3FZZA

Structure of grc
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
227
structure length
227
Chain Sequence
IIGGNEISPHSRPYMAYYEFLKVGGKKMFCGGFLVRDKFVLTAAHCKGRSMTVTLGAHNIKAKEETQQIIPVAKAIPHPDYNPDDRSNDIMLLKLVRNAKRTRAVRPLNLPRRNAHVKPGDECYVAGWGKVTPDGEFPKTLHEVKLTVQKDQVCESQFQSSYNRANEICVGDSKIKGASFEEDSGGPLVCKRAAAGIVSYGQTDGSAPQVFTRVLSFVSWIKKTMKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Granzyme C
publication title Structure of granzyme C reveals an unusual mechanism of protease autoinhibition
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 49
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3fzzA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3fzzA02
3SU1A 4Y6DA 1O3EA 1BRCE 1SLUB 4ASHA 1EB2A 1K1OA 3ZZDA 3QZRA 4X2WA 1P2NA 1Z8JB 1ZOMA 3QLPH 3B8JA 2W5EA 3E16B 1P2KA 1O2UA 4YOIA 2IPHA 3TH3H 1SLWB 5SGAE 3K9XB 5F8XA 1O2ZA 1P3EA 1TNIA 1MQ5A 4Y8YA 2VJ1A 1V2VT 3SW2B 1Y3XA 2O8TA 3E1XB 4BAKB 1W13U 5JBBS 1GMHG 1SMFE 3S7KB 2G4UA 3RXOA 1EP6A 3BTKE 2AEIH 2GMTB 1GBKA 1KLTA 2FI5E 2YNBA 5EQQA 5T6DA 2I6SA 3KL6A 1RIWB 5A09A 2BOHB 4DW2U 1HRTH 1QCPA 1QL9A 1PQ5A 1FY5A 1K1IA 3AW0A 3TGIE 1QBOA 1FPCH 1GBEA 2OC1A 4X1RU 2GV7A 2STAE 2FXRA 1O5AB 1C5ZB 1Z1IA 1Y8TA 1P57B 2ZQ1A 1UTJA 3NWUA 1VCPA 1SGFG 4FVBA 3LJOA 1BT7A 1T4VH 3PO1C 4MNXA 1J15A 1MKXH 2ZO3H 2J9NA 1GL0E 1MTWA 2R3UA 2V3HH 1UTNA 1YPHC 1MMJN 2J4IA 3KEEA 2FOFA 2K1QA 1DICA 1MTNC 3S0NA 1OWHA 1TMTH 4NZLA 1TPPA 4U2WA 4ISHH 5FHTA 1L1JA 3LGUA 1CBWB 2GCTC 2EA3A 5E0JA 1G3CA 3A8DA 2FLBH 1TGNA 1AUJA 3F9GA 1BTXA 3U9AH 1V2QT 3QDZB 1UVTH 2THFB 4GHQA 4Y71A 1PPCE 1UTMA 1WTHD 1D6WA 2OLGA 4ISLA 3VB7A 1Z8GA 1KXBA 2O9QA 1EOLA 2O8WA 3RXFA 1FUJA 1GBCA 2P3TB 4NWLA 1ANEA 1XUJA 2Z6BD 1C5LH 1LHEH 3LH3A 3SV7A 5ESBA 2QF0A 2PTCE 2H2ZA 3A88A 1F0UA 1T4UH 3MWIU 1G30B 2TGAA 1Y3UA 5DJ7A 1ORFA 4UFEH 2GTBA 5E8EH 1YBWA 1K1JA 4WXIA 3SHAH 1PJPA 1FN6A 1MKWK 1ZYOA 3MU8A 3CS0A 4KGAA 1QBVH 1HDTH 1W7XH 1MTUA 1SFIA 1OSSA 1BHXB 4ISOA 2ODYB 1GJ6A 3RXGA 2F9NA 1FXYA 1PQ8A 1P2JA 5C67A 1UTQA 2AERH 1AQ7A 4Y79A 2EI6A 1DY8A 3RLWH 2W3IA 5H4IB 3DT0H 3SNEA 1AWHB 2PLXA 3B23B 4IN2A 4AFQA 1MU8B 2BQ7B 3A87A 4BTUB 1V2LT 2A2XH 5C3NA 3VGCB 1OWKA 2W26A 1BTHH 4AG1A 4U30A 1GI3A 1DANH 4MNVA 5F8ZA 2FS8A 3VEQB 1IQNA 4FUCA 2Z9LA 4OGYA 1CU1A 2FOEA 2G52A 1C2KA 1WTGH 3PO1B 3RXHA 5GIBA 4AYVB 1KTSB 2BOKA 3QO6A 4Q80A 5C1YA 5DP9A 2BD8A 3RUOA 3BTME 2TBSA 2F83A 3AASA 3V7TA 3HGPA 1C2HA 4Q7YA 1BIOA 1ZGIA 1C4V2 4I8JA 4AGJA 1O3AA 5GXPA 1MD7A 2ANKH 3KNXA 2NU4E 4RSPA 4XDEA 1BRBE 4TPYA 2QAAA 1QB6A 5HXFA 3MNXA 1W0YH 3UNSA 4O97A 2PSXA 1FAXA 2PHBA 7GCHF 1BHXF 4DJZB 2G00A 3HK6B 1NFWA 1H1BA 1TB6H 1XVOA 2BB4A 3FANA 3T27A 1S6HA 2VH6A 2Z3DA 3R3GB 4LZ1H 1FIZA 5GCHG 4DURA 1GG6C 4FUEA 1A2CH 3QTOH 4O3UA 3ZVDA 2HALA 3UFAA 1MUEB 1XVMA 4FUFA 4CBNA 3UUZA 3M5MA 1BUIA 5EG4A 3SGAE 2RCEA 3PLKA 3NCLA 1LTOA 2Q6GA 4Y0ZE 2HPQH 1DWDH 1AFQC 4ZKRU 1C2IA 3ITIA 1NROH 3RXEA 4MG3A 5TJXA 2PR3A 1A3EH 2BM2A 1NRRH 2F9UA 2PW8H 2TGDA 1TE0A 2R2WU 2Z7FE 1ZPZA 4B71A 2BDAA 2AGEX 1FAKH 4UE7H 1ELFA 1GGDC 1ZHMA 3GICB 3PROA 4IN1A 2HWLB 1E0FD 3A89A 2Y81A 2WPHS 2C8YB 4HTCH 1HAOH 2WUBA 3S9CA 3M7TA 4D8NA 5IDKA 3ZZ5A 4YLQH 1FJSA 1P03A 1QL8A 5A2MH 3QN7A 4WMDA 1LVOA 3K2UA 1T8LA 3SJKA 3TJUA 1A5IA 1KDQA 1UHBA 3AAVA 3PLPA 1QGFA 1WCZA 1SGTA 3K6YA 3MO6A 1B5GH 1WQVH 2C8WB 1AUTC 4WH6A 2Y5FA 3I78A 4IMZA 2UWLA 1FDPA 3RXCA 1TPOA 1ZTKA 1EP5A 1P8VC 1H8DH 2Z9IA 1G3DA 1O5FH 3E6PH 3GY6A 3ZVGA 2ZFTA 1LKAA 2XC0A 4HFPB 1S5SA 1BMMH 4KKDA 1YCPK 5E2OA 1O2PA 1BOQA 2WPMS 2XXLA 1ANDA 1SGEE 4OGXA 1W3CA 2FZZA 3GDVA 4X8TH 5HMAA 2R0LA 2SGPE 1GJ5H 1GI0A 2TPIZ 1Y3VA 4WH8A 1HAVB 1S0RA 1OWJA 1C5UA 1Y3YA 1EPTA 2ZDNA 3BTQE 4B2AA 3MO9A 4I8KA 1BBRH 3RM0H 3A7YA 1F5KU 3F9EA 1UCYE 3SUGA 1OWIA 1OKXA 4NA9H 5A8YA 1WSSH 1DFPA 2BDIA 4GUXA 1GGDB 3VFEA 2FP7B 3SUDA 3VB3A 1O2TA 1ABIH 2A2QH 4YO9A 5F03A 1VITH 2ZGCA 3IWMA 3SZNA 1Y59T 1O3MA 1L2EA 3BIVH 7KMEH 5DP6A 4DVAU 2OP9A 3MYWA 4K1EA 3RMNH 1RFNA 2VWOA 1DWEH 1UHBB 1MQ6A 2PUQH 2WYGA 4X2YA 4BTIB 1RXPA 2Z3EA 1SHYA 4J2YB 2XBVA 5I46H 4IBLH 2AIPA 5A0CA 1EZXC 1O2IA 1O32A 2H1UA 3OX7U 2NWNA 1C2EA 2BDBA 1A46H 1ARBA 1O3HA 2AGIX 5EPYA 5EODA 3KN2A 1GCDA 2A4GA 2WYJA 1TOCB 1CVWH 1B0EA 1P02A 3A81A 3RXPA 2FI3E 1AGJA 3RMMH 1SGYE 3LH1A 4X8UH 3VXEH 3V12A 4E06H 2Y7ZA 1EZQA 4DY7B 2G5VA 3QGNB 8GCHG 4HI3A 1G9IE 1T31A 3E8LA 4FUIA 1MKXK 3ATWA 1TBZH 1QB1A 1LPGB 1JIRA 2G8TA 3A80A 1FONA 4LK4A 4FU7A 1HJAC 1AB9C 4D76A 1XXFA 5TCCA 3O8BA 3H7OA 3JZ1B 1XXDA 2PTNA 2QC2A 1WYKA 2ASUB 4Y8ZA 1AD8H 3ZZAA 4LOYH 5FX6A 4ZKNU 3M3TA 3SGBE 3M7UA 1O2YA 5L30H 4HZHA 3RMOH 6CHAC 2FS9A 3SV2H 3E0NB 3ATMA 2M5TA 5DP3A 1EJMA 1O2KA 3SU3A 5LH8A 3HPTB 3GISB 4X6NA 3SI3H 4K60A 3A7WA 3ZYEA 2OCVB 3U8OH 1ELGA 1GBAA 1ELTA 5CE1A 1E37B 1ZR0A 4XSKU 2NU0E 5EQRA 2AS9A 1JIMA 2Z9GA 1P3CA 3T28A 4JZ1A 3P8NA 1C1UH 1OPHB 1VR1H 3ZZ7A 1O2RA 3LIWA 2QXHA 5L6NH 4BAMB 3M3VA 2QCYA 2XBYA 3RXSA 2GZ9A 4NIVA 3T62A 1SLVB 1C1TA 1GI7B 2GDDA 1THPB 5GCHF 1ANCA 1C1MA 5A0AE 3LKWA 4ABBA 4H6TA 1FMGA 2SFAA 3BTGE 1UTPA 1HAZB 1G3EA 3DFLA 2BVXH 1TNKA 1C2GA 3VB6A 3BTHE 5T6FA 2B8OH 2V35A 1YKTA 3ZVFA 3UIRA 3QWCH 2ANYA 1HJ8A 5K7RA 2C3SA 