1E35B

Porcine pancreatic elastase complexed with (3s, 4s)n-para-toluenesulphonyl -3-ethyl-4-(carboxylic acid)pyrrolidin-2-one soaked in ph 9 buffer for two minutes
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE
publication title 'Ph-Jump' Crystallographic Analyses of Gamma-Lactam-Porcine Pancreatic Elastase Complexes
pubmed doi rcsb
molecule tags Hydrolase(serine protease)
total genus 59
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2000-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1e35B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1e35B01
2ZU5A 1TA2A 3MNCA 5AHGH 1B0FA 1RTKA 1SGRE 3PTNA 1UTLM 4UFEH 1GHXH 1C1PA 2QXGA 5HGGA 4MPUA 1CSOE 4RKJB 4INHA 1KLIH 2ZCKP 3LC5A 1ANDA 5CE1A 1HV7A 1BHXF 1DWCH 1C5SA 1GHAG 2SGAA 4RN6A 3PM3A 1O2OA 1ETTH 3TVJB 1C1QA 1P2MA 4CRDA 3BEIB 2SNWA 2ZFPH 1M9UA 3FAOA 1QHRB 2WPJS 1N8OC 3U9AH 1Y3UA 1TNHA 5EPNA 3ZZ4A 1LPGB 1E37B 2ODPA 1EPTC 2AMDA 2D2DA 3ATIA 1Y3YA 4LZ1H 5F6MA 1RXPA 2FEQH 1DFPA 1JBUH 2FTLE 5T6DA 1WSSH 2F3CE 4X1PU 2CV3A 4B74A 1XVOA 2B0FA 2NU0E 5DJ7A 1H8DH 3VEQB 3GY8A 1V2KT 1C5OH 2Y5GA 1GCTB 2XBYA 2OC1A 5CHAB 1PQAA 4NGAH 1HPGA 1VR1H 1YF4A 1O38A 2P3FH 3IITA 4JZ1A 1HXEH 3EA9A 1KDQB 1UK4A 5FX6A 1QQUA 4X8UH 1NFXA 2ZQ2A 1DITH 1O3GA 2PKAB 3MU8A 3LGTA 1O3MA 1SPJA 1SGFG 2FOBA 5GXPA 3L33A 2FWWA 5EGMA 3ATLA 4X1QU 2VIOA 3ZZ9A 3QO6A 3ATMA 2QYIA 3SJOA 2I6SA 1NT1A 3RXRA 1C1SA 1HAXB 3OY5U 4KKDA 5DO4H 1ANEA 1O2PA 3KQCA 2ANYA 1GG6C 3MHWU 1LDTT 3E3TA 2UUFB 1GBAA 2FTMA 3D49H 4YM9A 3S69A 4DCDA 4D76A 5E2OA 5DP5A 1EX3A 1W7GH 3BTME 4YLUA 4BNRA 4I8GA 3ZVDA 2R3UA 1EOJA 2XYAA 1AHTH 2GZ7A 2QIQA 2BTCE 1YP9A 3E90B 4AFUA 2BY5X 3F6UH 3NCLA 4IC5A 5SGAE 3O8RA 3NPSA 4CBOA 2AGIX 1CA0B 3ZZ8A 1GI7B 1O2WA 5DP7A 4D9QA 1TGBA 3FP7E 1SGPE 3D23A 3RXCA 2WPLS 2BLWA 2ZDKA 3VGCB 2Z9JA 4X2WA 2Z9GA 3PMJA 5DPAA 1ZRBA 3QGJA 1G2MA 3ZVCA 2DUCA 2ZCLP 3MU4A 3OU0A 3U69H 1P8VC 1ANBA 4GPGA 1VITF 1C2FA 2P3UB 4X2YA 4A6LA 1SGTA 1THRH 5L6NH 1MQ5A 3U98H 1QJ6B 3W94A 1GI4A 1OWHA 1YYY1 2AIPA 4TWYA 2PUQH 1O5FH 2ZDAH 4GAWA 1OWDA 1TAWA 3M5LA 2ZI2H 1TONA 3SQEE 3LC3A 3BTQE 1P11E 2UUYA 1C5MD 1EJAA 1NC6A 1F2SE 3H7TA 2VGCB 2QF0A 4K2YA 4NFEA 5F8TA 3TITA 3AAVA 3TK6A 2ZA5A 2TGPZ 3Q3XA 5A0CA 1XUJA 4JYTA 4ZKOU 3NUMA 1BA8B 3MU0A 5F8ZA 2ANKH 4CHAC 2FIRH 2PTCE 1GDUA 1C1NA 3UQVA 2C8YB 3RMLH 3A7TA 2PW8H 3SGBE 1SBWA 3V0XA 3FANA 4DG4A 3EYDA 4LOYH 1O2RA 3E91A 2AGGX 3H5CB 2W26A 2XWBI 1O5GH 1P3EA 1THPB 4ZAEA 1FUJA 4JZEH 3BTFE 2QV1A 5HYOA 1UTOA 2EI7A 1P01A 3GOVB 1Z7KA 5FBEA 1OPHB 1VJAU 2DE9A 4DURA 3RLYH 1O5CB 1T31A 2B7DH 4BAOB 2TBSA 1DWBH 4U01A 2WPMS 1JXPA 1TPPA 3STJA 3ODDA 3SU1A 1O2VA 1L1GA 3GCTF 3GY5A 4ESTE 1K1PA 3HK6B 1EAUA 3U8RH 1KXAA 2ZU4A 1G37A 3SV8A 3A7YA 3A8DA 1TBZH 3C27B 1NS3A 3MNSA 2HPQH 1SOTA 1QY6A 2WPHS 3TGJE 3RC4A 3T29A 4O03A 3KCGH 2V35A 1AZ8A 1MKWK 1J8AA 1TX6A 1GHBF 1LHFH 2ZHWH 4SGBE 1VITG 1W14U 1AN1E 5C1XA 1G2LA 1G3CA 1AB9B 3RXBA 1C5UA 1EATA 1KDQA 1DPOA 2A2XH 3BTEE 4R8TB 3RMOH 2R0LA 2VWNA 2PKAA 3GYMA 1LMWB 4MNVA 1Y3XA 1P9SA 1H8IH 1XM1A 2GV7A 1CU1A 1CBWB 1K9OE 2GVFA 5ABWA 1GBIA 2H5DA 4ISIH 1DDJA 1SGIB 4U2WA 4CRFA 4BTUB 1ELEE 4E7NA 2BM2A 3BV9B 1SGFA 5EQSA 1HAYB 1T8OA 2ZPQA 5DP4A 1NRRH 2WYGA 1TPOA 3U8TH 1A1RA 4BXWA 4XBDA 5BRRE 5L2YH 3BTTE 3I78A 4MNXA 1ELAA 1UTJA 2GDDA 2XCFA 1RTFB 2GX4A 3A7VA 3GCHB 4U32A 5E0GA 3SO3A 1A7SA 4TPYA 4WJG2 3I77A 4GHQA 2F9NA 3LDXH 1ABIH 3PLPA 4OGYA 2A4RA 4MLFB 1DS2E 3K6ZA 4AGKA 1MKWH 3T5FH 3VB5A 4BOHA 1GPZA 1ZHRA 1AFEH 4TY7A 1Q2WA 1S6HA 2G52A 5EXLA 4IN1A 1C1UH 2ZGXH 3CP7A 1ZLRA 2V3HH 3E16B 2SGEE 4IGDA 3RXTA 1BRUP 1N6YA 3IWMA 2BQ6B 1K22H 2HGTH 2F9UA 2ZHDA 3L3TA 4K60A 3GCTG 1UCYE 1GBJA 2QXJA 4XBCA 1ELBA 2C3SA 2PGBB 1YPGH 3PROA 1H9LB 1AD8H 1D9IA 4YESB 2P8OC 1H1BA 1KXBA 1G3BA 4IMQA 1V2NT 1G30B 5CHAC 4MNYA 1C5PA 1NESE 4UFFH 4YOIA 4DOQA 1EAXA 1V2VT 2OC0A 5E2PA 2ZGCA 3T27A 4WVPE 1GHBG 1C1RA 1KYNA 3B9FH 5A0BA 1XVMA 2XXLA 4UD9H 4IC6A 1F5RA 3FP8E 2STBE 1T4UH 1V2QT 1C4V2 3A82A 2BX4A 2R2MB 1OYQA 1A4WH 2ZFFH 3UOUA 1O3NA 1FPCH 2HNTC 2RCEA 4D8NA 5T6GA 1C9PA 2ULLA 4XE4A 2HPPH 5E0JA 3BTDE 4ZKNU 1NRPH 3A8BA 4BXSA 5FAHA 5DP3A 1GHYH 3HKJB 1ETRH 5AFYH 1HFDA 2PSYA 2PUXB 3GCOA 5B6OA 1TPAE 1IQGA 1AVGH 2AYWA 3BSQA 2W7SA 1LKAA 2M5TA 3VPKA 3MOCA 4CREA 5JB9S 4I8JA 3ATWA 4NIVA 4ABHA 1EJMA 2QGRA 4UEHH 2TGAA 1CT0E 3MI4A 3VB6A 3MH4A 5L2ZH 2A4GA 1V2UT 3A7XA 1E38B 5DG6A 1GVZA 1HAHH 2CHAB 4AFSA 3GDUA 2RDLA 4B75A 3KQBA 2BYAX 3NWUA 1YPLH 3R0FA 1TX7A 1A3BH 2J92A 3KL6A 3RDZA 2FO9A 2UWPA 1DXWA 2A1DB 1SFQB 2G55A 2W3KA 2PKSC 3VGCC 4ISNA 2RG3A 2ZECA 4ABDA 1YPHC 1Y3VA 1SLUB 1FLEE 1P57B 3P92A 2A2QH 2ZHQH 1H9IE 4O97A 2H6MA 2Y81A 1UVSH 3M3TA 1DX5M 2PWXA 3GICB 3M5MA 2BX3A 4YLQH 1BMAA 1BBRE 1V2MT 1W11U 3QZRA 2XBXA 5TJXA 4HTCH 1YCPM 3SU2A 2BXUH 1MKXK 2TGDA 5IYTA 1ESAA 1PFXC 3SV7A 1C1TA 4AB8A 1O3DA 2AMPA 1G3DA 3O8DA 4PROA 4Y76A 3LH1A 4NIXA 3ZVBA 4HGCA 3ZZ7A 1TIOA 4NSYA 1TWXB 1XMNB 3VB4A 2ILNA 2AERH 5BPEA 1E35B 2R2WU 3SUFA 1GBMA 3SV9A 5J4SA 1L4ZA 1TFXA 2P95A 3Q00A 1IQHA 1GJCB 4UONA 3Q76A 1FY1A 1LQEA 2ZF0H 1RRKA 4HI3A 1NROH 4KTCA 1C2JA 3LU9B 1VGCB 1QR3E 4JCNA 3AW1A 1UVTH 1P03A 