5E0JA

1.20 a resolution structure of norovirus 3cl protease in complex with a triazole-based macrocyclic (21-mer) inhibitor
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
174
structure length
174
Chain Sequence
HAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLTGANAKGMDLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protease/protease inhibitor
molecule keywords Norovirus 3C-like protease
publication title Structure-based design and synthesis of triazole-based macrocyclic inhibitors of norovirus protease: Structural, biochemical, spectroscopic, and antiviral studies.
pubmed doi rcsb
source organism Norwalk virus
total genus 36
structure length 174
sequence length 174
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5e0jA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5e0jA01
1BJVA 3A83A 1OWIA 2WPLS 4BXSA 3UQVA 5T3HA 3SGQE 1Q2WA 3UWJH 2ZU2A 1DY8A 4O97A 1X7AC 4I8GA 1BBRK 5FX5A 1T8MA 1P03A 2WYGA 4RKJB 5L2ZH 2H2ZA 2Z6BD 4X2YA 4KTSA 1QB1A 1AHTH 2ZFPH 1NFYA 4B1TA 3MYWA 4WVPE 2ZG0H 1NC6A 1ZJKA 5FAHA 3TITA 1Z1JA 1O35A 3BTDE 1UVUH 1GL1A 1YLDA 1WQSA 4VGCC 2VWOA 1BJUA 1O30A 4TWWA 4NA7A 2W26A 2ALPA 3KQEA 2QC2A 1AE5A 2AEIH 4ABDA 4WXVA 1DDJA 1ZMJA 5IYTA 2G55A 1FY3A 2A5AA 3VB3A 1PQ8A 2EA3A 4ZHAA 4CBNA 3T28A 3Q77A 5GXPA 5EOKA 3VB5A 1EAUA 2PLXA 4GSOA 1V2WT 1D4PB 3TVJB 5C5OA 1QL7A 1GDNA 2Y7XA 4YLUA 1QFKH 3ZZ9A 3PMJA 1MU6B 1DICA 4IC6A 2A45B 3EGKH 1EJMA 1YPJH 1HIAA 2RDLA 3W94A 1NRSH 1ARCA 4KP0A 2HGTH 4BAOB 4DIHH 1QL9A 6CHAC 3BN9A 3SU1A 1HFDA 1Y3VA 1GHBG 1RRKA 1GJAB 3A7ZA 2FWWA 5I46H 4CREA 3RDZA 1O2MA 1A61H 1QJ6B 4DW2U 3OSYA 1V2VT 2GD4B 4WH6A 1T8OA 5DP3A 1P2IA 1ESTA 4Y8XA 4IN2A 2AIPA 3O8DA 3H5CB 4K8BA 2A7CA 3BG4B 4K5ZA 4ZKNU 2TGTA 1MTWA 5HMAA 1EPTA 1O2LA 2Q6FA 3E16B 2PSXA 4Q2KA 4A6LA 1A0HB 2FOGA 3IWMA 2BLQA 1NRPH 7ESTE 1QHRB 4X6PA 1DT2A 4MNWA 1E34B 1TGTA 1AD8H 1O3HA 3LDXH 1CQQA 1FY1A 1GI0A 5F8ZA 1DSTA 4X2WA 3ZVEA 5TJXA 2SNWA 1QCPA 2F9OA 1Z7KA 2VH0A 3P92A 1SPJA 2P8OC 3VB4A 1O3OA 2ZFTA 2BY6X 4THNH 2C90B 3SUEA 2FZZA 5A09A 2B8OH 1EJAA 4MDSA 1SOZA 2QXIA 5EU8A 4UONA 3MNSA 1THPB 1DS2E 3LH1A 1DITH 4DURA 1ANCA 3SJIA 4JZEH 4Y10E 1C1OA 2YNAA 2BHGA 1ZMLA 1BTYA 5L30H 1GI1A 4NWLA 4AG1A 9ESTA 1V2JT 4XDEA 1O39A 1T4VH 1NU9A 2FOEA 5FPYA 2PKAB 1LVYA 2XRCA 1KXAA 1ZTKA 3MNBA 1W13U 1VITH 5AF9H 1DPOA 3FP7E 1AWHB 2PGQB 4DGJA 1A4WH 1MBMA 1L1NA 4YOIA 2AERH 3GY7A 1GJBB 3ZVDA 2O8TA 1H1BA 4K60A 1ZGIA 3RMOH 1NU7B 2PSYA 4BOHA 2VINA 1C1QA 1A0LA 2TGDA 2Y81A 3RXBA 4YT6H 4CRCA 3RXSA 1KIGH 3T5FH 1CGIE 1IHSH 4AFUA 3H7TA 1FY5A 1HBTH 3VGCB 3TU7H 3RXOA 1ZGVA 1YPHE 1GVLA 1W2KH 3TJVA 1LVOA 2BLVA 3TLOA 5DK1A 3C1KA 1ELAA 4CRFA 3PV4A 2O8LA 2BD2A 1GMDG 1TA2A 1EZSC 4MNXA 1IHTH 1AVXA 1TQ0B 1DANH 1DX5M 4NFFA 2BVSH 3GY8A 5C3NA 2BD3A 1DVAH 4OGXA 1EZQA 4CRGA 3A81A 2QA9E 1HAYB 4O9VA 3UQOA 3V7TA 3KIDU 3UNQA 1B0EA 5K0HA 2ZQ1A 4YOJA 1D6WA 4MG3A 4XOJA 2HRVA 5E2PA 4UDWH 1Z8IB 3ZZ8A 4LXBH 6GCHF 1UTKA 3TH2H 4Y0ZE 3GDUA 3SUGA 4X1RU 3ZZ5A 4I8JA 4NSYA 4U2WA 4YOGA 2HNTC 1C5MD 1AZ8A 2FOHA 4X2VA 1AKSA 1L1GA 1PPZA 1SGNE 2QV1A 2ZI2H 1C5SA 2XTTB 2ZTZA 4Y79A 2STAE 1MKXH 2KAIB 3BTME 3TK9A 1D3PB 1DXPA 3ATMA 4B2BA 2D1JA 2BDAA 1HNEE 1QJ7B 1W0ZU 1GJCB 1W0YH 3LOXA 1EJNA 1XUHA 1MZAA 3UUZA 4FUBA 2B9LA 2V3HH 1KSNA 3QTOH 1GBKA 5GPIB 2XNIA 3PM3A 3A7TA 1FIWA 1P2MA 2OQUA 4X1QU 1ZPZA 3VPKA 1W11U 3EYDA 1RTLA 2W7UA 1GI7B 4IMZA 5C1YA 4K1SA 1EOLA 3VEQB 2WPJS 1BBRH 1S0QA 