2QIQA

Structure-based design and synthesis and biological evaluation of peptidomimetic sars-3clpro inhibitors
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
301
structure length
301
Chain Sequence
AGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Replicase polyprotein 1ab
publication title Structure-based design, synthesis, and biological evaluation of peptidomimetic SARS-CoV 3CLpro inhibitors.
pubmed doi rcsb
source organism Sars coronavirus
total genus 83
structure length 301
sequence length 301
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2qiqA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qiqA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qiqA02
1K1PA 1A5HA 4ABHA 1AHTH 4JZIA 4AORA 4YLUA 1TPAE 3VB7A 2ODQA 3KF2A 1C5WB 1KTTB 3Q3YA 1GHAG 4QT8C 3RXPA 1YCPM 1HLTH 1D3TB 1CGIE 1LVMA 1C5UA 1O2VA 5JBCS 4GCHG 1FNIA 4WMFA 3UNRA 4MNWA 1Y3VA 8ESTE 2CV3A 1W8BH 3SQEE 1LHFH 2WV4A 3M7TA 1TQ7B 3P8GA 1GHBG 1C1TA 1T7CA 1UTOA 5DP3A 1KY9A 3AAUA 4OGXA 2ZHEH 2EI7A 1A3BH 3BTWE 1HCGA 2Q6GA 1C2HA 1CGHA 2OXSA 1XMNB 1BBRE 1G32B 2ZU4A 2XBVA 1ZHRA 3GY4A 2VIVA 7LPRA 4D76A 2G52A 4F4OC 1ZHPA 1P2KA 3LU9B 2R3UA 1GGDB 1TABE 3KN2A 1GI2A 1O2XA 2D8WA 1CGJE 2OCVB 2FOFA 1K1OA 1QA7A 3ZZ8A 3RXFA 3P95A 3SO3A 4B76A 1BUIA 3UNQA 4NWLA 2GT8A 1F7ZA 3V13A 4J1YA 3BTEE 1MU6B 4AN7A 2ZHQH 2PV9B 1QJ1B 2H2ZA 1EOLA 1KYNA 2SNVA 4FUHA 4WH8A 1ZGVA 1YPMH 3OX7U 4IMQA 5DJ7A 4CRDA 4I8KA 1QRWA 1AQ7A 1YLDA 2UWOA 5FBIA 1TNLA 2Y80A 2STAE 3MNBA 1QFKH 3M5MA 5C5OA 3A7TA 4OS7A 1HAZB 3U8TH 1TAWA 4X1PU 1W11U 1IQJA 2Z9JA 1GJ7B 2RG3A 4AZ2B 4WXIA 3AAVA 3M7UA 5TCCA 3MOCA 2H9HA 4NGAH 4IBLH 3SBKA 1YPEH 4CRCA 2BD7A 4NSYA 6GCHF 2FO9A 1S85A 2PWXA 1TNGA 1KDQB 1E36B 1TX6A 2HOBA 2BY8X 1ZRKA 2Q6FA 1OP2A 2BD5A 3HK3B 3ZV9A 2IOTA 1HXEH 4ZROA 3FVFB 5C5NA 1O3HA 3A7ZA 3ESTA 1RS0A 4A1TA 3SJIA 3UFAA 2BZAA 1AVGH 1NU9A 2VVVA 5FHTA 3VB6A 1GI6A 3NUMA 1ELCA 1D6WA 2FM2A 5HM9A 1YPHE 3EAJA 1ZR0A 2FIRH 3MFJA 2QYIA 2ZHFH 3RMMH 1ETTH 1O39A 1BOQA 1O3JA 2XCNA 4MNXA 1THPB 3MO6A 4X8TH 2BTCE 1AIXH 5JYIA 4NA8A 3TH2H 2GT7A 4ZXYH 4AB9A 4AFUA 1HGTH 2PTNA 2OINA 1C5LH 1GBBA 1A7SA 2QGRA 1JWTA 1AUJA 2JH5D 2K1QA 3LONA 1BRCE 1K22H 1D3DB 1HAHH 2BLWA 4Y79A 3LH3A 3U69H 4ZUHA 2DE9A 4JZ1A 5L30H 1PPBH 3BG4B 5SGAE 4X0WU 1EPTA 2WYJA 4Q7ZA 1V2JT 1XX9A 2WUCA 1GG6B 3BTTE 1A3EH 1ZRBA 2WPHS 5A8XA 3K6YA 3BF6H 3KNXA 3LGYA 2BOHB 1B5GH 4OS1A 1EUFA 1SHHB 4ISOA 2ZFQH 1BDAA 3MH4A 1S0RA 4AYVB 4FU9A 2GV7A 1S0QA 2GMTB 2ZGHA 3UR9A 1WV7H 9ESTA 1B0FA 4OGYA 1CO7E 2BLQA 4B73A 1E35B 1P05A 2H9TH 2HRVA 1C5YB 2OC0A 1L1NA 3T29A 1XUGA 1ESBA 1DE7H 4AFQA 3M7QA 4UFGH 1P06A 4IW4E 3E16B 1O2ZA 3HKJB 1AWHB 1BJVA 2BOKA 1B7XB 3QK1A 5JDUB 3IWMA 1GL1A 1VJAU 5DP5A 4A1XA 3ZZCA 1VCPA 4A1VA 1P8VC 3ITIA 1EJMA 1SI5H 4MTBA 2HGTH 1K1JA 1O2LA 2Y7ZA 2ZU3A 1TGCA 3R0FA 1UTMA 1NROH 2A2XH 1NO9H 1G2MA 4CRBA 2BMGB 3A7VA 4ISLA 1OYQA 1A4WH 1OWJA 2P16A 9LPRA 3MU0A 3U1JB 3LGTA 1Y5BT 3LGWA 1P03A 1C2GA 1ZTKA 4GVUA 2XYAA 1HAIH 3LH1A 1CBWC 2IN2A 1BRBE 1BZXE 2BZ6H 4ZH8A 3PMHB 3LGVA 3RUOA 4IC5A 2ESTE 3P6ZB 2H9EH 1GHVH 2BVSH 1P09A 2BDAA 3SJ8A 4ZHLU 2P59A 2I6SA 3OU0A 1ZOMA 1JRSA 5FPTA 3SNEA 1ACBE 3MU5A 1D4PB 1O2TA 3SGQE 4DCDA 4CHAC 1ARBA 3ZYEA 4CREA 2BQ6B 4DOQA 1FZZA 1OYTH 4ZHMU 2KAIB 2TBSA 2ZU5A 2FP7B 2P93A 4BXWA 1KSNA 3MNSA 4O9VA 2XBWA 2BX3A 3S9CA 2ZPRA 1UTKA 2QN5T 1T31A 2F9BH 1SGRE 3C27B 5JBAS 5FCKA 3G01A 4I31A 1UJ1A 2ZDMA 2VIDA 2ZHDA 3ZV8A 1GI8B 3D23A 1GJDB 3C1KA 4NFFA 1LHGH 1EZUC 1SLWB 4UDWH 1BA8B 1NS3A 1BHXF 5BRRE 4CHAB 1UVUH 1QRZA 2C90B 1QL7A 3SU1A 1PPHE 2FOCA 4Y0ZE 3EA9A 1AWFH 1DWBH 1SGIB 4UD9H 3F1SB 2A32A 1TPSA 1RIWB 2A0QB 2BDIA 1HAVA 4WWYA 1TIOA 2GCHF 1AFQC 1QBOA 3RMNH 3ZZAA 3A89A 4BXSA 1WSSH 1W10U 2HWLB 3MI4A 4XE4A 4H6SB 1O2IA 1V2UT 2CJIA 1GI0A 4BAMB 3HGPA 1CHGA 1O3AA 1MD7A 3MU4A 1THSH 5LPRA 3SU0A 2UUKB 5E0GA 1FY1A 4FVDA 2C8YB 4TY6A 5ESTE 1SGCA 2ZTZA 1OS8A 4JMYA 3BSQA 3DHKH 3GY6A 2AH4X 3RXIA 4AGKA 1ZMJA 1SGFA 2QC2A 3PLPA 3NXPA 1K1IA 3MNCA 4PROA 2RA3A 3P8NA 4MG3A 1GBFA 1O2RA 1OWEA 2GD4B 1TPOA 2VIQA 1F0RA 1C2JA 3ZYDA 4JZFH 1JIMA 2QAAA 1TMBH 2AS9A 3BTQE 1TLDA 4BTTB 2AMQA 4ZKSU 2RA0A 3FP8E 1MMJN 1TMTH 1C5SA 3QLPH 1GDQA 4B71A 4CBNA 3A7XA 1NRSH 2AMPA 1JMOH 3S9AA 1BBRH 2VGCB 1HJAC 6CHAC 1SGNE 3UTUH 2XRCA 1MD8A 2HNTF 4Y7AA 1HYLA 3E91A 1YP9A 5GWZA 2UWPA 2ZGCA 3SUFA 1NFUA 2A2QH 1ZTJA 2VJ1A 2ANYA 1BJUA 1HAPH 2ULLA 2SGDE 4Y0YE 1SQAA 4ABBA 5L2YH 1Q3XA 1YCPH 4X8UH 2NU1E 1U6QA 1DUEA 7GCHG 1P12E 1WQVH 2Z3CA 3LIWA 4BNRA 1OXGA 1BMAA 1ETRH 1F5RA 3GCHC 1HV7A 3RU4E 1ZMNA 2FX4A 1GBMA 2NU2E 1ELFA 1O2WA 1OSSA 5JPMH 1ZYOA 1LVBA 2JKHA 4I33A 4K1EA 1BITA 1HAGE 5DP9A 1AGJA 2ALPA 3F9FA 1T8LA 1O2HA 1TGSZ 2O9QA 3BN9A 1MCVA 3O8BA 2ZIQH 1GBDA 2P3TB 4X1SU 1TGTA 1EASA 4YO9A 1HPGA 7ESTE 4VGCC 2PUXB 1W7XH 1THRH 1O30A 1VITF 2VIPA 1V2QT 2A4RA 3FFGA 2XXLA 4I7YH 3NPSA 1KXBA 3SI4H 4BTUB 1YYY1 2GTBA 5DP8A 3RXDA 3ZVAA 3ODDA 3EGKH 4CRFA 3LJOA 1GMCF 1MKXH 1ZSLA 2F9PA 4FUJA 5A0CA 2OC1A 1ZTLA 1SBWA 3SU6A 2GDEH 2TIOA 4ZAEA 4M7GA 1MAXA 1CT2E 1TX7A 2P3UB 5E0HA 3GYMA 1N8OC 4ISNA 3GDVA 1AZZA 2FS8A 2FESH 1G2LA 1F92A 4Y7BA 1O2YA 1GMHG 3MMGA 2PKSC 1AU8A 