3FZZA

Structure of grc
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
227
structure length
227
Chain Sequence
IIGGNEISPHSRPYMAYYEFLKVGGKKMFCGGFLVRDKFVLTAAHCKGRSMTVTLGAHNIKAKEETQQIIPVAKAIPHPDYNPDDRSNDIMLLKLVRNAKRTRAVRPLNLPRRNAHVKPGDECYVAGWGKVTPDGEFPKTLHEVKLTVQKDQVCESQFQSSYNRANEICVGDSKIKGASFEEDSGGPLVCKRAAAGIVSYGQTDGSAPQVFTRVLSFVSWIKKTMKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of granzyme C reveals an unusual mechanism of protease autoinhibition
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords Granzyme C
total genus 49
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3fzzA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3fzzA02
4I8JA 3MYWA 3UTUH 3ITIA 1L1NA 5JBBS 2Y82A 2VVVA 1GBKA 1HYLA 5LPFA 1MQ6A 1E0FD 2B7DH 2D26C 1LPKB 1O2KA 4I32A 4X2XA 3SU2A 1OWIA 4H6SB 1O2SA 2JETB 1VZQH 1IQMA 5FPSA 5JYIA 3ZYEA 3A82A 3ATLA 1LHCH 3R0FA 1IQKA 1PPZA 4E7NA 2A2QH 1TALA 1V2ST 1LQDB 1VJ9U 2SNWA 1Y3UA 1ELDE 2ZDKA 1O5BB 2AGIX 4TY7A 2QF3A 1TIOA 1WCZA 1GI0A 3RM0H 4ISLA 4X6PA 2I6SA 1YPHE 1VGCB 2P3TB 1P9SA 5FCKA 5JBAS 1C4U2 2V0BA 1KXFA 2FOBA 3SU4A 1EQ9A 4INKA 1ELEE 2R3YA 4OS4A 2C8XB 4UONA 4O9VA 5AFZH 1QGFA 1W7XH 1V2MT 3F9GA 1QJ6B 1O3NA 1UK4A 2GX4A 1O35A 1GJDB 1BQYA 3TLOA 4AB8A 1BT7A 5A8XA 1IQEA 1C1RA 4AB9A 4MTBA 1GCDA 1H1BA 3M36A 2FP7B 4NWLA 5DGJA 4IN1A 3A89A 4B2AA 3BV9B 3PMJA 4XOJA 3SBKA 1HV7A 2G8TA 2JH5D 2Z94A 8KME2 2WPLS 1D3DB 3MTYA 4A5TS 4B2BA 3SUDA 1O2MA 4JYTA 2J9NA 1MKWH 1ARCA 4X6NA 3SO3A 4MQAA 2RCEA 2XBWA 1C2LA 2G00A 1EKBB 1GHVH 1P3CA 1Y3YA 3TJNA 1D6WA 3OY5U 1QRWA 4GCHG 3URCA 6GCHG 1O2NA 1IQHA 4ISHH 2BDYA 1FPCH 1OWHA 3ENSB 3DFLA 2W7SA 4NCYA 1BDAA 2GCTC 2QXIA 3B9FH 3RDZA 4Y7BA 4NWKA 2SGQE 3M5NA 4TYDA 1G3CA 3U8TH 3SORA 1C5TA 2VNTA 3S9BA 3UR9A 2BY8X 1HJ8A 1LCYA 1QQ4A 3SHCH 1FZZA 5FBEA 1A0JA 3E90B 3PTBA 1BUIA 3U69H 4K3JA 1GBBA 4BTIB 2OCVB 2OD3B 1FN6A 1P03A 2AFQB 3Q3KA 1ZJKA 1K1IA 1C5ZB 3K65B 3LH1A 1F5LA 3ZZ7A 1C2IA 1JXPA 2F9UA 2KAIB 2O9QA 2ZDMA 3RM2H 1AVGH 2AIQA 5HM2A 1C5NH 3EAJA 3SU0A 2P93A 1S84A 1XUHA 3EQ0H 4INLA 1MU6B 1MU8B 1E34B 1EOJA 1C2FA 4Q7ZA 4WXVA 3RXTA 1ZZZA 1G9IE 3SNCA 1QFKH 5CHAB 5DPAA 1OWJA 4JZEH 3SV7A 3KN2A 2PFEA 2GV7A 1BRBE 1L4DA 4DCDA 4XBDA 3KF2A 2UUKB 5FBIA 3M3TA 1SGFA 3MNCA 3UNSA 1QA0A 1EAUA 1HCGA 1TB6H 1QL7A 3QX5H 3MO9A 1SLUB 1EASA 2LNCA 4MDSA 4KP0A 3ELAH 1BRAA 2OBOA 2P16A 2XXLA 1A3BH 3M37A 4R0IA 1ZHPA 3SU3A 2H5DA 1NU7B 3CS0A 3TK9A 2HALA 7GCHF 1WV7H 2Y7ZA 1RRKA 1CGJE 1NT1A 2ZIQH 4O97A 3ZZCA 1J8AA 2ANMH 1RJXB 1A46H 3P8NA 1HFDA 1GDQA 1F92A 3RP2A 4GSOA 1C2HA 1FMGA 2UUFB 5HMAA 2HGTH 3BEIB 1WU1A 1SBWA 3UQOA 1Z71A 4LK4A 2VWOA 1C1PA 1TPOA 1NU9A 1G36A 1TPSA 3UOPA 1YCPH 4XBBA 1F0UA 3RXOA 4XBCA 4B71A 3QUMP 2ZTYA 1G2MA 1HXEH 6CHAB 1A4WH 1UVTH 3A83A 1DPOA 1ELGA 1Z8IB 4U01A 1UMAH 4XFQA 1DM4B 2DUCA 3BTGE 3ZZ8A 3SU5A 3GCTG 1Z7KA 3URDA 1UTLM 3T29A 2ZCHP 1TMUH 2Y6TA 4ZH8A 2OC7A 1JOUB 4D76A 3TGIE 2A4OA 2O8MA 1MTNC 1GMCG 4ISNA 2BMGB 2OC1A 1ANCA 3SQEE 1GG6C 1MTUA 1QR3E 3E0NB 2W3IA 3LC5A 1LHEH 1PFXC 1KYNA 3STIA 1MAYA 1CGIE 1EX3A 1QRZA 1CU1A 1PYTD 2WPJS 1P0SH 1GHWH 1FY5A 2BLQA 1RGQA 4IN2A 1V2UT 3RXQA 4ZHAA 2G5NA 1EOLA 3A8AA 3P8GA 3HKIB 2H1UA 2H5CA 3PO1B 4ESTE 3A7TA 1FNIA 3EGKH 2F83A 3FANA 4WJG2 1TQ0B 4AGJA 1O33A 2XBYA 3RC5A 3SZNA 2YOLA 1MKXH 2O8UA 3GICB 5TCAA 2ZFTA 3SGQE 1O2RA 3L6PA 1QNJA 2Q6DA 4ZAEA 2ZP0H 3TITA 2QIQA 3NZIA 2AS9A 1SQOA 2GGVB 1FUJA 2VIDA 1M9UA 1OX1A 2WUCA 1O2LA 2AMPA 3GY4A 1ZMNA 1AQ7A 2BZAA 1FONA 3EA7A 3B23B 4CRBA 2BXUH 2CF9H 3TK6A 2H9HA 4IMZA 1OKXA 3RXFA 2V6NA 3HKJB 1HDTH 1O3PB 2TGAA 2BQ7B 3F6UH 2IN2A 2ZNKH 3Q3YA 1UTMA 1Z8JB 4GUXA 2VU8E 1NZQH 4MNXA 4MLFB 3TNTA 1TNHA 2UWOA 2Z9GA 1BMMH 1Q3XA 3SJIA 3ZVAA 4NZQA 1TGTA 3SGAE 1MAXA 1ZMJA 1W2KH 1CHGA 1C2DA 5GCHG 1QBNA 5DP3A 1BBRK 3GISB 2ZFFH 3I29A 1IQLA 1S6FA 5JDUB 2CHAB 1TRYA 3BG4B 3GCHC 1N8OC 1S0RA 2BD2A 1EZXC 4K2YA 4ZHMU 2BHGA 3SUEA 1ZTJA 2ZHWH 5ABWA 1LDTT 1NRNH 3A7ZA 1SHYA 1W7GH 3BTKE 2W26A 1KTSB 4ABAA 3GOVB 4YLUA 1V2OT 4FUDA 4ISOA 1UVUH 3W95A 3GDVA 1IHSH 1Y3VA 5L6NH 3TH3H 8GCHF 1F5KU 2A4GA 2BYAX 4H42U 2QXGA 1O5EH 2VGCB 3WY8A 4Y8ZA 3FP8E 3UQVA 1PPFE 3BTME 1O0DH 1UVPA 3VXFH 3HPTB 2Z9IA 1YLDA 4Y8XA 1PQ8A 4KKDA 2BVSH 1X7AC 2GDEH 2ZPRA 1MQ5A 4AGKA 2Z6BD 1VCWA 4ABJA 1V2LT 2ZGXH 3NXPA 3MWIU 1ZSKA 1AE5A 1BBRE 1P2IA 4DJZB 1U6QA 8ESTE 1TX7A 1W8BH 2BDGA 1C2MA 1K1OA 2Z9KA 2SNVA 2F3CE 1Y8TA 2BD4A 3TJVA 5GXPA 4NSYA 1NY22 1YP9A 2HVXA 4RSPA 5K0HA 4KTCA 1CHOG 2K1QA 1CHOF 2ZWLH 1FAKH 2NU1E 4YT7H 3QGJA 2BDIA 3M5OA 1BJUA 2PW8H 4NSVA 1A3EH 1HUTH 1V2VT 1SLWB 5GWZA 4XSKU 3F9EA 1TGNA 1AFQC 1L2EA 2OC8A 2ZPSA 5DK1A 1AU8A 3Q00A 2Z3EA 3P92A 4BOHA 5EOKA 2DE9A 3UNQA 1BMNH 3VB4A 2Z3CA 7ESTE 4AFSA 2ZCKP 3TGKE 4NA7A 4IBLH 1P04A 1BOQA 1NFYA 1SL3A 2ZZUH 3KHVA 1YPEH 5DP9A 1LTOA 4Y8YA 1OWKA 4FU9A 3BG4C 4ZXXH 1PPEE 3MU4A 4FUHA 5C5NA 1LHDH 4DVAU 3RXHA 1P01A 1JRSA 3SV2H 1QY6A 1J17T 2STAE 3DT0H 1EAXA 3UIRA 4TWYA 5C1UA 1QQUA 4ZKRU 2FLBH 1PPHE 5EPNA 2FTMA 3PWBA 4WF8A 2FS8A 5DG6A 3SNAA 1SGFG 2ZCLP 2CHAC 1P12E 1E38B 5ESTE 2OBQA 2WV4A 1GMCF 2A4QA 1AIXH 1Y59T 1ZPBA 3AAUA 3OX7U 4NG9H 1T8MA 2B0FA 1YCPK 3JZ1B 1GDNA 1MCTA 