2XC4A 1GVZA 1QBNA 4MPUA 5JYIA 3MU4A 1TPOA 4YM9A 5FCRA 1BOQA 1GBFA 1NM6A 1WQVH 1LQEA 4JZFH 3S9AA 1C1PA 1RFNA 1TABE 3LKWA 1C2DA 4ZHLU 5DGJA 1VCQA 1D3TB 3M7QA 3RP2A 8GCHF 3RXHA 4I32A 2FP7B 1AUJA 2W3KA 3K2UA 3PMBB 4A7IB 5E8EH 1TNJA 1O3MA 2W3IA 1UTJA 5JBTA 1L0ZA 1QQUA 1SLVB 1ZR0A 2PV9B 1C9TA 4X8VH 4GVUA 2A5IA 1C2IA 4X1PU 1PPFE 3SNCA 1EAWA 4Z6AH 2P59A 1TONA 1WYKA 2GZ8A 3MU8A 1KYNA 4MPXA 4FUHA 3UR9A 2M5TA 2GTBA 1JMOH 1FJSA 1GJDB 2ZPSA 1GHAG 4NIXA 4ABBA 1LHFH 5DJ7A 1KXCA 1HAPH 4K2YA 1CT2E 2ZGXH 4Q80A 1GHXH 1F92A 1MD7A 3ZVFA 1HJ9A 4U32A 1BTUA 1MTNB 4ABAA 1O2RA 1BT7A 3ZVGA 3P17H 1N6YA 1IQGA 1GBIA 3RU4D 1PQ7A 4O03A 4XFQA 4GUXA 3LU9B 3A86A 2CN0H 4K69A 2I6SA 1O3DA 1ELBA 4JMYA 1WTHD 3A87A 4LZ1H 1CE5A 1G30B 2FODA 4YESB 5F8TA 4MPVA 3GCTG 2ZFSA 2FOFA 4B2CA 1ZHRA 3MWIU 1G3EA 2NU1E 3SQEE 1JOUB 1QURH 2OUAA 2ZTYA 1TMBH 1FZZA 1UTOA 2EC9H 1FY4A 2V35A 5DO4H 2FX6A 3ZZ3A 3FZZA 4U01A 1SSXA 2FEQH 4RKOB 2BQ7B 1EKBB 2FLRH 1GBCA 3SJOA 3RU4E 1BDAA 4Y7BA 3P8GA 1AB9C 1G9IE 1UTNA 3R0FA 4HGCA 5A8YA 1A2CH 2SGAA 4ZMAH 3TK6A 2FTLE 5E0JA 1W7GH 4A1VA 1FN8A 2XYAA 1WBGB 1UVOA 1UCYK 4NG9H 3MH7A 3A7VA 1TOCB 1O2JA 3HKIB 3TJNA 1LKAA 5E0GA 1N8OC 1C2EA 1MH0A 4ABIA 3ZZAA 5JBAS 4CBOA 2A4RA 1AWFH 1GJ9B 1T4UH 4MNVA 2FXRA 2ASUB 4XBBA 5T6FA 1D3QB 1TBQH 2C8WB 2ZU5A 4NGAH 4ABHA 2ZO3H 2UUKB 5A8XA 1NS3A 1OWKA 5DP6A 2VVVA 1RS0A 2ESTE 2BMGB 1BUIA 1GI6A 1W12U 1VR1H 3PLBA 1O3AA 4YT7H 1SGQE 1FIZA 2VIVA 3SHAH 1HRTH 1C5VA 1KDQA 1ANEA 1AUTC 1A5GH 3AASA 3LC5A 3MO3A 1OWHA 1PPCE 1HDTH 2WPKS 1CO7E 5LH8A 1SG8B 2OBOA 4INKA 1ETTH 1HJAB 3PMAB 1W14U 1P01A 1MBQA 1VJ9U 3MOCA 4E05H 3A88A 4JZ1A 3TPIZ 2Y5FA 1OPHB 3SNAA 1EP6A 1GHBF 1NZQH 3PMHB 1IQFA 1GBLA 2GT8A 1O2XA 4FUGA 2O8UA 1GDUA 2VB0A 2A7JA 1YBWA 2BZAA 1O3PB 2J95A 1MZDA 1QRXA 5T6DA 1HAGE 1S85A 1D9IA 4NZLA 2ZHQH 1GBMA 2GDEH 4PROA 3UOUA 2WPIS 1XXDA 3MU1A 1YCPH 4MTBA 2TPIZ 2G51A 2ALVA 1GI3A 3ODDA 5EG4A 1AN1E 2EI6A 3UR6A 4ESTE 1K22H 1ZOMA 3W95A 3A8BA 3SUDA 4BTTB 1GBEA 3ZZ7A 4J1YA 3NUMA 4ABEA 4VGCB 3ESTA 1OX1A 1J16A 1K9OE 2P16A 2VJ1A 3GCNA 1FXYA 2F3CE 1C4Y2 1OS8A 4ZXYH 5JB8S 1O5GH 2OLGA 3SI4H 3B8JA 1TIOA 1GVKB 2Y7ZA 3RXVA 1LVMA 2XC0A 1MTVA 3AAUA 5LPRA 2BDYA 3QZQA 3KQDA 1GI9B 1EATA 3L33A 4JYTA 4AFQA 2UUJB 2HALA 1MCTA 1B7XB 3RXKA 4UFFH 3A8DA 3SJ8A 3T29A 1LDTT 1IQNA 4WMEA 1C5UA 3ZZ4A 4ZKSU 1TGBA 4GAWA 1NRQH 3FVFB 3RC6A 3E6PH 2QGRA 2O8WA 1GI2A 1QGFA 2VIWA 4Y8YA 4GLYA 5GCHG 4B71A 1NRNH 2QY0B 1O0DH 4TPYA 3VB6A 4BAQB 2G4UA 1AMHA 2BLOA 2J38A 1S82A 4IBLH 1O3LA 1CT0E 1SC8U 3LIWA 1LVBA 2B0FA 3MNCA 1BBRE 3SHCH 5A0CA 1RTFB 2IJOB 5JDUB 3L3TA 3M7TA 1BMMH 3LGYA 2ANWA 1W7XH 1P3CA 4FU7A 1ZPCA 4BXWA 4GHTA 1YYY1 1GMDF 1RJXB 1ARBA 4FUFA 1O5EH 2PW8H 1SGIB 3STIA 2P8OB 3S7HB 3RC5A 1BMNH 1ZPBA 3SJKA 1MTUA 1GG6C 3V13A 2RG3A 1ZZZA 5C1XA 2BD9A 3U69H 5C2ZA 3RM0H 1PYTC 3EDXB 1DOJA 3RXEA 1LPZB 2WUBA 4D9QA 1SGYE 5L2YH 4Z0KA 3CP7A 1C2GA 7LPRA 3RLYH 2VGCC 2OC1A 3GICB 4IGDA 2ANKH 2IOTA 1Y5AT 1QBOA 1K28D 5EODA 3O8BA 1OXGA 2G00A 1BTWA 1L2EA 2JH5D 2O8MA 1TA6A 2AYWA 5DKMA 1DFPA 2BVRH 4AZ2B 1Z8RA 1QIXB 1H9LB 1YLCA 1C5LH 1EB2A 3UNRA 3LGVA 1HUTH 5EQQA 1AGJA 4ZROA 4F49A 1A5HA 1GBHA 1UCYH 3LH3A 3SN8A 5ESTE 4YTAA 1HIAB 2A0QB 1M9UA 1PPBH 4E7RG 2R0KA 3RMLH 4AB8A 3RXDA 3TGIE 1TNGA 3SI3H 1THSH 3RM2H 3H7OA 1IAUA 4JCNA 1FI8A 1O36A 5AFZH 4AG2A 3GDVA 3F6UH 1O34A 2Y80A 2TRMA 3SZNA 1J8AA 3BIUH 1T7CA 3AAVA 1MU8B 1UHBA 1SGEE 2Z3CA 3BIVH 2JH6D 4M7GA 1LPGB 1KXDA 2BQWB 1ABJH 