1E35B

Porcine pancreatic elastase complexed with (3s, 4s)n-para-toluenesulphonyl -3-ethyl-4-(carboxylic acid)pyrrolidin-2-one soaked in ph 9 buffer for two minutes
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(serine protease)
molecule keywords ELASTASE
publication title 'Ph-Jump' Crystallographic Analyses of Gamma-Lactam-Porcine Pancreatic Elastase Complexes
pubmed doi rcsb
total genus 59
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2000-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1e35B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1e35B01
4U32A 2PGBB 1FY8E 4E7NA 4DIIH 1L4DA 2GCHG 4MTBA 1EP6A 1DFPA 1ANEA 3UOPA 3B9FH 4Y71A 3ZZ8A 4ZKNU 3M37A 2ZU2A 1W8BH 1TGBA 3PM3A 3SGQE 1Y5AT 1DANH 5DKMA 1AY6H 1GJ9B 3G01A 2ZFPH 3HATH 4X1NU 1MTUA 4YLQH 1XUKA 1QGFA 3AW0A 1C4Y2 4FUHA 2CHAB 3BTQE 1O35A 4B2AA 2D26C 3SU1A 1CGHA 4D76A 1O2YA 1C1MA 1LVMA 1MTVA 2ZDKA 1BJVA 2BOKA 3A8AA 3VB5A 1UVOA 1ZSLA 2J2UA 4K3JA 5HM9A 1B7XB 1EZSC 1GG6C 1GBJA 4X1QU 2Y7ZA 1P2KA 4K1SA 2CJIA 2XXLA 5EODA 4AG2A 3HGNA 2G8TA 1SGFA 1GMHG 3BV9B 5FBIA 1TRYA 3HKJB 1C2EA 2F9OA 1NRNH 1GVZA 1LKBA 1BTUA 2SGPE 1NZQH 5FPTA 4HZHA 5T3HA 1CSOE 3OTJE 1O5DH 4OGXA 2PFEA 3FZZA 2BZ6H 1MBMA 1TBQH 2RA3A 1C2LA 1EAWA 3D49H 3Q00A 1NU9A 1GJAB 1GHBF 1BRUP 3SV6A 5FCKA 4I7YH 2XCNA 4X2YA 3NZIA 2O9QA 2NWNA 3ITIA 1DSTA 3C1KA 1HCGA 5G4BA 1SLUB 1FI8A 2OP9A 1CA8B 5EQQA 3UNQA 4LZ4B 2HALA 3BTKE 1GHZA 1O38A 3BTWE 3TJUA 1GJBB 1ZZZA 2XC0A 1WTGH 4KTCA 1C5YB 4NA7A 1W0ZU 4XBCA 2PTCE 3A86A 1SGTA 5EOKA 1FAXA 4NWLA 2VWMA 3KQDA 2GV7A 4D7FA 3TJVA 5EXNA 4AYVB 3MNCA 2ZQ2A 1B0FA 1ACBE 2R0KA 2ZU5A 3NWUA 4B2CA 4X6NA 2WPLS 3SN8A 3ZZCA 1TBRH 1IQEA 2B7DH 1C5RA 2HNTE 3S69A 1MKWH 2Y7XA 1TX7A 4XSKU 1NFXA 2O8TA 2HWLB 4IW4E 1FZZA 3RXDA 1BBRE 1O2TA 2ZHEH 1V2TT 1UO6A 2CV3A 5A2MH 3URCA 1UHBB 2VNTA 2GCTC 2ZHWH 2C8YB 3Q76A 4Y8ZA 2J94A 2B9LA 1O3IA 1PPHE 2F9VA 3M61U 1O3CA 2PKSB 3F9GA 3LT3A 2BDCA 3BN9A 1W12U 4TPIZ 1O3BA 3TPIZ 1A5GH 1E34B 3QZQA 1SLVB 3LGUA 1PQ5A 4CH8B 1K1LA 1AB9B 3TLOA 1A61H 1KXBA 1C1RA 1LVBA 1BRBE 4I8LA 4A1TA 5K0HA 2HGTH 3PWCA 4GAWA 2LPRA 4KKDA 1TPSA 2W3IA 3TU7H 1A2CH 1AMHA 1Q2WA 1E38B 4OS5A 1GVKB 4BTIB 3A7YA 4ABIA 1Y59T 1O36A 5T6DA 2BY9X 1SHYA 2P3FH 4CRBA 1GL1A 4BXSA 2G52A 2VB0A 1SPJA 5CHAB 3TH3H 1NPMA 3ESTA 1DLKB 4R8TB 3E3TA 2AEIH 3AAUA 1XM1A 1WU1A 4YESB 5DP3A 1QBVH 1O2OA 4U30A 3BG4B 1PPGE 3QLPH 1EPTB 1S84A 2WPKS 1EJAA 1WAYB 1Y5UT 2ZGCA 4SGAE 5F8ZA 2VINA 3ATWA 1F92A 4O97A 2BLVA 4GCHF 1ZMLA 2FESH 1C2HA 5F03A 1UTOA 4TPYA 1C1NA 1C1TA 3PTBA 2BYAX 1IQLA 1ZYOA 2QF3A 1DWBH 1JRTA 3U8TH 2QGRA 1GDNA 4NIWA 1AIXH 2A4RA 3UQVA 1ZTLA 1VITF 2H1UA 4A1VA 1V2LT 1MCVA 1D3QB 1DLEA 1TRMA 1Y5BT 6CHAC 1THPB 1TGTA 2BMGB 2PR3A 1O2IA 2OCVB 3MU5A 2PW8H 1QL9A 2ZWLH 1DPOA 3LJJA 3RMOH 3SGBE 3TK5A 3EDXB 3LDXH 1GBKA 3V13A 3M5OA 1KSNA 1KIGH 2P3TB 1HV7A 2FOCA 1GDUA 3RC4A 1V2WT 3RXJA 1ETRH 1H9LB 3Q3YA 1PPZA 4I32A 3TK6A 4FUBA 1RIWC 2ZO3H 4IMZA 3A88A 4UDWH 3BSQA 4WJG2 5A09A 1ZPZA 2Z3DA 1QCPA 2CHAC 1AZ8A 3VXFH 5EQSA 3QWCH 4F4OC 1TOMH 1FY1A 2H5DA 5LPFA 2BD7A 1PPFE 1QJ1B 4JK6A 2XTTB 1MQ6A 3W94A 3QX5H 1GBHA 1SGCA 1SGEE 1GMDF 1NRQH 1BBRK 4NCYA 1Y3XA 1KLIH 5FPSA 4DG4A 2TIOA 2STAE 2AMQA 1C5WB 3LJOA 1KLJH 1DT2A 2BXUH 3KCGH 1G32B 1QBOA 4LK4A 4DJZB 1JWTA 4YO9A 1C2JA 3UNRA 4AFQA 3EGKH 4X8VH 3K65B 1SG8B 3SJ8A 1Q3XA 4M7GA 1Z6JH 1WQSA 3S9BA 1ETTH 1QTFA 5HM2A 3BTEE 1A0JA 5E2OA 1CVWH 1GI6A 3NUMA 3PO1C 5CMXH 4BAKB 4CHAB 1CQQA 3VGCB 4HTCH 4CRDA 4FVBA 5C1XA 1QR3E 2V6NA 3RXTA 1N8OB 1WV7H 1YCPH 1RS0A 3RXAA 3LC5A 1FAKH 2UWLA 1LVOA 5A0AE 1TQ0B 3M3TA 1H8DH 2QYIA 1OWHA 3VB6A 5EU8A 4FUJA 1WSSH 3P8NA 3QZRA 2JETC 1T31A 1EX3A 5LPRA 1EZXC 1G2LA 1O2LA 4JZFH 2KAIA 4CRCA 5C2ZA 4RN6A 1RXPA 2OBQA 1TNKA 3SV7A 1V2UT 4GPGA 1P2MA 1V3XA 1GI1A 3RC6A 2BOHB 2Z9LA 4U01A 4KGAA 2HPPH 2OLGA 1N6YA 4NGAH 4ZMAH 3QUMP 1XX9A 2A2XH 4K69A 5JDUB 4RSPA 2G81E 1GJ4H 1DY9A 4BTUB 1OS8A 3SHAH 2PHBA 2ZIQH 3GYLB 5SGAE 3GY7A 1QA7A 2AERH 3FFGA 4NSYA 1L0ZA 2DE8A 3PMBB 5DP7A 1GBEA 2ALVA 2ANYA 3SHCH 1T8LA 1C1WH 1NTPA 2QXHA 3A8BA 2BD3A 4JZ1A 2WV4A 3PROA 3MNSA 1WOFA 1RFNA 2A0QB 1GG6B 4KP0A 3T5FH 3BTFE 3T62A 5L30H 1RTLA 3NPSA 1NROH 3CENA 1BMLA 2Q6FA 1SR5C 4NG9H 1MD8A 3BG8A 1GGDC 5BRRE 1BMMH 2ZA5A 1BCUH 2XNIA 1XXFA 4DW2U 1SSXA 2BD5A 1K1MA 1MQ5A 1CGJE 1EQ9A 1ZOMA 4NA9H 5L6NH 1LHDH 2XC4A 2B0FA 1EKBB 6ESTA 1UTPA 2A7HA 1MTSA 3H7TA 4XBDA 3TITA 5E0HA 3BEFB 4YOGA 3OY6U 2C3SA 1ESAA 1S6FA 5I46H 1BUIA 1JBUH 3T29A 1IQJA 1GHVH 5T6GA 3ATKA 2A4GA 3F9HA 1W11U 3NKKA 4I33A 1EASA 1NRSH 1BA8B 2A4OA 5JBTA 2ANMH 4NFEA 2FIRH 4X2VA 3U8OH 5AVDA 2WUCA 1HGTH 1ELCA 3D62A 2BVSH 3P92A 3ZZBA 4IN2A 4ZHMU 1AE5A 1GBBA 2TGDA 2C4FH 2BVXH 2BXTH 1S85A 3PYHA 1E0FD 4VGCC 3KEEA 1QFKH 4MNVA 1SLXB 1JOUB 1DUEA 3QGJA 4JZEH 4DURA 3EAJA 3QN7A 1UK2A 1D4PB 1UTQA 3A81A 2H9HA 1DWDH 1ELGA 1KYNA 2WYJA 2CMYA 2XWAA 1EB2A 4NIXA 4ESTE 4INHA 3RP2A 1XUFA 4WY3A 1QB1A 5DO4H 3ZZ7A 1CT4E 1ELVA 1LPZB 1TPAE 4R0IA 2Y6TA 2GKVE 3U98H 3UR9A 3S9AA 2ZGHA 1H1BA 1UK4A 5JB9S 1Z8GA 2CF8H 3RXRA 2QXGA 1TAWA 1TWXB 1C9TA 3OX7U 4GLYA 2A5AA 2GCTB 1GI0A 2GZ7A 1L1JA 1V2ST 2Z7FE 2H2ZA 1P2OA 