2ALPA 4FUIA 2FEQH 4FXGH 3LPRA 3ZVGA 1NRPH 4BNRA 5C3NA 1BMAA 1KXDA 2FODA 1C2KA 4O3TA 2HPQH 2ZC9H 1VGCC 3MNSA 1FY4A 3OU0A 1ELBA 1SGTA 4AFZA 1BRCE 2FOFA 1ZSLA 1GBIA 4O03A 1ARBA 1WYKA 2GCHF 3TK5A 3UNRA 3GY6A 2HWLB 2FPZA 3U98H 1O3JA 1VCPA 1LVOA 3AAVA 4Y11E 3ZV8A 4TWWA 1TNLA 4BAHB 1CO7E 1SMFE 1GPZA 1GJBB 3O8RA 1MTNB 4NFEA 5FXLA 1NFWA 3V13A 2WPKS 5EG4A 4BAQB 2GMTC 1CA0C 2FZZA 2CF8H 1BHXF 1TWXB 1LO6A 1N1LA 3PTNA 4WVPE 3E8LA 1T4UH 2VGCC 1NO9H 1YPMH 1O37A 2J94A 5FHTA 1Y3XA 1V6DA 4I8LA 3MNBA 3RXKA 2O8WA 4AFUA 3LGTA 1ANBA 3T26A 1KDQB 1BBRH 3RC4A 4FUBA 4YM9A 3C1KA 1YPJH 1EB1H 1UTKA 3BN9A 3KIDU 1BTZA 2QGRA 1RIWC 4GVUA 2BD5A 1A5GH 1A2CH 3RU4E 5T6FA 1HAHH 6ESTA 4KGAA 4K60A 3Q77A 3LGUA 4X8TH 1BHXB 3ATIA 4KELA 4OS6A 3RXSA 4IW4E 4JZ1A 2G4TA 3PLPA 1K9OE 2BDHA 1J16A 1GI6A 1JRTA 2WPHS 2BY7X 5AHGH 1EPTA 4Q7YA 3DFJA 2QC2A 1Y5UT 3PLKA 1O3BA 1ELFA 1YM0A 2FX6A 1ELCA 2H6MA 2NU2E 2R2WU 3IWMA 4D9QA 3FAOA 2ZFPH 5EW1H 3NWUA 1OYQA 1C5SA 3TJUA 2G5VA 1ZHRA 1P2JA 2QAAA 3LGWA 5C1YA 1BTWA 4X1NU 2PKAB 1GI1A 4PROA 4ZUHA 5FPTA 1BIOA 1PQ5A 3HGPA 1GVKB 2QN5T 2HNTC 1EZSC 3NCLA 5DP6A 4UDWH 4U32A 5DP7A 5I25A 1YBWA 3A7YA 4NA9H 1AUJA 1O3DA 1NFXA 1XMNB 1ZRKA 1B0FA 2A4RA 1TX8A 2JKHA 5PTPA 5HGGA 3FZZA 1O2PA 4O3UA 1DUAA 4FVBA 1RTFB 2ZU3A 1TRNA 4X1SU 5E8EH 1HAGE 5BPEA 3RXEA 2J92A 3SW2B 4FUCA 1N8OB 2F9OA 3P17H 3I77A 1CE5A 3M5LA 1S83A 1HIAB 4Y6DA 2ILNA 3S69A 1AO5A 1UJ1A 2BVRH 2Y7XA 4DURA 1XUIA 2Z9JA 5K7RA 2OQ5A 3PV4A 1OS8A 4YO9A 4MNYA 2H2ZA 2F91A 4E05H 2ESTE 2GVFA 4CH8B 4UFGH 4OS5A 5FAHA 5EODA 1W0ZU 3BSQA 4UEHH 1A5HA 2VWMA 1EPTB 1H8IH 2BD7A 3UREA 1WAYB 3A81A 4XE4A 1XUJA 2HNTF 1XKAC 3TIUA 2PSYA 3DHKH 1FY8E 1GHZA 1KIGH 1TONA 2FOMB 4FU7A 1T31A 5TCCA 1GHAF 1IQIA 1YPKH 1D4PB 2GKVE 2ZHQH 3UPEA 2Y5HA 3SUFA 3GY2A 2PKSB 2SGAA 1Y5AT 1ABJH 3GYMA 5A0CA 6GCHF 1LKBA 2ZU1A 1FN8A 3IG6B 1C9PA 1H9HE 5AVDA 2SGFE 4CBNA 2Y5FA 4I8GA 4Q80A 1MBQA 1OP8A 1D9IA 4BTUB 3A84A 4Y0YE 4AZ2B 1S81A 1B7XB 2HOBA 1O39A 3MH5A 1OXGA 2B8OH 2PHBA 1MTSA 1CA0B 4NIWA 4CREA 1KLTA 4GHQA 3TH4H 1HPGA 2W7UA 2AYWA 2CMYA 2GP9B 3MO6A 1UCYK 1GJ8B 5JPMH 2BX4A 2VIOA 4UFEH 2BY9X 3SNBA 3FVFB 4DIHH 5EPYA 1O3IA 1P2QA 1JIMA 3PM3A 4X2VA 3S9AA 1DICA 4BXSA 2BVXH 3M5MA 5BRRE 3BTDE 3T28A 3K6YA 1QA7A 4X1RU 2D8WA 2OLGA 3ZVEA 2O8LA 1G3BA 3LKWA 3QN7A 4ABDA 1P09A 3RXBA 3E3TA 1NC6A 2FOHA 2FI4E 1BTHH 2ZFQH 3L3TA 2W3KA 2GV6A 2GCTB 1BRUP 1HAZB 1P3EA 3CP7A 1QBVH 2BD8A 1DWEH 1L4ZA 1VITF 2FO9A 1TLDA 2FIRH 4RN6A 4DT7B 2OQUA 3FZDA 1HAIH 1SSXA 3NKKA 1YKTA 1O2IA 1A1RA 1GMHF 4AYVB 2ZECA 3LGVA 2OXSA 1GBEA 3BTEE 4THNH 1ID5H 5CE1A 1EUFA 1SG8B 2XRCA 1DDJA 1ZJDA 1UHBA 1Z6EA 1ZLRA 3BTHE 1AN1E 4K8BA 4SGBE 2VB0A 1TNKA 2SGEE 3Q76A 1O34A 1F0TA 1TGSZ 1D3TB 2RG3A 4ZKSU 3ATKA 4CR5A 1GJ5H 2FS9A 1ACBE 1OP0A 3T27A 2XCFA 3SU6A 3FP6E 1C1UH 1O2XA 4D7FA 1W12U 1SB1H 2VH6A 1O2TA 3V0XA 1P2NA 1P9UA 1TOCB 1CBWB 2JH6D 1NRQH 3KEEA 1TFXA 1PPGE 3CS7A 2ZDNA 1GHAG 1K1NA 2JH0D 2ANWA 1GVLA 2ZF0H 2BDAA 1ABIH 3S7HB 1AE8H 2F9VA 4D8NA 1HBTH 1KSNA 2EEKA 3BTQE 2KAIA 1H9IE 1SI5H 1QL8A 1DLKB 1V2PT 2NU4E 1PPBH 4JK6A 4IMQA 3SNEA 1C5RA 1YPHC 4DIIH 1ESBA 2C90B 1CT4E 5L2ZH 1TA6A 4K1TA 2ZPQA 2WPMS 3D62A 4UD9H 1GL1A 4ZKOU 2GZ9A 1S85A 1P2OA 4Q2KA 4Y10E 2B5TB 2P3UB 3ZYDA 1THPB 4YOJA 1T32A 2OUAA 2J38A 3L33A 1C1OA 1K1MA 1P06A 1AD8H 2XBVA 1MTWA 3SI3H 4UFDH 1TBQH 4MPWA 1MCVA 4WMFA 2FOGA 3N7OA 1T4VH 1SGIB 1DY9A 3D65E 1AUTC 1MZDA 1OWDA 1XUGA 1YPGH 1C5VA 4A1TA 5A2MH 1SFQB 1OOKB 4NGAH 5EQQA 1J9CH 2A0QB 4AX9H 1BB0B 1HAPH 4ABBA 2XTTB 2ZFSA 1S6HA 4FUFA 1NESE 3I78A 1KLIH 3RC6A 3BTFE 4Y7AA 2SGDE 1EJMA 4DOQA 3LJJA 1YYY1 3NUMA 2WINI 3VGCB 3HGNA 5E0HA 1C5PA 3LJOA 3RXDA 7KMEH 3KCGH 3MOCA 1K1PA 3M3VA 3D49H 1EJNA 3RXVA 5A09A 1GJCB 1HJAB 2BLVA 3DD2H 2FI5E 1YPLH 1WBGB 3KQBA 1P10A 1HRTH 1BTXA 1GI2A 1PQAA 3LDXH 4JZIA 1KDQA 1O3CA 1VITG 2GCHG 4TPYA 1YC0A 4X2WA 4X0WU 1SGEE 1QIXB 3MH4A 3K6ZA 4WMDA 2THFB 1JIRA 4M7GA 2AEIH 2C8WB 4YLQH 2VIPA 3GCOA 4FUEA 2ZTZA 2P94A 1SFIA 1TGBA 3MU5A 5DJ7A 1GJ6A 3RMMH 4Q7XA 4YTAA 3E6PH 2BD9A 3GCNA 2OTVA 4IC6A 4SGAE 3EA8A 4Z0KA 5F8ZA 1DX5M 2G4UA 5CMXH 1GCTB 3MHWU 3VB6A 4E06H 5HXFA 1V2WT 3BIVH 4NIVA 3JZ2B 3KQEA 1GDUA 1G30B 1O5CB 3ZZ5A 3E16B 2IOTA 1EXFA 1SR5C 1E35B 3M7UA 1TRMA 2ANYA 1GI5A 1GHBF 2FYRA 2TGDA 2BXTH 2BB4A 3GCHB 3QZQA 1DSUA 1FIWA 2A7CA 1TBRH 1C2GA 1GBMA 1CGHA 3VFEA 1C1QA 2YNAA 3MU1A 3KNXA 1EZUC 4GPGA 2PR3A 1TGCA 3M7TA 5JBCS 2ZU2A 2ZGJA 4Y76A 2BY6X 4Y71A 4OGXA 3PMHB 1C5MD 3RXMA 2BOKA 3OTJE 2FWWA 4X2YA 1LVYA 1F2SE 4GHTA 2PKAA 1QBOA 1JMOH 1ZYOA 1C1TA 4RKOB 4ZHLU 5F6MA 2FTLE 2A7HA 1OWEA 4CR9A 1O5AB 1CBWC 1TE0A 1Z1JA 4CBOA 5B6OA 4AFQA 1UTPA 2Z3DA 1B5GH 1AKSA 5H4IB 4NIXA 1K21H 1O2QA 1FPHH 1O30A 2GDDA 7LPRA 2HPPH 1MZAA 1TABE 3BIUH 3E91A 6CHAC 1N6XA 3F9FA 2TGTA 1J15A 2J34A 3HK6B 3ZVFA 1RS0A 2ZI2H 3ZZ6A 1CT2E 5AFYH 2OINA 1T8LA 1ZRBA 3TU7H 3UWJH 3EYDA 2QF0A 3T25A 1L1GA 1EATA 4OS2A 1AY6H 4B1TA 2H9TH 2OC0A 1A61H 3A8CA 4X6OA 4BTTB 3GYLB 1C5LH 3SV6A 4YZUA 4I31A 1NN6A 1SGPE 3P70B 1O2ZA 1A5IA 1HNEE 1GHXH 1IOEA 1TYNA 1DY8A 2BM2A 4J1YA 4QT8C 1GWAA 4YT6H 6LPRA 3RXCA 1G37A 5SGAE 3RMLH 4HTCH 2PSXA 2PKSC 1DFPA 2ZHDA 1HJAC 1AVXA 5AF9H 4B2CA 