3FZZA

Structure of grc
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
227
structure length
227
Chain Sequence
IIGGNEISPHSRPYMAYYEFLKVGGKKMFCGGFLVRDKFVLTAAHCKGRSMTVTLGAHNIKAKEETQQIIPVAKAIPHPDYNPDDRSNDIMLLKLVRNAKRTRAVRPLNLPRRNAHVKPGDECYVAGWGKVTPDGEFPKTLHEVKLTVQKDQVCESQFQSSYNRANEICVGDSKIKGASFEEDSGGPLVCKRAAAGIVSYGQTDGSAPQVFTRVLSFVSWIKKTMKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Granzyme C
publication title Structure of granzyme C reveals an unusual mechanism of protease autoinhibition
pubmed doi rcsb
source organism Mus musculus
total genus 49
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3fzzA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3fzzA02
5GJ4B 3M7UA 1LHCH 5EODA 3P8FA 3SV7A 4IN1A 1C2JA 1O3JA 3A7TA 1O2OA 4R8TB 1BIOA 2JH5D 2H2ZA 4ZXXH 1EP6A 1O3GA 2UUYA 3MH6A 4NIWA 1FN6A 2NU1E 1UTPA 1EJMA 2VIWA 1NY22 5EQQA 3RXUA 1C1VH 1QRWA 2ZI2H 1K28D 2SGPE 3HATH 4BAQB 1GJ8B 1N6YA 3MWIU 2A7JA 3RXSA 1DLKB 2FIRH 3UOUA 2Z3EA 3UNSA 2WYJA 1GMHF 3VGCB 5EW1H 1WSSH 2BDCA 1W7GH 1C1RA 1PQ5A 1Z8RA 1E35B 2UUJB 2FLBH 3ZZ3A 2D2DA 2BMGB 4K8BA 5A0BA 1GBMA 2EEKA 4B73A 2R2MB 3P8OA 5ESBA 3RXJA 1QJ6B 4H42U 3KN2A 3O8BA 2ZWLH 2A4GA 2ANYA 1A2CH 3PYHA 1EX3A 4TY6A 4CHAC 3PWCA 3AASA 1ARBA 2FMJA 2PFEA 1TX6A 3ZZAA 1TOCB 3NZIA 1BMAA 1GBIA 1U6QA 1XXDA 2FEQH 2P16A 4X6PA 3S9AA 3RXHA 1VJAU 1ID5H 4HI3A 5BRRE 1HAHH 1NFWA 1CSOE 2Z94A 4B74A 2P3TB 3TLOA 1VITG 1BTYA 1SGPE 2HPQH 3BTFE 5K7RA 3ZYEA 3A7XA 2SNVA 5C20A 1VCWA 1O5BB 2BDAA 1ZGVA 3GDUA 1P0SH 4CRGA 1C1TA 1GHAG 3RXDA 2W7UA 2O8MA 4YT6H 1C2HA 1LDTT 2UWPA 4MPWA 1G2LA 1K1MA 3ODFA 2B8OH 2CGAA 4XOJA 1ELFA 1XKBC 2H9EH 3PMAB 2W3IA 1NM6A 2GD4B 3M36A 5A0CA 2O8WA 2UUKB 2QCYA 1T8NA 1F5KU 2O8LA 4OGYA 1P57B 1GDNA 3KGPA 1SSXA 1V2VT 1YBWA 4NGAH 3MU4A 1WAYB 4Q2KA 2AIQA 2SGQE 2ZGBH 1S84A 1RTFB 1BDAA 3SU5A 2FOFA 1GPZA 1AFQC 1W0ZU 3RC4A 1CA0C 1VCPA 1W12U 5DK1A 3LT3A 4VGCB 4B2CA 1IAUA 1O2JA 1OKXA 1EZXC 2VINA 4BXWA 1G2MA 2ZCHP 3VB3A 2BY5X 1P02A 3WY8A 4YT7H 1ZRKA 1DXPA 2XW9A 3BTQE 3RXPA 5LPRA 1LTOA 1GGDC 2WPKS 2Q6FA 1GI9B 2R2WU 4JZ1A 2A31A 1LMWB 4K1TA 1HAXB 1O2MA 4BOHA 1A61H 4AORA 3OX7U 2STBE 4WF8A 2C8XB 2F9PA 5EXLA 1AO5A 3RC6A 4B2BA 3UREA 1G32B 2VWOA 5DJ7A 1VITF 2FOAA 1P2KA 1YPJH 3MFJA 3FFGA 1EQ9A 4YM9A 2VNTA 4B76A 4JCNA 2FX4A 4MPVA 1UHBA 2QN5T 2ZQ2A 3JZ1B 5JBAS 2M5TA 4X1RU 1GHAF 3A7WA 2ZC9H 1MKWH 1YCPH 2HNTF 2BY7X 3HKIB 3MH7A 3SU3A 1BRUP 1UHBB 5CHAC 4I31A 2C8YB 1FLEE 1GHZA 1L1NA 3Q00A 2TGAA 5E8EH 3HGNA 5DP5A 2JH6D 3A82A 5AFZH 3RU4E 3RC5A 1GCTB 1O2GH 3UPEA 1XM1A 1HAOH 2G52A 1C5SA 1SHYA 4D7FA 1TBZH 1UTMA 1GBTA 4LK4A 4RSPA 4WY3A 5F6MA 2J2UA 3MO9A 1SQTA 2CHAB 2Y82A 3KNXA 2ZFQH 4GSOA 5EGMA 2ALVA 7KMEH 3RDZA 2J4IA 3GY6A 1AMHA 1BMNH 3PLBA 1GJ5H 1V2TT 2A2QH 3PV4A 2BDIA 3MH4A 3RXAA 4NWLA 1O2XA 1IQEA 2PW8H 3E3TA 4RN6A 1O3DA 2Y5FA 4ZKRU 2XBWA 1O5AB 3RXIA 1NESE 1ANBA 4ABGA 1DWCH 2VIDA 1EAUA 1MZAA 2P95A 2NWNA 2G5NA 1C9PA 2IOTA 2ZFSA 2VIVA 3KL6A 2PSXA 1C5WB 1SGDE 1QRZA 2J9NA 2GZ9A 1P05A 1SGRE 1SGQE 2QAAA 1P3EA 2P3UB 3ZVCA 4J1YA 3EA9A 4K60A 2Z9KA 3S9BA 5F8TA 1GI2A 1GHYH 2J92A 3I29A 1C4U2 3M3VA 2HLCA 1L2EA 3M37A 1A7SA 1GI1A 1KTSB 2ODYB 2ZHWH 2O9QA 5A2MH 3MH5A 5DO4H 1C5LH 1M9UA 2J34A 5E2OA 1SGFA 1O32A 4I8JA 3GY3A 3TH3H 1K1PA 1O2PA 2CN0H 1P12E 3CP7A 1MTNB 3TNSA 3ZZ6A 3UR9A 4NZLA 2FZZA 1O2ZA 1YKTA 4OS1A 1BMLA 1QL9A 4PROA 2FX6A 3TGJE 1GG6C 4K3JA 3T27A 1CT4E 1DT2A 1S0QA 5EG4A 1ZYOA 3LGYA 3QDZB 3RUOA 1EZSC 2P93A 4ZMAH 1K1OA 1Y5UT 2HOBA 2ANWA 2HVXA 4F49A 1L1JA 1GBAA 1BB0B 4BAMB 4GPGA 1C1PA 3BTGE 3OTJE 1K1JA 1C5YB 5IYTA 1GVLA 2W5EA 2FOCA 1RS0A 1OYQA 3EE0B 4JK5A 1B0EA 3A88A 2Y5HA 4A1VA 6LPRA 2QA9E 3M5OA 1O2KA 1BTZA 1SLVB 2O8UA 1ANCA 1GBBA 3IITA 1ZLRA 3A83A 4UEHH 3QN7A 3ATKA 1MKXK 1PYTC 5GWZA 1F0TA 1WUNH 1O2NA 1QFKH 3RXGA 3U69H 3BF6H 3E90B 1ETTH 3GY5A 1G9IE 1QL7A 5DG6A 3BTDE 3ATIA 5JPMH 2A1DB 2A45B 3ELAH 3HPTB 1GMDG 5GDSH 1A0HB 5LH8A 3DFLA 2FTLE 1VGCC 2AERH 1HGTH 2P8OB 1IQLA 2PUXB 1ZTLA 1C2KA 1HAIH 3QUMP 1N6XA 1AU8A 2LNCA 4AYYB 1EATA 4H6SB 7LPRA 3URCA 4ZH8A 2GP9B 4LZ4B 3LGIA 5HYOA 3SHAH 4DCDA 1AGJA 3F9EA 3M35A 2VB0A 2CV3A 3G01A 3PROA 5GIBA 1RIWC 1O30A 1KXEA 1PQ7A 5FPTA 1HXFH 2XCNA 2OD3B 4NIVA 2F83A 1XX9A 2G55A 5FBIA 1K2I1 4A6LA 1UVTH 3P17H 1P8VC 1HBTH 1LHDH 3SGQE 2Y7ZA 4FXGH 1GJ6A 4FU7A 4AB8A 1Y3WA 3MO3A 3SJIA 3U8TH 3UNQA 3UUZA 2V6NA 3H7TA 2A4OA 4QT8C 3RMLH 3PTNA 1ANEA 4WMDA 5EW2H 2R3YA 1TPAE 1XUGA 2A5IA 1EZQA 2ZU2A 1ZR0A 1W3CA 3N7OA 1Z1JA 4J2YB 2AH4X 4FUCA 3VXEH 4BAKB 2AMPA 2BLWA 3F9FA 4WJG2 1UK2A 4K69A 1DUAA 1MUEB 3A84A 2FXRA 4UE7H 4CRCA 4DIHH 1SVPA 2SNWA 4ZROA 3SI4H 1YPKH 2FTMA 3NUMA 5K0HA 1NS3A 1RRKA 3GYMA 2VWLA 2D26C 1WYKA 3FP7E 1BA8B 1AI8H 1ZHRA 2W7SA 3K6ZA 4UFEH 2ZDAH 2BD8A 1HCGA 2AMDA 5GPIB 3F68H 1QR3E 1G36A 1AUJA 1PPEE 1YLDA 1GBCA 1YM0A 3E8LA 3IG6B 4A7IB 3OYPA 1SOZA 3OY6U 4B2AA 4AZ2B 1P9SA 4B1TA 1S6FA 1GMCG 2VVCA 6ESTA 4X0WU 1JOUB 1HJAB 4O3TA 5I25A 4INKA 3ZYDA 3QZQA 1GI7B 1SC8U 2BDHA 1UCYE 1C4V2 1TE0A 2WINI 1J8AA 1Q2WA 4DT7B 1D6RA 2A4QA 4KELA 2BX3A 1EB2A 1A46H 3KQEA 4IMZA 2FI3E 4NSVA 1QTFA 1O3PB 3UFAA 1TNLA 1TX8A 5FAHA 1TPSA 4NIYA 2ZTXA 2BTCE 1GWAA 