1D4PB 3GY7A 3A84A 1YF4A 5B6LA 3LC5A 4GPGA 1SGQE 1P8VC 1O5BB 1XXFA 2J38A 2V3OH 3I77A 4TYDA 2SGDE 1WTHD 3SHAH 1F92A 3ZVCA 1LHCH 3N7DA 2Q6DA 2OINA 4X2XA 1H8IH 1LMWB 1FJSA 1Z8JB 4UDWH 2HVYB 2GKVE 4UFEH 2FOHA 4LXBH 1LVMA 3RXVA 2OC1A 3ZVAA 2VIPA 2WPKS 3AAUA 1EAUA 1GI5A 1UTKA 2FOCA 3A81A 5F03A 2H6MA 2FMJA 4ZAEA 3AW0A 1T8NA 5TCAA 4HG6A 4O3UA 4ZKRU 9ESTA 7ESTE 2AHME 1ANEA 1GI9B 2UUKB 4KTCA 1O5GH 3ENSB 2ODYB 1TNLA 1O3KA 3RXLA 1ZRKA 1LDTT 2O9QA 1NC6A 3FP8E 2ZO3H 1DXWA 1AB9B 2JH6D 2O8UA 3PO1B 2PGBB 4AC9A 3ATIA 3BEFB 4DVAU 5CHAC 1H8DH 1KY9A 3KQCA 1JXPA 1A1RA 4IGDA 1E37B 2HNTF 3GY8A 3MO6A 2WUCA 1O2SA 1YM0A 3H5CB 4H42U 1J8AA 3SJ9A 5C17A 1PJPA 4RT1A 3EE0B 4IC6A 1OX1A 1KYNA 1W0JD 2XWBI 5DP3A 1JBUH 3FZZA 1XVMA 1NN6A 1GBJA 1OWKA 4WMFA 1HPGA 2H9EH 5F8ZA 2SGFE 3UR9A 1KTTB 3RLYH 4B71A 2AH4X 1AI8H 1UJ1A 2AGEX 3GCTF 4GHTA 1C5RA 3LGVA 5EODA 1UHBA 1GHBF 4JYUH 1IQKA 3MU1A 1SGDE 1QGFA 4D76A 1Y3WA 3K65B 3H7OA 3ZVBA 1D3DB 3KHVA 2BZAA 3IWMA 1AVWA 2ZHQH 3R3GB 1DY8A 3MO3A 3SNEA 4NA8A 1C9TA 1V2NT 3KEEA 4A1VA 1C2MA 3SUEA 4XFQA 1SI5H 1C4V2 1DE7H 2Z6BD 3QWCH 1O2TA 1Z8IB 5EJLA 3RP2A 1SGEE 3A82A 1K9OE 3F9GA 1G3CA 1PQAA 3SGAE 4D8NA 3NCLA 3UWIA 4TT3D 3M5LA 1BTHH 2P59A 4NWKA 1O2PA 1E79D 1TE0A 2ANMH 3MTYA 3SJ8A 3RM0H 7GCHF 2F3CE 1P05A 2ODQA 3E0NB 1XX9A 1XUIA 2BX4A 2Y5FA 4X8UH 4DW2U 1Y8TA 2ZQ1A 2FESH 4XD7D 1MAXA 1Y3UA 1GHZA 1YKTA 2PKSC 3LONA 4X1QU 5CE1A 3S9AA 1O31A 2A5KA 2YOLA 1E0FD 4INLA 2F91A 3VB7A 1YPHE 1ZMNA 1PPHE 1EB2A 4ZH8A 1OWEA 1OYTH 1AZZA 2G55A 1BHXF 3RXBA 1LPKB 2Z3DA 3BEUA 2PKAB 1ACBE 3GY5A 3M5NA 1P10A 2XBYA 3A8AA 3K2UA 2ZDNA 4BTUB 1N8OB 1C1MA 2G4UA 1IQMA 3S0NA 2A4QA 2L6OA 1WTGH 1PPBH 5E0HA 4AORA 4X8VH 1GDNA 1DWBH 1VCPA 4B6FA 1Q3XA 2FYRA 4Y0YE 2O8WA 1TQ0B 1NM6A 1P04A 5GJ4B 5HIYA 1VKYA 8GCHG 5EQQA 2KFWA 2EQNA 2GJGA 1JOUB 1FIWA 2ZNKH 1AHTH 1JRTA 1OOKB 3VB6A 2GCHF 4GCHG 4FETA 1GI7B 3AASA 4E05H 2BQWB 1OWDA 2PUXB 3ZZCA 1O3HA 3HK6B 4JYVH 1V2RT 