5I25A 1AE5A 2ANMH 2PGBB 3SHAH 1UVTH 5E2OA 1RTLA 1UO6A 1CU1A 2G5NA 1DFPA 1SFIA 1CSOE 3SGBE 4D7GA 5JB8S 1XUFA 2BDHA 3U8OH 5GCHF 3R3GB 1UTLM 2ZCKP 4TY7A 3UWJH 2ZDKA 3STIA 1ABIH 1TQ0B 3GY5A 5EGMA 3GCNA 1O2OA 3B23B 3SJ9A 5CHAB 2BLVA 1AZ8A 2P3FH 3RXLA 2KAIA 1A0HB 2QXJA 1TRMA 2D26C 3TK6A 5EXNA 1CA8B 1GVLA 1XXFA 2QXHA 4X8VH 1BRAA 3A80A 2WPJS 3A88A 3ATKA 2R0KA 2O8TA 3U8RH 1DOJA 1O0DH 1MKXK 1DXPA 1GI4A 2FS9A 1GCTB 4DVAU 1AI8H 1NN6A 1EAUA 4X1NU 4JZDH 1MH0A 1K21H 3MTYA 3DA9B 5AHGH 3Q3XA 4E05H 4F49A 3MU8A 1CQQA 2AMDA 1GHAF 1W12U 4RKJB 2G00A 4Y8ZA 2ODPA 1O5GH 1O3DA 3F9EA 2FOMB 1O38A 2F9UA 3ZZ5A 1LTOA 1DUAA 3NZIA 1O3LA 4YM9A 1UK3A 1VITH 1FY5A 5CMXH 1GCDA 2PLXA 4AG1A 1CA0C 1GJBB 1C5QA 1GHBF 1NM6A 2GCTC 4JYVH 3QWCH 2O8MA 1O5BB 1Z8IB 3BTGE 1MTWA 2AFQB 1VJ9U 3NCLA 1DX5M 3TU7H 3UOUA 4FXGH 2FWWA 2ZFRH 5LPEA 4FUBA 3GDSA 2QV1A 4AX9H 1DXWA 2BY7X 1PYTC 5IYTA 4DIIH 4BAQB 1ZPCA 2F3CE 3HK6B 1DY9A 1C4Y2 1LCYA 3KIDU 4GPGA 4FUFA 3PTNA 4A7IB 1TALA 3ODFA 4K69A 3ZVEA 1KXEA 3GCOA 4IMZA 3GOVB 2J92A 1TWXB 2IJOB 4XOJA 1NU7B 2H6MA 3V7TA 1Z8JB 1LQDB 2FI3E 5HMAA 1UHBA 2FODA 2ZO3H 2CMYA 2EEKA 1Z1IA 4AGJA 4YT6H 3A87A 2BQWB 2J38A 4ABDA 1HUTH 1IOEA 2QF0A 2P94A 3E6PH 3JZ1B 1F5KU 2BY5X 1TYNA 5F8TA 3V0XA 1UTPA 1SGDE 2CF9H 4O97A 2JETC 2R9PA 1C1SA 4WXVA 1GBAA 2FXRA 2BD4A 4CR9A 1KLTA 5A8ZA 3RM0H 3ZZ7A 4YLQH 1QJ7B 5F6MA 3HPTB 1FAXA 3TVJB 2ZG0H 2FOGA 2GP9B 1N6XA 2Z9IA 3B8JA 1IHSH 4H6TA 2CF8H 2G51A 5A2MH 2XCFA 1C2MA 1QB1A 2G55A 4DURA 1FY8E 3T2NA 1EZQA 2A5KA 1C1WH 4K2YA 2FEQH 3NK8A 3QZQA 2ZECA 3VB3A 1ESAA 2SFAA 1ESTA 3BTDE 4UFEH 3VXEH 3A8DA 1PFXC 3O8DA 1XUHA 1KXFA 3GCTG 3ZZ6A 1TBRH 1XUIA 4MLFB 1ELEE 1QHRB 3OY5U 1NFXA 2ZFTA 1P2OA 4RN6A 1XVMA 4I8LA 5EXLA 3ATWA 1E34B 1GJCB 4AYYB 1QTFA 1O3PB 2ZQ2A 3AW1A 3FAOA 1W0YH 1J16A 3E3TA 1O3EA 4X1RU 1FLEE 2VIWA 1C5ZB 5FPSA 3PLBA 4ABJA 1NPMA 3RXMA 2C8WB 1PYTD 1TE0A 1YPJH 3F9HA 2O8LA 1HAOH 1AVWA 4CR5A 1TGBA 1DVAH 3MH7A 2GX4A 1A1RA 3SU4A 1ELTA 2PUQH 4X6OA 4Z0KA 2A7HA 1BMMH 6LPRA 4INLA 4A92A 1Z6JH 2OUAA 3MNXA 2A4OA 1C1VH 1WYKA 3LPRA 1ZGIA 3RXKA 2ZGBH 1EJAA 3ZZ4A 1GMDG 1BCUH 3SV6A 1T8NA 4THNH 3RXQA 5EXMA 1FN6A 2ZDLA 5FX5A 1QA0A 4Y8XA 2H5CA 4AOQA 2Y5GA 4KTCA 1EKBB 2FMJA 1BTPA 4H42U 1AB9C 5DGJA 5C2ZA 1JOUB 1C1UH 1SOZA 2Y5FA 4WJG2 3SW2B 1RTKA 1O3OA 1ZPZA 1G37A 2ZNKH 2HNTE 6GCHG 1LHEH 3RXUA 1LPGB 1GHZA 3A84A 1C5TA 1HIAA 3TJUA 1WU1A 1DS2E 3RLYH 3UWIA 4O3TA 3MHWU 2ZPQA 4GAWA 1BTYA 4ABAA 1O2SA 3LGIA 1F5LA 4K1SA 1FIWA 4ESTE 3TGKE 2VWMA 1D6RA 2F9NA 1AY6H 3M5LA 3UY9A 1S84A 4NA9H 4FUCA 1D3PB 4LOYH 1TBZH 1L4ZA 1H9HE 3HATH 3U9AH 1F0TA 2AGEX 3F9GA 1EAXA 3PB1E 3KHVA 5DKMA 3QTOH 1TA2A 1DT2A 1H1BA 1C4V2 2STBE 3ATLA 4HI3A 1EB2A 4KTSA 1CHOG 1EZXC 2GGVB 4DW2U 8GCHF 4X2XA 3QDZB 2FI4E 1KLJH 1QL9A 2CN0H 2BHGA 4MPUA 2XBYA 3B9FH 4TYDA 2LPRA 4WF8A 5ETXA 1QURH 1GPZA 2FPZA 2B8OH 1W2KH 3SNAA 2PSXA 1H9LB 3S7HB 2VU8E 4OS5A 4JCNA 2YNAA 1ABJH 3SHCH 4NZQA 1JRTA 2O8WA 4LXBH 3QX5H 2PTCE 1RD3B 4K1TA 4D8NA 3RDZA 1A2CH 2OC8A 1QQUA 2OQ5A 1AKSB 1Z8RA 1SR5C 4K60A 3TH3H 3SV8A 1EP6A 3M3TA 4KP0A 3SV7A 3TNSA 2A31A 1ANCA 4R8TB 2PHBA 1RGQA 1Y8TA 4XFQA 1ZMLA 3RXEA 3RM2H 3P70B 1ELBA 1PQ7A 3GY2A 1RXPA 2TRMA 2D2DA 4JYTA 4WMDA 1K9OE 1HXFH 3BG8A 3BTHE 2ZQ1A 4AB8A 4J2YB 4ZKRU 4O03A 3ZZDA 2J4IA 3RXVA 2XWAA 4DIHH 1CVWH 1O36A 3CS7A 2J94A 5FCRA 8KME2 1L1GA 1MTNC 1SFQB 2J34A 4YOIA 4GHQA 1C5MD 1MCTA 3Q00A 1Y5AT 4UFFH 1L0ZA 2RCEA 5H4IB 4JK6A 1OWKA 1ANDA 1V2VT 4AFZA 2A5AA 2OBQA 3KL6A 1SMFE 1L4DA 4AG2A 3D65E 1CBWB 5ESBA 4MPVA 2FTMA 1O5DH 1A0LA 5CE1A 1GHYH 2G81E 2V0BA 4D7FA 1S5SA 4Q7YA 4NIVA 4Y10E 1DM4B 1J17T 1FIZA 1SGYE 3URDA 1ZJDA 2ILNA 3SNDA 1XKBC 1VGCC 3BIUH 3SU5A 3AASA 3MH5A 3TPIZ 1DDJA 2ZC9H 1A61H 1EAWA 3EBNA 3A7WA 1GVZA 2B5TB 2NU4E 4A6LA 4SGAE 3L3TA 1H9IE 1FXYA 1UCYK 1KDQA 1A0JA 1SLUB 3FP6E 2AIQA 2PKAB 4UE7H 1FONA 2PR3A 1T4UH 1O31A 1WBGB 4NIYA 1O2GH 3EYDA 4FUDA 1OP0A 3MWIU 5EU8A 2HPPH 1B0EA 2ZDAH 1GWAA 3GY3A 1SB1H 1PPZA 1XM1A 1UK2A 1AFEH 3VGCC 2OTVA 1WCZA 3ATIA 3KQCA 5T6GA 1BTZA 4CH2B 2VINA 1P57B 2PFEA 1LPKB 1AFQB 2FOBA 2ZA5A 2W7UA 4R0IA 2Q6DA 1S83A 1C2FA 3A86A 2FYRA 1TMUH 3FANA 1MKWK 2A7CA 1Q2WA 7GCHF 3Q76A 1JXPA 2Q1JA 2HVXA 1YPGH 2VB0A 5A0BA 1G3CA 2D1JA 2BVXH 3ENSB 2BXUH 1HBTH 2VVCA 3H7TA 5FBEA 5T6DA 5DP6A 5FXLA 1J14A 1W7GH 1NT1A 4U30A 4YESB 4XBBA 1XXDA 2W5EA 1YC0A 3SU3A 4FUEA 1V2RT 2WINI 4GSOA 1SQOA 2BX4A 1ZZZA 2PSYA 5DP7A 1YF4A 5HXFA 1QR3E 4BAHB 2V6NA 1P9SA 1BTXA 2FOHA 1H8DH 1SG8B 1V2ST 3PM3A 2GVFA 2ZFSA 2BYAX 1W14U 1EZSC 3AVZA 3GDUA 2OD3B 4K3JA 5JB9S 2QY0B 4RSPA 2BB4A 3JZ2B 3D49H 3EE0B 3KQBA 4LK4A 1HJAB 1SVPA 6CHAB 1ARCA 5EQSA 1K28D 1E37B 2BVRH 5L6NH 2BM2A 1O3FA 5AFZH 3IG6B 3T5FH 8LPRA 2AEIH 4JZEH 1C2LA 1EB1H 1QRXA 1WAYB 4OS6A 3E8LA 2R2MB 1YPHC 3BV9B 3L6PA 3ELAH 3DT0H 4HFPB 4OS4A 1LQEA 2VIOA 3TH4H 2Z9GA 4CBOA 3RC6A 3M36A 3K2UA 1O2UA 3TIUA 1P3CA 3GCHB 1K1LA 2XC4A 4A5TS 2JH6D 4KKDA 5EPYA 4X1QU 1AKSA 2HNTC 1MZDA 1P01A 1UVSH 2VWLA 1LHDH 5BPEA 4MPXA 1VR1H 2BDGA 1E0FD 4ABIA 2QA9E 4B74A 1O33A 2H1UA 4WY3A 1CE5A 3UR6A 1IQHA 1BMNH 1J8AA 1IHTH 1NFWA 2FTLE 4VGCB 1WOFA 4Y8YA 3SUEA 1UCYE 5EW2H 1SLVB 2IPHA 1GJ6A 1CT4E 3RC4A 1EPTC 1H4WA 