2ZHWH 1SGDE 1K1MA 2BDHA 4Y8ZA 1LHCH 3EA8A 4JZIA 4WJG2 4AGKA 1GGDB 1CA0B 1JWTA 3CS0A 2QCYA 2BY5X 2NU3E 2XBVA 3RXPA 4OS4A 2GKVE 2PKAA 5PTPA 2ZIQH 4ZUHA 4ZKOU 5B6OA 1QRWA 1TNLA 3M3TA 1P10A 2ZU1A 4X8TH 3NPSA 1P9UA 1NESE 1IQLA 2CJIA 1EP5A 2XCNA 5FXLA 1GHAF 2PUXB 1C2FA 5EQSA 3LJOA 1O2ZA 4FUCA 4KTCA 1ID5H 4FUJA 1GHZA 3PTBA 1MQ5A 1SL3A 1FQ3A 1E0FD 4BTIB 3PWCA 1W8BH 4H42U 4X6OA 1OYTH 1FDPA 5FCKA 1TNIA 2FI4E 3UREA 1SLWB 1C2HA 4AGJA 1F0SA 4I8HA 3K6ZA 1ELEE 1QL8A 2A1DB 3BTGE 1AZZA 1ELTA 1Z6EA 3T2NA 2QYIA 6LPRA 2G5NA 2J34A 1V6DA 4AYYB 3GCTF 1BA8B 1NFUA 2O9QA 1PQAA 3FP6E 2ZZUH 4MVNA 1TPAE 2ZDNA 3CENA 4E7NA 1O32A 3UPEA 2AIQA 4Y6DA 2F9PA 4LZ4B 3BTFE 1XUGA 3LONA 3ZZDA 1OP2A 2P95A 1EPTC 1EASA 4E06H 3TGKE 4SGAE 5C5NA 1GGDC 1CA0C 1HV7A 2R2MB 2QXHA 1SGFA 2HNTF 5CE1A 3F9GA 1O2YA 3Q76A 1P05A 2ZPRA 1E35B 1GMHG 2OD3B 2ZA5A 1GMCG 1QBVH 3UNSA 2TGAA 3PO1B 1VCPA 1ACBE 1C2MA 4INHA 5BPEA 2BVXH 1P8VC 5EGMA 3P95A 2NWNA 1GCDA 2AGGX 1O2PA 3GDSA 2OP9A 3NZIA 2ZFQH 2OINA 2KAIA 4TWYA 1XVOA 4NIVA 1P02A 5HYOA 1C1VH 1U6QA 2GCHG 5EPNA 2ZWLH 1C5QA 3QGNB 2C3SA 2C8XB 2ZCKP 2C93B 2FO9A 3UIRA 1B5GH 1O3KA 1TAWA 3GYMA 4HI3A 1TBZH 2XWBI 1SVPA 1UTMA 5EXLA 1LHDH 2H5CA 1ZRKA 3A8CA 3PYHA 1XMNB 2PTCE 3U1IB 1TRMA 4MQAA 2G8TA 2VIPA 1JIRA 1DLEA 1ANBA 1P2OA 3B9FH 3HK6B 1K2I1 1YCPM 1K1PA 2VWMA 2RCEA 4A92A 3LGWA 1FV9A 1C1NA 1F2SE 1C1WH 1V2NT 2ZGHA 5DPAA 1HPGA 1CHOG 2ZF0H 2BZ6H 1ESBA 3O8RA 1F0TA 2G52A 1YF4A 3SOSA 1CVWH 1DUAA 1HB0B 2SGQE 2PKSC 1LPKB 3E0NB 4K8YA 3M3SA 1HAHH 1KTSB 4XBDA 3DHKH 1GPZA 1EXFA 1ZTLA 3KL6A 2G4TA 5HM2A 3IITA 4AYVB 3EA9A 1ANDA 4KKDA 3RXMA 1DUEA 1UTPA 4XE4A 1AB9B 2BLWA 5LPEA 3SV7A 1HLTH 1NO9H 1GBBA 1HJ8A 1RD3B 3PO1C 5EW1H 4D7FA 2C8ZB 3SV6A 1ETSH 1UTQA 1IOEA 3MO9A 4Q7ZA 1PQ5A 3UOPA 5F6MA 1W3CA 1G32B 3D23A 1F0UA 1N8OB 2W5EA 4XBCA 2R3YA 2F9BH 1C5RA 1KLJH 2H9EH 3ENSB 4ISOA 1KXEA 1TALA 2WV4A 3LT3A 4O3UA 4UD9H 3RMMH 4H6SB 2I6QA 1FN6A 4TY6A 3M5LA 4OS5A 3SU4A 1C4V2 2VWLA 3LGTA 1NN6A 4MLFB 4DCDA 3ZV9A 1N6XA 1K1JA 1GWAA 2XXLA 1SBWA 1C5OH 3P8FA 1GJ5H 2R2WU 2ZKSA 1VZQH 1LMWB 4CHAC 4DVAU 3OTJE 1A0JA 3FZDA 2JH0D 3PWBA 2NU2E 2ODYB 3GY2A 1IQJA 1C5YB 2FOCA 2AFQB 2HPQH 5JPMH 2A4QA 1O2SA 2SFAA 1UTLM 2ILNA 1O5BB 4AORA 2XBYA 1W10U 2FIRH 3V12A 3MMGA 2CHAC 1O2KA 5ETXA 5HXFA 2FOAA 2PUQH 1Y3XA 3RXQA 3SNEA 1TX6A 3QZRA 1PPGE 3FFGA 4I8KA 1VJAU 3NKKA 5BRRE 3U8TH 4HTCH 2JKHA 5EW2H 1O5AB 4OS2A 1C5WB 1G36A 3LGUA 1SI5H 3BTKE 1S83A 4D8NA 3AW1A 3M3VA 4Y0YE 1TOMH 3MHWU 3M5MA 4FU8A 4IN1A 2OQ5A 2H6MA 4UE7H 2EI7A 2HOBA 2OC8A 2ZHEH 2OC0A 5FHTA 4UFDH 2FESH 3N7OA 1JIMA 2Z3EA 2HLCA 4A1XA 1KXFA 1UCYE 4WY3A 4DG4A 1VITG 1TX8A 5EXNA 1QA0A 1JRSA 2Y6TA 1IQKA 5GCHF 2DE9A 4ABGA 5EQRA 1O2VA 2P3UB 1JXPA 1BTXA 3VXEH 3ZVBA 2ZDVH 3E8LA 3BG8A 1ZJDA 1TE0A 1F5KU 2LPRA 3M61U 2ANYA 5AHGH 4K3JA 1YPKH 4KGAA 1YM0A 2ZDLA 3ZYDA 2H1UA 1MAYA 5AVDA 3EQ0H 1AVGH 1L4DA 1A3EH 1C2JA 1WV7H 1P0SH 1NRRH 2B7DH 4RN6A 5CHAC 1O2HA 3KCGH 5DP9A 1SQTA 2FOBA 1C1MA 4NA9H 1XXFA 4K1EA 2TBSA 1TYNA 2P93A 2GMTC 2UWPA 4Q7YA 3BEFB 1BHXF 2Y82A 1XUFA 2IN2A 2WPMS 1G37A 3SU2A 2FYRA 4OS6A 2BD7A 3QUMP 1T8LA 2ZEBA 1TB6H 1IQMA 2BDCA 2GCTC 2XC5A 1UK2A 4SGBE 2OTVA 2PGBB 1SGFG 1SHHB 1OSSA 1DY9A 1DWCH 2STBE 4LK4A 1EUFA 1KDQB 3NCLA 2D8WA 1ELGA 1NFWA 1THRH 1Z8GA 1P57B 2VIDA 3SORA 1WU1A 2VNTA 5DP7A 5GWZA 1GJ6A 4HFPB 2R9PA 2WUCA 1UK3A 1ZRBA 2QF0A 1TPPA 2SGFE 1SQOA 3GY3A 1PPEE 3GYLB 1AO5A 1SGCA 4NIWA 4X6NA 1QQ4A 2GV6A 4H4FA 2ZGBH 3KNXA 