1OP2A 1XUFA 2VJ1A 1C5UA 3EQ0H 1ZOMA 4KTSA 3GY8A 1MQ5A 2EC9H 1KXFA 4KTUA 1FJSA 4K8YA 1WQVH 1MMJN 2R9PA 1CGJE 3PLPA 3TU7H 1IQFA 4O97A 2P59A 3EA7A 5A09A 3PMHB 1W11U 1Q3XA 1O5GH 4MVNA 3IWMA 4IC6A 2TGDA 2ZZUH 1MCVA 1GJ7B 1ORFA 5DP7A 1BRAA 3ZZ4A 1E37B 2GGVB 1AB9B 1SI5H 4OS6A 3DD2H 4INHA 3A7ZA 4I32A 3RU4D 3ENSB 4Y71A 1QHRB 4AFQA 4XFQA 1NFYA 1FN8A 2AIPA 3ZZBA 1F92A 1OYTH 4F4OC 1K22H 2GT8A 4Q7XA 2BDBA 1CHOG 1LPKB 3QX5H 1H4WA 2P3FH 3PO1C 4U01A 1TBQH 4MDSA 6GCHG 1DANH 1XMNB 1AE5A 1EAWA 1T8LA 2JETB 1GMCF 3SUDA 2A2XH 2NU3E 4JZDH 3ZVFA 2BY6X 4ABBA 3ATLA 1DY8A 5FCRA 2TIOA 2XNIA 2AEIH 2BM2A 2GDEH 2IJOB 3UTUH 1AIXH 2FM2A 2C4FH 1ELDE 1LPGB 2FP7B 2PGBB 4MTBA 4Y8XA 3M5MA 4I7YH 4AB9A 4ZHLU 1UCYH 2AYWA 2FI5E 1PPHE 1PQAA 4FUIA 4K1SA 5JBBS 1AVWA 3DHKH 1BTWA 2BVRH 1GJ4H 1LVBA 1OWDA 1UVOA 1ZMJA 5JBCS 1L0ZA 5DKMA 3UOPA 3SV6A 1P3CA 3E16B 1TWXB 3LJJA 4KTCA 2NU2E 2GZ8A 1FAXA 2PTCE 1PPCE 1V2UT 4E05H 1THSH 1HNEE 3RU4T 3K9XB 4Y79A 4DURA 3S69A 4XBCA 5DP9A 3JZ2B 5T3HA 3SUEA 1MTVA 2ZEBA 3VPKA 1JMOH 1T31A 1YPHC 1ELGA 3M61U 2QXIA 4SGBE 3A8BA 9ESTA 5EQSA 4D9RA 1GJDB 4I8HA 1V6DA 3RXBA 1FIWA 2WV5A 1YP9A 1P03A 2B7DH 4GCHG 2ZO3H 3H5CB 3RXTA 5EOKA 1YPEH 1SLXB 2LPRA 2ZGHA 3A87A 2ODPA 3QZRA 1PQ8A 1GJBB 4LZ1H 1DICA 3OU0A 4OS4A 3A8DA 3B8JA 2QC2A 4MPXA 4NG9H 3P8GA 5SGAE 3RLWH 1YLCA 1SHHB 4BTUB 4WVPE 4BNRA 2FYQA 3AW0A 4AGKA 1C2FA 6CHAB 3SNDA 2Z7FE 2ZCLP 3S0NA 1GI4A 2WPLS 3I77A 1SGFG 2QYIA 1T7CA 1EPTA 4E06H 1QQ4A 1GDQA 1YPGH 1H8DH 3P70B 5ESTE 2ZFRH 2Y81A 3GY2A 1O33A 1EPTB 2V35A 1DXWA 2ZDKA 1Z6JH 8GCHG 3E91A 2BLOA 2Z9JA 5L30H 3MYWA 4H6TA 1HJ9A 1OXGA 2OCVB 5HMAA 1C1SA 4AOQA 1FY4A 3SV9A 3LGUA 2PKSC 2BD3A 2G51A 4CRBA 3SHCH 2B0FA 3TJOA 1YCPK 1JRTA 1O2HA 1H9LB 1FMGA 4CR5A 2G4TA 1F0SA 1F2SE 1CE5A 1PYTD 3UQOA 4DOQA 1EAIA 2EI7A 5T6DA 4NFFA 3PLKA 3DA9B 1DOJA 2UUFB 1J14A 1P04A 3BV9B 4SGAE 4YLQH 1ELEE 1O2YA 1V2PT 2PHBA 3KQBA 3BIUH 1MTNC 2HNTC 1GI3A 1OOKB 3LJOA 1EAXA 1VZQH 3U1IB 3LONA 2VVUA 2ZGXH 1P10A 2VGCB 3A8CA 2FI4E 3SJ8A 4GCHF 1ZPBA 2Y5GA 2ZHFH 2GX4A 5PTPA 2QIQA 3K65B 3CS7A 4UDWH 4AYVB 2RCEA 1DS2E 2BD2A 2FOBA 1SGYE 1L4ZA 4X2XA 5C1XA 1TGNA 4ISLA 1OWHA 3U9AH 1CBWC 1O3IA 4UONA 3PMBB 2GKVE 2H1UA 3LIWA 4D76A 4D9QA 1S0RA 1H9IE 2J94A 3CENA 3EDXB 1K1IA 3GCTG 2XC4A 3QGJA 3QLPH 1SR5C 1JXPA 1THPB 1WV7H 3SNEA 1ETRH 3SUGA 1OX1A 3NPSA 1BJUA 4K5ZA 1O2LA 1ZGIA 1EKBB 1WU1A 8GCHF 1C1NA 1N8OC 1TRNA 4ISOA 4MNYA 3BTME 4Y11E 3RXEA 3RP2A 3W94A 4CHAB 3SU2A 3ESTA 1MH0A 1O36A 5J4SA 1S83A 1F0RA 2D8WA 3RM0H 1LVOA 2ZPQA 1FIZA 4XBBA 2ULLA 3ZZ9A 2P94A 1KDQA 3MU5A 1TIOA 4GUXA 1BTUA 3E1XB 2C8ZB 1JRSA 3A81A 3GCHC 4A5TS 1ZTJA 3M5NA 3V0XA 2CXVA 1KDQB 4X2YA 2Z9LA 5EXNA 4OS5A 4AG1A 1EJAA 1GI0A 2J38A 1HAPH 3SQHE 4XBDA 3HGPA 1ELAA 1ZZZA 1ZPCA 1O2SA 1NZQH 5CE1A 1FY3A 1W0YH 2ZU1A 3RXFA 2F9VA 2Q6DA 1BRCE 3VB6A 1P2NA 4HGCA 1O5CB 3EYDA 3SU0A 4JYVH 1TABE 2BQ7B 2FS9A 1GHBG 3DFJA 5LGOA 1W7XH 2AS9A 2ZG0H 4JZFH 5DP4A 1YCPM 3URDA 2A7CA 4NIXA 3PB1E 2BXTH 1QJ7B 1UMAH 1O3HA 1MCTA 1O2RA 2HWLB 5FX6A 1C1MA 4E7NA 3QK1A 2A0QB 3L3TA 4AX9H 1TNIA 2J95A 1MU8B 2RG3A 2W3KA 3GDSA 3LH1A 2H5DA 2WPJS 1J17T 4WXIA 5B6OA 1O34A 1BHXB 3LPRA 4A1TA 4DY7B 1QQUA 3L33A 1YF4A 2XRCA 2BD5A 4Q80A 1O2TA 5AVDA 3SJKA 1AWFH 1C1QA 2PSYA 4IN2A 5L2ZH 2SGFE 1GGDB 2OXSA 4OS2A 1VR1H 1SG8B 5E0JA 3RXMA 2XWBI 3T26A 2ANMH 4WMEA 1FNIA 1ZMLA 3OSYA 4HTCH 2XC5A 4YOJA 2EA3A 5F8ZA 3F9GA 4FVDA 1K21H 4YLUA 3TITA 3C27B 2ZU4A 3F6UH 3ZVAA 2OLGA 3MMGA 1IHTH 1NFXA 3KEEA 4FUJA 2Y6TA 1ZTKA 3SJOA 1CGHA 2B5TB 1D3PB 2ZCKP 2OC7A 2DE9A 1SLUB 3TK9A 7GCHG 2EI8A 4UD9H 2GCTC 1TMTH 3R0FA 3V12A 1THRH 1XVOA 2FLRH 5E2PA 5CHAB 4A1XA 1BBRK 3QO6A 2BD4A 2FYRA 1GHBF 3D65E 3MO6A 1BUIA 5E0GA 3RMNH 3SV2H 2FO9A 4U2WA 1TX7A 3S7KB 1HLTH 3ZV8A 4Y8YA 1O2VA 2HGTH 1TA6A 1XXFA 4NFEA 1MU6B 1V2LT 4ABJA 1EXFA 2FOMB 1C9TA 5EU8A 2DUCA 4K1EA 2BB4A 4ZUHA 1YPLH 1SPJA 4NA7A 3QTVH 3RXLA 2G5VA 4ZHAA 4DIIH 1LHGH 2ZIQH 2GDDA 3ZV9A 2ZGJA 3H7OA 2BDGA 3UR6A 1YGCH 2JH0D 1AB9C 2THFB 4FU9A 1NU7B 3HK6B 1GHWH 2ANKH 2DE8A 4CRDA 2GMTC 2D1JA 3U98H 2ZGCA 3B9FH 4XE4A 1IQGA 1LQEA 1TNGA 2I6SA 1OSSA 3EA8A 1EUFA 3W95A 1SGCA 1TNKA 4BXSA 3LGWA 5HM2A 2Z3CA 1ESBA 1UJ1A 3AVZA 1D6WA 2SGEE 1V2NT 5GCHG 2UWLA 1UO6A 4TPYA 4XSKU 4Q7ZA 2JETC 3GCNA 1FAKH 3D49H 2FODA 4D8NA 2ZP0H 3A86A 4M7GA 2ZA5A 4DJZB 1E34B 2F9BH 2A4RA 2C90B 1PFXC 1LO6A 5DP8A 3SV8A 4TY7A 1BTXA 1ZSKA 5G4BA 2OUAA 7GCHF 1J9CH 2NU4E 4MLFB 4MPUA 2QF0A 2H9HA 1SFQB 2VH0A 3DT0H 5FBEA 4H4FA 4RKJB 1B7XB 1GG6B 2FOEA 3SBKA 1GBEA 1BITA 1IQIA 2ZDVH 1GMDF 4I8GA 1H8IH 3RMMH 4U32A 1NN6A 2Z6BD 4A92A 1GBJA 3BSQA 1C5ZB 2Z9GA 3LGTA 3Q76A 4AGJA 1HUTH 1GBFA 4IC5A 2VVVA 3TJNA 1O38A 1G37A 1IQNA 1ABIH 2H9TH 3VGCC 1ETSH 1OWJA 4ZKOU 4BAHB 2ZHQH 3BN9A 3NWUA 2WPHS 2OINA 3ZVBA 1UVUH 3V3MA 1O3AA 1L1GA 1P9UA 1IHSH 4NSYA 1BTHH 1O3KA 1ZSJA 2BOKA 1UTOA 1KYNA 3Q3YA 4LOYH 1AZZA 1FV9A 2BX4A 1Y3XA 3ZZ7A 1GHXH 4BAOB 2OTVA 2WPMS 5ETXA 2YOLA 1BQYA 3UQVA 2SFAA 3FAOA 5DGJA 1O3EA 3MU1A 3GY4A 2QGRA 1H1BA 1Y5AT 2O8TA 1D9IA 1PPGE 3A80A 3P6ZB 1UVPA 3ODDA 1MQ6A 1TYNA 1TPOA 3AAVA 3KQCA 4UFFH 2RDLA 4X2WA 5L2YH 2BY9X 1O3NA 3P8NA 1QB1A 2G4UA 3B23B 4FVBA 3STJA 5A0AE 4GAWA 