3CS0A 1TNHA 5TCAA 1PPFE 1TNJA 5EW1H 1MUEB 1OOKB 1Y59T 5L2ZH 4DY7B 2CHAC 4FUIA 2Z94A 3TK5A 3TJNA 4YTAA 1N8OB 3D62A 1AVXA 2NU3E 3L33A 3K9XB 1FPHH 5IDKA 2A4QA 3RXHA 2FLRH 2XTTB 1MTSA 1L2EA 4YOGA 3KCGH 3MU1A 2FOAA 2V3OH 4TWWA 3PTBA 1OWHA 1ZSJA 3RP2A 1S6FA 2PKSB 1C2DA 3F68H 5F8ZA 3SU2A 5A8YA 1PPEE 3ZZBA 2VWNA 1IQMA 1KXDA 2PGQB 5T6FA 1C1QA 2CHAB 2QCYA 2P8OC 2FZZA 2ZF0H 1C5PA 3M61U 1O5FH 2Y82A 2AERH 4NCYA 1XUJA 5GDSH 1FDPA 1EATA 2G4UA 2WYGA 1QNJA 4TPYA 1C1NA 1QB6A 5GJ4B 1O2JA 2ZPSA 1SQTA 1Z7KA 5C1XA 4XSKU 2F9OA 4NFEA 1G36A 4WH6A 3SJKA 2J2UA 1QJ6B 2ZGXH 1LVOA 2FOEA 3DFLA 2SGAA 3RXJA 2LNCA 5DG6A 1F0UA 2AGIX 3E1XB 4GCHF 3M3SA 4SGBE 2PW8H 1UK4A 3UQOA 1O2QA 2WV5A 1GBKA 1O35A 1GJ4H 2PKAA 2ZFFH 2WPMS 1O5AB 2FX6A 2SGPE 1HAYB 3FZDA 1L1JA 4XBDA 5GXPA 1EQ9A 1OWDA 2P95A 2UWLA 1ZLRA 1TB6H 1TFXA 1MBMA 2AIPA 3WY8A 2I6QA 2ZU1A 1A5GH 4Y71A 2W7SA 1NRRH 4JK5A 1C5RA 1VCWA 1Z8GA 1EJNA 3PMJA 2WPKS 3OYPA 5PTPA 3ZVBA 2R2WU 4XDEA 2A5IA 2BQ7B 4BTIB 2VH0A 1OPHB 1CA0B 1HRTH 2G4TA 2GCTB 3A7YA 1GI9B 2O8UA 3SGAE 1WTGH 3BTFE 3ZZ3A 2Y6TA 1UMAH 4ISHH 4K8YA 3T28A 1GGDC 2FDAA 5C1UA 2ZEBA 2FYQA 5G4BA 1D9IA 1O5CB 1HJ8A 1Z6EA 2Z9KA 3PYHA 1IQEA 3U98H 1LKAA 4IGDA 1D3QB 2TGTA 3V12A 1ZPBA 3PROA 1YLCA 3GCTF 3LJJA 2THFB 1NZQH 1YGCH 3KGPA 3EA7A 2B9LA 1IQIA 1QIXB 2NWNA 2WPLS 5C67A 2FLBH 4ZXXH 2DUCA 4RKOB 5DP4A 3KQDA 5JBBS 1C1OA 1OWIA 2ZI2H 1P2QA 1AUTC 4X8SH 3TGIE 1Y3YA 3SQHE 3IITA 3BTME 1YBWA 1LKBA 2YOLA 1C2EA 1EP5A 2BY9X 1EAIA 2XW9A 3Q3KA 1DWEH 3LGUA 1O3IA 3T25A 5TJXA 1O37A 2JETB 1Y3UA 1XKAC 5HYOA 4KTUA 1SGFG 2UUJB 3N7OA 3PWBA 1GMDF 2FI5E 3GISB 3M5NA 4GHTA 4KGAA 3SV9A 2A7JA 2F9VA 4UEHH 1LPZB 2VVUA 3GY8A 3HGNA 1F2SE 3GICB 4IN1A 3ZVDA 4MNVA 4CRAA 1V2LT 2SGEE 3EQ0H 4HZHA 4MPWA 1FJSA 3QGNB 3SZNA 3A81A 3S7KB 1TOCB 1V2PT 2BLOA 2VWOA 3S9BA 1JIRA 2ANKH 4H4FA 1HAVB 1HJ9A 5E2PA 2CGAA 1QGFA 4JYUH 2TGPZ 1BIOA 2A45B 3E0NB 3M3VA 5FPYA 2ZCLP 1C5XB 3QUMP 1NRPH 1EX3A 1K2I1 1C9PA 1MU8B 6ESTA 4OS2A 1RJXB 3EDXB 4ZKOU 3VEQB 1GHXH 4NG9H 1LVYA 1AMHA 4U01A 2W26A 1ORFA 1IQFA 3UIRA 1TX8A 3I29A 5B6OA 3URCA 1TOMH 3BG4C 5FX6A 4Y76A 5EQRA 1GG6C 3TLOA 2R0LA 3PO1C 5EODA 1C1RA 4B2CA 3DUXH 1C1PA 4ASHA 2Z6BD 5K0HA 1DY8A 5F03A 4B1TA 1BB0B 4B2BA 2EA3A 1EOJA 3TK9A 1O5EH 1P3EA 1QCPA 3K65B 2GV6A 1CHOF 3SUDA 1GDUA 2Z9LA 1UVOA 4NIXA 5E0JA 1V2KT 2GMTC 4E06H 1GBCA 1V2TT 1NC6A 1GDNA 3MO9A 3LDXH 3PMBB 1ANBA 5GIBA 2Z3EA 4X2VA 4Y11E 5GPIB 1AB9B 3DD2H 1V6DA 2DE8A 4X6MA 4BAOB 4MDSA 4BANB 3PO1B 2AGGX 3F6UH 1DANH 1LHCH 3ZVCA 4Z6AH 1C9TA 1AN1E 3RU4T 1A5IA 2OC7A 3O8CA 1FUJA 3PWCA 2B7DH 5C3NA 1Y3WA 5E8EH 1MZAA 1O32A 3A8BA 3LKWA 3SI3H 2ZKSA 3SN8A 1P04A 2YNBA 2GKVE 4INHA 4ZHAA 4UONA 1FPCH 3VXFH 3M35A 1MTVA 4FUGA 2OP9A 4ISIH 1FV9A 3ZVGA 5I46H 1GI1A 2JH0D 3I77A 3RXGA 3P92A 3A82A 5AVDA 4MVNA 1BTWA 4LZ4B 3Q77A 3BIVH 2ZFPH 3E90B 1P9UA 5EG4A 4Q80A 4D9RA 2BD8A 4FVBA 3PLKA 3T26A 1ELAA 3CP7A 1DICA 1HB0B 1P2IA 1GI5A 3ATMA 1DSTA 4WMEA 1QY6A 3KEEA 3UPEA 2ZGJA 1WUNH 1ELDE 2QXGA 5EPNA 1TONA 3NKKA 1TPPA 3LC3A 1SGPE 1KXAA 1PPCE 2ZCHP 2W3KA 1T8MA 4X2YA 3QTVH 4X6PA 3VPKA 8GCHG 3RU4D 3U1IB 4E7NA 4ZMAH 4GUXA 3CENA 3LOXA 4ABEA 4ABFA 1UCYH 5DO4H 3A85A 5HM2A 4I8HA 2ZP0H 3BEFB 4ZKNU 3M5OA 1C5NH 3VB4A 1FY4A 1G3BA 1P2JA 3QGJA 3RC5A 3SORA 2ASUB 1G30B 1IAUA 1OKXA 4HGCA 3RXRA 4YOJA 2Z7FE 3QZRA 1C4U2 1PPGE 1P0SH 4GLYA 5J4SA 1Q31A 1W3CA 2VH6A 1LO6A 4U2WA 3RXTA 3A8AA 1K1MA 1GL0E 4X6NA 1Y3XA 2G5VA 3DFJA 2SNWA 3RXSA 2J9NA 1MKWH 1SGTA 1BRUP 2ALVA 1MBQA 1V2MT 1TBQH 2BD3A 3SNCA 1UVPA 1NFYA 2B0FA 1GVKB 1MTNB 1RRKA 1TA6A 1FQ3A 3UUZA 1RIWC 3STJA 1GI7B 3EA8A 3T27A 4Y6DA 3OTJE 4Q7XA 2OLGA 2BDBA 4HTCH 1TNIA 3GYLB 1WTHD 1IQGA 1J15A 2GZ9A 3FP7E 1HNEE 2OQUA 1O2MA 1C5VA 5T3HA 1NTPA 2EC9H 4AFSA 3UQVA 3E0PB 2V3HH 1T8OA 2TGAA 3W94A 2ODYB 3AW0A 3HKIB 1T32A 1TGNA 2C3SA 1YM0A 2GZ7A 2XBXA 4IN2A 5F8XA 3LT3A 2XWBI 3MYWA 5DK1A 1HDTH 4UFDH 2UUYA 2G8TA 1AE8H 2SGQE 1GBEA 4FU8A 1VGCB 1Y5UT 5A0AE 4WVPE 4B2AA 1DLEA 2WUBA 2BXTH 1V2OT 2ZZUH 5LPFA 5EOKA 3TITA 1UTNA 1CT0E 3M37A 2XC5A 1DSUA 3UREA 4B75A 1AD8H 1M9UA 5K7RA 4BAKB 1FY3A 2ZDNA 3VFEA 1P2NA 1MTUA 3O8RA 1N1LA 1XUKA 1P10A 3VB5A 5FAHA 1O3KA 1GJAB 2VGCC 1O2KA 1C2KA 1PQAA 3RXCA 3QN7A 1QBVH 1QL8A 4ABGA 1IQNA 2GCHG 1BMLA 1P2MA 2GZ8A 2ZTXA 1NRQH 4KELA 1BT7A 3RMLH 3KQEA 4E7RG 1TNKA 1GJ8B 1BTUA 3VGCB 4MNYA 4DT7B 1V3XA 2H5DA 3TJVA 1NESE 1KXCA 3SNBA 3BTKE 5JBTA 2TPIZ 4NSVA 3TGJE 1UHBB 1IQKA 4Q2KA 2VNTA 1SL3A 3RMOH 1PQ8A 2R3YA 2K7XA 1G3EA 1UTQA 1V2NT 3QO6A 4XBCA 2Y81A 2BD9A 1J9CH 2CXVA 1T4VH 4YT7H 3S69A 1ID5H 1KIGH 4TPIZ 1BHXB 1GBTA 1SOTA 3SOSA 3P8OA 1SPJA 1KTSB 4INKA 1BTHH 4I32A 2GDDA 2WPIS 3OY6U 7KMEH 1DLKB 2SGFE 3BEIB 1P11E 2Z3DA 1RTFB 1IQLA 4IC6A 1GI3A 1MQ5A 1VCQA 3SUGA 5ABWA 2XNIA 1F0SA 2EI6A 2ZTYA 1N6YA 1SHYA 1K1NA 2ZU2A 1YPLH 3T62A 1V2WT 1DITH 1TRYA 2A4GA 2F91A 1GJ5H 1GMHF 4CRGA 1Z71A 2M5TA 1ETSH 2QXIA 1O34A 1JBUH 2F83A 4D9QA 1FAKH 4FU7A 4TWYA 1YPKH 1GHWH 1SGEE 2V35A 5A09A 4I8GA 3RXBA 3S0NA 1SC8U 1NRNH 4I8JA 5J4QA 3PV4A 4CH8B 2BY6X 3BEUA 4NZLA 1HFDA 1PQ5A 1S81A 3ZZ9A 1G3DA 3GY7A 1KLIH 1GBJA 1O2NA 1BBRK 2HLCA 3W95A 4K5ZA 2ZDVH 5DPAA 2HPQH 4MQAA 4NA7A 5LGOA 5EQQA 1FN8A 1FMGA 