1QNJA 4IW4E 2HVXA 5JB9S 1MTSA 1SQAA 4Y7AA 4X8UH 4B74A 3SJ9A 1WSSH 1V2TT 4I8LA 1Y5BT 1G3DA 1O3NA 1LTOA 1WAYB 1XKBC 3SGBE 5JBCS 2Y5GA 1BRAA 2BD8A 4NWKA 1EX3A 4IS5A 1AE8H 2NU0E 5DP8A 3R3GB 5SGAE 1QRZA 1CSOE 7GCHG 1OP8A 5K7RA 1BRCE 3M35A 1LKBA 3GISB 1T8NA 2BYAX 1MAXA 1IQIA 3TH3H 3S0NA 1GG6B 2BOKA 3SU0A 2FS8A 3LGIA 3OYPA 1C5NH 2AH4X 2WINI 3M37A 2A5KA 1HAVB 1PFXC 2P3FH 3KF2A 1EAIA 4QT8C 2P3TB 1HCGA 2GDDA 1Y3WA 3ATWA 2OC7A 1EZXC 1TQ7B 4Q7XA 4X1NU 1HXFH 1QJ1B 1S6FA 1Y5UT 3MH6A 1ELFA 5DP5A 1XVMA 2Z9IA 1MCVA 2H5DA 1C2LA 2VGCB 1S84A 3PLKA 5DP4A 1TNHA 4R8TB 1YPHC 2HPPH 3D65E 1FAKH 2XBWA 2AGEX 1MKWK 2H9HA 4BAMB 2UUYA 4FUDA 2Z7FE 1C5ZB 5E2OA 4D9RA 1OWEA 5EPYA 1JRTA 3VFEA 5J4QA 1S0RA 1Q3XA 1WCZA 2XCFA 3QGJA 2BD5A 3BV9B 3NWUA 1FMGA 2CXVA 5GIBA 3AVZA 2CF9H 3V3MA 3Q3YA 2QIQA 1C1RA 2PTNA 5FBIA 3TJOA 3C27B 4R0IA 1TMTH 1UK4A 2Q6GA 4CRDA 1RIWC 2A2QH 2A2XH 1QB9A 4A5TS 3QK1A 1SLXB 3Q00A 4NCYA 1AQ7A 4ABFA 2V3OH 3RXUA 2BDGA 1D6RA 4INLA 3MFJA 4I33A 3SW2B 3FP8E 2LNCA 5TCAA 3BEIB 4UEHH 5I25A 3I77A 1ZYOA 1JBUH 3T62A 1QR3E 1GJ7B 1S6HA 1FPHH 1G3CA 1SLUB 2GZ7A 3TNSA 3EAJA 5FPTA 2JETC 1NPMA 4TPIZ 3ZZCA 3KQBA 1DWBH 2ZGJA 4FUEA 2F9NA 3GY4A 3HGPA 7KMEH 2AS9A 3MU0A 4CRBA 2UWOA 2Z9LA 1GMHF 1F5RA 1GBDA 1TX7A 1GMCF 4J2YB 4CR9A 3TH4H 1Z6JH 3SNDA 1HAOH 4F4OC 3MO6A 3MH4A 1IQHA 2B5TB 3KQCA 3URDA 1XUKA 2G81E 2OXSA 1OYQA 3VB7A 2VWNA 3GOVB 5G4BA 1VGCC 3QO6A 1INCA 4IMQA 5DG6A 2GCHF 1DLKB 1P3EA 1GHVH 1SHYA 2PWXA 3DFLA 2PR3A 1AFQC 2THFB 3RUOA 1V2MT 1V2KT 1EZUC 1KLTA 1YGCH 2ZHDA 2Q6DA 1VCWA 1BB0B 3E0PB 3S9BA 2QAAA 1GL0E 2BQ6B 1PJPA 1Z1IA 1E37B 4XSKU 2BM2A 2WPHS 3SU5A 1IQEA 4WMFA 1V2UT 1BCUH 4JZDH 2GVFA 1P06A 4X1SU 1C1SA 4X8SH 5LGOA 1GBJA 3BEUA 1ORFA 3LPRA 3QX5H 2ZC9H 4WF8A 3A7XA 1CHOF 1H9IE 5T6GA 4YZUA 1FAXA 3KHVA 2H9TH 2ODQA 4DJZB 5FBEA 2CV3A 2VIOA 1ZSJA 2ZNKH 4B75A 1EPTB 3PLPA 3D49H 4AFSA 1Y59T 4X2XA 1LHEH 2FMJA 3IG6B 2SGEE 5AFYH 5F03A 3TK5A 4I7YH 3KEEA 4NA8A 4BTUB 3E3TA 1GHYH 1WOFA 2ZCLP 1Z71A 2GZ9A 4ABJA 3A82A 3DUXH 1LHGH 4TYDA 3F9FA 8KME2 2ULLA 2ZECA 4WMDA 1ELVA 1K1IA 1SGTA 1UHBB 3RXRA 3SU6A 3NK8A 1AVWA 4DOQA 4O3TA 1TBRH 1DXWA 3Q3XA 3MNXA 1FY8E 1EAXA 3TNTA 4GCHG 1T32A 1CGHA 3F9EA 2ODPA 3RXTA 3A84A 2HWLB 3HK3B 1G3BA 3ZYEA 3ZV8A 1UJ1A 1TNKA 1YPEH 5JBBS 2A4OA 3SU3A 1D3DB 3DA9B 1O2NA 3MI4A 2BDBA 1KY9A 1J15A 1J17T 2ZDAH 1TGSZ 3ZZBA 1O37A 2Z9GA 1ZHPA 3OX7U 3P8NA 1F7ZA 3BG4C 1GJ8B 1ELDE 2Z9KA 4YLQH 2EI8A 5FX6A 1L4ZA 3BTWE 3U1JB 1OOKB 1S81A 1O5FH 2IPHA 2D2DA 4FUIA 1BQYA 2BB4A 3QN7A 4AOQA 1E36B 4D76A 2FM2A 2Z9JA 1O2WA 2PKSB 3ODFA 1B0FA 1GI5A 4JK6A 1C9PA 8LPRA 3ZVAA 1WTGH 4LOYH 3ATLA 1C1TA 3KGPA 1A46H 1ABIH 2FTMA 5J4SA 3MU5A 2ZQ2A 3RXIA 1Q31A 1A5IA 2BY8X 1NROH 4BNRA 4ZKRU 1GBTA 4ZHMU 1P11E 2J92A 4WXIA 2CMYA 4Y76A 1PYTD 2ZDKA 2ZDMA 3D62A 1O2OA 2D26C 3QWCH 3URCA 6ESTA 1BRUP 1ZTJA 5EXMA 1YPLH 2ZU4A 1O5DH 3SGAE 1SB1H 1VITF 2P94A 4U30A 4BANB 3A8AA 2Q1JA 3KN2A 4FU9A 2CF8H 5HGGA 4DY7B 2DUCA 5H4IB 1BTHH 2GGVB 4MPWA 1TRNA 1YCPK 3RXJA 4FVDA 1V2ST 1SR5C 1AY6H 1MKWH 4D7GA 3S9CA 1SGPE 2Z3DA 3UWIA 1CA8B 1BTPA 1TGCA 1UVSH 2DE8A 3ATKA 3A85A 3OU0A 1FONA 2F83A 3I29A 3HATH 3T25A 2ZTXA 2CGAA 1ZMNA 1Y3UA 4CHAB 1O2IA 2SNVA 4KTUA 4FXGH 1H8IH 1AKSB 1NY22 1DSUA 2A32A 5FPSA 2QF3A 1K21H 3U9AH 1KLIH 5F8XA 3RXFA 2AGIX 3BF6H 2BOHB 3GY5A 5CMXH 5GJ4B 1PPHE 3DT0H 3VXFH 1GCTB 2GV7A 3VGCC 4B76A 1K1OA 2XBXA 1K1NA 1LO6A 2FI5E 2Z94A 1MQ6A 3P6ZB 3UY9A 1C2KA 2A7HA 2CHAB 1C5XB 1O2TA 2R0LA 