1ESTA

The atomic structure of crystalline porcine pancreatic elastase at 2.5 angstroms resolution. comparisons with the structure of alpha-chymotrypsin
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PORCINE PANCREATIC ELASTASE
publication title The atomic structure of crystalline porcine pancreatic elastase at 2.5 A resolution: comparisons with the structure of alpha-chymotrypsin.
pubmed doi rcsb
source organism Sus scrofa
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1976-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1estA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1estA01
4K1SA 2AGIX 2FI3E 3TK5A 4JZ1A 4K2YA 1LTOA 3BF6H 4GSOA 5GJ4B 3ZVDA 1CBWC 2HPQH 1TGCA 2QF3A 1QGFA 2A31A 1GMCF 4KKDA 4FUGA 1FY8E 1OWKA 1SGIB 3GCTF 4I32A 4MVNA 2ZECA 1HIAB 1ZYOA 1RTFB 3MO3A 3QZRA 1EOJA 5A0AE 2NU2E 1SI5H 1KSNA 1AZZA 1SG8B 4JYTA 2G4TA 4ZKSU 4IGDA 5DP6A 1O30A 5FBIA 5L2ZH 3H7TA 4X6NA 3DD2H 2W26A 3LU9B 3MO6A 3ODFA 4XOJA 4X8TH 1MTUA 1GI4A 2VNTA 4MNYA 2ZCKP 1SGNE 1V6DA 3SZNA 4A92A 1TB6H 4Y76A 3HK3B 5EOKA 1C2JA 2K1QA 1DFPA 3RXHA 3F9GA 3LDXH 1T32A 3RC4A 4MDSA 1D6RA 4IC6A 1GHBG 1BDAA 1GMHG 2VJ1A 1V2ST 4NIXA 3M3VA 3LJOA 3M35A 2UWPA 2WPHS 3M61U 2FLBH 1IQHA 1J16A 2XBWA 4FUCA 1YPKH 4WJG2 5DP5A 5FX5A 3VB4A 1T8OA 4NGAH 3RXSA 1TOCB 3URDA 3A81A 2PLXA 1SGEE 1XUHA 1W10U 1IAUA 2BY9X 3STJA 1S6FA 4CRGA 2A32A 1O0DH 2A5KA 5A8XA 1EKBB 5DO4H 2F9NA 3FZDA 1GMDG 2G51A 4IW4E 2FOCA 3EGKH 4UONA 3C1KA 1EAWA 2XC5A 1CA0B 3GYMA 4A1VA 2C4FH 3E90B 3TNTA 4X2YA 3RC5A 1V3XA 1KY9A 2AYWA 1MZAA 1SMFE 2LPRA 4O03A 2QXIA 3MNXA 1AD8H 2ZP0H 1GMDF 1L4ZA 1EOLA 3LKWA 4AX9H 1IQLA 1CBWB 5EXMA 4Z0KA 3SU1A 5JYIA 1ZGIA 3F9EA 2W3KA 1Z1JA 1O2JA 4KGAA 1UO6A 2XBVA 2GMTC 4RKJB 2ZI2H 1B5GH 3EA9A 4INLA 5FXLA 1P10A 1O2LA 2PHBA 3ATWA 3RXQA 1MD8A 3ZZ6A 2XCNA 2ULLA 2NU4E 1UMAH 2F9UA 1C5QA 1HCGA 1OPHB 2FI4E 3MI4A 1OWDA 3MWIU 4I8JA 2G4UA 3MH5A 1VITF 3URCA 1THSH 5AFYH 1MTWA 3RXTA 1FY1A 2Z9LA 1BJVA 1TNHA 1G3BA 1FIZA 4WH6A 1NZQH 1YPJH 1MTNC 3M7UA 4O9VA 2AS9A 3NK8A 3UREA 1NRPH 4HFPB 3BTME 1S81A 1C2HA 1TNGA 2J34A 1S0RA 2B8OH 3BG8A 5H4IB 1QJ7B 4FUEA 1C5LH 1HIAA 1MAXA 2AERH 5CMXH 1HXEH 2ZDVH 1GI7B 3NWUA 3R3GB 2ILNA 3PMAB 1TNJA 1GI0A 2HVXA 4UFGH 4Y6DA 5E8EH 2AGGX 3F9HA 4JZDH 1BHXF 3D49H 3AW0A 5K0HA 3A8AA 5EXLA 3MTYA 2FOGA 1O2MA 1Z8JB 9LPRA 4K60A 2JKHA 9ESTA 3A7YA 2FWWA 1MZDA 1G36A 3KIDU 1HGTH 1VCQA 1AHTH 5TJXA 4DIHH 4R8TB 2ZHFH 2A7JA 4CRCA 2OD3B 4JCNA 1W12U 3RM2H 1HAIH 3SNEA 4FU9A 1C4U2 3FZZA 1ELEE 1QCPA 2GMTB 1L1NA 3I29A 4CREA 2TGDA 4D76A 2ZG0H 3T25A 1W8BH 2FI5E 3SI3H 1JIMA 3GCHC 1FAKH 1ZSJA 1LMWB 1Y59T 1BTXA 1SQAA 2V6NA 1SGYE 1J8AA 4IBLH 1PPZA 1OP2A 2F9VA 2XTTB 6CHAC 2WUCA 3GCOA 1OP8A 2XC4A 4HZHA 4XFQA 4ESTE 1HPGA 4D9QA 1XXFA 3ZVFA 3RXRA 1IQKA 5SGAE 3SJIA 1MTNB 2PTNA 2VU8E 1DVAH 4Q7XA 1BUIA 1HLTH 3HGNA 2C90B 1HAYB 1SGTA 1L4DA 2XC0A 1EB1H 2GTBA 5EQSA 2DE9A 1AMHA 1SOZA 1AU8A 1Z6EA 4HTCH 1VGCC 3PWBA 4SGBE 2FDAA 3UNRA 3RLWH 3UIRA 1GJ4H 1XUIA 3TLOA 1O2QA 3SU5A 2BY5X 1ACBE 1HRTH 2OP9A 4KP0A 2G5VA 1C5TA 2LNCA 2ZFRH 1TONA 2OC8A 3GDSA 1DXWA 1P2NA 3BSQA 3FVFB 2D26C 1C2IA 4ABFA 3SUEA 1N1LA 1UVPA 4WXIA 4NWLA 3MU4A 7GCHG 4UDWH 1ZPZA 4I8GA 4ABIA 4Z6AH 1JIRA 1F5LA 1NRQH 2BDGA 1V2LT 1KXAA 1ID5H 1V2OT 4UFEH 3U1JB 3ATIA 1T8NA 2PV9B 3PTBA 2PKSC 2SGEE 2HNTF 2ODYB 3TPIZ 4IN1A 3MFJA 1Z71A 4O3TA 1O2VA 2ANKH 3M5LA 3DFJA 4SGAE 5ABWA 1C5PA 7GCHF 3GOVB 1K21H 1G32B 1NESE 1O3EA 1W0YH 1TIOA 2R9PA 1ORFA 1UTNA 2BX4A 3GCHB 2THFB 4B73A 1UTJA 5A8YA 3HPTB 2WINI 1E37B 1BOQA 1MTSA 4Y79A 4NFFA 3AW1A 2GZ9A 4Y11E 1SBWA 1P3EA 4LK4A 1JWTA 6CHAB 2Z9KA 2UWOA 4NSVA 2PFEA 3EQ0H 2XBYA 3ZVCA 1P11E 4GHQA 3ZV8A 1A4WH 3M7TA 1PQ7A 4FVBA 2G00A 3SU0A 2ZQ2A 1O3LA 2ZHWH 2JETC 2FP7B 2ZFSA 2OBOA 2ZDNA 4DGJA 1DSUA 1A61H 3MMGA 4AZ2B 2Z6BD 1VGCB 5B6OA 1O38A 2GD4B 3EAJA 1HAPH 3OY5U 4XDEA 1H1BA 1C1NA 4YZUA 4NIWA 4NFEA 1F7ZA 2FMJA 1MAYA 1XX9A 2A2QH 2A4GA 2ALVA 2VGCC 4YESB 1DWBH 1WTGH 4DG4A 2O8LA 3OTJE 4J1YA 2ALPA 4MLFB 2XXLA 3P17H 4CRDA 3TJVA 1EP5A 3IG6B 1O3IA 2R0LA 4Q7ZA 3I78A 1C1WH 3TVJB 3UFAA 3BEIB 2BD2A 3QX5H 2TGAA 4JZEH 1K1MA 2BQ7B 1LVMA 4BXSA 1FY4A 1Z8IB 2ZDKA 3Q3KA 2ZU2A 1FXYA 4K5ZA 2PKSB 1P2KA 4E06H 4MNVA 3ZYEA 2ZDLA 3K65B 1OP0A 2Z7FE 3TNSA 1C2LA 3VB7A 1TQ7B 6GCHF 4Y7AA 1N8OC 1CGIE 1C2FA 5J4QA 2FYQA 1A7SA 2BYAX 5FHTA 2J2UA 1NN6A 2BMGB 1O32A 3MO9A 1SFQB 1FJSA 2XYAA 4Y10E 4DIIH 2QF0A 2A0QB 1LHDH 2B5TB 1AVWA 2ZPSA 5LPEA 3E16B 1W2KH 3T29A 5C1YA 4NCYA 3RU4T 5JDUB 5GWZA 1EB2A 1ZPBA 3A89A 3SV2H 3MHWU 1OWEA 3BTQE 3QTOH 5L2YH 2P94A 2FOEA 2Y5FA 3LIWA 1A46H 2ZNKH 1Z1IA 2AFQB 1AVGH 3P6ZB 3FP7E 3QGNB 2XNIA 3LGWA 1O3AA 3V0XA 4ABJA 3GY2A 2JETB 1C1TA 3SHAH 1GI8B 2ODPA 4TWYA 5GCHG 1YPHC 1EQ9A 1VJAU 3TJOA 3LGVA 1L1JA 2ANWA 1IQJA 4OS2A 2BVRH 2H2ZA 4GPGA 4YM9A 1TALA 1T8LA 1QJ6B 3ZVAA 1K22H 2WPIS 1O5EH 2VGCB 3GICB 3RXJA 3U1IB 5DK1A 1K1IA 1ZHPA 2O8UA 4UD9H 1TX7A 1HUTH 1UK4A 1P04A 2ODQA 3KQCA 1CGHA 3KEEA 1O2RA 5A0BA 5C5OA 1VZQH 2HOBA 2VB0A 1YYY1 3SUFA 3SUGA 2PSYA 1BTZA 6ESTA 1W7GH 2WV4A 1FPCH 1GBIA 1RTLA 1GVLA 3P8GA 5CHAC 3UTUH 4Q7YA 1SVPA 1S85A 1YGCH 3N7OA 1BBRK 1E38B 4WMDA 1AUTC 