3A7ZA 1HAGE 1O37A 1O5GH 2J92A 1AB9B 1SHHB 2JH0D 4FU9A 1PQAA 1GJ8B 2ODPA 2XCFA 3BG8A 5A0BA 1P0SH 1V2RT 3RC4A 4X1SU 2ZPRA 2ILNA 2LPRA 1S0QA 3GY2A 3FZDA 3GDUA 3A8AA 5E0HA 2Y5GA 2IJOB 4YZUA 1SL3A 2G5NA 1GHWH 2ALPA 5EW1H 1ESAA 1TYNA 4X2VA 1E36B 2GD4B 2ZHFH 3EA9A 1OYTH 1CQQA 1TWXB 2OBQA 1HLTH 1O3LA 3ZZ9A 2H6MA 4XFQA 3RXLA 1CHGA 1SGIB 1C9TA 1ZTJA 5JB9S 1ANBA 1LMWB 1P06A 1JXPA 1NN6A 3BEUA 3SJ9A 1CHOG 3LONA 1QR3E 1XUIA 1SVPA 1KSNA 3O8RA 2UWOA 1DDJA 2GMTC 3ZVAA 1ESTA 1IQGA 3EQ0H 3RU4E 5DGJA 3HGNA 5C1XA 1HPGA 1O3KA 1P9UA 4YOGA 4CRFA 1CA8B 1CSOE 2ZPSA 3SOSA 3UTUH 3MNCA 1SSXA 3TK9A 4KTUA 2TIOA 4KP0A 5C5OA 4F4OC 1QQUA 1C2DA 4TY7A 5JB8S 2ZP0H 1UVSH 1IQMA 3EYDA 3QK1A 4AGKA 1YF4A 1VCWA 4AX9H 2ZHQH 2C8ZB 3W94A 1FV9A 1ZRKA 3UR9A 4DOQA 3UNQA 3BTEE 1V3XA 4JYTA 4OS4A 5FBEA 1JOUB 2AFQB 2WPLS 1HGTH 1CT2E 2F91A 1DOJA 1O3NA 4M7GA 3GCTG 4DG4A 7ESTE 4TWWA 1TGSZ 2B5TB 1BTPA 3LOXA 1Z1JA 1G3BA 1OP0A 2BVRH 2JH6D 3O8DA 5A8ZA 1UJ1A 4ISNA 1E34B 2QY0B 1GJ9B 1GHZA 3MNSA 1LPZB 3GCOA 3SUEA 5JBAS 3RXJA 2GZ8A 2SGFE 2A4RA 3RP2A 1GBHA 1CA0C 3SU4A 1BCUH 4Z6AH 1O5DH 1QL7A 3NUMA 2VWNA 3VXFH 1AVWA 1IQJA 1FQ3A 3QGJA 3UOUA 2OTVA 1D3DB 1QIXB 2F9PA 1F0SA 2XW9A 2V0BA 4JYUH 1YGCH 3D65E 4I7YH 8KME2 1GI6A 1SFQB 3RU4D 4NG9H 5DKMA 5L2YH 2VGCB 1ABJH 4AZ2B 1O3BA 2QXJA 2ZU2A 3M37A 2GT7A 4THNH 1DPOA 1BBRK 8GCHF 3ZZ4A 1PPHE 1ZJDA 4YTAA 3VGCC 3PB1E 1BZXE 1P2MA 3M5NA 2FODA 3MHWU 5C5NA 3MU1A 4Q7ZA 3DA9B 2D8WA 1A4WH 1S84A 3SNDA 2G55A 2IOTA 3ZZBA 4B74A 3ODDA 1C1VH 2FESH 2ZG0H 4Y10E 1EZSC 1O2OA 2RDLA 2OBOA 3SU2A 3L33A 5T3HA 1YC0A 1DITH 1DS2E 2G4TA 2ANWA 1QJ1B 4X1NU 1SR5C 3GCHC 2ZGBH 1WQSA 1C1WH 2KAIB 4X1QU 1C2MA 3HKIB 5C2ZA 2ZFSA 4H4FA 3LT3A 1EASA 4ABJA 1ARCA 1PQ7A 1ELCA 1LKBA 1DLKB 5GJ4B 4B2CA 5FPYA 2J95A 4JK5A 3BTWE 2HRVA 1TFXA 4GVUA 3K65B 2A0QB 2A7JA 2C93B 4YOJA 2VWMA 3V13A 1TGCA 1WV7H 4ZROA 2A7CA 5TCAA 1VZQH 1CA0B 2ZCKP 4F49A 2UUYA 1DXWA 2RG3A 1GJDB 2STBE 2OQ5A 2FMJA 1HXFH 2PFEA 1W11U 4RN6A 2EI8A 2R0KA 1C4U2 3KQDA 1GI4A 1D4PB 1O2NA 2GX4A 3MI4A 1GHAG 1OS8A 1QA0A 5J4SA 1SGNE 1AZ8A 4MPXA 4K8YA 1KXFA 1O3DA 3MH4A 4DCDA 1EAUA 3ATKA 4GAWA 1NC6A 1BBRE 2A4QA 2XBWA 4IW4E 2AIQA 2F3CE 2P3FH 1O35A 3E0PB 3S7HB 3URCA 3TK5A 1O5EH 1VITG 3Q3KA 1C4Y2 1O3FA 3SO3A 3LPRA 1P01A 4B75A 1F92A 3MH7A 1GJ4H 5AVDA 1F5LA 1MAYA 1C1OA 1LCYA 2FOAA 3GCHB 1IQEA 3D23A 1H9HE 4ZHAA 3SQEE 3RDZA 2PKSC 3RXRA 1AI8H 4ZMAH 2GV6A 5E2PA 1GDUA 2XC4A 1HBTH 1IQKA 2ZC9H 1UTOA 1Z8IB 2ZDMA 3PMHB 1L1NA 3A84A 2WV5A 3MH5A 3SNCA 1BRUP 1CHOF 1QFKH 4O9VA 1QNJA 1SI5H 3NKKA 4ZAEA 1NRNH 4MNYA 3W95A 1F5RA 3BF6H 1BTUA 2Z94A 2PWXA 2SGAA 2BLOA 5GDSH 3RXMA 1C5OH 4ZHLU 2P95A 2AYWA 2OC7A 4E7NA 3P70B 2WV4A 3AAUA 1FIWA 4INKA 4Y0YE 4FVDA 1DVAH 4AFUA 2BDYA 3L6PA 3ZZ8A 2ZFPH 1G2MA 1C5PA 5EPNA 1ACBE 1BRAA 2J34A 3F1SB 3A8CA 4RKJB 1TX8A 1OOKB 1LDTT 1AY6H 1B0FA 3UQOA 1O3GA 1Y5AT 1BDAA 1P2IA 1E38B 3F68H 1LQEA 1FY1A 4ABGA 1Y5UT 1ZSLA 1FLEE 3U69H 3F6UH 1O38A 3EAJA 1O34A 3EGKH 3P95A 1P12E 1V2KT 4XE4A 1X7AC 3KF2A 3GDSA 4NIWA 3GY8A 2JH5D 1C5QA 2VIWA 3GCTF 3MU0A 2ZDAH 2HVXA 1GVLA 3K6ZA 1A61H 2V6NA 2EI7A 3PWCA 1F2SE 3F9HA 4O03A 2GGVB 4I32A 1O2VA 3KHVA 1TLDA 5A8XA 2VU8E 3KCGH 1IQLA 2AMDA 2PKSB 4XBBA 5EXMA 1TRYA 1C2JA 2A32A 3E91A 4MLFB 4NSVA 4UFDH 1YPMH 2ZU3A 2VIOA 1SC8U 1ID5H 1SBWA 1MU6B 1MCTA 3HK3B 2HGTH 1O3CA 4ABAA 2C4FH 3TNTA 4YT6H 1HNEE 1AVXA 2QA9E 1FY4A 1C5XB 1UK3A 1L0ZA 3M35A 1O2HA 1LHFH 2ZDVH 4D7GA 2PKAA 3SN8A 3SNAA 4A1VA 4OS1A 3H5CB 3JZ2B 1OWEA 1P05A 1ZLRA 4HGCA 1ELDE 1EPTC 3FVFB 4WJG2 3TJNA 3PMJA 4ISIH 2XWAA 4CR5A 1IHSH 1NRQH 2O8MA 1RJXB 1Z6JH 1F7ZA 1C1QA 1O30A 1IQIA 2HLCA 4K1TA 4PROA 2EC9H 4JZIA 3L3TA 3P8OA 1H4WA 1OWDA 1G36A 4KTSA 2BX3A 2BY6X 4WY3A 3U1IB 1AIXH 1AKSA 4CBOA 2Q6DA 2HPPH 1RGQA 1NU9A 1CGJE 1KDQB 2ZIQH 1SQOA 3PMBB 5FPSA 4B1TA 2GT8A 1FN8A 1XMNB 2W7UA 5C20A 1TNGA 4BNRA 3ZYDA 2VVUA 2Q1JA 3GYMA 3T26A 1C1RA 2FLRH 1TPAE 5AHGH 2ZI2H 1KXDA 2XBXA 3LC5A 2BX4A 3URDA 3ZVBA 1FZZA 1Y5BT 2NU3E 5AF9H 2A45B 1G32B 3C27B 6GCHF 1RTLA 4CR9A 4YLUA 4RKOB 2QXGA 1SPJA 2Z9KA 1ZJKA 1O0DH 2J2UA 1FY3A 1RS0A 2ZDKA 1LHCH 1XUKA 1TQ0B 5ETXA 1Z8RA 4YT7H 1GHAF 5LPRA 1THRH 1HJ9A 1C5VA 3UR6A 1G37A 2BD3A 1BMAA 4X6OA 2BLVA 3KQBA 1J17T 1N1LA 1J16A 2QGRA 1J14A 1VGCC 2ZCLP 1EPTB 1C2LA 2W3KA 2JETB 3VB4A 1EB1H 2FIRH 1N8OC 1NTPA 1VITF 3BG4C 2F9BH 4CH2B 3VPKA 1MCVA 1RTKA 4BANB 1LHDH 3EE0B 3M61U 1DSUA 1H8IH 2FPZA 2SGEE 1MBMA 2Z9JA 3ZVEA 1DM4B 1ZRBA 7LPRA 3Q00A 2P3UB 5B6OA 1HIAA 2QYIA 2B9LA 4UFFH 1UTLM 2A5KA 1SQAA 5IYTA 1LVBA 1ELEE 1IHTH 1WUNH 1HUTH 1RRKA 2CN0H 4GHTA 1GJCB 2FEQH 2BYAX 1EUFA 1GI8B 2OD3B 1GBMA 2ZPQA 2BY5X 5JYIA 2SGDE 2EEKA 5AFZH 1S6FA 2J94A 1SB1H 4JK6A 4X1PU 3SJ8A 1H9IE 1NZQH 3TJOA 1UK4A 3DUXH 1JRSA 3U8TH 3LGIA 1O3IA 4FUJA 1TABE 2BY8X 4I33A 1D3TB 2ZNKH 2A5IA 2DUCA 2ZGXH 3RMLH 1SQTA 1MBQA 1T7CA 4AB8A 1O3OA 4AOQA 4OS2A 3ESTA 1TIOA 1T8NA 3D62A 2WPIS 2FX4A 1DUAA 1ZTLA 3TLOA 1P2OA 4MPVA 4X2XA 2UUFB 3BTFE 4NGAH 1YM0A 4AORA 3MFJA 1L4DA 1KXEA 3Q3XA 5CMXH 1GDQA 1OXGA 4BAQB 1VGCB 1C9PA 2OC8A 2FYQA 3LGWA 3PM3A 5EQSA 2GKVE 5HYOA 1BJVA 5LPEA 4TWYA 3IITA 3EA8A 1N8OB 3BG4B 4A6LA 1J8AA 1A5GH 1ELVA 1O2GH 1Q2WA 2ZU1A 3PWBA 