1EOJA 1DM4B 3BTHE 3HKJB 3MH5A 1H9HE 4AFZA 1HAXB 1F0RA 3BTEE 2F91A 2VH6A 1SGRE 2FS9A 1LQDB 4IC5A 1DWDH 1O2GH 2XWAA 1OWDA 3O8CA 1HGTH 1O3BA 2WYJA 2ZCHP 4KELA 4K1TA 3SO3A 1NT1A 1O38A 1YPMH 4RSPA 5TCCA 3ELAH 2BY9X 2GT7A 3A89A 1ZSLA 2AMDA 3K6YA 2FI3E 3P8OA 2UWLA 1SOTA 3S7KB 3E90B 3SQHE 4GHQA 2F9VA 1QTFA 4CH8B 3QLPH 2A31A 3GCHB 1BTZA 4OGYA 1P2KA 1GI4A 2OBQA 3EA7A 3WY8A 1QY6A 3LJJA 3ZVCA 3A7YA 3E91A 1TRYA 1KXBA 2V0BA 3FAOA 3OY6U 4ASHA 1SMFE 1Z8JB 1RXPA 4OS1A 1CGJE 1V2PT 1O3GA 2SGDE 4GPGA 3U8OH 1BMAA 1YP9A 1RGQA 2GX4A 1AIXH 1CT4E 3SV8A 3F1SB 4X6MA 7GCHF 1ELCA 1RTKA 1K1LA 2ZU3A 3A7WA 3RMNH 5IDKA 1BITA 1FLEE 1P12E 5CHAB 4Y71A 1GCTC 4UFGH 2G5VA 3RXCA 1G2MA 4JYUH 3ZZ6A 2VIQA 1V2LT 3A80A 2Y5HA 1DE7H 4ZH8A 3SBKA 2FPZA 3T27A 1C1UH 2BTCE 2GMTB 3TJUA 3F9HA 1TFXA 1YPGH 3OY5U 1FPCH 4ISLA 4ZXXH 1S5SA 1NTPA 1P2JA 2PFEA 1HXEH 1OKXA 1XUJA 2GCTB 4HZHA 1P09A 3SUFA 1TWXB 3B23B 3U98H 2J94A 1LCYA 1P2NA 3Q3KA 3TIUA 1BZXE 2BD4A 4CR5A 3L6PA 2OCVB 1XKAC 1EB1H 1BHXB 3M7UA 5LPFA 2QXJA 4NIYA 3K65B 2BXUH 1P9SA 1EQ9A 3GCHC 3HGNA 4OS7A 1MMJN 1TPSA 2RA3A 1C4U2 3UFAA 3F68H 6GCHG 4Y11E 3V0XA 1O2QA 1C5TA 4MNYA 2ZFRH 3K9XB 1BIOA 1L1JA 3TGJE 1TLDA 1FUJA 2BX4A 4AB9A 3LC3A 1H8DH 3SV9A 3M5NA 5A8ZA 1T31A 3RXAA 1QB6A 3PTNA 2BX3A 3BTQE 2VVCA 3ITIA 3S69A 1BMLA 2J9NA 3RXLA 3EE0B 1HYLA 2QXGA 4UFEH 1ZHMA 1MTNC 3AW0A 3NXPA 1E38B 1CBWB 2K1QA 1DWEH 2J2UA 1XX9A 1YKTA 5HM9A 1CHGA 2ANMH 4ISIH 2TIOA 4H6TA 2ZPQA 4JYVH 4YO9A 2A4GA 2FX4A 1O3EA 3FANA 3I78A 2RA0A 3RU4T 8ESTE 1UO6A 3RXGA 2HNTE 4FVBA 1BRBE 4I31A 4ISNA 1O5CB 4BAKB 1V2RT 4DT7B 4B73A 1ETRH 1A3BH 2FYQA 3SV2H 1TMUH 2C4FH 1P04A 2C8YB 2AMQA 1OWJA 4NZQA 2GP9B 1KTTB 1HAIH 1O3CA 4WWYA 3M36A 4DIIH 1AU8A 3U8RH 3SNBA 2BY7X 8GCHG 1H4WA 2ZP0H 2R3UA 3DD2H 1G2LA 2SGPE 4TY7A 3ATIA 2FDAA 3M5OA 9LPRA 1A1RA 4JK5A 1SFIA 2BXTH 2J4IA 1AI8H 5A0BA 1ZSKA 1RIWB 5A0AE 5C67A 4B2AA 1UVTH 2ZFFH 2YNBA 1AFEH 1GDQA 2AMPA 5ABWA 4ISHH 5E0HA 5A2MH 1HAZB 1GJ4H 1TGNA 1A7SA 2NU4E 2ZHFH 3QDZB 4ZAEA 1UMAH 3E1XB 2FLBH 2TGPZ 4A1TA 1CBWC 1MD8A 1NFXA 1F5LA 3P70B 2BDIA 1YC0A 1V3XA 1HAVA 2UUFB 4NSVA 3PB1E 1V2QT 2JETB 3BSQA 1O33A 3HPTB 3JZ2B 4CH2B 1P2QA 3GCOA 1OP0A 3DFJA 3MTYA 5C20A 1J9CH 4NFEA 2ZGCA 1C5PA 4CRAA 5ESBA 3QTVH 1Y3YA 1XUIA 3STJA 5C1UA 1J14A 1WUNH 3UTUH 1CU1A 1MUEB 1ESAA 3RLWH 5GDSH 4AX9H 1O2UA 3CS7A 2W7SA 2FOMB 1HJAC 4GCHF 1O31A 4WH8A 1N1LA 2PHBA 2VU8E 1VGCB 2QN5T 2WV5A 3BTTE 1SFQB 3G01A 1UVPA 4X0WU 2EEKA 2V6NA 5L6NH 1AFQB 1O3JA 2VVUA 3RC4A 1QA7A 1GI8B 1MKXK 1V2OT 1FNIA 1O3FA 6CHAB 3PROA 1GBAA 1GHWH 1Y8TA 3JZ1B 1XM1A 1O3IA 2YOLA 2F9UA 4BAHB 3GY6A 1ZLRA 3T26A 2XW9A 4AN7A
chains in the Genus database with same CATH superfamily
1BJVA 2YMSD 3A83A 1OWIA 2WPLS 4BXSA 3UQVA 4XD7D 3MQKC 5T3HA 3SGQE 1Q2WA 3UWJH 2ZU2A 1DY8A 4O97A 1X7AC 4I8GA 1FX0B 1BBRK 5FX5A 1T8MA 1P03A 2WYGA 4RKJB 5L2ZH 2H2ZA 2Z6BD 4X2YA 4KTSA 1QB1A 2J97A 1AHTH 2ZFPH 1NFYA 4B1TA 3MYWA 4WVPE 2ZG0H 1NC6A 1ZJKA 5FAHA 3TITA 1Z1JA 1O35A 3BTDE 1UVUH 1GL1A 1YLDA 1WQSA 4VGCC 2VWOA 1BJUA 2QF4A 1O30A 4TWWA 4NA7A 2W26A 2ALPA 3KQEA 2QC2A 1AE5A 2AEIH 2XOKD 4ABDA 4WXVA 2RDEA 1DDJA 1ZMJA 5IYTA 2G55A 1FY3A 2A5AA 3VB3A 1PQ8A 2EA3A 4ZHAA 4CBNA 3T28A 3Q77A 5GXPA 5EOKA 3VB5A 1EAUA 2PLXA 4GSOA 1V2WT 1D4PB 3TVJB 5C5OA 1S6LA 1QL7A 1GDNA 2Y7XA 4YLUA 1QFKH 3ZZ9A 3PMJA 1MU6B 1DICA 4IC6A 2A45B 3EGKH 1EJMA 1YPJH 1HIAA 2RDLA 3W94A 1NRSH 1ARCA 4KP0A 2HGTH 4BAOB 4DIHH 1QL9A 6CHAC 3BN9A 3SU1A 1HFDA 