4D9RA 2J4IA 1N8OB 1ZMJA 1O33A 4HGCA 3L33A 1MCTA 2OC1A 3A7VA 2G81E 1T4UH 1QRWA 4X2XA 1C5VA 3BEUA 4JYVH 1GHAG 1NFXA 1O2XA 1GBMA 4BTTB 5DP8A 1C9TA 4HI3A 1YP9A 2NU3E 4X6MA 3WY8A 1LVOA 2R0KA 1P2QA 4GLYA 2YNAA 2J38A 2H5DA 1C1SA 2BLVA 5J4SA 1Z8GA 1NFYA 1XVMA 5C3NA 5C2ZA 3SGBE 1F0RA 1GBKA 1HV7A 1KYNA 1DM4B 3TH4H 1O3PB 4H4FA 1FAXA 3VB5A 1A3EH 1IQMA 4X1PU 3ZZBA 1P9SA 3ATLA 1NFWA 4FXGH 2UUYA 1FQ3A 2G8TA 1DWCH 1N6YA 4ZUHA 1C2MA 3MNBA 2VINA 1ELBA 1GDQA 2WPJS 5EW2H 1H8IH 4RKOB 1QJ1B 1SGQE 2FM2A 1C5SA 2WPLS 2YOLA 3I77A 1QRZA 1SL3A 1KLTA 3SORA 2ANYA 3PMJA 1Y5UT 2VWNA 1O3KA 2VWOA 1TPAE 1BRAA 1UCYK 3BEFB 4U30A 1BBRH 2ZKSA 1O3JA 2QXJA 1QR3E 4DW2U 5IDKA 3TJNA 3LGTA 4X6OA 2FX6A 2BLWA 1THRH 2RG3A 1Q31A 4X2WA 3MNCA 2JH6D 3BV9B 2Z9GA 1O31A 3QN7A 1VR1H 3ZZ4A 1RIWC 4D8NA 5CHAB 3ZV9A 1KLJH 2Y5GA 3ZVBA 1ZSKA 4D7GA 1BITA 4NA8A 1GVZA 1F5KU 1GL1A 1ZPCA 3GY7A 3ELAH 3M5MA 3HKJB 1ESTA 1AFQC 2ZHDA 5C5NA 4QT8C 1FLEE 3RXVA 4YLQH 1ZRBA 2V35A 4IN2A 2EI6A 5JBAS 1DPOA 2FTMA 1SHYA 1Z8RA 1TABE 3SBKA 4BAKB 4LZ1H 1GBJA 4TWWA 2OBQA 1S0QA 3A86A 2DE8A 3M3SA 2NU1E 2XWBI 4ZKNU 1DSTA 1O2GH 1QQ4A 1P57B 2AIPA 1P2MA 3B23B 1A5HA 1V2WT 2QA9E 1CT0E 1Z7KA 1O3BA 1GDUA 2Y7ZA 1IQNA 5A09A 4GAWA 3RMLH 1AE8H 1CSOE 2EI7A 2GV6A 5ETXA 3OU0A 1LKAA 1FUJA 2ZGJA 1OYTH 3E8LA 5AHGH 2VIVA 4YT7H 1BB0B 1DWDH 1OXGA 1IHSH 4Y8YA 1VCPA 1UCYH 2SGPE 2ZCHP 3UUZA 1KDQB 3P8OA 1AIXH 2BD3A 5HM2A 1O2TA 2CJIA 3LH3A 2ZGHA 1EPTC 3O8BA 1N6XA 3KQEA 2UUKB 2FOAA 2IOTA 1B0EA 4A7IB 1TBRH 2FXRA 1GHBF 1GMHF 1P09A 1SLWB 4I7YH 2QXHA 3TK9A 1P05A 3PM3A 2BXTH 1GHVH 2PW8H 4JZFH 4B2BA 1AKSB 2H5CA 3TGJE 1O5AB 2FOBA 1S84A 1ETRH 1GBFA 3SV6A 1GHXH 4B1TA 1IQGA 1O5FH 4DURA 3SV8A 4FU8A 4NIVA 2AMPA 1ZOMA 2BTCE 1SPJA 3SHCH 1CQQA 1RIWB 4OS7A 2A5IA 1TOMH 1P0SH 1UHBB 1HNEE 1YLCA 2SGFE 2IN2A 3LOXA 4Y8XA 1Y3YA 3SQHE 4UEHH 1IHTH 5F8ZA 3A7XA 1AFQB 3SGQE 2BDAA 3LGYA 1KLIH 3H5CB 1XKBC 2GDEH 4AFZA 1QBOA 3T2NA 3FP8E 3M7QA 1YF4A 4U01A 1PFXC 4Y7BA 1L0ZA 1PPBH 4AYVB 1C5UA 1K1NA 2OC0A 2BD5A 2O8TA 1UTPA 1C2DA 2F3CE 4OGXA 4AGJA 1C2KA 1V2UT 5LH8A 4NA9H 8LPRA 1EJMA 4I8KA 4FUIA 2VWLA 1NS3A 1HAXB 1LHCH 2SNWA 1TBQH 1QNJA 3GY8A 1DS2E 1ZJDA 1ZJKA 1X7AC 5HXFA 4ABAA 2F9OA 1ARCA 4U2WA 1K9OE 1ZHMA 1GI2A 2BDHA 8GCHG 2BQWB 1EPTB 1Q3XA 1GI3A 2G55A 2O8MA 1DY8A 1P8VC 3PMHB 3QLPH 3HATH 1P02A 2CV3A 3TU7H 4WF8A 5T6FA 1F5RA 1O3CA 1LHEH 4MTBA 1O5GH 1VITH 2JH0D 5T6GA 2A4QA 3SU3A 5AF9H 1LHFH 2OQ5A 8GCHF 1E36B 1OYQA 1H4WA 4ABBA 1BT7A 4IC5A 1RD3B 1FDPA 4F4OC 3UQOA 4X6PA 1J9CH 1YPLH 3ZZ9A 1DX5M 2BDYA 2QCYA 4BOHA 5ESBA 2PSXA 1KXDA 8ESTE 4WWYA 1FN6A 3VXEH 1O2PA 2SGAA 4MPWA 4BANB 2HRVA 1A0LA 1GJ9B 2GT7A 3RMMH 1MH0A 3BTWE 1YPHE 1CU1A 1ABIH 1ZRKA 2ESTE 3TGKE 2QC2A 2ZHEH 1GG6C 1TPSA 1ZZZA 3NKKA 1A1RA 5GIBA 2DUCA 2GT8A 1XMNB 1GBLA 1UVSH 4ISHH 2V3OH 4THNH 3A80A 4BTUB 3RM0H 1G3DA 5E2PA 3SNDA 2P16A 3PO1C 3RXLA 3CS0A 3F1SB 1AKSA 1C5WB 1A0JA 2TRMA 1YCPK 4Y8ZA 1PPGE 1OWHA 4AB8A 3A7TA 4CR9A 1HAHH 3RUOA 1ESAA 1SFIA 1SGRE 1C1UH 2ZDMA 1BBRE 3ZZDA 1P06A 2QN5T 1PPHE 4Q2KA 4I31A 1JXPA 3QK1A 2FODA 1UHBA 3T62A 3A84A 3EA7A 4DJZB 1BIOA 1TLDA 2ZZUH 1SLXB 3GY5A 1C5YB 2FS8A 3RXMA 1ZHRA 3SU6A 1Z6JH 2A2XH 4KELA 3UR6A 1VCWA 2R3YA 5HYOA 3NUMA 1IQFA 2BY6X 4ZKOU 3BTTE 5DP7A 2B7DH 2HALA 5I46H 1H8DH 2ZPRA 3RXIA 1FY3A 1RRKA 2ZGCA 2R3UA 1HXFH 2QV1A 3A85A 1XUJA 3V12A 1MD7A 1MMJN 1MKWK 1TA2A 2UWLA 1AE5A 3BIVH 1SR5C 2GCHG 3P92A 1WAYB 5EG4A 2STBE 1C1RA 1QL9A 1GJ5H 3SNBA 1L1GA 5F6MA 1SLVB 1O2HA 1XXDA 1C5XB 1DITH 1C1VH 4CBOA 1DLKB 4MNXA 1W7XH 2D1JA 1EZUC 2Y80A 1GCDA 1TWXB 2VIOA 1HJ8A 2O8WA 1AVXA 1T8MA 5EXNA 1FIWA 1YCPH 2GVFA 2P95A 4TYDA 2SGQE 1GG6B 3PLPA 1D3PB 1NPMA 4AB9A 1QRXA 1UCYE 2H9TH 5E0JA 3HGPA 1YKTA 1O34A 3PO1B 1QB6A 1WTHD 3LC5A 3LPRA 5DPAA 1LVYA 3QGJA 1DE7H 4BAMB 3E3TA 2FTLE 3VB3A 2CF9H 1GJCB 3E6PH 3M3TA 1INCA 2VH0A 5CE1A 1NC6A 5L30H 1P2JA 4ISIH 3S9CA 5LGOA 2D8WA 1ELAA 1NFUA 1ZTKA 3NXPA 4FUJA 4TPYA 3Q00A 3RU4D 1BTPA 1WOFA 4FUBA 2W3IA 3SQEE 1HJ9A 1O2IA 2QAAA 4ZKRU 2SNVA 1MKWH 3KCGH 1AWFH 2ANMH 3Q3YA 4BTIB 2BD7A 1C1MA 4CHAC 1YLDA 1EZXC 3GDUA 1OKXA 1GBHA 1DT2A 2GGVB 1FN8A 1GHYH 1GBCA 4B2AA 1QBNA 3RLYH 3SW2B 5JB9S 4BAHB 1V2KT 2ZU4A 1QB9A 1UK2A 3RDZA 2BZAA 1GI1A 4OS4A 3ZZCA 2QY0B 2PR3A 2Q1JA 4B2CA 2R2MB 3JZ1B 3P95A 3OSYA 3SO3A 2H9HA 4ZHLU 2OQUA 1C5MD 3E0PB 2D2DA 1NRSH 3LJJA 3RP2A 1DICA 3TH3H 2GX4A 2CXVA 1ZSLA 1O3FA 1O2KA 1G3EA 2AIQA 2OXSA 2GZ7A 4X0WU 1BMNH 2A45B 2F9PA 3O8DA 3SUDA 2ZFFH 2BOKA 1DUEA 4KTSA 4XBCA 2A7CA 2C3SA 2OLGA 3ATKA 2P8OC 4CR5A 1BA8B 4DVAU 3E0NB 3RMOH 1PPCE 2F91A 1DXPA 2TGTA 3VEQB 5E0HA 3RXUA 2KAIB 4ZMAH 2VH6A 1IQIA 1H9HE 5FPTA 1EATA 1EP6A 1G3CA 2J94A 4JYUH 2C8WB 4Y0YE 1GJ8B 2I6SA 3L3TA 2Z3DA 1NU7B 2Y81A 1MU8B 4X8VH 1JBUH 1CT2E 2BDIA 1NM6A 1JRSA 1RJXB 3A82A 2ZO3H 1GBEA 3U9AH 3GISB 1ARBA 3FFGA 1O35A 4MPXA 1UTMA 2ZHQH 1P9UA 3UOPA 1SB1H 5FCKA 1CHOG 5A2MH 1L2EA 1BMAA 2BLQA 1B7XB 4CHAB 3K6ZA 3RXPA 1P2OA 3S7KB 1XKAC 2XW9A 2TIOA 1SQTA 4LZ4B 4NSYA 3GYLB 5HM9A 2RCEA 2BB4A 5GCHF 3RC6A 4WMEA 4ISNA 1V2VT 1K1LA 3VXFH 2FPZA 2Z3EA 3QO6A 1FPHH 1LCYA 5FPSA 5A0CA 1XUKA 5K7RA 5ESTE 2GV7A 1IOEA 3A7ZA 4JMYA 4XBDA 4E7RG 2V0BA 3ZYDA 1EXFA 