1S5SA 1A0JA 2ZO3H 5FXLA 4H6SB 3TPIZ 3UR6A 3ZYDA 4Y10E 1K28D 2PTNA 1HRTH 1Q31A 1A2CH 1C2DA 1O3IA 4FUEA 1GJBB 1Y8TA 1FY4A 3V13A 4NFFA 1ZMJA 2AMQA 1QL8A 1HAOH 1OXGA 2ZPSA 1FJSA 1QA0A 2G5NA 5C2ZA 4IBLH 1MKXH 4ABJA 1G36A 3KQEA 2A7CA 1E0FD 1CGIE 4BAQB 1S0QA 4ZHAA 1KXCA 3RC5A 1EXFA 4I8KA 1FNIA 5FHTA 3F9GA 1Z8JB 1UTNA 2CGAA 2BY7X 1XKAC 1GBDA 1V2OT 1SQOA 1GBFA 5C20A 1QB6A 1GVKB 2Y7ZA 3V3MA 5DK1A 3SOSA 1SL3A 1QNJA 2BZAA 4IW4E 1HJAB 1WUNH 1MAYA 5DP8A 2THFB 2OXSA 3BEFB 1C5TA 4LXBH 1RFNA 1JWTA 3KGPA 2OLGA 4WXIA 1QTFA 4LK4A 3LT3A 3QTOH 1ZPBA 3MMGA 1WCZA 3RMMH 5CMXH 2A5IA 1J17T 1SLXB 2BXTH 2Y7XA 3PO1B 1UHBB 2QC2A 1CBWC 1XUGA 3TJUA 4AB9A 2G5VA 2HNTF 2BDYA 2FS9A 2GP9B 1ZMNA 1DANH 1UMAH 1GGDC 3KQDA 1CE5A 3SHAH 3RU4E 1S81A 1P02A 1XUIA 2IOTA 2R0KA 1GBBA 5EW2H 2B8OH 4INKA 3RXLA 4Q7XA 1AI8H 2ANWA 2BOHB 3K2UA 2CF8H 1OSSA 1YBWA 3SNAA 3SUEA 1DY9A 1GMDF 1ABJH 3SU4A 3BG8A 3UQOA 3QX5H 2VVUA 3RMNH 4KELA 4XOJA 1O3BA 2ZEBA 3ATKA 3OY6U 2F9BH 1ZRKA 1YLDA 1AFQB 1ZTLA 1G32B 2O9QA 1NPMA 1WYKA 4WMFA 3RLWH 2W5EA 3MNBA 2ZDVH 2BVSH 3GY2A 3GY7A 2GKVE 1TGTA 1NRSH 2ESTE 1SR5C 2SGQE 1B7XB 1CGHA 3MO6A 1QRWA 3LIWA 1LHCH 3FZDA 2WV5A 4NIWA 3O8CA 4I7YH 1FN8A 2FLRH 3TH4H 1O3FA 2OBQA 4X6MA 3ZZ3A 3M61U 2ZCHP 5ESBA 1O33A 1S83A 4XSKU 4KTUA 1TOCB 1TX8A 4MG3A 3DFJA 2FOFA 2Y5HA 1ID5H 1ESBA 1WTHD 4CRAA 1UK2A 5FX5A 1Z6EA 2ZDMA 1KXDA 4Y7AA 1FXYA 1NU7B 5C67A 1A0HB 1QRXA 1VCQA 1WBGB 1GJ7B 2ZU3A 2OINA 1CHOF 1SB1H 2ZP0H 4IN2A 1UTPA 5HMAA 1FDPA 2C93B 4TYDA 3P17H 4OS4A 1BRAA 4FXGH 5C1UA 3O8BA 2R9PA 1NRNH 3T2NA 1V3XA 1AWFH 1GCDA 2TIOA 2O8MA 2PFEA 1MZDA 1EZUC 2BZ6H 1MMJN 1TPSA 1O2LA 2GDEH 2AGEX 1AVWA 3UNRA 3RXSA 5GDSH 5DGJA 4M7GA 3EAJA 2G4TA 1CVWH 1MH0A 1RIWB 1GMDG 1AIXH 4I8LA 6LPRA 1C5ZB 4TY6A 4A7IB 2CHAC 2FMJA 2FS8A 1O36A 1T4VH 3T28A 2J94A 1V2WT 3VFEA 5LH8A 1O3EA 3ITIA 3VB3A 1MTUA 1BHXB 4GHTA 5LGOA 5G4BA 1GBEA 1EJNA 1X7AC 3NZIA 1O2XA 1CO7E 2A4QA 1DICA 3Q77A 4MPVA 1NO9H 1TGNA 3M35A 2ZDLA 5H4IB 1O2ZA 3LPRA 1BJUA 1OS8A 3RXQA 1BTZA 1D6WA 2ZDNA 4O9VA 4X1RU 3TJOA 1WV7H 1TQ0B 2ALVA 1BMNH 2FI4E 1IQLA 1K1OA 1O3OA 1BTWA 1QFKH 3GY6A 5EG4A 2NU2E 3SU0A 1EKBB 1S6FA 2BDCA 2LPRA 2YNBA 3MFJA 3PB1E 4INLA 4Y0ZE 5T3HA 1UHBA 4DIHH 2FOMB 3MYWA 4H6TA 4IS5A 3S0NA 1LVYA 5GCHF 2AH4X 1MUEB 1V6DA 3GY4A 1GJDB 1JRSA 2BD4A 4X1SU 1LTOA 1CHOG 4MTBA 2BD5A 1BB0B 1VGCC 1P12E 3F68H 7ESTE 2Z7FE 4I8HA 3HPTB 1ZTKA 1BZXE 1Z1IA 2XCNA 3SJ8A 1HAIH 1HJ9A 3A83A 3MNXA 2ZNKH 2ZG0H 4U30A 1D3QB 2GV6A 2OP9A 2CMYA 4X0WU 4B71A 1EP5A 1BJVA 1LHEH 3CENA 1E34B 2J9NA 1W12U 2UUJB 1DVAH 1IQIA 3M7UA 2GMTC 1C1WH 4JZDH 5GIBA 3RXJA 1QJ7B 1FIZA 1GI8B 1FY5A 4Y7BA 1JRTA 2OUAA 3NXPA 1RGQA 1FAKH 1TNIA 2FYQA 2FI5E 1HAZB 1C2GA 5JB8S 1BCUH 2Z9LA 3MTYA 5AF9H 3LKWA 3P95A 1A61H 1GL0E 1ELDE 1C5VA 2C4FH 1LVMA 1EAWA 1EB1H 1MD8A 1ZGIA 1ZPZA 2ANMH 3SNEA 1FONA 2Z9IA 1ZMLA 2JKHA 5K7RA 3S9AA 2BDGA 1C2KA 1O3PB 2Z3CA 4AOQA 1D3DB 1O31A 3MO3A 3SGAE 2GD4B 1HLTH 2A32A 2ASUB 1S85A 2W3IA 1SFIA 1LVOA 3OX7U 1ETSH 1K21H 2FESH 1FIWA 1SHYA 2Q6FA 2AIQA 4BAKB 1C2EA 1NM6A 3F9FA 5A8ZA 4D9RA 4ABBA 1XUKA 2H2ZA 3ZV8A 2C8WB 3ESTA 1C1VH 3HGPA 3Q3YA 3RM2H 1TB6H 1TOMH 3JZ2B 4Z0KA 1ZJKA 1KSNA 4CRBA 2XC4A 3BTHE 3BG4B 1UCYK 2B5TB 2BDBA 5GCHG 1W2KH 4JZFH 1EP6A 4NA8A 4J2YB 5EXNA 5A0AE 2G81E 2ZHEH 3AASA 3LH3A 4ZKSU 4FUJA 1NFWA 1EUFA 4ABFA 1NY22 1C5YB 1E36B 2RA0A 2YOLA 1FV9A 2JH0D 2OCVB 4Y71A 4WF8A 3R3GB 3D62A 1PYTD 3SU6A 4NIYA 1CA8B 1GI6A 3E1XB 3GYLB 6GCHF 2FPZA 1KXFA 3NK8A 8LPRA 2OTVA 3U1JB 3MO9A 4K3JA 4BANB 1J15A 2AFQB 2CJIA 1EQ9A 2D1JA 1C2LA 2V0BA 1INCA 1PPGE 3WY8A 2O8TA 1SGCA 3DA9B 2QN5T 3UOPA 2ZU2A 1MU8B 2OC8A 1LO6A 4ZHLU 4JYUH 1UVPA 2XBWA 2Z6BD 1TLDA 3I29A 1EZXC 2FODA 1MAXA 1C5WB 1TE0A 2BDAA 3RC6A 1T8MA 1U6QA 4AG1A 4TPIZ 1N8OB 3RM0H 1QCPA 3M7QA 2J2UA 2CF9H 1GCTC 1PPFE 2QY0B 1ZHMA 2OC7A 1UCYH 1EPTB 2TPIZ 3TH2H 3GISB 1VCPA 4CH2B 4K8YA 2HALA 1RJXB 3BTKE 4KP0A 1O3CA 5HXFA 4I32A 4H4FA 5A2MH 4GSOA 2EC9H 2HNTE 1O35A 4ISHH 1F0RA 2OQUA 3ZVFA 1A5IA 1TBRH 1DM4B 2HVXA 4FU8A 3PTBA 2A7HA 3QWCH 4JK5A 3FFGA 1RS0A 4ZUHA 1ORFA 3A80A 2NU3E 3DFLA 4Y8ZA 3V7TA 1N1LA 1P3CA 2GZ9A 2PSXA 4ISOA 2QA9E 4FU9A 1BMMH 2H9TH 3V12A 1HUTH 3LJJA 2FX6A 3PWCA 1BBRK 1KIGH 3P8FA 1V2RT 3VXEH 2ODQA 1GG6B 3A84A 5DKMA 3LGUA 1HXFH 1AU8A 4AFZA 1GL1A 3BTGE 4OS2A 3S7HB 3MU1A 1QL9A 5FCKA 1UTKA 1C4Y2 1HDTH 2Y82A 2A4OA 6GCHG 3H7OA 4DGJA 1GI0A 4DVAU 4YOGA 5EOKA 1D6RA 1YPHE 7LPRA 1CA0C 1KXEA 2VVVA 3PMHB 3ZV9A 2FYRA 7GCHF 1EOLA 5JYIA 4Y11E 1QQ4A 5DP6A 4SGAE 1QJ1B 4F49A 1W13U 1ZGVA 1TNJA 2F83A 2AEIH 3UUZA 1N6XA 1XXFA 1OX1A 1T8LA 1BTYA 1Y59T 1HIAB 1P2IA 3M37A 4OS7A 1XX9A 4CRGA 1GI2A 4ZKRU 3P6ZB 1V2ST 1D3PB 1GBTA 3GY3A 3M5OA 1QB1A 5EQQA 4CR9A 1P05A 3ZVGA 3DD2H 2PHBA 1NFUA 4NZQA 5F8XA 4BAMB 2RA3A 1P9UA 2VIDA 1LKBA 3SNDA 1BBRH 4GVUA 2VIVA 1L2EA 4YO9A 1BTPA 4ABEA 1HAPH 5IDKA 3NKKA 4CH8B 1IQJA 2BY6X 3QGNB 2A5AA 1MTWA 2VGCC 2BVRH 4A5TS 1LPKB 3PWBA 5FPYA 1L1NA 1O2SA 2BD9A 1PQ7A 1GJ9B 2ZIQH 5AFZH 3UWIA 2G4UA 3TNSA 2JH6D 1ELVA 1P2KA 1SGQE 3RXPA 1SVPA 2HRVA 4FUCA 1GBHA 3A85A 1GWAA 5LPEA 1GMHF 1O2TA 2EEKA 2G51A 1DT2A 4NCYA 3A7ZA 4CBNA 3E6PH 1ZSJA 2B9LA 2WPIS 2PV9B 2XC0A 2ZGBH 