3RXTA 2BXUH 2PSYA 2ESTE 1OX1A 1HCGA 3SGQE 2C90B 2WUCA 3OTJE 3NPSA 1UCYH 4A92A 1V6DA 1D3PB 1ZZZA 4IC6A 2UUKB 4Z0KA 4OS6A 2BLWA 3T25A 1O2SA 3BIUH 4UD9H 1CGHA 5E0GA 1IQFA 1C5TA 5HM9A 1S83A 1V2ST 1Y3WA 5T6GA 1AZZA 3DFJA 3LDXH 1K1NA 2I6QA 3MU5A 4NZQA 3RXBA 2A7HA 2D1JA 1BTYA 1TGTA 2NU1E 2HNTF 9LPRA 2FOCA 1MZDA 2GDEH 3FP7E 2VGCC 3EDXB 2BDGA 2OQUA 3D49H 2H9TH 1MAXA 3PTBA 1O2QA 1QJ7B 5DK1A 2AMQA 2G51A 2TGPZ 4SGAE 5DG6A 1ETSH 1HXEH 4MPUA 1P9SA 3BTDE 1V2UT 3FFGA 3M7QA 2VNTA 4AFZA 1TOMH 1UVOA 3ELAH 1P04A 4ABDA 4BAOB 1HYLA 1GDNA 3UWIA 1QB9A 3RXQA 1SGDE 3PLBA 2VIVA 4GLYA 4A5TS 2A4OA 1ZHRA 3M5OA 4ZXYH 4NFFA 3BEIB 1T8MA 1AVGH 5EOKA 4K8BA 4MDSA 1O3JA 3ZV8A 1TX6A 1ETTH 2A31A 2VIQA 1C2FA 3RU4T 1XUGA 2WPJS 2Z3CA 3I77A 4A1XA 5DP8A 2BQWB 3IG6B 1GBDA 3TGKE 4ABEA 1K28D 1NPMA 1W10U 4R0IA 4WVPE 1LQDB 3SQHE 3LGVA 3ATIA 1TA6A 3BV9B 3FP8E 1C5SA 1KTTB 1IQHA 2J38A 3KQEA 4BTTB 2ZGHA 4BXSA 1XUFA 1ELAA 3SJOA 2C8XB 4JYVH 1BA8B 1A7SA 1GCTC 3A7TA 1GI9B 1IOEA 1LPKB 1HAYB 1ZSJA 4A7IB 2ZF0H 1TRMA 2GCHG 4CRAA 1YPKH 1C5YB 1M9UA 3TGJE 2QF3A 5FXLA 3U1JB 1L1GA 1T32A 3TNSA 2B7DH 3T2NA 4NWKA 3UPEA 3E90B 4UEHH 1MTSA 1HFDA 1PPBH 4D9RA 1EJNA 1QQ4A 3MH6A 1TMBH 2YNAA 3DD2H 4NA8A 2QIQA 3PMAB 1QRZA 5DP5A 1AU8A 1JBUH 2GP9B 1GBLA 1A0HB 4BOHA 4MTBA 3ODFA 4E05H 2BDCA 1HAPH 1FNIA 2WINI 2FO9A 1CT0E 2UUJB 2DE8A 4I8LA 2A5AA 4X6MA 2LNCA 1MTVA 4K2YA 4DIIH 2O8LA 3KQCA 1SOZA 1WU1A 3UOPA 3BSQA 1NFUA 1QRWA 2XWBI 2RA3A 1GMCF 2WPKS 3PTNA 1A0LA 4WF8A 1N6XA 3BN9A 2QXIA 1SOTA 1C5WB 1B7XB 3CP7A 1W0ZU 2F9OA 4IGDA 6GCHG 2D2DA 2BTCE 3WY8A 1DWCH 4ABHA 4LZ4B 1DX5M 2CF9H 5EXLA 2AMPA 3SNBA 2VVVA 3A7VA 2SGQE 4I31A 2IN2A 1WAYB 1GCTB 1QTFA 1Q3XA 4ZUHA 1DLEA 4ZKSU 3MMGA 3RXAA 1GHBF 3E3TA 1O2LA 8LPRA 4Q7XA 4CH8B 3TJVA 5JBCS 3A82A 2BD9A 4XBCA 1EXFA 2W7SA 3TH2H 1JWTA 1GMDF 3LU9B 2ZTYA 1EJAA 1NESE 4AFSA 1GPZA 1GBTA 3OY6U 2XCNA 1EAWA 3GY3A 1D6RA 3A85A 1S81A 4D7FA 1TRNA 1TNHA 1K1LA 1F0RA 2CHAC 1GI1A 2ZFRH 2ZU4A 2R9PA 1V2TT 2XRCA 1XM1A 4XOJA 1Z6EA 3ZZ3A 3FAOA 1SGCA 4B73A 3ENSB 3OU0A 1UK2A 4NIXA 4CRDA 4UONA 1MD8A 4E7RG 4ZHMU 1SG8B 5FBIA 2H9HA 2VIDA 4YM9A 3QUMP 5PTPA 1TALA 1P2QA 3NZIA 1BJUA 3S9BA 1MTNB 4FUDA 1KLJH 1SGFA 2YOLA 1O31A 1T8OA 4BXWA 4AN7A 2BZ6H 3ZVCA 5HGGA 3Q77A 3V3MA 4ZH8A 3P8GA 3STJA 2GCTB 4GCHG 3MNBA 1V2MT 5F6MA 5EGMA 1YLCA 1QHRB 1D3QB 3LC3A 2VB0A 2ZECA 3DHKH 2PUXB 4LXBH 4NFEA 1G2LA 1TBRH 2H9EH 2AGGX 2CV3A 5DO4H 1AFEH 1VJAU 3M5LA 2FM2A 3SV9A 1DXPA 1EAIA 2BDHA 1HAXB 6ESTA 3MTYA 1C1SA 2ZEBA 3SI4H 4H6SB 1HAIH 1O33A 2B0FA 2FTMA 3T29A 4JMYA 1EOJA 1TPSA 5ESTE 1W14U 1D9IA 2FI4E 1TNJA 2VWLA 4IMQA 4IC5A 3TPIZ 1MZAA 1RTFB 4JZDH 5GWZA 1A1RA 2SNVA 1QBNA 1ZGVA 4JZFH 4TYDA 3M36A 5EW2H 1HAVA 1GL1A 1QRXA 1UCYK 4B76A 2FX6A 1P10A 1FPHH 1Q31A 4FUBA 2VH0A 2CHAB 3A83A 2ZDLA 1CGIE 2H5CA 3P8FA 1V2WT 1SGRE 1TGBA 1WOFA 1YPEH 2FDAA 3RC6A 1IAUA 3SORA 1BMLA 2P8OC 4AG2A 2BD7A 2CJIA 4QT8C 1F0TA 1N6YA 1DUEA 4FU8A 1YPGH 1YYY1 5EXNA 2ZQ2A 1NT1A 2GVFA 2R3YA 8ESTE 1BTWA 1O36A 1HV7A 3GYLB 3TVJB 2HOBA 1LVMA 4SGBE 4CRBA 2VIPA 3NK8A 4Y11E 1PFXC 2HNTE 3HKJB 1S82A 1C5RA 1GVKB 2PGQB 1TA2A 2ALVA 2AH4X 3KGPA 4GPGA 4JZEH 3UWJH 1C5NH 5K0HA 3RXUA 1SGQE 1GI5A 2O8UA 1GMHF 4VGCC 5FAHA 2GCHF 4OS7A 3TH4H 2ZZUH 4OS5A 1O2MA 1THSH 4DT7B 1ZMJA 4NA7A 1KYNA 1H9LB 1VJ9U 1JMOH 2JETC 1GG6B 3ZZ6A 4U32A 1QY6A 3S9AA 1NU7B 1A3BH 4Q2KA 4ZXXH 2ODQA 1DY9A 2R2MB 1EX3A 1EKBB 1ZSKA 3Q76A 4H42U 1NRSH 2Y80A 1S85A 1EAXA 1U6QA 1C1PA 1AFQB 1OP2A 5F8TA 2ZHEH 4K1SA 1BTZA 2XNIA 4O3TA 4INHA 5JBTA 1ZMNA 3MO3A 3CENA 1V2OT 1O5BB 3OSYA 3O8CA 2ZHWH 1CT4E 3P17H 1DWBH 2ZFQH 1DE7H 1OP8A 4CHAC 3A86A 3R0FA 5CHAC 2P8OB 4ZKOU 3BEFB 2ZFFH 2ZGJA 4U01A 1Z71A 3GOVB 3SV6A 1PPEE 1OYQA 3KIDU 1NO9H 5GPIB 4K3JA 2OUAA 3SUFA 1UVPA 3RXVA 4NIYA 1QJ6B 2BMGB 2ULLA 5LGOA 4WMFA 1PPGE 1UO6A 1AO5A 4KTCA 4ESTE 1C1NA 4MVNA 4X0WU 1P11E 1TNLA 3ATLA 3TITA 1GJ7B 4B2BA 4FXGH 1UVUH 2VINA 4CREA 1ZHPA 1TAWA 1K1PA 3V0XA 1UMAH 2FOBA 1W7GH 5FX5A 4AYYB 1V2NT 2PGBB 2P16A 5AFYH 3S69A 5LPFA 2FOMB 1KXAA 1AMHA 2HNTC 3LJJA 3FZZA 1EQ9A 1GVZA 5HM2A 4K69A 1AWFH 4VGCB 2PKAB 4DGJA 4KELA 1O2JA 1NRPH 3ZV9A 5BRRE 4NCYA 2P59A 1O2WA 1V2PT 5I25A 1YPJH 5L2ZH 2BLQA 1TONA 1ETRH 3PYHA 4I8HA 2FWWA 1E35B 1ESBA 1DSTA 2Y6TA 1AN1E 2BD4A 4Y76A 3U98H 1ZPCA 1MKWH 3RLYH 1W12U 4ABIA 1INCA 4X8VH 2FOGA 4I8GA 3TK6A 3UREA 1O2XA 2RA0A 1LO6A 1AE5A 3AW1A 2ZTZA 3I29A 2NU2E 3TU7H 1BITA 3SHCH 3EA7A 3SJIA 1O3PB 4A1TA 2CGAA 2BY7X 5FPTA 3GY7A 3STIA 1BB0B 3LGYA 4MPWA 4CHAB 2SNWA 4K5ZA 3SU5A 1GMCG 2BZAA 1A0JA 3T5FH 3A7XA 1AKSB 1RD3B 5CHAB 2BVSH 3UNRA 2V3OH 3P6ZB 1KXCA 2Y5HA 4MNWA 2P94A 1GJBB 3TIUA 3LGTA 2ZTXA 5EU8A 1AE8H 3SU6A 4GCHF 1SGPE 3MU4A 1GI2A 1KIGH 1K21H 1L4ZA 1AHTH 4JCNA 4WXVA 2GZ7A 2BHGA 1ZPBA 2ZU5A 3F9FA 4BAHB 3RXIA 2DE9A 4YESB 1GHBG 1FI8A 2H5DA 5ABWA 2FOHA 1CE5A 1P09A 4NSYA 1NY22 1O5CB 1XX9A 2Y82A 3ZZCA 3B9FH 2UWPA 2ZKSA 1ELBA 2G81E 2F9VA 5C1UA 1GMDG 1NM6A 1PPZA 1SLXB 2Y7XA 5DP4A 2BD5A 2OXSA 2CMYA 2ZWLH 3H7TA 1K9OE 4AB9A 2BQ6B 3GCNA 2TRMA 4UFGH 3PV4A 4XBDA 1YCPM 1WBGB 4UDWH 3UY9A 3GY4A 1XKBC 4D9QA 1LHGH 1PPFE 1VCQA 2ZHDA 3P92A 2XYAA 2VVCA 1QA7A 3OYPA 1HJAB 4X8SH 5DP7A 1K1MA 5J4QA 