3K6ZA 3ZVFA 3A83A 1GJ9B 1C2IA 2RDLA 2TGDA 1QB9A 4O3UA 1YCPK 5AF9H 1INCA 5CHAC 4NWKA 1MQ6A 1VITG 3I78A 1ELVA 1DPOA 1C1MA 3NWUA 1ZSKA 1RFNA 4U32A 3RXOA 3SJOA 3RLWH 2BDYA 5LH8A 4X2WA 2XC0A 3SV2H 1O3CA 3MH6A 1GMCG 1S6HA 1DWDH 5C20A 1O3MA 2UUFB 3OSYA 4DJZB 4DG4A 3PMAB 2EI8A 1GCTC 1DWCH 4BOHA 1QQ4A 2QIQA 1EPTB 1HIAB 1AO5A 1W0ZU 1LDTT 4LZ1H 3FZZA 1SGQE 1MAYA 1GBLA 2A1DB 5AFYH 1C5OH 3P17H 1SSXA 1PJPA 1VZQH 1E38B 2OBOA 3LC5A 2ZHWH 3TNTA 1NY22 1TRNA 1ANEA 1HAXB 2BD2A 1OP8A 3P8FA 1BQYA 2C8ZB 3TJOA 2ZWLH 2NU0E 3UOPA 1FI8A 5HGGA 2QF3A 5GCHG 5C1YA 1P02A 2Y7XA 2LIZA 3H7OA 1UTJA 1S82A 1EXFA 1GBHA 2ANWA 1OX1A 4YZUA 2C4FH 1XVOA 1QBNA 4NIWA 2Y5HA 1YKTA 4IS5A 1ZJKA 4K8BA 3V3MA 2P8OB 3RXAA 2AYWA 2BDCA 3H5CB 3A8CA 2C93B 4DGJA 1O3NA 1O3BA 1SLXB 2C8XB 1O2PA 1LMWB 3UNSA 1Z1JA 1GBIA 3MO3A 1W13U 2W3IA 1WQSA 1G9IE 1A46H 1O3GA 1H8IH 2HALA 2J95A 1X7AC 1ELGA 1ZHMA
chains in the Genus database with same CATH superfamily
1K1PA 1A5HA 4ABHA 1AHTH 4JZIA 4AORA 4YLUA 1TPAE 3VB7A 2ODQA 3KF2A 1C5WB 1KTTB 3Q3YA 1GHAG 4QT8C 3RXPA 1YCPM 1HLTH 1D3TB 1CGIE 1LVMA 1C5UA 1O2VA 5JBCS 4GCHG 1FNIA 4WMFA 3UNRA 4MNWA 1Y3VA 8ESTE 2CV3A 1W8BH 3SQEE 1LHFH 2WV4A 3M7TA 1TQ7B 3P8GA 1GHBG 1C1TA 1T7CA 1UTOA 5DP3A 1KY9A 3AAUA 4OGXA 2ZHEH 2EI7A 1A3BH 3BTWE 1HCGA 2Q6GA 1C2HA 1CGHA 2OXSA 1XMNB 1BBRE 1G32B 2ZU4A 2XBVA 1ZHRA 3GY4A 2VIVA 7LPRA 4D76A 2G52A 4F4OC 1ZHPA 1P2KA 3LU9B 2R3UA 1GGDB 1TABE 2KR7A 3KN2A 1GI2A 1COWD 1O2XA 2D8WA 1CGJE 2OCVB 2FOFA 1K1OA 1QA7A 3ZZ8A 3RXFA 3P95A 3SO3A 4B76A 2QF4A 1BUIA 3UNQA 4NWLA 2GT8A 1F7ZA 3V13A 4J1YA 3BTEE 1MU6B 4AN7A 2ZHQH 1EFRD 2PV9B 1QJ1B 2H2ZA 1EOLA 1KYNA 2SNVA 4FUHA 4WH8A 1ZGVA 1YPMH 3OX7U 4IMQA 5DJ7A 4CRDA 4I8KA 1QRWA 1AQ7A 1YLDA 2UWOA 5FBIA 1TNLA 2Y80A 2STAE 3MNBA 1QFKH 3M5MA 5C5OA 3A7TA 4OS7A 1HAZB 3U8TH 1TAWA 4X1PU 1W11U 1IQJA 2Z9JA 1GJ7B 2RG3A 4AZ2B 4WXIA 3AAVA 3M7UA 5TCCA 1VKYA 3MOCA 2H9HA 4NGAH 4IBLH 3SBKA 1YPEH 4CRCA 2BD7A 2KCOA 4NSYA 6GCHF 2FO9A 1S85A 2PWXA 1TNGA 1KDQB 1E36B 5KGOA 1TX6A 2HOBA 2BY8X 1ZRKA 2Q6FA 1OP2A 2BD5A 3HK3B 3ZV9A 2IOTA 1HXEH 4ZROA 3FVFB 5C5NA 1O3HA 3A7ZA 3ESTA 1RS0A 4A1TA 1WDIA 3SJIA 4XRNA 3UFAA 2BZAA 1AVGH 1NU9A 2VVVA 5FHTA 3VB6A 1GI6A 3NUMA 1ELCA 1D6WA 4RT1A 2FM2A 5HM9A 1YPHE 3EAJA 1ZR0A 2FIRH 3MFJA 2QYIA 2ZHFH 3RMMH 1ETTH 1O39A 1BOQA 1O3JA 2XCNA 4MNXA 1THPB 3MO6A 1H8HD 4RI0A 2BTCE 4X8TH 1AIXH 5JYIA 4NA8A 3TH2H 2GT7A 4ZXYH 4AB9A 4AFUA 1HGTH 2PTNA 5C0UA 2OINA 1C5LH 1GBBA 1A7SA 2QGRA 4FETA 3SYJA 1JWTA 1AUJA 2JH5D 2K1QA 3LONA 1BRCE 1K22H 1D3DB 1HAHH 2RFKC 2BLWA 4Y79A 3LH3A 3U69H 4ZUHA 2DE9A 4JZ1A 5L30H 1PPBH 3BG4B 5SGAE 4X0WU 1EPTA 2WYJA 4Q7ZA 1V2JT 1XX9A 2WUCA 1GG6B 3BTTE 1A3EH 1ZRBA 4DT4A 2WPHS 5A8XA 3K6YA 3BF6H 3KNXA 3LGYA 2BOHB 1B5GH 4OS1A 1EUFA 1SHHB 4ISOA 2ZFQH 1BDAA 3MH4A 1S0RA 4AYVB 2F43B 4FU9A 2GV7A 1S0QA 2GMTB 2ZGHA 3UR9A 1WV7H 9ESTA 1B0FA 4OGYA 1CO7E 2BLQA 4B73A 1E35B 1P05A 2H9TH 2HRVA 1MABB 1C5YB 2OC0A 1L1NA 3T29A 1XUGA 1ESBA 1DE7H 4AFQA 3M7QA 4UFGH 1P06A 4IW4E 3E16B 1O2ZA 3HKJB 4Z1MD 1AWHB 1BJVA 2BOKA 1B7XB 3QK1A 5JDUB 3IWMA 1GL1A 1VJAU 2J98A 5DP5A 4A1XA 3ZZCA 1VCPA 4A1VA 1P8VC 3ITIA 1EJMA 1SI5H 4MTBA 2HGTH 1K1JA 1O2LA 3N99A 2Y7ZA 2QE7D 2ZU3A 1TGCA 3R0FA 1UTMA 2JJ2D 1NROH 2J5UA 2A2XH 1NO9H 1G2MA 4CRBA 2BMGB 3A7VA 4ISLA 1OYQA 1A4WH 1OWJA 2P16A 9LPRA 3MU0A 3U1JB 3LGTA 1Y5BT 3LGWA 1P03A 1C2GA 1ZTKA 4GVUA 2XYAA 1HAIH 3LH1A 1CBWC 2IN2A 1BRBE 1BZXE 2BZ6H 4ZH8A 3PMHB 3LGVA 3RUOA 4IC5A 2ESTE 3P6ZB 2H9EH 3DSOA 1GHVH 2BVSH 1P09A 2BDAA 3SJ8A 1FX0B 4ZHLU 2P59A 2I6SA 3OU0A 1ZOMA 1JRSA 3PV2A 5FPTA 3SNEA 1ACBE 3MU5A 1D4PB 1O2TA 3SGQE 4DCDA 4CHAC 1ARBA 3ZYEA 4CREA 2BQ6B 4DOQA 1FZZA 1OYTH 2KM0A 4ZHMU 2KAIB 2TBSA 2ZU5A 4F48B 2FP7B 2P93A 4BXWA 1KSNA 3MNSA 4O9VA 2XBWA 2BX3A 3S9CA 2ZPRA 1UTKA 2QN5T 1T31A 2F9BH 1SGRE 3C27B 5JBAS 5FCKA 3G01A 4I31A 1UJ1A 2ZDMA 2VIDA 4Q4LA 2ZHDA 3ZV8A 1GI8B 3D23A 1GJDB 3C1KA 4NFFA 1LHGH 1EZUC 1SLWB 4UDWH 1BA8B 1NS3A 1BHXF 5BRRE 4CHAB 1UVUH 1QRZA 2C90B 1QL7A 2JJ1D 3SU1A 1PPHE 2FOCA 4Y0ZE 3EA9A 1AWFH 1DWBH 1SGIB 4UD9H 3F1SB 2A32A 1TPSA 1RIWB 2A0QB 2BDIA 1HAVA 2WZQA 4WWYA 3UAIC 1TIOA 2GCHF 1AFQC 1QBOA 3F2FA 3RMNH 3A89A 3ZZAA 1WSSH 4BXSA 1W10U 2HWLB 3MI4A 4XE4A 4H6SB 1WXRA 1O2IA 1V2UT 2CJIA 1GI0A 4BAMB 3HGPA 1CHGA 1O3AA 1MD7A 3MU4A 1THSH 5LPRA 3SU0A 2UUKB 5E0GA 1FY1A 4FVDA 2C8YB 4TY6A 5ESTE 1SGCA 2ZTZA 1OS8A 4JMYA 3BSQA 2HVYB 3DHKH 3GY6A 2AH4X 3RXIA 4AGKA 1ZMJA 1SGFA 2QC2A 3PLPA 3NXPA 1K1IA 3MNCA 4PROA 2RA3A 3P8NA 4MG3A 1GBFA 1O2RA 1OWEA 2GD4B 1TPOA 2VIQA 1F0RA 1C2JA 3ZYDA 4JZFH 1JIMA 2QAAA 1TMBH 2AS9A 3BTQE 1TLDA 4BTTB 2AMQA 4ZKSU 2RA0A 3FP8E 1MMJN 1TMTH 1C5SA 3QLPH 1GDQA 4B71A 4CBNA 5CDFE 3A7XA 1NRSH 2AMPA 1JMOH 3F0PA 1BBRH 2VGCB 3S9AA 1HJAC 6CHAC 1SGNE 2XOKD 3UTUH 2XRCA 1MD8A 2M2AA 2HNTF 4Y7AA 1HYLA 3E91A 1YP9A 5GWZA 2UWPA 2ZGCA 3SUFA 1NFUA 3MQKC 2A2QH 1ZTJA 5GNDA 2VJ1A 2ANYA 1BJUA 2V3MA 1HAPH 2ULLA 2SGDE 4Y0YE 1SQAA 4ABBA 5L2YH 4ACAA 1Q3XA 1YCPH 4X8UH 2K8IA 2NU1E 1U6QA 1DUEA 7GCHG 1P12E 1WQVH 2Z3CA 3LIWA 4BNRA 1OXGA 1BMAA 2VBCA 1ETRH 1F5RA 3GCHC 1HV7A 3RU4E 1ZMNA 2FX4A 1GBMA 2NU2E 1ELFA 1O2WA 1OSSA 5JPMH 1ZYOA 1LVBA 2JKHA 