3V12A 3UREA 1HFDA 2ZHDA 4LOYH 1PQ8A 3SORA 4DY7B 1TX6A 1HAVB 2ODYB 1P9SA 1V2QT 7LPRA 1TPOA 1GI8B 1GI7B 2PWXA 4NFFA 1T4VH 2FWWA 4Z0KA 1K1OA 1Y3WA 3QDZB 5A8ZA 2QCYA 1H9IE 2WYGA 2BY8X 3RXQA 2AS9A 4UEHH 5A8XA 5GPIB 2UWOA 3H5CB 1Z8RA 4SGBE 3OY5U 2QA9E 1YPKH 2GTBA 5EG4A 1TX8A 1DOJA 3M7QA 8KME2 2Y5FA 3UY9A 4WH6A 4AG1A 2VIVA 3C27B 1SHHB 4ASHA 1IQFA 1HBTH 3OU0A 3E90B 4MPUA 2OC0A 4ZHLU 1ZSKA 2SGEE 4A6LA 4ABHA 3BEUA 1ZLRA 3KN2A 2VIPA 1LDTT 2ZGXH 3A7TA 1W3CA 2SGQE 1P2JA 5GCHF 2YNBA 3ZVEA 4JZIA 2G51A 5AFZH 1GWAA 1Y3YA 3ELAH 3BTHE 1SI5H 1A3BH 1TGNA 1O3PB 3Q3XA 1C9PA 3LONA 1ETSH 1ESTA 4WMDA 1MKWK 2V3HH 6CHAB 1FIZA 1O3KA 1HB0B 3CP7A 3RMLH 2ASUB 1EJMA 1K21H 2FS8A 3KF2A 3BTTE 1N1LA 3M7UA 1O2RA 2GMTC 2A5KA 3LH1A 1IQKA 3M5LA 2AGIX 3HKIB 3W95A 4FUCA 1RIWB 1HAGE 3FAOA 1INCA 2JKHA 2VVCA 4GVUA 1QL8A 1V2MT 2J4IA 2ZFRH 1T8MA 1D3TB 4ZXYH 1WUNH 5FHTA 1SVPA 4PROA 3QGNB 4O9VA 1WBGB 3UWIA 2G00A 3GYMA 1T4UH 1LHCH 2FODA 2FZZA 4IC5A 1O2GH 3MTYA 2GT8A 1NRPH 4AZ2B 1KXDA 1L4ZA 2VIQA 2P94A 1P12E 1O37A 1IOEA 4WWYA 4JYTA 1SLWB 1PPCE 1P06A 1OXGA 3RXPA 2OC7A 1V2OT 3SOSA 3BTME 4YM9A 1FN8A 3ENSB 4Y79A 4AB9A 3VB4A 1FLEE 3GCHC 1BMNH 3HGPA 1BHXF 1TFXA 1EP5A 1KY9A 2WPHS 4GCHG 4GUXA 3BIUH 2NU1E 3PO1B 2Z3EA 1KXEA 1CT2E 3M7TA 3V0XA 1HJ9A 1TMUH 4NIVA 1CGIE 3EA8A 2Y81A 4E05H 3SU3A 1Z1JA 3A84A 4I8KA 2BZAA 1LCYA 1AUJA 3EYDA 6LPRA 1TIOA 2Y80A 4XDEA 4ISHH 1C2GA 1GBFA 4ABEA 1BTYA 4INKA 1KTTB 2ZPSA 2JH5D 4H42U 3SNCA 4WXVA 5DK1A 1FY4A 3MOCA 3NCLA 4JCNA 1TLDA 2D1JA 2FLBH 2JETB 4LXBH 1O5BB 1VJ9U 1LTOA 1H8IH 2ZPQA 1HDTH 1WQVH 1O3OA 2FOMB 4ZKOU 4TY6A 1Z8JB 4I31A 1S0RA 3ATMA 3SI4H 3KQBA 1AKSA 4KTUA 2P3UB 4WMEA 3RXMA 3MH5A 5BPEA 5JBAS 2UUJB 1FNIA 2UUKB 1QRZA 2ZEBA 1SL3A 2Y5HA 3UNSA 1V2JT 2KAIB 1ID5H 4ZKRU 3CS7A 1GMCG 1W10U 1A3EH 1GJ5H 3P8FA 3MU1A 4CRAA 1C1UH 1TNHA 3A8CA 3GDSA 3SQEE 3DT0H 1E35B 2C8WB 3O8CA 4BAHB 2OQ5A 4ISNA 1HPGA 3MU4A 1PJPA 4J2YB 2ZI2H 1BJUA 2PTNA 1HAVA 3DD2H 1O39A 3O8BA 5T6FA 1BTHH 1V2PT 1O3LA 4BNRA 2CGAA 2O8MA 2OC8A 5I25A 2EA3A 1AI8H 1O3AA 2QXJA 1TABE 2ZF0H 1HJ8A 3ZVBA 6GCHF 2ODQA 2ZFQH 2XC5A 2W3KA 1NC6A 4YOIA 2ZQ1A 1V2RT 4JZDH 3P17H 4FUEA 2J9NA 4OS1A 3VB7A 8GCHG 4K1EA 5JYIA 1FPHH 4MNXA 1K1NA 2XYAA 4MNWA 2A2QH 2BM2A 2FEQH 1K1PA 1GGDB 4AGJA 2GVFA 1FXYA 2ZPRA 1N6XA 4NSVA 2EI6A 3FP7E 2UUYA 1Y3UA 4X1RU 1VITH 5L2YH 2I6SA 1FDPA 4CR9A 1GHXH 3JZ1B 5F6MA 1ANBA 1NFYA 3PTNA 2IN2A 1YCPK 2ZTZA 1KLTA 2BDIA 4X6OA 2FDAA 1MTWA 1UCYE 1IQMA 1KDQA 2AIQA 2G55A 8LPRA 5E0GA 5AFYH 2BQ6B 1OSSA 4B2BA 1YPHC 1HLTH 4K8YA 1V2NT 2GGVB 1UTNA 4I8GA 1C2KA 5CE1A 3SI3H 2UWPA 1F0SA 3T26A 1F5LA 4BXWA 2A7CA 2A4QA 2IJOB 4YT6H 3K6ZA 3DFLA 4K8BA 1GBIA 2YOLA 1NU7B 3VXEH 3EQ0H 3M36A 1Z7KA 2Y5GA 2FX4A 2VGCC 3I29A 1BDAA 4VGCB 1QL7A 2BDGA 2IOTA 3MH6A 5L2ZH 3V3MA 1BRCE 2HPQH 5TCAA 4MDSA 1UTMA 2P8OC 1GJ8B 4QT8C 1CBWC 1BZXE 2BHGA 4CREA 3STIA 1TGCA 2BD4A 2PV9B 1YYY1 2BD9A 2OC1A 1P2IA 2F9BH 2FOGA 5B6OA 4GSOA 3T28A 1CT0E 2JH6D 3TH4H 1AQ7A 2BLQA 1P04A 2HRVA 4NA8A 1O33A 1T32A 1W2KH 1XUGA 3A7XA 2PSYA 2ZTXA 3RXBA 3GY8A 3F6UH 4Y6DA 4NIYA 1HYLA 2O8UA 1O2UA 2FO9A 1QURH 3HK3B 4JK5A 4FXGH 4FUGA 4NZQA 1F0TA 5DJ7A 1BTPA 2CXVA 1K28D 4Y7BA 3MO6A 1MCTA 4A5TS 3RXFA 5IDKA 2JH0D 1GBDA 3PLKA 2I6QA 2GZ8A 1O2NA 1EUFA 2TPIZ 2J92A 1AO5A 2O8LA 3TNTA 2P93A 4E06H 2R9PA 1NT1A 5F8XA 3UPEA 1UK3A 4OS4A 1ELTA 2G4UA 3ZVGA 1GCTC 1XVOA 1BMAA 3TVJB 2EI8A 2VVUA 3MO3A 1G3BA 3UOUA 1O2HA 5FBEA 4D9QA 2H9EH 3P6ZB 1K22H 1GBTA 1PQ7A 1ZSJA 1Z6EA 3HK6B 1GBLA 3P8GA 3U8RH 4CRGA 1EATA 3NXPA 2XBYA 4DIHH 2QC2A 1DS2E 2V3OH 3UWJH 4Y8YA 3WY8A 3RU4D 2BB4A 1FJSA 3IWMA 3AVZA 4O03A 3SU5A 2A1DB 2BX4A 3TGKE 1E37B 1X7AC 3SNDA 2VWLA 3MU8A 1DX5M 2FS9A 4Q2KA 5GJ4B 3T2NA 2AGEX 1AVXA 2OTVA 1P2QA 4FU7A 3TNSA 1PPEE 1P03A 2P59A 5DPAA 4HGCA 3LGWA 3M35A 1C5PA 3ZVDA 2ODPA 9ESTA 1W7GH 3T25A 3UR6A 1NFWA 1C5SA 3MH4A 1LMWB 3SUDA 5FX5A 3PLBA 2VJ1A 5C5OA 1TONA 3QO6A 1DE7H 2FLRH 3VFEA 1QNJA 1SGQE 1YCPM 3RXGA 2BVRH 3ZYEA 3K2UA 3LGTA 1DUAA 3V7TA 1BT7A 4B71A 4MVNA 1P0SH 2XCFA 2FTMA 4YZUA 4INLA 2GMTB 1C1PA 1A0LA 1GI9B 1RTKA 3RLYH 3LKWA 2TGPZ 2F9NA 1TB6H 2AFQB 4WF8A 4KTSA 4BANB 1P57B 4AFSA 1A46H 3LOXA 2DUCA 1SFIA 1H9HE 3LGIA 2WINI 1C5ZB 3FANA 3R0FA 4TY7A 4YT7H 4DCDA 3SV9A 4ZAEA 4UFDH 1A5IA 3KQEA 5C1UA 1SOZA 5GDSH 1BHXB 2AGGX 4B76A 2R3UA 4BAMB 3TK9A 1MZDA 2Z94A 2XBXA 3RXHA 5EQRA 1O30A 2ZFFH 2SGFE 3L6PA 8ESTE 2BLOA 2ZCKP 1YP9A 3GCHB 2VU8E 1J14A 1YPLH 1MAYA 2TGAA 1ZGIA 3PV4A 2FOHA 1O3FA 2VWNA 1OWEA 1G37A 3TH2H 3ZZ9A 3UQOA 2A32A 1DY8A 3BEIB 1LQEA 1IQGA 2RA0A 1T8NA 1P11E 2D8WA 2SGAA 1O34A 2ZFSA 5FCRA 2FI5E 2PKAA 1NESE 2SFAA 4OS7A 5EXLA 4MPVA 1C5MD 4ZH8A 5GIBA 2A5IA 2G5NA 3M5NA 1MTNC 4ABDA 4CR5A 2ZDVH 2AMDA 4J1YA 3F9FA 2Q6GA 1AHTH 2ZDNA 3JZ2B 1ELBA 5DP5A 1YLCA 5J4SA 1UTKA 3SJIA 1UCYH 2VH6A 1FY5A 1L2EA 1UJ1A 2GZ9A 1O32A 1VGCC 1K9OE 4B74A 1MU8B 5H4IB 3A80A 1HNEE 1D3DB 4FUDA 4X6MA 2QN5T 1O3JA 4X0WU 1EZQA 1O3NA 3AW1A 3LGYA 4FVDA 3UUZA 1ZMJA 4OGYA 4A92A 1AKSB 3PMJA 2TGTA 1ELAA 1H4WA 1UVSH 4B75A 4IMQA 3RU4T 1KTSB 2BY7X 4NWKA 1S81A 1V2KT 1OYTH 4ISLA 4U2WA 3O8RA 4UFEH 1SQAA 1YPHE 2F9UA 3OYPA 2NU0E 2G5VA 1GJ7B 2GX4A 1TNIA 1HAZB 4THNH 