3T25A 1HAVB 4A1VA 2UUKB 1LVBA 4CHAB 1DLKB 3ELAH 1SG8B 4CR5A 4YOJA 1FN6A 3P70B 1OP2A 3RXKA 3D65E 3RXIA 1SOZA 3TK5A 4MQAA 1HBTH 1OWKA 3P8OA 2O8UA 1QGFA 4Y6DA 1OWJA 1GVLA 2Y80A 1D4PB 2FOAA 1A5GH 3BEUA 1ZOMA 8KME2 2VU8E 1YPEH 1SGYE 3UTUH 7GCHG 1O32A 1VJ9U 4NZLA 2H1UA 3MU5A 4K1EA 1BQYA 4FUDA 1HYLA 1O5DH 4B1TA 3UPEA 2FDAA 1DE7H 1HAGE 1JIRA 1CT2E 1XKBC 4I31A 1VITH 5C5OA 2ZGHA 2GCHF 1BTUA 5EU8A 1SQTA 1QRZA 3B23B 4UFGH 9ESTA 1SHHB 2NU4E 1EPTA 2HLCA 4Q7ZA 5JDUB 3KN2A 1TGSZ 1AB9C 1AY6H 2EI8A 1SQAA 5GJ4B 1SI5H 1HJ8A 3OYPA 1CT4E 4E05H 5TCCA 4ISLA 1YM0A 4DT7B 1O37A 4ZXYH 1EAIA 3Q3KA 1TQ7B 1BIOA 1KLJH 4O3UA 1K1NA 3BN9A 2WYJA 4THNH 3UY9A 1Z1JA 4AORA 3U1IB 1GBKA 3SZNA 4DY7B 3A86A 3T62A 2JH5D 3SORA 2ZPRA 2FOHA 4D7FA 4X8VH 3ZZ6A 1IQFA 2QAAA 4AGJA 1SLVB 1YC0A 1MTNB 2ZFRH 2F9OA 1DLEA 4ABIA 2FM2A 1OKXA 2G8TA 1P06A 4B2AA 1AWHB 1W0ZU 2YNAA 3TU7H 4AYVB 2XTTB 1P2JA 2Q6GA 1QIXB 1O0DH 1WU1A 3SW2B 1QURH 1Z6JH 3GCHC 1GMHG 1PPEE 1ESTA 1G9IE 2CN0H 1IAUA 2Z3DA 3A89A 2WUCA 1O2NA 5JPMH 1JMOH 2GT7A 4B2CA 2QXIA 1UTMA 3DT0H 1PYTC 2NWNA 1V2PT 1CQQA 1GJ6A 2JETB 2QF3A 3P8GA 2BQ7B 1LHDH 1SGEE 4FVBA 1VCWA 4FVDA 4A92A 1WQVH 3LOXA 3A81A 3UNSA 1HCGA 1MCTA 2IN2A 1A3EH 1AQ7A 1GHZA 1YPKH 4Q2KA 2J95A 4QT8C 4ABGA 5GWZA 3SHCH 1CGJE 4GLYA 2OD3B 1O2MA 1GI9B 2C8ZB 1SSXA 1GDQA 1HIAA 4MNWA 1O3KA 1C1MA 5FPSA 1D3TB 1GJ8B 1HNEE 2DE8A 3LGIA 2VH0A 1UJ1A 2PLXA 3QUMP 4E06H 2J38A 2WUBA 3SI4H 1PJPA 2GCHG 3ZZBA 1QB9A 1KTTB 2Z94A 1ZSKA 4VGCB 1TRMA 1TNLA 1TALA 2P8OB 1AKSB 1KY9A 3K65B 1EB2A 1IOEA 1GHVH 1O39A 1MBQA 3CS0A 1XXDA 1MCVA 4OS1A 1RD3B 1DOJA 1QBVH 2ZTXA 4X2XA 4FUGA 4RKOB 4CRCA 2VWOA 1OP0A 1C1OA 4AG2A 3OTJE 2WINI 5JBTA 6CHAB 1F7ZA 1O30A 1O34A 4OS5A 1Y3WA 2O8WA 3KIDU 3URDA 2BHGA 1C5QA 1GI1A 6ESTA 1F92A 1T8NA 3SUDA 3FZZA 3AW0A 1NU9A 3EE0B 3ZVAA 1YCPK 1HAVA 1IHTH 3MH6A 4MDSA 1SLWB 4K8BA 4ASHA 3JZ1B 5I46H 4ZMAH 2FOEA 3FVFB 1WOFA 1FAXA 1T7CA 2GT8A 1CHGA 2SNVA 3HK3B 1O2GH 2PR3A 2CXVA 1KTSB 1PPBH 2OQ5A 4F4OC 2O8LA 1EASA 1HB0B 3GCNA 1P0SH 4RSPA 3UNQA 5AVDA 1C5NH 3RXDA 2H9EH 1DXPA 1O3JA 1T32A 4NWLA 3U8OH 4JZIA 2GCTB 2J34A 1BMLA 3E8LA 1DSUA 2P59A 2ZTYA 1BT7A 1TA6A 1ACBE 1V2JT 1TNGA 4WXVA 3EDXB 2XNIA 3SQHE 1NRQH 3KHVA 1FY3A 1Z8GA 2PKSB 1WAYB 2BB4A 4AFQA 3UIRA 3MH7A 3SJIA 2BD8A 3HGNA 4ZH8A 3BIUH 1FQ3A 2XC5A 3SUGA 2ZU1A 2ALPA 4Y0YE 1ELTA 1YCPH 1YPMH 1AUJA 2Y5FA 3EA8A 4WMEA 1Z8RA 1ELCA 5EQRA 1NTPA 3LGWA 5EPYA 2BY8X 2F9VA 4BTIB 1UVOA 4UE7H 5JBBS 5A8YA 5E8EH 1AE5A 4DIIH 1P09A 1TRYA 1O5AB 3SN8A 4YZUA 4J1YA 2FLBH 4BTTB 1F0SA 1UVUH 3A8CA 1C9TA 1GMCF 1S0RA 4K1TA 2C90B 2F9PA 3KNXA 3STIA 3N7OA 5I25A 1W3CA 2BDHA 1NFYA 2BD7A 4X8TH 4WMDA 4YT6H 4GCHF 1DWEH 4H42U 4Q7YA 1AVXA 2VWLA 2TRMA 4Y8XA 1YGCH 2A7JA 2ZFTA 1QBOA 1O2JA 5LPFA 3TJVA 2BQWB 2OBOA 1GJAB 2VNTA 3M3SA 1Z8IB 1UTQA 4UDWH 2P94A 5ESTE 1ZSLA 3SJ9A 2ZWLH 2VJ1A 4B76A 1AZZA 1G3EA 1ZR0A 1IQKA 1GDNA 2D26C 8GCHF 2V6NA 3RXOA 1P2OA 1FMGA 1C2IA 1J14A 1L4DA 1LQDB 3SBKA 1A5HA 1AO5A 4XFQA 2NU1E 4AN7A 2GZ8A 3UWJH 1UO6A 1A0LA 3ZYEA 3EA7A 1S82A 1HJAC 1F5KU 2BDIA 1ZJDA 3SNCA 1K1JA 2ZTZA 4Y8YA 5C1YA 5JBAS 1ZYOA 2QXHA 2UWOA 3SNBA 3RXMA 3ODFA 1Y5UT 4FUFA 1PQ8A 4Q80A 4NSVA 1PPZA 3PLBA 3K9XB 3PMBB 2A31A 2WPKS 5HM2A 3F1SB 3S7KB 3F9HA 3B8JA 3S9CA 3TGIE 1AKSA 2BVXH 2Q1JA 4R0IA 3SV6A 1AE8H 4AX9H 1OWEA 3PO1C 1QA7A 1L1JA 1IHSH 2XW9A 3KEEA 3RXGA 4OGXA 1BITA 3ENSB 1BUIA 1Z71A 2J4IA 3SJKA 1HGTH 3RP2A 5T6FA 1MTNC 3QZQA 4Y79A 3G01A 5DP9A 1BTXA 3AAUA 1L0ZA 2I6QA 4AZ2B 5J4QA 4WY3A 1MBMA 1PPHE 1O3LA 1B0EA 5EXMA 4OS6A 2SGFE 3LGVA 2FI3E 1GGDB 4ABAA 1GJ4H 1GMCG 3ZZDA 3UR9A 3ZVEA 1ELFA 2KAIB 1BOQA 2HOBA 4GCHG 2JETC 3RU4D 4NA7A 1O2YA 2C8XB 1AFQC 1JIMA 1IQMA 2FX4A 1O2IA 2Y6TA 1THSH 3QN7A 4LZ4B 3A88A 3MWIU 1OWIA 2A45B 4FUHA 1V2LT 3QTVH 1B5GH 1RTLA 1ZHPA 2P3TB 3T26A 4NWKA 1BTHH 1ELGA 1K2I1 1DWDH 4HZHA 3DUXH 8GCHG 1GI5A 2BD3A 2BMGB 1TMTH 3F9EA 1FPHH 1MZAA 2ZHFH 1C5RA 1C5XB 3RUOA 5C5NA 1KLTA 2BLQA 1O3AA 4E7RG 1DSTA 4K1SA 4ZROA 2ZQ1A 1UK3A 1QBNA 3P8NA 1YLCA 5L30H 1F0TA 1OOKB 3M7TA 4JK6A 4VGCC 3GDSA 3SU3A 4KTSA 5FBIA 3SU5A 1ZTJA 1W10U 3FP6E 4WH8A 4XBBA 1TABE 1Y5BT 4MPWA 3ZZ5A 4ZXXH 1O2QA 1P2QA 3ZZCA 3TLOA 5GPIB 4IMZA 4X2VA 3TGKE 6CHAC 5A8XA 1FI8A 1FY8E 2EI6A 1C4U2 1Q3XA 1QL7A 2FOGA 1BRBE 1EZSC 1C2MA 1XUFA 2FP7B 4WH6A 1O3HA 1AGJA 2BLVA 1WTGH 2VVCA 7KMEH 1Y5AT 5PTPA 2LNCA 1RIWC 3SI3H 3HATH 3RXEA 1OP8A 4B2BA 2BLOA 1SGNE 3LGYA 5FPTA 2ZC9H 1LHGH 2XRCA 1WQSA 4JYVH 1ANCA 3M36A 1A46H 2H9HA 2UWLA 4TWWA 1TMUH 2VB0A 2Q6DA 1GHWH 5ETXA 1K1MA 1PPCE 1MU6B 3BTWE 1JOUB 1TNKA 2W7UA 2Z3EA 2VIQA 2GCTC 2QCYA 4WWYA 2ODYB 4X8SH 1TRNA 4K69A 2ZZUH 3UFAA 4K5ZA 1S84A 1MQ6A 3GDVA 5TCAA 1PQ5A 2IJOB 2ZGJA 3RXUA 3UREA 2F91A 1DUEA 3EGKH 4FUIA 4GUXA 5K0HA 2AS9A 1W0YH 3OSYA 1J9CH 3IG6B 3QLPH 1K1LA 1GBLA 1XUHA 1AUTC 2SFAA 1YKTA 3LJOA 3M3VA 3VXFH 3W95A 1P04A 3BIVH 1TMBH 2VH6A 5EODA 1K1IA 5HM9A 2K1QA 1P2NA 2H5CA 1NZQH 1MTSA 2GGVB 2IPHA 2BOKA 3RU4T 2FXRA 4NA9H 2FZZA 1J16A 2TGTA 2V3OH 3M5NA 2GTBA 1GJ5H 1IQEA 1VZQH 3VB7A 3L6PA 1ARCA 4I33A 2G00A 2A0QB 3PV4A 3C1KA 4JMYA 4DJZB 1O5EH 1TBQH 1MD7A 2Z9KA 1O2UA 4B73A 3S9BA 3E0PB 5FCRA 3E0NB 1ZPCA 1C5LH 3ZZAA 