4I33A 4K1EA 1BITA 1HAGE 5DP9A 1AGJA 2ALPA 3F9FA 1T8LA 1O2HA 1TGSZ 2O9QA 3BN9A 1MCVA 3O8BA 2ZIQH 1GBDA 2P3TB 4X1SU 1TGTA 1EASA 4YO9A 1HPGA 7ESTE 4VGCC 2PUXB 1W7XH 1THRH 2YMSC 1O30A 1VITF 2VIPA 1V2QT 2LP6A 2A4RA 3FFGA 2XXLA 4I7YH 3NPSA 1KXBA 3SI4H 4BTUB 1YYY1 2GTBA 5DP8A 3RXDA 3ZVAA 3ODDA 3EGKH 4CRFA 3LJOA 1GMCF 1MKXH 1ZSLA 2F9PA 4FUJA 5A0CA 2OC1A 1ZTLA 1SBWA 3SU6A 2GDEH 2TIOA 4ZAEA 4M7GA 1MAXA 1CT2E 1TX7A 2P3UB 5E0HA 3GYMA 1N8OC 4ISNA 3GDVA 3WWBA 3FN8A 1AZZA 2FS8A 2FESH 1G2LA 1F92A 4Y7BA 1O2YA 2YMSB 1GMHG 3MMGA 2PKSC 1AU8A 5I25A 1AE5A 2ANMH 2PGBB 3SHAH 1UVTH 5E2OA 1RTLA 1UO6A 1CU1A 2G5NA 1DFPA 1SFIA 1CSOE 3SGBE 4D7GA 5JB8S 1XUFA 2BDHA 3U8OH 5GCHF 3R3GB 1UTLM 2ZCKP 4TY7A 3UWJH 2ZDKA 3STIA 1ABIH 5EJLA 1TQ0B 3GY5A 5EGMA 3GCNA 1O2OA 3B23B 3SJ9A 5CHAB 2BLVA 1AZ8A 2P3FH 3RXLA 2KAIA 1A0HB 2QXJA 3VG8A 1TRMA 2D26C 3TK6A 5EXNA 1CA8B 1GVLA 1XXFA 2QXHA 4X8VH 1BRAA 3A80A 2WPJS 3A88A 3ATKA 2R0KA 2O8TA 3U8RH 1DOJA 1O0DH 1MKXK 1DXPA 1GI4A 2FS9A 2KZ4A 1GCTB 4DVAU 1AI8H 1NN6A 5F53A 1EAUA 4X1NU 4JZDH 1MH0A 1K21H 3MTYA 3DA9B 2YMSD 3N7DA 3Q3XA 5AHGH 4E05H 4F49A 3MU8A 1CQQA 2AMDA 1GHAF 1W12U 4RKJB 2G00A 4Y8ZA 2ODPA 1O5GH 1E1QD 1O3DA 3F9EA 2FOMB 1O38A 2F9UA 3ZZ5A 1LTOA 1BMFD 1DUAA 3NZIA 1O3LA 4YM9A 1UK3A 1VITH 1FY5A 5CMXH 1GCDA 2PLXA 4AG1A 1CA0C 1GJBB 1C5QA 1GHBF 1NM6A 2GCTC 4JYVH 3QWCH 2O8MA 1O5BB 1Z8IB 3BTGE 3KYGA 1MTWA 2AFQB 1VJ9U 3NCLA 1DX5M 3TU7H 1YLNA 3UOUA 4FXGH 2FWWA 2ZFRH 5LPEA 4FUBA 3GDSA 2QV1A 4AX9H 1DXWA 2BY7X 1PYTC 5IYTA 4DIIH 4BAQB 1ZPCA 2F3CE 3HK6B 1DY9A 1C4Y2 1LCYA 2IJD1 3KIDU 4FUFA 3PTNA 4GPGA 4A7IB 1TALA 3ODFA 4K69A 3ZVEA 1KXEA 3GCOA 4IMZA 3GOVB 3KYFA 2J92A 1TWXB 2IJOB 4XOJA 1NU7B 4ASUD 2H6MA 3V7TA 1Z8JB 1LQDB 1W0KD 2FI3E 5HMAA 1UHBA 2FODA 2ZO3H 2CMYA 2EEKA 1Z1IA 4AGJA 4YT6H 3A87A 2AHME 2BQWB 2J38A 4ABDA 1HUTH 1IOEA 2QF0A 2P94A 3E6PH 3JZ1B 1F5KU 2BY5X 1TYNA 5F8TA 1E1RD 2QF5A 3V0XA 1UTPA 1SGDE 2CF9H 4O97A 2JETC 2R9PA 1C1SA 4WXVA 1GBAA 2FXRA 2BD4A 4CR9A 1KLTA 5A8ZA 3RM0H 3ZZ7A 4YLQH 1QJ7B 5F6MA 3HPTB 1FAXA 3TVJB 2ZG0H 2FOGA 2GP9B 1N6XA 2Z9IA 3B8JA 1IHSH 4H6TA 2CF8H 2G51A 5A2MH 2XCFA 1C2MA 1QB1A 2G55A 4DURA 1FY8E 3T2NA 1EZQA 2A5KA 1C1WH 4K2YA 2FEQH 3NK8A 3QZQA 2ZECA 3VB3A 1ESAA 2SFAA 1ESTA 3BTDE 4UFEH 3VXEH 3A8DA 1PFXC 3O8DA 1XUHA 1KXFA 3GCTG 3ZZ6A 1TBRH 1XUIA 4MLFB 1ELEE 1QHRB 3OY5U 1NFXA 2ZFTA 1P2OA 4RN6A 1XVMA 4I8LA 5EXLA 3ATWA 1E34B 1GJCB 4AYYB 1QTFA 1O3PB 2ZQ2A 3AW1A 3FAOA 1W0YH 1J16A 3E3TA 1O3EA 4X1RU 1FLEE 2VIWA 1C5ZB 5FPSA 3PLBA 4ABJA 1NPMA 3RXMA 2C8WB 1PYTD 1TE0A 1YPJH 3F9HA 2O8LA 1HAOH 1AVWA 4CR5A 2EY4C 1QZ8A 1TGBA 2KCYA 1DVAH 3MH7A 2GX4A 1A1RA 3SU4A 1ELTA 2PUQH 4X6OA 4Z0KA 2A7HA 1BMMH 6LPRA 4INLA 4A92A 1Z6JH 1NBME 2OUAA 3MNXA 2A4OA 1C1VH 1WYKA 3LPRA 1ZGIA 3RXKA 2WSSD 2ZGBH 1EJAA 3ZZ4A 1GMDG 1BCUH 3SV6A 1T8NA 4THNH 3RXQA 5EXMA 1K0HA 1FN6A 1YWUA 2ZDLA 5FX5A 1QA0A 4Y8XA 2H5CA 4AOQA 2Y5GA 4KTCA 1EKBB 2FMJA 1BTPA 4H42U 3PV5A 1AB9C 5DGJA 5C2ZA 1JOUB 1C1UH 1SOZA 1SQRA 2Y5FA 4WJG2 2KFWA 3SW2B 1RTKA 1O3OA 1ZPZA 1G37A 2ZNKH 2HNTE 6GCHG 1LHEH 3RXUA 1LPGB 1GHZA 3A84A 1C5TA 1HIAA 3TJUA 1WU1A 3NRLA 1DS2E 4RT0A 3RLYH 3UWIA 4O3TA 3MHWU 2ZPQA 4GAWA 1BTYA 4ABAA 1O2SA 3LGIA 1F5LA 4K1SA 1FIWA 4ESTE 3TGKE 2VWMA 1D6RA 2F9NA 1AY6H 3M5LA 3UY9A 1S84A 4NA9H 4FUCA 1D3PB 4LOYH 5EJZA 1TBZH 1L4ZA 1H9HE 3HATH 5EJ1A 3U9AH 1F0TA 2AGEX 3F9GA 1EAXA 3PB1E 3KHVA 5DKMA 3QTOH 1TA2A 1DT2A 1H1BA 1C4V2 2STBE 3ATLA 4OM9A 3U28C 4HI3A 4ACBA 1EB2A 4KTSA 1CHOG 1EZXC 2GGVB 4DW2U 8GCHF 4X2XA 3OE7D 3QDZB 2FI4E 1KLJH 1QL9A 2CN0H 2BHGA 4MPUA 2XBYA 3B9FH 4TYDA 2LPRA 4WF8A 5ETXA 1QURH 1GPZA 2FPZA 2B8OH 4HG6A 1W2KH 3SNAA 2PSXA 1H9LB 3S7HB 2VU8E 4OS5A 4JCNA 2YNAA 1ABJH 3SHCH 4NZQA 1JRTA 2O8WA 4LXBH 3QX5H 2PTCE 1RD3B 4K1TA 4D8NA 3RDZA 1A2CH 2OC8A 1QQUA 2OQ5A 1AKSB 4M9FA 1Z8RA 1SR5C 4K60A 5HIYA 3TH3H 3SV8A 1EP6A 1W0JD 3M3TA 4KP0A 3SV7A 3TNSA 2A31A 1ANCA 4R8TB 2HLDD 2PHBA 1RGQA 1Y8TA 4XFQA 2PP6A 1ZMLA 3RXEA 3RM2H 3P70B 1ELBA 1PQ7A 3GY2A 1RXPA 2TRMA 2D2DA 4JYTA 4WMDA 1K9OE 1HXFH 3BG8A 3BTHE 2ZQ1A 4AB8A 4J2YB 4ZKRU 4O03A 3ZZDA 2J4IA 3RXVA 2XWAA 4DIHH 1CVWH 3F2HA 1O36A 3CS7A 2J94A 5FCRA 8KME2 1L1GA 1MTNC 1SFQB 2J34A 4YOIA 4GHQA 1C5MD 1MCTA 2WV9A 3Q00A 1Y5AT 4UFFH 1L0ZA 2RCEA 5H4IB 4JK6A 1OWKA 1ANDA 1V2VT 4AFZA 2A5AA 2OBQA 3KL6A 1SMFE 1L4DA 4AG2A 3D65E 1CBWB 5ESBA 4MPVA 2FTMA 1O5DH 1A0LA 5CE1A 1GHYH 2G81E 2V0BA 4D7FA 1S5SA 4Q7YA 4NIVA 4Y10E 1DM4B 1J17T 1FIZA 1SGYE 5KECA 3URDA 1ZJDA 2ILNA 3SNDA 1XKBC 1VGCC 3BIUH 3SU5A 3AASA 3MH5A 3TPIZ 1DDJA 2ZC9H 1A61H 1EAWA 3EBNA 3A7WA 1GVZA 2B5TB 2NU4E 4A6LA 4SGAE 3L3TA 1H9IE 2GJGA 1FXYA 1UCYK 1KDQA 1A0JA 1SLUB 3FP6E 2AIQA 2PKAB 4UE7H 1FONA 2PR3A 1T4UH 1O31A 1WBGB 4NIYA 1O2GH 3EYDA 4FUDA 1OP0A 3MWIU 5EU8A 2HPPH 1B0EA 2ZDAH 1GWAA 3GY3A 1SB1H 1PPZA 1XM1A 4F55A 1UK2A 1AFEH 3VGCC 2OTVA 1WCZA 3ATIA 3KQCA 5T6GA 1BTZA 4CH2B 2VINA 1P57B 2PFEA 1LPKB 1AFQB 2FOBA 2ZA5A 2W7UA 4R0IA 2Q6DA 3F3BA 1S83A 1C2FA 3OFND 3A86A 2FYRA 1TMUH 3FANA 1MKWK 2A7CA 1Q2WA 7GCHF 3Q76A 1JXPA 2Q1JA 2HVXA 1YPGH 2VB0A 5A0BA 1G3CA 2D1JA 2BVXH 3ENSB 2BXUH 1HBTH 2VVCA 3H7TA 5FBEA 5T6DA 5DP6A 5FXLA 1J14A 1W7GH 1NT1A 