1Y3VA 1GHBG 3DSGA 1RRKA 1GJAB 3A7ZA 2FWWA 5I46H 4CREA 3RDZA 1O2MA 4DT4A 1A61H 1QJ6B 4DW2U 3W1EA 3OSYA 1V2VT 2GD4B 4WH6A 1T8OA 5DP3A 1P2IA 4B6FA 1ESTA 4Y8XA 4IN2A 2AIPA 3O8DA 4AC9A 3H5CB 4K8BA 2A7CA 3BG4B 4K5ZA 4ZKNU 2TGTA 1MTWA 5HMAA 1EPTA 2AHME 3N7EA 3WWFA 1O2LA 2Q6FA 3ZIAD 3E16B 2PSXA 4Q2KA 4A6LA 1A0HB 2FOGA 3IWMA 2BLQA 1NRPH 7ESTE 1QHRB 4X6PA 1DT2A 4MNWA 1E34B 1TGTA 1AD8H 1O3HA 3LDXH 1CQQA 1FY1A 1GI0A 2K0QA 5F8ZA 1DSTA 4X2WA 3ZVEA 5TJXA 2SNWA 1QCPA 2F9OA 1Z7KA 2VH0A 3P92A 1SPJA 2P8OC 3VB4A 1O3OA 2KR7A 2ZFTA 2BY6X 4THNH 3OAAD 2C90B 3SUEA 2FZZA 5A09A 2B8OH 1EJAA 4MDSA 1SOZA 2QXIA 5EU8A 4UONA 3MNSA 1THPB 1DS2E 3LH1A 1DITH 4DURA 1ANCA 3SJIA 4F55A 4JZEH 4Y10E 1C1OA 2YNAA 2BHGA 1ZMLA 3N99A 1BTYA 5L30H 1GI1A 4NWLA 4AG1A 9ESTA 1V2JT 4XDEA 1O39A 1T4VH 1NU9A 2FOEA 5FPYA 2PKAB 1LVYA 2XRCA 1KXAA 2J5UA 1ZTKA 3MNBA 1W13U 1VITH 5AF9H 1DPOA 2PP6A 1AWHB 3FP7E 2PGQB 4DGJA 1A4WH 1MBMA 1L1NA 4YOIA 2AERH 3GY7A 1GJBB 3ZVDA 2O8TA 1H1BA 4K60A 1ZGIA 3RMOH 1NU7B 2PSYA 4BOHA 2VINA 1C1QA 1A0LA 2TGDA 2Y81A 3RXBA 4YT6H 4CRCA 3RXSA 1KIGH 3T5FH 1CGIE 1IHSH 4AFUA 3H7TA 1FY5A 1HBTH 3VGCB 3TU7H 3RXOA 1ZGVA 1YPHE 2L74A 1GVLA 2HLDD 1W2KH 3TJVA 3WW7A 1LVOA 2BLVA 3TLOA 5DK1A 3C1KA 1ELAA 4CRFA 3PV4A 2O8LA 2BD2A 1GMDG 1TA2A 1EZSC 4MNXA 1IHTH 1AVXA 1TQ0B 1DANH 1DX5M 3H09A 2BVSH 3GY8A 4NFFA 5C3NA 2BD3A 1DVAH 4OGXA 1EZQA 4CRGA 3A81A 2QA9E 1HAYB 4O9VA 3UQOA 3V7TA 3KIDU 3UNQA 1B0EA 5K0HA 2ZQ1A 4YOJA 1D6WA 4MG3A 4XOJA 2HRVA 5E2PA 4UDWH 1Z8IB 3ZZ8A 4LXBH 6GCHF 1UTKA 3TH2H 4Y0ZE 3GDUA 2F43B 3SUGA 2W6JD 4X1RU 4P02A 3ZZ5A 4I8JA 4NSYA 4U2WA 4YOGA 2HNTC 1C5MD 1AZ8A 2FOHA 4X2VA 1AKSA 1L1GA 1PPZA 1SGNE 2QV1A 2ZI2H 1C5SA 2XTTB 2ZTZA 4Y79A 2STAE 1MKXH 2KAIB 3BTME 3TK9A 1D3PB 1DXPA 3ATMA 4B2BA 2D1JA 2BDAA 1HNEE 1QJ7B 1W0ZU 1GJCB 1W0YH 3LOXA 1EJNA 1XUHA 1MZAA 3F2HA 3UUZA 3FN8A 4FUBA 2B9LA 2V3HH 1KSNA 3QTOH 1GBKA 5GPIB 2XNIA 3PM3A 3A7TA 1FIWA 1P2MA 2OQUA 4X1QU 1ZPZA 3VPKA 1W11U 3EYDA 1RTLA 2W7UA 1GI7B 4IMZA 5C1YA 4K1SA 1EOLA 4FETA 3VEQB 2WPJS 1BBRH 1S0QA 2XC4A 1GVZA 1QBNA 4MPUA 5JYIA 3MU4A 1TPOA 4YM9A 5FCRA 1BOQA 1GBFA 1NM6A 2KZ4A 1WQVH 1LQEA 4JZFH 3S9AA 1C1PA 1RFNA 1TABE 3LKWA 1C2DA 4ZHLU 5DGJA 1VCQA 1D3TB 3M7QA 3RP2A 2JIZD 8GCHF 3RXHA 4I32A 2FP7B 1AUJA 2W3KA 4Q4LA 3K2UA 3PMBB 4A7IB 5E8EH 1TNJA 1O3MA 2W3IA 1UTJA 5JBTA 1L0ZA 1QQUA 1SLVB 1ZR0A 2PV9B 1C9TA 4X8VH 4GVUA 2A5IA 1C2IA 4X1PU 1PPFE 3SNCA 4RT1A 1EAWA 4Z6AH 2LP6A 2P59A 1TONA 1WYKA 2GZ8A 3MU8A 1KYNA 4MPXA 4FUHA 3UR9A 3OTPA 2M5TA 2GTBA 1JMOH 1FJSA 1GJDB 2ZPSA 1GHAG 4NIXA 4ABBA 1LHFH 5DJ7A 1KXCA 1H8ED 1HAPH 5EJ1A 4K2YA 1CT2E 2ZGXH 4Q80A 2WPDD 1GHXH 1F92A 1MD7A 3ZVFA 1HJ9A 4U32A 1BTUA 1MTNB 4ABAA 1O2RA 1BT7A 3ZVGA 3P17H 1N6YA 1IQGA 1GBIA 3RU4D 1PQ7A 4O03A 4XFQA 4GUXA 3LU9B 3A86A 2CN0H 4K69A 2I6SA 1O3DA 1ELBA 4JMYA 1WTHD 3A87A 4LZ1H 1CE5A 2WSSD 1G30B 3AK5A 2FODA 4YESB 5F8TA 4MPVA 3GCTG 2ZFSA 2FOFA 4B2CA 1ZHRA 3MWIU 1G3EA 2NU1E 3SQEE 1JOUB 1QURH 2OUAA 2ZTYA 1TMBH 1FZZA 1UTOA 2EC9H 1FY4A 2V35A 5KEDA 5DO4H 2FX6A 3ZZ3A 3FZZA 4U01A 3GS9A 2HVYB 1SSXA 2FEQH 4RKOB 2BQ7B 1EKBB 2FLRH 1GBCA 1E79D 3SJOA 3RU4E 1BDAA 4Y7BA 3P8GA 1AB9C 1G9IE 1UTNA 3R0FA 4HGCA 5A8YA 1A2CH 1VKYA 2SGAA 4ZMAH 3TK6A 2FTLE 5E0JA 1W7GH 4A1VA 1FN8A 2XYAA 1WBGB 1QZ8A 1UVOA 1UCYK 3OEED 4NG9H 3MH7A 3A7VA 1TOCB 1O2JA 3HKIB 3TJNA 1LKAA 5E0GA 1N8OC 1C2EA 1MH0A 4ABIA 3ZZAA 5JBAS 4CBOA 2A4RA 1AWFH 1GJ9B 1T4UH 4MNVA 2FXRA 2ASUB 4XBBA 5T6FA 