3TK9A 3TJNA 1V2TT 1O2KA 3EQ0H 4X6OA 4X6NA 2KAIA 2WV4A 3CS7A 1H4WA 2P16A 1W7XH 3TH3H 1ZZZA 2A5KA 5E0HA 4Z6AH 1MTVA 3K6YA 4DW2U 4MVNA 1ARBA 2ZFQH 1H9HE 1GHAF 3SV2H 8ESTE 4FUBA 1TYNA 1IQNA 4ZHMU 3SGQE 2SGDE 1YPJH 1C2HA 2PGQB 1NN6A 4FU7A 2ZKSA 1DUAA 2GMTB 3TNTA 5LPRA 2R3YA 2VIWA 3RXHA 1BDAA 4X1NU 2XWAA 3HKIB 2ZFSA 3QK1A 5JBCS 4YTAA 2VWMA 1F5LA 2FOCA 1FZZA 5F03A 5C3NA 3PYHA 4O3TA 4UFDH 3RXVA 1O5BB 3PLKA 3QDZB 3URCA 3A87A 1F0UA 3RXFA 1DY8A 1LPZB 3BF6H 4YT7H 2SGPE 1LCYA 4BAHB 4HFPB 9LPRA 2HWLB 2VIPA 1SGDE 1TGCA 1EZQA 3RXAA 4NG9H 3A8AA 3KF2A 1GI3A 4X6PA 1W8BH 2XBVA 3PMAB 1AMHA 1GBCA 4KGAA 3BG4C 4AYYB 2BD2A 3TIUA 3A7WA 5EW1H 2P93A 1SMFE 2D8WA 1BRCE 1SC8U 2STAE 1P10A 2EA3A 2VINA 1O2HA 3DHKH 3MH5A 3AVZA 2BY9X 4MPXA 4A1XA 1OYTH 3LONA 4XDEA 5A09A 4D7GA 4A1TA
chains in the Genus database with same CATH superfamily
2ZU5A 1TA2A 3MNCA 5AHGH 1B0FA 1RTKA 1SGRE 3PTNA 3PV5A 1UTLM 4UFEH 1OHHD 1GHXH 1C1PA 2QXGA 5HGGA 4MPUA 1CSOE 4RKJB 4INHA 1KLIH 2ZCKP 3LC5A 1ANDA 5CE1A 1HV7A 1BHXF 1DWCH 1C5SA 1GHAG 2SGAA 4RN6A 2KZ4A 3PM3A 1O2OA 1ETTH 3TVJB 1C1QA 1P2MA 4CRDA 3BEIB 2SNWA 2ZFPH 1M9UA 3FAOA 1QHRB 2WPJS 1N8OC 3U9AH 1Y3UA 1TNHA 5EPNA 3ZZ4A 1LPGB 1E37B 2ODPA 1EPTC 2AMDA 2D2DA 3ATIA 1Y3YA 4LZ1H 5F6MA 1RXPA 2FEQH 1DFPA 5HIYA 1JBUH 2FTLE 2L6OA 5T6DA 1WSSH 2F3CE 4X1PU 2YMSC 2CV3A 4B74A 5DN6D 1XVOA 2B0FA 2NU0E 5DJ7A 1H8DH 3VEQB 3GY8A 1V2KT 1C5OH 2Y5GA 1GCTB 2XBYA 2OC1A 5CHAB 1PQAA 3WW7A 4NGAH 1HPGA 1VR1H 1YF4A 1O38A 2P3FH 3IITA 4JZ1A 1HXEH 3EA9A 1KDQB 1UK4A 5FX6A 1QQUA 4X8UH 1NFXA 2ZQ2A 1DITH 1O3GA 2PKAB 3MU8A 3LGTA 1O3MA 1SPJA 1SGFG 2FOBA 5GXPA 3L33A 2FWWA 5EGMA 5B6LA 3ATLA 4X1QU 2VIOA 3ZZ9A 3QO6A 3ATMA 2QYIA 3SJOA 2I6SA 1NT1A 3RXRA 1C1SA 1HAXB 3OY5U 4KKDA 5DO4H 1ANEA 1O2PA 3KQCA 2ANYA 1GG6C 3MHWU 1LDTT 4XD7D 3E3TA 2UUFB 1GBAA 2FTMA 2CK3D 3D49H 4YM9A 3S69A 4DCDA 4D76A 5E2OA 5DP5A 1EX3A 1W7GH 3BTME 4YLUA 4BNRA 4I8GA 3DSOA 3ZVDA 2R3UA 1EOJA 2XYAA 1AHTH 2GZ7A 2QIQA 2BTCE 1YP9A 3E90B 4AFUA 2BY5X 3F6UH 3NCLA 4IC5A 5SGAE 3O8RA 3NPSA 4OM9A 4CBOA 2AGIX 1CA0B 3ZZ8A 1GI7B 1O2WA 5DP7A 4D9QA 1TGBA 3FP7E 1SGPE 3D23A 3RXCA 2WPLS 2BLWA 2ZDKA 3VGCB 2Z9JA 4X2WA 2Z9GA 3PMJA 5DPAA 1ZRBA 3QGJA 1G2MA 3ZVCA 2DUCA 2ZCLP 3MU4A 3OU0A 3U69H 2KX4A 1P8VC 1ANBA 4GPGA 1VITF 1C2FA 2P3UB 4X2YA 4A6LA 1SGTA 1THRH 5L6NH 1MQ5A 3U98H 1QJ6B 3W94A 1GI4A 1OWHA 1YYY1 3W1EA 2AIPA 4TWYA 2HVYB 2PUQH 1O5FH 2ZDAH 4GAWA 4B6EA 1OWDA 1TAWA 3M5LA 2ZI2H 3MQKC 1TONA 3SQEE 3LC3A 3BTQE 1P11E 2UUYA 1C5MD 1EJAA 1NC6A 1F2SE 3H7TA 2VGCB 2QF0A 5EJLA 4K2YA 4NFEA 5F8TA 3TITA 3AAVA 3TK6A 2ZA5A 2TGPZ 3Q3XA 5A0CA 1XUJA 4JYTA 4ZKOU 3NUMA 1BA8B 3MU0A 5F8ZA 2ANKH 4CHAC 2FIRH 2PTCE 1GDUA 1C1NA 3UQVA 2C8YB 3RMLH 3A7TA 2PW8H 3SGBE 1SBWA 3DSGA 3FANA 3V0XA 4DG4A 3EYDA 4LOYH 1O2RA 3E91A 2AGGX 3H5CB 2W26A 2XWBI 1O5GH 1P3EA 1THPB 4ZAEA 1FUJA 3OE7D 3BTFE 2QV1A 4JZEH 5HYOA 1UTOA 2EI7A 1P01A 3GOVB 1Z7KA 5FBEA 1OPHB 1VJAU 2DE9A 4DURA 3RLYH 1O5CB 1T31A 2B7DH 4BAOB 2TBSA 1DWBH 4U01A 2WPMS 1JXPA 1TPPA 4P00A 3STJA 1BMFD 3ODDA 3SU1A 1O2VA 1L1GA 4HG6A 3GCTF 3GY5A 4ESTE 1K1PA 3HK6B 1EAUA 3U8RH 1KXAA 2ZU4A 1G37A 3SV8A 3A7YA 3A8DA 1TBZH 3C27B 1NS3A 3MNSA 2HPQH 1SOTA 1QY6A 2WPHS 3TGJE 3RC4A 3T29A 4O03A 3KCGH 2V35A 1AZ8A 1MKWK 1J8AA 1TX6A 1GHBF 1LHFH 2ZHWH 4SGBE 1VITG 1W14U 1AN1E 5C1XA 1G2LA 1G3CA 1AB9B 3RXBA 1C5UA 1EATA 1KDQA 1DPOA 2A2XH 3BTEE 4R8TB 3RMOH 2R0LA 2VWNA 2PKAA 3GYMA 1LMWB 4MNVA 1Y3XA 1WXRA 1NBMD 1P9SA 1H8IH 1XM1A 2GV7A 1CU1A 1CBWB 1K9OE 2GVFA 5ABWA 1GBIA 2H5DA 4ISIH 1DDJA 1SGIB 4U2WA 4CRFA 4BTUB 1ELEE 4E7NA 2BM2A 3BV9B 3VG8A 1SGFA 5EQSA 1HAYB 1T8OA 2ZPQA 5DP4A 1NRRH 2WYGA 1TPOA 3U8TH 1A1RA 4BXWA 4XBDA 5BRRE 5L2YH 3BTTE 3F0PA 3I78A 1ELAA 4MNXA 1UTJA 2GDDA 2XCFA 1RTFB 2GX4A 3A7VA 3GCHB 4U32A 4TT3D 5E0GA 3SO3A 1A7SA 4TPYA 4WJG2 3I77A 4GHQA 4TSFD 2F9NA 3LDXH 1ABIH 3PLPA 4OGYA 3FKSD 2A4RA 4MLFB 1DS2E 3K6ZA 4AGKA 1MKWH 3T5FH 3VB5A 2J97A 4BOHA 1GPZA 1ZHRA 4Q4LA 1AFEH 4TY7A 1Q2WA 1S6HA 2G52A 5EXLA 4IN1A 1C1UH 2ZGXH 3CP7A 1ZLRA 2V3HH 3E16B 2SGEE 4IGDA 3RXTA 1BRUP 1N6YA 3IWMA 2BQ6B 1K22H 2HGTH 2F9UA 2ZHDA 3L3TA 4K60A 3GCTG 1UCYE 1GBJA 2QXJA 4XBCA 1ELBA 2C3SA 2PGBB 1YPGH 1YWUA 3PROA 1H9LB 1AD8H 1D9IA 4YESB 2P8OC 1H1BA 1KXBA 1G3BA 4IMQA 1V2NT 1G30B 5CHAC 4MNYA 1E1QD 1C5PA 1NESE 4UFFH 4YOIA 4DOQA 1E1RD 1EAXA 1V2VT 2OC0A 5E2PA 2ZGCA 3T27A 4WVPE 1GHBG 1C1RA 1KYNA 3B9FH 5A0BA 1XVMA 2XXLA 4UD9H 4IC6A 1F5RA 3FP8E 2STBE 1T4UH 1V2QT 1C4V2 3A82A 2BX4A 2R2MB 1OYQA 1A4WH 2ZFFH 3UOUA 1O3NA 1FPCH 2HNTC 2RCEA 2WZQA 5T6GA 4D8NA 1C9PA 2ULLA 4XE4A 2HPPH 5E0JA 3BTDE 4ZKNU 1NRPH 3A8BA 4BXSA 5FAHA 5DP3A 1GHYH 3HKJB 1ETRH 5AFYH 1HFDA 2PSYA 2PUXB 3GCOA 5B6OA 1TPAE 1IQGA 1AVGH 2AYWA 3BSQA 2W7SA 1LKAA 2M5TA 3VPKA 3MOCA 4CREA 5JB9S 4I8JA 3ATWA 4NIVA 4ABHA 1EJMA 2QGRA 3PV2A 4UEHH 2TGAA 1CT0E 2JJ2D 3MI4A 3VB6A 3MH4A 5L2ZH 2A4GA 1V2UT 3A7XA 1E38B 5DG6A 1GVZA 1COWD 1HAHH 2CHAB 3GDUA 2RDLA 4ACBA 4AFSA 4B75A 3KQBA 2BYAX 3NWUA 1YPLH 3R0FA 1TX7A 1A3BH 2J92A 3KL6A 3RDZA 2FO9A 2UWPA 3OFND 2A1DB 1SFQB 2G55A 2W3KA 2PKSC 1DXWA 3VGCC 4ISNA 2RG3A 2ZECA 4ABDA 1YPHC 1Y3VA 1SLUB 1FLEE 1P57B 3P92A 2A2QH 