3G01A 5G4BA 3QTVH 4X6PA 1YLDA 1NFYA 4TY6A 3UQVA 2ANMH 3GY5A 2A1DB 3FP6E 1HIAB 4R8TB 4FUGA 1XKAC 3A8BA 2PV9B 2QV1A 2XTTB 1DT2A 1FY8E 3RXKA 1V2JT 2FTLE 6LPRA 1GBBA 3U8RH 1HAHH 3NXPA 6CHAB 4DIHH 1GWAA 2XC5A 3AVZA 4Y8XA 2ZA5A 3OY5U 4CRGA 1K22H 1TQ7B 9ESTA 1JRTA 5JDUB 1EATA 3VB5A 4IS5A 3CS7A 1ZMLA 7GCHG 2BY9X 1YPLH 3BTTE 4Y7BA 4CRCA 2Q6FA 1TX7A 1HB0B 1C5MD 3RXDA 1YP9A 2ZCHP 3RM2H 2TGTA 1NS3A 3MOCA 1KY9A 1XUHA 3SV8A 3M3SA 4J1YA 1NFXA 5BPEA 1GHYH 1RIWC 2QN5T 3QZQA 1BQYA 1PYTC 1PYTD 1CO7E 4WMEA 2BD2A 2P93A 2OINA 4GSOA 1TBQH 1Z7KA 2JKHA 1K2I1 3N7OA 4INLA 2CF8H 1MH0A 1A5HA 1W2KH 3QX5H 2CXVA 1EZUC 3RC5A 2BXTH 3HATH 5FCRA 3C1KA 1YCPH 1KLIH 1GBJA 3SU0A 5JPMH 3Q3YA 1GBFA 4Y7AA 1J9CH 1YPHE 1LVYA 1TMUH 2D26C 1W8BH 1QURH 4ABFA 1GJAB 5DPAA 1O39A 1GHVH 1GBIA 2FYRA 1BMNH 4WWYA 1GHXH 4MQAA 4TPIZ 3SBKA 5FCKA 1UTKA 1CBWC 2OC0A 4FUHA 2KAIA
chains in the Genus database with same CATH superfamily
3SU1A 4Y6DA 1O3EA 1BRCE 1SLUB 4ASHA 1EB2A 1K1OA 3ZZDA 3QZRA 4X2WA 1P2NA 1Z8JB 1ZOMA 3QLPH 3B8JA 2W5EA 3E16B 1P2KA 1O2UA 4YOIA 2IPHA 3TH3H 1SLWB 5SGAE 3K9XB 5F8XA 1O2ZA 1P3EA 1TNIA 1MQ5A 4Y8YA 2VJ1A 1V2VT 3SW2B 5EIYA 1Y3XA 2O8TA 3E1XB 4BAKB 1W13U 4P00A 5JBBS 1GMHG 4XD7D 1SMFE 3S7KB 2G4UA 3RXOA 2M2AA 1EP6A 3BTKE 2AEIH 2GMTB 1GBKA 1KLTA 2FI5E 2YNBA 5EQQA 5T6DA 2I6SA 3KL6A 1RIWB 5A09A 2BOHB 4DW2U 1HRTH 1QCPA 1QL9A 1PQ5A 1H8HD 1FY5A 1K1IA 3AW0A 3TGIE 1QBOA 1FPCH 1GBEA 2OC1A 4X1RU 2GV7A 2STAE 2FXRA 1O5AB 1C5ZB 1Z1IA 5C0TA 1Y8TA 1P57B 2ZQ1A 1UTJA 3NWUA 1VCPA 1SGFG 4FVBA 3LJOA 1BT7A 1T4VH 3PO1C 4MNXA 1J15A 1MKXH 2ZO3H 3KYFA 2J9NA 1GL0E 1MTWA 2R3UA 2V3HH 1UTNA 1YPHC 1MMJN 2J4IA 3KEEA 2FOFA 2K1QA 1DICA 1MTNC 3S0NA 2K0QA 1OWHA 1TMTH 4NZLA 1TPPA 4U2WA 3F0OA 4ISHH 5FHTA 1L1JA 3LGUA 1CBWB 2GCTC 2EA3A 5E0JA 1G3CA 3A8DA 2FLBH 1TGNA 1AUJA 3F9GA 1BTXA 3U9AH 1V2QT 3QDZB 1UVTH 2THFB 4GHQA 4Y71A 1PPCE 1UTMA 1WTHD 1D6WA 2OLGA 4ISLA 3VB7A 1Z8GA 1KXBA 2O9QA 1EOLA 2O8WA 3RXFA 1FUJA 1GBCA 2P3TB 4NWLA 1ANEA 1XUJA 2Z6BD 1C5LH 1LHEH 3LH3A 3SV7A 5ESBA 2QF0A 2PTCE 2H2ZA 3OFND 3A88A 1F0UA 1T4UH 3MWIU 1G30B 2TGAA 1Y3UA 3N7EA 5DJ7A 1ORFA 4UFEH 2GTBA 5E8EH 1YBWA 1K1JA 4WXIA 3EE7A 3SHAH 1PJPA 1FN6A 1MKWK 1ZYOA 3MU8A 3CS0A 4KGAA 1QBVH 1HDTH 1W7XH 1MTUA 1SFIA 1OSSA 1BHXB 4ISOA 2ODYB 1GJ6A 3RXGA 2F9NA 1FXYA 1PQ8A 1P2JA 5C67A 1UTQA 2AERH 1AQ7A 4Y79A 2EI6A 1DY8A 3RLWH 2W3IA 5H4IB 2WPDD 3DT0H 1AWHB 3SNEA 2PLXA 3B23B 4IN2A 4AFQA 1MU8B 2BQ7B 3A87A 4BTUB 1V2LT 2A2XH 5C3NA 3VGCB 1OWKA 2W26A 1BTHH 4AG1A 4U30A 1GI3A 1DANH 4MNVA 5F8ZA 2FS8A 3VEQB 1IQNA 4FUCA 2Z9LA 4OGYA 1CU1A 2FOEA 2J98A 2G52A 1C2KA 1WTGH 3OEHD 3PO1B 3RXHA 5GIBA 4AYVB 1KTSB 2BOKA 3QO6A 4Q80A 5C1YA 5DP9A 2BD8A 3RUOA 3BTME 2TBSA 2F83A 3AASA 3V7TA 3HGPA 1C2HA 4Q7YA 1BIOA 1ZGIA 1C4V2 4I8JA 4AGJA 1O3AA 5GXPA 1MD7A 3FOAA 2ANKH 3KNXA 2NU4E 4RSPA 4XDEA 1BRBE 4TPYA 2QAAA 1QB6A 5HXFA 3MNXA 1W0YH 2WZQA 3UNSA 4O97A 2PSXA 1FAXA 2PHBA 7GCHF 1BHXF 4DJZB 2G00A 3HK6B 1NFWA 1H1BA 1TB6H 1XVOA 2BB4A 3DCLA 3FANA 3T27A 1S6HA 2VH6A 2Z3DA 3R3GB 4LZ1H 1FIZA 4P02A 5GCHG 4DURA 1GG6C 4FUEA 1A2CH 3QTOH 4O3UA 3ZVDA 2HALA 3UFAA 1MUEB 1XVMA 4FUFA 4CBNA 3UUZA 3M5MA 1BUIA 5EG4A 3SGAE 2RCEA 3PLKA 3NCLA 1LTOA 2Q6GA 4Y0ZE 2HPQH 1DWDH 1AFQC 4ZKRU 1C2IA 3ITIA 1NROH 3RXEA 4MG3A 5TJXA 4HG6A 2PR3A 5DSFA 1A3EH 2BM2A 5HIZA 1NRRH 2F9UA 2PW8H 1BMFD 2TGDA 1TE0A 5KECA 2R2WU 2Z7FE 1ZPZA 4B71A 2BDAA 2AGEX 1FAKH 2V7QD 4UE7H 1ELFA 1GGDC 1ZHMA 3GICB 3PROA 4IN1A 2HWLB 1E0FD 3A89A 2Y81A 2WPHS 2C8YB 4HTCH 1HAOH 2WUBA 3S9CA 3M7TA 4D8NA 5IDKA 3ZZ5A 4YLQH 1FJSA 1P03A 1QL8A 5A2MH 3QN7A 4WMDA 1LVOA 2PP6A 3K2UA 1T8LA 3SJKA 3TJUA 1A5IA 1KDQA 1UHBA 3AAVA 3PLPA 1QGFA 1WCZA 1SGTA 3K6YA 3MO6A 1B5GH 1WQVH 2C8WB 1AUTC 4WH6A 2Y5FA 3I78A 4IMZA 2UWLA 1FDPA 3RXCA 1TPOA 1ZTKA 1EP5A 1P8VC 1H8DH 2Z9IA 1G3DA 1O5FH 4ACBA 3E6PH 3GY6A 3ZVGA 2ZFTA 1LKAA 2XC0A 4HFPB 1S5SA 2XOKD 1BMMH 4KKDA 1YCPK 5E2OA 1O2PA 1BOQA 2WPMS 2XXLA 1ANDA 1SGEE 4OGXA 1W3CA 2FZZA 3GDVA 4X8TH 2V3MA 5HMAA 2R0LA 2SGPE 1GJ5H 1GI0A 2TPIZ 1Y3VA 4WH8A 1HAVB 1S0RA 1OWJA 1C5UA 1Y3YA 1EPTA 2ZDNA 3BTQE 4B2AA 3MO9A 4I8KA 1BBRH 3RM0H 3A7YA 1F5KU 3F9EA 1UCYE 3SUGA 1OWIA 1OKXA 4NA9H 5A8YA 1WSSH 1DFPA 2BDIA 3F2GA 3AK5A 4GUXA 1GGDB 2WHXA 3VFEA 2FP7B 3SUDA 3VB3A 1O2TA 1ABIH 2A2QH 4YO9A 5F03A 2OK5A 1VITH 2ZGCA 3IWMA 3SZNA 3ZIAD 1Y59T 1O3MA 1L2EA 3BIVH 7KMEH 5DP6A 1KMHB 4DVAU 2OP9A 3MYWA 4K1EA 3RMNH 1RFNA 2VWOA 1DWEH 1UHBB 1MQ6A 2PUQH 2WYGA 2RFKC 4X2YA 4BTIB 1RXPA 2Z3EA 1SHYA 4J2YB 4B6FA 2XBVA 5I46H 4IBLH 2AIPA 5A0CA 1EZXC 1O2IA 1O32A 2H1UA 3OX7U 2NWNA 1C2EA 2BDBA 1A46H 1YWUA 1ARBA 1O3HA 2AGIX 5EPYA 5EODA 3KN2A 1GCDA 2A4GA 2WYJA 1TOCB 1CVWH 1B0EA 1P02A 3A81A 3RXPA 2FI3E 1AGJA 3RMMH 1SGYE 3LH1A 4X8UH 3VXEH 3V12A 4E06H 2Y7ZA 2L74A 1EZQA 4DY7B 2G5VA 3QGNB 8GCHG 4HI3A 1G9IE 1T31A 3E8LA 4FUIA 1MKXK 3ATWA 1TBZH 1QB1A 1LPGB 1JIRA 2G8TA 3A80A 1FONA 4LK4A 4FU7A 1HJAC 1AB9C 4D76A 1XXFA 5TCCA 3O8BA 3H7OA 3JZ1B 1XXDA 2PTNA 2QC2A 1WYKA 2ASUB 4Y8ZA 1AD8H 3ZZAA 4LOYH 5FX6A 4ZKNU 3M3TA 3KQ5A 3SGBE 3M7UA 1O2YA 5L30H 4HZHA 3RMOH 3WW7A 6CHAC 2FS9A 3SV2H 5EJ1A 3E0NB 3WWFA 3ATMA 2M5TA 5DP3A 1EJMA 1O2KA 3SU3A 