4LZ1H 2VIOA 3A85A 3KL6A 4K5ZA 1QA0A 3ZZ5A 4UFFH 5DG6A 2ZZUH 1YF4A 4ZHAA 1CHOF 1NRRH 1GHBG 1GJCB 2BD8A 4AGKA 1WTHD 1ZR0A 3SJOA 1SGFG 1ZHRA 5A0CA 1P3CA 1OP2A 1TQ7B 4K2YA 1VJAU 4ZUHA 2OD3B 2EC9H 1O3EA 1DDJA 3F68H 1YC0A 1XUIA 2ZU4A 2RDLA 3ZVFA 3NK8A 5ETXA 3L33A 2QV1A 3RXCA 7GCHF 1RJXB 3SO3A 1O5AB 2FM2A 1C1QA 2NU3E 5GXPA 1C5QA 2STBE 1TA6A 4CRFA 4DT7B 3K6YA 2FMJA 5PTPA 1JXPA 1TBZH 2GDDA 3SV8A 1YGCH 1G3DA 1SQTA 1ELFA 2C8ZB 1EB1H 2R2MB 3EE0B 4B73A 5GWZA 3RLWH 2WPMS 1DM4B 2ZNKH 2ZP0H 1GCDA 1EAUA 1E36B 1ZRKA 1ZHPA 5F8TA 3PLPA 4YLUA 2PLXA 1KDQB 1S0QA 5C5NA 4H6TA 2VIDA 1C5OH 1GVLA 4IC6A 4NZLA 1GI3A 1AFQC 2BQWB 1DSUA 4Q7XA 2VGCB 1Y8TA 3MYWA 1TPPA 4IS5A 1MKXK 1F0UA 1UVTH 1L1NA 1FONA 1XVMA 1YPGH 1TMTH 2WPJS 2AMPA 3B8JA 2BQ7B 4XFQA 1DICA 3GCTF 2VH0A 1O2JA 2P8OB 1KXCA 1G30B 1LHEH 3SU2A 1CBWB 1OWJA 1QB9A 5LPEA 5HYOA 1HRTH 3R3GB 1AU8A 4ABFA 2XBVA 1IQNA 3P8OA 1QIXB 1A5HA 2GDEH 1A1RA 3ZZDA 1BB0B 1PYTC 2EI7A 2J34A 2FXRA 1EXFA 5JBBS 3I78A 3GCOA 3I77A 4JYVH 2FPZA 3SNEA 2ZTYA 1K1JA 5DP4A 1JIRA 2AIPA 1C5TA 3VB3A 3DUXH 1OPHB 3LIWA 2Z9IA 5TCCA 1OWIA 1IQIA 1G2MA 4TYDA 1O2WA 4AORA 3O8DA 2AYWA 3SV2H 4IN1A 3GDUA 4DOQA 1A7SA 4Q7YA 5DP8A 1JMOH 1C1VH 1GHAF 1GBMA 1J15A 2FP7B 1FMGA 1IHTH 1RD3B 3LC3A 2OQUA 1GCTB 1ZTJA 3QK1A 4MPWA 1QQ4A 1OYQA 3E8LA 1GJDB 3URDA 4MG3A 1J8AA 4XOJA 4FUIA 2RCEA 1TGSZ 1S6HA 2OINA 1DWEH 4ABAA 1ZPBA 4RKJB 1CE5A 1AWFH 1VITG 1FV9A 1O2QA 1MD7A 4DGJA 2GD4B 5C1YA 1JIMA 1BITA 1GHYH 5A0BA 3SQHE 1OP8A 2P95A 4BOHA 1O5CB 3TIUA 4I8HA 1ZHMA 1UMAH 1TNJA 1Z1IA 7ESTE 1TRNA 1SGPE 1EAXA 4H6SB 3ATIA 4AFUA 1FQ3A 2ZGBH 3M5MA 3ZZ3A 1T8OA 1THSH 2Z9KA 3A7WA 5E8EH 3ZVAA 2WPIS 1K1IA 3ZZ6A 3KQCA 1A0HB 1P02A 1O5FH 1TMBH 2FOAA 2FI3E 1D6RA 4BAQB 1HAIH 3TJOA 1AE8H 1MKXH 3DFJA 1G9IE 3E16B 1Z71A 1GMDG 1GI2A 1XUHA 1YPEH 2ZKSA 3MNXA 2C93B 3LPRA 1UVPA 3EA7A 3SJ9A 3H7OA 1SB1H 1HJAC 1L1GA 1QBNA 2B8OH 3S7HB 4UD9H 1RTFB 2Y82A 1K2I1 5E2PA 3U1IB 2QIQA 1LQDB 1AN1E 3RU4E 1BIOA 5AHGH 5EGMA 3QTVH 4E7RG 2BDHA 4CBNA 1AGJA 3SU6A 4K1TA 1YKTA 3RC5A 1O2PA 1C2IA 4JMYA 1EAIA 5FAHA 2XWBI 5C67A 3GOVB 3EA9A 5ESTE 2ZC9H 2BY5X 3PB1E 2OXSA 1ELEE 2GCHF 1B0EA 1SGIB 5LH8A 3A8DA 2LNCA 1SFQB 3BIVH 1F2SE 2R0LA 4BAOB 3IG6B 4AX9H 1OKXA 1NO9H 2K1QA 3RMNH 2ZU1A 2NU2E 3CS0A 2ZCHP 3DA9B 4AB8A 1O31A 2UUFB 1AWHB 2M5TA 2Z9JA 3TGIE 1C5XB 1DXPA 1O2VA 4ABBA 3SNBA 1MAXA 1RGQA 5EW2H 4CBOA 3RDZA 1ABIH 1QY6A 1AVGH 1TE0A 3ZV9A 3SW2B 2BY6X 1SQOA 2ZDLA 4AN7A 3Q3KA 1CU1A 3FZDA 1F5RA 2RG3A 3ZYDA 1LHFH 1MZAA 4ZKSU 3RM2H 3MMGA 2G4TA 1ZPCA 4X1SU 4Y76A 1PQAA 3SZNA 2H9TH 2ILNA 2R3YA 2DE9A 1GBAA 1HAHH 4O3UA 1GDQA 1P09A 3LGVA 4A7IB 1GMHF 2F3CE 4X8UH 4A1XA 1MTNB 3E6PH 2ZU3A 2EEKA 3TJNA 2SNWA 3KIDU 2PKAB 1Q31A 3GY2A 1SMFE 1C2FA 3GCNA 1SBWA 1WYKA 3RXOA 1HAYB 1HXEH 1UVUH 1ZJKA 1HIAA 1IQHA 5DP6A 1SGYE 2ZHQH 1OP0A 2CF9H 1VGCB 2GT7A 4UFGH 3S7KB 3P95A 1GPZA 1O2XA 2F9PA 3MI4A 1XXDA 5AF9H 1OOKB 2A31A 2NU4E 3VEQB 5DP9A 1YPJH 4OS6A 3MHWU 2BD2A 1T7CA 1O3GA 1S83A 2R2WU 4YTAA 1DVAH 1FUJA 2PSXA 4Q80A 4RKOB 4HI3A 1D3PB 5A8YA 1AUTC 1F5KU 5HXFA 1YLDA 5JBCS 1J17T 4Y0ZE 1S5SA 1M9UA 1NM6A 3GY4A 1XMNB 2ZHFH 4X2WA 4ZXXH 1P05A 2F91A 4K60A 3QTOH 1ORFA 2HLCA 2CN0H 1UTLM 3P70B 3ZVCA 1HAOH 5E0JA 3K9XB 2ESTE 3RXUA 2Q6DA 1MMJN 1SGNE 4IGDA 1XUJA 3E0PB 1YPMH 2W5EA 2C8XB 1YBWA 4OS2A 1GI4A 1W14U 3ZV8A 1GMCF 3GDVA 3S9CA 3MO9A 4X8SH 1UTJA 3TGJE 1CA0B 1P10A 2W26A 1LHGH 1HAPH 5EPNA 3LU9B 4MLFB 3BF6H 3A82A 4CH2B 4WVPE 1G36A 1ZTKA 4X6PA 1ELDE 1VCPA 4Y11E 2BX3A 2HOBA 3A7VA 1BRAA 3ATLA 2GP9B 1C4U2 2O8WA 3RXLA 9LPRA 3OSYA 1S82A 1BTXA 1UCYK 3ODFA 2VIWA 3RMMH 8GCHF 1C5LH 1D9IA 2BTCE 3RXEA 1O3DA 1GJ6A 2THFB 3SUFA 1KXFA 2AH4X 3A89A 1BTWA 1AFQB 1AVWA 1EOLA 3RM0H 1BOQA 5HMAA 1AFEH 3GY5A 1Y3VA 2V0BA 7KMEH 2C90B 1GI5A 1ARCA 2H6MA 3B23B 3U9AH 2Q1JA 3FVFB 3RXSA 3F1SB 2FOBA 3SU4A 5C3NA 3PMAB 1P01A 1PPBH 2WUBA 4ABJA 1C2DA 1ZGVA 1CHOG 1ZJDA 3GY6A 4MNYA 3SGAE 4B1TA 5IYTA 3MWIU 4AYYB 1C1SA 1ESBA 3SUGA 4O3TA 2ZGJA 2A7JA 2Z3CA 2PUXB 2J95A 1SOTA 4JYUH 1UHBA 2PGQB 1HAXB 1QJ7B 2H5CA 1C1OA 3BTDE 3F9EA 4BTTB 4Y7AA 1EZUC 5J4QA 3S0NA 2PUQH 3DHKH 7GCHG 5JPMH 1OX1A 3SBKA 3MFJA 3STJA 4KELA 3E0NB 1ZRBA 3HPTB 1KXAA 1TALA 3KHVA 1BQYA 4GHQA 4Q7ZA 4ABGA 2B5TB 2YNAA 1DXWA 3AASA 2PKSC 1VCQA 1DWCH 5K7RA 3ODDA 3M3VA 1THRH 1EJNA 1AB9C 1B5GH 2TRMA 2QY0B 1FY3A 1NS3A 2FOFA 2ULLA 4F49A 1F0RA 1BBRH 5DGJA 1O2MA 3SJKA 3A83A 2P16A 5GCHG 3A7ZA 4UE7H 1LVYA 3PMHB 1FN6A 3LH3A 4Z6AH 4Y10E 4DVAU 4MQAA 1A4WH 1AD8H 1NY22 1XKBC 1ANDA 1C5NH 2W7UA 2ZG0H 1O5EH 4TWWA 2HNTC 5CHAC 1FPCH 1VR1H 3GCTG 4XE4A 1EPTA 3U69H 1ANCA 3T27A 4I8JA 2IPHA 4FU8A 5HGGA 1TYNA 2VVVA 1DITH 1SC8U 1EOJA 2A45B 3SU0A 3BG4C 2HNTF 1G3EA 1NN6A 1GHWH 1EPTC 1XKAC 2F83A 2FYRA 1J9CH 1QB6A 3FP6E 1LO6A 1C4V2 1C5VA 3IITA 3D23A 2XRCA 2V35A 3UTUH 1VZQH 5EPYA 3UFAA 1HXFH 4TWYA 4WH8A 2BLWA 5FPYA 5C20A 4HFPB 1IHSH 1P3EA 1P9UA 1CO7E 2HVXA 3AAVA 1O2SA 3RXVA 4UONA 3KNXA 2QF0A 2BDAA 4ISIH 1OWDA 4WMFA 2TBSA 4YOJA 1LPGB 3GY3A 1G3CA 1HJAB 1QRWA 4IBLH 2XW9A 3KGPA 1IAUA 4XBBA 4WXIA 1MBQA 2OBOA 2WV5A 1PYTD 3RUOA 2QXIA 2QAAA 4ZROA 1GHAG 2W7SA 2ANKH 5ESBA 1QJ6B 1AZZA 2ANWA 3PWBA 1GBCA 1W0YH 