1OWIA 3BEFB 5EPNA 1N1LA 1NT1A 4MNWA 4ABHA 3TH4H 1IOEA 2C3SA 4Z0KA 1UCYK 1VGCB 2FOHA 2IPHA 1MBMA 5GCHF 2OC0A 1EZUC 3FZDA 1TALA 1HIAA 2Y80A 1FY8E 1PPBH 1PJPA 3SORA 1UTKA 3VB5A 3UNRA 4NA8A 1SOTA 1V2WT 2PTNA 2AGEX 4X8VH 4ISIH 4IBLH 2ZNKH 1AHTH 1SGNE 1C1OA 1ZMNA 4ZKSU 3ZVEA 5C1UA 2QY0B 1TAWA 2SGDE 2XWAA 1V2QT 5EXMA 4X6NA 1RIWB 2ZECA 1NRNH 1TGTA 5F8XA 3VB7A 8LPRA 3RXVA 2ZHDA 1LPZB 4KKDA 5C5NA 3S7HB 1GCDA 4JZEH 1IQMA 3O8DA 4AFUA 3L6PA 1ZHPA 1GBHA 1UK3A 2TPIZ 1HXEH 1Z6EA 4NA9H 2BQ6B 1LKAA 1O3MA 2BY8X 2XBXA 5EPYA 1DLEA 4ISNA 1CGIE 1G3EA 4UFGH 4VGCC 3STIA 1DM4B 2ZU5A 5CMXH 1S6HA 4AFZA 1DWEH 4YO9A 1XUKA 3E6PH 2Q6GA 1C5VA 2I6QA 1C4Y2 1V3XA 1Y3UA 2BVSH 2GT7A 3TJUA 1MTUA 3HKJB 1HB0B 1GBLA 1AWHB 3RM2H 2PUQH 4AG2A 3K6YA 2A5AA 4CH8B 1UK4A 1UTQA 4FUHA 1EB1H 1V2JT 2VGCC 1QJ1B 2STAE 2F9UA 1Z1IA 3ZZDA 2V3HH 3GY7A 5F03A 1C2LA 1P2IA 2ZPRA 1DVAH 1XKAC 2BLQA 4BANB 1LHEH 1DSTA 1INCA 1TGSZ 1RFNA 3TIUA 4KP0A 2QXHA 4ABDA 1HRTH 3MHWU 3T28A 1F7ZA 4R0IA 1O35A 1WCZA 2BDYA 3E0NB 1W13U 1ZHMA 2RA0A 2ASUB 2OQUA 1RTKA 4ABIA 1NC6A 2R0LA 2VWMA 1GI8B 3TPIZ 2Z9IA 4ZXYH 1S85A 1YC0A 3SNCA 4TWYA 3UY9A 3VB4A 1SGEE 3K2UA 3SZNA 3LC3A 2OC8A 2F3CE 2WPIS 4RKOB 1Z8GA 1GCTC 2PWXA 1O3FA 1QA0A 2WV4A 2K1QA 2V3OH 3FANA 4AN7A 1S81A 1FY1A 1CHOF 2CHAC 1OS8A 1CU1A 6GCHF 1XUIA 1A5HA 2BYAX 1G3BA 3CS0A 2WUCA 2RA3A 1NO9H 1OP8A 1YPHE 5AFYH 1FPHH 1FQ3A 2G81E 1WQSA 3SU1A 3FP6E 5HM9A 1QRXA 3MU0A 3O8RA 4X6MA 4JZIA 1S5SA 1CT2E 2ZDMA 1GJAB 1AD8H 2OQ5A 5LPFA 1K9OE 1C2GA 1JIRA 4U30A 1LHFH 1FY5A 1MD8A 1UVSH 1YPMH 1Z71A 1TB6H 1GHVH 2WYGA 2XCFA 1BJVA 1Z8IB 4FUGA 1O3OA 3BG4B 3MTYA 2ILNA 4CR9A 4MNVA 2PGQB 2HRVA 5I46H 1NRQH 1EOLA 1VJ9U 1DUEA 3BTTE 1FPCH 1GBDA 1MKWK 2NU0E 3VEQB 1TMBH 3A89A 1C2DA 1EJNA 3ZZ8A 1PPFE 1C2IA 1NU9A 4INLA 5C5OA 3PO1B 2ESTE 4BTTB 4Y8ZA 1H9HE 3V13A 1UTJA 2XYAA 1QNJA 3SI3H 1Q31A 3P92A 1YYY1 4YTAA 5FPYA 2GV6A 3QWCH 1E38B 1LKBA 1C5NH 3TK5A 3SNAA 3SOSA 3T62A 1Z8JB 1AQ7A 1AFEH 4Q7YA 2F91A 1C1WH 7ESTE 1SB1H 4X8UH 3LGVA 1AE8H 4DG4A 2H5CA 3GCOA 1A4WH 1GI5A 4ABAA 5C67A 2G8TA 1QL8A 5JB8S 3LC5A 3SNBA 2ZTYA 2WUBA 3EGKH 4TPIZ 8ESTE 3UWJH 5DP3A 1DWDH 4CREA 9LPRA 4CBOA 1B0FA 4Y0ZE 2CMYA 1C2EA 4X1PU 4NWKA 5DP6A 1ESTA 3QTOH 1EOJA 1KXDA 1P01A 1FONA 2GTBA 3DUXH 3MI4A 4X8SH 2R3UA 2HNTE 4E7RG 1TONA 1WBGB 2ZDNA 3UIRA 3VFEA 2PV9B 1BHXF 4OGXA 1J16A 4YOIA 5BPEA 4I33A 3SW2B 5DPAA 1LCYA 1OWEA 2F9OA 1NTPA 1BT7A 2XC0A 3LKWA 1O31A 3RXOA 1D3DB 2ZFTA 3TVJB 3ZZCA 2ZQ1A 2FDAA 3PM3A 3M5LA 5ABWA 1FZZA 3PMJA 1MTWA 2CJIA 3KHVA 2PKAA 1AVXA 3NXPA 4I8LA 2ZF0H 1O2UA 5C2ZA 4Y10E 2BZAA 3M3TA 1W2KH 3E0PB 1JWTA 1WTGH 1FUJA 2JKHA 3SU6A 4ABEA 1OP0A 2P8OC 3BEIB 4O3UA 1GI6A 1T8MA 4YESB 1ELVA 2PKAB 1C5TA 1SFIA 1O0DH 1IQJA 1ABJH 1TBRH 2ZPSA 4ZAEA 4THNH 3TGIE 1C5XB 1QA7A 5AF9H 2BHGA 3BIVH 1Y3YA 1A0JA 3ITIA 1TGCA 1QB6A 3RXCA 1GL0E 1NFUA 1BMMH 1T4VH 3M7TA 3T2NA 1BOQA 1TRYA 1BZXE 2FPZA 1F5LA 3M3SA 3TGKE 2Y7XA 2ZTZA 3SUFA 1GVKB 3U8OH 3ATMA 4FUDA 5T6FA 5TCAA 5A8XA 1NROH 5T6GA 1HAYB 4MQAA 4Y7BA 3SU4A 2G00A 1NPMA 2HALA 2VIPA 4B75A 2ALPA 3A85A 2OBOA 1MZDA 4YZUA 1HV7A 4Y76A 1BCUH 5HGGA 5FX5A 5C1YA 2YNBA 3GISB 3I78A 1LQDB 3MNSA 1TA2A 2SGAA 5FXLA 3TK6A 1WOFA 2PKSB 1QBVH 3KQDA 1G30B 3RXKA 1B5GH 4GLYA 3LDXH 2A32A 2HPPH 1AFQB 1PPZA 1LVYA 2GZ7A 1C5PA 1FXYA 2EI6A 1VITH 4O9VA 1CA0B 4I8KA 1HAVA 1C2MA 3SN8A 3GCTF 2BD9A 3LH3A 4X6OA 1GJCB 1KXCA 1O5FH 1TNHA 2QV1A 5C3NA 1A5IA 2XTTB 2VU8E 1AUTC 1E36B 2YNAA 1HAVB 1T4UH 1GJ9B 2VH6A 3A7VA 2B9LA 1DDJA 4MNXA 1DFPA 2V0BA 3BTWE 2TGPZ 2TBSA 1V2KT 3T5FH 4CBNA 1HFDA 1CO7E 1TOMH 1DX5M 4YOGA 3T25A 1MD7A 3ATWA 1A3EH 1D3TB 2FS8A 1ELBA 1SGTA 3GDVA 2CF8H 1G3CA 4XDEA 4O03A 1C5MD 1HJAC 1DWBH 4TYDA 1O39A 1BBRE 1Y3VA 1P06A 1GBKA 1RD3B 2XXLA 3KF2A 1K1LA 1W10U 3HK3B 4CRFA 4MG3A 2BVXH 2IN2A 3A7YA 1AY6H 4DGJA 1DY9A 1X7AC 4CRAA 3SGBE 1CBWB 2GCHG 2QXGA 4X1QU 2BOHB 2VIOA 1SL3A 3BTHE 3LOXA 1Z7KA 2AMQA 4ABFA 4NZQA 2BD7A 2VIQA 2A7HA 1NRSH 1AKSA 1QY6A 4GHQA 5LPEA 1QBNA 2ZDLA 3C1KA 1D3QB 3A8AA 1N8OB 2ZU3A 3R3GB 3SQEE 1QB9A 1JIMA 1AKSB 3KIDU 2ZFFH 1C5OH 5JYIA 1TNJA 3AW1A 2Q1JA 4ZHMU 1CT0E 5L6NH 2W26A 5AHGH 2XBVA 3U1JB 3RLYH 2FWWA 1FDPA 1CA8B 2BZ6H 3EAJA 3GCHB 1D4PB 4DVAU 1ESAA 1C5RA 2TGTA 1P11E 4JMYA 5TJXA 1HJ8A 4WMFA 1P2OA 2PLXA 3S9CA 1TQ7B 4D7GA 1ZSLA 1VCQA 1SGIB 5EQRA 1SLWB 1AN1E 1A0LA 3Q3KA 2VWNA 8KME2 2XBYA 1Y5BT 3SGAE 4ESTE 1XVMA 2H6MA 1FI8A 1RGQA 3SO3A 4FUFA 1W8BH 5GXPA 1TPPA 3F9HA 1S82A 4X8TH 4X1SU 3ZZ5A 3MU8A 3AAUA 1MBQA 1F5RA 1HAZB 1L4DA 1RTLA 5E0HA 4LXBH 1HAGE 1HDTH 1MKXH 4GVUA 1OWKA 1IQHA 1TQ0B 1CVWH 1KXBA 1QURH 1DE7H 1KY9A 1KLIH 1XUHA 3RXQA 1O3LA 1V2OT 2TRMA 2OP9A 2F9NA 5J4QA 4JK6A 5A8ZA 1O3CA 4IS5A 2BQWB 1DPOA 1NRRH 1UTNA 5JDUB 1A5GH 1BBRH 3NKKA 1BTPA 2GCHF 4K2YA 3F1SB 4HZHA 1GVZA 2C8WB 2ODQA 1HYLA 4FUEA 5TCCA 4Y7AA 1ARCA 3PWBA 1DITH 1G3DA 3LU9B 4DW2U 1OPHB 5HXFA 2AFQB 1KXAA 1P09A 3BG8A 1QGFA 3TNTA 4ASHA 1ELTA 4UFDH 4GHTA 1O2WA 4CH2B 1O2IA 1MAYA 1QCPA 1JBUH 1GL1A 1ZJDA 1MTSA 3Q77A 2A5KA 4FU8A 3MNXA 1F0UA 1QBOA 4WWYA 1DSUA 1BRBE 1HPGA 1XUJA 1LVMA 2GVFA 4ISHH 1RXPA 3M7QA 1SBWA 3TJVA 3U8RH 3OY5U 2CF9H 1T32A 4X2VA 1O37A 3P95A 1ACBE 1ELCA 1O3BA 1ZJKA 4KGAA 