4U30A 4YESB 4XBBA 1XXDA 2W5EA 1YC0A 3SU3A 4FUEA 1V2RT 2WINI 4GSOA 1SQOA 2BX4A 1ZZZA 2PSYA 5DP7A 1YF4A 5HXFA 3W1EA 1QR3E 4BAHB 2V6NA 1P9SA 1BTXA 2FOHA 1H8DH 1SG8B 1V2ST 3PM3A 2GVFA 2ZFSA 2BYAX 3N7EA 1W14U 1EZSC 3AVZA 3GDUA 2OD3B 4K3JA 5JB9S 2QY0B 4RSPA 2BB4A 3JZ2B 3D49H 4P00A 3EE0B 3KQBA 4LK4A 1OHHD 1HJAB 1SVPA 6CHAB 1ARCA 5EQSA 1K28D 1E37B 2BVRH 5L6NH 2BM2A 1O3FA 5AFZH 3IG6B 3T5FH 8LPRA 2AEIH 4JZEH 1C2LA 1EB1H 1QRXA 1WAYB 4OS6A 3E8LA 4FOUC 2R2MB 1YPHC 3BV9B 3L6PA 3ELAH 3DT0H 4HFPB 4OS4A 1LQEA 2VIOA 3TH4H 2Z9GA 4CBOA 3RC6A 3M36A 3K2UA 1O2UA 3TIUA 1P3CA 3GCHB 1K1LA 3F0OA 2XC4A 4A5TS 3AK5A 2JH6D 4KKDA 5EPYA 4X1QU 1AKSA 3SZEA 2HNTC 1MZDA 1P01A 1UVSH 2VWLA 1LHDH 2W6ID 5BPEA 4MPXA 1VR1H 2BDGA 1E0FD 4ABIA 2QA9E 4B74A 1O33A 2H1UA 4WY3A 5CHBA 1CE5A 3UR6A 1IQHA 1BMNH 1J8AA 1IHTH 1NFWA 2FTLE 4VGCB 1WOFA 4Y8YA 3SUEA 1UCYE 5EW2H 1SLVB 2IPHA 1GJ6A 1CT4E 3RC4A 1EPTC 1H4WA 3CS0A 1TNHA 5TCAA 1PPFE 1TNJA 5EW1H 1MUEB 1OOKB 1Y59T 5L2ZH 4DY7B 2CHAC 4FUIA 2Z94A 3TK5A 3TJNA 5B6LA 4YTAA 2LELA 1N8OB 3D62A 1AVXA 2NU3E 4XD7D 3L33A 3K9XB 1FPHH 5IDKA 2A4QA 3DSPA 3RXHA 2FLRH 2XTTB 1MTSA 1L2EA 4YOGA 3KCGH 3MU1A 2FOAA 2V3OH 4TWWA 3PTBA 1OWHA 1ZSJA 3RP2A 1S6FA 2PKSB 1C2DA 3F68H 5F8ZA 3SU2A 5A8YA 3WW7A 1PPEE 2JIZD 1NBMD 3ZZBA 2VWNA 1IQMA 1KXDA 2PGQB 5T6FA 1C1QA 2CHAB 2L74A 2QCYA 2P8OC 2FZZA 2ZF0H 1C5PA 3M61U 1O5FH 2Y82A 2AERH 4NCYA 1XUJA 5GDSH 1FDPA 1EATA 2G4UA 2WYGA 1QNJA 4TPYA 1C1NA 1QB6A 5GJ4B 1O2JA 2ZPSA 1S6LA 1SQTA 1Z7KA 5C17A 5C1XA 4XSKU 2F9OA 4NFEA 1G36A 4WH6A 3SJKA 2J2UA 1QJ6B 2ZGXH 1LVOA 2FOEA 3DFLA 2SGAA 3RXJA 2LNCA 5DG6A 1F0UA 2AGIX 3E1XB 4GCHF 3M3SA 4SGBE 2PW8H 1UK4A 3UQOA 1O2QA 2WV5A 1GBKA 1O35A 1GJ4H 2PKAA 2ZFFH 2WPMS 1O5AB 2FX6A 2SGPE 5HIZA 1HAYB 3FZDA 1L1JA 4XBDA 5GXPA 1EQ9A 1OWDA 2P95A 2IPQX 2UWLA 1ZLRA 1TB6H 1TFXA 1MBMA 2AIPA 3WY8A 2I6QA 2ZU1A 1A5GH 4Y71A 2W7SA 1NRRH 4JK5A 1C5RA 1VCWA 2KX4A 1Z8GA 1EJNA 3OEHD 3PMJA 2WPKS 3OYPA 5PTPA 3ZVBA 2R2WU 2WHXA 4XDEA 2A5IA 2BQ7B 4BTIB 2VH0A 1OPHB 3FKSD 1CA0B 1HRTH 2G4TA 2GCTB 3A7YA 3WWFA 1GI9B 2O8UA 3SGAE 1WTGH 3BTFE 3ZZ3A 2Y6TA 1UMAH 4ISHH 4K8YA 3T28A 1GGDC 2FDAA 5C1UA 2ZEBA 2FYQA 5G4BA 1D9IA 1O5CB 1HJ8A 1Z6EA 2Z9KA 3PYHA 1IQEA 3U98H 1LKAA 4IGDA 1D3QB 2TGTA 3V12A 1ZPBA 3PROA 1YLCA 3OTPA 3GCTF 3LJJA 2THFB 1NZQH 1YGCH 3KGPA 3EA7A 2B9LA 1IQIA 2RDEA 1QIXB 2NWNA 2WPLS 5C67A 2FLBH 4ZXXH 2DUCA 4RKOB 5DP4A 3KQDA 2J97A 5JBBS 1C1OA 1OWIA 2ZI2H 1P2QA 1AUTC 4X8SH 3TGIE 1Y3YA 3SQHE 3IITA 3BTME 1YBWA 5EIYA 1LKBA 2YOLA 1C2EA 1EP5A 2BY9X 1EAIA 2XW9A 3Q3KA 1DWEH 3LGUA 1O3IA 3T25A 5TJXA 1O37A 2JETB 1Y3UA 1XKAC 5HYOA 4KTUA 5C0TA 1SGFG 2UUJB 3N7OA 3PWBA 1GMDF 2FI5E 3GISB 3M5NA 4GHTA 4KGAA 3SV9A 2A7JA 2F9VA 4UEHH 1LPZB 2VVUA 3GY8A 3HGNA 1F2SE 3GICB 4IN1A 3ZVDA 4MNVA 4I86A 4CRAA 1V2LT 2SGEE 3EQ0H 4HZHA 4MPWA 1FJSA 3QGNB 3SZNA 3A81A 3S7KB 3H09A 1TOCB 1V2PT 2BLOA 4B6FA 2VWOA 3S9BA 1JIRA 2ANKH 4H4FA 1HAVB 1HJ9A 5E2PA 2CGAA 1QGFA 4JYUH 2TGPZ 1BIOA 2A45B 3E0NB 3M3VA 5FPYA 2ZCLP 1C5XB 3QUMP 1NRPH 3PRBA 1EX3A 1K2I1 1C9PA 1MU8B 6ESTA 4OS2A 1RJXB 3EDXB 4ZKOU 3VEQB 1GHXH 2W6JD 4NG9H 1LVYA 1AMHA 4U01A 2W26A 1ORFA 1IQFA 3UIRA 1TX8A 3I29A 5B6OA 3URCA 1TOMH 3BG4C 5FX6A 4Y76A 5EQRA 3EE7A 1GG6C 3TLOA 2R0LA 3PO1C 5EODA 1C1RA 4B2CA 3DUXH 1C1PA 4ASHA 2Z6BD 5K0HA 1DY8A 5F03A 4B1TA 1BB0B 4B2BA 3PRDA 5C94A 2EA3A 1EOJA 3TK9A 1O5EH 2KCAA 1P3EA 1QCPA 3K65B 5HKKD 2GV6A 1CHOF 3SUDA 1GDUA 2Z9LA 1UVOA 4NIXA 5E0JA 1V2KT 2GMTC 4E06H 1GBCA 1V2TT 1NC6A 1GDNA 3MO9A 3LDXH 3PMBB 1ANBA 5GIBA 2Z3EA 4X2VA 4Y11E 5GPIB 1AB9B 3DD2H 1V6DA 2DE8A 4X6MA 4BAOB 4MDSA 4BANB 3PO1B 2AGGX 3F6UH 1DANH 1LHCH 3ZVCA 4Z6AH 1C9TA 1AN1E 3RU4T 1A5IA 2OC7A 3O8CA 1FUJA 3PWCA 2B7DH 5C3NA 1Y3WA 5E8EH 1MZAA 1O32A 3A8BA 3LKWA 3SI3H 2ZKSA 3SN8A 1P04A 2YNBA 2GKVE 4INHA 4ZHAA 4UONA 1FPCH 3VXFH 3M35A 1MTVA 4FUGA 2OP9A 4ISIH 1FV9A 3ZVGA 5I46H 1GI1A 2JH0D 3I77A 3RXGA 3P92A 5IK2D 4ZCNA 3A82A 5AVDA 4MVNA 1BTWA 4LZ4B 3Q77A 3BIVH 2ZFPH 3E90B 1P9UA 5EG4A 4Q80A 4D9RA 2BD8A 4FVBA 3PLKA 3T26A 1ELAA 3CP7A 1DICA 1HB0B 1P2IA 3FO8D 5FL7D 1GI5A 3ATMA 1DSTA 4WMEA 1QY6A 3KEEA 3UPEA 2ZGJA 1WUNH 1ELDE 2QXGA 5EPNA 1TONA 3NKKA 1TPPA 3LC3A 1SGPE 1KXAA 3OEED 1PPCE 2ZCHP 2W3KA 1T8MA 4X2YA 3QTVH 4X6PA 3VPKA 8GCHG 3RU4D 3U1IB 4E7NA 4ZMAH 4GUXA 3CENA 3LOXA 4ABEA 4ABFA 1UCYH 5DO4H 3A85A 5HM2A 4I8HA 2ZP0H 3BEFB 4ZKNU 3M5OA 1C5NH 3VB4A 1FY4A 1G3BA 1P2JA 3QGJA 3RC5A 3SORA 2ASUB 1G30B 1IAUA 1OKXA 4HGCA 3RXRA 4YOJA 4AC9A 2Z7FE 3QZRA 1C4U2 1PPGE 1P0SH 4B6EA 4GLYA 5J4SA 1Q31A 1W3CA 5DN6D 2VH6A 1LO6A 4U2WA 3RXTA 3A8AA 1K1MA 1GL0E 4X6NA 1Y3XA 2G5VA 3DFJA 2SNWA 3RXSA 2J9NA 1MKWH 1SGTA 1BRUP 2ALVA 1MBQA 1V2MT 1TBQH 5DSFA 2BD3A 3SNCA 1UVPA 1NFYA 2B0FA 1GVKB 1MTNB 1RRKA 1TA6A 2K0QA 1FQ3A 3UUZA 1RIWC 3STJA 1GI7B 3EA8A 3T27A 4Y6DA 3OTJE 4Q7XA 2OLGA 2BDBA 4HTCH 1TNIA 3GYLB 1WTHD 1IQGA 1J15A 2OK5A 2GZ9A 3FP7E 1HNEE 2OQUA 1O2MA 1C5VA 5T3HA 1NTPA 2EC9H 3FOAA 4AFSA 3UQVA 3E0PB 2V3HH 1T8OA 2TGAA 3W94A 2ODYB 3AW0A 3HKIB 1T32A 1TGNA 2C3SA 1YM0A 2GZ7A 2XBXA 4IN2A 5F8XA 3LT3A 2XWBI 3MYWA 5DK1A 1HDTH 4UFDH 2UUYA 2G8TA 1AE8H 2SGQE 1GBEA 4FU8A 1VGCB 1Y5UT 1H8ED 5A0AE 4WVPE 