4INKA 1HIAB 1QJ1B 1SGPE 3ODDA 5FCRA 2PSYA 3LU9B 1TX8A 4B2BA 1O2MA 1THPB 2RA0A 4X6NA 1GL0E 1UO6A 1QL9A 3A80A 3E3TA 2QXIA 3R0FA 4NWLA 5IK2D 2VVVA 3NPSA 1S6LA 1KLIH 4AGJA 1GHXH 1AVXA 3NUMA 1ETSH 1RIWB 5G4BA 5DKMA 2R3UA 1MQ6A 1NBMD 4X2YA 3QTVH 1H9IE 2W7SA 3KGPA 1EPTC 2ZU3A 1XXDA 1SC8U 2FOGA 1P01A 3SUFA 1NFXA 4OS4A 3P17H 5EXMA 1L2EA 2BVSH 2FLRH 2ZGCA 2ZI2H 1NESE 3LC3A 1NPMA 1MTUA 3RLWH 3DT0H 4KELA 2BD2A 1AMHA 1QB6A 2Y5HA 2ZC9H 2ZGJA 1D3QB 3SNDA 2KM0A 2BQ6B 1MU8B 2FOBA 4P00A 3MWIU 1LHGH 1GBAA 4R8TB 2F83A 5ETXA 3OU0A 4CBOA 1GGDB 2P8OC 2V35A 1D6RA 1DSTA 1O38A 3SV2H 1O3OA 1V2PT 2VWLA 3PYHA 4DIIH 1AD8H 3SU4A 1M9UA 5DO4H 1TONA 4WH6A 1DSUA 2Z9JA 3MH5A 3PMBB 3TVJB 4DURA 2GT7A 2UUJB 1FY8E 2HGTH 5T3HA 1GJ6A 1BJUA 1N6XA 4I7YH 1BITA 1AKSB 1QFKH 2BDHA 2ZPSA 2ZCHP 5CHBA 2GDDA 2TPIZ 3SBKA 2XW9A 1KSNA 1CHGA 2BD5A 3FFGA 1ARCA 3K9XB 1PPFE 3E8LA 4WY3A 1YBWA 1P3CA 4K1EA 1BTWA 1GPZA 2FOFA 1O5FH 2A7HA 1O5DH 2G8TA 3VB4A 2I6QA 3U28C 1FN8A 2YNBA 1MZDA 1TGNA 1B7XB 4YOGA 2BTCE 2A4GA 4X6MA 1EXFA 3BG4C 4CR5A 1T8MA 3O8CA 1SGCA 1BMMH 2EY4C 5DSFA 1ANCA 1ELAA 3LOXA 4YLUA 1IQJA 1ELVA 4JZDH 3OY6U 1FY3A 1MTNB 3U1IB 1EQ9A 3KQBA 2HNTE 7GCHG 4BAKB 1K1IA 3ZZ7A 5EJ1A 1FQ3A 4IS5A 1O35A 3AVZA 1T7CA 2ZFTA 2Z9GA 1A0JA 4Y8ZA 3UNRA 4ACAA 3MFJA 2ZFPH 2ZQ2A 1CU1A 2JETC 2ZWLH 5DP5A 5JBAS 2ZIQH 1QA7A 3A7TA 4ZUHA 2WPJS 2J95A 4WXIA 1C1NA 2R0LA 1GVKB 3FVFB 1WBGB 4XDEA 5C67A 1G37A 1GJ5H 1QBNA 5EOKA 3QZRA 4B75A 5KGOA 1GBDA 1LHDH 3G01A 1MKXK 2G00A 1YPGH 1TBZH 3E90B 3SJOA 1OP8A 1TFXA 2XTTB 1F0UA 5FX5A 3OE7D 1RD3B 2FX6A 2SGAA 1GHAG 1RRKA 2ZGXH 3GISB 1GBMA 2LELA 1VJ9U 1LHEH 3F3BA 1AE5A 3RM2H 2J2UA 1HUTH 4GVUA 5GWZA 2BDBA 3E91A 2PP6A 5E2OA 2GMTB 2F9OA 3I78A 4ZKOU 2ZFFH 1ETRH 2A7JA 1CVWH 1Y5AT 4K1TA 5F53A 2AGIX 2VJ1A 1W2KH 4TPIZ 4AOQA 1AFQB 2W26A 1QA0A 9LPRA 1J9CH 3PM3A 5FPSA 1HBTH 2IPQX 2Z9IA 1C2KA 4A7IB 4BXWA 3P6ZB 5EPNA 5JBBS 2DUCA 1A5IA 1F0SA 3Q76A 4XBBA 1MABB 4Y7AA 5FCKA 