1D3QB 1TBQH 2C8WB 5CHBA 2ZU5A 4NGAH 4ABHA 2ZO3H 2UUKB 5A8XA 1NS3A 1OWKA 5DP6A 2VVVA 1RS0A 2ESTE 2BMGB 1BUIA 1GI6A 1W12U 1VR1H 3PLBA 1O3AA 4YT7H 1SGQE 1FIZA 2VIVA 3SHAH 1HRTH 1C5VA 1KDQA 1ANEA 1AUTC 1A5GH 3AASA 3LC5A 3MO3A 1OWHA 1PPCE 1HDTH 2WPKS 1CO7E 5LH8A 1SG8B 2OBOA 4INKA 1ETTH 1HJAB 3PMAB 1W14U 1P01A 1MBQA 1VJ9U 3DSPA 3MOCA 4E05H 3A88A 4JZ1A 3TPIZ 2Y5FA 1OPHB 3SNAA 1EP6A 4ACAA 1GHBF 1NZQH 3PMHB 1IQFA 1GBLA 2GT8A 1O2XA 4FUGA 2O8UA 1GDUA 2VB0A 2A7JA 1YBWA 2BZAA 1O3PB 2J95A 1MZDA 1QRXA 5T6DA 1HAGE 1S85A 4TT3D 1D9IA 4NZLA 2ZHQH 1GBMA 2GDEH 4PROA 3UOUA 2WPIS 1XXDA 3MU1A 1YCPH 4MTBA 2TPIZ 2G51A 2ALVA 1GI3A 3ODDA 2XNDD 1AN1E 5EG4A 2EI6A 3UR6A 4ESTE 1K22H 1ZOMA 3W95A 3A8BA 3SUDA 4BTTB 1GBEA 3ZZ7A 4J1YA 3NUMA 4ABEA 4VGCB 5F53A 3ESTA 1OX1A 1J16A 1K9OE 2P16A 2VJ1A 3GCNA 5HIZA 1FXYA 2F3CE 1C4Y2 1OS8A 4ZXYH 5JB8S 1O5GH 2OLGA 3SI4H 3B8JA 1TIOA 1GVKB 2Y7ZA 3RXVA 1LVMA 2XC0A 1MTVA 3AAUA 1WXRA 5LPRA 2BDYA 3QZQA 3KQDA 1GI9B 1EATA 3L33A 4JYTA 4AFQA 3FOAA 2UUJB 2HALA 5C0UA 1MCTA 1B7XB 3RXKA 4UFFH 3A8DA 3SJ8A 3T29A 1LDTT 1IQNA 4WMEA 1C5UA 3ZZ4A 4ZKSU 1TGBA 4GAWA 1NRQH 3FVFB 3RC6A 3E6PH 1YY3A 2QGRA 2O8WA 1GI2A 1QGFA 2VIWA 4Y8YA 4GLYA 5GCHG 4B71A 1NRNH 2QY0B 1O0DH 4TPYA 3VB6A 4BAQB 2G4UA 1AMHA 2BLOA 2J38A 1S82A 4IBLH 3VG8A 1O3LA 1CT0E 1SC8U 3LIWA 1LVBA 2B0FA 3MNCA 1BBRE 3SHCH 5A0CA 1RTFB 2IJOB 2KCPA 5JDUB 2KX4A 3L3TA 1BMMH 3M7TA 4ZCNA 3LGYA 2ANWA 3KYGA 1W7XH 1P3CA 4FU7A 1ZPCA 4BXWA 4GHTA 1YYY1 1GMDF 1RJXB 1ARBA 4FUFA 1O5EH 2PW8H 1SGIB 2F4LA 3STIA 2P8OB 3S7HB 3RC5A 1BMNH 1ZPBA 3SJKA 1MTUA 1GG6C 3V13A 2RG3A 1ZZZA 5C1XA 2BD9A 3U69H 5C2ZA 3RM0H 1PYTC 3EDXB 1W0JD 1DOJA 2V7QD 3RXEA 1LPZB 2WUBA 4D9QA 4B6EA 1SGYE 5L2YH 3DSOA 1KMHB 4Z0KA 3CP7A 1C2GA 7LPRA 3RLYH 2VGCC 2OC1A 3GICB 4IGDA 2ANKH 2OK5A 2IOTA 1Y5AT 1QBOA 1K28D 5EODA 3O8BA 1OXGA 2G00A 1BTWA 1L2EA 2JH5D 2O8MA 1TA6A 2AYWA 5DKMA 1DFPA 2BVRH 4AZ2B 1Z8RA 1QIXB 1H9LB 1YLCA 1C5LH 1EB2A 3UNRA 3LGVA 1HUTH 5EQQA 1AGJA 4ZROA 4F49A 3SZEA 1A5HA 1GBHA 1UCYH 3LH3A 3SN8A 5ESTE 4YTAA 1HIAB 2A0QB 5EIYA 1M9UA 1PPBH 4E7RG 2R0KA 3RMLH 4AB8A 3RXDA 3TGIE 1TNGA 3SI3H 1THSH 3RM2H 3H7OA 1IAUA 4JCNA 1FI8A 1O36A 5AFZH 4AG2A 3GDVA 4XRNA 3F6UH 1O34A 2Y80A 2TRMA 3SZNA 1J8AA 3BIUH 2WHXA 1T7CA 3AAVA 1MU8B 1UHBA 1SGEE 2Z3CA 3BIVH 2JH6D 4M7GA 1LPGB 1KXDA 2BQWB 1ABJH 2ZHWH 1SGDE 1K1MA 2BDHA 4Y8ZA 1LHCH 3EA8A 4JZIA 4WJG2 4AGKA 1GGDB 1CA0B 1JWTA 3CS0A 2QCYA 1K0HA 2BY5X 2NU3E 2XBVA 3RXPA 4OS4A 5DN6D 2GKVE 2PKAA 5PTPA 2ZIQH 4ZUHA 4ZKOU 5B6OA 4OM9A 1QRWA 1TNLA 3M3TA 1P10A 2ZU1A 4X8TH 3NPSA 1P9UA 1NESE 1IQLA 2CJIA 1EP5A 2XCNA 5FXLA 1GHAF 2PUXB 1C2FA 1WDIA 5EQSA 3LJOA 1O2ZA 4FUCA 4KTCA 1ID5H 4FUJA 1GHZA 3PTBA 1MQ5A 1SL3A 1FQ3A 1E0FD 4BTIB 3N7DA 3PWCA 1W8BH 4H42U 4X6OA 1OYTH 1FDPA 5FCKA 1TNIA 2FI4E 3SYJA 3UREA 1SLWB 1C2HA 4AGJA 1F0SA 4I8HA 3K6ZA 1ELEE 1QL8A 2A1DB 3BTGE 1AZZA 1ELTA 1Z6EA 3T2NA 2QYIA 6LPRA 2G5NA 2J34A 2JDID 1V6DA 4AYYB 3GCTF 1BA8B 1NFUA 2O9QA 1PQAA 3FP6E 2ZZUH 4MVNA 2LELA 1TPAE 2ZDNA 3CENA 4E7NA 1O32A 3UPEA 2AIQA 4Y6DA 2F9PA 4LZ4B 3BTFE 1XUGA 3LONA 4RI0A 3ZZDA 1OP2A 2P95A 1EPTC 1EASA 4E06H 3TGKE 4SGAE 5C5NA 1GGDC 1CA0C 2VBCA 1HV7A 2R2MB 2QXHA 1SGFA 2HNTF 5CE1A 3F9GA 1O2YA 3Q76A 1E1RD 1P05A 2ZPRA 1E35B 1GMHG 2KCAA 2OD3B 2ZA5A 1GMCG 1QBVH 5DSFA 2TGAA 3PO1B 1VCPA 3UNSA 1ACBE 1C2MA 4INHA 5BPEA 2BVXH 1P8VC 5EGMA 3P95A 2NWNA 1GCDA 2AGGX 1O2PA 3GDSA 2OP9A 3NZIA 2ZFQH 2OINA 2KAIA 4TWYA 1XVOA 