4B2AA 1DLEA 2WUBA 2BXTH 1V2OT 2ZZUH 5LPFA 5EOKA 3TITA 1UTNA 1CT0E 3M37A 2XC5A 1DSUA 3UREA 2KCPA 4B75A 1AD8H 1M9UA 5K7RA 4BAKB 1FY3A 2ZDNA 3OAAD 3VFEA 1P2NA 1MTUA 3O8RA 1N1LA 1XUKA 1P10A 3VB5A 5FAHA 1O3KA 1GJAB 2VGCC 1O2KA 1C2KA 1PQAA 3RXCA 3QN7A 1QBVH 1QL8A 4ABGA 1IQNA 2GCHG 1BMLA 1P2MA 2V7QD 2GZ8A 2ZTXA 1NRQH 4KELA 1BT7A 3RMLH 3KQEA 4E7RG 1TNKA 3F2GA 5T1VA 1GJ8B 1BTUA 3VGCB 4MNYA 4DT7B 1V3XA 2H5DA 3TJVA 2JDID 1NESE 1KXCA 3SNBA 3BTKE 5JBTA 2TPIZ 4NSVA 3TGJE 1UHBB 1IQKA 4Q2KA 2VNTA 1SL3A 3RMOH 1PQ8A 2R3YA 2K7XA 1G3EA 1UTQA 1V2NT 2XNDD 3QO6A 4XBCA 2Y81A 2BD9A 1J9CH 2CXVA 1T4VH 4YT7H 3S69A 1ID5H 4TT3D 1KIGH 1UW7A 4TPIZ 1BHXB 1GBTA 1SOTA 3SOSA 3P8OA 5KEDA 1SPJA 1KTSB 4INKA 1BTHH 4I32A 2GDDA 2WPIS 3OY6U 7KMEH 1DLKB 2SGFE 4YXWD 3BEIB 1P11E 3ZIAD 2Z3DA 1RTFB 1IQLA 4IC6A 1GI3A 1MQ5A 1VCQA 3SUGA 5ABWA 2XNIA 1F0SA 2EI6A 2ZTYA 1N6YA 4TSFD 3UB0A 1SHYA 1K1NA 2ZU2A 1YPLH 3KQ5A 3T62A 1V2WT 1DITH 1TRYA 2A4GA 2F91A 1GJ5H 1GMHF 4CRGA 1Z71A 4Q63A 2M5TA 1ETSH 2QXIA 1O34A 1JBUH 2F83A 1SKYE 4D9QA 3GS9A 1FAKH 4FU7A 2WPDD 4TWYA 1YPKH 1GHWH 1SGEE 2V35A 5A09A 4I8GA 3RXBA 3S0NA 1SC8U 1NRNH 4I8JA 5J4QA 3DSGA 3PV4A 4CH8B 2BY6X 3BEUA 4NZLA 1HFDA 1PQ5A 2EQNA 1S81A 3ZZ9A 1G3DA 3GY7A 1KLIH 1GBJA 1O2NA 1BBRK 2HLCA 3W95A 4K5ZA 2ZDVH 5DPAA 2HPQH 4MQAA 4NA7A 5LGOA 5EQQA 1FN8A 1FMGA 3K6ZA 3ZVFA 3A83A 1GJ9B 1C2IA 2RDLA 2TGDA 1QB9A 4O3UA 1YCPK 5AF9H 1INCA 5CHAC 4NWKA 1MQ6A 1VITG 3I78A 1ELVA 1DPOA 1C1MA 3NWUA 1ZSKA 1RFNA 4U32A 3RXOA 3SJOA 3RLWH 2BDYA 3DCLA 2CK3D 5LH8A 4X2WA 2XC0A 3SV2H 1O3CA 3MH6A 1GMCG 4P02A 1S6HA 1DWDH 5C20A 1O3MA 2UUFB 3OSYA 4DJZB 4DG4A 3PMAB 2EI8A 1GCTC 1DWCH 4BOHA 1QQ4A 2QIQA 1E79D 1EPTB 1HIAB 1AO5A 1W0ZU 1LDTT 4LZ1H 3FZZA 2F4LA 1SGQE 1MAYA 1GBLA 2A1DB 5AFYH 1C5OH 3P17H 1SSXA 1PJPA 1VZQH 1E38B 1YY3A 3CNRA 2OBOA 3LC5A 2ZHWH 3TNTA 1NY22 1TRNA 1ANEA 2L6OA 1HAXB 2BD2A 1OP8A 3P8FA 1BQYA 2C8ZB 3TJOA 2ZWLH 2NU0E 3UOPA 1FI8A 1KMHB 5HGGA 2QF3A 5GCHG 5C1YA 1P02A 2Y7XA 2LIZA 3H7OA 1UTJA 1S82A 1EXFA 1GBHA 2ANWA 1OX1A 4YZUA 2C4FH 1XVOA 1QBNA 4NIWA 2Y5HA 1YKTA 4IS5A 1ZJKA 4K8BA 3V3MA 2P8OB 3RXAA 2AYWA 2BDCA 3H5CB 3A8CA 2C93B 4DGJA 1O3NA 1O3BA 1SLXB 2C8XB 1O2PA 1LMWB 3UNSA 1Z1JA 1GBIA 3MO3A 1W13U 2W3IA 1WQSA 2J98B 1G9IE 1A46H 1O3GA 1H8IH 2HALA 2J95A 1X7AC 1ELGA 1ZHMA
chains in the Genus database with same CATH topology
1K1PA 1A5HA 4ABHA 1AHTH 4JZIA 4AORA 4YLUA 1TPAE 3VB7A 2ODQA 3KF2A 1C5WB 1KTTB 3Q3YA 1GHAG 4QT8C 3RXPA 1YCPM 1HLTH 1D3TB 1CGIE 1LVMA 1C5UA 1O2VA 5JBCS 4GCHG 1FNIA 4WMFA 3UNRA 4MNWA 1Y3VA 8ESTE 2CV3A 1W8BH 3SQEE 1LHFH 2WV4A 3M7TA 1TQ7B 3P8GA 1GHBG 1C1TA 1T7CA 1UTOA 5DP3A 1KY9A 3AAUA 4OGXA 2ZHEH 2EI7A 1A3BH 3BTWE 1HCGA 2Q6GA 1C2HA 1CGHA 2OXSA 1XMNB 1BBRE 1G32B 2ZU4A 2XBVA 1ZHRA 3GY4A 2VIVA 7LPRA 4D76A 2G52A 4F4OC 1ZHPA 1P2KA 3LU9B 2R3UA 1GGDB 1TABE 3KN2A 1GI2A 1O2XA 2D8WA 1CGJE 2OCVB 2FOFA 1K1OA 1QA7A 3ZZ8A 3RXFA 3P95A 3SO3A 4B76A 1BUIA 3UNQA 4NWLA 2GT8A 1F7ZA 3V13A 4J1YA 3BTEE 1MU6B 4AN7A 2ZHQH 2PV9B 1QJ1B 2H2ZA 1EOLA 1KYNA 2SNVA 4FUHA 4WH8A 1ZGVA 1YPMH 3OX7U 4IMQA 5DJ7A 4CRDA 4I8KA 1QRWA 1AQ7A 1YLDA 2UWOA 5FBIA 1TNLA 2Y80A 2STAE 3MNBA 1QFKH 3M5MA 5C5OA 3A7TA 4OS7A 1HAZB 3U8TH 1TAWA 4X1PU 1W11U 1IQJA 2Z9JA 1GJ7B 2RG3A 4AZ2B 4WXIA 3AAVA 3M7UA 5TCCA 3MOCA 2H9HA 4NGAH 4IBLH 3SBKA 1YPEH 4CRCA 2BD7A 4NSYA 6GCHF 2FO9A 1S85A 2PWXA 1TNGA 1KDQB 1E36B 1TX6A 2HOBA 2BY8X 1ZRKA 2Q6FA 1OP2A 2BD5A 3HK3B 3ZV9A 2IOTA 1HXEH 4ZROA 3FVFB 5C5NA 1O3HA 3A7ZA 3ESTA 1RS0A 4A1TA 3SJIA 3UFAA 2BZAA 1AVGH 1NU9A 2VVVA 5FHTA 3VB6A 1GI6A 3NUMA 1ELCA 1D6WA 2FM2A 5HM9A 1YPHE 3EAJA 1ZR0A 2FIRH 3MFJA 2QYIA 2ZHFH 3RMMH 1ETTH 1O39A 1BOQA 1O3JA 2XCNA 4MNXA 1THPB 3MO6A 4X8TH 2BTCE 1AIXH 5JYIA 4NA8A 3TH2H 2GT7A 4ZXYH 4AB9A 4AFUA 1HGTH 2PTNA 2OINA 1C5LH 1GBBA 1A7SA 2QGRA 1JWTA 1AUJA 2JH5D 2K1QA 3LONA 1BRCE 1K22H 1D3DB 1HAHH 2BLWA 4Y79A 3LH3A 3U69H 4ZUHA 2DE9A 4JZ1A 5L30H 1PPBH 3BG4B 5SGAE 4X0WU 1EPTA 2WYJA 4Q7ZA 1V2JT 1XX9A 2WUCA 1GG6B 3BTTE 1A3EH 1ZRBA 2WPHS 5A8XA 3K6YA 3BF6H 3KNXA 3LGYA 2BOHB 1B5GH 4OS1A 1EUFA 1SHHB 4ISOA 2ZFQH 1BDAA 3MH4A 1S0RA 4AYVB 4FU9A 2GV7A 1S0QA 2GMTB 2ZGHA 3UR9A 1WV7H 9ESTA 1B0FA 4OGYA 1CO7E 2BLQA 4B73A 1E35B 1P05A 2H9TH 2HRVA 1C5YB 2OC0A 1L1NA 3T29A 1XUGA 1ESBA 1DE7H 4AFQA 3M7QA 4UFGH 1P06A 4IW4E 3E16B 1O2ZA 3HKJB 1AWHB 1BJVA 2BOKA 1B7XB 3QK1A 5JDUB 3IWMA 1GL1A 1VJAU 5DP5A 4A1XA 3ZZCA 1VCPA 4A1VA 1P8VC 3ITIA 1EJMA 1SI5H 4MTBA 2HGTH 1K1JA 1O2LA 2Y7ZA 2ZU3A 1TGCA 3R0FA 1UTMA 1NROH 2A2XH 1NO9H 1G2MA 4CRBA 2BMGB 3A7VA 4ISLA 1OYQA 1A4WH 1OWJA 2P16A 9LPRA 3MU0A 3U1JB 3LGTA 1Y5BT 3LGWA 1P03A 1C2GA 1ZTKA 4GVUA 2XYAA 1HAIH 3LH1A 1CBWC 2IN2A 1BRBE 1BZXE 2BZ6H 4ZH8A 3PMHB 3LGVA 3RUOA 4IC5A 2ESTE 3P6ZB 2H9EH 1GHVH 2BVSH 1P09A 2BDAA 3SJ8A 4ZHLU 2P59A 2I6SA 3OU0A 1ZOMA 1JRSA 5FPTA 3SNEA 1ACBE 3MU5A 1D4PB 1O2TA 3SGQE 4DCDA 4CHAC 1ARBA 3ZYEA 4CREA 2BQ6B 4DOQA 1FZZA 1OYTH 4ZHMU 2KAIB 2TBSA 2ZU5A 2FP7B 2P93A 4BXWA 1KSNA 3MNSA 4O9VA 2XBWA 2BX3A 3S9CA 2ZPRA 1UTKA 2QN5T 1T31A 2F9BH 1SGRE 3C27B 5JBAS 5FCKA 3G01A 4I31A 1UJ1A 2ZDMA 2VIDA 2ZHDA 3ZV8A 1GI8B 3D23A 1GJDB 3C1KA 4NFFA 1LHGH 1EZUC 1SLWB 4UDWH 1BA8B 