1G36A 1A61H 1ANDA 2VWOA 1NRSH 1WU1A 1O3EA 1C5LH 4AB9A 3SU0A 4NA7A 3LJOA 4M7GA 1O3CA 1K1MA 5A8ZA 1UK4A 2YNAA 4DGJA 3PV5A 1OS8A 2H5CA 5DG6A 3GCTG 5T6GA 4E7NA 5JBCS 1KDQB 1A5HA 1TYNA 1DY9A 7KMEH 1GHBG 3TH4H 4OS6A 2PGQB 4Q2KA 5IYTA 1TNJA 4ABEA 2H2ZA 2ZTZA 2ZZUH 1GJDB 1QL7A 2GCTC 2FXRA 2KAIA 3S9CA 3SU1A 2ALVA 4K69A 5GPIB 1UTNA 1WSSH 2V3HH 1DWCH 3TK5A 2RFKC 2SGEE 1FIZA 1BB0B 2AMDA 3TH3H 3V3MA 1G3EA 5T1VA 2D26C 1GWAA 2CHAC 3ZZ3A 1V2LT 5F8TA 3T2NA 4K5ZA 1P03A 1SPJA 2ZU2A 5FHTA 2LPRA 2CF8H 2CXVA 2B0FA 2TGDA 4TY6A 2F9UA 2BOHB 1FY5A 1EJNA 1BMLA 4TY7A 2B9LA 1GMDG 4AB8A 3AW1A 1FY1A 1GDQA 3NXPA 4SGAE 1GJCB 1ZYOA 4FVDA 3PV2A 4MG3A 3SOSA 2VIOA 4MNYA 4X6OA 3LGIA 1S83A 1P2QA 3DCLA 4H6TA 1SGNE 3TITA 2P3UB 2XRCA 4Y79A 1HYLA 4NSYA 5J4SA 1AO5A 2FTLE 1SLWB 4IW4E 1BUIA 1RFNA 3QLPH 2CK3D 1Y5UT 1P0SH 3MHWU 2ANKH 4XRNA 4D9QA 1FZZA 1CGHA 1H8ED 1W11U 1HJAB 1KMHB 2Y82A 3UFAA 2H5DA 1FMGA 2ZECA 4CREA 3FO8D 4IC5A 1B5GH 3GY3A 5I25A 1K1NA 1C9PA 3CNRA 1VGCB 4D7FA 1FONA 1LHFH 1E1QD 1WCZA 3ZZ5A 4P02A 3P8FA 3LGWA 3CP7A 1T4VH 4AGKA 3BTKE 3A7YA 1GJ9B 2WPMS 1C5YB 3AAVA 1QBOA 1E36B 1UTQA 3UREA 1GJ4H 3Q00A 1FY4A 3S7HB 2XNIA 1A46H 1YLNA 1P09A 1TIOA 1O33A 1H1BA 2PLXA 1Y3XA 3RMOH 2PFEA 3ATMA 4MNXA 1MZAA 3UOPA 4MLFB 1O2VA 3MO9A 2BDIA 3KQ5A 3M37A 2OD3B 2RG3A 5JB9S 4LZ1H 4NA9H 2QN5T 3PMHB 4FUEA 1ESAA 2BY5X 5HYOA 4OGXA 1TPOA 3WWBA 2CHAB 4CR9A 1ZMLA 1YPHC 3RXIA 1GHAF 1SQOA 4ISOA 1TPPA 4I8LA 5DGJA 1WQVH 3TH2H 1EZXC 2ZA5A 5C1XA 5GXPA 1K0HA 2V6NA 4O9VA 1OWHA 1MD8A 2ZDMA 1FLEE 3PTBA 2A1DB 3PB1E 5HM2A 3BN9A 1MQ5A 2IOTA 2C8WB 1F7ZA 1EFRD 1QRXA 3RC6A 2SGQE 1IQGA 5EPYA 1NRNH 3ZV8A 2P3TB 1C5MD 2IJD1 1ZGIA 1P2KA 2PKAA 1P9SA 2BDGA 1HAYB 1EJMA 1ZTJA 3PMAB 6LPRA 3F2GA 5EIYA 3EGKH 1GI8B 2GD4B 3KYFA 3OTPA 2G4TA 1HNEE 5JDUB 1ZSLA 2Z3CA 1NS3A 1DVAH 1K28D 2Q6FA 4F48B 3U1JB 2WSSD 5K0HA 4MPVA 1C1TA 1OP2A 3M5OA 2G52A 4UD9H 3KL6A 4IBLH 4RT0A 5DK1A 2WPLS 4NIXA 1JIRA 1T8OA 3ATWA 