5LH8A 3SZEA 3HPTB 3GISB 4X6NA 3SI3H 4K60A 3A7WA 3ZYEA 2OCVB 3U8OH 1ELGA 1GBAA 1ELTA 5CE1A 1E37B 1ZR0A 4XSKU 2NU0E 5EQRA 2AS9A 1JIMA 2Z9GA 1P3CA 3T28A 4JZ1A 3P8NA 1C1UH 1OPHB 1VR1H 3ZZ7A 1O2RA 3LIWA 2QXHA 5L6NH 4BAMB 3M3VA 1YLNA 2QCYA 2XBYA 3RXSA 2GZ9A 4NIVA 3T62A 1SLVB 4XRNA 1C1TA 1GI7B 2GDDA 1THPB 5GCHF 1ANCA 1C1MA 5A0AE 3LKWA 4ABBA 4H6TA 1FMGA 2SFAA 3BTGE 1UTPA 1HAZB 1G3EA 3DFLA 2BVXH 3N99A 1TNKA 1C2GA 3VB6A 3BTHE 5T6FA 2B8OH 2V35A 1YKTA 3ZVFA 3UIRA 3QWCH 2ANYA 1HJ8A 5K7RA 2C3SA 3A7ZA 1HAGE 1O37A 1O5GH 2J92A 4FOUC 1AB9B 1SHHB 2JH0D 4FU9A 1PQAA 1GJ8B 2ODPA 2XCFA 1VKYA 3BG8A 5A0BA 1P0SH 1V2RT 3RC4A 5C0UA 4X1SU 2ZPRA 2ILNA 2LPRA 1S0QA 3GY2A 3FZDA 1SKYE 3GDUA 3A8AA 5E0HA 2Y5GA 2IJOB 4YZUA 4Q63A 1SL3A 2G5NA 1GHWH 2ALPA 5EW1H 1ESAA 1TYNA 4X2VA 1E36B 2GD4B 5EJZA 2ZHFH 3EA9A 1OYTH 1CQQA 1TWXB 2OBQA 1HLTH 1O3LA 3ZZ9A 2H6MA 4XFQA 3RXLA 1CHGA 1SGIB 1C9TA 1ZTJA 5JB9S 1ANBA 1LMWB 1P06A 1JXPA 1NN6A 3BEUA 3SJ9A 1CHOG 3LONA 1QR3E 1XUIA 1SVPA 1KSNA 3O8RA 2UWOA 1E79D 1DDJA 2GMTC 3ZVAA 1ESTA 1IQGA 1EFRD 3EQ0H 3RU4E 5DGJA 3HGNA 5C1XA 1HPGA 1O3KA 1P9UA 4YOGA 4CRFA 1CA8B 1CSOE 2ZPSA 2W6ID 3SOSA 3UTUH 3MNCA 1SSXA 3TK9A 4KTUA 2JJ2D 2TIOA 4KP0A 5C5OA 4F4OC 1QQUA 1C2DA 4TY7A 5JB8S 2ZP0H 1UVSH 1IQMA 3EYDA 3QK1A 4AGKA 1YF4A 1VCWA 4AX9H 2ZHQH 2C8ZB 3W94A 5CDFE 1FV9A 1ZRKA 2JIZD 3UR9A 4DOQA 5FL7D 3UNQA 3BTEE 1V3XA 4JYTA 4OS4A 5FBEA 1JOUB 2AFQB 2WPLS 1HGTH 1CT2E 2F91A 1E1QD 1DOJA 1O3NA 4M7GA 3GCTG 4DG4A 7ESTE 4TWWA 1TGSZ 2B5TB 1BTPA 3LOXA 1Z1JA 1G3BA 1OP0A 2BVRH 2JH6D 3O8DA 5A8ZA 1UJ1A 4ISNA 1E34B 2QY0B 1GJ9B 1GHZA 3MNSA 1LPZB 3GCOA 3SUEA 5JBAS 3RXJA 2GZ8A 2SGFE 2A4RA 3RP2A 1MABB 1GBHA 1CA0C 3SU4A 1BCUH 4Z6AH 1O5DH 1QL7A 3NUMA 2VWNA 3VXFH 1AVWA 2KCOA 3H09A 1IQJA 1FQ3A 1SQRA 3QGJA 3UOUA 2OTVA 1D3DB 4TT3D 1QIXB 2F9PA 1F0SA 2XW9A 2KR7A 2V0BA 4JYUH 3OTPA 1YGCH 3D65E 4I7YH 8KME2 1GI6A 1SFQB 3RU4D 4NG9H 5DKMA 5L2YH 2VGCB 1ABJH 4AZ2B 1O3BA 2QXJA 2ZU2A 3M37A 2GT7A 4THNH 1DPOA 1BBRK 5HKKD 8GCHF 3ZZ4A 1PPHE 1ZJDA 4YTAA 3VGCC 3PB1E 1BZXE 1P2MA 3M5NA 2FODA 3MHWU 3PV2A 5C5NA 3MU1A 4Q7ZA 3DA9B 2D8WA 1A4WH 1S84A 3SNDA 3NRLA 2G55A 2IOTA 3ZZBA 4B74A 3ODDA 1C1VH 2FESH 2ZG0H 4Y10E 1EZSC 1O2OA 2RDLA 2OBOA 3SU2A 5B6LA 3L33A 5T3HA 1YC0A 1DITH 1DS2E 2G4TA 2ANWA 1QJ1B 4X1NU 1SR5C 3GCHC 2ZGBH 1WQSA 1C1WH 2KAIB 4X1QU 1C2MA 3HKIB 5C2ZA 2ZFSA 4H4FA 2WSSD 3LT3A 1EASA 4ABJA 1ARCA 1PQ7A 1ELCA 3SYJA 1LKBA 1DLKB 5GJ4B 4B2CA 5FPYA 2J95A 4JK5A 3BTWE 2HRVA 1TFXA 4GVUA 3K65B 2A0QB 2A7JA 2C93B 4YOJA 2VWMA 3V13A 1TGCA 1WV7H 4ZROA 4TSFD 2A7CA 5TCAA 1VZQH 1CA0B 2ZCKP 4F49A 2UUYA 1DXWA 2RG3A 1GJDB 2JJ1D 2STBE 2OQ5A 2FMJA 1HXFH 2PFEA 1W11U 4RN6A 2EI8A 2R0KA 1C4U2 3KQDA 1GI4A 1D4PB 1O2NA 2GX4A 3MI4A 1GHAG 1OS8A 1QA0A 5J4SA 1SGNE 1AZ8A 4MPXA 1S6LA 2F43B 1KXFA 1O3DA 4K8YA 3MH4A 4DCDA 1EAUA 3ATKA 4GAWA 1FX0B 1NC6A 1BBRE 2A4QA 2XBWA 4IW4E 2AIQA 2F3CE 2P3FH 1O35A 3E0PB 5C94A 3URCA 3S7HB 3TK5A 1O5EH 1VITG 2XNDD 3Q3KA 1C4Y2 1O3FA 3F2FA 3SO3A 3LPRA 1P01A 4B75A 1F92A 3MH7A 1GJ4H 5AVDA 1F5LA 1MAYA 1C1OA 1LCYA 2FOAA 3GCHB 1IQEA 3D23A 1H9HE 4ZHAA 3SQEE 3RDZA 4B6EA 2PKSC 3RXRA 1AI8H 4ZMAH 2GV6A 5E2PA 1GDUA 2XC4A 1HBTH 2VBCA 1IQKA 2ZC9H 1UTOA 1Z8IB 2ZDMA 3PMHB 1L1NA 3A84A 2WV5A 3MH5A 3SNCA 2K8IA 1BRUP 1CHOF 1QFKH 4O9VA 1QNJA 1SI5H 3NKKA 4ZAEA 1NRNH 4MNYA 3W95A 1F5RA 3BF6H 1BTUA 2Z94A 2PWXA 2SGAA 2BLOA 5GDSH 3RXMA 1C5OH 4ZHLU 2QE7D 2P95A 2AYWA 2OC7A 4E7NA 3P70B 2WV4A 3AAUA 1FIWA 2WV9A 4INKA 4FVDA 1DVAH 4Y0YE 4AFUA 2BDYA 3L6PA 3ZZ8A 2ZFPH 1G2MA 1C5PA 5EPNA 1ACBE 1BRAA 2J34A 3OE7D 3F1SB 3A8CA 4RKJB 1TX8A 1OOKB 1LDTT 1AY6H 1B0FA 3UQOA 1O3GA 1Y5AT 1BDAA 1P2IA 1E38B 3F68H 1LQEA 1FY1A 4ABGA 1Y5UT 1ZSLA 1FLEE 3U69H 3F6UH 1O38A 3EAJA 1O34A 3EGKH 3P95A 1P12E 1V2KT 4XE4A 2J98B 1X7AC 3KF2A 3GDSA 4NIWA 3GY8A 4Z1MD 2JH5D 1C5QA 2VIWA 3GCTF 3MU0A 2ZDAH 2HVXA 1GVLA 3K6ZA 1A61H 2V6NA 2EI7A 3PWCA 1F2SE 3F9HA 4O03A 2GGVB 3DSOA 4I32A 1O2VA 3KHVA 3U28C 1TLDA 5A8XA 2VU8E 3KCGH 1IQLA 2AMDA 2PKSB 4XBBA 5EXMA 1TRYA 2KCYA 3OEED 1C2JA 2A32A 3E91A 4MLFB 4NSVA 4UFDH 1YPMH 2ZU3A 2VIOA 2JDID 1SC8U 1ID5H 1SBWA 1MU6B 1MCTA 3HK3B 2HGTH 2KX4A 1O3CA 4ABAA 2C4FH 3TNTA 4YT6H 1HNEE 5GNDA 2AHME 1AVXA 2QA9E 1FY4A 1C5XB 1UK3A 1L0ZA 3M35A 1O2HA 1LHFH 2ZDVH 4D7GA 2PKAA 3SN8A 3SNAA 4A1VA 4OS1A 3H5CB 3JZ2B 1OWEA 4RT1A 1P05A 1ZLRA 3F3BA 4HGCA 1ELDE 5HIYA 1EPTC 3FVFB 4WJG2 3TJNA 3PMJA 4ISIH 2XWAA 4CR5A 1IHSH 1NRQH 2O8MA 1RJXB 1Z6JH 1F7ZA 1C1QA 1O30A 1IQIA 2HLCA 4K1TA 4PROA 2EC9H 4JZIA 3L3TA 4F55A 3P8OA 1H4WA 1OWDA 1G36A 4KTSA 2BX3A 5IK2D 2BY6X 4WY3A 3U1IB 5C17A 1AIXH 1AKSA 4Q4LA 2Q6DA 4CBOA 2HPPH 1RGQA 1NU9A 1CGJE 1KDQB 2ZIQH 1SQOA 3PMBB 5FPSA 4B1TA 2GT8A 1FN8A 1XMNB 2W7UA 5C20A 1TNGA 4BNRA 3ZYDA 2VVUA 2Q1JA 3GYMA 3T26A 1C1RA 2FLRH 1TPAE 5AHGH 2ZI2H 1KXDA 2XBXA 3LC5A 2BX4A 3URDA 3ZVBA 1FZZA 1Y5BT 2NU3E 5AF9H 2A45B 1G32B 3C27B 6GCHF 1RTLA 4CR9A 3N7DA 4YLUA 4RKOB 2QXGA 1SPJA 2Z9KA 1ZJKA 1O0DH 2YMSD 2J2UA 1FY3A 1RS0A 2ZDKA 1LHCH 1XUKA 1TQ0B 5ETXA 1Z8RA 4YT7H 1GHAF 5LPRA 1THRH 1HJ9A 1C5VA 3UR6A 1G37A 2BD3A 1BMAA 4X6OA 2BLVA 3KQBA 4RI0A 1J17T 1N1LA 1J16A 2QGRA 1J14A 1VGCC 2ZCLP 1EPTB 