1NS3A 1BHXF 5BRRE 4CHAB 1UVUH 1QRZA 2C90B 1QL7A 3SU1A 1PPHE 2FOCA 4Y0ZE 3EA9A 1AWFH 1DWBH 1SGIB 4UD9H 3F1SB 2A32A 1TPSA 1RIWB 2A0QB 2BDIA 1HAVA 4WWYA 1TIOA 2GCHF 1AFQC 1QBOA 3RMNH 3ZZAA 3A89A 4BXSA 1WSSH 1W10U 2HWLB 3MI4A 4XE4A 4H6SB 1O2IA 1V2UT 2CJIA 1GI0A 4BAMB 3HGPA 1CHGA 1O3AA 1MD7A 3MU4A 1THSH 5LPRA 3SU0A 2UUKB 5E0GA 1FY1A 4FVDA 2C8YB 4TY6A 5ESTE 1SGCA 2ZTZA 1OS8A 4JMYA 3BSQA 3DHKH 3GY6A 2AH4X 3RXIA 4AGKA 1ZMJA 1SGFA 2QC2A 3PLPA 3NXPA 1K1IA 3MNCA 4PROA 2RA3A 3P8NA 4MG3A 1GBFA 1O2RA 1OWEA 2GD4B 1TPOA 2VIQA 1F0RA 1C2JA 3ZYDA 4JZFH 1JIMA 2QAAA 1TMBH 2AS9A 3BTQE 1TLDA 4BTTB 2AMQA 4ZKSU 2RA0A 3FP8E 1MMJN 1TMTH 1C5SA 3QLPH 1GDQA 4B71A 4CBNA 3A7XA 1NRSH 2AMPA 1JMOH 3S9AA 1BBRH 2VGCB 1HJAC 6CHAC 1SGNE 3UTUH 2XRCA 1MD8A 2HNTF 4Y7AA 1HYLA 3E91A 1YP9A 5GWZA 2UWPA 2ZGCA 3SUFA 1NFUA 2A2QH 1ZTJA 2VJ1A 2ANYA 1BJUA 1HAPH 2ULLA 2SGDE 4Y0YE 1SQAA 4ABBA 5L2YH 1Q3XA 1YCPH 4X8UH 2NU1E 1U6QA 1DUEA 7GCHG 1P12E 1WQVH 2Z3CA 3LIWA 4BNRA 1OXGA 1BMAA 1ETRH 1F5RA 3GCHC 1HV7A 3RU4E 1ZMNA 2FX4A 1GBMA 2NU2E 1ELFA 1O2WA 1OSSA 5JPMH 1ZYOA 1LVBA 2JKHA 4I33A 4K1EA 1BITA 1HAGE 5DP9A 1AGJA 2ALPA 3F9FA 1T8LA 1O2HA 1TGSZ 2O9QA 3BN9A 1MCVA 3O8BA 2ZIQH 1GBDA 2P3TB 4X1SU 1TGTA 1EASA 4YO9A 1HPGA 7ESTE 4VGCC 2PUXB 1W7XH 1THRH 1O30A 1VITF 2VIPA 1V2QT 2A4RA 3FFGA 2XXLA 4I7YH 3NPSA 1KXBA 3SI4H 4BTUB 1YYY1 2GTBA 5DP8A 3RXDA 3ZVAA 3ODDA 3EGKH 4CRFA 3LJOA 1GMCF 1MKXH 1ZSLA 2F9PA 4FUJA 5A0CA 2OC1A 1ZTLA 1SBWA 3SU6A 2GDEH 2TIOA 4ZAEA 4M7GA 1MAXA 1CT2E 1TX7A 2P3UB 5E0HA 3GYMA 1N8OC 4ISNA 3GDVA 1AZZA 2FS8A 2FESH 1G2LA 1F92A 4Y7BA 1O2YA 1GMHG 3MMGA 2PKSC 1AU8A 5I25A 1AE5A 2ANMH 2PGBB 3SHAH 1UVTH 5E2OA 1RTLA 1UO6A 1CU1A 2G5NA 1DFPA 1SFIA 1CSOE 3SGBE 4D7GA 5JB8S 1XUFA 2BDHA 3U8OH 5GCHF 3R3GB 1UTLM 2ZCKP 4TY7A 3UWJH 2ZDKA 3STIA 1ABIH 1TQ0B 3GY5A 5EGMA 3GCNA 1O2OA 3B23B 3SJ9A 5CHAB 2BLVA 1AZ8A 2P3FH 3RXLA 2KAIA 1A0HB 2QXJA 1TRMA 2D26C 3TK6A 5EXNA 1CA8B 1GVLA 1XXFA 2QXHA 4X8VH 1BRAA 3A80A 2WPJS 3A88A 3ATKA 2R0KA 2O8TA 3U8RH 1DOJA 1O0DH 1MKXK 1DXPA 1GI4A 2FS9A 1GCTB 4DVAU 1AI8H 1NN6A 1EAUA 4X1NU 4JZDH 1MH0A 1K21H 3MTYA 3DA9B 5AHGH 3Q3XA 4E05H 4F49A 3MU8A 1CQQA 2AMDA 1GHAF 1W12U 4RKJB 2G00A 4Y8ZA 2ODPA 1O5GH 1O3DA 3F9EA 2FOMB 1O38A 2F9UA 3ZZ5A 1LTOA 1DUAA 3NZIA 1O3LA 4YM9A 1UK3A 1VITH 1FY5A 5CMXH 1GCDA 2PLXA 4AG1A 1CA0C 1GJBB 1C5QA 1GHBF 1NM6A 2GCTC 4JYVH 3QWCH 2O8MA 1O5BB 1Z8IB 3BTGE 1MTWA 2AFQB 1VJ9U 3NCLA 1DX5M 3TU7H 3UOUA 4FXGH 2FWWA 2ZFRH 5LPEA 4FUBA 3GDSA 2QV1A 4AX9H 1DXWA 2BY7X 1PYTC 5IYTA 4DIIH 4BAQB 1ZPCA 2F3CE 3HK6B 1DY9A 1C4Y2 1LCYA 3KIDU 4GPGA 4FUFA 3PTNA 4A7IB 1TALA 3ODFA 4K69A 3ZVEA 1KXEA 3GCOA 4IMZA 3GOVB 2J92A 1TWXB 2IJOB 4XOJA 1NU7B 2H6MA 3V7TA 1Z8JB 1LQDB 2FI3E 5HMAA 1UHBA 2FODA 2ZO3H 2CMYA 2EEKA 1Z1IA 4AGJA 4YT6H 3A87A 2BQWB 2J38A 4ABDA 1HUTH 1IOEA 2QF0A 2P94A 3E6PH 3JZ1B 1F5KU 2BY5X 1TYNA 5F8TA 3V0XA 1UTPA 1SGDE 2CF9H 4O97A 2JETC 2R9PA 1C1SA 4WXVA 1GBAA 2FXRA 2BD4A 4CR9A 1KLTA 5A8ZA 3RM0H 3ZZ7A 4YLQH 1QJ7B 5F6MA 3HPTB 1FAXA 3TVJB 2ZG0H 2FOGA 2GP9B 1N6XA 2Z9IA 3B8JA 1IHSH 4H6TA 2CF8H 2G51A 5A2MH 2XCFA 1C2MA 1QB1A 2G55A 4DURA 1FY8E 3T2NA 1EZQA 2A5KA 1C1WH 4K2YA 2FEQH 3NK8A 3QZQA 2ZECA 3VB3A 1ESAA 2SFAA 1ESTA 3BTDE 4UFEH 3VXEH 3A8DA 1PFXC 3O8DA 1XUHA 1KXFA 3GCTG 3ZZ6A 1TBRH 1XUIA 4MLFB 1ELEE 1QHRB 3OY5U 1NFXA 2ZFTA 1P2OA 4RN6A 1XVMA 4I8LA 5EXLA 3ATWA 1E34B 1GJCB 4AYYB 1QTFA 1O3PB 2ZQ2A 3AW1A 3FAOA 1W0YH 1J16A 3E3TA 1O3EA 4X1RU 1FLEE 2VIWA 1C5ZB 5FPSA 3PLBA 4ABJA 1NPMA 3RXMA 2C8WB 1PYTD 1TE0A 1YPJH 3F9HA 2O8LA 1HAOH 1AVWA 4CR5A 1TGBA 1DVAH 3MH7A 2GX4A 1A1RA 3SU4A 1ELTA 2PUQH 4X6OA 4Z0KA 2A7HA 1BMMH 6LPRA 4INLA 4A92A 1Z6JH 2OUAA 3MNXA 2A4OA 1C1VH 1WYKA 3LPRA 1ZGIA 3RXKA 2ZGBH 1EJAA 3ZZ4A 1GMDG 1BCUH 3SV6A 1T8NA 4THNH 3RXQA 5EXMA 1FN6A 2ZDLA 5FX5A 1QA0A 4Y8XA 2H5CA 4AOQA 2Y5GA 4KTCA 1EKBB 2FMJA 1BTPA 4H42U 1AB9C 5DGJA 5C2ZA 1JOUB 1C1UH 1SOZA 2Y5FA 4WJG2 3SW2B 1RTKA 1O3OA 1ZPZA 1G37A 2ZNKH 2HNTE 6GCHG 1LHEH 3RXUA 1LPGB 1GHZA 3A84A 1C5TA 1HIAA 3TJUA 1WU1A 1DS2E 3RLYH 3UWIA 4O3TA 3MHWU 2ZPQA 4GAWA 1BTYA 4ABAA 1O2SA 3LGIA 1F5LA 4K1SA 1FIWA 4ESTE 3TGKE 2VWMA 1D6RA 2F9NA 1AY6H 3M5LA 3UY9A 1S84A 4NA9H 4FUCA 1D3PB 4LOYH 1TBZH 1L4ZA 1H9HE 3HATH 3U9AH 1F0TA 2AGEX 3F9GA 1EAXA 3PB1E 3KHVA 5DKMA 3QTOH 1TA2A 1DT2A 1H1BA 1C4V2 2STBE 3ATLA 4HI3A 1EB2A 4KTSA 1CHOG 1EZXC 2GGVB 4DW2U 8GCHF 4X2XA 3QDZB 2FI4E 1KLJH 1QL9A 2CN0H 2BHGA 4MPUA 2XBYA 3B9FH 4TYDA 2LPRA 4WF8A 5ETXA 1QURH 1GPZA 2FPZA 2B8OH 1W2KH 3SNAA 2PSXA 1H9LB 3S7HB 2VU8E 4OS5A 4JCNA 2YNAA 1ABJH 3SHCH 4NZQA 1JRTA 2O8WA 4LXBH 3QX5H 2PTCE 1RD3B 4K1TA 4D8NA 3RDZA 1A2CH 2OC8A 1QQUA 2OQ5A 1AKSB 1Z8RA 1SR5C 4K60A 3TH3H 3SV8A 1EP6A 3M3TA 4KP0A 3SV7A 3TNSA 2A31A 1ANCA 4R8TB 2PHBA 1RGQA 1Y8TA 4XFQA 1ZMLA 3RXEA 3RM2H 3P70B 1ELBA 1PQ7A 3GY2A 1RXPA 2TRMA 2D2DA 4JYTA 4WMDA 1K9OE 1HXFH 3BG8A 3BTHE 2ZQ1A 4AB8A 4J2YB 4ZKRU 4O03A 3ZZDA 2J4IA 3RXVA 2XWAA 4DIHH 1CVWH 1O36A 3CS7A 2J94A 5FCRA 8KME2 1L1GA 1MTNC 1SFQB 2J34A 4YOIA 4GHQA 1C5MD 1MCTA 3Q00A 1Y5AT 4UFFH 1L0ZA 2RCEA 5H4IB 4JK6A 1OWKA 1ANDA 1V2VT 4AFZA 2A5AA 2OBQA 3KL6A 1SMFE 1L4DA 4AG2A 3D65E 1CBWB 5ESBA 4MPVA 2FTM