1QHRB 4D9RA 1O2ZA 4ISOA 1TNGA 3BTGE 1QRXA 5TJXA 1HUTH 3MH7A 1LKAA 1Z8IB 3M3SA 5FXLA 1PFXC 2Z6BD 3A87A 3GICB 4AOQA 1F7ZA 5EXMA 4X8TH 2ZCLP 1TNLA 1BTZA 1CHGA 2SNVA 1OWKA 3SUEA 1CA0C 4D7GA 1LPKB 1NFUA 2VWOA 4FUFA 2FYQA 2J38A 3RXIA 2D2DA 3MNBA 1MH0A 3ZZAA 1FIWA 1TOCB 3FP8E 2GV6A 4Y8XA 1W13U 2XBWA 1D6WA 4H4FA 2ZECA 1ARBA 1O3MA 2ZFTA 2BDYA 1VCWA 3D65E 5ABWA 1V2VT 1W7XH 2FI4E 4CHAC 1SGRE 3ZZ4A 2FX6A 3SNAA 3VGCC 1J16A 3GISB 1YM0A 3E91A 1O5GH 1V6DA 2FTLE 3U1JB 1WCZA 4X1PU 4D8NA 1U6QA 1N8OC 5JB8S 4Y0YE 1JRSA 1RRKA 2BDBA 1ABJH 3RXKA 5FX6A 1O2KA 1SGDE 4MPXA 1O0DH 3VPKA 3UIRA 3Q77A 1P8VC 3L3TA 1C5UA 4X2XA 5EW1H 3MU0A 1C2MA 2Z9GA 1TA2A 2FOEA 2ZDAH 3E1XB 1ZMNA 1O3HA 1MU6B 2SGDE 1HIAB 1MUEB 4FU9A 6GCHG 1QQUA 5LGOA 2ZDMA 3N7OA 1P2NA 2OUAA 1GL0E 4AFZA 4GHTA 2ALPA
chains in the Genus database with same CATH superfamily
4U32A 2PGBB 1FY8E 4E7NA 4DIIH 1L4DA 2GCHG 4MTBA 5EJ1A 1EP6A 1DFPA 1ANEA 3UOPA 3B9FH 4Y71A 3ZZ8A 4ZKNU 3M37A 2ZU2A 1W8BH 1TGBA 3PM3A 3SGQE 1Y5AT 1DANH 5DKMA 1AY6H 1GJ9B 3G01A 2ZFPH 3HATH 4X1NU 1MTUA 4YLQH 1XUKA 1QGFA 3AW0A 1C4Y2 4FUHA 2CHAB 3BTQE 1O35A 4B2AA 2D26C 3SU1A 1CGHA 4D76A 1O2YA 2W6ID 1C1MA 1LVMA 1MTVA 2ZDKA 1BJVA 2BOKA 3A8AA 3VB5A 1UVOA 1ZSLA 2J2UA 4K3JA 5HM9A 1B7XB 1EZSC 1GG6C 1GBJA 4X1QU 2Y7ZA 1P2KA 4K1SA 2CJIA 2XXLA 5EODA 4AG2A 3HGNA 2G8TA 1SGFA 1GMHG 3BV9B 5FBIA 1TRYA 3HKJB 1C2EA 2F9OA 1NRNH 1GVZA 1LKBA 1BTUA 2SGPE 2KZ4A 1NZQH 5FPTA 4HZHA 5HIYA 1CSOE 3OTJE 5T3HA 1O5DH 4OGXA 2PFEA 3FZZA 2BZ6H 1MBMA 1TBQH 2RA3A 1C2LA 1EAWA 3D49H 3Q00A 4XD7D 1NU9A 3F3BA 1GJAB 1GHBF 1BRUP 2LELA 3SV6A 5FCKA 4I7YH 2XCNA 4X2YA 3NZIA 2O9QA 2NWNA 3ITIA 1DSTA 3C1KA 1HCGA 5G4BA 1SLUB 1FI8A 2OP9A 1CA8B 5EQQA 3UNQA 4LZ4B 2HALA 3BTKE 1GHZA 1O38A 3BTWE 3TJUA 1GJBB 1ZZZA 2XC0A 1WTGH 3UB0A 4KTCA 1C5YB 4NA7A 1W0ZU 4XBCA 2PTCE 3A86A 1SGTA 5EOKA 1FAXA 4NWLA 2VWMA 3KQDA 2GV7A 4D7FA 3TJVA 5EXNA 4AYVB 3MNCA 2ZQ2A 1B0FA 1ACBE 2R0KA 2ZU5A 3NWUA 4B2CA 4X6NA 2WPLS 3SN8A 3ZZCA 1TBRH 1IQEA 2B7DH 1C5RA 2HNTE 3S69A 1MKWH 2Y7XA 1TX7A 4XSKU 1NFXA 2O8TA 2HWLB 3UAIC 4IW4E 1FZZA 3RXDA 1BBRE 1O2TA 2ZHEH 1V2TT 1UO6A 2CV3A 5A2MH 3URCA 2KCYA 1UHBB 2VNTA 2GCTC 2ZHWH 2C8YB 3Q76A 1WXRA 4Y8ZA 2J94A 2B9LA 4XRNA 1O3IA 1PPHE 2F9VA 3M61U 1O3CA 2PKSB 3F9GA 3LT3A 2BDCA 3BN9A 1W12U 4TPIZ 1O3BA 3TPIZ 1A5GH 1E34B 3QZQA 1SLVB 3LGUA 1PQ5A 4CH8B 1K1LA 1AB9B 3GS9A 3TLOA 1A61H 1KXBA 1C1RA 1LVBA 1BRBE 4I8LA 4A1TA 5K0HA 2HGTH 3PWCA 4GAWA 2LPRA 4KKDA 1TPSA 2W3IA 3TU7H 1A2CH 1AMHA 1Q2WA 1E38B 4OS5A 1GVKB 4BTIB 3A7YA 4ABIA 1Y59T 1O36A 5T6DA 2BY9X 1SHYA 2P3FH 5EJZA 4CRBA 1GL1A 1W0KD 4BXSA 2G52A 2VB0A 1SPJA 5CHAB 3TH3H 1NPMA 3DSGA 3ESTA 1DLKB 4R8TB 3E3TA 2AEIH 3AAUA 1XM1A 1WU1A 4YESB 5DP3A 1QBVH 1O2OA 4U30A 3BG4B 1PPGE 2HLDD 3QLPH 1EPTB 1S84A 2WPKS 1EJAA 1WAYB 1Y5UT 2ZGCA 4SGAE 5F8ZA 5GNDA 2VINA 3ATWA 3EE7A 1F92A 4O97A 2BLVA 4GCHF 1ZMLA 2FESH 1C2HA 5F03A 1UTOA 3FO8D 4TPYA 1C1NA 1C1TA 3PTBA 2BYAX 1ZYOA 1IQLA 2QF3A 1DWBH 1JRTA 3U8TH 2QGRA 1GDNA 4NIWA 1AIXH 2A4RA 3UQVA 1ZTLA 1VITF 2H1UA 4A1VA 1V2LT 1MCVA 1D3QB 1DLEA 1TRMA 1Y5BT 4AC9A 6CHAC 1THPB 1TGTA 2BMGB 2PR3A 1O2IA 2OCVB 3MU5A 2PW8H 1QL9A 2ZWLH 1DPOA 3LJJA 3RMOH 3SGBE 3TK5A 3EDXB 3LDXH 4M9FA 1GBKA 3V13A 3M5OA 1KSNA 1KIGH 2P3TB 1HV7A 2FOCA 1GDUA 3RC4A 1V2WT 3RXJA 1ETRH 1H9LB 3Q3YA 1PPZA 4I32A 3TK6A 4FUBA 1RIWC 2ZO3H 4IMZA 3A88A 4UDWH 3BSQA 4WJG2 5A09A 1ZPZA 5DSFA 2Z3DA 3KQ5A 1QCPA 2CHAC 1AZ8A 3VXFH 5EQSA 3QWCH 4F4OC 1TOMH 1FY1A 2H5DA 5LPFA 2BD7A 1PPFE 1QJ1B 4JK6A 2XTTB 1MQ6A 3W94A 2JJ1D 1GBHA 3DSPA 3QX5H 1SGCA 1SGEE 1GMDF 1NRQH 1BBRK 4NCYA 1Y3XA 1KLIH 5FPSA 4DG4A 2TIOA 2YMSB 2STAE 2AMQA 1C5WB 3LJOA 1KLJH 1DT2A 2BXUH 3KCGH 1G32B 1QBOA 4LK4A 4DJZB 1JWTA 4YO9A 1C2JA 3UNRA 4AFQA 3EGKH 4X8VH 3K65B 1SG8B 3SJ8A 1Q3XA 4M7GA 1Z6JH 1WQSA 3S9BA 1ETTH 1QTFA 5HM2A 3BTEE 1A0JA 5E2OA 1CVWH 1GI6A 3NUMA 3PO1C 3VG8A 5CMXH 4BAKB 4CHAB 5KECA 1CQQA 3VGCB 4HTCH 4CRDA 4FVBA 1UW7A 5C1XA 1QR3E 2V6NA 3RXTA 1N8OB 1WV7H 1YCPH 1RS0A 3RXAA 3LC5A 1FAKH 2UWLA 1LVOA 5A0AE 1TQ0B 3M3TA 1H8DH 2QYIA 1OWHA 2J98B 3VB6A 5EU8A 5KGOA 4FUJA 3PV5A 1WSSH 3P8NA 3QZRA 2JETC 1T31A 1EX3A 5LPRA 1EZXC 1G2LA 1O2LA 4JZFH 4OM9A 2KAIA 4CRCA 5C2ZA 4RN6A 1RXPA 2OBQA 1TNKA 3SV7A 1V2UT 4GPGA 1P2MA 1V3XA 1GI1A 3RC6A 2BOHB 2Z9LA 4U01A 3DSOA 4KGAA 2HPPH 2OLGA 1N6YA 4NGAH 4ZMAH 3QUMP 1XX9A 2A2XH 4K69A 5JDUB 4RSPA 2G81E 1GJ4H 1DY9A 4BTUB 1OS8A 3SHAH 2PHBA 3WWFA 2ZIQH 3GYLB 5SGAE 3GY7A 1QA7A 2AERH 3FFGA 4NSYA 1L0ZA 2DE8A 3PMBB 5DP7A 1GBEA 2ALVA 2ANYA 3SHCH 1T8LA 1C1WH 3F2HA 2KFWA 1NTPA 2QXHA 3A8BA 1QZ8A 2BD3A 4JZ1A 2WV4A 3PROA 3MNSA 1WOFA 1RFNA 2A0QB 1GG6B 4KP0A 3T5FH 3BTFE 3T62A 5L30H 3OFND 1RTLA 2XNDD 1NROH 3NPSA 3CENA 1BMLA 2Q6FA 1SR5C 4NG9H 1MD8A 3BG8A 1GGDC 5BRRE 1BMMH 2ZA5A 1BCUH 2XNIA 1XXFA 4DW2U 1SSXA 2BD5A 1K1MA 1MQ5A 1CGJE 1EQ9A 1ZOMA 4NA9H 5L6NH 1LHDH 2XC4A 2B0FA 2WZQA 1EKBB 6ESTA 1UTPA 2A7HA 1MTSA 3H7TA 4XBDA 3TITA 5E0HA 3BEFB 4YOGA 3OY6U 2C3SA 1ESAA 1S6FA 5I46H 1BUIA 1JBUH 3T29A 1IQJA 1GHVH 3F0OA 5T6GA 3ATKA 5EIYA 2A4GA 3F9HA 1W11U 3NKKA 4I33A 1EASA 1NRSH 1BA8B 2F4LA 4P02A 2A4OA 5JBTA 2ANMH 4NFEA 2FIRH 4X2VA 