1C2LA 2W3KA 2JETB 3VB4A 1EB1H 2FIRH 1N8OC 1NTPA 1VITF 3BG4C 2F9BH 4CH2B 3VPKA 1MCVA 1RTKA 4BANB 1LHDH 3EE0B 3M61U 1DSUA 1H8IH 2FPZA 2SGEE 1MBMA 2Z9JA 4YXWD 3ZVEA 1DM4B 1ZRBA 7LPRA 3Q00A 2P3UB 5B6OA 2LP6A 1HIAA 2QYIA 2B9LA 4UFFH 1UTLM 2A5KA 1SQAA 1COWD 5IYTA 1LVBA 1ELEE 1IHTH 1WUNH 1HUTH 1RRKA 2CN0H 4GHTA 1GJCB 2KCAA 2FEQH 2BYAX 1EUFA 1GI8B 2OD3B 1GBMA 2ZPQA 2BY5X 5JYIA 2SGDE 2EEKA 5AFZH 1S6FA 2J94A 1SB1H 4JK6A 4X1PU 3SJ8A 1H9IE 2EQNA 1NZQH 3PRBA 3TJOA 1UK4A 3DUXH 1JRSA 3U8TH 3LGIA 1O3IA 4FUJA 1TABE 2BY8X 4I33A 1D3TB 2ZNKH 2A5IA 2YMSB 2DUCA 2ZGXH 3RMLH 1SQTA 1MBQA 1T7CA 4AB8A 1O3OA 4AOQA 4OS2A 3ESTA 1TIOA 1T8NA 3D62A 2WPIS 2FX4A 1DUAA 1ZTLA 3TLOA 1P2OA 4MPVA 1E1RD 2UUFB 3BTFE 4NGAH 4X2XA 1YM0A 4AORA 3MFJA 1L4DA 1KXEA 3Q3XA 5CMXH 1GDQA 1OXGA 4BAQB 1VGCB 1C9PA 2OC8A 2FYQA 3LGWA 3PM3A 5EQSA 1WXRA 2GKVE 5HYOA 1BJVA 5LPEA 4TWYA 3IITA 3EA8A 1N8OB 3BG4B 4A6LA 1J8AA 1A5GH 1ELVA 1O2GH 1Q2WA 2ZU1A 3PWBA 3RXTA 4AC9A 2BXUH 2PSYA 2ESTE 4ACAA 1OX1A 1HCGA 3SGQE 2C90B 2WUCA 3OTJE 3NPSA 1UCYH 4A92A 1V6DA 1D3PB 1ZZZA 4IC6A 2UUKB 4Z0KA 4OS6A 2BLWA 3T25A 1O2SA 3BIUH 4UD9H 1CGHA 5E0GA 1IQFA 1C5TA 5HM9A 1S83A 1V2ST 1Y3WA 5T6GA 1AZZA 4ZCNA 3DFJA 3LDXH 1K1NA 2I6QA 3MU5A 4NZQA 3RXBA 2A7HA 2D1JA 1BTYA 1TGTA 2NU1E 2HNTF 9LPRA 2FOCA 1MZDA 2GDEH 2HVYB 3FP7E 2VGCC 3EDXB 2BDGA 2OQUA 3D49H 2H9TH 1MAXA 3PTBA 1O2QA 2HLDD 1QJ7B 5DK1A 2AMQA 2G51A 2TGPZ 4SGAE 5DG6A 1ETSH 1HXEH 4MPUA 1P9SA 2F4LA 3BTDE 1V2UT 3FFGA 3M7QA 2J5UA 2VNTA 4AFZA 1TOMH 1UVOA 3ELAH 3CNRA 1P04A 4ABDA 4BAOB 1HYLA 1GDNA 3UWIA 1QB9A 3RXQA 1SGDE 3PLBA 2VIVA 4GLYA 4A5TS 2A4OA 1ZHRA 3M5OA 4ZXYH 4NFFA 3BEIB 1T8MA 1AVGH 5EOKA 3F0PA 4K8BA 4MDSA 1O3JA 3ZV8A 1TX6A 1ETTH 2A31A 2VIQA 1C2FA 3RU4T 1XUGA 2WPJS 2Z3CA 3I77A 4A1XA 5DP8A 2BQWB 3IG6B 1GBDA 3TGKE 4ABEA 1K28D 1NPMA 1W10U 4R0IA 4WVPE 1LQDB 3SQHE 3LGVA 3ATIA 5F53A 1TA6A 3BV9B 3UAIC 3FP8E 1C5SA 1KTTB 1IQHA 2J38A 3KQEA 4BTTB 3PV5A 2ZGHA 4BXSA 1XUFA 1ELAA 3SJOA 2C8XB 4JYVH 1BA8B 1A7SA 1GCTC 3A7TA 1GI9B 1IOEA 1LPKB 1HAYB 1ZSJA 4A7IB 2ZF0H 1TRMA 2GCHG 4CRAA 1YPKH 1C5YB 1M9UA 3TGJE 2QF3A 2GJGA 5FXLA 1L1GA 3U1JB 1T32A 3TNSA 2B7DH 3T2NA 4NWKA 3UPEA 3E90B 4UEHH 1MTSA 1HFDA 1PPBH 4D9RA 1EJNA 1QQ4A 3MH6A 1TMBH 2YNAA 3DD2H 4OM9A 4NA8A 2QIQA 3PMAB 1QRZA 5DP5A 1AU8A 1JBUH 2GP9B 1GBLA 1A0HB 4BOHA 4MTBA 3ODFA 4E05H 2BDCA 1HAPH 1FNIA 2WINI 2FO9A 1CT0E 2UUJB 2DE8A 4I8LA 2A5AA 4X6MA 2LNCA 1MTVA 4K2YA 4DIIH 2O8LA 3KQCA 1SOZA 1WU1A 3UOPA 3BSQA 1NFUA 1QRWA 2XWBI 2RA3A 1GMCF 2WPKS 3PTNA 1A0LA 4WF8A 1NBMD 1N6XA 3BN9A 2QXIA 1SOTA 1C5WB 1B7XB 3CP7A 1W0ZU 2F9OA 4IGDA 6GCHG 2D2DA 2BTCE 3WY8A 1DWCH 4ABHA 4LZ4B 1DX5M 2CF9H 5EXLA 2AMPA 3SNBA 2VVVA 3A7VA 2SGQE 4I31A 2IN2A 1WAYB 1GCTB 1QTFA 1Q3XA 4ZUHA 1DLEA 4ZKSU 3MMGA 3RXAA 1GHBF 3E3TA 1O2LA 8LPRA 4Q7XA 4CH8B 3TJVA 5JBCS 3A82A 2BD9A 4XBCA 1EXFA 2W7SA 3TH2H 1JWTA 1GMDF 3LU9B 2ZTYA 1EJAA 1NESE 4AFSA 1GPZA 1GBTA 3OY6U 5DN6D 2XCNA 1EAWA 3GY3A 1D6RA 3A85A 1S81A 4D7FA 1TRNA 1TNHA 1K1LA 1F0RA 2CHAC 1GI1A 2ZFRH 2ZU4A 2R9PA 1V2TT 2XRCA 2KCPA 1XM1A 4XOJA 1Z6EA 3ZZ3A 3FAOA 1SGCA 4B73A 3ENSB 3OU0A 2KZ4A 1UK2A 4NIXA 4CRDA 4UONA 1MD8A 4E7RG 4ZHMU 1SG8B 5FBIA 2H9HA 2VIDA 4YM9A 3QUMP 5PTPA 1TALA 1P2QA 3NZIA 1BJUA 3S9BA 1MTNB 4FUDA 1KLJH 1SGFA 2YOLA 1O31A 1T8OA 3PRDA 4BXWA 4AN7A 2BZ6H 3ZVCA 5HGGA 3Q77A 3V3MA 4ZH8A 3P8GA 3STJA 2GCTB 4GCHG 3MNBA 1V2MT 5F6MA 5EGMA 1YLCA 1QHRB 1D3QB 3LC3A 2VB0A 2ZECA 3W1EA 3DHKH 2PUXB 4LXBH 4NFEA 1G2LA 1TBRH 2H9EH 2AGGX 2CV3A 5DO4H 1AFEH 1VJAU 3M5LA 2FM2A 3SV9A 1DXPA 1EAIA 2BDHA 1HAXB 6ESTA 3MTYA 1C1SA 2ZEBA 3SI4H 4H6SB 1HAIH 1O33A 2B0FA 2FTMA 3T29A 4JMYA 3DSGA 1EOJA 1TPSA 5ESTE 1W14U 1WDIA 1D9IA 2FI4E 1TNJA 2VWLA 4IMQA 4IC5A 3TPIZ 1MZAA 5CHBA 1RTFB 4JZDH 5GWZA 1A1RA 2SNVA 1QBNA 1ZGVA 4JZFH 4TYDA 3M36A 5EW2H 1HAVA 1GL1A 1QRXA 1UCYK 4B76A 2FX6A 1P10A 1FPHH 5KEDA 1Q31A 4FUBA 2VH0A 2CHAB 3A83A 2ZDLA 1CGIE 2H5CA 3P8FA 1V2WT 1SGRE 1TGBA 1W0JD 1WOFA 1YPEH 2FDAA 3RC6A 1IAUA 3SORA 1BMLA 2P8OC 3DSPA 4AG2A 2BD7A 2CJIA 4QT8C 1F0TA 1N6YA 1DUEA 4FU8A 1YPGH 1YYY1 5EXNA 2ZQ2A 1NT1A 2GVFA 2R3YA 8ESTE 1BTWA 1O36A 1HV7A 3GYLB 3TVJB 2HOBA 1LVMA 4SGBE 1YY3A 4CRBA 2VIPA 3NK8A 4Y11E 1PFXC 2HNTE 3HKJB 1S82A 1C5RA 1GVKB 2PGQB 1TA2A 2ALVA 2AH4X 3KGPA 4FETA 4GPGA 4JZEH 3UWJH 1C5NH 5K0HA 2QF4A 3RXUA 1SGQE 1GI5A 2O8UA 1GMHF 4VGCC 5FAHA 2GCHF 4OS7A 3TH4H 2ZZUH 4OS5A 1O2MA 1THSH 4DT7B 3OAAD 1ZMJA 4ASUD 4NA7A 1KYNA 1H9LB 1VJ9U 1JMOH 2JETC 1GG6B 3ZZ6A 4U32A 1QY6A 3S9AA 1NU7B 1A3BH 4Q2KA 4ZXXH 2ODQA 1DY9A 2R2MB 3UB0A 1EX3A 1EKBB 1ZSKA 3Q76A 2IJD1 4H42U 1NRSH 4RT0A 2Y80A 1S85A 1EAXA 1U6QA 1C1PA 1AFQB 1OP2A 2KFWA 5F8TA 2ZHEH 4K1SA 1BTZA 2XNIA 4O3TA 4INHA 5JBTA 1ZMNA 3MO3A 3CENA 1V2OT 1O5BB 3OSYA 3O8CA 2ZHWH 1CT4E 3P17H 1DWBH 2ZFQH 4I86A 1DE7H 1OP8A 4CHAC 3A86A 3R0FA 2LELA 5CHAC 2P8OB 4ZKOU 3BEFB 2ZFFH 2ZGJA 4U01A 1Z71A 3GOVB 3SV6A 1PPEE 1OYQA 3KIDU 1NO9H 5GPIB 4K3JA 2OUAA 1W0KD 3SUFA 1UVPA 3RXVA 4NIYA 1QJ6B 2BMGB 2ULLA 5LGOA 4WMFA 1PPGE 1UO6A 1AO5A 4KTCA 3KYGA 1C1NA 2CK3D 4MVNA 4ESTE 4X0WU 1P11E 1TNLA 3ATLA 3TITA 1GJ7B 4B2BA 4FXGH 2YMSC 1UVUH 2VINA 4CREA 1ZHPA 1TAWA 1K1PA 