2VINA 1RD3B 1GBTA 2P59A 4B76A 1O3GA 2AMQA 1O2HA 2G81E 4MG3A 4BAMB 2PTCE 1C5WB 1C5XB 1SGQE 2FOEA 1NRRH 3GDSA 1K22H 1GJ7B 3H7TA 4ZXYH 5F03A 3U8RH 5GCHF 3DA9B 5A8YA 3V3MA 2PUXB 5T3HA 3SU1A 2BZ6H 1OPHB 2VWLA 4WWYA 5EGMA 4B73A 1AI8H 1FV9A 3V12A 1CA8B 1AZZA 1W0YH 3QGNB 1F7ZA 3MH7A 3UWIA 1WQVH 4U2WA 5E2OA 1AWFH 1DXWA 1Q31A 2ZGBH 4F4OC 1V2NT 1K1JA 1OP2A 1D6RA 4NFFA 4UE7H 1HAOH 2G52A 1GI7B 1SGNE 3ESTA 2ZHFH 1XX9A 2BTCE 1ANEA 2A5KA 2C8ZB 2QA9E 1GL0E 1FY3A 3GCTF 1VJAU 1UTJA 2TPIZ 5C20A 3MMGA 4NZLA 3E0PB 5J4QA 2I6QA 1GBAA 4FUGA 4D7GA 3RUOA 1UVOA 4DW2U 4BAKB 2F9NA 3P95A 3U8OH 1GCTC 2CN0H 1FAXA 3UY9A 1S82A 3UUZA 3KGPA 3LC3A 1EAIA 1V2JT 3ZZ9A 1QHRB 4XDEA 1HB0B 1GJ4H 1VR1H 4Z6AH 3ZZ4A 2ZEBA 5G4BA 1SVPA 1MUEB 1THRH 2C3SA 2M5TA 2BX3A 8LPRA 2AGEX 2ODPA 4MPUA 1EAWA 1YGCH 4RKJB 1EP5A 3A7WA 3MFJA 1GJAB 1ZR0A 5A8ZA 2D2DA 2XWAA 4MPXA 2GTBA 5E2PA 1GVZA 3FP7E 2XYAA 2ZDVH 2ODQA 1E37B 1F5RA 1ANDA 2QV1A 4ABEA 1YCPM 3LGIA 1RFNA 3GY8A 2Z9LA 1KXAA 1H9LB 1FI8A 4J2YB 1IQGA 1MD7A 2PV9B 1BMLA 1D3QB 3W94A 4YESB 3O8DA 2A31A 5J4SA 1ESAA 1LVMA 4X8SH 3G01A 3RXPA 3SI4H 1O2UA 3QDZB 1DLEA 2J4IA 2FYQA 1TMTH 2J2UA 2C93B 1FJSA 3ODFA 3TPIZ 1W13U 3NK8A 2YNBA 2DE8A 4CRFA 1DWDH 1C1SA 3O8BA 1OYTH 2R9PA 2ZFRH 1QJ7B 4I8KA 1C4Y2 4LZ4B 2AGGX 3QK1A 1DXPA 1TMBH 5DP5A 1C2EA 2O8TA 1SPJA 4Y79A 3IITA 1TNJA 1ELAA 1Y3WA 3VEQB 1SHHB 4MVNA 3EA9A 4B75A 1INCA 1RTKA 3A8BA 2PUQH 1YLCA 1NM6A 2HLCA 1W11U 1ZGVA 2R0LA 4LXBH 4NIYA 3U1JB 2TRMA 3RXLA 3TJOA 1O5GH 3QZRA 1KXEA 1IQFA 5ETXA 4CH2B 4ABFA 5ESBA 1K28D 2WYGA 1SOZA 3K9XB 1WOFA 5LPEA 4LZ1H 4MNWA 4ABIA 1DWBH 3PB1E 5EU8A 4VGCB 1DOJA 4X8VH 2ZO3H 3R3GB 1O2GH 2XC4A 4CRDA 1SC8U 2R3UA 2XCNA 2VJ1A 2V3OH 2UWLA 4HGCA 2OP9A 3UOUA 3A80A 3RXIA 3C27B 2EI8A 3SN8A 1W3CA 2UWPA 1GMHG 5DP4A 4CRAA 2WPIS 1TBZH 1C9TA 3QWCH 1GI9B 3RMNH 3HK3B 3ZZDA 2TBSA 3VB7A 5EQSA 4K5ZA 2Y5GA 4AOQA 1G32B 4WH8A 2G51A 3RXJA 1UTQA 3SV9A 1L1JA 2LPRA 1SGYE 4A7IB 1D3PB 3F1SB 1Y5BT 1QRXA 1C1NA 1S5SA 1MH0A 1GBLA 5GIBA 5C2ZA 5F8TA 1LMWB 1T8OA 1GBJA 2FXRA 2FX4A 2AIPA 4DY7B 3ZVDA 1ZPCA 4F49A 1C5QA 2AMDA 2AH4X 1DVAH 2BDBA 3M35A 2FI3E 5DO4H 1TQ7B 1NRSH 2BD3A 5HM9A 1T8NA 5L30H 2FMJA 2WV5A 2VVCA 2BOHB 3BEFB 2ZQ1A 3PMAB 2QXHA 1DSTA 3RMOH 3F9HA 1UTNA 2C4FH 1UCYE 7GCHG 4IC5A 1DUEA 1C1WH 1TNIA 2VH0A 2ZKSA 4HZHA 2G55A 3OSYA 4X6MA 3A86A 3KL6A 5FPYA 3GDUA 1F0SA 2GT8A 3LH3A 3P8OA 1CSOE 1LHGH 1MKXK 1AWHB 2EI6A 3PYHA 4CRGA 1EZQA 1SQTA 4ZROA 1MBMA 1AB9C 1SGCA 3AASA 1PJPA 1W14U 4ZKNU 1UK3A 4TY6A 3DUXH 3ODDA 5JBTA 2A5IA 1MMJN 3VB5A 1IQJA 4JZDH 2GMTB 1WQSA 3PWCA 5C67A 1BTYA 1C1MA 1GI8B 4YOGA 2CXVA 4WMEA 3NPSA 1C2JA 3U9AH 2ZA5A 4CHAC 1SLVB 3Q3XA 2V35A 4I33A 1GG6B 2FESH 1ZTKA 3UFAA 1N6YA 2A1DB 1H8DH 3LIWA 1C1VH 2FDAA 1O31A 2P8OB 1O3FA 1SOTA 1KXBA 1QB6A 1Z8GA 1Z8RA 1ZGIA 2NU0E 1XXDA 1ZMLA 1RTLA 3D23A 5EQRA 1GBFA 3SJKA 5FCRA 1QB9A 2ANKH 3VGCC 5HYOA 3LU9B 3MO3A 4BXWA 4GCHF 1V3XA 2PGQB 5L2YH 1OSSA 1KLJH 1C5OH 1SGRE 1GBDA 5C1XA 1LQEA 1GGDB 1HIAA 1LVBA 3K2UA 1CT0E 2VIQA 2Y80A 4GLYA 3SHAH 1QB1A 4X1PU 1C5YB 3STJA 1DANH 4ISIH 4K69A 4GAWA 4D9RA 1HAVB 4IGDA 3FFGA 3P6ZB 3A7XA 2QXJA 2P95A 1XKBC 2GT7A 2BQWB 2RA0A 3E1XB 5CHAC 1XUFA 1O2OA 1FIZA 3LOXA 3M61U 1P2MA 5EXMA 1P11E 1V2KT 1SQAA 1BA8B 2BLOA 3ZZBA 2NWNA 4TPIZ 3V7TA 1O3OA 1O3LA 1UHBB 4JZFH 4FVDA 1O2WA 3PMBB 1PPCE 1AFQB 5DKMA 3S9CA 3AVZA 3KQCA 4I7YH 1EP6A 1UCYH 2GD4B 3F68H 1LPGB 3LONA 2A32A 3SGBE 1QURH 1PQ7A 1UK2A 3SJ9A 3KQDA 2A5AA 2H9EH 2XW9A 3A85A 1AHTH 1KTTB 1HAYB 5E0JA 2PGBB 1QCPA 2ZGHA 1FQ3A 1V2QT 4A1XA 3MI4A 3ZVBA 1VITH 4NA8A 5C5OA 4K1SA 1QL9A 3BTTE 1JBUH 2RDLA 3TNSA 2P3FH 4WH6A 4BANB 2A7JA 1TAWA 2XNIA 4H6TA 1XUKA 1O5DH 2NU3E 2VIWA 2PTNA 4DG4A 1WUNH 1QJ1B 4A6LA 1BITA 1GBCA 3RU4T 1NTPA 3B8JA 1W10U 1SLXB 1XXFA 1B0EA 2QY0B 4MPVA 9ESTA 4B74A 1IHTH 1A0HB 2W5EA 1SGDE 5GJ4B 2SFAA 1EPTC 4FU8A 1J14A 1T7CA 1V2RT 1F0RA 1HGTH 3ZV9A 3EDXB 3MH6A 4H4FA 2BY5X 2P8OC 1AB9B 1DITH 2B9LA 1MD8A 1AGJA 4ABGA 1KY9A 1P02A 3VXEH 5LH8A 5A0AE 1AZ8A 1E36B 4JCNA 1P57B 2XC5A 1BJVA 5IYTA 3RXGA 1G3DA 3RXAA 3A7VA 9LPRA 4AG2A 1O2JA 3BTWE 2A45B 3VB3A 2FOCA 2UUYA 3BEUA 1O2VA 3BG8A 1Z1IA 1QTFA 5FX6A 1O3KA 4HFPB 1A7SA 1WTHD 2TGPZ 4OS7A 3ZZAA 1KXCA 1TPAE 2CGAA 2VIVA 2BDCA 2GZ7A 2WUBA 3ATMA 4A1VA 2R2MB 5LPRA 4BAOB 2AERH 3RLYH 2STBE 2XC0A 1ETTH 3S0NA 1MKWK 3H7OA 1HJ9A 1JWTA 5T6GA 1DWCH 1ELTA 1BZXE 1UO6A 1ETRH 1C5UA 1ZPZA 2ALVA 1GBHA 3EE0B 4JYVH 3ZVCA 1NPMA 4X8UH 5F8XA 3HATH 1BTUA 3GY7A 4OS1A 1EJAA 3QTVH 1H4WA 4OGYA 3AW0A 1GMDF 1O32A 3U1IB 1FDPA 1DT2A 3PROA 3MU8A 1O38A 1UVSH 1IAUA 4VGCC 2CV3A 1GI4A 4JYUH 1ETSH 4FUJA 3PO1C 4INHA 1HAVA 4ZMAH 1K2I1 3RU4D 5LGOA 1WSSH 3PLBA 4MNVA 2VVUA 2EA3A 1FY1A 2VWNA 3LT3A 2FM2A 5FX5A 1G3EA 3MU0A 2ZU4A 3M3SA 1AVWA 3OYPA 2BLWA 4K1EA 5JB9S 5T6DA 3CENA 3TVJB 5IDKA 1LPZB 2XBXA 1DS2E 1GI3A 2SGPE 3SOSA 5EXLA 1NROH 4X1QU 4JK5A 2ASUB 4ASHA 1HAXB 1TPPA 1XVOA 3A8DA 8GCHG 3OY6U 1AMHA 1HXFH 3QLPH 1VCQA 3T62A 5GPIB 3LGYA 2EI7A 1O3MA 4IS5A 3H5CB 5I46H 5A0BA 4LOYH 3P8FA 1THSH 3SUGA 1ESTA 3RXRA 2FOAA 3M7QA 2FLRH 2JETC 3T2NA 2HNTE 1O3HA 3QO6A 3UR6A 1NFUA 3ATWA 1TOMH 5TJXA 2ZQ2A 4KTUA 4AORA 1AFEH 1PYTC 1FXYA 2XWBI 1XM1A 