3GOVB 1QIXB 3Q3XA 4BTIB 1GDUA 3FVFB 1EP5A 1ZPZA 3KCGH 1AVGH 3NK8A 4OS7A 1J15A 1AZ8A 2GCTB 4ZKNU 4IMQA 1EASA 1UTLM 5A8YA 2R0KA 4WH6A 3VXFH 4Y6DA 1O2QA 1P2MA 1SQOA 2BLVA 4JYTA 3BEUA 2GV7A 2UWOA 2ZKSA 1KLTA 1ANDA 1SQAA 5JBTA 1C5QA 2AGIX 1CHGA 1IQKA 2BXUH 1GMHG 6CHAC 4Z6AH 1NRPH 3RMOH 5FPSA 4JYUH 1HIAB 3TH2H 3SJ9A 1O5EH 3FP8E 4WXVA 5JB9S 3ZVDA 1A1RA 1A3BH 4Y0YE 5FCKA 2QF3A 3MOCA 1EPTC 1SMFE 1K1NA 1V2ST 1CQQA 1KLJH 3V7TA 4TWWA 1WTHD 3GICB 3MNCA 3D62A 2ZFPH 4IGDA 2FOGA 1TRMA 1KTTB 3NCLA 2KAIA 3QGNB 3BG4C 4FUBA 4HFPB 4AFSA 2Z3DA 1C1UH 4WH8A 3UWIA 1T8OA 3FZZA 5H4IB 1O5DH 5IDKA 4IW4E 1W14U 1KSNA 1TLDA 1RJXB 2FESH 5FHTA 2KAIB 2GMTB 3MNBA 2ZHEH 4B71A 2OBQA 1E0FD 3GYLB 3RXRA 1TMUH 3T29A 1ZRBA 3O8CA 3BTKE 2AGGX 1Y8TA 2OC1A 1TGBA 1P2QA 1KIGH 1P2JA 2QXJA 1V2MT 1MAXA 1V2RT 4NCYA 2C93B 3PTBA 1Y59T 3BTEE 3ZVGA 4X1NU 2PR3A 1TFXA 3D23A
chains in the Genus database with same CATH superfamily
5GJ4B 3M7UA 1LHCH 5EODA 3P8FA 3SV7A 4IN1A 1C2JA 1FX0B 1O3JA 3A7TA 1O2OA 4R8TB 1BIOA 2JH5D 2H2ZA 4ZXXH 1EP6A 1O3GA 2UUYA 3MH6A 4NIWA 1FN6A 2NU1E 1UTPA 1EJMA 2VIWA 1NY22 5EQQA 3RXUA 1C1VH 1QRWA 2ZI2H 1K28D 2SGPE 3HATH 4BAQB 1GJ8B 1N6YA 3MWIU 2A7JA 3RXSA 3WWBA 1DLKB 2FIRH 3UOUA 2Z3EA 3UNSA 5FL7D 2WYJA 1GMHF 3VGCB 5EW1H 1WSSH 2BDCA 1W7GH 1C1RA 1PQ5A 1Z8RA 1E35B 2UUJB 2FLBH 3ZZ3A 2D2DA 2BMGB 4K8BA 5A0BA 1GBMA 5HIZA 2EEKA 4B73A 2R2MB 3P8OA 5ESBA 3RXJA 1QJ6B 4H42U 3KN2A 3O8BA 2ZWLH 2A4GA 2ANYA 1A2CH 3PYHA 1EX3A 4TY6A 4CHAC 3PWCA 3AASA 1ARBA 2FMJA 2PFEA 1TX6A 3ZZAA 2J98A 1TOCB 3NZIA 1YY3A 1BMAA 1GBIA 1U6QA 1XXDA 2FEQH 2P16A 4X6PA 1H8HD 3S9AA 3RXHA 4RT1A 1VJAU 1ID5H 4HI3A 5BRRE 1HAHH 1NFWA 1CSOE 2Z94A 2IJD1 4B74A 2P3TB 3TLOA 1VITG 1BTYA 1SGPE 2HPQH 3BTFE 5K7RA 3ZYEA 3A7XA 2SNVA 3H09A 5C20A 1VCWA 1O5BB 2BDAA 1ZGVA 3GDUA 1P0SH 4CRGA 5HIYA 1C1TA 1GHAG 3RXDA 2W7UA 2O8MA 4YT6H 1C2HA 1LDTT 2UWPA 4MPWA 1G2LA 1K1MA 3ODFA 2B8OH 2CGAA 4XOJA 1ELFA 1XKBC 2H9EH 4B6EA 3PMAB 2W3IA 1NM6A 2GD4B 3M36A 5A0CA 2O8WA 2UUKB 2QCYA 1T8NA 1F5KU 2O8LA 4OGYA 1P57B 1GDNA 3KGPA 1SSXA 1V2VT 1YBWA 4NGAH 3MU4A 1WAYB 4Q2KA 2AIQA 2SGQE 2ZGBH 1S84A 1RTFB 1BDAA 3SU5A 3F0OA 3VG8A 2FOFA 1GPZA 1AFQC 1W0ZU 3RC4A 1CA0C 1VCPA 1W12U 5DK1A 3LT3A 4VGCB 4B2CA 1IAUA 5CHBA 1O2JA 1OKXA 1EZXC 2VINA 4BXWA 1G2MA 2ZCHP 3VB3A 2BY5X 1WXRA 1COWD 1P02A 5GNDA 3WY8A 4YT7H 1ZRKA 1DXPA 3DSGA 2XW9A 3BTQE 3RXPA 5LPRA 1LTOA 1GGDC 2WPKS 2Q6FA 1GI9B 2R2WU 4JZ1A 2A31A 3GS9A 1LMWB 4K1TA 1HAXB 2WZQA 4ACAA 1O2MA 4BOHA 1A61H 4AORA 3OX7U 2STBE 4WF8A 2C8XB 2F9PA 5EXLA 1AO5A 3RC6A 4B2BA 3UREA 2XNDD 1G32B 2VWOA 5DJ7A 1VITF 2FOAA 1P2KA 1YPJH 3MFJA 3FFGA 1EQ9A 4YM9A 2VNTA 4B76A 4JCNA 2FX4A 4MPVA 1UHBA 2QN5T 2ZQ2A 3JZ1B 5JBAS 2M5TA 4X1RU 1GHAF 1S6LA 3A7WA 2ZC9H 1MKWH 1YCPH 2HNTF 2BY7X 3HKIB 3MH7A 3SU3A 1BRUP 1UHBB 5CHAC 4I31A 2C8YB 1FLEE 1GHZA 1L1NA 3Q00A 2TGAA 2WHXA 5E8EH 3HGNA 5DP5A 2JH6D 3A82A 5AFZH 3RU4E 3RC5A 1GCTB 1O2GH 3UPEA 1XM1A 1NBMD 1HAOH 2G52A 1C5SA 1SHYA 4D7FA 1TBZH 3DSOA 1UTMA 1GBTA 4LK4A 4RSPA 4WY3A 5F6MA 2J2UA 3OEHD 3MO9A 1SQTA 2CHAB 2Y82A 3KNXA 2IPQX 3F2HA 2ZFQH 4GSOA 5EGMA 2ALVA 7KMEH 3RDZA 2J4IA 3GY6A 1AMHA 1BMNH 3PLBA 1GJ5H 1V2TT 2A2QH 3PV4A 2BDIA 3MH4A 3RXAA 4NWLA 1O2XA 1IQEA 2PW8H 1EFRD 3E3TA 1O3DA 4RN6A 2Y5FA 4ZKRU 2XBWA 1O5AB 3RXIA 1NESE 1ANBA 4ABGA 1DWCH 2VIDA 1EAUA 1MZAA 2P95A 2NWNA 2G5NA 1C9PA 2IOTA 2ZFSA 2VIVA 3KL6A 2PSXA 1C5WB 1SGDE 1QRZA 2J9NA 2GZ9A 1P05A 1SGRE 1SGQE 2QAAA 1P3EA 2P3UB 3ZVCA 4J1YA 3EA9A 4K60A 2Z9KA 3S9BA 5F8TA 1GI2A 1GHYH 2J92A 3I29A 1C4U2 3M3VA 2HLCA 1L2EA 3M37A 4B6FA 1A7SA 1GI1A 1KTSB 2ODYB 2ZHWH 2O9QA 2V7QD 5A2MH 3MH5A 5F53A 1W0KD 5DO4H 1C5LH 1M9UA 2J34A 5E2OA 1SGFA 1O32A 4I8JA 3GY3A 3TH3H 1K1PA 1O2PA 2CN0H 1P12E 3CP7A 1MTNB 3TNSA 3ZZ6A 3UR9A 4NZLA 2FZZA 3MQKC 1O2ZA 1YKTA 4OS1A 1BMLA 1QL9A 4PROA 2FX6A 3TGJE 1GG6C 4K3JA 3T27A 1CT4E 1DT2A 1S0QA 5EG4A 1ZYOA 3LGYA 3QDZB 3RUOA 1EZSC 2P93A 4ZMAH 1K1OA 1Y5UT 2EY4C 2HOBA 2ANWA 2HVXA 4F49A 1L1JA 1GBAA 1BB0B 4BAMB 4GPGA 1C1PA 3BTGE 3OTJE 1K1JA 1C5YB 5IYTA 1GVLA 2W5EA 2FOCA 1RS0A 3U28C 1OYQA 3EE0B 4JK5A 1B0EA 3A88A 2Y5HA 4A1VA 6LPRA 2QA9E 3M5OA 1O2KA 1BTZA 1SLVB 2O8UA 1ANCA 1GBBA 3IITA 1ZLRA 3A83A 4UEHH 3QN7A 3ATKA 4RT0A 1MKXK 1PYTC 5GWZA 1F0TA 1WUNH 1O2NA 1QFKH 3RXGA 3U69H 3BF6H 3E90B 1ETTH 3GY5A 4TT3D 1G9IE 1QL7A 5DG6A 3BTDE 3ATIA 5JPMH 2A1DB 2A45B 3ELAH 3HPTB 1GMDG 5GDSH 1A0HB 5LH8A 3DFLA 2FTLE 1VGCC 2AERH 1HGTH 2P8OB 1IQLA 2LP6A 2PUXB 1ZTLA 1C2KA 1HAIH 3QUMP 1N6XA 1AU8A 2LNCA 4AYYB 1EATA 4H6SB 7LPRA 3URCA 4ZH8A 2GP9B 4LZ4B 1WDIA 3LGIA 5HYOA 3SHAH 4DCDA 3UAIC 1AGJA 3F9EA 3M35A 2VB0A 2CV3A 3G01A 3PROA 5GIBA 1RIWC 1O30A 1KXEA 1PQ7A 5FPTA 1VKYA 1HXFH 2XCNA 2OD3B 4NIVA 2F83A 1XX9A 2G55A 5FBIA 1K2I1 4A6LA 1UVTH 3P17H 2HVYB 1P8VC 1HBTH 1LHDH 3SGQE 1E1RD 2Y7ZA 4FXGH 1GJ6A 4FU7A 4AB8A 1Y3WA 3MO3A 3SJIA 3U8TH 3UNQA 3UUZA 2V6NA 3H7TA 2A4OA 1YWUA 4QT8C 3RMLH 3PTNA 1ANEA 4WMDA 5EW2H 2R3YA 1TPAE 1XUGA 2A5IA 1EZQA 2ZU2A 1ZR0A 1W3CA 3N7OA 1Z1JA 4J2YB 2AH4X 4FUCA 3VXEH 4BAKB 2AMPA 2BLWA 2JJ1D 3F9FA 4WJG2 1UK2A 4K69A 1DUAA 1MUEB 3A84A 2FXRA 4UE7H 4CRCA 4DIHH 1SVPA 2SNWA 4ZROA 3SI4H 1YPKH 2FTMA 