3U8OH 5AVDA 2WUCA 1HGTH 1ELCA 3D62A 2BVSH 3P92A 3ZZBA 4IN2A 4ZHMU 1AE5A 1GBBA 2TGDA 2C4FH 2BVXH 2BXTH 1S85A 3PYHA 3OE7D 1E0FD 4VGCC 3KEEA 1QFKH 4MNVA 1SLXB 1JOUB 1DUEA 3QGJA 4JZEH 4DURA 3EAJA 3QN7A 1UK2A 1D4PB 1UTQA 3A81A 2H9HA 1DWDH 1ELGA 1KYNA 2WYJA 2CMYA 4FETA 5IK2D 2XWAA 1EB2A 4NIXA 4ESTE 1BMFD 4INHA 3RP2A 1XUFA 4WY3A 3AK5A 1QB1A 3MQKC 5DO4H 5FL7D 3ZZ7A 1CT4E 1ELVA 1LPZB 1TPAE 3OEHD 2Y6TA 4R0IA 2GKVE 3U98H 3UR9A 3S9AA 2ZGHA 1H1BA 1UK4A 5JB9S 1Z8GA 2CF8H 3RXRA 4RT0A 2QXGA 1TAWA 1TWXB 1C9TA 1COWD 3OX7U 4GLYA 2A5AA 2GCTB 1GI0A 2GZ7A 1L1JA 1V2ST 2Z7FE 2H2ZA 1P2OA 3V12A 3UREA 1HFDA 2ZHDA 4LOYH 1PQ8A 3SORA 4DY7B 1TX6A 1HAVB 2ODYB 1P9SA 1V2QT 7LPRA 1TPOA 1GI8B 1GI7B 2PWXA 4NFFA 1T4VH 2FWWA 4Z0KA 1K1OA 1Y3WA 3QDZB 5A8ZA 2QCYA 1H9IE 2WYGA 2BY8X 3RXQA 2AS9A 4UEHH 5A8XA 5GPIB 2UWOA 4B6FA 3CNRA 4TT3D 3H5CB 1Z8RA 4SGBE 2KCAA 2QA9E 3OY5U 1YPKH 2GTBA 5EG4A 1TX8A 1DOJA 3M7QA 4DT4A 8KME2 2Y5FA 3UY9A 4WH6A 4AG1A 2VIVA 3C27B 1SHHB 4ASHA 1IQFA 1HBTH 3OU0A 3E90B 4MPUA 2OC0A 4ZHLU 1ZSKA 2SGEE 4A6LA 4ABHA 3BEUA 1ZLRA 3KN2A 2VIPA 1LDTT 2ZGXH 3A7TA 1W3CA 4RI0A 2SGQE 1P2JA 5GCHF 2YNBA 3ZVEA 4JZIA 2G51A 1OHHD 5AFZH 1GWAA 1Y3YA 3ELAH 3BTHE 1SI5H 3F2FA 1A3BH 5C17A 1TGNA 1O3PB 3Q3XA 1C9PA 3LONA 1ETSH 1ESTA 4WMDA 1MKWK 2V3HH 6CHAB 1FIZA 1O3KA 1HB0B 3CP7A 3RMLH 2ASUB 1EJMA 1K21H 2FS8A 3KF2A 3BTTE 1N1LA 3M7UA 1O2RA 2GMTC 2A5KA 3LH1A 1IQKA 3M5LA 2AGIX 3HKIB 3W95A 4FUCA 1RIWB 1HAGE 3FAOA 1INCA 2JKHA 2VVCA 4GVUA 1QL8A 1V2MT 2J4IA 2ZFRH 1T8MA 1D3TB 4ZXYH 1WUNH 5FHTA 1SVPA 4PROA 3QGNB 4O9VA 1WBGB 3UWIA 2G00A 3GYMA 2HVYB 1T4UH 1LHCH 2FODA 2FZZA 4IC5A 1O2GH 5KEDA 3MTYA 2GT8A 1NRPH 4AZ2B 1KXDA 1L4ZA 2VIQA 2P94A 1P12E 5B6LA 1O37A 1IOEA 2QF4A 4WWYA 4JYTA 1SLWB 1PPCE 1P06A 1OXGA 3RXPA 2OC7A 1V2OT 3SOSA 3BTME 4YM9A 1FN8A 3ENSB 4Y79A 4AB9A 3VB4A 1FLEE 3GCHC 1BMNH 3HGPA 1BHXF 1TFXA 3FKSD 1EP5A 1KY9A 2WPHS 4GCHG 4GUXA 3BIUH 2NU1E 3PO1B 2Z3EA 1KXEA 1CT2E 3M7TA 3V0XA 1HJ9A 1TMUH 2L6OA 1CGIE 1YWUA 3EA8A 4NIVA 2Y81A 5C0TA 4E05H 3SU3A 1Z1JA 3A84A 4I8KA 2BZAA 1LCYA 1AUJA 3EYDA 6LPRA 1TIOA 2Y80A 4XDEA 4ISHH 1C2GA 1GBFA 4ABEA 1BTYA 4INKA 1KTTB 2ZPSA 2JH5D 4H42U 3SNCA 3ZIAD 4WXVA 5DK1A 1FY4A 3MOCA 3NCLA 4JCNA 1TLDA 2D1JA 2FLBH 2JETB 4LXBH 1O5BB 1VJ9U 1LTOA 1H8IH 2ZPQA 1HDTH 1WQVH 1O3OA 2FOMB 4ZKOU 4TY6A 1Z8JB 4I31A 1S0RA 3ATMA 3SI4H 3KQBA 1AKSA 4KTUA 2P3UB 4WMEA 3RXMA 3MH5A 5BPEA 5JBAS 2AHME 2UUJB 1FNIA 2UUKB 1QRZA 2ZEBA 1SL3A 4ASUD 2Y5HA 3H09A 3UNSA 1V2JT 2KAIB 1ID5H 4ZKRU 3CS7A 1GMCG 1W10U 1A3EH 1GJ5H 3P8FA 3MU1A 4CRAA 1C1UH 1TNHA 3A8CA 3GDSA 3SQEE 3DT0H 1E35B 2C8WB 3O8CA 4BAHB 2OQ5A 4ISNA 1HPGA 3MU4A 1PJPA 4J2YB 2ZI2H 1BJUA 2PTNA 1HAVA 3DD2H 1O39A 3O8BA 5T6FA 1BTHH 1V2PT 1O3LA 4BNRA 2CGAA 2O8MA 2OC8A 5I25A 2EA3A 1AI8H 1O3AA 2QXJA 1TABE 2ZF0H 1HJ8A 3ZVBA 6GCHF 2ODQA 2ZFQH 2XC5A 2W3KA 1NC6A 4HG6A 4YOIA 2ZQ1A 1V2RT 4JZDH 3P17H 4FUEA 2J9NA 4OS1A 3VB7A 8GCHG 4K1EA 5JYIA 1FPHH 4MNXA 1K1NA 2XYAA 4MNWA 2A2QH 2BM2A 2FEQH 1K1PA 1GGDB 4AGJA 2GVFA 1FXYA 2ZPRA 1N6XA 4NSVA 2EI6A 3FP7E 2UUYA 1Y3UA 4X1RU 1VITH 5L2YH 2I6SA 1FDPA 4CR9A 1GHXH 3JZ1B 5F6MA 1ANBA 1NFYA 3PTNA 2IN2A 1YCPK 2ZTZA 1KLTA 2BDIA 1YY3A 2WHXA 4X6OA 2FDAA 1MTWA 1UCYE 1IQMA 1KDQA 2AIQA 2G55A 8LPRA 5E0GA 5AFYH 2BQ6B 1OSSA 4B2BA 1YPHC 1HLTH 4K8YA 1V2NT 4ZCNA 2GGVB 1UTNA 4I8GA 1C2KA 5CE1A 3SI3H 2UWPA 1F0SA 3T26A 1F5LA 4BXWA 2A7CA 2A4QA 2IJOB 4YT6H 3K6ZA 3DFLA 4K8BA 1GBIA 2YOLA 1NU7B 3VXEH 3EQ0H 3M36A 1Z7KA 2Y5GA 2FX4A 2VGCC 3I29A 1BDAA 4VGCB 1QL7A 2BDGA 2IOTA 3MH6A 5L2ZH 3V3MA 1BRCE 2HPQH 5TCAA 4MDSA 4ACBA 1H8HD 1UTMA 2P8OC 1GJ8B 4QT8C 1CBWC 1BZXE 2BHGA 4CREA 3STIA 1TGCA 2BD4A 2PV9B 1E1RD 1YYY1 2BD9A 2OC1A 1P2IA 2F9BH 2FOGA 5B6OA 4GSOA 3T28A 1CT0E 2JH6D 3TH4H 2W6JD 1AQ7A 2BLQA 1P04A 2HRVA 4NA8A 1O33A 1T32A 1W2KH 1XUGA 3A7XA 2PSYA 2ZTXA 3RXBA 3GY8A 3F6UH 4Y6DA 5T1VA 4NIYA 2K0QA 1HYLA 1O2UA 2FO9A 2O8UA 1QURH 3HK3B 4JK5A 4FXGH 4FUGA 4NZQA 1F0TA 5DJ7A 1BTPA 2CXVA 1K28D 4Y7BA 3MO6A 1MCTA 4A5TS 3RXFA 5IDKA 2JH0D 1GBDA 3PLKA 2I6QA 2GZ8A 1O2NA 1EUFA 2TPIZ 2J92A 1AO5A 2O8LA 3TNTA 2P93A 4E06H 2R9PA 1NT1A 2PP6A 5F8XA 3UPEA 1UK3A 4OS4A 2JDID 1ELTA 2G4UA 3ZVGA 1GCTC 1XVOA 1BMAA 3TVJB 2EI8A 2VVUA 3MO3A 1G3BA 3UOUA 1O2HA 5FBEA 4D9QA 2H9EH 3P6ZB 1K22H 1GBTA 4B6EA 1PQ7A 1ZSJA 1Z6EA 3HK6B 1GBLA 3P8GA 3U8RH 4CRGA 1EATA 2F43B 3NXPA 2XBYA 4DIHH 2QC2A 1DS2E 2V3OH 3UWJH 4Y8YA 3WY8A 3RU4D 2BB4A 1FJSA 3IWMA 1SKYE 3AVZA 4O03A 3SU5A 2A1DB 2BX4A 3TGKE 1E37B 1X7AC 3SNDA 2VWLA 2OK5A 3MU8A 1DX5M 2FS9A 4Q2KA 5GJ4B 3T2NA 2AGEX 1AVXA 2OTVA 1P2QA 4FU7A 3TNSA 1PPEE 1P03A 2P59A 5DPAA 4HGCA 3LGWA 3M35A 1C5PA 3ZVDA 2ODPA 9ESTA 1W7GH 3T25A 3UR6A 1NFWA 1C5SA 3MH4A 1LMWB 3SUDA 5FX5A 3PLBA 2VJ1A 5C5OA 1TONA 3QO6A 1DE7H 2FLRH 3VFEA 5EJLA 1QNJA 4I86A 1SGQE 1YCPM 3RXGA 2BVRH 3ZYEA 3K2UA 3LGTA 1DUAA 3V7TA 1BT7A 4B71A 4MVNA 1P0SH 2XCFA 2FTMA 4YZUA 4INLA 2GMTB 1C1PA 1A0LA 1GI9B 1RTKA 3RLYH 3LKWA 2TGPZ 2F9NA 1TB6H 2AFQB 4WF8A 4KTSA 4BANB 1P57B 4AFSA 1A46H 3LOXA 1H8ED 4ACAA 2DUCA 1SFIA 1H9HE 3LGIA 2WINI 1C5ZB 3FANA 3R0FA 1K0HA 4TY7A 4YT7H 4DCDA 3SV9A 4ZAEA 4UFDH 2WV9A 1A5IA 3KQEA 5C1UA 1SOZA 