4DOQA 3E91A 3D65E 1QQUA 2AEIH 3FP6E 3E1XB 3BIUH 1C1OA 1NY22 3TH2H 2STAE 1H9LB 1K2I1 2FO9A 4I33A 3SGAE 2OC7A 3RXCA 4X8SH 3SJ9A 4UE7H 2VVUA 1ELVA 1WSSH 2P3FH 3UY9A 1TRMA 1D3TB 3A8BA 4R0IA 3NPSA 5LPFA 4B76A 1XUFA 4GHTA 1V2NT 2OTVA 2BX3A 2P8OB 4ABHA 3EYDA 1YBWA 1S6HA 1TBZH 1ANDA 3O8RA 1AY6H 2RA3A 1WYKA 1NTPA 1HAZB 1P2IA 1GHAF 1LQEA 1O5BB 1NT1A 2BQ6B 1Y5AT 1S5SA 1ZMNA 3PMBB 4WY3A 4AFSA 1WU1A 2UUFB 1SLUB 4GUXA 5GDSH 3IITA 3L6PA 1GJAB 4OS5A 3KGPA 5JBTA 1ESBA 3TIUA 2H1UA 3T27A 1LHGH 2PUQH 1G30B 3P8NA 4AFQA 1C1QA 2ZU1A 2UUJB 1NO9H 2C8XB 2Z9JA 1C5OH 1DOJA 1W0ZU 2BM2A 4JK5A 2Z3CA 2ZDAH 1UVOA 2ZCLP 1G2MA 2Z94A 2P3TB 1OWJA 1E34B 1WUNH 7LPRA 2CGAA 4AG2A 3O8CA 1NRNH 1GGDC 1CE5A 2F9BH 3ZZAA 1V2RT 1AUJA 1QBVH 1MTVA 4Q80A 1LQDB 3ITIA 4H42U 4GCHG 2KAIA 1Q2WA 5F8TA 1HFDA 1TMTH 2AMQA 1ZR0A 1KTSB 1BRCE 3RXFA 1V2JT 1J15A 4CH2B 3QTVH 5DG6A 5FPYA 3SNCA 1RS0A 3KF2A 1OSSA 3FAOA 4TY7A 2GZ8A 3EA8A 1AO5A 4MG3A 4DCDA 1GHZA 5TCCA 3SU2A 2C8YB 2HNTE 2OINA 1O3DA 3LGUA 3ZZ7A 1GMCG 2FOFA 3GCTG 1C5ZB 2BOHB 3VFEA 3GCNA 1HDTH 1PPEE 5JBCS 2ZC9H 1RFNA 1EZQA 5JPMH 4WMFA 2FX4A 3B9FH 1FV9A 5HGGA 5T6DA 4OGYA 3A83A 1CT4E 1C5RA 4OS6A 5G4BA 5DP9A 1TGSZ 4K69A 1E35B 1LKBA 2OUAA 1BMLA 1TGTA 4LOYH 2ZEBA 1ANEA 1THPB 3QDZB 1GHWH 2FEQH 1BTYA 7ESTE 1W3CA 1MUEB 3V13A 1KXEA 3SNAA 5F8XA 3MYWA 1BRBE 4LXBH 1RXPA 1YPEH 4A1TA 1CVWH 2VIQA 2XWAA 4YOGA 3BG4C 2P93A 1W14U 2ASUB 4F49A 2EI8A 2RA0A 3MH7A 1E0FD 3S9AA 3VGCC 1GGDB 3STIA 2F83A 5DKMA 3BTDE 3F68H 4ZAEA 3MU1A 1O5CB 1P3CA 1ETTH 3M5OA 2C93B 2TPIZ 3BN9A 1FZZA 2G52A 5DGJA 2HGTH 2NWNA 4CRFA 4MNWA 3M37A 3ENSB 1O2WA 3S7HB 3GY6A 1C5NH 1MKXK 1CA8B 1TNIA 2Q6DA 4J2YB 1ELDE 1FNIA 3MOCA 4B71A 3DT0H 1O3MA 4E7NA 1Y3XA 1LVBA 3ZZ5A 6LPRA 5A8ZA 1O2SA 1WQSA 1UTOA 1O3HA 1ZMLA 2ZU3A 1B0FA 1D3DB 5PTPA 3KQDA 3A87A 4A6LA 1S82A 1Y3VA 4Y71A 4YOIA 1CHGA 4O3UA 5FX6A 3RU4E 2VVVA 3D23A 2Y7XA 3GY3A 3SV9A 1P12E 1SOTA 1DDJA 3GY4A 2VIDA 1GL0E 4MPUA 1O5DH 5T3HA 1YM0A 1ELCA 4FU7A 2BY8X 1VITG 2EC9H 1P03A 3UOUA 1KIGH 4XE4A 1GBTA 1GI9B 3RXAA 2BXUH 1TFXA 1OX1A 3TK6A 3UWJH 1BRUP 3A88A 3PB1E 3PLBA 1JOUB 2QGRA 1QTFA 4WH8A 2ZPQA 1AFEH 1SGCA 3BG4B 3PLKA 3R0FA 2Z9IA 1F0UA 1PPFE 1SGPE 2GP9B 4KTUA 3U69H 2IPHA 2VIWA 3Q3XA 3VPKA 1NU9A 1O3NA 5EGMA 1EASA 3VGCB 2H6MA 2VIPA 2P59A 4YOJA 1MKXH 1DY9A 4UFDH 3M36A 2AGEX 4BNRA 1XM1A 1AQ7A 3BTFE 4ZXXH 3ESTA 4H6TA 1KXCA 1TRNA 3CP7A 4FUHA 1GDNA 5GXPA 2Q6FA 4YTAA 3AAUA 1TMBH 1TYNA 3ODDA 4GVUA 3RXEA 1NRRH 1YCPM 4XBBA 1UK3A 2PWXA 1OOKB 3W94A 3U8OH 4X1SU 1C4Y2 1HJAC 1CO7E 1TPPA 1YC0A 1BQYA 3A7WA 1JRTA 3LGIA 3LT3A 1TRYA 3DUXH 2QXGA 3B8JA 3T28A 1G9IE 1KDQA 2ZF0H 2J92A 1O2OA 3SJKA 2FOMB 5JBBS 4B74A 2VWMA 4K8BA 3F9FA 1GCTC 3TJUA 1CGJE 3HKIB 1GI6A 2ZIQH 3SJ8A 1J17T 5HMAA 3UR9A 5FCRA 1TNKA 3D62A 4AN7A 1MU6B 1BHXB 3CENA 4IMZA 4RSPA 1P01A 5EQRA 1ZTLA 1DWEH 1Y8TA 3PV4A 5BRRE 2ZA5A 5I25A 5TCAA 4BAOB 2OCVB 1O39A 3HK6B 2FOHA 2CF8H 2CN0H 1YPMH 1F2SE 1NROH 3QUMP 1PQ8A 1ELTA 1T4VH 3PWCA 3P70B 4ZH8A 2C8ZB 2HNTC 4A5TS 3OY6U 3BTHE 3DFLA 2ZQ1A 1T31A 2WYGA 2TGPZ 4ISLA 2J9NA 2ZFPH 3A8CA 3RXBA 2W7SA 2FESH 3NZIA 1ELGA 3EDXB 1KXBA 4ZXYH 2PGQB 2ZWLH 5C1UA 5F03A 1V2PT 2ZFQH 4ABDA 1HAGE 4JZIA 1EAIA 2BD4A 4B75A 3C27B 1UVTH 4ABEA 1BMMH 1UJ1A 2WPMS 3AAVA 1AB9C 3LONA 1ANBA 1FI8A 5C20A 1ZTJA 4BXWA 4X1QU 3UPEA 1Y5BT 4FVDA 1GWAA 4IMQA 1HJAB 2BLOA 7KMEH 1AN1E 1K1JA 2XCFA 3ZVGA 1TAWA 1MCVA 4TPIZ 2BZ6H 5FBEA 3BTGE 3PTNA 3UWIA 1BCUH 3W95A 4NIYA 2PUXB 2GCHF 1EPTA 1EJAA 3MU8A 5AVDA 3BTKE 4DT7B 1GCTB 4NWKA 1V2TT 5C67A 2HPPH 4AYYB 3OYPA 3DHKH 1MBMA 3A8DA 1ELFA 1LPGB 1XUGA 1O2ZA 2CHAC 1AI8H 2GCTC 2A4RA 1EUFA 1MQ6A 1EJNA 1UTQA 3RXGA 3ZVEA 1H9IE 4H6SB 3Q76A 1GPZA 2A1DB 1PJPA 2FZZA 1EZSC 5EPYA 4ZHMU 2ZGXH 4X8UH 1GJ7B 4JK6A 1KXFA 2A5AA 3CS7A 1TX6A 1GI5A 3MH6A 3SV7A 1DUAA 2BD9A 4NZQA 1YPGH 4Y0ZE 2I6QA 2Q6GA 3F6UH 5LPRA 4CBNA 1F0TA 3AVZA 3SJOA 1K1PA 3U8RH 5AFZH 2P3UB 1RGQA 2WPKS 1RTKA 3SU4A 1SSXA 1OWIA 2M5TA 2RDLA 2ZFTA 5E2OA 3V7TA 4K3JA 1O3OA 4VGCC 3KL6A 3DA9B 3QZQA 1TGNA 1ZGVA 1ZLRA 4X1NU 4FUDA 3UNSA 1T7CA 5DP3A 1AB9B 1BJUA 4AG1A 1Y3UA 4ABGA 1LPKB 4CRAA 1KTTB 1WCZA 3T26A 1QFKH 5BPEA 2BDBA 4MPVA 2ZTYA 4E05H 1D4PB 4WXVA 1HAVB 4YLUA 2O9QA 1QA0A 1GVKB 4OS1A 3MU0A 2EA3A 2W5EA 2PTCE 3NCLA 1A5IA 6GCHG 5DP4A 1A5GH 3MH4A 1GBBA 2Y82A 1SGFG 3K2UA 3SN8A 1A2CH 2H9EH 1W13U 4X1RU 1QL7A 3GDVA 1C4V2 1MBQA 1D3QB 5E0GA 1PYTD 2CHAB 5EODA 1O2YA 2GCTB 1OS8A 4WVPE 1FONA 1S83A 2QYIA 2PKAB 1HBTH 2WUBA 1DANH 1EAXA 1DLEA 2SGDE 1PYTC 1TGBA 1IQEA 2GDDA 1SHHB 4PROA 3V3MA 1M9UA 1O3GA 4ZHAA 3S69A 3KN2A 4AFUA 1LO6A 1K28D 2XBXA 2JH5D 1F0SA 1ANCA 1GBAA 1G37A 1GJBB 1BTWA 2HWLB 2YNBA 4YO9A 3ATMA 5DJ7A 1BTHH 4MQAA 1QA7A 5FAHA 1QY6A 3UQVA 3H7OA 2ZTZA 1W11U 1SC8U 4XSKU 1TX8A 2Y6TA 1QURH 4FUFA 4AOQA 1G2LA 4K8YA 2AH4X 4BAQB 1LPZB 1JMOH 4VGCB 1EAUA 4O97A 1XVOA 1O2NA 1TQ0B 4X2VA 1CHOF 1C9PA 4NA7A 1AWHB 3OX7U 3MNSA 4K1EA 1GJ6A 1FMGA 3KNXA 3RMNH 2B0FA 1TMUH 2A7HA 2BY7X 2B9LA 2HLCA 1UTKA 1BTUA 1VJ9U 4NZLA 3TITA 4CRBA 4NG9H 3T5FH 1FY5A 2NU0E 5GPIB 3LH1A 2WV5A 1K1OA 3IWMA 3LC3A 1PQAA 1SGDE 2TBSA 1EX3A 2BDCA 1QB1A 1UTLM 2ZGBH 1C2GA 1TA6A 1C1PA 3PROA 4I8HA 1WBGB 