4K8YA 1ELVA 1O3AA 1O5FH 2C8YB 4HI3A 3VPKA 1ZTLA 1BTPA 2RA3A 2F9BH 1A0LA 4WXIA 4Y0ZE 2F9PA 5GDSH 1CVWH 2ZHEH 1CQQA 5JB8S 2WYJA 1GHBG 1P8VC 2Q6FA 2IPHA 2Z7FE 3BF6H 5E0GA 3S7KB 4YOIA 2CJIA 4AG1A 2ZG0H 5EW2H 4I8HA 2ZDLA 1FLEE 1L0ZA 2UUJB 3TH2H 2Y81A 4AN7A 1P05A 3RLWH 1TA2A 1O3EA 4AYYB 1C4V2 1ORFA 1G2LA 2HRVA 2R0KA 2V3HH 2PWXA 1NS3A 3QTOH 3O8CA 1HLTH 5EXNA 4R8TB 3ZZ3A 1GMDG 2ZU5A 3SNDA 2QCYA 1K1LA 2A2XH 1UTOA 4WY3A 1ZHMA 2ULLA 2ZDAH 3T5FH 2GZ8A 1GHYH 2ZTXA 1O36A 4CHAB 4ABHA 1IQNA 1XVMA 2BQ6B 2QYIA 3AW1A 3SQHE 4KTSA 2ODYB 1MTVA 2TIOA 3SJ8A 2IJOB 4A92A 1O2YA 1ZSJA 3GY5A 2EC9H 3A88A 3SV8A 3TGJE 1BCUH 1RXPA 4JMYA 1AKSB 1LHFH 4U30A 2J95A 1DE7H 1RIWB 1WTGH 2Q1JA 2ZGCA 1S0QA 2PLXA 3A87A 5DP8A 1YF4A 2D1JA 3GY3A 1EB2A 4DGJA 1GGDC 1TNGA 1Q2WA 3MNXA 2Q6GA 1V2TT 1TX6A 4UFFH 1Z6JH 1GJ9B 1P2KA 3SJOA 1LKAA 4CRCA 4E7RG 3RXUA 1ZOMA
chains in the Genus database with same CATH superfamily
4I8JA 3MYWA 4FOUC 3UTUH 3ITIA 1L1NA 5JBBS 2Y82A 2VVVA 1GBKA 1HYLA 5LPFA 1MQ6A 1E0FD 2B7DH 2D26C 1LPKB 1O2KA 4I32A 2J98A 4X2XA 3SU2A 1OWIA 4ACBA 4H6SB 1O2SA 2JETB 1VZQH 1IQMA 5KEDA 5FPSA 5JYIA 3ZYEA 3A82A 3ATLA 1LHCH 3R0FA 1IQKA 1PPZA 4E7NA 2A2QH 1TALA 1V2ST 1LQDB 1VJ9U 2SNWA 1Y3UA 1ELDE 2ZDKA 1O5BB 2AGIX 4TY7A 2QF3A 1TIOA 1WCZA 1GI0A 3RM0H 4ISLA 4X6PA 2I6SA 1YPHE 1VGCB 2P3TB 1P9SA 5FCKA 5JBAS 1C4U2 2V0BA 1KXFA 2FOBA 3SU4A 1EQ9A 5F53A 4INKA 1ELEE 2R3YA 4OS4A 2C8XB 4UONA 4O9VA 5AFZH 1QGFA 1W7XH 1V2MT 3F9GA 1QJ6B 1O3NA 1UK4A 2GX4A 1O35A 1GJDB 1BQYA 3TLOA 4AB8A 1BT7A 5A8XA 3DCLA 1IQEA 4RT1A 1C1RA 4AB9A 4MTBA 1GCDA 1H1BA 3M36A 2FP7B 4NWLA 1E1QD 5DGJA 4IN1A 3A89A 4B2AA 3BV9B 3PMJA 4XOJA 3SBKA 1HV7A 2G8TA 2JH5D 2Z94A 1COWD 8KME2 2WPLS 1D3DB 3MTYA 4A5TS 4B2BA 3SUDA 1O2MA 4JYTA 2J9NA 1MKWH 1ARCA 4X6NA 3SO3A 4MQAA 2RCEA 2XBWA 1C2LA 2G00A 1EKBB 1GHVH 2QF5A 1P3CA 1Y3YA 3TJNA 1D6WA 3OY5U 1QRWA 2F4LA 3WWBA 4GCHG 3URCA 6GCHG 1O2NA 1IQHA 1W0JD 4ISHH 2BDYA 1FPCH 1OWHA 3ENSB 3DFLA 2W7SA 4NCYA 1BDAA 2GCTC 2QXIA 3B9FH 3RDZA 4Y7BA 4NWKA 2SGQE 3M5NA 4TYDA 1OHHD 1G3CA 3U8TH 3SORA 1C5TA 2VNTA 3S9BA 3UR9A 2BY8X 1HJ8A 1LCYA 1QQ4A 3SHCH 1FZZA 5FBEA 1A0JA 3E90B 3PTBA 1BUIA 2YMSC 3U69H 4K3JA 1GBBA 4BTIB 2OCVB 2OD3B 1FN6A 1P03A 2AFQB 3Q3KA 1ZJKA 1K1IA 1C5ZB 3K65B 3LH1A 1F5LA 3ZZ7A 1C2IA 1JXPA 2F9UA 2KAIB 2O9QA 2ZDMA 3RM2H 1AVGH 2AIQA 5HM2A 1C5NH 3EAJA 3SU0A 2P93A 1S84A 1XUHA 3EQ0H 4INLA 1MU6B 1MU8B 1E34B 1EOJA 1C2FA 4Q7ZA 4WXVA 3RXTA 1ZZZA 1G9IE 3SNCA 1QFKH 5CHAB 5DPAA 1OWJA 4JZEH 3SV7A 3KN2A 2PFEA 2GV7A 1BRBE 1L4DA 4DCDA 4XBDA 3KF2A 2UUKB 5FBIA 3M3TA 1SGFA 3MNCA 3UNSA 1QA0A 1EAUA 1HCGA 1TB6H 1QL7A 4RT0A 3QX5H 3MO9A 1SLUB 1EASA 2LNCA 2XNDD 4MDSA 4KP0A 3ELAH 1BRAA 2OBOA 2P16A 2XXLA 1A3BH 3M37A 4R0IA 1ZHPA 2WHXA 3SU3A 2H5DA 1NU7B 3CS0A 3TK9A 2HALA 7GCHF 1WV7H 2Y7ZA 1RRKA 1CGJE 1NT1A 2ZIQH 4O97A 3ZZCA 1J8AA 2ANMH 1RJXB 1A46H 3P8NA 1HFDA 1GDQA 1F92A 3RP2A 4GSOA 1C2HA 1FMGA 2UUFB 5HMAA 2HGTH 3BEIB 1WU1A 1SBWA 3UQOA 1Z71A 2QF4A 4LK4A 2VWOA 1C1PA 1TPOA 1NU9A 1G36A 1TPSA 3UOPA 1YCPH 4XBBA 1F0UA 3RXOA 4XBCA 4B71A 3QUMP 2ZTYA 1G2MA 1HXEH 6CHAB 1A4WH 1UVTH 3A83A 1DPOA 1ELGA 1Z8IB 4U01A 1UMAH 4XFQA 1DM4B 2DUCA 3BTGE 3ZZ8A 3SU5A 3GCTG 3OFND 1Z7KA 3URDA 1UTLM 3T29A 2ZCHP 1TMUH 2Y6TA 4P00A 3OTPA 4FETA 4ZH8A 2OC7A 3KQ5A 1JOUB 4D76A 3TGIE 2A4OA 2O8MA 1MTNC 1GMCG 1W0KD 4ISNA 2BMGB 2OC1A 3PRDA 1ANCA 3SQEE 1GG6C 1MTUA 1QR3E 3E0NB 2IPQX 2W3IA 3LC5A 2J97A 1LHEH 1PFXC 1KYNA 3STIA 1MAYA 1CGIE 1EX3A 1QRZA 1CU1A 1PYTD 5CDFE 2WPJS 1P0SH 1GHWH 1FY5A 2BLQA 1RGQA 4IN2A 1V2UT 3RXQA 4ZHAA 2G5NA 1EOLA 2KFWA 3A8AA 3P8GA 3HKIB 2H1UA 2H5CA 3PO1B 4ESTE 3A7TA 1FNIA 3EGKH 2F83A 3FANA 4WJG2 1TQ0B 4AGJA 1O33A 2XBYA 3RC5A 3SZNA 2YOLA 1MKXH 2O8UA 3GICB 5TCAA 2ZFTA 3SGQE 1O2RA 3EE7A 2EQNA 3L6PA 1QNJA 2Q6DA 4ZAEA 2ZP0H 3TITA 2QIQA 3NZIA 1YY3A 2AS9A 1SQOA 2GGVB 1FUJA 2VIDA 1M9UA 1OX1A 2WUCA 1O2LA 2AMPA 3GY4A 1ZMNA 1AQ7A 2BZAA 1FONA 3EA7A 3B23B 4CRBA 2BXUH 2CF9H 3TK6A 2H9HA 2XOKD 1OKXA 4IMZA 3RXFA 2V6NA 3HKJB 1HDTH 1O3PB 2TGAA 2BQ7B 3F6UH 2IN2A 2ZNKH 3Q3YA 1UTMA 5T1VA 1Z8JB 4GUXA 2VU8E 1NZQH 4MNXA 4MLFB 3TNTA 1TNHA 2UWOA 3DSOA 2Z9GA 1BMMH 1Q3XA 3SJIA 3ZVAA 4NZQA 1TGTA 3SGAE 1MAXA 2YMSD 1ZMJA 1W2KH 1CHGA 1C2DA 5GCHG 1QBNA 5DP3A 1BBRK 3GISB 2ZFFH 3I29A 1IQLA 1S6FA 5JDUB 2CHAB 1TRYA 3BG4B 3GCHC 1N8OC 1S0RA 2BD2A 1EZXC 4K2YA 4ZHMU 2BHGA 3SUEA 1ZTJA 2ZHWH 5ABWA 1LDTT 1NRNH 3A7ZA 1SHYA 1W7GH 2HLDD 3BTKE 2W26A 1KTSB 4ABAA 3GOVB 4YLUA 1V2OT 4FUDA 4ISOA 1UVUH 3W95A 3GDVA 1IHSH 1Y3VA 5L6NH 3TH3H 8GCHF 1F5KU 2A4GA 2BYAX 4H42U 2QXGA 2JJ2D 1O5EH 2VGCB 3WY8A 4Y8ZA 3FP8E 3UQVA 1PPFE 3BTME 1O0DH 1UVPA 3VXFH 3HPTB 2Z9IA 1YLDA 4Y8XA 1PQ8A 4KKDA 2BVSH 1X7AC 2GDEH 2ZPRA 1MQ5A 4AGKA 2Z6BD 1VCWA 4ABJA 1V2LT 2ZGXH 3NXPA 3MWIU 1ZSKA 1AE5A 1BBRE 1P2IA 4DJZB 1U6QA 8ESTE 1TX7A 1W8BH 2BDGA 1C2MA 1K1OA 1WXRA 2Z9KA 2SNVA 2F3CE 1Y8TA 2BD4A 3TJVA 5GXPA 5DN6D 4NSYA 1NY22 1YP9A 2HVXA 4RSPA 5K0HA 2K8IA 4KTCA 1CHOG 2K1QA 1CHOF 2ZWLH 1FAKH 2NU1E 4YT7H 3QGJA 2BDIA 3M5OA 1BJUA 2PW8H 4NSVA 1A3EH 1HUTH 1V2VT 1SLWB 5GWZA 4XSKU 1H8HD 3F9EA 1TGNA 1AFQC 1L2EA 2OC8A 2ZPSA 2W6JD 5DK1A 1AU8A 3Q00A 5FL7D 2Z3EA 