5GDSH 1BHXB 2AGGX 4B76A 2R3UA 4BAMB 3TK9A 1MZDA 2Z94A 2XBXA 3RXHA 5EQRA 1O30A 2ZFFH 2SGFE 3L6PA 8ESTE 2BLOA 2ZCKP 2M2AA 1YP9A 3GCHB 2VU8E 1J14A 1YPLH 1MAYA 2TGAA 1ZGIA 3PV4A 2FOHA 1O3FA 2VWNA 1OWEA 1G37A 3TH2H 3ZZ9A 3UQOA 2A32A 1DY8A 3BEIB 1LQEA 1IQGA 2RA0A 1T8NA 1P11E 2D8WA 2SGAA 1O34A 2ZFSA 5FCRA 2FI5E 2PKAA 1NESE 3KYFA 2SFAA 4OS7A 5EXLA 4MPVA 1C5MD 4ZH8A 5GIBA 2A5IA 2G5NA 3M5NA 1MTNC 4ABDA 4CR5A 2ZDVH 2AMDA 4J1YA 3F9FA 2Q6GA 1AHTH 2ZDNA 3JZ2B 1ELBA 5DP5A 1YLCA 5J4SA 1UTKA 3SJIA 1UCYH 2VH6A 1FY5A 1L2EA 1UJ1A 2GZ9A 1O32A 1VGCC 1K9OE 4B74A 1MU8B 5H4IB 3A80A 1HNEE 1D3DB 4FUDA 4X6MA 2QN5T 1O3JA 4X0WU 1EZQA 1O3NA 3AW1A 3LGYA 4FVDA 3UUZA 1ZMJA 4OGYA 4A92A 1AKSB 3PMJA 2TGTA 2RFKC 1ELAA 1H4WA 1UVSH 4B75A 4IMQA 3RU4T 1KTSB 2BY7X 4NWKA 1S81A 1V2KT 1OYTH 4ISLA 4U2WA 3O8RA 4UFEH 1SQAA 1YPHE 2F9UA 5C0UA 3OYPA 2NU0E 2G5VA 1GJ7B 2GX4A 1TNIA 1HAZB 4THNH 4LZ1H 2VIOA 3A85A 3KL6A 4K5ZA 1QA0A 3ZZ5A 4UFFH 5DG6A 2ZZUH 1YF4A 4ZHAA 1CHOF 1NRRH 1GHBG 1GJCB 2BD8A 4AGKA 1WTHD 1ZR0A 3SJOA 5DN6D 1SGFG 1ZHRA 5A0CA 1P3CA 2LP6A 1OP2A 1TQ7B 4K2YA 1VJAU 4ZUHA 2OD3B 2EC9H 1O3EA 1DDJA 3F68H 1YC0A 1XUIA 2ZU4A 2RDLA 3ZVFA 3NK8A 5ETXA 3L33A 1YLNA 2QV1A 3RXCA 7GCHF 1RJXB 3SO3A 1O5AB 2FM2A 1C1QA 2EQNA 2NU3E 5GXPA 1C5QA 2STBE 4YXWD 1TA6A 4CRFA 4DT7B 3K6YA 2FMJA 5PTPA 1JXPA 1TBZH 2GDDA 3SV8A 1YGCH 1G3DA 1SQTA 1ELFA 2C8ZB 1EB1H 2R2MB 3EE0B 4B73A 5GWZA 3RLWH 2WPMS 1DM4B 3FN8A 2ZNKH 2ZP0H 1MABB 1GCDA 1EAUA 1E36B 1ZRKA 1ZHPA 2IPQX 5F8TA 3PLPA 4YLUA 2PLXA 1KDQB 1S0QA 5C5NA 4H6TA 2VIDA 1C5OH 1GVLA 4IC6A 4NZLA 1GI3A 1AFQC 2BQWB 1DSUA 4Q7XA 2VGCB 1Y8TA 3MYWA 1TPPA 4IS5A 1MKXK 2JJ2D 1F0UA 1UVTH 1L1NA 1FONA 1XVMA 1YPGH 1TMTH 2WPJS 2AMPA 3B8JA 2BQ7B 3F2GA 4XFQA 1DICA 3GCTF 2VH0A 1O2JA 2L74A 3PRBA 2P8OB 1KXCA 1G30B 1LHEH 3SU2A 1CBWB 2J5UA 1OWJA 1QB9A 5LPEA 5HYOA 1HRTH 3R3GB 1AU8A 4ABFA 2XBVA 1IQNA 3P8OA 1QIXB 1A5HA 2GDEH 1A1RA 3ZZDA 1BB0B 1PYTC 2EI7A 2J34A 2FXRA 1EXFA 5JBBS 3I78A 3GCOA 3I77A 4JYVH 2FPZA 3SNEA 2ZTYA 1K1JA 5DP4A 1JIRA 2AIPA 1C5TA 3VB3A 3DUXH 1OPHB 3LIWA 2Z9IA 5TCCA 1OWIA 1IQIA 1G2MA 4TYDA 1O2WA 4AORA 3O8DA 2AYWA 3SV2H 4IN1A 3GDUA 4DOQA 1A7SA 4Q7YA 5DP8A 3NRLA 1JMOH 1C1VH 1GHAF 1GBMA 1J15A 2FP7B 1FMGA 1IHTH 2V7QD 1RD3B 3LC3A 2OQUA 1GCTB 1ZTJA 3QK1A 4MPWA 1QQ4A 1OYQA 3E8LA 1GJDB 3URDA 4MG3A 1J8AA 4XOJA 4FUIA 2RCEA 1TGSZ 1S6HA 2OINA 1KMHB 1DWEH 4ABAA 1ZPBA 4RKJB 1CE5A 1AWFH 1VITG 1FV9A 1O2QA 1MD7A 4DGJA 2GD4B 5C1YA 1JIMA 1BITA 1GHYH 5A0BA 3SQHE 1OP8A 2P95A 4BOHA 1NBME 1O5CB 3TIUA 4I8HA 1ZHMA 1UMAH 1TNJA 1Z1IA 7ESTE 1TRNA 1SGPE 1EAXA 4H6SB 3ATIA 4AFUA 1FQ3A 2ZGBH 3M5MA 3ZZ3A 1T8OA 3U28C 1THSH 2Z9KA 3A7WA 5E8EH 3ZVAA 2WPIS 1K1IA 3ZZ6A 3KQCA 1A0HB 1P02A 1O5FH 1TMBH 2FOAA 2FI3E 1D6RA 4BAQB 1HAIH 3TJOA 1AE8H 1MKXH 3DFJA 1G9IE 3E16B 1Z71A 1GMDG 1GI2A 1XUHA 1YPEH 2ZKSA 3MNXA 2C93B 3LPRA 1UVPA 3EA7A 3SJ9A 3H7OA 1SB1H 1HJAC 4FOUC 1L1GA 1QBNA 2B8OH 3S7HB 4UD9H 1RTFB 2Y82A 1K2I1 5E2PA 3U1IB 2QIQA 1LQDB 1AN1E 3RU4E 1BIOA 5AHGH 2KCOA 4RT1A 3QTVH 5EGMA 4E7RG 2BDHA 4CBNA 1AGJA 3SU6A 4K1TA 1YKTA 3FOAA 3RC5A 1O2PA 1C2IA 4JMYA 1EAIA 5FAHA 2XWBI 5C67A 3GOVB 3EA9A 5ESTE 2ZC9H 2BY5X 3PB1E 2OXSA 1ELEE 2GCHF 1B0EA 1SGIB 5LH8A 3A8DA 2LNCA 1SFQB 3BIVH 1F2SE 2R0LA 4BAOB 3IG6B 4AX9H 1OKXA 5CHBA 1NO9H 2K1QA 3RMNH 2ZU1A 2NU2E 3CS0A 2ZCHP 3DA9B 4AB8A 1O31A 2UUFB 1AWHB 2M5TA 3N99A 2Z9JA 3TGIE 1C5XB 1DXPA 1O2VA 4ABBA 4Q4LA 3SNBA 1MAXA 1RGQA 5EW2H 2KX4A 4CBOA 3RDZA 1ABIH 1QY6A 1AVGH 1TE0A 3ZV9A 3SW2B 2BY6X 1SQOA 2ZDLA 4AN7A 3Q3KA 1CU1A 3FZDA 1F5RA 2RG3A 3ZYDA 2WPDD 1LHFH 1MZAA 4ZKSU 3RM2H 3MMGA 2G4TA 5CDFE 1ZPCA 4X1SU 4Y76A 1PQAA 3SZNA 2H9TH 2ILNA 2R3YA 2DE9A 2CK3D 1GBAA 1HAHH 4O3UA 1GDQA 1P09A 3LGVA 4A7IB 1GMHF 2F3CE 4X8UH 4A1XA 1MTNB 3E6PH 4P00A 2WSSD 2ZU3A 2EEKA 3TJNA 2SNWA 3KIDU 2PKAB 1Q31A 3GY2A 1SMFE 1C2FA 3GCNA 1SBWA 1WYKA 3RXOA 1HAYB 1HXEH 1UVUH 2JIZD 1ZJKA 1HIAA 1IQHA 5DP6A 1SGYE 2ZHQH 1OP0A 2CF9H 1VGCB 2GT7A 4UFGH 3S7KB 3P95A 1GPZA 1O2XA 2F9PA 3MI4A 1XXDA 5AF9H 1OOKB 2A31A 2NU4E 3VEQB 5DP9A 1YPJH 4OS6A 3MHWU 2BD2A 1T7CA 1O3GA 1S83A 2R2WU 4YTAA 1DVAH 1FUJA 1FX0B 2PSXA 4Q80A 4RKOB 4HI3A 1D3PB 5A8YA 1AUTC 1F5KU 3SYJA 5HXFA 3OTPA 1YLDA 5JBCS 1J17T 3DCLA 4Y0ZE 1S5SA 1NBMD 1M9UA 1NM6A 3GY4A 1XMNB 2ZHFH 4X2WA 4ZXXH 1P05A 2F91A 2J97A 3QTOH 4K60A 1ORFA 2HLCA 2CN0H 1UTLM 3P70B 3ZVCA 1HAOH 5E0JA 3K9XB 2ESTE 3RXUA 2Q6DA 1MMJN 1SGNE 2KCPA 4IGDA 1XUJA 3E0PB 5HKKD 1YPMH 2W5EA 2C8XB 1SQRA 1YBWA 1GI4A 1W14U 4OS2A 3ZV8A 1GMCF 3GDVA 3S9CA 3MO9A 4X8SH 1UTJA 3TGJE 1CA0B 1P10A 2W26A 1LHGH 1HAPH 5EPNA 3LU9B 4MLFB 3BF6H 3A82A 4CH2B 4WVPE 1G36A 1ZTKA 4X6PA 1ELDE 1VCPA 4Y11E 2BX3A 2HOBA 3A7VA 2KR7A 1BRAA 3ATLA 3SZEA 2GP9B 1C4U2 2O8WA 3RXLA 9LPRA 3OSYA 1S82A 1BTXA 1UCYK 3ODFA 2VIWA 3RMMH 8GCHF 1C5LH 1D9IA 2BTCE 3RXEA 1O3DA 1GJ6A 2THFB 3SUFA 1KXFA 2AH4X 3A89A 1BTWA 1AFQB 5C94A 1AVWA 1EOLA 3RM0H 1BOQA 5HMAA 1AFEH 3KYGA 3GY5A 1Y3VA 2IJD1 2V0BA 7KMEH 2C90B 1GI5A 1ARCA 2H6MA 3B23B 3U9AH 2Q1JA 3FVFB 3RXSA 3F1SB 2FOBA 3SU4A 5C3NA 3PMAB 1P01A 1PPBH 2WUBA 4ABJA 1C2DA 3OEED 4Z1MD 1ZGVA 1CHOG 1ZJDA 3W1EA 3GY6A 4MNYA 3SGAE 1E1QD 4B1TA 5IYTA 