2G5NA 3G01A 1AZ8A 5IYTA 3QWCH 3Q77A 2R2WU 3P8FA 3RXOA 3ZZ8A 4I8LA 1C2EA 4CH8B 2WYJA 1MQ5A 2XRCA 1O37A 2QIQA 3S0NA 2BHGA 1V2QT 5C1XA 1ABJH 1D9IA 3RXKA 3M5NA 3MU5A 1TNLA 2ZU5A 5EPNA 5EU8A 1A0HB 2V3HH 1U6QA 2BD8A 1HYLA 1F92A 5EQQA 2W7UA 1QHRB 1HAVA 1Y3WA 2AMDA 4INKA 2GKVE 4RN6A 2IJOB 3JZ2B 4UFFH 1AGJA 4ISOA 3TGIE 1D6WA 1O36A 1QIXB 1UVUH 1TPOA 3AASA 2FS9A 3ZZ3A 2PGBB 2BVXH 3KQBA 5EW1H 3UNQA 3K9XB 1HB0B 4AORA 3U98H 8KME2 2VVCA 3K6YA 4IS5A 5L6NH 4U32A 2FYRA 2J95A 4TY6A 2ZTXA 3U8TH 4KTCA 3SI4H 4DY7B 4INHA 3VB6A 1LDTT 3PYHA 2FLRH 2CMYA 1QL8A 2PKAA 1GBDA 5JB8S 3SOSA 4K1TA 4AGKA 1J14A 2A4OA 1PQ5A 3FANA 4ZROA 3BTEE 1BZXE 2SFAA 3EE0B 3S9BA 4D7FA 1A3BH 1ETSH 1WV7H 4YT6H 4M7GA 2FIRH 1TE0A 1CA0C 4GCHF 3RXDA 1HAOH 1WQVH 4ASHA 3KHVA 2BVSH 2EEKA 1V2MT 2Y5HA 4A1XA 1GJDB 1O2UA 1SGFA 1SQOA
chains in the Genus database with same CATH superfamily
4K1SA 2AGIX 2FI3E 3TK5A 4JZ1A 4K2YA 1LTOA 3BF6H 4GSOA 5GJ4B 3ZVDA 1CBWC 2HPQH 1TGCA 2QF3A 1QGFA 2A31A 1GMCF 4KKDA 4FUGA 1FY8E 1OWKA 1SGIB 3GCTF 4I32A 4MVNA 2ZECA 1HIAB 1ZYOA 1RTFB 3MO3A 3QZRA 1EOJA 5A0AE 2NU2E 1SI5H 1KSNA 4ASUD 1AZZA 1SG8B 4JYTA 2G4TA 4ZKSU 4IGDA 5DP6A 1O30A 5FBIA 5L2ZH 3H7TA 4X6NA 3DD2H 2W26A 3LU9B 3MO6A 3F2HA 2K8IA 3ODFA 4XOJA 4X8TH 1MTUA 1GI4A 2VNTA 4MNYA 2ZCKP 1SGNE 1V6DA 3SZNA 4A92A 1TB6H 4Y76A 3HK3B 5EOKA 1C2JA 2K1QA 1DFPA 3RXHA 3F9GA 3LDXH 1T32A 3RC4A 4P02A 4MDSA 1D6RA 4IC6A 1GHBG 1BDAA 1GMHG 2VJ1A 1V2ST 4NIXA 3M3VA 3LJOA 3M35A 2UWPA 2WPHS 3M61U 2FLBH 3KYGA 1IQHA 1J16A 2XBWA 4FUCA 1YPKH 4WJG2 5DP5A 5FX5A 3VB4A 1T8OA 4NGAH 3RXSA 1TOCB 3URDA 3A81A 2PLXA 1SGEE 1XUHA 1W10U 1IAUA 2BY9X 3STJA 1S6FA 4CRGA 2A32A 1O0DH 2A5KA 5A8XA 1EKBB 5DO4H 2F9NA 3FZDA 1GMDG 2G51A 4IW4E 2FOCA 3EGKH 4UONA 3C1KA 5F53A 1EAWA 2XC5A 1CA0B 3GYMA 4A1VA 2C4FH 3E90B 3TNTA 4X2YA 3RC5A 1V3XA 1KY9A 2AYWA 1MZAA 1SMFE 4Z1MD 2LPRA 4O03A 2QXIA 3MNXA 1AD8H 1H8HD 1GMDF 1L4ZA 2ZP0H 1EOLA 3LKWA 4AX9H 1IQLA 1CBWB 2XNDD 5EXMA 4Z0KA 3SU1A 5JYIA 1ZGIA 3F9EA 2W3KA 4TSFD 1Z1JA 1O2JA 4KGAA 1UO6A 2XBVA 2GMTC 4RKJB 2ZI2H 1B5GH 3EA9A 4INLA 5FXLA 1P10A 2KCYA 1O2LA 2PHBA 3ATWA 3RXQA 3F2GA 1MD8A 3ZZ6A 2XCNA 2ULLA 2NU4E 1UMAH 2F9UA 1C5QA 1HCGA 1OPHB 2FI4E 3MI4A 1OWDA 3MWIU 4I8JA 2G4UA 3MH5A 1VITF 3URCA 1THSH 5AFYH 1MTWA 3RXTA 1FY1A 2Z9LA 1BJVA 1TNHA 1G3BA 1FIZA 4WH6A 1NZQH 1YPJH 1MTNC 2KCAA 3M7UA 4O9VA 2AS9A 3NK8A 3UREA 1NRPH 4HFPB 3BTME 1S81A 1C2HA 1H8ED 4AC9A 1TNGA 2J34A 1S0RA 2B8OH 3BG8A 5H4IB 1QJ7B 4FUEA 1C5LH 1HIAA 5DSFA 1MAXA 2AERH 5CMXH 1HXEH 2ZDVH 1GI7B 3NWUA 3R3GB 2ILNA 3PMAB 1TNJA 1GI0A 2HVXA 4UFGH 4Y6DA 5E8EH 2AGGX 3F9HA 3AK5A 4JZDH 1BHXF 3D49H 3AW0A 5K0HA 3A8AA 5EXLA 3MTYA 2FOGA 1O2MA 1Z8JB 9LPRA 4K60A 2JKHA 9ESTA 3A7YA 2FWWA 1MZDA 1G36A 3KIDU 1HGTH 1VCQA 1AHTH 5TJXA 4DIHH 4R8TB 2ZHFH 2A7JA 4CRCA 2OD3B 4JCNA 1W12U 3RM2H 1HAIH 1E79D 3SNEA 4FU9A 1C4U2 3FZZA 1ELEE 1QCPA 2GMTB 1L1NA 3I29A 4CREA 2TGDA 5T1VA 2ZG0H 4D76A 3T25A 1W8BH 2FI5E 3SI3H 1JIMA 3GCHC 1FAKH 1ZSJA 1LMWB 1Y59T 1BTXA 1SQAA 2V6NA 1SGYE 1J8AA 4IBLH 1PPZA 1OP2A 2F9VA 2XTTB 6CHAC 2WUCA 3GCOA 1OP8A 2XC4A 4HZHA 3KQ5A 4XFQA 4ESTE 3U28C 1HPGA 4D9QA 1XXFA 3ZVFA 5C94A 3RXRA 1IQKA 5SGAE 3SJIA 4P00A 1MTNB 2PTNA 2VU8E 1DVAH 4Q7XA 1BUIA 1HLTH 3HGNA 2C90B 1HAYB 1SGTA 1L4DA 2XC0A 1EB1H 2GTBA 5EQSA 2DE9A 1AMHA 1SOZA 1AU8A 1Z6EA 4HTCH 1VGCC 3PWBA 4SGBE 2FDAA 3UNRA 4XRNA 3RLWH 3UIRA 1GJ4H 1XUIA 3TLOA 1O2QA 3SU5A 2BY5X 1ACBE 1HRTH 2OP9A 4KP0A 2G5VA 1C5TA 2LNCA 2ZFRH 1TONA 4F48B 2OC8A 3GDSA 1DXWA 1P2NA 3BSQA 3FVFB 2D26C 1C2IA 4ABFA 3SUEA 1N1LA 1UVPA 4WXIA 4NWLA 3MU4A 7GCHG 4UDWH 1ZPZA 4I8GA 4ABIA 4Z6AH 4FOUC 1JIRA 1F5LA 1NRQH 2BDGA 1V2LT 1KXAA 1ID5H 1V2OT 4UFEH 3WWFA 3U1JB 3ATIA 1T8NA 2PV9B 1BMFD 3PTBA 2PKSC 2SGEE 2HNTF 2ODYB 3TPIZ 1VKYA 4RT0A 4IN1A 3MFJA 1Z71A 4O3TA 1O2VA 2ANKH 3M5LA 3DFJA 4SGAE 5ABWA 1C5PA 7GCHF 3GOVB 1K21H 1G32B 1NESE 1O3EA 1W0YH 1TIOA 2R9PA 1ORFA 1UTNA 2BX4A 3GCHB 2THFB 4B73A 1UTJA 5A8YA 3HPTB 2WINI 1E37B 1BOQA 1MTSA 4Y79A 4NFFA 3AW1A 2GZ9A 2EQNA 4Y11E 1SBWA 1P3EA 4LK4A 1JWTA 6CHAB 5C17A 3ZIAD 2Z9KA 2UWOA 4NSVA 2PFEA 3EQ0H 2XBYA 3ZVCA 1P11E 4GHQA 3ZV8A 1A4WH 3M7TA 1PQ7A 2RDEA 4FVBA 2G00A 3SU0A 2ZQ2A 1O3LA 2ZHWH 2JETC 2FP7B 2ZFSA 2OBOA 2ZDNA 4DGJA 1DSUA 1A61H 3MMGA 4AZ2B 2Z6BD 1VGCB 5B6OA 1O38A 2GD4B 3EAJA 1HAPH 5HIZA 3OY5U 4XDEA 1H1BA 1C1NA 4YZUA 4NIWA 4NFEA 1F7ZA 2FMJA 1EFRD 1MAYA 1E1RD 1XX9A 2A2QH 2A4GA 2ALVA 2VGCC 4YESB 1DWBH 1WTGH 4DG4A 2O8LA 3OTJE 4J1YA 2ALPA 4MLFB 2XXLA 3P17H 4CRDA 3TJVA 1EP5A 1YWUA 3IG6B 1O3IA 2R0LA 4Q7ZA 3I78A 1C1WH 3TVJB 3UFAA 3BEIB 2BD2A 3QX5H 2TGAA 4JZEH 1K1MA 2BQ7B 1LVMA 4BXSA 1FY4A 2GJGA 1Z8IB 2ZDKA 3Q3KA 2ZU2A 1FXYA 3EE7A 4K5ZA 2PKSB 1P2KA 4E06H 4MNVA 3ZYEA 2ZDLA 3K65B 1OP0A 2Z7FE 3TNSA 1C2LA 3VB7A 1TQ7B 6GCHF 4Y7AA 1N8OC 1CGIE 1C2FA 5J4QA 2JIZD 2FYQA 1A7SA 2BYAX 5FHTA 2J2UA 1NN6A 2BMGB 1O32A 3MO9A 1SFQB 1FJSA 2XYAA 1S6LA 4Y10E 4DIIH 2QF0A 2A0QB 1LHDH 2B5TB 1AVWA 2ZPSA 5LPEA 3E16B 1W2KH 3T29A 5C1YA 4NCYA 3RU4T 5JDUB 5GWZA 1EB2A 1ZPBA 3A89A 3SV2H 3MHWU 3SZEA 1OWEA 3BTQE 3QTOH 5L2YH 2P94A 2FOEA 2Y5FA 3LIWA 1A46H 2ZNKH 1Z1IA 2AFQB 1AVGH 3P6ZB 3FP7E 