2ANWA 4CRBA 4F49A 3CS0A 1DS2E 1CSOE 2OC7A 4ABBA 1N6YA 3RXJA 2WZQA 3PROA 4ISLA 1YYY1 2FOEA 4MPXA 1TGTA 3ZZBA 1BBRH 2BHGA 1A7SA 2OQ5A 2CMYA 3BTQE 1DWEH 1CO7E 2BD7A 1VCWA 1MTWA 2ALPA 3LGUA 1C5ZB 3V0XA 2VH0A 2QV1A 2W3KA 1GMCF 2ZKSA 1BZXE 2FOAA 4JYTA 1A3EH 4O03A 1W10U 2WV4A 1BBRK 1S5SA 3BTWE 1CGJE 5TCCA 3E0PB 3FANA 3UQOA 5DP8A 1CA0C 1AFQC 1CT4E 1P2OA 2FEQH 1S0RA 4JMYA 1PQ7A 1TALA 3SN8A 2QY0B 1E38B 2OC0A 1Q2WA 2J94A 2ZCLP 3L6PA 2QXJA 3UAIC 6CHAC 2OTVA 2UWLA 4XOJA 1GMDF 3LH3A 3P92A 4MQAA 4B2AA 2ZFQH 3ELAH 4CRDA 1OP0A 1XMNB 1BTXA 3ODFA 4YOJA 1VR1H 1RTKA 5AFZH 1S84A 4ZXYH 2Z7FE 3NRLA 2BB4A 2SNVA 2WPHS 5E8EH 2ZDKA 2QIQA 4I31A 1X7AC 4DT4A 2KR7A 1QR3E 4IMQA 3QGNB 1A4WH 1MBQA 1IQLA 2XCNA 2KCPA 3GCNA 3RC5A 4HTCH 3TGKE 2GCHG 2FS8A 2G5NA 1V2ST 1O30A 4FUBA 3WW7A 4FUJA 3SV6A 3P95A 1AGJA 2ODPA 2ZDVH 1EAWA 1O2HA 4DY7B 5K7RA 4OGYA 2PTCE 2VBCA 1TAWA 3PLKA 2WV5A 3I29A 1Z8RA 1NU7B 4NIWA 4KGAA 1S6FA 1UTPA 4UONA 1EP5A 1HCGA 1ZPBA 3GYLB 4NZLA 4YO9A 2FDAA 1T8LA 3WY8A 1TA6A 5DP9A 1C5WB 1CQQA 2QE7D 2BY8X 1SQTA 3HGNA 3V13A 1O2LA 3LJJA 5CDFE 3GY4A 3PRBA 2TGAA 4NIVA 3UY9A 5B6OA 1IQEA 3PLBA 1ZSJA 2F9BH 4UEHH 1PQ5A 1O2JA 3FN8A 4X1PU 2W6ID 3M5MA 3MOCA 3M3SA 2SGPE 1TQ7B 1C2DA 3BEIB 1O2WA 4I33A 1TMTH 4CBNA 4ABIA 2KCAA 1Z8GA 3T26A 2WUBA 3SW2B 1MUEB 1P2NA 3ZVGA 3ZIAD 2A7CA 3GYMA 2JIZD 4O97A 3RXQA 1SQAA 3TGJE 1V2WT 3QN7A 3BIVH 3TPIZ 4TWWA 3F0PA 1TGCA 1AQ7A 1GI2A 1AWFH 4OS7A 3SNAA 1QB9A 3MU5A 2KAIB 3A89A 3HATH 4YOIA 4BANB 1UVOA 1UW7A 5LPRA 2KCYA 4CRAA 1J15A 2BD8A 5EXLA 5FBIA 2AS9A 3MNCA 2GZ8A 1O2IA 1T4UH 1O0DH 3KYGA 4ACBA 5HM9A 1A0HB 2BOKA 3A8CA 4UFFH 4U2WA 2OCVB 4U01A 2RCEA 3ITIA 2AFQB 2AMQA 3TJUA
chains in the Genus database with same CATH topology