3V0XA 1UMAH 2FOBA 1W7GH 5FX5A 4AYYB 1V2NT 2PGBB 2P16A 2KM0A 5AFYH 3S69A 5LPFA 2FOMB 1KXAA 1AMHA 2HNTC 3LJJA 3FO8D 3FZZA 1EQ9A 2RDEA 1GVZA 5HM2A 4K69A 1AWFH 4VGCB 2PKAB 4DGJA 1K0HA 4KELA 1O2JA 1NRPH 3ZV9A 4F48B 5BRRE 4NCYA 2P59A 1O2WA 1V2PT 5I25A 1YPJH 5L2ZH 2BLQA 1TONA 1ETRH 3PYHA 4I8HA 2FWWA 1E35B 1ESBA 5EJLA 1DSTA 2Y6TA 1AN1E 2BD4A 4Y76A 3U98H 1ZPCA 1MKWH 4M9FA 3RLYH 1W12U 4ABIA 1INCA 4X8VH 2FOGA 4I8GA 3TK6A 3UREA 1O2XA 2RA0A 1LO6A 1AE5A 3AW1A 2ZTZA 3I29A 2NU2E 3TU7H 1BITA 3SHCH 3EA7A 3SJIA 1O3PB 4A1TA 2CGAA 2BY7X 5FPTA 3GY7A 3STIA 1BB0B 3LGYA 4MPWA 4CHAB 2SNWA 4K5ZA 3SU5A 1GMCG 2BZAA 1A0JA 3T5FH 3A7XA 1AKSB 1RD3B 5CHAB 2BVSH 3UNRA 2V3OH 3WWBA 3P6ZB 1KXCA 2Y5HA 4MNWA 2P94A 1GJBB 3TIUA 3LGTA 2ZTXA 5EU8A 1AE8H 3SU6A 4GCHF 1SGPE 2L6OA 3MU4A 1GI2A 1KIGH 1K21H 1L4ZA 1AHTH 4JCNA 4WXVA 2GZ7A 2BHGA 1ZPBA 2ZU5A 3F9FA 4BAHB 3RXIA 2DE9A 4YESB 1GHBG 1FI8A 2H5DA 5ABWA 2FOHA 1CE5A 1P09A 4NSYA 1NY22 1O5CB 1XX9A 2Y82A 3ZZCA 3B9FH 2UWPA 2ZKSA 1ELBA 2EY4C 2G81E 2F9VA 5C1UA 1GMDG 1NM6A 1PPZA 1SLXB 2Y7XA 5DP4A 1H8ED 2BD5A 3MQKC 2OXSA 3FN8A 2CMYA 2ZWLH 3H7TA 1K9OE 4AB9A 2BQ6B 3VG8A 3GCNA 2TRMA 4UFGH 3PV4A 4XBDA 1YCPM 1WBGB 4UDWH 3UY9A 2QF5A 3GY4A 1XKBC 4D9QA 1LHGH 1PPFE 1VCQA 2ZHDA 3P92A 2XYAA 2VVCA 1QA7A 3OYPA 1HJAB 4X8SH 5DP7A 1K1MA 5J4QA 3G01A 5G4BA 3QTVH 4X6PA 1YLDA 1NFYA 4TY6A 4DT4A 3UQVA 2ANMH 3GY5A 2A1DB 5KGOA 2J97A 3FP6E 1HIAB 4R8TB 4FUGA 1XKAC 3A8BA 2PV9B 2QV1A 2XTTB 1DT2A 1FY8E 3RXKA 1V2JT 2FTLE 6LPRA 1GBBA 3U8RH 1HAHH 3NXPA 6CHAB 4DIHH 1GWAA 2XC5A 3AVZA 4Y8XA 2ZA5A 3OY5U 4CRGA 1K22H 1TQ7B 9ESTA 1JRTA 5JDUB 1EATA 3VB5A 4IS5A 3CS7A 1ZMLA 7GCHG 2BY9X 1YPLH 3BTTE 4Y7BA 2IPQX 4CRCA 2Q6FA 1TX7A 1HB0B 1C5MD 3RXDA 1YP9A 2ZCHP 3RM2H 2TGTA 1NS3A 3MOCA 1KY9A 1XUHA 3SV8A 3M3SA 4J1YA 1NFXA 5BPEA 1GHYH 1RIWC 2QN5T 3QZQA 1BQYA 1PYTC 1PYTD 1CO7E 4WMEA 2BD2A 2P93A 2OINA 4GSOA 1TBQH 3GS9A 1Z7KA 2JKHA 1K2I1 3N7OA 4INLA 2CF8H 1MH0A 1A5HA 1UW7A 1W2KH 3QX5H 2CXVA 1EZUC 3F2HA 1OHHD 3RC5A 2BXTH 5T1VA 3HATH 5FCRA 3C1KA 1YCPH 1KLIH 1GBJA 3SU0A 5JPMH 3Q3YA 1GBFA 4Y7AA 1J9CH 1YPHE 1LVYA 1TMUH 2D26C 1W8BH 1QURH 3FKSD 4ABFA 1GJAB 5DPAA 1O39A 1QZ8A 1GHVH 1GBIA 2FYRA 1BMNH 4WWYA 1GHXH 1NBME 4MQAA 2W6JD 4TPIZ 3SBKA 5FCKA 1UTKA 1CBWC 2OC0A 4FUHA 2KAIA
chains in the Genus database with same CATH topology
3SU1A 4Y6DA 1O3EA 1BRCE 1SLUB 4ASHA 1EB2A 1K1OA 3ZZDA 3QZRA 4X2WA 1P2NA 1Z8JB 1ZOMA 3QLPH 3B8JA 2W5EA 3E16B 1P2KA 1O2UA 4YOIA 2IPHA 3TH3H 1SLWB 5SGAE 3K9XB 5F8XA 1O2ZA 1P3EA 1TNIA 1MQ5A 4Y8YA 2VJ1A 1V2VT 3SW2B 1Y3XA 2O8TA 3E1XB 4BAKB 1W13U 5JBBS 1GMHG 1SMFE 3S7KB 2G4UA 3RXOA 1EP6A 3BTKE 2AEIH 2GMTB 1GBKA 1KLTA 2FI5E 2YNBA 5EQQA 5T6DA 2I6SA 3KL6A 1RIWB 5A09A 2BOHB 4DW2U 1HRTH 1QCPA 1QL9A 1PQ5A 1FY5A 1K1IA 3AW0A 3TGIE 1QBOA 1FPCH 1GBEA 2OC1A 4X1RU 2GV7A 2STAE 2FXRA 1O5AB 1C5ZB 1Z1IA 1Y8TA 1P57B 2ZQ1A 1UTJA 3NWUA 1VCPA 1SGFG 4FVBA 3LJOA 1BT7A 1T4VH 3PO1C 4MNXA 1J15A 1MKXH 2ZO3H 2J9NA 1GL0E 1MTWA 2R3UA 2V3HH 1UTNA 1YPHC 1MMJN 2J4IA 3KEEA 2FOFA 2K1QA 1DICA 1MTNC 3S0NA 1OWHA 1TMTH 4NZLA 1TPPA 4U2WA 4ISHH 5FHTA 1L1JA 3LGUA 1CBWB 2GCTC 2EA3A 5E0JA 1G3CA 3A8DA 2FLBH 1TGNA 1AUJA 3F9GA 1BTXA 3U9AH 1V2QT 3QDZB 1UVTH 2THFB 4GHQA 4Y71A 1PPCE 1UTMA 1WTHD 1D6WA 2OLGA 4ISLA 3VB7A 1Z8GA 1KXBA 2O9QA 1EOLA 2O8WA 3RXFA 1FUJA 1GBCA 2P3TB 4NWLA 1ANEA 1XUJA 2Z6BD 1C5LH 1LHEH 3LH3A 3SV7A 5ESBA 2QF0A 2PTCE 2H2ZA 3A88A 1F0UA 1T4UH 3MWIU 1G30B 2TGAA 1Y3UA 5DJ7A 1ORFA 4UFEH 2GTBA 5E8EH 1YBWA 1K1JA 4WXIA 3SHAH 1PJPA 1FN6A 1MKWK 1ZYOA 3MU8A 3CS0A 4KGAA 1QBVH 1HDTH 1W7XH 1MTUA 1SFIA 1OSSA 1BHXB 4ISOA 2ODYB 1GJ6A 3RXGA 2F9NA 1FXYA 1PQ8A 1P2JA 5C67A 1UTQA 2AERH 1AQ7A 4Y79A 2EI6A 1DY8A 3RLWH 2W3IA 5H4IB 3DT0H 3SNEA 1AWHB 2PLXA 3B23B 4IN2A 4AFQA 1MU8B 2BQ7B 3A87A 4BTUB 1V2LT 2A2XH 5C3NA 3VGCB 1OWKA 2W26A 1BTHH 4AG1A 4U30A 1GI3A 1DANH 4MNVA 5F8ZA 2FS8A 3VEQB 1IQNA 4FUCA 2Z9LA 4OGYA 1CU1A 2FOEA 2G52A 1C2KA 1WTGH 3PO1B 3RXHA 5GIBA 4AYVB 1KTSB 2BOKA 3QO6A 4Q80A 5C1YA 5DP9A 2BD8A 3RUOA 3BTME 2TBSA 2F83A 3AASA 3V7TA 3HGPA 1C2HA 4Q7YA 1BIOA 1ZGIA 1C4V2 4I8JA 4AGJA 1O3AA 5GXPA 1MD7A 2ANKH 3KNXA 2NU4E 4RSPA 4XDEA 1BRBE 4TPYA 2QAAA 1QB6A 5HXFA 3MNXA 1W0YH 3UNSA 4O97A 2PSXA 1FAXA 2PHBA 7GCHF 1BHXF 4DJZB 2G00A 3HK6B 1NFWA 1H1BA 1TB6H 1XVOA 2BB4A 3FANA 3T27A 1S6HA 2VH6A 2Z3DA 3R3GB 4LZ1H 1FIZA 5GCHG 4DURA 1GG6C 4FUEA 1A2CH 3QTOH 4O3UA 3ZVDA 2HALA 3UFAA 1MUEB 1XVMA 4FUFA 4CBNA 3UUZA 3M5MA 1BUIA 5EG4A 3SGAE 2RCEA 3PLKA 3NCLA 1LTOA 2Q6GA 4Y0ZE 2HPQH 1DWDH 1AFQC 4ZKRU 1C2IA 3ITIA 1NROH 3RXEA 4MG3A 5TJXA 2PR3A 1A3EH 2BM2A 1NRRH 2F9UA 2PW8H 2TGDA 1TE0A 2R2WU 2Z7FE 1ZPZA 4B71A 2BDAA 2AGEX 1FAKH 4UE7H 1ELFA 1GGDC 1ZHMA 3GICB 3PROA 4IN1A 2HWLB 1E0FD 3A89A 2Y81A 2WPHS 2C8YB 4HTCH 1HAOH 2WUBA 3S9CA 3M7TA 4D8NA 5IDKA 3ZZ5A 4YLQH 1FJSA 1P03A 1QL8A 5A2MH 3QN7A 4WMDA 1LVOA 3K2UA 1T8LA 3SJKA 3TJUA 1A5IA 1KDQA 1UHBA 3AAVA 3PLPA 1QGFA 1WCZA 1SGTA 3K6YA 3MO6A 1B5GH 1WQVH 2C8WB 1AUTC 4WH6A 2Y5FA 3I78A 4IMZA 2UWLA 1FDPA 3RXCA 1TPOA 1ZTKA 1EP5A 1P8VC 1H8DH 2Z9IA 1G3DA 1O5FH 3E6PH 3GY6A 3ZVGA 2ZFTA 1LKAA 2XC0A 4HFPB 1S5SA 1BMMH 4KKDA 1YCPK 5E2OA 1O2PA 1BOQA 2WPMS 