3QGNB 2XNIA 3LGWA 1O3AA 3V0XA 4ABJA 3GY2A 2JETB 1C1TA 3SHAH 1GI8B 2ODPA 4TWYA 5GCHG 1YPHC 1EQ9A 1VJAU 3TJOA 4Q4LA 3LGVA 1L1JA 2ANWA 1IQJA 4OS2A 2BVRH 2H2ZA 4GPGA 4YM9A 1TALA 1T8LA 1QJ6B 3ZVAA 2HLDD 1K22H 2WPIS 1O5EH 2VGCB 3F0PA 3GICB 3RXJA 3U1IB 5DK1A 1K1IA 1ZHPA 2O8UA 4UD9H 1TX7A 1HUTH 1UK4A 1P04A 2ODQA 3KQCA 1CGHA 3KEEA 1O2RA 5A0BA 4HG6A 5C5OA 5C0UA 1VZQH 2HOBA 2VB0A 1YYY1 3SUFA 3SUGA 2PSYA 1BTZA 6ESTA 1W7GH 2WV4A 1FPCH 1GBIA 1RTLA 1GVLA 3P8GA 5CHAC 3UTUH 4Q7YA 1SQRA 1SVPA 1S85A 1YGCH 3N7OA 1BBRK 1E38B 1W0JD 4WMDA 1AUTC 4D9RA 2J4IA 1N8OB 1ZMJA 1O33A 4HGCA 3L33A 1MCTA 2OC1A 3A7VA 2G81E 1T4UH 1QRWA 4X2XA 1C5VA 3BEUA 4JYVH 1GHAG 1NFXA 1O2XA 1GBMA 4BTTB 5DP8A 1C9TA 2KCPA 4HI3A 1YP9A 2NU3E 4X6MA 3WY8A 4TT3D 1QZ8A 1LVOA 2R0KA 1P2QA 4GLYA 5DN6D 2YNAA 2J38A 2H5DA 1C1SA 2BLVA 5J4SA 1Z8GA 1NFYA 1XVMA 5C3NA 5C2ZA 3SGBE 1F0RA 1GBKA 1HV7A 1KYNA 1DM4B 3TH4H 1O3PB 4H4FA 1FAXA 1WDIA 3VB5A 5B6LA 1A3EH 5GNDA 1IQMA 4X1PU 3ZZBA 1P9SA 3ATLA 1NFWA 4FXGH 2UUYA 1FQ3A 2G8TA 1DWCH 1N6YA 4ZUHA 1C2MA 3MNBA 2VINA 1ELBA 1GDQA 2WPJS 5EW2H 1H8IH 4RKOB 1QJ1B 1SGQE 2FM2A 1C5SA 2WPLS 2YOLA 3I77A 1QRZA 1SL3A 1KLTA 3SORA 2ANYA 3PMJA 1Y5UT 2VWNA 1O3KA 1FX0B 2VWOA 1TPAE 1BRAA 1UCYK 3BEFB 4U30A 1BBRH 2ZKSA 1O3JA 2QXJA 1QR3E 4DW2U 5IDKA 3TJNA 3LGTA 4X6OA 2FX6A 2BLWA 1THRH 1W0KD 2RG3A 1Q31A 4X2WA 3MNCA 2JH6D 3BV9B 2Z9GA 1O31A 3QN7A 1VR1H 3ZZ4A 1RIWC 4D8NA 5CHAB 3ZV9A 1KLJH 2Y5GA 3ZVBA 1ZSKA 4D7GA 1BITA 4NA8A 1GVZA 1F5KU 1GL1A 1ZPCA 3GY7A 3ELAH 3M5MA 3HKJB 1ESTA 1AFQC 2ZHDA 5C5NA 4QT8C 1FLEE 3RXVA 4YLQH 1ZRBA 2V35A 3CNRA 4IN2A 2EI6A 3OEED 4I86A 5JBAS 1DPOA 2FTMA 1SHYA 1Z8RA 1TABE 3SBKA 4BAKB 4LZ1H 1GBJA 4TWWA 2OBQA 1S0QA 2J97A 3A86A 2DE8A 3M3SA 2NU1E 2XWBI 4ZKNU 1DSTA 1O2GH 1QQ4A 1P57B 2AIPA 1P2MA 3B23B 1A5HA 1V2WT 2QA9E 1CT0E 1Z7KA 1NBME 1O3BA 1GDUA 2Y7ZA 1IQNA 5A09A 4GAWA 3RMLH 1AE8H 1CSOE 2EI7A 2GV6A 5ETXA 3OU0A 1LKAA 1FUJA 2ZGJA 1OYTH 3E8LA 5AHGH 2VIVA 4YT7H 1BB0B 1DWDH 1OXGA 1IHSH 4Y8YA 1VCPA 1UCYH 2SGPE 2ZCHP 3UUZA 1KDQB 3P8OA 1AIXH 2BD3A 5HM2A 1O2TA 3UB0A 2CJIA 3LH3A 2ZGHA 1EPTC 3O8BA 1N6XA 3KQEA 2UUKB 2FOAA 2IOTA 1B0EA 3F0OA 4A7IB 1TBRH 2FXRA 1GHBF 1GMHF 1P09A 1SLWB 4I7YH 2QXHA 3TK9A 1P05A 3PM3A 2BXTH 1GHVH 2PW8H 4JZFH 4B2BA 1AKSB 2H5CA 3TGJE 1O5AB 2FOBA 1S84A 1ETRH 1GBFA 3SV6A 1GHXH 4B1TA 1IQGA 1O5FH 4DURA 3SV8A 4FU8A 4NIVA 2AMPA 1ZOMA 2BTCE 1SPJA 3SHCH 1CQQA 1RIWB 4OS7A 2A5IA 2YMSC 1TOMH 1P0SH 1UHBB 1HNEE 1YLCA 3H09A 2SGFE 2IN2A 3LOXA 4Y8XA 1Y3YA 3SQHE 4UEHH 1IHTH 5F8ZA 3A7XA 1AFQB 3SGQE 2BDAA 3LGYA 1KLIH 3H5CB 1XKBC 2GDEH 4AFZA 1QBOA 3T2NA 3FP8E 3M7QA 1YF4A 4U01A 1PFXC 4Y7BA 1L0ZA 1PPBH 4AYVB 1C5UA 1K1NA 2OC0A 2BD5A 2O8TA 1UTPA 1C2DA 2F3CE 4OGXA 4AGJA 1C2KA 1V2UT 5LH8A 4NA9H 8LPRA 1EJMA 4I8KA 4FUIA 2VWLA 1NS3A 1HAXB 1LHCH 2SNWA 1TBQH 1QNJA 2JDID 3GY8A 1DS2E 1ZJDA 1ZJKA 1X7AC 5HXFA 4ABAA 2F9OA 1ARCA 4U2WA 1K9OE 1ZHMA 1GI2A 2BDHA 8GCHG 2BQWB 1EPTB 1Q3XA 1GI3A 2WPDD 2G55A 2O8MA 1DY8A 1P8VC 3PMHB 3QLPH 3HATH 1P02A 2CV3A 3TU7H 4WF8A 5T6FA 1F5RA 1O3CA 1LHEH 4MTBA 1O5GH 1VITH 2JH0D 5T6GA 2A4QA 3SU3A 5AF9H 1LHFH 2OQ5A 8GCHF 1E36B 1OYQA 1H4WA 4ABBA 1BT7A 4IC5A 1RD3B 1FDPA 4F4OC 3UQOA 4X6PA 1J9CH 1YPLH 3ZZ9A 1DX5M 2BDYA 2QCYA 4BOHA 5ESBA 2PSXA 2CK3D 2YMSB 1KXDA 8ESTE 4WWYA 1FN6A 3VXEH 1O2PA 2SGAA 4MPWA 4BANB 3OFND 2HRVA 1A0LA 1GJ9B 2GT7A 3RMMH 1MH0A 3BTWE 1YPHE 1CU1A 1ABIH 1ZRKA 2ESTE 3TGKE 2QC2A 2ZHEH 1GG6C 1TPSA 1ZZZA 3NKKA 1A1RA 5GIBA 2DUCA 2GT8A 1XMNB 1GBLA 1UVSH 4ISHH 2V3OH 4THNH 3A80A 4BTUB 2WSSD 3RM0H 1G3DA 5E2PA 3SNDA 2P16A 3PO1C 3RXLA 3CS0A 3F1SB 1AKSA 1C5WB 1A0JA 2TRMA 1YCPK 4Y8ZA 1PPGE 1OWHA 4AB8A 3A7TA 4CR9A 1HAHH 5C0TA 3RUOA 1ESAA 1SFIA 1SGRE 1C1UH 2ZDMA 1BBRE 3ZZDA 1P06A 2QN5T 1PPHE 4Q2KA 4I31A 1JXPA 3QK1A 2FODA 1UHBA 3T62A 3A84A 2OK5A 3EA7A 4DJZB 1BIOA 1TLDA 2ZZUH 1SLXB 3GY5A 1C5YB 2FS8A 3RXMA 1ZHRA 3SU6A 1Z6JH 2A2XH 4KELA 3UR6A 1VCWA 1NBMD 2R3YA 5HYOA 3NUMA 1IQFA 2BY6X 2J98B 4ZKOU 3BTTE 5DP7A 2B7DH 2HALA 5I46H 1H8DH 2ZPRA 3RXIA 1FY3A 1RRKA 2ZGCA 2R3UA 3F2FA 1HXFH 2QV1A 3A85A 1XUJA 3V12A 1MD7A 1MMJN 1MKWK 1TA2A 2UWLA 1AE5A 3BIVH 1SR5C 2GCHG 3P92A 1WAYB 5EG4A 2STBE 1C1RA 1QL9A 1GJ5H 3SNBA 1L1GA 5F6MA 3PRBA 1UW7A 1SLVB 1O2HA 1XXDA 1C5XB 1DITH 1C1VH 4CBOA 1DLKB 4MNXA 1W7XH 2D1JA 1EZUC 2Y80A 3OE7D 1GCDA 1TWXB 2VIOA 1HJ8A 2O8WA 1AVXA 1T8MA 5EXNA 1FIWA 1YCPH 2GVFA 2P95A 5FL7D 5KECA 4TYDA 2SGQE 1GG6B 3PLPA 1D3PB 1NPMA 4AB9A 1QRXA 1UCYE 2H9TH 5E0JA 3HGPA 1YKTA 1O34A 3PO1B 1QB6A 1WTHD 3LC5A 3LPRA 5DPAA 1LVYA 3WWBA 3QGJA 1DE7H 5EJ1A 4BAMB 3E3TA 2FTLE 3VB3A 2CF9H 1GJCB 3E6PH 3M3TA 1INCA 2VH0A 5CE1A 1NC6A 5L30H 1P2JA 4ACBA 4ISIH 3S9CA 5LGOA 2D8WA 1ELAA 2JJ1D 1NFUA 1ZTKA 3FO8D 3NXPA 4FUJA 4TPYA 3Q00A 3RU4D 1BTPA 1WOFA 4FUBA 2W3IA 3SQEE 1HJ9A 1O2IA 2QAAA 4ZKRU 2SNVA 1MKWH 3KCGH 1AWFH 2ANMH 3Q3YA 4BTIB 2BD7A 1C1MA 4CHAC 1YLDA 1EZXC 3GDUA 1OKXA 1GBHA 1DT2A 2GGVB 1FN8A 3OAAD 1GHYH 4ACAA 1GBCA 4B2AA 1QBNA 3RLYH 3SW2B 5JB9S 4BAHB 1V2KT 2ZU4A 1QB9A 4FETA 1UK2A 3RDZA 2BZAA 1GI1A 4OS4A 3ZZCA 2QY0B 2PR3A 2Q1JA 4B2CA 2L74A 2R2MB 3JZ1B 3P95A 3OSYA 3SO3A 2H9HA 4ZHLU 2OQUA 1C5MD 3E0PB 2D2DA 