3NUMA 5K0HA 1NS3A 1RRKA 3GYMA 2VWLA 2D26C 1WYKA 2HLDD 1BA8B 2CK3D 1AI8H 3F2FA 3FP7E 1ZHRA 2W7SA 3K6ZA 4UFEH 2ZDAH 4F48B 2BD8A 1HCGA 2AMDA 5GPIB 3F68H 1QR3E 1G36A 1AUJA 1PPEE 1YLDA 3PV5A 1GBCA 1YM0A 3E8LA 3IG6B 4A7IB 2GJGA 3OYPA 1SOZA 3OY6U 4B2AA 4AZ2B 1P9SA 4B1TA 1S6FA 1GMCG 2VVCA 6ESTA 1W0JD 4X0WU 1JOUB 1HJAB 4O3TA 5I25A 4INKA 3ZYDA 3QZQA 1GI7B 1SC8U 2BDHA 1UCYE 1C4V2 1TE0A 2WINI 5T1VA 1J8AA 1Q2WA 4DT7B 1D6RA 2A4QA 4KELA 2BX3A 1EB2A 1A46H 5EJZA 3KQEA 3N7EA 4IMZA 2FI3E 4NSVA 1QTFA 1O3PB 3UFAA 1TNLA 1TX8A 5FAHA 1TPSA 4NIYA 2ZTXA 2BTCE 1GWAA 1OP2A 4F55A 1XUFA 2VJ1A 1C5UA 3EQ0H 4AC9A 1ZOMA 4Q63A 4KTSA 3AK5A 3GY8A 1MQ5A 2EC9H 1KXFA 4KTUA 1FJSA 4K8YA 1WQVH 5EIYA 1MMJN 2R9PA 1CGJE 3PLPA 3TU7H 2LELA 1IQFA 4O97A 2P59A 3EA7A 5A09A 3PMHB 1W11U 1Q3XA 1O5GH 4MVNA 3IWMA 4IC6A 4XRNA 2TGDA 2ZZUH 1MCVA 1GJ7B 1ORFA 5DP7A 1BRAA 3ZZ4A 1E37B 2GGVB 1AB9B 1SI5H 4OS6A 3DD2H 4INHA 3A7ZA 4I32A 3RU4D 3ENSB 4Y71A 1QHRB 4AFQA 4XFQA 1NFYA 1FN8A 2AIPA 3ZZBA 1F92A 1OYTH 4F4OC 1K22H 2GT8A 4Q7XA 2BDBA 1CHOG 1LPKB 3QX5H 1H4WA 2P3FH 3PO1C 4U01A 1TBQH 4MDSA 6GCHG 1DANH 1XMNB 1AE5A 1EAWA 1T8LA 2JETB 1GMCF 3SUDA 2A2XH 2NU3E 2QE7D 4JZDH 4XD7D 2BY6X 3ZVFA 4ABBA 3ATLA 1DY8A 5FCRA 2TIOA 2XNIA 2AEIH 2BM2A 2GDEH 2IJOB 3UTUH 1AIXH 2FM2A 2C4FH 1ELDE 1LPGB 2FP7B 2PGBB 4MTBA 4Y8XA 3M5MA 4I7YH 4AB9A 4ZHLU 3PRDA 1UCYH 2AYWA 2FI5E 1PPHE 1PQAA 4FUIA 4K1SA 5JBBS 1AVWA 3DHKH 1BTWA 2BVRH 1GJ4H 1LVBA 1OWDA 1UVOA 1ZMJA 5JBCS 1L0ZA 5DKMA 3UOPA 3SV6A 1P3CA 3E16B 1TWXB 3LJJA 4KTCA 2NU2E 2GZ8A 1FAXA 2PTCE 1PPCE 1V2UT 4E05H 2YMSC 1THSH 1HNEE 3RU4T 3K9XB 4Y79A 4DURA 3S69A 4XBCA 5DP9A 3JZ2B 5T3HA 3SUEA 1MTVA 2ZEBA 3VPKA 1JMOH 1T31A 1YPHC 1ELGA 3M61U 2QXIA 4SGBE 3A8BA 9ESTA 5EQSA 4D9RA 1GJDB 4I8HA 3DCLA 1V6DA 3RXBA 1FIWA 2WV5A 1YP9A 1P03A 2B7DH 4GCHG 3SYJA 2ZO3H 3H5CB 3RXTA 3W1EA 5EOKA 1YPEH 1SLXB 2LPRA 2ZGHA 3A87A 2ODPA 2J98B 3QZRA 1PQ8A 1GJBB 4LZ1H 1DICA 3OU0A 4OS4A 3A8DA 3B8JA 3WWFA 2QC2A 4MPXA 4NG9H 3P8GA 5SGAE 3RLWH 5EJ1A 1YLCA 2KZ4A 1SHHB 3OFND 4OM9A 4BTUB 4WVPE 4BNRA 2FYQA 3AW0A 4AGKA 1C2FA 6CHAB 3SNDA 2Z7FE 2ZCLP 3S0NA 1GI4A 2WPLS 3I77A 1SGFG 2QYIA 1T7CA 1EPTA 3NRLA 4E06H 1QQ4A 3F2GA 1GDQA 1YPGH 1H8DH 3P70B 5ESTE 2ZFRH 2Y81A 3GY2A 1O33A 1EPTB 2V35A 1DXWA 2ZDKA 1Z6JH 8GCHG 3E91A 2BLOA 2Z9JA 5L30H 3MYWA 4H6TA 1HJ9A 1OXGA 2OCVB 5HMAA 1C1SA 4AOQA 1FY4A 3SV9A 3LGUA 2PKSC 2BD3A 2G51A 4CRBA 3SHCH 3KYFA 2B0FA 3TJOA 1YCPK 1JRTA 1O2HA 1H9LB 1FMGA 4CR5A 2G4TA 1F0SA 1F2SE 1CE5A 1PYTD 3UQOA 4DOQA 1EAIA 2EI7A 5T6DA 4NFFA 3PLKA 3DA9B 1DOJA 2UUFB 1J14A 1P04A 3BV9B 4SGAE 4YLQH 1ELEE 4DT4A 1O2YA 1V2PT 2PHBA 3KQBA 3BIUH 1MTNC 2HNTC 3OTPA 1GI3A 1OOKB 3LJOA 1EAXA 1VZQH 3U1IB 3LONA 2VVUA 2ZGXH 1P10A 3EE7A 2VGCB 3A8CA 2FI4E 3SJ8A 4GCHF 1ZPBA 2Y5GA 2ZHFH 2GX4A 5PTPA 2QIQA 3K65B 3CS7A 4UDWH 4AYVB 2RCEA 1DS2E 2BD2A 2FOBA 1SGYE 1L4ZA 4X2XA 5C1XA 2L74A 1TGNA 4ISLA 1OWHA 3U9AH 1CBWC 1O3IA 4UONA 3PMBB 2GKVE 5KEDA 2H1UA 3LIWA 4D76A 4D9QA 1S0RA 1H9IE 2J94A 3CENA 3EDXB 1K1IA 3GCTG 3DSPA 2XC4A 3QGJA 3QLPH 1SR5C 1JXPA 1K0HA 1THPB 1WV7H 3SNEA 1ETRH 3SUGA 1OX1A 3NPSA 1BJUA 4K5ZA 1O2LA 1ZGIA 1EKBB 1WU1A 8GCHF 1C1NA 1N8OC 1TRNA 4ISOA 4MNYA 3BTME 4Y11E 3RXEA 3RP2A 3W94A 4CHAB 3SU2A 3ESTA 1MH0A 1O36A 1SKYE 5J4SA 1S83A 1F0RA 2D8WA 3RM0H 1LVOA 2ZPQA 1FIZA 4XBBA 2ULLA 3ZZ9A 2P94A 1KDQA 3MU5A 1TIOA 4GUXA 1BTUA 3E1XB 2C8ZB 1JRSA 3A81A 3GCHC 4A5TS 1ZTJA 3M5NA 3V0XA 2CXVA 1KDQB 4X2YA 2Z9LA 5EXNA 4OS5A 4AG1A 1EJAA 1GI0A 2J38A 1HAPH 3SQHE 4XBDA 3HGPA 1ELAA 1ZZZA 1ZPCA 1O2SA 1NZQH 5CE1A 1FY3A 1W0YH 2ZU1A 3RXFA 2F9VA 2Q6DA 1BRCE 4RI0A 3VB6A 1P2NA 4HGCA 1O5CB 3EYDA 4ZCNA 3SU0A 4JYVH 1TABE 2BQ7B 2FS9A 1GHBG 3DFJA 5LGOA 5IK2D 1W7XH 2AS9A 2ZG0H 4JZFH 5DP4A 1YCPM 3URDA 2A7CA 4NIXA 3PB1E 2BXTH 1QJ7B 1UMAH 1O3HA 1MCTA 2WV9A 1O2RA 2HWLB 5FX6A 1C1MA 4E7NA 3QK1A 2A0QB 3L3TA 4AX9H 1TNIA 2J95A 1MU8B 2JDID 2RG3A 2W3KA 1MABB 4TSFD 3GDSA 3LH1A 2H5DA 2WPJS 1J17T 4WXIA 5B6OA 1O34A 1BHXB 3LPRA 4A1TA 4DY7B 1QQUA 3L33A 1YF4A 2XRCA 2BD5A 4Q80A 1O2TA 5AVDA 5KECA 3SJKA 1AWFH 1C1QA 2PSYA 4IN2A 5L2ZH 5B6LA 2SGFE 1GGDB 2OXSA 2WPDD 1VR1H 4OS2A 1SG8B 5E0JA 3RXMA 5DN6D 2XWBI 3T26A 2KR7A 2ANMH 4WMEA 1FNIA 1ZMLA 3OSYA 4HTCH 2XC5A 4YOJA 2EA3A 5F8ZA 3F9GA 3OE7D 4FVDA 1K21H 4YLUA 3TITA 3C27B 2ZU4A 3F6UH 3ZVAA 2OLGA 3MMGA 1IHTH 1NFXA 3KEEA 4FUJA 2Y6TA 1H8ED 1ZTKA 3SJOA 1CGHA 2B5TB 2KM0A 1D3PB 2ZCKP 2OC7A 2DE9A 1SLUB 3TK9A 7GCHG 2EI8A 4UD9H 2GCTC 3F3BA 1TMTH 3R0FA 3V12A 1THRH 1XVOA 2FLRH 5E2PA 5CHAB 4A1XA 1BBRK 3QO6A 2BD4A 2FYRA 1GHBF 3D65E 3MO6A 1BUIA 5E0GA 3RMNH 3SV2H 2FO9A 4U2WA 1TX7A 4Q4LA 3S7KB 1HLTH 3ZV8A 4Y8YA 1O2VA 2HGTH 1TA6A 1XXFA 4NFEA 1MU6B 1V2LT 4ABJA 1EXFA 2FOMB 1C9TA 5EU8A 2DUCA 4K1EA 2BB4A 4ZUHA 1YPLH 1SPJA 4NA7A 3QTVH 3RXLA 2G5VA 4ZHAA 4DIIH 1LHGH 2ZIQH 2GDDA 3ZV9A 2ZGJA 3H7OA 2BDGA 3UR6A 1YGCH 2JH0D 1AB9C 2JIZD 2THFB 4FU9A 1NU7B 4HG6A 3HK6B 1GHWH 2ANKH 2DE8A 3FO8D 4CRDA 2GMTC 2YMSD 2D1JA 3U98H 2ZGCA 3B9FH 4XE4A 1IQGA 1LQEA 1TNGA 2I6SA 1OSSA 3EA8A 1EUFA 3W95A 1SGCA 1TNKA 4BXSA 3LGWA 5HM2A 2Z3CA 1ESBA 1UJ1A 2WSSD 3AVZA 1D6WA 2SGEE 1V2NT 5GCHG 2UWLA 1UO6A 4TPYA 4XSKU 4Q7ZA 