2XXLA 1ANDA 1SGEE 4OGXA 1W3CA 2FZZA 3GDVA 4X8TH 5HMAA 2R0LA 2SGPE 1GJ5H 1GI0A 2TPIZ 1Y3VA 4WH8A 1HAVB 1S0RA 1OWJA 1C5UA 1Y3YA 1EPTA 2ZDNA 3BTQE 4B2AA 3MO9A 4I8KA 1BBRH 3RM0H 3A7YA 1F5KU 3F9EA 1UCYE 3SUGA 1OWIA 1OKXA 4NA9H 5A8YA 1WSSH 1DFPA 2BDIA 4GUXA 1GGDB 3VFEA 2FP7B 3SUDA 3VB3A 1O2TA 1ABIH 2A2QH 4YO9A 5F03A 1VITH 2ZGCA 3IWMA 3SZNA 1Y59T 1O3MA 1L2EA 3BIVH 7KMEH 5DP6A 4DVAU 2OP9A 3MYWA 4K1EA 3RMNH 1RFNA 2VWOA 1DWEH 1UHBB 1MQ6A 2PUQH 2WYGA 4X2YA 4BTIB 1RXPA 2Z3EA 1SHYA 4J2YB 2XBVA 5I46H 4IBLH 2AIPA 5A0CA 1EZXC 1O2IA 1O32A 2H1UA 3OX7U 2NWNA 1C2EA 2BDBA 1A46H 1ARBA 1O3HA 2AGIX 5EPYA 5EODA 3KN2A 1GCDA 2A4GA 2WYJA 1TOCB 1CVWH 1B0EA 1P02A 3A81A 3RXPA 2FI3E 1AGJA 3RMMH 1SGYE 3LH1A 4X8UH 3VXEH 3V12A 4E06H 2Y7ZA 1EZQA 4DY7B 2G5VA 3QGNB 8GCHG 4HI3A 1G9IE 1T31A 3E8LA 4FUIA 1MKXK 3ATWA 1TBZH 1QB1A 1LPGB 1JIRA 2G8TA 3A80A 1FONA 4LK4A 4FU7A 1HJAC 1AB9C 4D76A 1XXFA 5TCCA 3O8BA 3H7OA 3JZ1B 1XXDA 2PTNA 2QC2A 1WYKA 2ASUB 4Y8ZA 1AD8H 3ZZAA 4LOYH 5FX6A 4ZKNU 3M3TA 3SGBE 3M7UA 1O2YA 5L30H 4HZHA 3RMOH 6CHAC 2FS9A 3SV2H 3E0NB 3ATMA 2M5TA 5DP3A 1EJMA 1O2KA 3SU3A 5LH8A 3HPTB 3GISB 4X6NA 3SI3H 4K60A 3A7WA 3ZYEA 2OCVB 3U8OH 1ELGA 1GBAA 1ELTA 5CE1A 1E37B 1ZR0A 4XSKU 2NU0E 5EQRA 2AS9A 1JIMA 2Z9GA 1P3CA 3T28A 4JZ1A 3P8NA 1C1UH 1OPHB 1VR1H 3ZZ7A 1O2RA 3LIWA 2QXHA 5L6NH 4BAMB 3M3VA 2QCYA 2XBYA 3RXSA 2GZ9A 4NIVA 3T62A 1SLVB 1C1TA 1GI7B 2GDDA 1THPB 5GCHF 1ANCA 1C1MA 5A0AE 3LKWA 4ABBA 4H6TA 1FMGA 2SFAA 3BTGE 1UTPA 1HAZB 1G3EA 3DFLA 2BVXH 1TNKA 1C2GA 3VB6A 3BTHE 5T6FA 2B8OH 2V35A 1YKTA 3ZVFA 3UIRA 3QWCH 2ANYA 1HJ8A 5K7RA 2C3SA 3A7ZA 1HAGE 1O37A 1O5GH 2J92A 1AB9B 1SHHB 2JH0D 4FU9A 1PQAA 1GJ8B 2ODPA 2XCFA 3BG8A 5A0BA 1P0SH 1V2RT 3RC4A 4X1SU 2ZPRA 2ILNA 2LPRA 1S0QA 3GY2A 3FZDA 3GDUA 3A8AA 5E0HA 2Y5GA 2IJOB 4YZUA 1SL3A 2G5NA 1GHWH 2ALPA 5EW1H 1ESAA 1TYNA 4X2VA 1E36B 2GD4B 2ZHFH 3EA9A 1OYTH 1CQQA 1TWXB 2OBQA 1HLTH 1O3LA 3ZZ9A 2H6MA 4XFQA 3RXLA 1CHGA 1SGIB 1C9TA 1ZTJA 5JB9S 1ANBA 1LMWB 1P06A 1JXPA 1NN6A 3BEUA 3SJ9A 1CHOG 3LONA 1QR3E 1XUIA 1SVPA 1KSNA 3O8RA 2UWOA 1DDJA 2GMTC 3ZVAA 1ESTA 1IQGA 3EQ0H 3RU4E 5DGJA 3HGNA 5C1XA 1HPGA 1O3KA 1P9UA 4YOGA 4CRFA 1CA8B 1CSOE 2ZPSA 3SOSA 3UTUH 3MNCA 1SSXA 3TK9A 4KTUA 2TIOA 4KP0A 5C5OA 4F4OC 1QQUA 1C2DA 4TY7A 5JB8S 2ZP0H 1UVSH 1IQMA 3EYDA 3QK1A 4AGKA 1YF4A 1VCWA 4AX9H 2ZHQH 2C8ZB 3W94A 1FV9A 1ZRKA 3UR9A 4DOQA 3UNQA 3BTEE 1V3XA 4JYTA 4OS4A 5FBEA 1JOUB 2AFQB 2WPLS 1HGTH 1CT2E 2F91A 1DOJA 1O3NA 4M7GA 3GCTG 4DG4A 7ESTE 4TWWA 1TGSZ 2B5TB 1BTPA 3LOXA 1Z1JA 1G3BA 1OP0A 2BVRH 2JH6D 3O8DA 5A8ZA 1UJ1A 4ISNA 1E34B 2QY0B 1GJ9B 1GHZA 3MNSA 1LPZB 3GCOA 3SUEA 5JBAS 3RXJA 2GZ8A 2SGFE 2A4RA 3RP2A 1GBHA 1CA0C 3SU4A 1BCUH 4Z6AH 1O5DH 1QL7A 3NUMA 2VWNA 3VXFH 1AVWA 1IQJA 1FQ3A 3QGJA 3UOUA 2OTVA 1D3DB 1QIXB 2F9PA 1F0SA 2XW9A 2V0BA 4JYUH 1YGCH 3D65E 4I7YH 8KME2 1GI6A 1SFQB 3RU4D 4NG9H 5DKMA 5L2YH 2VGCB 1ABJH 4AZ2B 1O3BA 2QXJA 2ZU2A 3M37A 2GT7A 4THNH 1DPOA 1BBRK 8GCHF 3ZZ4A 1PPHE 1ZJDA 4YTAA 3VGCC 3PB1E 1BZXE 1P2MA 3M5NA 2FODA 3MHWU 5C5NA 3MU1A 4Q7ZA 3DA9B 2D8WA 1A4WH 1S84A 3SNDA 2G55A 2IOTA 3ZZBA 4B74A 3ODDA 1C1VH 2FESH 2ZG0H 4Y10E 1EZSC 1O2OA 2RDLA 2OBOA 3SU2A 3L33A 5T3HA 1YC0A 1DITH 1DS2E 2G4TA 2ANWA 1QJ1B 4X1NU 1SR5C 3GCHC 2ZGBH 1WQSA 1C1WH 2KAIB 4X1QU 1C2MA 3HKIB 5C2ZA 2ZFSA 4H4FA 3LT3A 1EASA 4ABJA 1ARCA 1PQ7A 1ELCA 1LKBA 1DLKB 5GJ4B 4B2CA 5FPYA 2J95A 4JK5A 3BTWE 2HRVA 1TFXA 4GVUA 3K65B 2A0QB 2A7JA 2C93B 4YOJA 2VWMA 3V13A 1TGCA 1WV7H 4ZROA 2A7CA 5TCAA 1VZQH 1CA0B 2ZCKP 4F49A 2UUYA 1DXWA 2RG3A 1GJDB 2STBE 2OQ5A 2FMJA 1HXFH 2PFEA 1W11U 4RN6A 2EI8A 2R0KA 1C4U2 3KQDA 1GI4A 1D4PB 1O2NA 2GX4A 3MI4A 1GHAG 1OS8A 1QA0A 5J4SA 1SGNE 1AZ8A 4MPXA 4K8YA 1KXFA 1O3DA 3MH4A 4DCDA 1EAUA 3ATKA 4GAWA 1NC6A 1BBRE 2A4QA 2XBWA 4IW4E 2AIQA 2F3CE 2P3FH 1O35A 3E0PB 3S7HB 3URCA 3TK5A 1O5EH 1VITG 3Q3KA 1C4Y2 1O3FA 3SO3A 3LPRA 1P01A 4B75A 1F92A 3MH7A 1GJ4H 5AVDA 1F5LA 1MAYA 1C1OA 1LCYA 2FOAA 3GCHB 1IQEA 3D23A 1H9HE 4ZHAA 3SQEE 3RDZA 2PKSC 3RXRA 1AI8H 4ZMAH 2GV6A 5E2PA 1GDUA 2XC4A 1HBTH 1IQKA 2ZC9H 1UTOA 1Z8IB 2ZDMA 3PMHB 1L1NA 3A84A 2WV5A 3MH5A 3SNCA 1BRUP 1CHOF 1QFKH 4O9VA 1QNJA 1SI5H 3NKKA 4ZAEA 1NRNH 4MNYA 3W95A 1F5RA 3BF6H 1BTUA 2Z94A 2PWXA 2SGAA 2BLOA 5GDSH 3RXMA 1C5OH 4ZHLU 2P95A 2AYWA 2OC7A 4E7NA 3P70B 2WV4A 3AAUA 1FIWA 4INKA 4Y0YE 4FVDA 1DVAH 4AFUA 2BDYA 3L6PA 3ZZ8A 2ZFPH 1G2MA 1C5PA 5EPNA 1ACBE 1BRAA 2J34A 3F1SB 3A8CA 4RKJB 1TX8A 1OOKB 1LDTT 1AY6H 1B0FA 3UQOA 1O3GA 1Y5AT 1BDAA 1P2IA 1E38B 3F68H 1LQEA 1FY1A 4ABGA 1Y5UT 1ZSLA 1FLEE 3U69H 3F6UH 1O38A 3EAJA 1O34A 3EGKH 3P95A 1P12E 1V2KT 4XE4A 1X7AC 3KF2A 3GDSA 4NIWA 3GY8A 2JH5D 1C5QA 2VIWA 3GCTF 3MU0A 2ZDAH 2HVXA 1GVLA 3K6ZA 1A61H 2V6NA 2EI7A 3PWCA 1F2SE 3F9HA 4O03A 2GGVB 4I32A 1O2VA 3KHVA 1TLDA 5A8XA 2VU8E 3KCGH 1IQLA 2AMDA 2PKSB 4XBBA 5EXMA 1TRYA 1C2JA 2A32A 3E91A 4MLFB 4NSVA 4UFDH 1YPMH 2ZU3A 2VIOA 1SC8U 1ID5H 1SBWA 1MU6B 1MCTA 3HK3B 2HGTH 1O3CA 4ABAA 2C4FH 3TNTA 4YT6H 1HNEE 1AVXA 2QA9E 1FY4A 1C5XB 1UK3A 1L0ZA 3M35A 1O2HA 1LHFH 2ZDVH 4D7GA 2PKAA 3SN8A 3SNAA 4A1VA 4OS1A 3H5CB 3JZ2B 1OWEA 1P05A 1ZLRA 4HGCA 1ELDE 1EPTC 3FVFB 4WJG2 3TJNA 3PMJA