1NRSH 3LJJA 3RP2A 1DICA 3TH3H 2GX4A 2CXVA 1ZSLA 1O3FA 1O2KA 1G3EA 2AIQA 2OXSA 2GZ7A 4X0WU 2V3MA 1BMNH 2A45B 4B6EA 2F9PA 3O8DA 3SUDA 2ZFFH 2BOKA 1DUEA 4KTSA 4XBCA 2A7CA 2C3SA 2OLGA 3ATKA 2P8OC 4CR5A 1BA8B 4DVAU 3E0NB 3RMOH 1PPCE 2F91A 1DXPA 2TGTA 3VEQB 5E0HA 3RXUA 2KAIB 4ZMAH 2VH6A 1IQIA 1H9HE 5FPTA 1EATA 1EP6A 1G3CA 2J94A 3DCLA 4JYUH 2C8WB 4Y0YE 1GJ8B 2I6SA 1YY3A 3L3TA 2Z3DA 1NU7B 2Y81A 1MU8B 4X8VH 1JBUH 1CT2E 2BDIA 1NM6A 4M9FA 1JRSA 1RJXB 3A82A 2ZO3H 1GBEA 3U9AH 3GISB 1ARBA 3FFGA 1O35A 4MPXA 1UTMA 2ZHQH 1P9UA 3UOPA 1SB1H 2WHXA 5FCKA 1CHOG 5A2MH 1L2EA 4B6FA 1BMAA 2BLQA 1B7XB 4CHAB 3K6ZA 3WW7A 3RXPA 1P2OA 3S7KB 1XKAC 2XW9A 2TIOA 1SQTA 4LZ4B 4NSYA 3GYLB 5HM9A 2RCEA 2BB4A 5GCHF 3RC6A 4WMEA 4ISNA 1V2VT 1K1LA 3VXFH 2FPZA 2Z3EA 3QO6A 5EJZA 1FPHH 1LCYA 5FPSA 5A0CA 1XUKA 5K7RA 5ESTE 2GV7A 1IOEA 3A7ZA 4JMYA 4XBDA 4E7RG 1SKYE 2V0BA 3ZYDA 1EXFA 3DSOA 4DOQA 3E91A 3D65E 1QQUA 2AHME 2LELA 2AEIH 3FP6E 3E1XB 3BIUH 1C1OA 1NY22 3TH2H 2STAE 1H9LB 1K2I1 2FO9A 4I33A 3SGAE 2OC7A 3RXCA 4X8SH 3SJ9A 4UE7H 2VVUA 1ELVA 1WSSH 2P3FH 3UY9A 1TRMA 1D3TB 3A8BA 4R0IA 2F4LA 3NPSA 5LPFA 4B76A 1XUFA 4GHTA 1V2NT 2OTVA 2BX3A 2P8OB 4ABHA 3EYDA 1YBWA 1S6HA 1TBZH 1ANDA 3PV2A 3O8RA 1AY6H 2RA3A 1WYKA 1NTPA 1HAZB 1P2IA 4DT4A 1WXRA 1GHAF 1E1QD 1LQEA 1O5BB 1NT1A 2BQ6B 1Y5AT 1S5SA 1ZMNA 3PMBB 4WY3A 4AFSA 1WU1A 1OHHD 2UUFB 3PRDA 1SLUB 4GUXA 5GDSH 3IITA 3L6PA 1GJAB 4OS5A 3KGPA 5JBTA 1ESBA 3TIUA 2H1UA 3T27A 1LHGH 2PUQH 1G30B 3P8NA 4AFQA 1C1QA 2ZU1A 2UUJB 1NO9H 2C8XB 2Z9JA 1C5OH 1DOJA 1W0ZU 2BM2A 4JK5A 2Z3CA 2ZDAH 1UVOA 2ZCLP 1G2MA 2Z94A 2P3TB 1OWJA 1E34B 1WUNH 7LPRA 2CGAA 4AG2A 3O8CA 1NRNH 1GGDC 1CE5A 2F9BH 3ZZAA 1V2RT 1AUJA 1QBVH 1MTVA 2F43B 4Q80A 1LQDB 3UAIC 3ITIA 4H42U 4RT1A 4GCHG 2KAIA 1Q2WA 5F8TA 1HFDA 1TMTH 2AMQA 1ZR0A 1KTSB 1BRCE 3RXFA 1V2JT 1J15A 4CH2B 3QTVH 5DG6A 5FPYA 3SNCA 1RS0A 3KF2A 1OSSA 3FAOA 4TY7A 2GZ8A 3EA8A 1AO5A 4MG3A 2WV9A 4DCDA 1GHZA 5TCCA 3SU2A 2C8YB 2HNTE 3FOAA 2OINA 1O3DA 3LGUA 3ZZ7A 1GMCG 2FOFA 3GCTG 1C5ZB 2BOHB 3VFEA 3GCNA 1HDTH 1PPEE 5JBCS 2ZC9H 1RFNA 1EZQA 5JPMH 4WMFA 2FX4A 3B9FH 1FV9A 5HGGA 5T6DA 4OGYA 3A83A 1CT4E 1C5RA 4OS6A 5G4BA 5DP9A 1TGSZ 4K69A 4Q63A 1E35B 1LKBA 2OUAA 1BMLA 1TGTA 4LOYH 2ZEBA 1ANEA 2JJ2D 1THPB 3QDZB 1GHWH 2FEQH 1BTYA 7ESTE 1W3CA 1MUEB 3V13A 1KXEA 3SNAA 5F8XA 3MYWA 1BRBE 4LXBH 4XD7D 1RXPA 1YPEH 4A1TA 1CVWH 2VIQA 2XWAA 4YOGA 3BG4C 2P93A 1W14U 2ASUB 4F49A 2EI8A 2RA0A 3MH7A 3FKSD 1E0FD 3S9AA 3VGCC 2HVYB 1GGDB 3STIA 2F83A 5DKMA 4ZCNA 3BTDE 3F68H 2YMSD 4ZAEA 3MU1A 1O5CB 3PV5A 1P3CA 1ETTH 3M5OA 2C93B 2TPIZ 3BN9A 1FZZA 2VBCA 2G52A 5DGJA 2HGTH 2NWNA 4CRFA 4MNWA 3M37A 3ENSB 1O2WA 3S7HB 3GY6A 1C5NH 1MKXK 1CA8B 1TNIA 2Q6DA 4J2YB 1ELDE 1FNIA 3MOCA 3W1EA 5HKKD 4B71A 3DT0H 1O3MA 4E7NA 1Y3XA 1LVBA 3ZZ5A 6LPRA 5A8ZA 1O2SA 1WQSA 1UTOA 3VG8A 1O3HA 1ZMLA 2ZU3A 1B0FA 1D3DB 5PTPA 3GS9A 3A87A 3KQDA 4A6LA 1S82A 1Y3VA 2KR7A 4Y71A 1KMHB 4YOIA 1CHGA 4O3UA 5FX6A 3RU4E 2VVVA 3D23A 2Y7XA 3GY3A 3N7DA 1P12E 1SOTA 3SV9A 1DDJA 3GY4A 2VIDA 1GL0E 4MPUA 1O5DH 5T3HA 1YM0A 1ELCA 4FU7A 2BY8X 1VITG 2L6OA 2EC9H 1P03A 3UOUA 1KIGH 4XE4A 1GBTA 1GI9B 3OEHD 2IJD1 3RXAA 2BXUH 1TFXA 1OX1A 2KM0A 3TK6A 3UWJH 1BRUP 3A88A 2J5UA 3PB1E 4RI0A 3PLBA 1JOUB 2QGRA 1QTFA 4WH8A 2QE7D 2ZPQA 1AFEH 1SGCA 3BG4B 3PLKA 3R0FA 2RFKC 2Z9IA 1F0UA 1PPFE 1SGPE 2GP9B 4KTUA 3U69H 2IPHA 2VIWA 3Q3XA 3VPKA 1NU9A 1O3NA 5EGMA 1EASA 3VGCB 2H6MA 2VIPA 2P59A 4YOJA 1MKXH 1DY9A 4UFDH 3M36A 2AGEX 4BNRA 1XM1A 1AQ7A 3BTFE 4ZXXH 3ESTA 4H6TA 1KXCA 1TRNA 3CP7A 4FUHA 1GDNA 5GXPA 2Q6FA 4YTAA 3AAUA 1TMBH 1TYNA 3ODDA 4GVUA 3RXEA 1NRRH 1YCPM 4XBBA 1UK3A 2PWXA 1OOKB 3W94A 3U8OH 4X1SU 1C4Y2 1HJAC 1CO7E 1TPPA 1YC0A 1BQYA 3A7WA 1JRTA 3LGIA 3LT3A 1TRYA 3DUXH 2QXGA 3B8JA 3T28A 3N99A 1G9IE 1KDQA 2ZF0H 2J92A 3SYJA 1O2OA 3SJKA 2FOMB 5JBBS 4B74A 2VWMA 4K8BA 3F9FA 1GCTC 3TJUA 1CGJE 3HKIB 1GI6A 2ZIQH 3SJ8A 1J17T 5HMAA 3UR9A 5FCRA 3KYFA 1TNKA 3D62A 4AN7A 3DSPA 3NRLA 1MU6B 1BHXB 3CENA 4IMZA 4RSPA 2M2AA 1P01A 5EQRA 1ZTLA 1DWEH 1Y8TA 3PV4A 5BRRE 2ZA5A 5I25A 5TCAA 4BAOB 2OCVB 1O39A 3HK6B 2FOHA 2CF8H 2CN0H 1YPMH 1F2SE 1NROH 3QUMP 1PQ8A 1ELTA 1T4VH 3PWCA 3P70B 4ZH8A 2C8ZB 2HNTC 4A5TS 3OY6U 3OTPA 3BTHE 3DFLA 2ZQ1A 1T31A 2WYGA 2TGPZ 4ISLA 2LP6A 2J9NA 2ZFPH 3A8CA 3RXBA 2W7SA 2FESH 3NZIA 1ELGA 3EDXB 1KXBA 4ZXYH 2PGQB 2ZWLH 5C1UA 5F03A 1V2PT 2ZFQH 4ABDA 5CDFE 1HAGE 4JZIA 1EAIA 2BD4A 4B75A 3C27B 1UVTH 4ABEA 1K0HA 1BMMH 1UJ1A 2WPMS 3AAVA 1AB9C 3LONA 1ANBA 2PP6A 1FI8A 5C20A 1ZTJA 4BXWA 1MABB 4X1QU 3UPEA 1Y5BT 4FVDA 1GWAA 4IMQA 4YXWD 1HJAB 2BLOA 7KMEH 1AN1E 1K1JA 2XCFA 3ZVGA 1TAWA 1MCVA 4TPIZ 2W6JD 2BZ6H 5FBEA 3BTGE 2KX4A 3PTNA 3UWIA 1BCUH 3W95A 4NIYA 2PUXB 2GCHF 1EPTA 1EJAA 3MU8A 5AVDA 3BTKE 4DT7B 1GCTB 4NWKA 1V2TT 5C67A 2HPPH 4AYYB 3OYPA 3DHKH 1MBMA 3A8DA 1ELFA 1LPGB 1XUGA 1O2ZA 2CHAC 1AI8H 2GCTC 2A4RA 1EUFA 1MQ6A 1EJNA 1UTQA 3RXGA 3ZVEA 1H9IE 4H6SB 3Q76A 1GPZA 2A1DB 1PJPA 2FZZA 1EZSC 5EPYA 4ZHMU 2ZGXH 4X8UH 1GJ7B 4JK6A 5EJLA 1KXFA 2A5AA 3CS7A 1TX6A 1GI5A 3MH6A 3SV7A 1DUAA 2BD9A 4NZQA 1YPGH 4Y0ZE 2I6QA 2Q6GA 3F6UH 5LPRA 4CBNA 1F0TA 3AVZA 3SJOA 1K1PA 3U8RH 5AFZH 