2JETC 3GCNA 2EQNA 1FAKH 3D49H 2FODA 3WW7A 4D8NA 2ZP0H 3A86A 4M7GA 2ZA5A 4DJZB 1E34B 2F9BH 2A4RA 2C90B 1PFXC 3KYGA 1LO6A 5DP8A 3SV8A 4TY7A 1BTXA 1ZSKA 5G4BA 2OUAA 2RFKC 7GCHF 1J9CH 2NU4E 4MLFB 4MPUA 2QF0A 2H9HA 1SFQB 2VH0A 3DT0H 5FBEA 4H4FA 4RKJB 1B7XB 1GG6B 2FOEA 3SBKA 1GBEA 1BITA 1IQIA 2ZDVH 1GMDF 4I8GA 1H8IH 3RMMH 4U32A 1NN6A 2Z6BD 4A92A 3FN8A 1GBJA 3BSQA 1C5ZB 2Z9GA 3LGTA 3Q76A 4AGJA 1HUTH 1GBFA 4IC5A 2J5UA 2VVVA 3TJNA 1O38A 1G37A 1IQNA 1ABIH 2H9TH 3VGCC 1ETSH 1OWJA 4ZKOU 4BAHB 2ZHQH 3BN9A 3NWUA 2WPHS 2OINA 3ZVBA 1UVUH 3V3MA 1O3AA 1L1GA 1P9UA 1UW7A 1IHSH 4NSYA 1BMFD 1BTHH 1O3KA 1ZSJA 2BOKA 1UTOA 1KYNA 3Q3YA 3UB0A 4LOYH 1AZZA 1FV9A 2BX4A 1Y3XA 3ZZ7A 1GHXH 4BAOB 2OTVA 2WPMS 5ETXA 2YOLA 1BQYA 3UQVA 2SFAA 3FAOA 5DGJA 1O3EA 3SZEA 3MU1A 3GY4A 2QGRA 1H1BA 1Y5AT 2O8TA 1D9IA 1PPGE 3A80A 3P6ZB 1UVPA 3ODDA 1MQ6A 1TYNA 2KX4A 1TPOA 3AAVA 3KQCA 4UFFH 2RDLA 4X2WA 5L2YH 2BY9X 4FETA 1O3NA 3P8NA 1QB1A 2G4UA 3B23B 4FVBA 3STJA 5A0AE 4GAWA 1OWIA 3BEFB 5EPNA 1N1LA 1NT1A 4MNWA 4ABHA 3TH4H 1IOEA 2C3SA 4Z0KA 1UCYK 1VGCB 2FOHA 2IPHA 1MBMA 5GCHF 2OC0A 1EZUC 3FZDA 1TALA 1HIAA 2Y80A 1FY8E 1PPBH 1PJPA 1E79D 3SORA 1UTKA 3VB5A 3UNRA 4NA8A 2PP6A 1SOTA 1V2WT 2PTNA 2AGEX 4X8VH 4ISIH 4IBLH 2ZNKH 1AHTH 1SGNE 2RDEA 1C1OA 1ZMNA 4ZKSU 3ZVEA 5C1UA 2QY0B 1TAWA 2SGDE 2XWAA 1V2QT 5EXMA 4X6NA 1RIWB 2ZECA 1NRNH 1TGTA 5F8XA 3VB7A 8LPRA 3RXVA 2ZHDA 1LPZB 4KKDA 5C5NA 3S7HB 1GCDA 4JZEH 1IQMA 3O8DA 4AFUA 3L6PA 1ZHPA 1GBHA 1UK3A 2TPIZ 1HXEH 1Z6EA 4NA9H 2BQ6B 1LKAA 1O3MA 2BY8X 3PV2A 2XBXA 5EPYA 1DLEA 4ISNA 1CGIE 1G3EA 4UFGH 4VGCC 3STIA 1DM4B 2ZU5A 4P02A 5CMXH 1S6HA 4AFZA 1DWEH 4YO9A 1XUKA 3E6PH 2Q6GA 1C5VA 2I6QA 1C4Y2 1V3XA 1Y3UA 2BVSH 2GT7A 3TJUA 1MTUA 3HKJB 1HB0B 1GBLA 1AWHB 3RM2H 2PUQH 4AG2A 3K6YA 2A5AA 4CH8B 1UK4A 1UTQA 3CNRA 2KCOA 1EB1H 4FUHA 4ACBA 5CDFE 3PRBA 1V2JT 2VGCC 1QJ1B 2STAE 2F9UA 1Z1IA 3ZZDA 2V3HH 3GY7A 5F03A 1C2LA 1P2IA 2ZPRA 1DVAH 1XKAC 2BLQA 4BANB 1LHEH 1DSTA 1INCA 1TGSZ 1RFNA 3TIUA 1E1QD 4KP0A 2QXHA 4ABDA 1HRTH 3MHWU 2KCPA 3T28A 1F7ZA 4R0IA 1O35A 1WCZA 2BDYA 3E0NB 1W13U 1ZHMA 2RA0A 2ASUB 2OQUA 1RTKA 4ABIA 1NC6A 2R0LA 2VWMA 1GI8B 3TPIZ 2Z9IA 4ZXYH 1S85A 1YC0A 1YLNA 3SNCA 2L6OA 4TWYA 3UY9A 3VB4A 1SGEE 3K2UA 3SZNA 3LC3A 2OC8A 2F3CE 2WPIS 4RKOB 1Z8GA 1GCTC 2PWXA 1O3FA 1QA0A 2WV4A 2K1QA 2V3OH 3FANA 4AN7A 1S81A 1FY1A 1CHOF 2CHAC 1OS8A 1CU1A 6GCHF 1XUIA 1A5HA 2BYAX 1G3BA 3CS0A 2WUCA 2RA3A 1NO9H 1OP8A 1YPHE 5AFYH 1FPHH 1FQ3A 2G81E 1WQSA 3SU1A 3FP6E 5HM9A 1QRXA 3MU0A 3O8RA 4X6MA 4JZIA 1S5SA 1CT2E 2ZDMA 1GJAB 1AD8H 2OQ5A 5LPFA 1K9OE 1C2GA 1JIRA 4U30A 1LHFH 1FY5A 1MD8A 1UVSH 1YPMH 1Z71A 1TB6H 1GHVH 5C0TA 4ASUD 2WYGA 2XCFA 1BJVA 1Z8IB 4FUGA 2K0QA 2VBCA 1O3OA 3BG4B 3MTYA 2ILNA 4CR9A 4MNVA 2PGQB 2HRVA 5I46H 1NRQH 1EOLA 1VJ9U 1DUEA 3BTTE 1FPCH 1GBDA 1MKWK 2F43B 2NU0E 3VEQB 3OEED 1TMBH 3A89A 1C2DA 1EJNA 3ZZ8A 1PPFE 1C2IA 1NU9A 4INLA 5C5OA 3PO1B 2ESTE 4BTTB 4Y8ZA 1H9HE 3V13A 1UTJA 2XYAA 1QNJA 3SI3H 1Q31A 3P92A 1YYY1 4YTAA 5FPYA 2GV6A 3FOAA 3QWCH 1E38B 1LKBA 1C5NH 3TK5A 3SNAA 3SOSA 3T62A 1Z8JB 1AQ7A 1AFEH 4Q7YA 2F91A 1C1WH 7ESTE 1SB1H 4X8UH 3LGVA 1AE8H 4DG4A 2H5CA 3GCOA 2AHME 1A4WH 1GI5A 4ABAA 5C67A 2F4LA 2G8TA 1QL8A 5JB8S 3LC5A 3SNBA 2ZTYA 2WUBA 3EGKH 4TPIZ 8ESTE 3UWJH 5DP3A 1DWDH 4CREA 9LPRA 4CBOA 1B0FA 4Y0ZE 2CMYA 1C2EA 4X1PU 4NWKA 5DP6A 1ESTA 3QTOH 1EOJA 3ZIAD 1KXDA 1P01A 1FONA 2GTBA 3DUXH 3MI4A 4X8SH 2R3UA 2HNTE 2YMSB 4E7RG 1TONA 1WBGB 2ZDNA 3UIRA 3VFEA 2PV9B 1BHXF 4OGXA 1J16A 4YOIA 5BPEA 4I33A 3SW2B 5DPAA 1LCYA 1OWEA 2F9OA 1NTPA 1BT7A 2XC0A 3LKWA 1O31A 3RXOA 1D3DB 2ZFTA 3TVJB 3ZZCA 2ZQ1A 2FDAA 3PM3A 3M5LA 5ABWA 1FZZA 3PMJA 1MTWA 2CJIA 3KHVA 2PKAA 1AVXA 3NXPA 4I8LA 2ZF0H 1O2UA 5C2ZA 4Y10E 2BZAA 3M3TA 1W2KH 3E0PB 1JWTA 2JKHA 1FUJA 1WTGH 3SU6A 4ABEA 1OP0A 2P8OC 3BEIB 4O3UA 1GI6A 1T8MA 4YESB 1ELVA 2PKAB 3F0PA 1C5TA 1SFIA 4YXWD 1O0DH 1IQJA 1ABJH 1TBRH 2ZPSA 4ZAEA 4THNH 3TGIE 1C5XB 1QA7A 5AF9H 2BHGA 3BIVH 1Y3YA 1A0JA 3ITIA 1TGCA 1QB6A 3RXCA 4P00A 1GL0E 1NFUA 1BMMH 1T4VH 3M7TA 3T2NA 1BOQA 1TRYA 1BZXE 2FPZA 3N7DA 5C17A 1F5LA 3M3SA 3TGKE 2Y7XA 2ZTZA 1KMHB 3SUFA 1GVKB 3U8OH 3ATMA 4FUDA 5T6FA 5TCAA 5A8XA 1NROH 5T6GA 1HAYB 4MQAA 4Y7BA 2QF5A 3SU4A 2G00A 1NPMA 2HALA 2VIPA 4B75A 2ALPA 3A85A 2OBOA 1MZDA 4YZUA 1HV7A 4Y76A 1BCUH 5HGGA 5FX5A 5C1YA 2YNBA 3GISB 3I78A 1LQDB 3MNSA 1TA2A 2SGAA 5FXLA 3TK6A 1WOFA 2PKSB 1QBVH 3KQDA 1G30B 3RXKA 1B5GH 4GLYA 3LDXH 2A32A 2HPPH 1AFQB 1PPZA 1LVYA 2GZ7A 1C5PA 1FXYA 2EI6A 1VITH 4O9VA 1CA0B 4I8KA 2KCAA 1HAVA 1C2MA 3SN8A 3GCTF 2BD9A 3LH3A 4X6OA 1GJCB 1KXCA 1O5FH 1TNHA 2QV1A 5C3NA 1A5IA 2XTTB 2VU8E 1AUTC 1E36B 2YNAA 1HAVB 1T4UH 1GJ9B 2VH6A 3A7VA 2B9LA 1DDJA 4MNXA 1DFPA 2V0BA 2J97A 3BTWE 2TGPZ 2TBSA 1V2KT 3T5FH 4CBNA 1HFDA 1CO7E 1TOMH 1DX5M 4YOGA 3T25A 1MD7A 3ATWA 1A3EH 1D3TB 2FS8A 1ELBA 1SGTA 3GDVA 2CF8H 1G3CA 4XDEA 4O03A 1C5MD 1HJAC 1DWBH 4TYDA 1O39A 1BBRE 1Y3VA 1P06A 1GBKA 1RD3B 2XXLA 3KF2A 1K1LA 1W10U 3HK3B 4CRFA 4MG3A 2BVXH 2IN2A 3A7YA 1AY6H 4DGJA 1DY9A 1X7AC 4CRAA 5HKKD 3SGBE 1CBWB 2GCHG 2QXGA 4X1QU 2BOHB 2VIOA 1SL3A 3BTHE 3LOXA 1Z7KA 2AMQA 4ABFA 4NZQA 2BD7A 2VIQA 2A7HA 