3P92A 4BOHA 5EOKA 2DE9A 3UNQA 1BMNH 3VB4A 4P02A 2Z3CA 7ESTE 4AFSA 1EFRD 2ZCKP 3TGKE 4NA7A 4IBLH 1P04A 1BOQA 1NFYA 1SL3A 2ZZUH 3KHVA 1YPEH 5DP9A 1LTOA 4Y8YA 1OWKA 4FU9A 3BG4C 4ZXXH 1PPEE 3MU4A 4FUHA 3GS9A 5C5NA 1LHDH 4DVAU 3RXHA 1P01A 1JRSA 3SV2H 3DSPA 1QY6A 1J17T 2STAE 3DT0H 1EAXA 3UIRA 4TWYA 5C1UA 1QQUA 4ZKRU 2FLBH 1PPHE 5EPNA 2FTMA 3PWBA 1KMHB 4WF8A 2FS8A 5DG6A 3SNAA 1SGFG 2ZCLP 2CHAC 1P12E 1E38B 2V3MA 5ESTE 2OBQA 2WV4A 1GMCF 2A4QA 1AIXH 1Y59T 1ZPBA 3AAUA 3OX7U 4NG9H 1T8MA 2B0FA 1YCPK 3JZ1B 1GDNA 1MCTA 2ALPA 4FUIA 2FEQH 4FXGH 3LPRA 3ZVGA 1NRPH 5EJZA 4BNRA 1BMAA 5C3NA 1KXDA 2FODA 1C2KA 4O3TA 2HPQH 2ZC9H 1VGCC 3MNSA 1FY4A 3OU0A 4RI0A 1ELBA 2HVYB 1SGTA 4AFZA 1BRCE 2FOFA 1ZSLA 1GBIA 4O03A 1ARBA 1WYKA 2GCHF 3TK5A 3UNRA 3GY6A 2HWLB 2FPZA 3U98H 1O3JA 1VCPA 2IJD1 3VG8A 1LVOA 3AAVA 4Y11E 3ZV8A 4TWWA 1TNLA 4BAHB 1CO7E 1SMFE 1GPZA 1GJBB 3O8RA 3NRLA 1MTNB 4NFEA 5FXLA 1NFWA 3V13A 2WPKS 5EG4A 4BAQB 2GMTC 1CA0C 2FZZA 2CF8H 1BHXF 1TWXB 1LO6A 1N1LA 3PTNA 4WVPE 3E8LA 1T4UH 1NO9H 1YPMH 2J94A 1O37A 2VGCC 5FHTA 1Y3XA 1V6DA 4I8LA 3MNBA 3RXKA 2O8WA 4AFUA 3LGTA 1ANBA 3T26A 1KDQB 1BBRH 3RC4A 4FUBA 4YM9A 3C1KA 1YPJH 1EB1H 1UTKA 3BN9A 3KIDU 1BTZA 2QGRA 1NBME 1RIWC 4GVUA 5GNDA 2BD5A 1A5GH 1A2CH 3RU4E 5T6FA 1BMFD 1HAHH 6ESTA 4KGAA 4K60A 5C94A 3Q77A 3LGUA 4X8TH 1BHXB 3ATIA 4KELA 4OS6A 3RXSA 4IW4E 4JZ1A 2G4TA 3PLPA 1K9OE 2BDHA 1J16A 1GI6A 1JRTA 2WPHS 2BY7X 5AHGH 1EPTA 3N99A 4Q7YA 3DFJA 2QC2A 1Y5UT 3PLKA 3CNRA 1O3BA 1ELFA 1YM0A 2FX6A 1ELCA 2NU2E 2H6MA 2R2WU 3IWMA 4D9QA 3FAOA 2ZFPH 5EW1H 5C0UA 3NWUA 1OYQA 1C5SA 3TJUA 2G5VA 1K0HA 1ZHRA 1P2JA 2LELA 2QAAA 3LGWA 2CK3D 5C1YA 5HKKD 1BTWA 4X1NU 2PKAB 1GI1A 4PROA 4ZUHA 5FPTA 1BIOA 1PQ5A 2VBCA 3HGPA 3OE7D 1GVKB 2QN5T 2HNTC 1EZSC 3NCLA 5DP6A 4UDWH 4U32A 3FN8A 5DP7A 5I25A 1YBWA 3A7YA 4NA9H 1AUJA 1O3DA 1NFXA 1XMNB 1ZRKA 1B0FA 2A4RA 1TX8A 2JKHA 5PTPA 5HGGA 3FZZA 1O2PA 4O3UA 4Z1MD 1DUAA 4FVBA 1RTFB 2ZU3A 1TRNA 2OK5A 4F48B 4X1SU 5E8EH 3OAAD 1HAGE 5BPEA 3RXEA 2J92A 3F0PA 3SW2B 4FUCA 3PRBA 1N8OB 2F9OA 3P17H 3I77A 1CE5A 3M5LA 1S83A 1HIAB 4Y6DA 2ILNA 3S69A 1AO5A 1UJ1A 2BVRH 2Y7XA 4DURA 1XUIA 2Z9JA 5K7RA 2OQ5A 3PV4A 1OS8A 4YO9A 4MNYA 2H2ZA 2F91A 4E05H 2ESTE 1FX0B 2GVFA 4CH8B 4UFGH 4OS5A 5FAHA 5EODA 1W0ZU 3BSQA 3ZIAD 4UEHH 1A5HA 2VWMA 1EPTB 1H8IH 2BD7A 3UREA 1WAYB 2J98B 3A81A 4XE4A 1XUJA 2HNTF 1XKAC 3TIUA 2PSYA 3DHKH 1FY8E 1GHZA 1KIGH 1TONA 2FOMB 4FU7A 1T31A 5TCCA 1GHAF 1IQIA 1YPKH 1D4PB 2GKVE 2ZHQH 3UPEA 2Y5HA 3SUFA 3GY2A 2PKSB 2SGAA 1Y5AT 1ABJH 3GYMA 5A0CA 6GCHF 1LKBA 2ZU1A 1FN8A 3IG6B 1C9PA 1H9HE 5AVDA 2SGFE 4CBNA 2Y5FA 4I8GA 4Q80A 1MBQA 1OP8A 1D9IA 4BTUB 3A84A 3KYFA 4Y0YE 4AZ2B 1S81A 4YXWD 1B7XB 2HOBA 1O39A 3MH5A 1OXGA 5HIZA 2B8OH 2PHBA 1MTSA 1CA0B 4NIWA 4CREA 1KLTA 4GHQA 3TH4H 1HPGA 2W7UA 2AYWA 2CMYA 2GP9B 3MO6A 1UCYK 4TT3D 2J5UA 1GJ8B 5JPMH 2BX4A 2VIOA 4UFEH 2BY9X 3SNBA 3FVFB 2KX4A 4DIHH 5EPYA 1O3IA 1P2QA 1JIMA 3PM3A 4X2VA 3S9AA 1DICA 4BXSA 2BVXH 3M5MA 5BRRE 3BTDE 3T28A 3K6YA 1QA7A 4X1RU 2D8WA 2OLGA 3ZVEA 2O8LA 1G3BA 1QZ8A 3LKWA 3QN7A 4ABDA 1P09A 3RXBA 3E3TA 1NC6A 2FOHA 2FI4E 1BTHH 2ZFQH 3L3TA 2W3KA 2GV6A 2GCTB 1BRUP 1HAZB 1P3EA 3CP7A 1QBVH 2BD8A 1DWEH 1L4ZA 1VITF 2K0QA 4XD7D 2FO9A 1TLDA 2FIRH 4RN6A 4DT7B 2OQUA 3FZDA 1HAIH 1SSXA 3NKKA 1YKTA 1O2IA 1A1RA 1GMHF 4AYVB 2ZECA 3LGVA 2OXSA 1GBEA 3BTEE 4THNH 1ID5H 5CE1A 1EUFA 4DT4A 1SG8B 2XRCA 1DDJA 1ZJDA 1UHBA 1Z6EA 1ZLRA 3BTHE 1AN1E 4K8BA 4SGBE 2VB0A 1TNKA 2SGEE 3Q76A 1O34A 1F0TA 1TGSZ 2PP6A 1D3TB 2RG3A 4ZKSU 3ATKA 4CR5A 1GJ5H 2FS9A 1ACBE 1OP0A 3T27A 2XCFA 3SU6A 3FP6E 1C1UH 1O2XA 4D7FA 1W12U 1SB1H 2VH6A 1O2TA 3V0XA 1P2NA 1P9UA 1TOCB 1CBWB 2JH6D 1NRQH 3KEEA 1TFXA 1PPGE 3CS7A 2ZDNA 1GHAG 1K1NA 2JH0D 2ANWA 1GVLA 2ZF0H 2BDAA 1ABIH 3S7HB 1AE8H 2F9VA 4D8NA 1HBTH 1KSNA 2EEKA 3BTQE 2KAIA 1H9IE 1SI5H 1QL8A 1DLKB 1V2PT 2NU4E 1PPBH 4JK6A 4IMQA 3SNEA 1C5RA 1YPHC 4DIIH 1ESBA 2C90B 1CT4E 5L2ZH 1TA6A 4K1TA 2ZPQA 2WPMS 3D62A 4UD9H 1GL1A 4B6FA 4ZKOU 2GZ9A 1S85A 1P2OA 4Q2KA 4Y10E 2B5TB 2P3UB 3ZYDA 1THPB 4YOJA 1T32A 2OUAA 2J38A 3L33A 1C1OA 1K1MA 1P06A 1AD8H 2XBVA 1MTWA 3SI3H 4UFDH 4ZCNA 1TBQH 4MPWA 1MCVA 4WMFA 2FOGA 3N7OA 1T4VH 1SGIB 1DY9A 3D65E 1AUTC 1MZDA 1OWDA 1XUGA 1YPGH 1C5VA 4A1TA 5A2MH 1SFQB 1OOKB 4NGAH 5EQQA 1J9CH 2A0QB 4AX9H 1BB0B 1HAPH 4ABBA 2XTTB 2ZFSA 1S6HA 4FUFA 1NESE 3I78A 1KLIH 3RC6A 3BTFE 4F55A 4Y7AA 2SGDE 1EJMA 4DOQA 3LJJA 1YYY1 3NUMA 2WINI 3VGCB 3HGNA 5E0HA 1C5PA 3LJOA 3SZEA 3RXDA 7KMEH 3KCGH 3MOCA 1K1PA 3M3VA 3D49H 1EJNA 3RXVA 5A09A 1GJCB 1HJAB 2BLVA 3DD2H 2FI5E 1YPLH 1WBGB 3KQBA 1P10A 1HRTH 1BTXA 1GI2A 1PQAA 3LDXH 4JZIA 1KDQA 1O3CA 1VITG 2GCHG 4TPYA 1YC0A 4X2WA 4X0WU 1SGEE 1QIXB 3MH4A 3K6ZA 4WMDA 2THFB 1JIRA 4M7GA 2AEIH 2C8WB 4YLQH 2VIPA 3GCOA 4FUEA 2ZTZA 2P94A 1SFIA 1TGBA 3MU5A 5DJ7A 1GJ6A 3RMMH 4Q7XA 4YTAA 3E6PH 2BD9A 2L6OA 2OTVA 3GCNA 4IC6A 4SGAE 3EA8A 4Z0KA 5F8ZA 1DX5M 2G4UA 5CMXH 1GCTB 3MHWU 3VB6A 4E06H 5HXFA 1V2WT 3BIVH 4NIVA 3JZ2B 3KQEA 1GDUA 1G30B 1O5CB 3ZZ5A 3E16B 2IOTA 1EXFA 1SR5C 1E35B 3M7UA 1TRMA 2ANYA 1GI5A 1GHBF 2FYRA 2TGDA 2BXTH 2BB4A 3GCHB 3QZQA 1DSUA 3W1EA 1FIWA 2A7CA 1TBRH 1C2GA 