2KFWA 2P3UB 1RGQA 2WPKS 1RTKA 3SU4A 1SSXA 1OWIA 2M5TA 2RDLA 2ZFTA 5E2OA 3V7TA 3FN8A 4K3JA 1O3OA 4VGCC 3KL6A 3DA9B 3QZQA 1TGNA 1ZGVA 2IPQX 1ZLRA 4X1NU 4FUDA 3UNSA 1T7CA 5DP3A 1AB9B 1BJUA 4AG1A 1Y3UA 4ABGA 1LPKB 4CRAA 1KTTB 1WCZA 3T26A 1QFKH 5BPEA 2BDBA 4MPVA 2ZTYA 4E05H 1D4PB 4WXVA 1HAVB 4YLUA 2O9QA 1QA0A 1GVKB 4OS1A 3MU0A 2EA3A 2W5EA 2PTCE 3NCLA 1A5IA 3MQKC 6GCHG 5DP4A 1A5GH 3MH4A 1GBBA 3DSGA 2QF4A 2Y82A 1SGFG 3K2UA 3SN8A 1A2CH 2H9EH 1W13U 4X1RU 1QL7A 3GDVA 1C4V2 2J98A 1MBQA 1D3QB 5E0GA 1PYTD 2CHAB 5EODA 1O2YA 2GCTB 1OS8A 2KZ4A 4WVPE 1FONA 1S83A 5CHBA 5IK2D 2QYIA 3N7EA 2PKAB 1HBTH 2K0QA 2WUBA 1DANH 1EAXA 1DLEA 2SGDE 2W6ID 1PYTC 1TGBA 1IQEA 2GDDA 1SHHB 4PROA 3V3MA 1M9UA 1O3GA 4ZHAA 3S69A 3KN2A 4OM9A 4AFUA 1LO6A 1K28D 2XBXA 2JH5D 1F0SA 1ANCA 1GBAA 1G37A 1GJBB 1BTWA 2HWLB 2YNBA 4YO9A 3ATMA 5DJ7A 1BTHH 4MQAA 1QA7A 5FAHA 1QY6A 3UQVA 3H7OA 2XOKD 2ZTZA 1W11U 1SC8U 4XSKU 1TX8A 2Y6TA 1QURH 4FUFA 4AOQA 1G2LA 4K8YA 2AH4X 4BAQB 1LPZB 1JMOH 2V7QD 4VGCB 1EAUA 4O97A 1XVOA 1O2NA 1TQ0B 4X2VA 1CHOF 1C9PA 4NA7A 1AWHB 3OX7U 3MNSA 4K1EA 1GJ6A 1FMGA 3KNXA 3RMNH 2B0FA 1TMUH 2A7HA 2BY7X 2B9LA 2HLCA 1UTKA 1BTUA 1VJ9U 4NZLA 3TITA 4CRBA 4NG9H 3T5FH 1FY5A 2NU0E 5GPIB 3LH1A 2WV5A 1K1OA 3IWMA 3LC3A 1PQAA 1SGDE 2TBSA 1EX3A 2BDCA 1QB1A 1UTLM 2ZGBH 1C2GA 1TA6A 1C1PA 5HIYA 3PROA 4I8HA 1WBGB 2G5NA 3G01A 1AZ8A 5IYTA 3F3BA 2QF5A 3QWCH 3Q77A 2R2WU 3P8FA 3RXOA 3ZZ8A 4I8LA 1C2EA 4CH8B 2WYJA 1MQ5A 2XRCA 1O37A 2QIQA 3S0NA 2BHGA 1V2QT 5C1XA 1ABJH 1D9IA 3RXKA 3M5NA 3MU5A 1TNLA 2ZU5A 5EPNA 5EU8A 1A0HB 2V3HH 1U6QA 2BD8A 1HYLA 1F92A 5EQQA 2W7UA 1QHRB 1HAVA 1Y3WA 2AMDA 2WZQA 4INKA 2GKVE 4RN6A 2IJOB 3JZ2B 4UFFH 1AGJA 4ISOA 3TGIE 1D6WA 1O36A 1QIXB 1UVUH 1TPOA 3AASA 2FS9A 3ZZ3A 2PGBB 2BVXH 3KQBA 5EW1H 3UNQA 3K9XB 1COWD 1YLNA 1HB0B 4AORA 3U98H 8KME2 2VVCA 3K6YA 4IS5A 5L6NH 4U32A 2FYRA 2J95A 4TY6A 2ZTXA 4F55A 2EY4C 3U8TH 4KTCA 3SI4H 4DY7B 4INHA 3VB6A 1LDTT 3PYHA 2FLRH 2CMYA 1QL8A 2PKAA 1GBDA 5JB8S 3SOSA 4K1TA 4AGKA 1J14A 2A4OA 1PQ5A 3FANA 4ZROA 3BTEE 1BZXE 2SFAA 3EE0B 3S9BA 4D7FA 5EIYA 1A3BH 1ETSH 1WV7H 4YT6H 2KCOA 4M7GA 5KGOA 2FIRH 1TE0A 1CA0C 4GCHF 3RXDA 1HAOH 1WQVH 4ASHA 3KHVA 2BVSH 2EEKA 1V2MT 2Y5HA 4A1XA 1GJDB 5KEDA 1O2UA 1SGFA 1SQOA
chains in the Genus database with same CATH topology
4K1SA 2AGIX 2FI3E 3TK5A 4JZ1A 4K2YA 1LTOA 3BF6H 4GSOA 5GJ4B 3ZVDA 1CBWC 2HPQH 1TGCA 2QF3A 1QGFA 2A31A 1GMCF 4KKDA 4FUGA 1FY8E 1OWKA 1SGIB 3GCTF 4I32A 4MVNA 2ZECA 1HIAB 1ZYOA 1RTFB 3MO3A 3QZRA 1EOJA 5A0AE 2NU2E 1SI5H 1KSNA 1AZZA 1SG8B 4JYTA 2G4TA 4ZKSU 4IGDA 5DP6A 1O30A 5FBIA 5L2ZH 3H7TA 4X6NA 3DD2H 2W26A 3LU9B 3MO6A 3ODFA 4XOJA 4X8TH 1MTUA 1GI4A 2VNTA 4MNYA 2ZCKP 1SGNE 1V6DA 3SZNA 4A92A 1TB6H 4Y76A 3HK3B 5EOKA 1C2JA 2K1QA 1DFPA 3RXHA 3F9GA 3LDXH 1T32A 3RC4A 4MDSA 1D6RA 4IC6A 1GHBG 1BDAA 1GMHG 2VJ1A 1V2ST 4NIXA 3M3VA 3LJOA 3M35A 2UWPA 2WPHS 3M61U 2FLBH 1IQHA 1J16A 2XBWA 4FUCA 1YPKH 4WJG2 5DP5A 5FX5A 3VB4A 1T8OA 4NGAH 3RXSA 1TOCB 3URDA 3A81A 2PLXA 1SGEE 1XUHA 1W10U 1IAUA 2BY9X 3STJA 1S6FA 4CRGA 2A32A 1O0DH 2A5KA 5A8XA 1EKBB 5DO4H 2F9NA 3FZDA 1GMDG 2G51A 4IW4E 2FOCA 3EGKH 4UONA 3C1KA 1EAWA 2XC5A 1CA0B 3GYMA 4A1VA 2C4FH 3E90B 3TNTA 4X2YA 3RC5A 1V3XA 1KY9A 2AYWA 1MZAA 1SMFE 2LPRA 4O03A 2QXIA 3MNXA 1AD8H 2ZP0H 1GMDF 1L4ZA 1EOLA 3LKWA 4AX9H 1IQLA 1CBWB 5EXMA 4Z0KA 3SU1A 5JYIA 1ZGIA 3F9EA 2W3KA 1Z1JA 1O2JA 4KGAA 1UO6A 2XBVA 2GMTC 4RKJB 2ZI2H 1B5GH 3EA9A 4INLA 5FXLA 1P10A 1O2LA 2PHBA 3ATWA 3RXQA 1MD8A 3ZZ6A 2XCNA 2ULLA 2NU4E 1UMAH 2F9UA 1C5QA 1HCGA 1OPHB 2FI4E 3MI4A 1OWDA 3MWIU 4I8JA 2G4UA 3MH5A 1VITF 3URCA 1THSH 5AFYH 1MTWA 3RXTA 1FY1A 2Z9LA 1BJVA 1TNHA 1G3BA 1FIZA 4WH6A 1NZQH 1YPJH 1MTNC 3M7UA 4O9VA 2AS9A 3NK8A 3UREA 1NRPH 4HFPB 3BTME 1S81A 1C2HA 1TNGA 2J34A 1S0RA 2B8OH 3BG8A 5H4IB 1QJ7B 4FUEA 1C5LH 1HIAA 1MAXA 2AERH 5CMXH 1HXEH 2ZDVH 1GI7B 3NWUA 3R3GB 2ILNA 3PMAB 1TNJA 1GI0A 2HVXA 4UFGH 4Y6DA 5E8EH 2AGGX 3F9HA 4JZDH 1BHXF 3D49H 3AW0A 5K0HA 3A8AA 5EXLA 3MTYA 2FOGA 1O2MA 1Z8JB 9LPRA 4K60A 2JKHA 9ESTA 3A7YA 2FWWA 1MZDA 1G36A 3KIDU 1HGTH 1VCQA 1AHTH 5TJXA 4DIHH 4R8TB 2ZHFH 2A7JA 4CRCA 2OD3B 4JCNA 1W12U 3RM2H 1HAIH 3SNEA 4FU9A 1C4U2 3FZZA 1ELEE 1QCPA 2GMTB 1L1NA 3I29A 4CREA 2TGDA 4D76A 2ZG0H 3T25A 1W8BH 2FI5E 3SI3H 1JIMA 3GCHC 1FAKH 1ZSJA 1LMWB 1Y59T 1BTXA 1SQAA 2V6NA 1SGYE 1J8AA 4IBLH 1PPZA 1OP2A 2F9VA 2XTTB 6CHAC 2WUCA 3GCOA 1OP8A 2XC4A 4HZHA 4XFQA 4ESTE 1HPGA 4D9QA 1XXFA 3ZVFA 3RXRA 1IQKA 5SGAE 3SJIA 1MTNB 2PTNA 2VU8E 1DVAH 4Q7XA 1BUIA 1HLTH 3HGNA 2C90B 1HAYB 1SGTA 1L4DA 2XC0A 1EB1H 2GTBA 5EQSA 2DE9A 1AMHA 1SOZA 1AU8A 1Z6EA 4HTCH 1VGCC 3PWBA 4SGBE 2FDAA 3UNRA 3RLWH 3UIRA 1GJ4H 1XUIA 3TLOA 1O2QA 3SU5A 2BY5X 1ACBE 1HRTH 2OP9A 4KP0A 2G5VA 1C5TA 2LNCA 2ZFRH 1TONA 2OC8A 3GDSA 1DXWA 1P2NA 3BSQA 3FVFB 2D26C 1C2IA 4ABFA 3SUEA 1N1LA 1UVPA 4WXIA 4NWLA 3MU4A 7GCHG 4UDWH 1ZPZA 4I8GA 4ABIA 4Z6AH 1JIRA 1F5LA 1NRQH 2BDGA 1V2LT 1KXAA 1ID5H 1V2OT 4UFEH 3U1JB 3ATIA 1T8NA 2PV9B 3PTBA 2PKSC 2SGEE 2HNTF 2ODYB 3TPIZ 4IN1A 3MFJA 1Z71A 4O3TA 1O2VA 2ANKH 3M5LA 3DFJA 4SGAE 5ABWA 1C5PA 7GCHF 3GOVB 1K21H 1G32B 1NESE 1O3EA 1W0YH 1TIOA 2R9PA 