1NROH 1LQEA 2ESTE 2BMGB 2QA9E 1GJ8B 2GX4A 1O37A 3TLOA 2NWNA 2PKSB 3NKKA 3TGIE 1O5EH 3KIDU 4D9RA 3SI4H 4WVPE 1CGIE 1GMHF 1EPTB 1W13U 1VITF 1A5GH 2GMTC 5H4IB 2FLBH 1V3XA 2UUYA 1WV7H 4Y7BA 4GUXA 5L2YH 2AGGX 3A7WA 2FOMB 2OLGA 2Z94A 1N8OC 3VB5A 2FIRH 2ZGHA 2VINA 1V2QT 5I46H 4AYVB 2VIQA 2IN2A 3LKWA 3PMJA 1EZUC 3QTOH 2ZGBH 3DFJA 3GOVB 3M36A 1ABIH 1SMFE 4JZFH 4TPYA 1UVTH 1AE8H 3P70B 1DX5M 1C5SA 1DWDH 2HWLB 1HJ9A 4VGCC 2BVRH 2HRVA 1SSXA 2J34A 1T31A 1F2SE 2ASUB 3LT3A 5TJXA 2P94A 3SQEE 2BD3A 3PWCA 3E6PH 1P02A 1Z1JA 2VGCC 1TABE 1HAXB 1K2I1 1C5XB 4XE4A 1YPEH 1P12E 1WAYB 1CBWB 4ZKNU 1HB0B 3KQDA 5JYIA 1W14U 1TNHA 1G3BA 1HAGE 1NO9H 3DA9B 4Q7ZA 1O3FA 2EC9H 1C1UH 5HXFA 1BTYA 4ZROA 1GHVH 3T25A 3Q3XA 3EA9A 1ANBA 3V7TA 1TOCB 5ESBA 1FPCH 1O3BA 3C27B 1LQDB 3VGCB 5J4QA 4Z6AH 2EA3A 5C2ZA 1O3PB 2O8TA 5GIBA 3RXEA 1XVOA 1IOEA 2AYWA 1MKWK 1O3IA 3E1XB 3QX5H 1TBQH 1G3DA 1D3TB 2QGRA 3GDUA 3UWJH 5F6MA 4JZIA 4NZQA 1BT7A 3BTEE 1CA0B 5DP4A 1GJAB 2B5TB 4KTSA 1BRUP 3BTFE 3GICB 2QXHA 1KXEA 1QJ7B 3BG4B 4UFGH 4WF8A 1UVSH 3SU6A 2HPPH 3ZVDA 5GCHF 1DLKB 4A92A 4BAMB 4A6LA 3RU4D 4LOYH 1ZTLA 1C5OH 1YCPM 1GBHA 3BV9B 3SO3A 1N1LA 3RXCA 1EZSC 2DE9A 3RXGA 1HAOH 1QRWA 5A0CA 1G2MA 1C2GA 2Q6GA 3SUGA 5A8XA 2M5TA 1L4DA 4GAWA 3EA8A 1TMBH 3TK9A 1UCYH 2GV6A 1TRNA 2C8ZB 4DJZB 1TGSZ 4CHAC 1B0FA 1ELEE 1F0TA 2A2QH 3P8NA 3MU0A 1SLVB 1NT1A 4INHA 1QURH 2F9PA 1V2TT 2FX4A 4NFEA 2EI6A 4B74A 1ESBA 1MTSA 2TIOA 2XBXA 1L0ZA 2W5EA 1UTLM 2J4IA 2ZHFH 3HK3B 4I8GA 1J16A 1DLEA 5BPEA 3BIUH 1C1QA 3F9FA 3Q3YA 2OBQA 1ID5H 1MCTA 2HLCA 1XUJA 1K21H 2ZDLA 2FWWA 2O8MA 1CBWC 1XUKA 2R0KA 2ZU1A 1BTPA 1FPHH 1MMJN 1O2NA 1LPGB 1DITH 3BF6H 1RGQA 1P2JA 1BRBE 1IAUA 1G9IE 1SGRE 1W3CA 4Y0ZE 4WMEA 1XKAC 4F4OC 1O5AB 4YT7H 3RMLH 2VVUA 1W7XH 2FYQA 2TRMA 1HLTH 1MCVA 3LH1A 5AVDA 1GMHG 1UK2A 4X0WU 1MU6B 3RMNH 2C4FH 1DFPA 3F6UH 1E35B 2ZP0H 2OUAA 1LVYA 2BLVA 4PROA 1EASA 3UTUH 1EKBB 4CH2B 4Q80A 1NRPH 1YPMH 3HPTB 1O3GA 2WYGA 1G32B 1NU9A 2AIQA 2RA3A 1GCDA 1UVUH 1EUFA 2FI4E 1GBEA 4A5TS 1BRCE 2SNWA 1SOZA 3STJA 4B73A 1V2JT 2Y6TA 5HMAA 2IJOB 2ZTXA 4ABDA 1HDTH 3LIWA 1Y59T 1AKSA 2FZZA 5PTPA 1BRAA 2NU2E 2FI5E 1TRMA 1SFQB 