1NRSH 1AKSA 1QY6A 4GHQA 5LPEA 1OHHD 1QBNA 2ZDLA 3C1KA 1D3QB 3A8AA 1N8OB 2K8IA 2ZU3A 3R3GB 3SQEE 1QB9A 1JIMA 3KQ5A 1AKSB 3KIDU 2ZFFH 1C5OH 5JYIA 1TNJA 3AW1A 2Q1JA 4ZHMU 1CT0E 5L6NH 2W26A 5AHGH 2XBVA 3U1JB 3RLYH 2FWWA 1FDPA 1CA8B 2BZ6H 3EAJA 3GCHB 1D4PB 2KFWA 4DVAU 1ESAA 1C5RA 2TGTA 1P11E 4JMYA 5TJXA 1HJ8A 4WMFA 1P2OA 2PLXA 3S9CA 1TQ7B 4D7GA 1ZSLA 1VCQA 1SGIB 5EQRA 1SLWB 1AN1E 1A0LA 3Q3KA 2VWNA 8KME2 2XBYA 1Y5BT 3SGAE 4ESTE 1XVMA 2H6MA 1FI8A 1RGQA 3SO3A 4FUFA 1W8BH 5GXPA 1TPPA 3F9HA 1S82A 4X8TH 4X1SU 3ZZ5A 3MU8A 3OAAD 3AAUA 1MBQA 1F5RA 1HAZB 1L4DA 1RTLA 5E0HA 4I86A 4LXBH 1HAGE 1HDTH 1MKXH 4GVUA 1OWKA 1IQHA 1TQ0B 1CVWH 1KXBA 1QURH 1DE7H 1KY9A 1KLIH 1XUHA 3RXQA 1O3LA 1V2OT 2TRMA 2OP9A 2F9NA 5J4QA 4JK6A 5A8ZA 1O3CA 4IS5A 2BQWB 1DPOA 1NRRH 1UTNA 5JDUB 1A5GH 1BBRH 3NKKA 1BTPA 2GCHF 4K2YA 3F1SB 4HZHA 1GVZA 2C8WB 2ODQA 1HYLA 4FUEA 5TCCA 4Y7AA 1ARCA 5EJLA 3PWBA 1DITH 1G3DA 3LU9B 4DW2U 1OPHB 5HXFA 2AFQB 1KXAA 1P09A 2QF4A 3BG8A 1QGFA 3TNTA 4ASHA 2KCYA 1ELTA 4UFDH 4GHTA 1O2WA 4CH2B 2W6JD 1O2IA 1MAYA 1QCPA 1JBUH 1NBME 1GL1A 1ZJDA 1MTSA 3Q77A 2A5KA 4FU8A 4Z1MD 3MNXA 1F0UA 1QBOA 2XOKD 4WWYA 1DSUA 1BRBE 1HPGA 1XUJA 1LVMA 2GVFA 4ISHH 1RXPA 3M7QA 1SBWA 3TJVA 3U8RH 3OY5U 2CF9H 1T32A 4X2VA 1O37A 3P95A 1ACBE 1ELCA 1O3BA 1ZJKA 4KGAA 3GOVB 1QIXB 3Q3XA 4BTIB 2OK5A 1GDUA 3FVFB 1EP5A 1ZPZA 3KCGH 1AVGH 3NK8A 4OS7A 1J15A 1AZ8A 2GCTB 4ZKNU 4IMQA 1EASA 1UTLM 5A8YA 2R0KA 4WH6A 3VXFH 4Y6DA 1O2QA 1P2MA 1SQOA 2BLVA 1SQRA 4JYTA 3BEUA 2GV7A 2UWOA 2ZKSA 1KLTA 1ANDA 1SQAA 5JBTA 1C5QA 2AGIX 2V3MA 1CHGA 1IQKA 3FKSD 2BXUH 1GMHG 6CHAC 2JJ2D 2M2AA 4Z6AH 1NRPH 3RMOH 5FPSA 4JYUH 1HIAB 3TH2H 3SJ9A 1O5EH 3FP8E 4WXVA 5JB9S 3ZVDA 1A1RA 1A3BH 4Y0YE 5FCKA 2QF3A 3MOCA 1EPTC 1SMFE 1K1NA 1V2ST 1CQQA 1KLJH 3V7TA 4TWWA 1WTHD 3GICB 3MNCA 3D62A 2ZFPH 4IGDA 2FOGA 5C0UA 1TRMA 1KTTB 3NCLA 2KAIA 3QGNB 3BG4C 3N99A 4FUBA 4HFPB 4AFSA 2Z3DA 1C1UH 4WH8A 3UWIA 1T8OA 3FZZA 5H4IB 1O5DH 5IDKA 4IW4E 1W14U 1KSNA 1TLDA 1RJXB 2FESH 5DSFA 5FHTA 2KAIB 2GMTB 3MNBA 2ZHEH 4B71A 2OBQA 1E0FD 3GYLB 4FOUC 5KGOA 3RXRA 1TMUH 3T29A 1ZRBA 3O8CA 3BTKE 2AGGX 1Y8TA 2OC1A 1TGBA 1P2QA 1KIGH 1P2JA 2QXJA 2W6ID 1V2MT 1MAXA 1V2RT 4NCYA 2C93B 3PTBA 1Y59T 3BTEE 3ZVGA 4X1NU 2PR3A 5C94A 1TFXA 1QZ8A 4M9FA 3D23A
chains in the Genus database with same CATH topology
5GJ4B 3M7UA 1LHCH 5EODA 3P8FA 3SV7A 4IN1A 1C2JA 1O3JA 3A7TA 1O2OA 4R8TB 1BIOA 2JH5D 2H2ZA 4ZXXH 1EP6A 1O3GA 2UUYA 3MH6A 4NIWA 1FN6A 2NU1E 1UTPA 1EJMA 2VIWA 1NY22 5EQQA 3RXUA 1C1VH 1QRWA 2ZI2H 1K28D 2SGPE 3HATH 4BAQB 1GJ8B 1N6YA 3MWIU 2A7JA 3RXSA 1DLKB 2FIRH 3UOUA 2Z3EA 3UNSA 2WYJA 1GMHF 3VGCB 5EW1H 1WSSH 2BDCA 1W7GH 1C1RA 1PQ5A 1Z8RA 1E35B 2UUJB 2FLBH 3ZZ3A 2D2DA 2BMGB 4K8BA 5A0BA 1GBMA 2EEKA 4B73A 2R2MB 3P8OA 5ESBA 3RXJA 1QJ6B 4H42U 3KN2A 3O8BA 2ZWLH 2A4GA 2ANYA 1A2CH 3PYHA 1EX3A 4TY6A 4CHAC 3PWCA 3AASA 1ARBA 2FMJA 2PFEA 1TX6A 3ZZAA 1TOCB 3NZIA 1BMAA 1GBIA 1U6QA 1XXDA 2FEQH 2P16A 4X6PA 3S9AA 3RXHA 1VJAU 1ID5H 4HI3A 5BRRE 1HAHH 1NFWA 1CSOE 2Z94A 4B74A 2P3TB 3TLOA 1VITG 1BTYA 1SGPE 2HPQH 3BTFE 5K7RA 3ZYEA 3A7XA 2SNVA 5C20A 1VCWA 1O5BB 2BDAA 1ZGVA 3GDUA 1P0SH 4CRGA 1C1TA 1GHAG 3RXDA 2W7UA 2O8MA 4YT6H 1C2HA 1LDTT 2UWPA 4MPWA 1G2LA 1K1MA 3ODFA 2B8OH 2CGAA 4XOJA 1ELFA 1XKBC 2H9EH 3PMAB 2W3IA 1NM6A 2GD4B 3M36A 5A0CA 2O8WA 2UUKB 2QCYA 1T8NA 1F5KU 2O8LA 4OGYA 1P57B 1GDNA 3KGPA 1SSXA 1V2VT 1YBWA 4NGAH 3MU4A 1WAYB 4Q2KA 2AIQA 2SGQE 2ZGBH 1S84A 1RTFB 1BDAA 3SU5A 2FOFA 1GPZA 1AFQC 1W0ZU 3RC4A 1CA0C 1VCPA 1W12U 5DK1A 3LT3A 4VGCB 4B2CA 1IAUA 1O2JA 1OKXA 1EZXC 2VINA 4BXWA 1G2MA 2ZCHP 3VB3A 2BY5X 1P02A 3WY8A 4YT7H 1ZRKA 1DXPA 2XW9A 3BTQE 3RXPA 5LPRA 1LTOA 1GGDC 2WPKS 2Q6FA 1GI9B 2R2WU 4JZ1A 2A31A 1LMWB 4K1TA 1HAXB 1O2MA 4BOHA 1A61H 4AORA 3OX7U 2STBE 4WF8A 2C8XB 2F9PA 5EXLA 1AO5A 3RC6A 4B2BA 3UREA 1G32B 2VWOA 5DJ7A 1VITF 2FOAA 1P2KA 1YPJH 3MFJA 3FFGA 1EQ9A 4YM9A 2VNTA 4B76A 4JCNA 2FX4A 4MPVA 1UHBA 2QN5T 2ZQ2A 3JZ1B 5JBAS 2M5TA 4X1RU 1GHAF 3A7WA 2ZC9H 1MKWH 1YCPH 2HNTF 2BY7X 3HKIB 3MH7A 3SU3A 1BRUP 1UHBB 5CHAC 4I31A 2C8YB 1FLEE 1GHZA 1L1NA 3Q00A 2TGAA 5E8EH 3HGNA 5DP5A 2JH6D 3A82A 5AFZH 3RU4E 3RC5A 1GCTB 1O2GH 3UPEA 1XM1A 1HAOH 2G52A 1C5SA 1SHYA 4D7FA 1TBZH 1UTMA 1GBTA 4LK4A 4RSPA 4WY3A 5F6MA 2J2UA 3MO9A 1SQTA 2CHAB 2Y82A 3KNXA 2ZFQH 4GSOA 5EGMA 2ALVA 7KMEH 3RDZA 2J4IA 3GY6A 1AMHA 1BMNH 3PLBA 1GJ5H 1V2TT 2A2QH 3PV4A 2BDIA 3MH4A 3RXAA 4NWLA 1O2XA 1IQEA 2PW8H 3E3TA 4RN6A 1O3DA 2Y5FA 4ZKRU 2XBWA 1O5AB 3RXIA 1NESE 1ANBA 4ABGA 1DWCH 2VIDA 1EAUA 1MZAA 2P95A 2NWNA 2G5NA 1C9PA 2IOTA 2ZFSA 2VIVA 3KL6A 2PSXA 1C5WB 1SGDE 1QRZA 2J9NA 2GZ9A 1P05A 1SGRE 1SGQE 2QAAA 1P3EA 2P3UB 3ZVCA 4J1YA 3EA9A 4K60A 2Z9KA 3S9BA 5F8TA 1GI2A 1GHYH 2J92A 3I29A 1C4U2 3M3VA 2HLCA 1L2EA 3M37A 1A7SA 1GI1A 1KTSB 2ODYB 2ZHWH 2O9QA 5A2MH 3MH5A 5DO4H 1C5LH 1M9UA 2J34A 5E2OA 1SGFA 1O32A 4I8JA 3GY3A 3TH3H 1K1PA 1O2PA 2CN0H 1P12E 3CP7A 1MTNB 3TNSA 3ZZ6A 3UR9A 4NZLA 2FZZA 1O2ZA 1YKTA 4OS1A 1BMLA 1QL9A 4PROA 2FX6A 3TGJE 1GG6C 4K3JA 3T27A 1CT4E 1DT2A 1S0QA 5EG4A 1ZYOA 3LGYA 3QDZB 3RUOA 1EZSC 2P93A 4ZMAH 1K1OA 1Y5UT 2HOBA 2ANWA 2HVXA 4F49A 1L1JA 1GBAA 1BB0B 