1GBMA 1CGHA 3VFEA 1C1QA 2YNAA 3MU1A 3KNXA 1EZUC 4GPGA 2PR3A 1TGCA 3M7TA 5JBCS 2ZU2A 2ZGJA 4Y76A 2BY6X 2JDID 4Y71A 4OGXA 3PMHB 1C5MD 3RXMA 2BOKA 3OTJE 2FWWA 4X2YA 1LVYA 1F2SE 4GHTA 2PKAA 1QBOA 1JMOH 1ZYOA 1C1TA 4RKOB 3N7EA 4ZHLU 5F6MA 2FTLE 2A7HA 1OWEA 4CR9A 1O5AB 1CBWC 1TE0A 1Z1JA 4CBOA 5B6OA 4AFQA 1UTPA 2Z3DA 1B5GH 1AKSA 5H4IB 4NIXA 1K21H 1O2QA 1NBMD 1FPHH 1O30A 2GDDA 7LPRA 2HPPH 1MZAA 1TABE 3BIUH 3E91A 6CHAC 1N6XA 3F9FA 2TGTA 1J15A 2J34A 3HK6B 2WSSD 3ZVFA 1RS0A 2ZI2H 3ZZ6A 3MQKC 1CT2E 5AFYH 2OINA 1T8LA 1ZRBA 3TU7H 3UWJH 3EYDA 2QF0A 3T25A 1L1GA 1EATA 4OS2A 1AY6H 4B1TA 2H9TH 2OC0A 1A61H 3A8CA 4X6OA 4BTTB 3GYLB 4TSFD 1C5LH 3OEHD 3SV6A 4YZUA 4I31A 1NN6A 1SGPE 3P70B 1O2ZA 1A5IA 1HNEE 1GHXH 1IOEA 1TYNA 1DY8A 2BM2A 1WDIA 4J1YA 4QT8C 1GWAA 4YT6H 6LPRA 3RXCA 1G37A 5SGAE 3RMLH 4HTCH 2PSXA 2PKSC 3WWFA 1DFPA 2ZHDA 1HJAC 1AVXA 5AF9H 4B2CA 2VINA 1RD3B 1GBTA 2P59A 4B76A 2YMSB 1O3GA 2AMQA 1O2HA 2G81E 4MG3A 4BAMB 2PTCE 1C5WB 1C5XB 1SGQE 2FOEA 1NRRH 3GDSA 1K22H 1GJ7B 3H7TA 4ZXYH 5F03A 3U8RH 5GCHF 3DA9B 5A8YA 3V3MA 2PUXB 5T3HA 3SU1A 2BZ6H 1OPHB 2VWLA 4WWYA 5EGMA 4B73A 1AI8H 1FV9A 3V12A 1CA8B 1AZZA 1W0YH 3QGNB 1F7ZA 3MH7A 3UWIA 1WQVH 4U2WA 5E2OA 4Q4LA 1AWFH 1DXWA 1Q31A 2ZGBH 4F4OC 1V2NT 1K1JA 1OP2A 1D6RA 4NFFA 4UE7H 1HAOH 2G52A 1GI7B 1SGNE 3ESTA 2ZHFH 1XX9A 2BTCE 1ANEA 2A5KA 2C8ZB 2QA9E 1GL0E 1FY3A 5EJ1A 3GCTF 1VJAU 1UTJA 2TPIZ 5C20A 3OEED 3MMGA 4NZLA 3E0PB 4OM9A 3WW7A 5J4QA 2I6QA 1GBAA 4FUGA 2RDEA 4D7GA 3RUOA 1UVOA 4DW2U 4BAKB 2F9NA 3P95A 3U8OH 1GCTC 2CN0H 1FAXA 3UY9A 2WPDD 2L74A 5B6LA 1S82A 3UUZA 3KGPA 3LC3A 1EAIA 1V2JT 3ZZ9A 1QHRB 4XDEA 1HB0B 1GJ4H 1VR1H 1SKYE 4Z6AH 3ZZ4A 2ZEBA 5G4BA 1SVPA 1MUEB 1THRH 2C3SA 2M5TA 2BX3A 8LPRA 2AGEX 2ODPA 4MPUA 1EAWA 1YGCH 4RKJB 1EP5A 3A7WA 3MFJA 1GJAB 1ZR0A 5A8ZA 2D2DA 2XWAA 4MPXA 2GTBA 5E2PA 1GVZA 3FP7E 2XYAA 2ZDVH 2ODQA 1E37B 1F5RA 1ANDA 1MABB 2QV1A 4ABEA 1YCPM 3LGIA 1RFNA 3GY8A 2Z9LA 1KXAA 4M9FA 1H9LB 3FKSD 1FI8A 4J2YB 2GJGA 1IQGA 1MD7A 2PV9B 1BMLA 1D3QB 3W94A 4YESB 3O8DA 2A31A 5J4SA 1ESAA 1LVMA 2KCOA 4X8SH 3G01A 3RXPA 3SI4H 1O2UA 2KZ4A 2KCAA 3QDZB 1DLEA 2J4IA 2FYQA 1TMTH 3UB0A 2J2UA 2C93B 4HG6A 1FJSA 3ODFA 3TPIZ 1W13U 3NK8A 2YNBA 2DE8A 4CRFA 1DWDH 1C1SA 3O8BA 1OYTH 2R9PA 2ZFRH 1QJ7B 3H09A 2WV9A 4I8KA 1C4Y2 5C17A 4LZ4B 2AGGX 1YLNA 2KCPA 3QK1A 1DXPA 1TMBH 5DP5A 1C2EA 2O8TA 1SPJA 4Y79A 3IITA 1TNJA 1ELAA 1Y3WA 3VEQB 1SHHB 4MVNA 3EA9A 4B75A 1INCA 1RTKA 2M2AA 3A8BA 2PUQH 1YLCA 1NM6A 2HLCA 1W11U 1ZGVA 2R0LA 4LXBH 4NIYA 3U1JB 2TRMA 3RXLA 3TJOA 1O5GH 3QZRA 5CHBA 1KXEA 1IQFA 2F43B 5ETXA 4CH2B 4ABFA 5ESBA 1K28D 2KR7A 2WYGA 1SOZA 3K9XB 1WOFA 5LPEA 4LZ1H 4MNWA 4ABIA 1DWBH 3PB1E 5EU8A 3DSGA 4VGCB 1DOJA 4X8VH 2ZO3H 3R3GB 1O2GH 4I86A 2XC4A 4CRDA 1SC8U 2R3UA 2XCNA 2VJ1A 2V3OH 2UWLA 4HGCA 2OP9A 3UOUA 3A80A 3RXIA 3C27B 2EI8A 3SN8A 1W3CA 2UWPA 3FO8D 1GMHG 2AHME 5DP4A 4CRAA 2WPIS 1TBZH 1C9TA 3QWCH 1GI9B 3RMNH 3HK3B 3ZZDA 2TBSA 3VB7A 5EQSA 4K5ZA 2Y5GA 4AOQA 1G32B 4WH8A 2G51A 3RXJA 1UTQA 3SV9A 1L1JA 2LPRA 1SGYE 4A7IB 1D3PB 3F1SB 1Y5BT 3KYGA 1QRXA 1C1NA 1S5SA 1MH0A 1GBLA 5GIBA 5C2ZA 5KECA 5F8TA 1LMWB 1T8OA 1GBJA 2FXRA 2FX4A 2AIPA 4DY7B 3ZVDA 1ZPCA 4F49A 1C5QA 2AMDA 2AH4X 5IK2D 1DVAH 2KCYA 3SYJA 2JIZD 2BDBA 3M35A 2FI3E 5DO4H 3U28C 1TQ7B 1NRSH 2BD3A 5HM9A 1T8NA 5L30H 2FMJA 2WV5A 2VVCA 2BOHB 3BEFB 2ZQ1A 3F3BA 3PMAB 2QXHA 1DSTA 3RMOH 3F9HA 1UTNA 2C4FH 1UCYE 7GCHG 4IC5A 1DUEA 1C1WH 1TNIA 2VH0A 2ZKSA 4HZHA 2G55A 3OSYA 4X6MA 3A86A 3KL6A 1S6LA 5FPYA 3GDUA 1F0SA 2GT8A 3LH3A 3P8OA 1CSOE 1LHGH 1MKXK 1AWHB 2EI6A 3PYHA 4CRGA 1EZQA 1SQTA 4ZROA 1MBMA 1AB9C 1SGCA 3AASA 1PJPA 1W14U 4ZKNU 1UK3A 4TY6A 3DUXH 3ODDA 5JBTA 2A5IA 1MMJN 3F2HA 5KGOA 3VB5A 1IQJA 4JZDH 2GMTB 1WQSA 3PWCA 5C67A 1BTYA 1C1MA 1GI8B 4YOGA 2CXVA 4WMEA 1VKYA 3NPSA 1C2JA 3U9AH 2ZA5A 4CHAC 1SLVB 3Q3XA 2V35A 4I33A 1GG6B 2FESH 1ZTKA 3UFAA 1N6YA 2A1DB 1H8DH 3LIWA 1C1VH 2FDAA 1O31A 2P8OB 4AC9A 1O3FA 1SOTA 1KXBA 1QB6A 1YWUA 1Z8GA 1Z8RA 1ZGIA 2NU0E 1XXDA 1ZMLA 1RTLA 3D23A 5EQRA 1GBFA 3SJKA 3F2GA 5FCRA 1QB9A 2ANKH 3VGCC 5HYOA 3LU9B 3MO3A 4BXWA 4GCHF 1V3XA 2PGQB 2EY4C 5L2YH 1OSSA 1KLJH 1C5OH 1SGRE 1GBDA 3F0OA 5C1XA 1LQEA 1GGDB 1HIAA 1LVBA 3K2UA 1CT0E 2VIQA 2Y80A 4GLYA 3SHAH 1QB1A 4X1PU 1C5YB 3STJA 1DANH 4ISIH 4K69A 4GAWA 4D9RA 1HAVB 4IGDA 3FFGA 3P6ZB 3A7XA 2QXJA 2P95A 1XKBC 2GT7A 2BQWB 2RA0A 3E1XB 5CHAC 1XUFA 1O2OA 1FIZA 3LOXA 1SQRA 1P2MA 3M61U 5EXMA 1P11E 4B6EA 1V2KT 1SQAA 1BA8B 2BLOA 3ZZBA 2NWNA 4TPIZ 3V7TA 1O3OA 1O3LA 1UHBB 4JZFH 4FVDA 1O2WA 3PMBB 1PPCE 1AFQB 5DKMA 3S9CA 3AVZA 3KQCA 4I7YH 1EP6A 1UCYH 2GD4B 3F68H 1LPGB 3LONA 2A32A 3SGBE 1QURH 1PQ7A 1UK2A 3SJ9A 3KQDA 2A5AA 2H9EH 2XW9A 3A85A 1AHTH 1KTTB 1HAYB 5HIYA 4ACAA 5E0JA 2PGBB 1QCPA 2ZGHA 1FQ3A 1V2QT 4A1XA 3MI4A 3ZVBA 1VITH 1E1RD 4NA8A 5C5OA 4K1SA 1QL9A 3BTTE 1JBUH 2RDLA 3TNSA 2P3FH 4WH6A 4BANB 2A7JA 1TAWA 2XNIA 4H6TA 1XUKA 1O5DH 2NU3E 2VIWA 2PTNA 4DG4A 1WUNH 1QJ1B 4A6LA 1BITA 1GBCA 3RU4T 1NTPA 3B8JA 1W10U 1SLXB 1XXFA 1B0EA 2QY0B 4MPVA 9ESTA 4B74A 1IHTH 1A0HB 3F2FA 2W5EA 1SGDE 5GJ4B 2SFAA 1EPTC 4FU8A 1J14A 1T7CA 1V2RT 1F0RA 1HGTH 3ZV9A 3EDXB 3MH6A 4H4FA 