2ZHQH 1H9IE 4O97A 2H6MA 2Y81A 1UVSH 2W6ID 3M3TA 1DX5M 2PWXA 3GICB 3M5MA 2BX3A 4YLQH 1BMAA 1BBRE 1V2MT 1W11U 3QZRA 2XBXA 5TJXA 4HTCH 1YCPM 3SU2A 2BXUH 1MKXK 2L74A 2TGDA 5IYTA 1ESAA 1PFXC 3SV7A 1C1TA 4AB8A 1O3DA 2AMPA 1G3DA 3O8DA 4PROA 4Y76A 3LH1A 4NIXA 3ZVBA 4HGCA 3ZZ7A 1TIOA 4NSYA 1E79D 1TWXB 1XMNB 3VB4A 2ILNA 2AERH 5BPEA 1E35B 2R2WU 1WDIA 1GBMA 2V7QD 3SUFA 3SV9A 5J4SA 1L4ZA 1TFXA 2P95A 5FL7D 3Q00A 1IQHA 1GJCB 4UONA 3Q76A 1FY1A 1LQEA 2ZF0H 1RRKA 4HI3A 1NROH 4KTCA 1C2JA 3LU9B 1VGCB 1QR3E 4JCNA 3AW1A 2EY4C 1UVTH 1P03A 1S5SA 1A0JA 2ZO3H 5FXLA 4H6SB 3TPIZ 3UR6A 3ZYDA 4Y10E 1K28D 2PTNA 1HRTH 1Q31A 1A2CH 1C2DA 1O3IA 4FUEA 1GJBB 1Y8TA 1FY4A 3V13A 4NFFA 1ZMJA 2AMQA 1S6LA 2F43B 1QL8A 1HAOH 1OXGA 2ZPSA 1FJSA 1QA0A 2G5NA 5C2ZA 4IBLH 1MKXH 4ABJA 1G36A 3KQEA 2A7CA 1E0FD 1CGIE 4BAQB 1S0QA 4ZHAA 1KXCA 3RC5A 1EXFA 4I8KA 1FNIA 5FHTA 3F9GA 1Z8JB 1UTNA 2CGAA 2BY7X 1XKAC 1GBDA 1V2OT 1SQOA 1GBFA 5C20A 1QB6A 1GVKB 2Y7ZA 3V3MA 5DK1A 1FX0B 3SOSA 1SL3A 1QNJA 2BZAA 5EJZA 4IW4E 1HJAB 1WUNH 1MAYA 5DP8A 2THFB 2OXSA 3BEFB 1K0HA 1C5TA 4LXBH 1RFNA 1JWTA 3KGPA 2OLGA 4WXIA 1QTFA 4LK4A 3LT3A 3QTOH 1ZPBA 3MMGA 1WCZA 3RMMH 5GNDA 5CMXH 2A5IA 1J17T 1SLXB 2BXTH 2Y7XA 3PO1B 1UHBB 2QC2A 1CBWC 1XUGA 3TJUA 4AB9A 4FOUC 2G5VA 2HNTF 2BDYA 2FS9A 2GP9B 1ZMNA 1DANH 1UMAH 1GGDC 3KQDA 1CE5A 3SHAH 3RU4E 1S81A 1P02A 1XUIA 2IOTA 2R0KA 2LELA 1GBBA 5EW2H 2B8OH 4INKA 2KM0A 3RXLA 4Q7XA 1AI8H 2ANWA 2BOHB 3K2UA 2CF8H 1OSSA 1YBWA 3SNAA 3SUEA 1DY9A 1GMDF 1ABJH 3SU4A 3BG8A 3UQOA 3QX5H 2VVUA 3RMNH 4KELA 4XOJA 3F2FA 1O3BA 2ZEBA 2RFKC 3ATKA 3OY6U 2F9BH 1ZRKA 1YLDA 1AFQB 1ZTLA 1G32B 2O9QA 1NPMA 1WYKA 2KFWA 4WMFA 3RLWH 2W5EA 4RT1A 3MNBA 2ZDVH 2BVSH 3GY2A 3GY7A 2GKVE 1TGTA 1NRSH 2ESTE 1SR5C 2SGQE 1B7XB 1CGHA 3MO6A 1QRWA 3LIWA 1LHCH 3FZDA 2WV5A 4NIWA 3O8CA 4I7YH 1FN8A 2FLRH 3TH4H 1O3FA 2OBQA 4X6MA 3ZZ3A 3M61U 2ZCHP 5ESBA 1O33A 2WSSD 1S83A 4XSKU 4KTUA 1TOCB 1TX8A 4MG3A 3DFJA 2FOFA 2Y5HA 1ID5H 1ESBA 1WTHD 4CRAA 1UK2A 5FX5A 1Z6EA 2ZDMA 1KXDA 4Y7AA 1FXYA 5KGOA 1NU7B 5C67A 1A0HB 1QRXA 1VCQA 1WBGB 1GJ7B 2ZU3A 2OINA 1CHOF 1SB1H 2ZP0H 4IN2A 1UTPA 5HMAA 1FDPA 2C93B 4TYDA 3P17H 4OS4A 1BRAA 4FXGH 5C1UA 3O8BA 2R9PA 1NRNH 2RDEA 3T2NA 1V3XA 1AWFH 1GCDA 2TIOA 2O8MA 2PFEA 4I86A 1MZDA 1EZUC 2BZ6H 1MMJN 2WV9A 1TPSA 1O2LA 2GDEH 2AGEX 1AVWA 3H09A 2PP6A 3UNRA 3RXSA 5GDSH 5DGJA 4M7GA 3EAJA 4F48B 2G4TA 1CVWH 1MH0A 1RIWB 1GMDG 1AIXH 4I8LA 2GJGA 6LPRA 1C5ZB 4TY6A 4A7IB 2CHAC 2FMJA 2FS8A 5C17A 1YLNA 1O36A 5KEDA 1T4VH 3T28A 2J94A 1V2WT 3VFEA 5LH8A 1O3EA 3ITIA 3VB3A 1MTUA 1BHXB 4GHTA 5LGOA 5G4BA 1GBEA 1EJNA 1X7AC 3NZIA 1O2XA 1CO7E 2A4QA 1DICA 3Q77A 4MPVA 1NO9H 1TGNA 3M35A 3AK5A 2ZDLA 5H4IB 1O2ZA 3LPRA 1BJUA 1OS8A 3RXQA 1BTZA 1D6WA 2ZDNA 4O9VA 4X1RU 3TJOA 1WV7H 1TQ0B 2ALVA 1BMNH 2FI4E 1IQLA 1K1OA 1O3OA 1BTWA 1QFKH 3GY6A 5EG4A 2NU2E 3SU0A 1EKBB 1S6FA 2BDCA 2LPRA 2YNBA 3MFJA 3PB1E 4INLA 4Y0ZE 5T3HA 1UHBA 4DIHH 2FOMB 3MYWA 4H6TA 4IS5A 3SYJA 1LVYA 3S0NA 5GCHF 2AH4X 3EE7A 1MUEB 1V6DA 3GY4A 1GJDB 1JRSA 2BD4A 4X1SU 1LTOA 1CHOG 4MTBA 4YXWD 2BD5A 1BB0B 1VGCC 1P12E 3F68H 7ESTE 2Z7FE 4I8HA 3HPTB 1ZTKA 1BZXE 1Z1IA 2XCNA 3SJ8A 1HAIH 1HJ9A 3A83A 3MNXA 2ZNKH 2ZG0H 4U30A 1D3QB 2GV6A 2OP9A 2CMYA 4X0WU 4B71A 1EP5A 1BJVA 1LHEH 3CENA 1E34B 2J9NA 1W12U 2UUJB 1DVAH 1IQIA 3M7UA 2GMTC 1C1WH 2QE7D 4JZDH 5GIBA 3RXJA 1QJ7B 1FIZA 1GI8B 1FY5A 4Y7BA 1JRTA 3F2HA 2OUAA 3NXPA 1RGQA 1FAKH 1TNIA 2FYQA 2FI5E 1HAZB 1C2GA 5JB8S 1BCUH 2Z9LA 3MTYA 5AF9H 3LKWA 3P95A 1A61H 1GL0E 1ELDE 1C5VA 2C4FH 1LVMA 1EAWA 1EB1H 1MD8A 2OK5A 1ZGIA 1ZPZA 2ANMH 3SNEA 3UB0A 1FONA 2Z9IA 1ZMLA 2JKHA 5K7RA 3S9AA 2BDGA 1C2KA 1O3PB 2Z3CA 5F53A 1D3DB 1O31A 3MO3A 3SGAE 4AOQA 2GD4B 1HLTH 2A32A 2ASUB 1S85A 2W3IA 1SFIA 1LVOA 3OX7U 1ETSH 1K21H 2FESH 1FIWA 1SHYA 2QF5A 2Q6FA 2AIQA 4BAKB 1C2EA 1NM6A 3F9FA 5A8ZA 4D9RA 4ABBA 1XUKA 2H2ZA 3ZV8A 2C8WB 3ESTA 1C1VH 3HGPA 3Q3YA 3RM2H 1TB6H 1TOMH 3JZ2B 3F0OA 4Z0KA 1ZJKA 1KSNA 4CRBA 2XC4A 3BTHE 3BG4B 1UCYK 1SKYE 2B5TB 2BDBA 5GCHG 1W2KH 4JZFH 1EP6A 4NA8A 4J2YB 5EXNA 5A0AE 2G81E 2ZHEH 3AASA 3LH3A 4ZKSU 4FUJA 3DSPA 1NFWA 1EUFA 4ABFA 2LP6A 1NY22 1C5YB 1E36B 2RA0A 2YOLA 1FV9A 2JH0D 2OCVB 4Y71A 4WF8A 3R3GB 3D62A 1PYTD 3SU6A 4NIYA 1CA8B 1GI6A 3E1XB 3GYLB 6GCHF 2FPZA 1KXFA 3NK8A 8LPRA 2OTVA 3U1JB 3MO9A 5EJ1A 4K3JA 4BANB 1J15A 2AFQB 2CJIA 1EQ9A 2D1JA 1C2LA 2V0BA 1INCA 1PPGE 3WY8A 2O8TA 1SGCA 3DA9B 3OEHD 2QN5T 3UOPA 2ZU2A 1MU8B 2OC8A 1LO6A 4ZHLU 4JYUH 1UVPA 2XBWA 2Z6BD 5C0UA 2IPQX 1TLDA 3I29A 1EZXC 2FODA 1MAXA 1C5WB 1TE0A 2HLDD 2BDAA 3RC6A 1T8MA 1U6QA 4AG1A 4TPIZ 1N8OB 3RM0H 1QCPA 3M7QA 2J2UA 2CF9H 1GCTC 1PPFE 2QY0B 1ZHMA 2OC7A 1UCYH 1EPTB 2TPIZ 3TH2H 3GISB 1VCPA 4CH2B 1SQRA 4K8YA 2XNDD 2HALA 2YMSB 1RJXB 3BTKE 4KP0A 1O3CA 5HXFA 4I32A 4H4FA 5A2MH 4GSOA 2EC9H 2HNTE 1O35A 2IJD1 4ISHH 1F0RA 2OQUA 1VKYA 3ZVFA 1A5IA 1TBRH 1DM4B 2HVXA 4FU8A 3PTBA 2A7HA 3QWCH 4JK5A 3FFGA 1RS0A 4ZUHA 1ORFA 3A80A 2NU3E 3DFLA 4Y8ZA 3V7TA 1N1LA 1P3CA 2GZ9A 2PSXA 4ISOA 2QA9E 4FU9A 1BMMH 2H9TH 3V12A 3U28C 1HUTH 3LJJA 2FX6A 3PWCA 1BBRK 1KIGH 3P8FA 1V2RT 3VXEH 2ODQA 1GG6B 3A84A 5DKMA 3LGUA 1HXFH 1AU8A 2VBCA 