4BAMB 4GPGA 1C1PA 3BTGE 3OTJE 1K1JA 1C5YB 5IYTA 1GVLA 2W5EA 2FOCA 1RS0A 1OYQA 3EE0B 4JK5A 1B0EA 3A88A 2Y5HA 4A1VA 6LPRA 2QA9E 3M5OA 1O2KA 1BTZA 1SLVB 2O8UA 1ANCA 1GBBA 3IITA 1ZLRA 3A83A 4UEHH 3QN7A 3ATKA 1MKXK 1PYTC 5GWZA 1F0TA 1WUNH 1O2NA 1QFKH 3RXGA 3U69H 3BF6H 3E90B 1ETTH 3GY5A 1G9IE 1QL7A 5DG6A 3BTDE 3ATIA 5JPMH 2A1DB 2A45B 3ELAH 3HPTB 1GMDG 5GDSH 1A0HB 5LH8A 3DFLA 2FTLE 1VGCC 2AERH 1HGTH 2P8OB 1IQLA 2PUXB 1ZTLA 1C2KA 1HAIH 3QUMP 1N6XA 1AU8A 2LNCA 4AYYB 1EATA 4H6SB 7LPRA 3URCA 4ZH8A 2GP9B 4LZ4B 3LGIA 5HYOA 3SHAH 4DCDA 1AGJA 3F9EA 3M35A 2VB0A 2CV3A 3G01A 3PROA 5GIBA 1RIWC 1O30A 1KXEA 1PQ7A 5FPTA 1HXFH 2XCNA 2OD3B 4NIVA 2F83A 1XX9A 2G55A 5FBIA 1K2I1 4A6LA 1UVTH 3P17H 1P8VC 1HBTH 1LHDH 3SGQE 2Y7ZA 4FXGH 1GJ6A 4FU7A 4AB8A 1Y3WA 3MO3A 3SJIA 3U8TH 3UNQA 3UUZA 2V6NA 3H7TA 2A4OA 4QT8C 3RMLH 3PTNA 1ANEA 4WMDA 5EW2H 2R3YA 1TPAE 1XUGA 2A5IA 1EZQA 2ZU2A 1ZR0A 1W3CA 3N7OA 1Z1JA 4J2YB 2AH4X 4FUCA 3VXEH 4BAKB 2AMPA 2BLWA 3F9FA 4WJG2 1UK2A 4K69A 1DUAA 1MUEB 3A84A 2FXRA 4UE7H 4CRCA 4DIHH 1SVPA 2SNWA 4ZROA 3SI4H 1YPKH 2FTMA 3NUMA 5K0HA 1NS3A 1RRKA 3GYMA 2VWLA 2D26C 1WYKA 3FP7E 1BA8B 1AI8H 1ZHRA 2W7SA 3K6ZA 4UFEH 2ZDAH 2BD8A 1HCGA 2AMDA 5GPIB 3F68H 1QR3E 1G36A 1AUJA 1PPEE 1YLDA 1GBCA 1YM0A 3E8LA 3IG6B 4A7IB 3OYPA 1SOZA 3OY6U 4B2AA 4AZ2B 1P9SA 4B1TA 1S6FA 1GMCG 2VVCA 6ESTA 4X0WU 1JOUB 1HJAB 4O3TA 5I25A 4INKA 3ZYDA 3QZQA 1GI7B 1SC8U 2BDHA 1UCYE 1C4V2 1TE0A 2WINI 1J8AA 1Q2WA 4DT7B 1D6RA 2A4QA 4KELA 2BX3A 1EB2A 1A46H 3KQEA 4IMZA 2FI3E 4NSVA 1QTFA 1O3PB 3UFAA 1TNLA 1TX8A 5FAHA 1TPSA 4NIYA 2ZTXA 2BTCE 1GWAA 1OP2A 1XUFA 2VJ1A 1C5UA 3EQ0H 1ZOMA 4KTSA 3GY8A 1MQ5A 2EC9H 1KXFA 4KTUA 1FJSA 4K8YA 1WQVH 1MMJN 2R9PA 1CGJE 3PLPA 3TU7H 1IQFA 4O97A 2P59A 3EA7A 5A09A 3PMHB 1W11U 1Q3XA 1O5GH 4MVNA 3IWMA 4IC6A 2TGDA 2ZZUH 1MCVA 1GJ7B 1ORFA 5DP7A 1BRAA 3ZZ4A 1E37B 2GGVB 1AB9B 1SI5H 4OS6A 3DD2H 4INHA 3A7ZA 4I32A 3RU4D 3ENSB 4Y71A 1QHRB 4AFQA 4XFQA 1NFYA 1FN8A 2AIPA 3ZZBA 1F92A 1OYTH 4F4OC 1K22H 2GT8A 4Q7XA 2BDBA 1CHOG 1LPKB 3QX5H 1H4WA 2P3FH 3PO1C 4U01A 1TBQH 4MDSA 6GCHG 1DANH 1XMNB 1AE5A 1EAWA 1T8LA 2JETB 1GMCF 3SUDA 2A2XH 2NU3E 4JZDH 3ZVFA 2BY6X 4ABBA 3ATLA 1DY8A 5FCRA 2TIOA 2XNIA 2AEIH 2BM2A 2GDEH 2IJOB 3UTUH 1AIXH 2FM2A 2C4FH 1ELDE 1LPGB 2FP7B 2PGBB 4MTBA 4Y8XA 3M5MA 4I7YH 4AB9A 4ZHLU 1UCYH 2AYWA 2FI5E 1PPHE 1PQAA 4FUIA 4K1SA 5JBBS 1AVWA 3DHKH 1BTWA 2BVRH 1GJ4H 1LVBA 1OWDA 1UVOA 1ZMJA 5JBCS 1L0ZA 5DKMA 3UOPA 3SV6A 1P3CA 3E16B 1TWXB 3LJJA 4KTCA 2NU2E 2GZ8A 1FAXA 2PTCE 1PPCE 1V2UT 4E05H 1THSH 1HNEE 3RU4T 3K9XB 4Y79A 4DURA 3S69A 4XBCA 5DP9A 3JZ2B 5T3HA 3SUEA 1MTVA 2ZEBA 3VPKA 1JMOH 1T31A 1YPHC 1ELGA 3M61U 2QXIA 4SGBE 3A8BA 9ESTA 5EQSA 4D9RA 1GJDB 4I8HA 1V6DA 3RXBA 1FIWA 2WV5A 1YP9A 1P03A 2B7DH 4GCHG 2ZO3H 3H5CB 3RXTA 5EOKA 1YPEH 1SLXB 2LPRA 2ZGHA 3A87A 2ODPA 3QZRA 1PQ8A 1GJBB 4LZ1H 1DICA 3OU0A 4OS4A 3A8DA 3B8JA 2QC2A 4MPXA 4NG9H 3P8GA 5SGAE 3RLWH 1YLCA 1SHHB 4BTUB 4WVPE 4BNRA 2FYQA 3AW0A 4AGKA 1C2FA 6CHAB 3SNDA 2Z7FE 2ZCLP 3S0NA 1GI4A 2WPLS 3I77A 1SGFG 2QYIA 1T7CA 1EPTA 4E06H 1QQ4A 1GDQA 1YPGH 1H8DH 3P70B 5ESTE 2ZFRH 2Y81A 3GY2A 1O33A 1EPTB 2V35A 1DXWA 2ZDKA 1Z6JH 8GCHG 3E91A 2BLOA 2Z9JA 5L30H 3MYWA 4H6TA 1HJ9A 1OXGA 2OCVB 5HMAA 1C1SA 4AOQA 1FY4A 3SV9A 3LGUA 2PKSC 2BD3A 2G51A 4CRBA 3SHCH 2B0FA 3TJOA 1YCPK 1JRTA 1O2HA 1H9LB 1FMGA 4CR5A 2G4TA 1F0SA 1F2SE 1CE5A 1PYTD 3UQOA 4DOQA 1EAIA 2EI7A 5T6DA 4NFFA 3PLKA 3DA9B 1DOJA 2UUFB 1J14A 1P04A 3BV9B 4SGAE 4YLQH 1ELEE 1O2YA 1V2PT 2PHBA 3KQBA 3BIUH 1MTNC 2HNTC 1GI3A 1OOKB 3LJOA 1EAXA 1VZQH 3U1IB 3LONA 2VVUA 2ZGXH 1P10A 2VGCB 3A8CA 2FI4E 3SJ8A 4GCHF 1ZPBA 2Y5GA 2ZHFH 2GX4A 5PTPA 2QIQA 3K65B 3CS7A 4UDWH 4AYVB 2RCEA 1DS2E 2BD2A 2FOBA 1SGYE 1L4ZA 4X2XA 5C1XA 1TGNA 4ISLA 1OWHA 3U9AH 1CBWC 1O3IA 4UONA 3PMBB 2GKVE 2H1UA 3LIWA 4D76A 4D9QA 1S0RA 1H9IE 2J94A 3CENA 3EDXB 1K1IA 3GCTG 2XC4A 3QGJA 3QLPH 1SR5C 1JXPA 1THPB 1WV7H 3SNEA 1ETRH 3SUGA 1OX1A 3NPSA 1BJUA 4K5ZA 1O2LA 1ZGIA 1EKBB 1WU1A 8GCHF 1C1NA 1N8OC 1TRNA 4ISOA 4MNYA 3BTME 4Y11E 3RXEA 3RP2A 3W94A 4CHAB 3SU2A 3ESTA 1MH0A 1O36A 5J4SA 1S83A 1F0RA 2D8WA 3RM0H 1LVOA 2ZPQA 1FIZA 4XBBA 2ULLA 3ZZ9A 2P94A 1KDQA 3MU5A 1TIOA 4GUXA 1BTUA 3E1XB 2C8ZB 1JRSA 3A81A 3GCHC 4A5TS 1ZTJA 3M5NA 3V0XA 2CXVA 1KDQB 4X2YA 2Z9LA 5EXNA 4OS5A 4AG1A 1EJAA 1GI0A 2J38A 1HAPH 3SQHE 4XBDA 3HGPA 1ELAA 1ZZZA 1ZPCA 1O2SA 1NZQH 5CE1A 1FY3A 1W0YH 2ZU1A 3RXFA 2F9VA 2Q6DA 1BRCE 3VB6A 1P2NA 4HGCA 1O5CB 3EYDA 3SU0A 4JYVH 1TABE 2BQ7B 2FS9A 1GHBG 3DFJA 5LGOA 1W7XH 2AS9A 2ZG0H 4JZFH 5DP4A 1YCPM 3URDA 2A7CA 4NIXA 3PB1E 2BXTH 1QJ7B 1UMAH 1O3HA 1MCTA 1O2RA 2HWLB 5FX6A 1C1MA 4E7NA 3QK1A 2A0QB 3L3TA 4AX9H 1TNIA 2J95A 1MU8B 2RG3A 2W3KA 3GDSA 3LH1A 2H5DA 2WPJS 1J17T 4WXIA 5B6OA 1O34A 1BHXB 3LPRA 4A1TA 4DY7B 1QQUA 3L33A 1YF4A 2XRCA 2BD5A 4Q80A 1O2TA 5AVDA 3SJKA 1AWFH 1C1QA 2PSYA 4IN2A 5L2ZH 2SGFE 1GGDB 2OXSA 4OS2A 1VR1H 1SG8B 5E0JA 3RXMA 2XWBI 3T26A 2ANMH 4WMEA 1FNIA 1ZMLA 3OSYA 4HTCH 2XC5A 4YOJA 2EA3A 5F8ZA 3F9GA 4FVDA 1K21H 4YLUA 3TITA 3C27B 2ZU4A 3F6UH 3ZVAA 2OLGA 3MMGA 1IHTH 1NFXA 3KEEA 4FUJA 2Y6TA 1ZTKA 3SJOA 1CGHA 2B5TB 1D3PB 2ZCKP 2OC7A 2DE9A