3MWIU 4AYYB 1C1SA 1ESBA 3SUGA 4O3TA 2ZGJA 2A7JA 2Z3CA 2PUXB 2J95A 1SOTA 4JYUH 1UHBA 2PGQB 1HAXB 1QJ7B 2H5CA 1C1OA 3BTDE 3F9EA 4BTTB 4Y7AA 1EZUC 2V3MA 5J4QA 3S0NA 2PUQH 3DHKH 3N7DA 7GCHG 5JPMH 1OX1A 3SBKA 3MFJA 3STJA 4KELA 3E0NB 4Q63A 1ZRBA 3HPTB 1KXAA 1TALA 3KHVA 1BQYA 1EFRD 3PRDA 4GHQA 4Q7ZA 4ABGA 2B5TB 2YNAA 1DXWA 3AASA 2PKSC 1VCQA 1DWCH 5K7RA 3ODDA 3M3VA 2YMSD 1THRH 1EJNA 2VBCA 1AB9C 1B5GH 2TRMA 2QY0B 1FY3A 1NS3A 2FOFA 2ULLA 4F49A 1F0RA 1BBRH 5DGJA 1O2MA 3SJKA 3A83A 2P16A 5GCHG 3A7ZA 4UE7H 1LVYA 3PMHB 1FN6A 3LH3A 4Z6AH 3F0PA 4Y10E 4DVAU 4MQAA 1A4WH 1AD8H 1NY22 1XKBC 1ANDA 1C5NH 2W7UA 1E79D 2ZG0H 1O5EH 4TWWA 2HNTC 5CHAC 1FPCH 1VR1H 3GCTG 4XE4A 1EPTA 3U69H 1ANCA 5HIZA 3T27A 4I8JA 2IPHA 4FU8A 5HGGA 1TYNA 2VVVA 1DITH 1SC8U 1EOJA 2A45B 3SU0A 3BG4C 2HNTF 1W0JD 1G3EA 1NN6A 5F53A 1GHWH 1EPTC 1XKAC 2F83A 2FYRA 1J9CH 1QB6A 3FP6E 1LO6A 1C4V2 1C5VA 3IITA 3D23A 2XRCA 2V35A 3UTUH 1VZQH 5EPYA 3UFAA 1HXFH 4TWYA 4WH8A 2BLWA 5FPYA 5C20A 4HFPB 1IHSH 1P3EA 1P9UA 1CO7E 2HVXA 3AAVA 1O2SA 3RXVA 4UONA 2QE7D 3KNXA 2QF0A 2BDAA 4ISIH 1OWDA 4WMFA 2TBSA 4YOJA 1LPGB 3GY3A 1G3CA 1HJAB 1QRWA 4IBLH 2XW9A 3KGPA 1IAUA 4XBBA 4WXIA 1MBQA 2OBOA 2WV5A 2KM0A 1PYTD 3RUOA 2QXIA 2QAAA 4ZROA 1GHAG 2W7SA 2ANKH 5ESBA 1QJ6B 3WWBA 1AZZA 2ANWA 2QF5A 3PWBA 1GBCA 3PV2A 1W0YH 1QHRB 4D9RA 1VKYA 1O2ZA 4ISOA 2GJGA 1TNGA 3BTGE 1QRXA 5TJXA 2EY4C 1HUTH 2XOKD 3MH7A 1LKAA 1Z8IB 3M3SA 5FXLA 1PFXC 2Z6BD 3A87A 3GICB 4AOQA 1F7ZA 5EXMA 4X8TH 2ZCLP 1TNLA 4TSFD 1BTZA 1CHGA 2SNVA 1OWKA 3SUEA 1CA0C 3OAAD 4D7GA 1LPKB 2YMSC 1NFUA 2VWOA 4FUFA 2FYQA 2J38A 3RXIA 2D2DA 3MNBA 1MH0A 3ZZAA 1FIWA 2RDEA 1TOCB 3N7EA 3FP8E 2GV6A 4Y8XA 1W13U 2XBWA 1D6WA 2K8IA 4H4FA 2ZECA 1ARBA 1O3MA 2ZFTA 2BDYA 3WW7A 1VCWA 3D65E 4F48B 1V2VT 1W7XH 5ABWA 2FI4E 4CHAC 1SGRE 4F55A 3ZZ4A 2FX6A 3SNAA 3VGCC 1J16A 3GISB 1YM0A 3E91A 1O5GH 1V6DA 2FTLE 3U1JB 1WCZA 1S6LA 2J98A 4X1PU 4D8NA 1U6QA 1N8OC 5JB8S 4Y0YE 1JRSA 1RRKA 2BDBA 1ABJH 3RXKA 5FX6A 1O2KA 1SGDE 4MPXA 1O0DH 3VPKA 3UIRA 3Q77A 1P8VC 3L3TA 1WDIA 1C5UA 4X2XA 5EW1H 3MU0A 1C2MA 2Z9GA 1TA2A 2FOEA 2ZDAH 3E1XB 1ZMNA 1O3HA 1MU6B 2SGDE 1HIAB 1MUEB 4FU9A 6GCHG 1QQUA 5LGOA 2ZDMA 3N7OA 1P2NA 2OUAA 1GL0E 4AFZA 4GHTA 2ALPA
chains in the Genus database with same CATH topology
4U32A 2PGBB 1FY8E 4E7NA 4DIIH 1L4DA 2GCHG 4MTBA 1EP6A 1DFPA 1ANEA 3UOPA 3B9FH 4Y71A 3ZZ8A 4ZKNU 3M37A 2ZU2A 1W8BH 1TGBA 3PM3A 3SGQE 1Y5AT 1DANH 5DKMA 1AY6H 1GJ9B 3G01A 2ZFPH 3HATH 4X1NU 1MTUA 4YLQH 1XUKA 1QGFA 3AW0A 1C4Y2 4FUHA 2CHAB 3BTQE 1O35A 4B2AA 2D26C 3SU1A 1CGHA 4D76A 1O2YA 1C1MA 1LVMA 1MTVA 2ZDKA 1BJVA 2BOKA 3A8AA 3VB5A 1UVOA 1ZSLA 2J2UA 4K3JA 5HM9A 1B7XB 1EZSC 1GG6C 1GBJA 4X1QU 2Y7ZA 1P2KA 4K1SA 2CJIA 2XXLA 5EODA 4AG2A 3HGNA 2G8TA 1SGFA 1GMHG 3BV9B 5FBIA 1TRYA 3HKJB 1C2EA 2F9OA 1NRNH 1GVZA 1LKBA 1BTUA 2SGPE 1NZQH 5FPTA 4HZHA 5T3HA 1CSOE 3OTJE 1O5DH 4OGXA 2PFEA 3FZZA 2BZ6H 1MBMA 1TBQH 2RA3A 1C2LA 1EAWA 3D49H 3Q00A 1NU9A 1GJAB 1GHBF 1BRUP 3SV6A 5FCKA 4I7YH 2XCNA 4X2YA 3NZIA 2O9QA 2NWNA 3ITIA 1DSTA 3C1KA 1HCGA 5G4BA 1SLUB 1FI8A 2OP9A 1CA8B 5EQQA 3UNQA 4LZ4B 2HALA 3BTKE 1GHZA 1O38A 3BTWE 3TJUA 1GJBB 1ZZZA 2XC0A 1WTGH 4KTCA 1C5YB 4NA7A 1W0ZU 4XBCA 2PTCE 3A86A 1SGTA 5EOKA 1FAXA 4NWLA 2VWMA 3KQDA 2GV7A 4D7FA 3TJVA 5EXNA 4AYVB 3MNCA 2ZQ2A 1B0FA 1ACBE 2R0KA 2ZU5A 3NWUA 4B2CA 4X6NA 2WPLS 3SN8A 3ZZCA 1TBRH 1IQEA 2B7DH 1C5RA 2HNTE 3S69A 1MKWH 2Y7XA 1TX7A 4XSKU 1NFXA 2O8TA 2HWLB 4IW4E 1FZZA 3RXDA 1BBRE 1O2TA 2ZHEH 1V2TT 1UO6A 2CV3A 5A2MH 3URCA 1UHBB 2VNTA 2GCTC 2ZHWH 2C8YB 3Q76A 4Y8ZA 2J94A 2B9LA 1O3IA 1PPHE 2F9VA 3M61U 1O3CA 2PKSB 3F9GA 3LT3A 2BDCA 3BN9A 1W12U 4TPIZ 1O3BA 3TPIZ 1A5GH 1E34B 3QZQA 1SLVB 3LGUA 1PQ5A 4CH8B 1K1LA 1AB9B 3TLOA 1A61H 1KXBA 1C1RA 1LVBA 1BRBE 4I8LA 4A1TA 5K0HA 2HGTH 3PWCA 4GAWA 2LPRA 4KKDA 1TPSA 2W3IA 3TU7H 1A2CH 1AMHA 1Q2WA 1E38B 4OS5A 1GVKB 4BTIB 3A7YA 4ABIA 1Y59T 1O36A 5T6DA 2BY9X 1SHYA 2P3FH 4CRBA 1GL1A 4BXSA 2G52A 2VB0A 1SPJA 5CHAB 3TH3H 1NPMA 3ESTA 1DLKB 4R8TB 3E3TA 2AEIH 3AAUA 1XM1A 1WU1A 4YESB 5DP3A 1QBVH 1O2OA 4U30A 3BG4B 1PPGE 3QLPH 1EPTB 1S84A 2WPKS 1EJAA 1WAYB 1Y5UT 2ZGCA 4SGAE 5F8ZA 2VINA 3ATWA 1F92A 4O97A 2BLVA 4GCHF 1ZMLA 2FESH 1C2HA 5F03A 1UTOA 4TPYA 1C1NA 1C1TA 3PTBA 2BYAX 1IQLA 1ZYOA 2QF3A 1DWBH 1JRTA 3U8TH 2QGRA 1GDNA 4NIWA 1AIXH 2A4RA 3UQVA 1ZTLA 1VITF 2H1UA 4A1VA 1V2LT 1MCVA 1D3QB 1DLEA 1TRMA 1Y5BT 6CHAC 1THPB 1TGTA 2BMGB 2PR3A 1O2IA 2OCVB 3MU5A 2PW8H 1QL9A 2ZWLH 1DPOA 3LJJA 3RMOH 3SGBE 3TK5A 3EDXB 3LDXH 1GBKA 3V13A 3M5OA 1KSNA 1KIGH 2P3TB 1HV7A 2FOCA 1GDUA 3RC4A 1V2WT 3RXJA 1ETRH 1H9LB 3Q3YA 1PPZA 4I32A 3TK6A 4FUBA 1RIWC 2ZO3H 4IMZA 3A88A 4UDWH 3BSQA 4WJG2 5A09A 1ZPZA 2Z3DA 1QCPA 2CHAC 1AZ8A 3VXFH 5EQSA 3QWCH 4F4OC 1TOMH 1FY1A 2H5DA 5LPFA 2BD7A 1PPFE 1QJ1B 4JK6A 2XTTB 1MQ6A 3W94A 3QX5H 1GBHA 1SGCA 1SGEE 1GMDF 1NRQH 1BBRK 4NCYA 1Y3XA 1KLIH 5FPSA 4DG4A 2TIOA 2STAE 2AMQA 1C5WB 3LJOA 1KLJH 1DT2A 2BXUH 3KCGH 1G32B 1QBOA 4LK4A 4DJZB 1JWTA 4YO9A 1C2JA 3UNRA 4AFQA 3EGKH 4X8VH 3K65B 1SG8B 3SJ8A 1Q3XA 4M7GA 1Z6JH 1WQSA 3S9BA 1ETTH 1QTFA 5HM2A 3BTEE 1A0JA 5E2OA 1CVWH 1GI6A 3NUMA 3PO1C 5CMXH 