4AFZA 1GL1A 3BTGE 4OS2A 3S7HB 3MU1A 1QL9A 5FCKA 1UTKA 1C4Y2 1HDTH 2Y82A 2A4OA 6GCHG 3H7OA 4DGJA 1GI0A 4DVAU 4YOGA 5EOKA 1D6RA 1YPHE 7LPRA 1CA0C 1KXEA 2VVVA 3PMHB 3ZV9A 2FYRA 7GCHF 1EOLA 5JYIA 4Y11E 1QQ4A 3GS9A 2F4LA 2KR7A 5DP6A 4SGAE 1QJ1B 4F49A 1W13U 1ZGVA 1TNJA 2F83A 2AEIH 3UUZA 1N6XA 1XXFA 1OX1A 1T8LA 1BTYA 1Y59T 1HIAB 1P2IA 2K8IA 3M37A 4OS7A 1XX9A 4CRGA 1GI2A 4ZKRU 3P6ZB 1V2ST 1D3PB 1GBTA 3GY3A 3M5OA 1QB1A 5EQQA 4CR9A 1P05A 3ZVGA 3DD2H 2PHBA 1NFUA 2WPDD 4NZQA 5F8XA 4BAMB 4DT4A 5C94A 2RA3A 1P9UA 2VIDA 1LKBA 3SNDA 1BBRH 4GVUA 2VIVA 1L2EA 4YO9A 1BTPA 4ABEA 1HAPH 5IDKA 3NKKA 4CH8B 1IQJA 2BY6X 3QGNB 2A5AA 1MTWA 2KCAA 3FOAA 2VGCC 2BVRH 4A5TS 1LPKB 3PWBA 5FPYA 1L1NA 1O2SA 2BD9A 3PRDA 1PQ7A 1GJ9B 2ZIQH 5AFZH 3UWIA 2G4UA 3TNSA 2JH6D 1ELVA 1P2KA 1SGQE 3RXPA 1SVPA 2HRVA 4FUCA 1GBHA 3A85A 1GWAA 5LPEA 1GMHF 1O2TA 2EEKA 2G51A 4Q63A 1DT2A 4NCYA 3A7ZA 4CBNA 3E6PH 1ZSJA 3F2GA 2B9LA 2WPIS 2PV9B 2XC0A 2ZGBH 3T25A 1HAVB 4A1VA 2UUKB 1LVBA 4CHAB 1DLKB 3ELAH 1SG8B 4CR5A 4YOJA 1FN6A 3P70B 1OP2A 3RXKA 3D65E 3RXIA 1SOZA 3TK5A 4MQAA 1HBTH 1OWKA 3P8OA 2O8UA 1QGFA 4Y6DA 1OWJA 1GVLA 1EFRD 2Y80A 1D4PB 2FOAA 1A5GH 3BEUA 1ZOMA 8KME2 2VU8E 1YPEH 1SGYE 3UTUH 7GCHG 1O32A 1VJ9U 4NZLA 2H1UA 3MU5A 4K1EA 1BQYA 4FUDA 1HYLA 1O5DH 4B1TA 3UPEA 2FDAA 1DE7H 1HAGE 2QF4A 1JIRA 1CT2E 1XKBC 4I31A 1VITH 5C5OA 2ZGHA 2GCHF 1BTUA 5EU8A 1SQTA 1QRZA 3B23B 4UFGH 9ESTA 1SHHB 2NU4E 1EPTA 2HLCA 4Q7ZA 5JDUB 3KN2A 1TGSZ 1AB9C 1AY6H 2EI8A 1SQAA 5GJ4B 1SI5H 1HJ8A 3OYPA 1CT4E 4E05H 5TCCA 4ISLA 1YM0A 3KYGA 4DT7B 1O37A 4ZXYH 1EAIA 3Q3KA 1TQ7B 1BIOA 1KLJH 4O3UA 1K1NA 3BN9A 2WYJA 4THNH 3UY9A 1Z1JA 4AORA 3U1IB 1GBKA 3SZNA 4DY7B 1H8ED 3A86A 3T62A 2JH5D 5HKKD 3SORA 2ZPRA 2FOHA 4D7FA 4X8VH 3ZZ6A 1IQFA 2QAAA 4AGJA 1SLVB 1YC0A 1MTNB 2ZFRH 2F9OA 1DLEA 4ABIA 2FM2A 1OKXA 2G8TA 1P06A 4B2AA 1AWHB 1W0ZU 2YNAA 3TU7H 4AYVB 2XTTB 1P2JA 2Q6GA 1QIXB 1O0DH 1WU1A 3SW2B 1QURH 1Z6JH 3GCHC 1GMHG 1PPEE 1ESTA 1G9IE 2CN0H 1IAUA 2Z3DA 3A89A 2WUCA 1O2NA 5JPMH 3WWBA 1JMOH 2GT7A 4B2CA 3KYFA 2QXIA 1UTMA 3DT0H 1PYTC 2NWNA 1V2PT 1CQQA 1GJ6A 2JETB 2QF3A 3P8GA 2BQ7B 1LHDH 1SGEE 4FVBA 1VCWA 4FVDA 4A92A 1WQVH 3LOXA 3A81A 2EQNA 3UNSA 1HCGA 1MCTA 2IN2A 2M2AA 1A3EH 1AQ7A 1GHZA 1YPKH 4Q2KA 2J95A 4QT8C 4ABGA 5GWZA 3SHCH 1CGJE 4GLYA 2OD3B 1O2MA 1GI9B 2C8ZB 1SSXA 1GDQA 1HIAA 4MNWA 1O3KA 1C1MA 5FPSA 1D3TB 1GJ8B 1HNEE 2DE8A 3LGIA 2VH0A 1UJ1A 2PLXA 3QUMP 4E06H 2J38A 2WUBA 3SI4H 2JDID 1PJPA 2GCHG 3ZZBA 1QB9A 1KTTB 2Z94A 3SZEA 1ZSKA 4VGCB 1TRMA 1TNLA 1TALA 2P8OB 1AKSB 1KY9A 3K65B 1EB2A 1IOEA 1GHVH 1O39A 1MBQA 3CS0A 1XXDA 1MCVA 4OS1A 1RD3B 1DOJA 1QBVH 2ZTXA 4X2XA 4FUGA 4RKOB 4CRCA 2VWOA 1OP0A 1C1OA 4AG2A 3OTJE 2WINI 5JBTA 2JIZD 1F7ZA 1O30A 4XDEA 5C0TA 6CHAB 1O34A 4OS5A 1Y3WA 2O8WA 1YY3A 3KIDU 3URDA 2BHGA 1C5QA 3UAIC 1GI1A 6ESTA 1F92A 1T8NA 3SUDA 3FZZA 5DSFA 3AW0A 1NU9A 3EE0B 3ZVAA 1YCPK 4FETA 1HAVA 1IHTH 3MH6A 4MDSA 1SLWB 4M9FA 4K8BA 4ASHA 3JZ1B 5I46H 4ZMAH 2FOEA 3FVFB 1WOFA 1FAXA 1T7CA 3WWFA 2GT8A 1CHGA 2SNVA 3HK3B 1O2GH 2PR3A 2CXVA 1KTSB 1PPBH 2OQ5A 4F4OC 2O8LA 1EASA 1HB0B 3GCNA 1P0SH 4RSPA 5T1VA 3UNQA 5AVDA 1C5NH 3RXDA 2H9EH 1DXPA 1O3JA 1T32A 2WHXA 4NWLA 4JZIA 3U8OH 5CDFE 2GCTB 2J34A 1BMLA 3E8LA 1DSUA 2P59A 2ZTYA 1BT7A 1TA6A 1ACBE 1V2JT 1TNGA 4WXVA 3EDXB 2XNIA 3SQHE 1NRQH 3KHVA 1FY3A 1Z8GA 2PKSB 1WAYB 2BB4A 4AFQA 3UIRA 3MH7A 3SJIA 2BD8A 3HGNA 4ZH8A 3BIUH 1FQ3A 2XC5A 5HIZA 3SUGA 2ZU1A 2ALPA 3OEED 4Y0YE 1ELTA 1YCPH 1YPMH 1AUJA 2Y5FA 3OTPA 3EA8A 4WMEA 1Z8RA 1ELCA 5EQRA 1NTPA 3LGWA 5EPYA 2BY8X 2F9VA 4BTIB 1UVOA 4UE7H 5JBBS 5A8YA 5E8EH 1AE5A 4DIIH 1P09A 1TRYA 1O5AB 3SN8A 4YZUA 4J1YA 2FLBH 4BTTB 1F0SA 1UVUH 4RI0A 3A8CA 1C9TA 1GMCF 1S0RA 3F3BA 4K1TA 2C90B 2F9PA 3KNXA 3STIA 3N7OA 5I25A 1W3CA 2BDHA 1NFYA 2K0QA 2BD7A 4X8TH 4WMDA 4YT6H 4GCHF 1DWEH 4H42U 4Q7YA 1AVXA 2VWLA 2TRMA 4Y8XA 1YGCH 2A7JA 2ZFTA 4F55A 1QBOA 1O2JA 3FN8A 5LPFA 3TJVA 2BQWB 2OBOA 1GJAB 2VNTA 3M3SA 1Z8IB 1UTQA 4UDWH 2P94A 1MABB 5ESTE 1ZSLA 3SJ9A 2ZWLH 2VJ1A 4B76A 1AZZA 1G3EA 1ZR0A 1IQKA 1GDNA 2D26C 8GCHF 2V6NA 3RXOA 1P2OA 1FMGA 1C2IA 1J14A 1L4DA 1LQDB 3SBKA 1A5HA 1AO5A 4XFQA 2NU1E 4AN7A 2GZ8A 3UWJH 1UO6A 1A0LA 3ZYEA 3EA7A 1S82A 1HJAC 1F5KU 2BDIA 1ZJDA 3SNCA 1K1JA 2ZTZA 4Y8YA 5C1YA 5JBAS 1ZYOA 2QXHA 2UWOA 3SNBA 1QZ8A 1KMHB 3RXMA 3ODFA 1Y5UT 4FUFA 1PQ8A 4Q80A 4NSVA 1PPZA 3PLBA 3K9XB 3PMBB 2A31A 2WPKS 5HM2A 3F1SB 3S7KB 3F9HA 3B8JA 3S9CA 3TGIE 1AKSA 2BVXH 2Q1JA 4R0IA 3SV6A 1AE8H 4AX9H 1OWEA 2J98B 3PO1C 1QA7A 1L1JA 1IHSH 2XW9A 3KEEA 3RXGA 4OGXA 1BITA 3ENSB 1BUIA 1Z71A 2J4IA 3SJKA 1HGTH 3RP2A 5T6FA 1MTNC 3QZQA 4Y79A 3G01A 3N7DA 5DP9A 1BTXA 3AAUA 1L0ZA 2I6QA 4AZ2B 5J4QA 4WY3A 1MBMA 1PPHE 1O3LA 1B0EA 5EXMA 4OS6A 2SGFE 3LGVA 2FI3E 1GGDB 4ABAA 1GJ4H 1GMCG 2KCPA 3ZZDA 4Z1MD 3UR9A 3ZVEA 1ELFA 2KAIB 1BOQA 2HOBA 4GCHG 2JETC 3FO8D 3RU4D 4NA7A 1O2YA 1UW7A 2C8XB 4XRNA 1AFQC 1JIMA 1IQMA 2FX4A 1O2IA 2Y6TA 1THSH 3QN7A 4LZ4B 3A88A 3MWIU 1OWIA 2A45B 4FUHA 1V2LT 3QTVH 1B5GH 1RTLA 1ZHPA 2P3TB 3T26A 4NWKA 1BTHH 1ELGA 1K2I1 1DWDH 4HZHA 3DUXH 8GCHG 1GI5A 2BD3A 2BMGB 1TMTH 3F9EA 1FPHH 1MZAA 2ZHFH 1C5RA 1C5XB 3RUOA 5C5NA 