1ORFA 1UTNA 2BX4A 3GCHB 2THFB 4B73A 1UTJA 5A8YA 3HPTB 2WINI 1E37B 1BOQA 1MTSA 4Y79A 4NFFA 3AW1A 2GZ9A 4Y11E 1SBWA 1P3EA 4LK4A 1JWTA 6CHAB 2Z9KA 2UWOA 4NSVA 2PFEA 3EQ0H 2XBYA 3ZVCA 1P11E 4GHQA 3ZV8A 1A4WH 3M7TA 1PQ7A 4FVBA 2G00A 3SU0A 2ZQ2A 1O3LA 2ZHWH 2JETC 2FP7B 2ZFSA 2OBOA 2ZDNA 4DGJA 1DSUA 1A61H 3MMGA 4AZ2B 2Z6BD 1VGCB 5B6OA 1O38A 2GD4B 3EAJA 1HAPH 3OY5U 4XDEA 1H1BA 1C1NA 4YZUA 4NIWA 4NFEA 1F7ZA 2FMJA 1MAYA 1XX9A 2A2QH 2A4GA 2ALVA 2VGCC 4YESB 1DWBH 1WTGH 4DG4A 2O8LA 3OTJE 4J1YA 2ALPA 4MLFB 2XXLA 3P17H 4CRDA 3TJVA 1EP5A 3IG6B 1O3IA 2R0LA 4Q7ZA 3I78A 1C1WH 3TVJB 3UFAA 3BEIB 2BD2A 3QX5H 2TGAA 4JZEH 1K1MA 2BQ7B 1LVMA 4BXSA 1FY4A 1Z8IB 2ZDKA 3Q3KA 2ZU2A 1FXYA 4K5ZA 2PKSB 1P2KA 4E06H 4MNVA 3ZYEA 2ZDLA 3K65B 1OP0A 2Z7FE 3TNSA 1C2LA 3VB7A 1TQ7B 6GCHF 4Y7AA 1N8OC 1CGIE 1C2FA 5J4QA 2FYQA 1A7SA 2BYAX 5FHTA 2J2UA 1NN6A 2BMGB 1O32A 3MO9A 1SFQB 1FJSA 2XYAA 4Y10E 4DIIH 2QF0A 2A0QB 1LHDH 2B5TB 1AVWA 2ZPSA 5LPEA 3E16B 1W2KH 3T29A 5C1YA 4NCYA 3RU4T 5JDUB 5GWZA 1EB2A 1ZPBA 3A89A 3SV2H 3MHWU 1OWEA 3BTQE 3QTOH 5L2YH 2P94A 2FOEA 2Y5FA 3LIWA 1A46H 2ZNKH 1Z1IA 2AFQB 1AVGH 3P6ZB 3FP7E 3QGNB 2XNIA 3LGWA 1O3AA 3V0XA 4ABJA 3GY2A 2JETB 1C1TA 3SHAH 1GI8B 2ODPA 4TWYA 5GCHG 1YPHC 1EQ9A 1VJAU 3TJOA 3LGVA 1L1JA 2ANWA 1IQJA 4OS2A 2BVRH 2H2ZA 4GPGA 4YM9A 1TALA 1T8LA 1QJ6B 3ZVAA 1K22H 2WPIS 1O5EH 2VGCB 3GICB 3RXJA 3U1IB 5DK1A 1K1IA 1ZHPA 2O8UA 4UD9H 1TX7A 1HUTH 1UK4A 1P04A 2ODQA 3KQCA 1CGHA 3KEEA 1O2RA 5A0BA 5C5OA 1VZQH 2HOBA 2VB0A 1YYY1 3SUFA 3SUGA 2PSYA 1BTZA 6ESTA 1W7GH 2WV4A 1FPCH 1GBIA 1RTLA 1GVLA 3P8GA 5CHAC 3UTUH 4Q7YA 1SVPA 1S85A 1YGCH 3N7OA 1BBRK 1E38B 4WMDA 1AUTC 4D9RA 2J4IA 1N8OB 1ZMJA 1O33A 4HGCA 3L33A 1MCTA 2OC1A 3A7VA 2G81E 1T4UH 1QRWA 4X2XA 1C5VA 3BEUA 4JYVH 1GHAG 1NFXA 1O2XA 1GBMA 4BTTB 5DP8A 1C9TA 4HI3A 1YP9A 2NU3E 4X6MA 3WY8A 1LVOA 2R0KA 1P2QA 4GLYA 2YNAA 2J38A 2H5DA 1C1SA 2BLVA 5J4SA 1Z8GA 1NFYA 1XVMA 5C3NA 5C2ZA 3SGBE 1F0RA 1GBKA 1HV7A 1KYNA 1DM4B 3TH4H 1O3PB 4H4FA 1FAXA 3VB5A 1A3EH 1IQMA 4X1PU 3ZZBA 1P9SA 3ATLA 1NFWA 4FXGH 2UUYA 1FQ3A 2G8TA 1DWCH 1N6YA 4ZUHA 1C2MA 3MNBA 2VINA 1ELBA 1GDQA 2WPJS 5EW2H 1H8IH 4RKOB 1QJ1B 1SGQE 2FM2A 1C5SA 2WPLS 2YOLA 3I77A 1QRZA 1SL3A 1KLTA 3SORA 2ANYA 3PMJA 1Y5UT 2VWNA 1O3KA 2VWOA 1TPAE 1BRAA 1UCYK 3BEFB 4U30A 1BBRH 2ZKSA 1O3JA 2QXJA 1QR3E 4DW2U 5IDKA 3TJNA 3LGTA 4X6OA 2FX6A 2BLWA 1THRH 2RG3A 1Q31A 4X2WA 3MNCA 2JH6D 3BV9B 2Z9GA 1O31A 3QN7A 1VR1H 3ZZ4A 1RIWC 4D8NA 5CHAB 3ZV9A 1KLJH 2Y5GA 3ZVBA 1ZSKA 4D7GA 1BITA 4NA8A 1GVZA 1F5KU 1GL1A 1ZPCA 3GY7A 3ELAH 3M5MA 3HKJB 1ESTA 1AFQC 2ZHDA 5C5NA 4QT8C 1FLEE 3RXVA 4YLQH 1ZRBA 2V35A 4IN2A 2EI6A 5JBAS 1DPOA 2FTMA 1SHYA 1Z8RA 1TABE 3SBKA 4BAKB 4LZ1H 1GBJA 4TWWA 2OBQA 1S0QA 3A86A 2DE8A 3M3SA 2NU1E 2XWBI 4ZKNU 1DSTA 1O2GH 1QQ4A 1P57B 2AIPA 1P2MA 3B23B 1A5HA 1V2WT 2QA9E 1CT0E 1Z7KA 1O3BA 1GDUA 2Y7ZA 1IQNA 5A09A 4GAWA 3RMLH 1AE8H 1CSOE 2EI7A 2GV6A 5ETXA 3OU0A 1LKAA 1FUJA 2ZGJA 1OYTH 3E8LA 5AHGH 2VIVA 4YT7H 1BB0B 1DWDH 1OXGA 1IHSH 4Y8YA 1VCPA 1UCYH 2SGPE 2ZCHP 3UUZA 1KDQB 3P8OA 1AIXH 2BD3A 5HM2A 1O2TA 2CJIA 3LH3A 2ZGHA 1EPTC 3O8BA 1N6XA 3KQEA 2UUKB 2FOAA 2IOTA 1B0EA 4A7IB 1TBRH 2FXRA 1GHBF 1GMHF 1P09A 1SLWB 4I7YH 2QXHA 3TK9A 1P05A 3PM3A 2BXTH 1GHVH 2PW8H 4JZFH 4B2BA 1AKSB 2H5CA 3TGJE 1O5AB 2FOBA 1S84A 1ETRH 1GBFA 3SV6A 1GHXH 4B1TA 1IQGA 1O5FH 4DURA 3SV8A 4FU8A 4NIVA 2AMPA 1ZOMA 2BTCE 1SPJA 3SHCH 1CQQA 1RIWB 4OS7A 2A5IA 1TOMH 1P0SH 1UHBB 1HNEE 1YLCA 2SGFE 2IN2A 3LOXA 4Y8XA 1Y3YA 3SQHE 4UEHH 1IHTH 5F8ZA 3A7XA 1AFQB 3SGQE 2BDAA 3LGYA 1KLIH 3H5CB 1XKBC 2GDEH 4AFZA 1QBOA 3T2NA 3FP8E 3M7QA 1YF4A 4U01A 1PFXC 4Y7BA 1L0ZA 1PPBH 4AYVB 1C5UA 1K1NA 2OC0A 2BD5A 2O8TA 1UTPA 1C2DA 2F3CE 4OGXA 4AGJA 1C2KA 1V2UT 5LH8A 4NA9H 8LPRA 1EJMA 4I8KA 4FUIA 2VWLA 1NS3A 1HAXB 1LHCH 2SNWA 1TBQH 1QNJA 3GY8A 1DS2E 1ZJDA 1ZJKA 1X7AC 5HXFA 4ABAA 2F9OA 1ARCA 4U2WA 1K9OE 1ZHMA 1GI2A 2BDHA 8GCHG 2BQWB 1EPTB 1Q3XA 1GI3A 2G55A 2O8MA 1DY8A 1P8VC 3PMHB 3QLPH 3HATH 1P02A 2CV3A 3TU7H 4WF8A 5T6FA 1F5RA 1O3CA 1LHEH 4MTBA 1O5GH 1VITH 2JH0D 5T6GA 2A4QA 3SU3A 5AF9H 1LHFH 2OQ5A 8GCHF 1E36B 1OYQA 1H4WA 4ABBA 1BT7A 4IC5A 1RD3B 1FDPA 4F4OC 3UQOA 4X6PA 1J9CH 1YPLH 3ZZ9A 1DX5M 2BDYA 2QCYA 4BOHA 5ESBA 2PSXA 1KXDA 8ESTE 4WWYA 1FN6A 3VXEH 1O2PA 2SGAA 4MPWA 4BANB 2HRVA 1A0LA 1GJ9B 2GT7A 3RMMH 1MH0A 3BTWE 1YPHE 1CU1A 1ABIH 1ZRKA 2ESTE 3TGKE 2QC2A 2ZHEH 1GG6C 1TPSA 1ZZZA 3NKKA 1A1RA 5GIBA 2DUCA 2GT8A 1XMNB 1GBLA 1UVSH 4ISHH 2V3OH 4THNH 3A80A 4BTUB 3RM0H 1G3DA 5E2PA 3SNDA 2P16A 3PO1C 3RXLA 3CS0A 3F1SB 1AKSA 1C5WB 1A0JA 2TRMA 1YCPK 4Y8ZA 1PPGE 1OWHA 4AB8A 3A7TA 4CR9A 1HAHH 3RUOA 1ESAA 1SFIA 1SGRE 1C1UH 2ZDMA 1BBRE 3ZZDA 1P06A 2QN5T 1PPHE 4Q2KA 4I31A 1JXPA 3QK1A 2FODA 1UHBA 3T62A 3A84A 3EA7A 4DJZB 1BIOA 1TLDA 2ZZUH 1SLXB 3GY5A 1C5YB 2FS8A 3RXMA 1ZHRA 3SU6A 1Z6JH 2A2XH 4KELA 3UR6A 1VCWA 2R3YA 5HYOA 3NUMA 1IQFA 2BY6X 4ZKOU 3BTTE 5DP7A 2B7DH 2HALA 5I46H 1H8DH 2ZPRA 3RXIA 1FY3A 1RRKA 2ZGCA 2R3UA 1HXFH 2QV1A 3A85A 1XUJA 3V12A 1MD7A 1MMJN 1MKWK 1TA2A 2UWLA 1AE5A 3BIVH 1SR5C 2GCHG 3P92A 1WAYB 5EG4A 2STBE 1C1RA 1QL9A 1GJ5H 3SNBA 1L1GA 5F6MA 1SLVB 1O2HA 1XXDA