1TNGA 1GCTB 4AYYB 1KXFA 3L33A 3TNSA 3LPRA 2ANYA 3HKJB 2ZHDA 3URDA 2BVXH 4FUIA 2BLQA 1C5UA 1O2OA 3A83A 2C3SA 2EI7A 2CGAA 2NU0E 1YGCH 3RXAA 2A4OA 4CRGA 5EQRA 2QF0A 3N7OA 5JPMH 4ABJA 3SV9A 1ZGVA 3QUMP 3TK6A 1TOMH 3U8OH 2AMPA 2OP9A 1W8BH 5AHGH 2Z9LA 1C1VH 3NK8A 1BBRE 2BD9A 4JCNA 1HXFH 1GI3A 1BMNH 3A88A 4YM9A 1XKBC 3KN2A 2OXSA 4R0IA 5DJ7A 2VNTA 4SGBE 1HAZB 3DHKH 3UPEA 2G51A 2F9VA 5FAHA 1BQYA 1C2JA 1OYQA 4AN7A 3UUZA 4JZEH 2GVFA 3BTTE 5EW1H 3PWBA 3NZIA 3A87A 1JMOH 4OS1A 3SV7A 1FNIA 2ILNA 3MMGA 2ZFSA 3A7VA 1IQFA 4WXVA 5F8XA 5CMXH 1HAVA 1UTMA 2ZPQA 1LKAA 4FXGH 1C1WH 1TB6H 3CENA 2CN0H 1NFWA 2ZPRA 5A8YA 1H9LB 1S0QA 3EYDA 3ESTA 1UHBB 1S82A 3SUDA 1ZLRA 2ZHWH 1MAYA 1WQSA 2FO9A 1HFDA 1QCPA 1PFXC 1FAKH 1DANH 1QTFA 4ZMAH 1UCYE 3ATKA 1KXAA 3TNTA 2BDYA 4YLQH 2WYJA 5LPEA 5T6FA 3SHCH 3E16B 1P11E 1CHOF 3TJNA 2BLWA 2J9NA 1MKXH 1YPLH 3ATLA 5L2ZH 1EX3A 3RXPA 4CRFA 1THRH 1BTZA 1EOLA 3JZ1B 1ZHPA 2BX3A 1ELBA 2P16A 1PYTC 2D8WA 3RMMH 3RXDA 2GP9B 1MTVA 1CE5A 2A4RA 1SFIA 1H4WA 3UQVA 2GZ9A 1QQ4A 1NRRH 1T32A 2FS9A 4Y10E 5E0JA 1MKWH 3GCHB 1C4Y2 4HFPB 3VPKA 4MNWA 4YTAA 2TGTA 3QGJA 3RU4E 4J2YB 4MNVA 3MU8A 1YLCA 4WH8A 4X1NU 1YPJH 3U98H 1DOJA 1VGCC 1E34B 4ABFA 1AWHB 1S6HA 2VWNA 2P93A 2LNCA 3S9BA 1ZRBA 1HJAC 1AY6H 4K8YA 1QRZA 2BZ6H 2VU8E 1AZ8A 2AERH 7LPRA 1EZQA 1FN6A 4VGCB 3RU4T 2CJIA 4FU7A 1G30B 3F9EA 1TGBA 2Y81A 3U8RH 1RJXB 3SNBA 1SB1H 2QYIA 3VEQB 3K6ZA 3GDVA 3MNSA 3SZNA 3A8BA 1SL3A 4NCYA 4ISNA 3SJIA 4JZ1A 4YT6H 4RKJB 1O5CB 1NZQH 2C93B 2O8LA 1GDUA 1O2ZA 4JK5A 4MPWA 3VB3A 1C1SA 1QY6A 4J1YA 5FPYA 4B2CA 1ZPZA 3UNQA 3LGTA 1GG6C 4K2YA 3RXUA 2HVXA 2A2XH 3UOUA 2HALA 3IITA 3SU2A 3FZDA 3GCHC 3BTME 2ZTYA 4MDSA 3MYWA 4H6SB 1D9IA 1ZOMA 4WWYA 5ESTE 4KP0A 2XBVA 2WPIS 4U30A 2PWXA 4AFUA 5EG4A 3PTNA 5A0BA 1VITH 3BTGE 1UMAH 2Y7XA 1BDAA 1EATA 3A7ZA 4K3JA 3MNBA 4BTIB 2P8OB 4KKDA 1RTLA 4Y11E 1A2CH 1O2GH 4NG9H 4X6PA 2R3YA 1GBIA 1AIXH 1BTUA 4DIHH 5L30H 1QJ6B 1P9UA 