1KLTA 2BLQA 2YMSD 1O3AA 4E7RG 1DSTA 4K1SA 4ZROA 2ZQ1A 1UK3A 1QBNA 3P8NA 1YLCA 5L30H 1F0TA 1OOKB 3M7TA 2KCYA 4JK6A 4VGCC 3GDSA 3SU3A 4KTSA 2V3MA 5FBIA 3SU5A 1ZTJA 1W10U 3FP6E 4WH8A 4XBBA 1TABE 1Y5BT 4MPWA 3ZZ5A 1H8HD 1W0KD 4ZXXH 1O2QA 1P2QA 3ZZCA 3TLOA 5GPIB 4IMZA 4X2VA 3TGKE 6CHAC 5A8XA 1FI8A 1FY8E 2EI6A 1C4U2 1Q3XA 1QL7A 2FOGA 2W6JD 1BRBE 3CNRA 1EZSC 1C2MA 1XUFA 2FP7B 4WH6A 5CHBA 1O3HA 3N7EA 1AGJA 2BLVA 1WTGH 2VVCA 7KMEH 1Y5AT 5PTPA 2LNCA 1RIWC 3SI3H 3HATH 3RXEA 1OP8A 4B2BA 2BLOA 1SGNE 3LGYA 5FPTA 2ZC9H 4ZCNA 1LHGH 2XRCA 1WQSA 4JYVH 1ANCA 3M36A 1A46H 2J5UA 2H9HA 2UWLA 4TWWA 1TMUH 2VB0A 2Q6DA 1GHWH 5ETXA 1K1MA 1PPCE 1MU6B 3BTWE 1JOUB 1TNKA 2W7UA 2Z3EA 2VIQA 2GCTC 2QCYA 4WWYA 2ODYB 4X8SH 1TRNA 4K69A 2ZZUH 3UFAA 4K5ZA 1S84A 1MQ6A 3GDVA 5TCAA 1PQ5A 2IJOB 2ZGJA 2KCOA 3RXUA 3UREA 2F91A 1DUEA 3EGKH 4FUIA 4GUXA 5K0HA 2AS9A 1W0YH 4B6FA 3OSYA 1J9CH 3IG6B 3QLPH 1K1LA 3OAAD 1GBLA 1XUHA 1AUTC 2SFAA 1YKTA 3LJOA 3M3VA 3VXFH 3W95A 1P04A 3BIVH 1TMBH 2J98A 2VH6A 3ZIAD 5EODA 1K1IA 5HM9A 2K1QA 1P2NA 2H5CA 1NZQH 1MTSA 2JJ1D 2GGVB 2IPHA 2BOKA 3RU4T 2FXRA 4NA9H 2FZZA 1J16A 2TGTA 2V3OH 3M5NA 2GTBA 1GJ5H 1IQEA 1VZQH 3VB7A 3L6PA 1ARCA 4I33A 2G00A 3N99A 2A0QB 3PV4A 3C1KA 4JMYA 4DJZB 1O5EH 1TBQH 1MD7A 2Z9KA 1O2UA 4B73A 3S9BA 3E0PB 5FCRA 3E0NB 1ZPCA 1C5LH 3ZZAA 3TK9A 3TJNA 1V2TT 4ACAA 4AC9A 1O2KA 3EQ0H 4X6OA 4X6NA 2KAIA 2WV4A 3CS7A 1H4WA 2P16A 1W7XH 3TH3H 1ZZZA 2A5KA 5E0HA 4Z6AH 4P02A 1MTVA 3K6YA 4DW2U 4MVNA 1ARBA 2ZFQH 1H9HE 1GHAF 3SV2H 8ESTE 4FUBA 1TYNA 1IQNA 4ZHMU 3SGQE 2SGDE 1YPJH 1C2HA 2PGQB 1NN6A 4FU7A 2ZKSA 1DUAA 2GMTB 3TNTA 5LPRA 2R3YA 2VIWA 3RXHA 1BDAA 4X1NU 2XWAA 3HKIB 2ZFSA 3QK1A 5JBCS 4YTAA 2XOKD 2VWMA 1F5LA 3NRLA 2FOCA 1FZZA 5F03A 5C3NA 3PYHA 1NBME 4O3TA 4UFDH 3RXVA 1O5BB 3PLKA 3QDZB 3URCA 3A87A 1F0UA 3RXFA 1DY8A 1LPZB 5IK2D 3BF6H 3PRBA 5EIYA 4YT7H 2SGPE 1LCYA 3DCLA 4BAHB 4HFPB 9LPRA 2HWLB 2VIPA 3KQ5A 1SGDE 1TGCA 1EZQA 3RXAA 4NG9H 3A8AA 3KF2A 1GI3A 4X6PA 1W8BH 2XBVA 3PMAB 1AMHA 1GBCA 4KGAA 3BG4C 4AYYB 2BD2A 3TIUA 2AHME 3A7WA 5EW1H 2P93A 5KECA 1SMFE 2D8WA 1BRCE 1SC8U 2STAE 4ASUD 1P10A 2EA3A 2VINA 1O2HA 3DHKH 3MH5A 3AVZA 2BY9X 4MPXA 4A1XA 1OYTH 3LONA 4RT0A 5A09A 4D7GA 1W0JD 4A1TA
chains in the Genus database with same CATH topology
2ZU5A 1TA2A 3MNCA 5AHGH 1B0FA 1RTKA 1SGRE 3PTNA 1UTLM 4UFEH 1GHXH 1C1PA 2QXGA 5HGGA 4MPUA 1CSOE 4RKJB 4INHA 1KLIH 2ZCKP 3LC5A 1ANDA 5CE1A 1HV7A 1BHXF 1DWCH 1C5SA 1GHAG 2SGAA 4RN6A 3PM3A 1O2OA 1ETTH 3TVJB 1C1QA 1P2MA 4CRDA 3BEIB 2SNWA 2ZFPH 1M9UA 3FAOA 1QHRB 2WPJS 1N8OC 3U9AH 1Y3UA 1TNHA 5EPNA 3ZZ4A 1LPGB 1E37B 2ODPA 1EPTC 2AMDA 2D2DA 3ATIA 1Y3YA 4LZ1H 5F6MA 1RXPA 2FEQH 1DFPA 1JBUH 2FTLE 5T6DA 1WSSH 2F3CE 4X1PU 2CV3A 4B74A 1XVOA 2B0FA 2NU0E 5DJ7A 1H8DH 3VEQB 3GY8A 1V2KT 1C5OH 2Y5GA 1GCTB 2XBYA 2OC1A 5CHAB 1PQAA 4NGAH 1HPGA 1VR1H 1YF4A 1O38A 2P3FH 3IITA 4JZ1A 1HXEH 3EA9A 1KDQB 1UK4A 5FX6A 1QQUA 4X8UH 1NFXA 2ZQ2A 1DITH 1O3GA 2PKAB 3MU8A 3LGTA 1O3MA 1SPJA 1SGFG 2FOBA 5GXPA 3L33A 2FWWA 5EGMA 3ATLA 4X1QU 2VIOA 3ZZ9A 3QO6A 3ATMA 2QYIA 3SJOA 2I6SA 1NT1A 3RXRA 1C1SA 1HAXB 3OY5U 4KKDA 5DO4H 1ANEA 1O2PA 3KQCA 2ANYA 1GG6C 3MHWU 1LDTT 3E3TA 2UUFB 1GBAA 2FTMA 3D49H 4YM9A 3S69A 4DCDA 4D76A 5E2OA 5DP5A 1EX3A 1W7GH 3BTME 4YLUA 4BNRA 4I8GA 3ZVDA 2R3UA 1EOJA 2XYAA 1AHTH 2GZ7A 2QIQA 2BTCE 1YP9A 3E90B 4AFUA 2BY5X 3F6UH 3NCLA 4IC5A 5SGAE 3O8RA 3NPSA 4CBOA 2AGIX 1CA0B 3ZZ8A 1GI7B 1O2WA 5DP7A 4D9QA 1TGBA 3FP7E 1SGPE 3D23A 3RXCA 2WPLS 2BLWA 2ZDKA 3VGCB 2Z9JA 4X2WA 2Z9GA 3PMJA 5DPAA 1ZRBA 3QGJA 1G2MA 3ZVCA 2DUCA 2ZCLP 3MU4A 3OU0A 3U69H 1P8VC 1ANBA 4GPGA 1VITF 1C2FA 2P3UB 4X2YA 4A6LA 1SGTA 1THRH 5L6NH 1MQ5A 3U98H 1QJ6B 3W94A 1GI4A 1OWHA 1YYY1 2AIPA 4TWYA 2PUQH 1O5FH 2ZDAH 4GAWA 1OWDA 1TAWA 3M5LA 2ZI2H 1TONA 3SQEE 3LC3A 3BTQE 1P11E 2UUYA 1C5MD 1EJAA 1NC6A 1F2SE 3H7TA 2VGCB 2QF0A 4K2YA 4NFEA 5F8TA 3TITA 3AAVA 3TK6A 2ZA5A 2TGPZ 3Q3XA 5A0CA 1XUJA 4JYTA 4ZKOU 3NUMA 1BA8B 3MU0A 5F8ZA 2ANKH 4CHAC 2FIRH 2PTCE 1GDUA 1C1NA 3UQVA 2C8YB 3RMLH 3A7TA 2PW8H 3SGBE 1SBWA 3V0XA 3FANA 4DG4A 3EYDA 4LOYH 1O2RA 3E91A 2AGGX 3H5CB 2W26A 2XWBI 1O5GH 1P3EA 1THPB 4ZAEA 1FUJA 4JZEH 3BTFE 2QV1A 5HYOA 1UTOA 2EI7A 1P01A 3GOVB 1Z7KA 5FBEA 1OPHB 1VJAU 2DE9A 4DURA 3RLYH 1O5CB 1T31A 2B7DH 4BAOB 2TBSA 1DWBH 4U01A 2WPMS 1JXPA 1TPPA 3STJA 3ODDA 3SU1A 1O2VA 1L1GA 3GCTF 3GY5A 4ESTE 1K1PA 3HK6B 1EAUA 3U8RH 1KXAA 2ZU4A 1G37A 3SV8A 3A7YA 3A8DA 1TBZH 3C27B 1NS3A 3MNSA 2HPQH 1SOTA 1QY6A 2WPHS 3TGJE 3RC4A 3T29A 4O03A 3KCGH 2V35A 1AZ8A 1MKWK 1J8AA 1TX6A 1GHBF 1LHFH 2ZHWH 4SGBE 1VITG 1W14U 1AN1E 5C1XA 1G2LA 1G3CA 1AB9B 3RXBA 1C5UA 1EATA 1KDQA 1DPOA 2A2XH 3BTEE 4R8TB 3RMOH 2R0LA 2VWNA 2PKAA 3GYMA 1LMWB 4MNVA 1Y3XA 1P9SA 1H8IH 1XM1A 2GV7A 1CU1A 1CBWB 1K9OE 2GVFA 5ABWA 1GBIA 2H5DA 4ISIH 1DDJA 1SGIB 4U2WA 4CRFA 4BTUB 1ELEE 4E7NA 2BM2A 3BV9B 1SGFA 5EQSA 1HAYB 1T8OA 2ZPQA 5DP4A 1NRRH 2WYGA 1TPOA 3U8TH 1A1RA 4BXWA 4XBDA 5BRRE 5L2YH 3BTTE 3I78A 4MNXA 1ELAA 1UTJA 2GDDA 2XCFA 1RTFB 2GX4A 3A7VA 3GCHB 4U32A 5E0GA 3SO3A 1A7SA 4TPYA 4WJG2 3I77A 4GHQA 2F9NA 3LDXH 1ABIH 3PLPA 4OGYA 2A4RA 4MLFB 1DS2E 3K6ZA 4AGKA 