2BY5X 2P8OC 1AB9B 1DITH 2B9LA 1MD8A 1AGJA 4ABGA 1KY9A 1P02A 3VXEH 2KM0A 5LH8A 5A0AE 1AZ8A 1E36B 4JCNA 1P57B 2XC5A 1BJVA 5IYTA 3RXGA 1H8ED 1G3DA 3RXAA 3A7VA 9LPRA 4AG2A 1O2JA 3BTWE 2A45B 3VB3A 2FOCA 2UUYA 3BEUA 1O2VA 3BG8A 1Z1IA 1QTFA 5FX6A 1O3KA 4HFPB 1A7SA 1WTHD 2TGPZ 4OS7A 3ZZAA 1KXCA 1TPAE 2CGAA 3N7DA 2VIVA 2BDCA 2GZ7A 2WUBA 3ATMA 4A1VA 2R2MB 5LPRA 4BAOB 2AERH 3RLYH 2V7QD 2STBE 1ETTH 2XC0A 3S0NA 1MKWK 3H7OA 1HJ9A 1JWTA 5T6GA 1DWCH 1ELTA 1BZXE 1UO6A 1E79D 1ETRH 1C5UA 1ZPZA 2ALVA 1GBHA 3EE0B 4JYVH 3ZVCA 1NPMA 4X8UH 5F8XA 3HATH 1BTUA 3GY7A 4OS1A 2LP6A 1EJAA 3QTVH 1H4WA 4OGYA 3AW0A 1GMDF 1O32A 3U1IB 1FDPA 1DT2A 3PROA 3MU8A 1O38A 1UVSH 1IAUA 4ASUD 4VGCC 2CV3A 1GI4A 4JYUH 1ETSH 2QE7D 4FUJA 3PO1C 4INHA 1UW7A 1HAVA 4ZMAH 1K2I1 3RU4D 5LGOA 1WSSH 3PLBA 4MNVA 2VVUA 2EA3A 1FY1A 2VWNA 3LT3A 2FM2A 5FX5A 1G3EA 3MU0A 2ZU4A 3M3SA 1AVWA 3OYPA 2W6ID 4Q63A 3AK5A 2BLWA 4K1EA 5JB9S 5T6DA 3CENA 3TVJB 5IDKA 1LPZB 2XBXA 1DS2E 1GI3A 2SGPE 3SOSA 5EXLA 1NROH 5DSFA 4X1QU 4JK5A 2ASUB 4ASHA 1HAXB 1TPPA 1XVOA 3A8DA 3PV2A 8GCHG 3OY6U 1AMHA 1HXFH 3QLPH 4XRNA 5EIYA 1VCQA 3T62A 5GPIB 3LGYA 2EI7A 1O3MA 4IS5A 3H5CB 5I46H 5A0BA 4LOYH 3P8FA 1THSH 3SUGA 1ESTA 3RXRA 2FOAA 3M7QA 2FLRH 2JETC 3T2NA 2HNTE 1O3HA 3QO6A 3UR6A 1NFUA 3ATWA 1TOMH 5TJXA 2ZQ2A 4KTUA 4AORA 1AFEH 1PYTC 1FXYA 2XWBI 1XM1A 4K8YA 1ELVA 1O3AA 1O5FH 2C8YB 4HI3A 3UAIC 3VPKA 1ZTLA 1BTPA 2RA3A 2F9BH 1A0LA 4WXIA 4Y0ZE 2F9PA 5GDSH 1CVWH 2ZHEH 1CQQA 5JB8S 2WYJA 1GHBG 1P8VC 2Q6FA 2IPHA 2Z7FE 3BF6H 5E0GA 3S7KB 4YOIA 2CJIA 4AG1A 2ZG0H 5EW2H 4I8HA 2ZDLA 1FLEE 1L0ZA 2UUJB 3TH2H 2Y81A 4AN7A 1P05A 3RLWH 1TA2A 1O3EA 4AYYB 1C4V2 1ORFA 3FOAA 1G2LA 2JJ1D 3PV5A 2HRVA 2R0KA 2V3HH 2PWXA 1NS3A 3QTOH 3O8CA 1HLTH 5EXNA 4R8TB 3ZZ3A 1GMDG 2ZU5A 3SNDA 2QCYA 1K1LA 2A2XH 1UTOA 4WY3A 1ZHMA 2ULLA 2ZDAH 3T5FH 2GZ8A 1GHYH 2ZTXA 1O36A 4CHAB 4ABHA 1IQNA 1XVMA 2BQ6B 2QYIA 3AW1A 3SQHE 4KTSA 2ODYB 1MTVA 2RFKC 2TIOA 3SJ8A 2IJOB 5C0TA 4A92A 1O2YA 1ZSJA 3GY5A 2EC9H 3A88A 3SV8A 3TGJE 1BCUH 1RXPA 4JMYA 1AKSB 1LHFH 4U30A 2J95A 1DE7H 1RIWB 1WTGH 2Q1JA 2ZGCA 1S0QA 2PLXA 3A87A 5EJLA 5DP8A 1YF4A 2D1JA 3GY3A 1EB2A 4DGJA 1GGDC 1TNGA 1Q2WA 3MNXA 2Q6GA 1V2TT 1TX6A 4UFFH 1Z6JH 1GJ9B 2WZQA 1P2KA 3SJOA 1LKAA 4CRCA 4E7RG 3RXUA 1ZOMA
chains in the Genus database with same CATH topology
4I8JA 3MYWA 3UTUH 3ITIA 1L1NA 5JBBS 2Y82A 2VVVA 1GBKA 1HYLA 5LPFA 1MQ6A 1E0FD 2B7DH 2D26C 1LPKB 1O2KA 4I32A 4X2XA 3SU2A 1OWIA 4H6SB 1O2SA 2JETB 1VZQH 1IQMA 5FPSA 5JYIA 3ZYEA 3A82A 3ATLA 1LHCH 3R0FA 1IQKA 1PPZA 4E7NA 2A2QH 1TALA 1V2ST 1LQDB 1VJ9U 2SNWA 1Y3UA 1ELDE 2ZDKA 1O5BB 2AGIX 4TY7A 2QF3A 1TIOA 1WCZA 1GI0A 3RM0H 4ISLA 4X6PA 2I6SA 1YPHE 1VGCB 2P3TB 1P9SA 5FCKA 5JBAS 1C4U2 2V0BA 1KXFA 2FOBA 3SU4A 1EQ9A 4INKA 1ELEE 2R3YA 4OS4A 2C8XB 4UONA 4O9VA 5AFZH 1QGFA 1W7XH 1V2MT 3F9GA 1QJ6B 1O3NA 1UK4A 2GX4A 1O35A 1GJDB 1BQYA 3TLOA 4AB8A 1BT7A 5A8XA 1IQEA 1C1RA 4AB9A 4MTBA 1GCDA 1H1BA 3M36A 2FP7B 4NWLA 5DGJA 4IN1A 3A89A 4B2AA 3BV9B 3PMJA 4XOJA 3SBKA 1HV7A 2G8TA 2JH5D 2Z94A 8KME2 2WPLS 1D3DB 3MTYA 4A5TS 4B2BA 3SUDA 1O2MA 4JYTA 2J9NA 1MKWH 1ARCA 4X6NA 3SO3A 4MQAA 2RCEA 2XBWA 1C2LA 2G00A 1EKBB 1GHVH 1P3CA 1Y3YA 3TJNA 1D6WA 3OY5U 1QRWA 4GCHG 3URCA 6GCHG 1O2NA 1IQHA 4ISHH 2BDYA 1FPCH 1OWHA 3ENSB 3DFLA 2W7SA 4NCYA 1BDAA 2GCTC 2QXIA 3B9FH 3RDZA 4Y7BA 4NWKA 2SGQE 3M5NA 4TYDA 1G3CA 3U8TH 3SORA 1C5TA 2VNTA 3S9BA 3UR9A 2BY8X 1HJ8A 1LCYA 1QQ4A 3SHCH 1FZZA 5FBEA 1A0JA 3E90B 3PTBA 1BUIA 3U69H 4K3JA 1GBBA 4BTIB 2OCVB 2OD3B 1FN6A 1P03A 2AFQB 3Q3KA 1ZJKA 1K1IA 1C5ZB 3K65B 3LH1A 1F5LA 3ZZ7A 1C2IA 1JXPA 2F9UA 2KAIB 2O9QA 2ZDMA 3RM2H 1AVGH 2AIQA 5HM2A 1C5NH 3EAJA 3SU0A 2P93A 1S84A 1XUHA 3EQ0H 4INLA 1MU6B 1MU8B 1E34B 1EOJA 1C2FA 4Q7ZA 4WXVA 3RXTA 1ZZZA 1G9IE 3SNCA 1QFKH 5CHAB 5DPAA 1OWJA 4JZEH 3SV7A 3KN2A 2PFEA 2GV7A 1BRBE 1L4DA 4DCDA 4XBDA 3KF2A 2UUKB 5FBIA 3M3TA 1SGFA 3MNCA 3UNSA 1QA0A 1EAUA 1HCGA 1TB6H 1QL7A 3QX5H 3MO9A 1SLUB 1EASA 2LNCA 4MDSA 4KP0A 3ELAH 1BRAA 2OBOA 2P16A 2XXLA 1A3BH 3M37A 4R0IA 1ZHPA 3SU3A 2H5DA 1NU7B 3CS0A 3TK9A 2HALA 7GCHF 1WV7H 2Y7ZA 1RRKA 1CGJE 1NT1A 2ZIQH 4O97A 3ZZCA 1J8AA 2ANMH 1RJXB 1A46H 3P8NA 1HFDA 1GDQA 1F92A 3RP2A 4GSOA 1C2HA 1FMGA 2UUFB 5HMAA 2HGTH 3BEIB 1WU1A 1SBWA 3UQOA 1Z71A 4LK4A 2VWOA 1C1PA 1TPOA 1NU9A 1G36A 1TPSA 3UOPA 1YCPH 4XBBA 1F0UA 3RXOA 4XBCA 4B71A 3QUMP 2ZTYA 1G2MA 1HXEH 6CHAB 1A4WH 1UVTH 3A83A 1DPOA 1ELGA 1Z8IB 4U01A 1UMAH 4XFQA 1DM4B 2DUCA 3BTGE 3ZZ8A 3SU5A 3GCTG 1Z7KA 3URDA 1UTLM 3T29A 2ZCHP 1TMUH 2Y6TA 4ZH8A 2OC7A 1JOUB 4D76A 3TGIE 2A4OA 2O8MA 1MTNC 1GMCG 4ISNA 2BMGB 2OC1A 1ANCA 3SQEE 1GG6C 1MTUA 1QR3E 3E0NB 2W3IA 3LC5A 1LHEH 1PFXC 1KYNA 3STIA 1MAYA 1CGIE 1EX3A 1QRZA 1CU1A 1PYTD 2WPJS 1P0SH 1GHWH 1FY5A 2BLQA 1RGQA 4IN2A 1V2UT 3RXQA 4ZHAA 2G5NA 1EOLA 3A8AA 3P8GA 3HKIB 2H1UA 2H5CA 3PO1B 4ESTE 3A7TA 1FNIA 3EGKH 2F83A 3FANA 4WJG2 1TQ0B 4AGJA 1O33A 2XBYA 3RC5A 3SZNA 2YOLA 1MKXH 2O8UA 3GICB 5TCAA 2ZFTA 3SGQE 1O2RA 3L6PA 1QNJA 2Q6DA 4ZAEA 2ZP0H 3TITA 2QIQA 3NZIA 2AS9A 1SQOA 2GGVB 1FUJA 2VIDA 1M9UA 1OX1A 2WUCA 1O2LA 2AMPA 3GY4A 1ZMNA 1AQ7A 2BZAA 1FONA 3EA7A 3B23B 4CRBA 2BXUH 2CF9H 