4NSVA 4UE7H 3MH6A 4LZ4B 3OX7U 2P95A 2XCFA 1QBVH 1SOTA 1MBMA 1QL8A 1INCA 3BTDE 3MI4A 1AN1E 5GCHG 2XBWA 1P2IA 1A3BH 3SV8A 1IHSH 1LPZB 1OWIA 1CA8B 1NTPA 3A8DA 1SGFG 4U32A 2BXUH 1TX7A 2VIVA 2XWAA 4X2VA 3LDXH 3O8RA 2A31A 4X8TH 4AG1A 2QCYA 1GVZA 5C1YA 1XUGA 5AF9H 5EGMA 1ARBA 1O2QA 2JKHA 2FM2A 3GY2A 1FV9A 3KNXA 5IDKA 1O2YA 2VH6A 2A32A 1C4U2 5FXLA 2I6SA 1C5PA 2VIWA 2ZFRH 4ASHA 2HPQH 3RXTA 4ZHLU 1C2FA 4GSOA 5A09A 4FUHA 3SGQE 5LH8A 1F5KU 4CRCA 4CH8B 2XC4A 2OC8A 3F1SB 5DPAA 1KXCA 1V2UT 1QNJA 2G5VA 4ISHH 3B8JA 1UVPA 4BAOB 1L1GA 1LVBA 3BTHE 2C90B 1VJAU 1P2MA 1YC0A 1SVPA 1Y5BT 2CF9H 3IG6B 5A0AE 1QQUA 4LK4A 1HRTH 4NFFA 1B0EA 3FP7E 2R9PA 1NFUA 5EQSA 2ULLA 4Y71A 1S85A 2GTBA 3UIRA 1TNKA 3OY5U 1V2KT 5JBTA 5JB8S 1W12U 4AFQA 1XUFA 4Z0KA 3PO1C 1W7GH 1HAHH 3QDZB 3KF2A 1V2OT 1TMUH 4B1TA 1HGTH 1HJ8A 4I8KA 4MTBA 1GBTA 2XXLA 3B23B 2A5AA 1O3MA 1C2EA 1GBFA 1PPGE 2Z9KA 3TU7H 4ABHA 1XUHA 4TWYA 2STAE 1YPKH 3TJVA 1L4ZA 1C2HA 4Q7XA 3P8GA 1Y3VA 1WYKA 3V12A 1HV7A 5LGOA 3W94A 4ZKSU 1JWTA 2PTNA 2THFB 3GDSA 1IHTH 1ELCA 3RDZA 4DT7B 4Y8YA 3S7KB 4RKOB 1UK3A 5FPTA 2Y5GA 1LO6A 1D3PB 2STBE 2ZG0H 1KTSB 2JETB 4XBCA 1WOFA 5FBEA 3JZ2B 2GDEH 3TJOA 3VXFH 1ZR0A 3OYPA 2BD4A 2ZF0H 2VB0A 2GV7A 3M3VA 1Q31A 3HGPA 1LVOA 1RTFB 1TNIA 1ZTKA 1EPTA 1SLUB 1O2RA 4X1RU 1TX6A 4AX9H 4X2WA 4YESB 1GVLA 1BCUH 8ESTE 4RN6A 4BXSA 3F9HA 2NU4E 2ZEBA 3M7UA 2BYAX 2G81E 3M7QA 1P3EA 1YCPH 1A0LA 4FU8A 1K1OA 4XBDA 1J14A 1KIGH 4BTTB 1ABJH 1OPHB 2TBSA 3O8DA 3RXSA 1LKBA 1GBBA 4E06H 2JH0D 3HKIB 1HAVB 1HIAA 1BIOA 2K1QA 1O32A 3BSQA 4ZHMU 1BHXB 1THSH 2EEKA 2BDAA 1IQNA 1NRQH 1KLTA 1GJBB 1PPCE 5HGGA 1CHOG 2AEIH 1W0YH 5FX6A 1TLDA 1C5NH 3A86A 3RXKA 1K1PA 1O2XA 4I32A 3ZZ9A 1K1JA 1SGFA 2H9TH 1GBKA 1K1LA 1EJAA 3SGBE 2V0BA 2BQ7B 1TA2A 1Z1IA 1VCQA 1YP9A 1F0RA 4GLYA 3L3TA 2FODA 2TGPZ 3S69A 2A45B 2HNTC 4ABAA 1Z71A 3T28A 4K1SA 3T62A 1C1OA 1UTOA 2UWPA 1C1RA 1LCYA 1AVGH 1C2IA 4X1SU 1DT2A 2Q1JA 1O3DA 1C2LA 