4BAKB 4CHAB 1CQQA 3VGCB 4HTCH 4CRDA 4FVBA 5C1XA 1QR3E 2V6NA 3RXTA 1N8OB 1WV7H 1YCPH 1RS0A 3RXAA 3LC5A 1FAKH 2UWLA 1LVOA 5A0AE 1TQ0B 3M3TA 1H8DH 2QYIA 1OWHA 3VB6A 5EU8A 4FUJA 1WSSH 3P8NA 3QZRA 2JETC 1T31A 1EX3A 5LPRA 1EZXC 1G2LA 1O2LA 4JZFH 2KAIA 4CRCA 5C2ZA 4RN6A 1RXPA 2OBQA 1TNKA 3SV7A 1V2UT 4GPGA 1P2MA 1V3XA 1GI1A 3RC6A 2BOHB 2Z9LA 4U01A 4KGAA 2HPPH 2OLGA 1N6YA 4NGAH 4ZMAH 3QUMP 1XX9A 2A2XH 4K69A 5JDUB 4RSPA 2G81E 1GJ4H 1DY9A 4BTUB 1OS8A 3SHAH 2PHBA 2ZIQH 3GYLB 5SGAE 3GY7A 1QA7A 2AERH 3FFGA 4NSYA 1L0ZA 2DE8A 3PMBB 5DP7A 1GBEA 2ALVA 2ANYA 3SHCH 1T8LA 1C1WH 1NTPA 2QXHA 3A8BA 2BD3A 4JZ1A 2WV4A 3PROA 3MNSA 1WOFA 1RFNA 2A0QB 1GG6B 4KP0A 3T5FH 3BTFE 3T62A 5L30H 1RTLA 3NPSA 1NROH 3CENA 1BMLA 2Q6FA 1SR5C 4NG9H 1MD8A 3BG8A 1GGDC 5BRRE 1BMMH 2ZA5A 1BCUH 2XNIA 1XXFA 4DW2U 1SSXA 2BD5A 1K1MA 1MQ5A 1CGJE 1EQ9A 1ZOMA 4NA9H 5L6NH 1LHDH 2XC4A 2B0FA 1EKBB 6ESTA 1UTPA 2A7HA 1MTSA 3H7TA 4XBDA 3TITA 5E0HA 3BEFB 4YOGA 3OY6U 2C3SA 1ESAA 1S6FA 5I46H 1BUIA 1JBUH 3T29A 1IQJA 1GHVH 5T6GA 3ATKA 2A4GA 3F9HA 1W11U 3NKKA 4I33A 1EASA 1NRSH 1BA8B 2A4OA 5JBTA 2ANMH 4NFEA 2FIRH 4X2VA 3U8OH 5AVDA 2WUCA 1HGTH 1ELCA 3D62A 2BVSH 3P92A 3ZZBA 4IN2A 4ZHMU 1AE5A 1GBBA 2TGDA 2C4FH 2BVXH 2BXTH 1S85A 3PYHA 1E0FD 4VGCC 3KEEA 1QFKH 4MNVA 1SLXB 1JOUB 1DUEA 3QGJA 4JZEH 4DURA 3EAJA 3QN7A 1UK2A 1D4PB 1UTQA 3A81A 2H9HA 1DWDH 1ELGA 1KYNA 2WYJA 2CMYA 2XWAA 1EB2A 4NIXA 4ESTE 4INHA 3RP2A 1XUFA 4WY3A 1QB1A 5DO4H 3ZZ7A 1CT4E 1ELVA 1LPZB 1TPAE 4R0IA 2Y6TA 2GKVE 3U98H 3UR9A 3S9AA 2ZGHA 1H1BA 1UK4A 5JB9S 1Z8GA 2CF8H 3RXRA 2QXGA 1TAWA 1TWXB 1C9TA 3OX7U 4GLYA 2A5AA 2GCTB 1GI0A 2GZ7A 1L1JA 1V2ST 2Z7FE 2H2ZA 1P2OA 3V12A 3UREA 1HFDA 2ZHDA 4LOYH 1PQ8A 3SORA 4DY7B 1TX6A 1HAVB 2ODYB 1P9SA 1V2QT 7LPRA 1TPOA 1GI8B 1GI7B 2PWXA 4NFFA 1T4VH 2FWWA 4Z0KA 1K1OA 1Y3WA 3QDZB 5A8ZA 2QCYA 1H9IE 2WYGA 2BY8X 3RXQA 2AS9A 4UEHH 5A8XA 5GPIB 2UWOA 3H5CB 1Z8RA 4SGBE 3OY5U 2QA9E 1YPKH 2GTBA 5EG4A 1TX8A 1DOJA 3M7QA 8KME2 2Y5FA 3UY9A 4WH6A 4AG1A 2VIVA 3C27B 1SHHB 4ASHA 1IQFA 1HBTH 3OU0A 3E90B 4MPUA 2OC0A 4ZHLU 1ZSKA 2SGEE 4A6LA 4ABHA 3BEUA 1ZLRA 3KN2A 2VIPA 1LDTT 2ZGXH 3A7TA 1W3CA 2SGQE 1P2JA 5GCHF 2YNBA 3ZVEA 4JZIA 2G51A 5AFZH 1GWAA 1Y3YA 3ELAH 3BTHE 1SI5H 1A3BH 1TGNA 1O3PB 3Q3XA 1C9PA 3LONA 1ETSH 1ESTA 4WMDA 1MKWK 2V3HH 6CHAB 1FIZA 1O3KA 1HB0B 3CP7A 3RMLH 2ASUB 1EJMA 1K21H 2FS8A 3KF2A 3BTTE 1N1LA 3M7UA 1O2RA 2GMTC 2A5KA 3LH1A 1IQKA 3M5LA 2AGIX 3HKIB 3W95A 4FUCA 1RIWB 1HAGE 3FAOA 1INCA 2JKHA 2VVCA 4GVUA 1QL8A 1V2MT 2J4IA 2ZFRH 1T8MA 1D3TB 4ZXYH 1WUNH 5FHTA 1SVPA 4PROA 3QGNB 4O9VA 1WBGB 3UWIA 2G00A 3GYMA 1T4UH 1LHCH 2FODA 2FZZA 4IC5A 1O2GH 3MTYA 2GT8A 1NRPH 4AZ2B 1KXDA 1L4ZA 2VIQA 2P94A 1P12E 1O37A 1IOEA 4WWYA 4JYTA 1SLWB 1PPCE 1P06A 1OXGA 3RXPA 2OC7A 1V2OT 3SOSA 3BTME 4YM9A 1FN8A 3ENSB 4Y79A 4AB9A 3VB4A 1FLEE 3GCHC 1BMNH 3HGPA 1BHXF 1TFXA 1EP5A 1KY9A 2WPHS 4GCHG 4GUXA 3BIUH 2NU1E 3PO1B 2Z3EA 1KXEA 1CT2E 3M7TA 3V0XA 1HJ9A 1TMUH 4NIVA 1CGIE 3EA8A 2Y81A 4E05H 3SU3A 1Z1JA 3A84A 4I8KA 2BZAA 1LCYA 1AUJA 3EYDA 6LPRA 1TIOA 2Y80A 4XDEA 4ISHH 1C2GA 1GBFA 4ABEA 1BTYA 4INKA 1KTTB 2ZPSA 2JH5D 4H42U 3SNCA 4WXVA 5DK1A 1FY4A 3MOCA 3NCLA 4JCNA 1TLDA 2D1JA 2FLBH 2JETB 4LXBH 1O5BB 1VJ9U 1LTOA 1H8IH 2ZPQA 1HDTH 1WQVH 1O3OA 2FOMB 4ZKOU 4TY6A 1Z8JB 4I31A 1S0RA 3ATMA 3SI4H 3KQBA 1AKSA 4KTUA 2P3UB 4WMEA 3RXMA 3MH5A 5BPEA 5JBAS 2UUJB 1FNIA 2UUKB 1QRZA 2ZEBA 1SL3A 2Y5HA 3UNSA 1V2JT 2KAIB 1ID5H 4ZKRU 3CS7A 1GMCG 1W10U 1A3EH 1GJ5H 3P8FA 3MU1A 4CRAA 1C1UH 1TNHA 3A8CA 3GDSA 3SQEE 3DT0H 1E35B 2C8WB 3O8CA 4BAHB 2OQ5A 4ISNA 1HPGA 3MU4A 1PJPA 4J2YB 2ZI2H 1BJUA 2PTNA 1HAVA 3DD2H 1O39A 3O8BA 5T6FA 1BTHH 1V2PT 1O3LA 4BNRA 2CGAA 2O8MA 2OC8A 5I25A 2EA3A 1AI8H 1O3AA 2QXJA 1TABE 2ZF0H 1HJ8A 3ZVBA 6GCHF 2ODQA 2ZFQH 2XC5A 2W3KA 1NC6A 4YOIA 2ZQ1A 1V2RT 4JZDH 3P17H 4FUEA 2J9NA 4OS1A 3VB7A 8GCHG 4K1EA 5JYIA 1FPHH 4MNXA 1K1NA 2XYAA 4MNWA 2A2QH 2BM2A 2FEQH 1K1PA 1GGDB 4AGJA 2GVFA 1FXYA 2ZPRA 1N6XA 4NSVA 2EI6A 3FP7E 2UUYA 1Y3UA 4X1RU 1VITH 5L2YH 2I6SA 1FDPA 4CR9A 1GHXH 3JZ1B 5F6MA 1ANBA 1NFYA 3PTNA 2IN2A 1YCPK 2ZTZA 1KLTA 2BDIA 4X6OA 2FDAA 1MTWA 1UCYE 1IQMA 1KDQA 2AIQA 2G55A 8LPRA 5E0GA 5AFYH 2BQ6B 1OSSA 4B2BA 1YPHC 1HLTH 4K8YA 1V2NT 2GGVB 1UTNA 4I8GA 1C2KA 5CE1A 3SI3H 2UWPA 1F0SA 3T26A 1F5LA 4BXWA 2A7CA 2A4QA 2IJOB 4YT6H 3K6ZA 3DFLA 4K8BA 1GBIA 2YOLA 1NU7B 3VXEH 3EQ0H 3M36A 1Z7KA 2Y5GA 2FX4A 2VGCC 3I29A 1BDAA 4VGCB 1QL7A 2BDGA 2IOTA 3MH6A 5L2ZH 3V3MA 1BRCE 2HPQH 5TCAA 4MDSA 1UTMA 2P8OC 1GJ8B 4QT8C 1CBWC 1BZXE 2BHGA 4CREA 3STIA 1TGCA 2BD4A 2PV9B 1YYY1 2BD9A 2OC1A 1P2IA 2F9BH 2FOGA 5B6OA 4GSOA 3T28A 1CT0E 2JH6D 3TH4H 1AQ7A 2BLQA 1P04A 2HRVA 4NA8A 1O33A 1T32A 1W2KH 1XUGA 3A7XA 2PSYA 2ZTXA 3RXBA 3GY8A 3F6UH 4Y6DA 4NIYA 1HYLA 2O8UA 1O2UA 2FO9A 1QURH 3HK3B 4JK5A 4FXGH 4FUGA 4NZQA 1F0TA 5DJ7A 1BTPA 2CXVA 1K28D 4Y7BA 3MO6A 1MCTA 4A5TS 3RXFA 5IDKA 2JH0D 1GBDA 3PLKA 2I6QA 2GZ8A 1O2NA 1EUFA 2TPIZ 2J92A 1AO5A 2O8LA 3TNTA 2P93A 4E06H 2R9PA 1NT1A 5F8XA 3UPEA 1UK3A 4OS4A 1ELTA 2G4UA 3ZVGA 1GCTC 1XVOA 1BMAA 3TVJB 2EI8A 2VVUA 3MO3A 1G3BA 3UOUA 1O2HA 5FBEA 4D9QA 2H9EH 3P6ZB 1K22H 1GBTA 1PQ7A