1MKWH 3T5FH 3VB5A 4BOHA 1GPZA 1ZHRA 1AFEH 4TY7A 1Q2WA 1S6HA 2G52A 5EXLA 4IN1A 1C1UH 2ZGXH 3CP7A 1ZLRA 2V3HH 3E16B 2SGEE 4IGDA 3RXTA 1BRUP 1N6YA 3IWMA 2BQ6B 1K22H 2HGTH 2F9UA 2ZHDA 3L3TA 4K60A 3GCTG 1UCYE 1GBJA 2QXJA 4XBCA 1ELBA 2C3SA 2PGBB 1YPGH 3PROA 1H9LB 1AD8H 1D9IA 4YESB 2P8OC 1H1BA 1KXBA 1G3BA 4IMQA 1V2NT 1G30B 5CHAC 4MNYA 1C5PA 1NESE 4UFFH 4YOIA 4DOQA 1EAXA 1V2VT 2OC0A 5E2PA 2ZGCA 3T27A 4WVPE 1GHBG 1C1RA 1KYNA 3B9FH 5A0BA 1XVMA 2XXLA 4UD9H 4IC6A 1F5RA 3FP8E 2STBE 1T4UH 1V2QT 1C4V2 3A82A 2BX4A 2R2MB 1OYQA 1A4WH 2ZFFH 3UOUA 1O3NA 1FPCH 2HNTC 2RCEA 4D8NA 5T6GA 1C9PA 2ULLA 4XE4A 2HPPH 5E0JA 3BTDE 4ZKNU 1NRPH 3A8BA 4BXSA 5FAHA 5DP3A 1GHYH 3HKJB 1ETRH 5AFYH 1HFDA 2PSYA 2PUXB 3GCOA 5B6OA 1TPAE 1IQGA 1AVGH 2AYWA 3BSQA 2W7SA 1LKAA 2M5TA 3VPKA 3MOCA 4CREA 5JB9S 4I8JA 3ATWA 4NIVA 4ABHA 1EJMA 2QGRA 4UEHH 2TGAA 1CT0E 3MI4A 3VB6A 3MH4A 5L2ZH 2A4GA 1V2UT 3A7XA 1E38B 5DG6A 1GVZA 1HAHH 2CHAB 4AFSA 3GDUA 2RDLA 4B75A 3KQBA 2BYAX 3NWUA 1YPLH 3R0FA 1TX7A 1A3BH 2J92A 3KL6A 3RDZA 2FO9A 2UWPA 1DXWA 2A1DB 1SFQB 2G55A 2W3KA 2PKSC 3VGCC 4ISNA 2RG3A 2ZECA 4ABDA 1YPHC 1Y3VA 1SLUB 1FLEE 1P57B 3P92A 2A2QH 2ZHQH 1H9IE 4O97A 2H6MA 2Y81A 1UVSH 3M3TA 1DX5M 2PWXA 3GICB 3M5MA 2BX3A 4YLQH 1BMAA 1BBRE 1V2MT 1W11U 3QZRA 2XBXA 5TJXA 4HTCH 1YCPM 3SU2A 2BXUH 1MKXK 2TGDA 5IYTA 1ESAA 1PFXC 3SV7A 1C1TA 4AB8A 1O3DA 2AMPA 1G3DA 3O8DA 4PROA 4Y76A 3LH1A 4NIXA 3ZVBA 4HGCA 3ZZ7A 1TIOA 4NSYA 1TWXB 1XMNB 3VB4A 2ILNA 2AERH 5BPEA 1E35B 2R2WU 3SUFA 1GBMA 3SV9A 5J4SA 1L4ZA 1TFXA 2P95A 3Q00A 1IQHA 1GJCB 4UONA 3Q76A 1FY1A 1LQEA 2ZF0H 1RRKA 4HI3A 1NROH 4KTCA 1C2JA 3LU9B 1VGCB 1QR3E 4JCNA 3AW1A 1UVTH 1P03A 1S5SA 1A0JA 2ZO3H 5FXLA 4H6SB 3TPIZ 3UR6A 3ZYDA 4Y10E 1K28D 2PTNA 1HRTH 1Q31A 1A2CH 1C2DA 1O3IA 4FUEA 1GJBB 1Y8TA 1FY4A 3V13A 4NFFA 1ZMJA 2AMQA 1QL8A 1HAOH 1OXGA 2ZPSA 1FJSA 1QA0A 2G5NA 5C2ZA 4IBLH 1MKXH 4ABJA 1G36A 3KQEA 2A7CA 1E0FD 1CGIE 4BAQB 1S0QA 4ZHAA 1KXCA 3RC5A 1EXFA 4I8KA 1FNIA 5FHTA 3F9GA 1Z8JB 1UTNA 2CGAA 2BY7X 1XKAC 1GBDA 1V2OT 1SQOA 1GBFA 5C20A 1QB6A 1GVKB 2Y7ZA 3V3MA 5DK1A 3SOSA 1SL3A 1QNJA 2BZAA 4IW4E 1HJAB 1WUNH 1MAYA 5DP8A 2THFB 2OXSA 3BEFB 1C5TA 4LXBH 1RFNA 1JWTA 3KGPA 2OLGA 4WXIA 1QTFA 4LK4A 3LT3A 3QTOH 1ZPBA 3MMGA 1WCZA 3RMMH 5CMXH 2A5IA 1J17T 1SLXB 2BXTH 2Y7XA 3PO1B 1UHBB 2QC2A 1CBWC 1XUGA 3TJUA 4AB9A 2G5VA 2HNTF 2BDYA 2FS9A 2GP9B 1ZMNA 1DANH 1UMAH 1GGDC 3KQDA 1CE5A 3SHAH 3RU4E 1S81A 1P02A 1XUIA 2IOTA 2R0KA 1GBBA 5EW2H 2B8OH 4INKA 3RXLA 4Q7XA 1AI8H 2ANWA 2BOHB 3K2UA 2CF8H 1OSSA 1YBWA 3SNAA 3SUEA 1DY9A 1GMDF 1ABJH 3SU4A 3BG8A 3UQOA 3QX5H 2VVUA 3RMNH 4KELA 4XOJA 1O3BA 2ZEBA 3ATKA 3OY6U 2F9BH 1ZRKA 1YLDA 1AFQB 1ZTLA 1G32B 2O9QA 1NPMA 1WYKA 4WMFA 3RLWH 2W5EA 3MNBA 2ZDVH 2BVSH 3GY2A 3GY7A 2GKVE 1TGTA 1NRSH 2ESTE 1SR5C 2SGQE 1B7XB 1CGHA 3MO6A 1QRWA 3LIWA 1LHCH 3FZDA 2WV5A 4NIWA 3O8CA 4I7YH 1FN8A 2FLRH 3TH4H 1O3FA 2OBQA 4X6MA 3ZZ3A 3M61U 2ZCHP 5ESBA 1O33A 1S83A 4XSKU 4KTUA 1TOCB 1TX8A 4MG3A 3DFJA 2FOFA 2Y5HA 1ID5H 1ESBA 1WTHD 4CRAA 1UK2A 5FX5A 1Z6EA 2ZDMA 1KXDA 4Y7AA 1FXYA 1NU7B 5C67A 1A0HB 1QRXA 1VCQA 1WBGB 1GJ7B 2ZU3A 2OINA 1CHOF 1SB1H 2ZP0H 4IN2A 1UTPA 5HMAA 1FDPA 2C93B 4TYDA 3P17H 4OS4A 1BRAA 4FXGH 5C1UA 3O8BA 2R9PA 1NRNH 3T2NA 1V3XA 1AWFH 1GCDA 2TIOA 2O8MA 2PFEA 1MZDA 1EZUC 2BZ6H 1MMJN 1TPSA 1O2LA 2GDEH 2AGEX 1AVWA 3UNRA 3RXSA 5GDSH 5DGJA 4M7GA 3EAJA 2G4TA 1CVWH 1MH0A 1RIWB 1GMDG 1AIXH 4I8LA 6LPRA 1C5ZB 4TY6A 4A7IB 2CHAC 2FMJA 2FS8A 1O36A 1T4VH 3T28A 2J94A 1V2WT 3VFEA 5LH8A 1O3EA 3ITIA 3VB3A 1MTUA 1BHXB 4GHTA 5LGOA 5G4BA 1GBEA 1EJNA 1X7AC 3NZIA 1O2XA 1CO7E 2A4QA 1DICA 3Q77A 4MPVA 1NO9H 1TGNA 3M35A 2ZDLA 5H4IB 1O2ZA 3LPRA 1BJUA 1OS8A 3RXQA 1BTZA 1D6WA 2ZDNA 4O9VA 4X1RU 3TJOA 1WV7H 1TQ0B 2ALVA 1BMNH 2FI4E 1IQLA 1K1OA 1O3OA 1BTWA 1QFKH 3GY6A 5EG4A 2NU2E 3SU0A 1EKBB 1S6FA 2BDCA 2LPRA 2YNBA 3MFJA 3PB1E 4INLA 4Y0ZE 5T3HA 1UHBA 4DIHH 2FOMB 3MYWA 4H6TA 4IS5A 3S0NA 1LVYA 5GCHF 2AH4X 1MUEB 1V6DA 3GY4A 1GJDB 1JRSA 2BD4A 4X1SU 1LTOA 1CHOG 4MTBA 2BD5A 1BB0B 1VGCC 1P12E 3F68H 7ESTE 2Z7FE 4I8HA 3HPTB 1ZTKA 1BZXE 1Z1IA 2XCNA 3SJ8A 1HAIH 1HJ9A 3A83A 3MNXA 2ZNKH 2ZG0H 4U30A 1D3QB 2GV6A 2OP9A 2CMYA 4X0WU 4B71A 1EP5A 1BJVA 1LHEH 3CENA 1E34B 2J9NA 1W12U 2UUJB 1DVAH 1IQIA 3M7UA 2GMTC 1C1WH 4JZDH 5GIBA 3RXJA 1QJ7B 1FIZA 1GI8B 1FY5A 4Y7BA 1JRTA 2OUAA 3NXPA 1RGQA 1FAKH 1TNIA 2FYQA 2FI5E 1HAZB 1C2GA 5JB8S 1BCUH 2Z9LA 3MTYA 5AF9H 3LKWA 3P95A 1A61H 1GL0E 1ELDE 1C5VA 2C4FH 1LVMA 1EAWA 1EB1H 1MD8A 1ZGIA 1ZPZA 2ANMH 3SNEA 1FONA 2Z9IA 1ZMLA 2JKHA 5K7RA 3S9AA 2BDGA 1C2KA 1O3PB 2Z3CA 4AOQA 1D3DB 1O31A 3MO3A 3SGAE 2GD4B 1HLTH 2A32A 2ASUB 1S85A 2W3IA 1SFIA 1LVOA 3OX7U 1ETSH 1K21H 2FESH 1FIWA 1SHYA 2Q6FA 2AIQA 4BAKB 1C2EA 1NM6A 3F9FA 5A8ZA 4D9RA 4ABBA 1XUKA 2H2ZA 3ZV8A 2C8WB 3ESTA 1C1VH 3HGPA 3Q3YA 3RM2H 1TB6H 1TOMH 3JZ2B 4Z0KA 1ZJKA 1KSNA 4CRBA 2XC4A 3BTHE 3BG4B 1UCYK 2B5TB 2BDBA 5GCHG 1W2KH 4JZFH 1EP6A 4NA8A 4J2YB 5EXNA 5A0AE 2G81E 2ZHEH 3AASA 3LH3A 4ZKSU 4FUJA 1NFWA 1EUFA 4ABFA 1NY22 1C5YB 1E36B 2RA0A 2YOLA 1FV9A 2JH0D 2OCVB 4Y71A 4WF8A 3R3GB 3D62A 1PYTD 3SU6A 4NIYA 1CA8B 1GI6A 3E1XB 3GYLB 6GCHF 2FPZA 1KXFA