2NU1E 3B9FH 2ZDAH 3VGCC 5E0GA 1F5RA 1ZJDA 1P06A 4I8JA 1G2LA 1DUEA 2OBOA 1ELFA 2VVCA 3H7TA 1DUAA 2QAAA 5C1UA 5LPFA 1GHWH 3U69H 2EI8A 4WMDA 4D7GA 4WJG2 3BG8A 2BY9X 2QXGA 1TPAE 3SQHE 2BY6X 4NGAH 8KME2 4THNH 1EAXA 1NY22 5AFYH 1BJVA 4QT8C 2C8YB 2D2DA 3EQ0H 1RXPA 5SGAE 1BA8B 1XM1A 3ZZAA 2BM2A 4A1XA 4IN2A 1FXYA 2WINI 5BRRE 5ABWA 3O8BA 4I8HA 2BY7X 4DOQA 4E7RG 6GCHG 6CHAB 1GI4A 1ZJKA 3SU3A 2ZCKP 3PLPA 1ELDE 2D1JA 3VFEA 1V2MT 4BAQB 2B7DH 4XSKU 1V6DA 1C5QA 3GY6A 5L6NH 2FP7B 3MU4A 2C8XB 3RXRA 1GGDC 1O2UA 1PQ8A 4ABGA 1YLDA 6ESTA 2AIPA 3RXHA 1O34A 1P57B 3EA7A 3D49H 3KQEA 1ETTH 1ZMJA 2R2WU 1SG8B 3MH7A 5EXNA 1DXPA 3K6YA 1GHYH 1TRYA 1GI1A 2A0QB 4KTUA 1OWJA 1Z7KA 3CS7A 1PPZA 2ZU4A 3TIUA 1DDJA 3LGYA 1OKXA 1GBCA 3T5FH 2FI3E 1GBLA 1QHRB 1L1NA 3QK1A 4FUGA 3ZVFA 1OXGA 3QO6A 4K60A 2QC2A 2ZU5A 1C5VA 1O3JA 1Z6JH 4X8SH 1Y3YA 4YZUA 2PSXA 1EAIA 3ZV9A 3MH4A 2Z3EA 1S81A 1HAIH 1RIWC 3FAOA 4DCDA 1ELGA 4IMZA 1O3AA 5EU8A 1SR5C 4Y8XA 1AU8A 3M35A 1GI6A 1C1PA 5CHAB 4AG2A 1DPOA 1V2VT 4ISIH 1SGIB 3M7TA 1VZQH 3Q77A 2VWMA 4GHQA 4K8BA 2JH5D 3ZYDA 4Y6DA 4HI3A 3SORA 1GG6B 2BXTH 3P8OA 2XYAA 2HOBA 1QIXB 1SLXB 1MTNC 1C5TA 5DP7A 5C3NA 2W7UA 1JRSA 3A85A 1GMCG 3PV4A 1DICA 8LPRA 1GJ7B 2Y80A 3SJKA 1FI8A 3D23A 2PR3A 3UNSA 8GCHF 1DM4B 4ZHAA 1O3NA 1Z6EA 2RDLA 3URCA 2F9NA 2FPZA 2FTMA 1UTJA 4OS2A 2BDCA 5T6DA 3ZZ6A 2R2MB 4GCHF 1RS0A 4ZXXH 2NU3E 3F68H 3D62A 5C5OA 1VITG 1D6WA 1O3LA 1EB1H 3RC4A 4BAHB 2VIDA 4ESTE 1TBRH 3SI3H 3EDXB 1CT2E 2GGVB 3STIA 3ZZ4A 1O2KA 1AUTC 5C5NA 3M3TA 1O36A 3EAJA 4O3TA 1TWXB 3RXFA 4AFZA 1GCTC 1EOJA 1AFEH 2GT8A 2CV3A 2PV9B 4IN1A 1ELTA 2VGCB 4BOHA 1SGTA 1IQIA 1SHHB 1ZZZA 3D65E 5A2MH 3C1KA 3U9AH 1ZSKA 1WUNH 1ESTA 2PW8H 3SNCA 3SU5A 4DG4A 3ZVEA 3KCGH 4RSPA 2BLOA 1J17T 3FP6E 4FUFA 3RXOA 3T29A 1L1JA 2DE8A 5DP6A 2QF3A 3U8TH 5GDSH 4B76A 2B8OH 3DD2H 4MPUA 1NFYA 1ZPCA 1F5LA 1H9HE 4Y76A 2A5IA 4FU9A 3ZYEA 1SHYA 3UR6A 5C20A 1BMAA 3A7XA 2H1UA 3RUOA 1JIMA 1GI