3TK6A 2H9HA 4IMZA 1OKXA 3RXFA 2V6NA 3HKJB 1HDTH 1O3PB 2TGAA 2BQ7B 3F6UH 2IN2A 2ZNKH 3Q3YA 1UTMA 1Z8JB 4GUXA 2VU8E 1NZQH 4MNXA 4MLFB 3TNTA 1TNHA 2UWOA 2Z9GA 1BMMH 1Q3XA 3SJIA 3ZVAA 4NZQA 1TGTA 3SGAE 1MAXA 1ZMJA 1W2KH 1CHGA 1C2DA 5GCHG 1QBNA 5DP3A 1BBRK 3GISB 2ZFFH 3I29A 1IQLA 1S6FA 5JDUB 2CHAB 1TRYA 3BG4B 3GCHC 1N8OC 1S0RA 2BD2A 1EZXC 4K2YA 4ZHMU 2BHGA 3SUEA 1ZTJA 2ZHWH 5ABWA 1LDTT 1NRNH 3A7ZA 1SHYA 1W7GH 3BTKE 2W26A 1KTSB 4ABAA 3GOVB 4YLUA 1V2OT 4FUDA 4ISOA 1UVUH 3W95A 3GDVA 1IHSH 1Y3VA 5L6NH 3TH3H 8GCHF 1F5KU 2A4GA 2BYAX 4H42U 2QXGA 1O5EH 2VGCB 3WY8A 4Y8ZA 3FP8E 3UQVA 1PPFE 3BTME 1O0DH 1UVPA 3VXFH 3HPTB 2Z9IA 1YLDA 4Y8XA 1PQ8A 4KKDA 2BVSH 1X7AC 2GDEH 2ZPRA 1MQ5A 4AGKA 2Z6BD 1VCWA 4ABJA 1V2LT 2ZGXH 3NXPA 3MWIU 1ZSKA 1AE5A 1BBRE 1P2IA 4DJZB 1U6QA 8ESTE 1TX7A 1W8BH 2BDGA 1C2MA 1K1OA 2Z9KA 2SNVA 2F3CE 1Y8TA 2BD4A 3TJVA 5GXPA 4NSYA 1NY22 1YP9A 2HVXA 4RSPA 5K0HA 4KTCA 1CHOG 2K1QA 1CHOF 2ZWLH 1FAKH 2NU1E 4YT7H 3QGJA 2BDIA 3M5OA 1BJUA 2PW8H 4NSVA 1A3EH 1HUTH 1V2VT 1SLWB 5GWZA 4XSKU 3F9EA 1TGNA 1AFQC 1L2EA 2OC8A 2ZPSA 5DK1A 1AU8A 3Q00A 2Z3EA 3P92A 4BOHA 5EOKA 2DE9A 3UNQA 1BMNH 3VB4A 2Z3CA 7ESTE 4AFSA 2ZCKP 3TGKE 4NA7A 4IBLH 1P04A 1BOQA 1NFYA 1SL3A 2ZZUH 3KHVA 1YPEH 5DP9A 1LTOA 4Y8YA 1OWKA 4FU9A 3BG4C 4ZXXH 1PPEE 3MU4A 4FUHA 5C5NA 1LHDH 4DVAU 3RXHA 1P01A 1JRSA 3SV2H 1QY6A 1J17T 2STAE 3DT0H 1EAXA 3UIRA 4TWYA 5C1UA 1QQUA 4ZKRU 2FLBH 1PPHE 5EPNA 2FTMA 3PWBA 4WF8A 2FS8A 5DG6A 3SNAA 1SGFG 2ZCLP 2CHAC 1P12E 1E38B 5ESTE 2OBQA 2WV4A 1GMCF 2A4QA 1AIXH 1Y59T 1ZPBA 3AAUA 3OX7U 4NG9H 1T8MA 2B0FA 1YCPK 3JZ1B 1GDNA 1MCTA 2ALPA 4FUIA 2FEQH 4FXGH 3LPRA 3ZVGA 1NRPH 4BNRA 5C3NA 1BMAA 1KXDA 2FODA 1C2KA 4O3TA 2HPQH 2ZC9H 1VGCC 3MNSA 1FY4A 3OU0A 1ELBA 1SGTA 4AFZA 1BRCE 2FOFA 1ZSLA 1GBIA 4O03A 1ARBA 1WYKA 2GCHF 3TK5A 3UNRA 3GY6A 2HWLB 2FPZA 3U98H 1O3JA 1VCPA 1LVOA 3AAVA 4Y11E 3ZV8A 4TWWA 1TNLA 4BAHB 1CO7E 1SMFE 1GPZA 1GJBB 3O8RA 1MTNB 4NFEA 5FXLA 1NFWA 3V13A 2WPKS 5EG4A 4BAQB 2GMTC 1CA0C 2FZZA 2CF8H 1BHXF 1TWXB 1LO6A 1N1LA 3PTNA 4WVPE 3E8LA 1T4UH 2VGCC 1NO9H 1YPMH 1O37A 2J94A 5FHTA 1Y3XA 1V6DA 4I8LA 3MNBA 3RXKA 2O8WA 4AFUA 3LGTA 1ANBA 3T26A 1KDQB 1BBRH 3RC4A 4FUBA 4YM9A 3C1KA 1YPJH 1EB1H 1UTKA 3BN9A 3KIDU 1BTZA 2QGRA 1RIWC 4GVUA 2BD5A 1A5GH 1A2CH 3RU4E 5T6FA 1HAHH 6ESTA 4KGAA 4K60A 3Q77A 3LGUA 4X8TH 1BHXB 3ATIA 4KELA 4OS6A 3RXSA 4IW4E 4JZ1A 2G4TA 3PLPA 1K9OE 2BDHA 1J16A 1GI6A 1JRTA 2WPHS 2BY7X 5AHGH 1EPTA 4Q7YA 3DFJA 2QC2A 1Y5UT 3PLKA 1O3BA 1ELFA 1YM0A 2FX6A 1ELCA 2H6MA 2NU2E 2R2WU 3IWMA 4D9QA 3FAOA 2ZFPH 5EW1H 3NWUA 1OYQA 1C5SA 3TJUA 2G5VA 1ZHRA 1P2JA 2QAAA 3LGWA 5C1YA 1BTWA 4X1NU 2PKAB 1GI1A 4PROA 4ZUHA 5FPTA 1BIOA 1PQ5A 3HGPA 1GVKB 2QN5T 2HNTC 1EZSC 3NCLA 5DP6A 4UDWH 4U32A 5DP7A 5I25A 1YBWA 3A7YA 4NA9H 1AUJA 1O3DA 1NFXA 1XMNB 1ZRKA 1B0FA 2A4RA 1TX8A 2JKHA 5PTPA 5HGGA 3FZZA 1O2PA 4O3UA 1DUAA 4FVBA 1RTFB 2ZU3A 1TRNA 4X1SU 5E8EH 1HAGE 5BPEA 3RXEA 2J92A 3SW2B 4FUCA 1N8OB 2F9OA 3P17H 3I77A 1CE5A 3M5LA 1S83A 1HIAB 4Y6DA 2ILNA 3S69A 1AO5A 1UJ1A 2BVRH 2Y7XA 4DURA 1XUIA 2Z9JA 5K7RA 2OQ5A 3PV4A 1OS8A 4YO9A 4MNYA 2H2ZA 2F91A 4E05H 2ESTE 2GVFA 4CH8B 4UFGH 4OS5A 5FAHA 5EODA 1W0ZU 3BSQA 4UEHH 1A5HA 2VWMA 1EPTB 1H8IH 2BD7A 3UREA 1WAYB 3A81A 4XE4A 1XUJA 2HNTF 1XKAC 3TIUA 2PSYA 3DHKH 1FY8E 1GHZA 1KIGH 1TONA 2FOMB 4FU7A 1T31A 5TCCA 1GHAF 1IQIA 1YPKH 1D4PB 2GKVE 2ZHQH 3UPEA 2Y5HA 3SUFA 3GY2A 2PKSB 2SGAA 1Y5AT 1ABJH 3GYMA 5A0CA 6GCHF 1LKBA 2ZU1A 1FN8A 3IG6B 1C9PA 1H9HE 5AVDA 2SGFE 4CBNA 2Y5FA 4I8GA 4Q80A 1MBQA 1OP8A 1D9IA 4BTUB 3A84A 4Y0YE 4AZ2B 1S81A 1B7XB 2HOBA 1O39A 3MH5A 1OXGA 2B8OH 2PHBA 1MTSA 1CA0B 4NIWA 4CREA 1KLTA 4GHQA 3TH4H 1HPGA 2W7UA 2AYWA 2CMYA 2GP9B 3MO6A 1UCYK 1GJ8B 5JPMH 2BX4A 2VIOA 4UFEH 2BY9X 3SNBA 3FVFB 4DIHH 5EPYA 1O3IA 1P2QA 1JIMA 3PM3A 4X2VA 3S9AA 1DICA 4BXSA 2BVXH 3M5MA 5BRRE 3BTDE 3T28A 3K6YA 1QA7A 4X1RU 2D8WA 2OLGA 3ZVEA 2O8LA 1G3BA 3LKWA 3QN7A 4ABDA 1P09A 3RXBA 3E3TA 1NC6A 2FOHA 2FI4E 1BTHH 2ZFQH 3L3TA 2W3KA 2GV6A 2GCTB 1BRUP 1HAZB 1P3EA 3CP7A 1QBVH 2BD8A 1DWEH 1L4ZA 1VITF 2FO9A 1TLDA 2FIRH 4RN6A 4DT7B 2OQUA 3FZDA 1HAIH 1SSXA 3NKKA 1YKTA 1O2IA 1A1RA 1GMHF 4AYVB 2ZECA 3LGVA 2OXSA 1GBEA 3BTEE 4THNH 1ID5H 5CE1A 1EUFA 1SG8B 2XRCA 1DDJA 1ZJDA 1UHBA 1Z6EA 1ZLRA 3BTHE 1AN1E 4K8BA 4SGBE 2VB0A 1TNKA 2SGEE 3Q76A 1O34A 1F0TA 1TGSZ 1D3TB 2RG3A 4ZKSU 3ATKA 4CR5A 1GJ5H 2FS9A 1ACBE 1OP0A 3T27A 2XCFA 3SU6A 3FP6E 1C1UH 1O2XA 4D7FA 1W12U 1SB1H 2VH6A 1O2TA 3V0XA 1P2NA 1P9UA 1TOCB 1CBWB 2JH6D 1NRQH 3KEEA 1TFXA 1PPGE 3CS7A 2ZDNA 1GHAG 1K1NA 2JH0D 2ANWA 1GVLA 2ZF0H 2BDAA 1ABIH 3S7HB 1AE8H 2F9VA 4D8NA 1HBTH 1KSNA 2EEKA 3BTQE 2KAIA 1H9IE 1SI5H 1QL8A 1DLKB 1V2PT 2NU4E 1PPBH 4JK6A 4IMQA 3SNEA 1C5RA 1YPHC 4DIIH 1ESBA 2C90B 1CT4E 5L2ZH 1TA6A 4K1TA 2ZPQA 2WPMS 3D62A 4UD9H 1GL1A 4ZKOU 2GZ9A 1S85A 1P2OA 4Q2KA 4Y10E 2B5TB 2P3UB 3ZYDA 1THPB 4YOJA 1T32A 2OUAA 2J38A 3L33A 1C1OA 1K1MA 1P06A 1AD8H 2XBVA 1MTWA 3SI3H 4UFDH 1TBQH 4MPWA 1MCVA 4WMFA 2FOGA 3N7OA 1T4VH 1SGIB 1DY9A 3D65E 1AUTC 1MZDA 1OWDA 1XUGA 1YPGH 1C5VA 4A1TA 5A2MH 1SFQB 1OOKB 4NGAH 5EQQA 1J9CH 2A0QB 4AX9H 1BB0B 1HAPH 4ABBA 2XTTB 2ZFSA 1S6HA