4NIVA 1P02A 5HYOA 1C1VH 1U6QA 2GCHG 5EPNA 2ZWLH 1C5QA 3QGNB 1EFRD 2C3SA 2C8XB 2ZCKP 2C93B 2FO9A 3UIRA 1B5GH 1O3KA 1TAWA 3GYMA 4HI3A 1TBZH 2XWBI 1SVPA 1UTMA 5EXLA 1LHDH 2H5CA 1ZRKA 3A8CA 3PYHA 1XMNB 2PTCE 3U1IB 1TRMA 4MQAA 2G8TA 2VIPA 1JIRA 1DLEA 1ANBA 1P2OA 3B9FH 3HK6B 1K2I1 1YCPM 1K1PA 2VWMA 2RCEA 4A92A 3LGWA 1FV9A 1C1NA 1F2SE 1C1WH 1V2NT 2ZGHA 4ACBA 5DPAA 1HPGA 1CHOG 2ZF0H 2BZ6H 1ESBA 3O8RA 1F0TA 2G52A 1YF4A 3SOSA 1CVWH 1DUAA 1HB0B 2SGQE 2PKSC 1LPKB 3E0NB 4K8YA 3M3SA 1HAHH 1KTSB 4XBDA 3DHKH 1GPZA 1EXFA 1ZTLA 3KL6A 2G4TA 5HM2A 3IITA 4AYVB 3EA9A 1ANDA 4KKDA 3RXMA 1DUEA 1UTPA 4XE4A 1AB9B 2BLWA 5LPEA 3SV7A 1HLTH 1NO9H 1GBBA 1HJ8A 1RD3B 3PO1C 5EW1H 4D7FA 2C8ZB 3SV6A 1ETSH 1UTQA 1IOEA 3MO9A 4Q7ZA 1PQ5A 3UOPA 5F6MA 1W3CA 1G32B 3D23A 1F0UA 1N8OB 2W5EA 4XBCA 2R3YA 2F9BH 1C5RA 1KLJH 2H9EH 3ENSB 4ISOA 1KXEA 1TALA 2WV4A 3LT3A 4O3UA 4UD9H 2CK3D 3RMMH 4H6SB 5C94A 2I6QA 1FN6A 4TY6A 3M5LA 4OS5A 3SU4A 1C4V2 2VWLA 3LGTA 1NN6A 4MLFB 4DCDA 3ZV9A 1N6XA 1K1JA 1GWAA 2XXLA 1SBWA 1C5OH 3P8FA 1GJ5H 2R2WU 2ZKSA 1VZQH 4TSFD 1LMWB 4CHAC 4DVAU 3OTJE 1A0JA 3FZDA 2JH0D 3PWBA 2NU2E 2ODYB 3GY2A 1IQJA 1C5YB 2FOCA 2AFQB 2HPQH 5JPMH 2A4QA 1O2SA 2SFAA 1UTLM 2ILNA 1O5BB 4AORA 1W0KD 2XBYA 1W10U 2FIRH 3V12A 3MMGA 2CHAC 1O2KA 5ETXA 5HXFA 2FOAA 2PUQH 1Y3XA 3RXQA 3SNEA 1TX6A 3QZRA 1PPGE 3FFGA 4I8KA 1VJAU 3NKKA 3OE7D 5BRRE 3U8TH 4HTCH 2JKHA 5EW2H 1O5AB 4OS2A 1C5WB 1G36A 3LGUA 1YWUA 1SI5H 3BTKE 1S83A 4M9FA 4D8NA 3AW1A 3M3VA 4Y0YE 1TOMH 3MHWU 3M5MA 4FU8A 4IN1A 2OQ5A 2H6MA 4UE7H 2EI7A 2HOBA 2OC8A 2ZHEH 2OC0A 5FHTA 4UFDH 2FESH 3N7OA 1JIMA 2Z3EA 2HLCA 4A1XA 1KXFA 1UCYE 4WY3A 4DG4A 2YMSC 1VITG 1TX8A 5EXNA 1QA0A 1JRSA 2Y6TA 1IQKA 5GCHF 2DE9A 4ABGA 5EQRA 1O2VA 2P3UB 1JXPA 1BTXA 3VXEH 3ZVBA 2ZDVH 3E8LA 3BG8A 1ZJDA 1TE0A 1F5KU 2LPRA 3M61U 3UB0A 2ANYA 5AHGH 4K3JA 1YPKH 4KGAA 1SKYE 1YM0A 2ZDLA 3ZYDA 2H1UA 1MAYA 5AVDA 3EQ0H 1AVGH 1L4DA 1A3EH 1C2JA 1WV7H 1P0SH 1NRRH 2B7DH 4RN6A 5CHAC 1O2HA 3KCGH 5DP9A 4YXWD 1SQTA 2FOBA 1C1MA 4NA9H 4Q63A 5EJLA 1XXFA 4K1EA 2TBSA 1UW7A 1TYNA 2P93A 2GMTC 2WV9A 2UWPA 4P00A 4Q7YA 3BEFB 3F0PA 1BHXF 2Y82A 1XUFA 2IN2A 2WPMS 1G37A 3OEHD 2J98B 4I86A 3SU2A 2FYRA 4OS6A 2BD7A 3QUMP 1T8LA 2ZEBA 1TB6H 1IQMA 2BDCA 2GCTC 2QF5A 2XC5A 4RT0A 1UK2A 2L6OA 4SGBE 2OTVA 2PGBB 1SGFG 1SHHB 1OSSA 1DY9A 1DWCH 1OHHD 2STBE 4LK4A 1EUFA 1KDQB 3NCLA 2D8WA 1ELGA 1NFWA 1THRH 1Z8GA 1P57B 2VIDA 3SORA 3KYFA 1WU1A 2VNTA 5DP7A 5GWZA 1GJ6A 4HFPB 2R9PA 2WUCA 1UK3A 1ZRBA 2QF0A 1TPPA 2SGFE 1SQOA 3GY3A 1PPEE 3GYLB 1AO5A 1SGCA 4NIWA 4X6NA 1QQ4A 2GV6A 4H4FA 2ZGBH 3KNXA 5HIYA 1QNJA 4IW4E 2HVXA 5JB9S 1MTSA 1SQAA 4Y7AA 4X8UH 4B74A 3SJ9A 1WSSH 1V2TT 4I8LA 1Y5BT 1G3DA 1O3NA 1LTOA 1WAYB 1XKBC 3SGBE 5JBCS 2Y5GA 1BRAA 2BD8A 4NWKA 1EX3A 4IS5A 1AE8H 2NU0E 5DP8A 3R3GB 2IJD1 5SGAE 1QRZA 1CSOE 7GCHG 1OP8A 5K7RA 1BRCE 3M35A 1LKBA 3GISB 1T8NA 2BYAX 3KQ5A 1MAXA 1IQIA 3TH3H 3S0NA 1GG6B 2BOKA 3SU0A 5IK2D 2FS8A 3CNRA 3LGIA 3OYPA 1C5NH 2AH4X 2WINI 3M37A 2A5KA 1HAVB 1PFXC 2JJ2D 2P3FH 3KF2A 1EAIA 4QT8C 2P3TB 1HCGA 2GDDA 1Y3WA 3ATWA 2OC7A 1EZXC 1TQ7B 4Q7XA 4X1NU 1HXFH 1QJ1B 1S6FA 1Y5UT 3MH6A 1ELFA 5DP5A 1XVMA 2Z9IA 5KGOA 1MCVA 2H5DA 1C2LA 2VGCB 1S84A 3PLKA 5DP4A 1TNHA 4R8TB 1YPHC 2HPPH 3D65E 1FAKH 2XBWA 2AGEX 1MKWK 2H9HA 4BAMB 2UUYA 4FUDA 2Z7FE 1C5ZB 5E2OA 4D9RA 1OWEA 5EPYA 1JRTA 3VFEA 5J4QA 1S0RA 1Q3XA 1WCZA 2XCFA 3QGJA 2BD5A 3BV9B 3NWUA 1FMGA 2CXVA 5GIBA 3AVZA 2CF9H 3V3MA 3Q3YA 2QIQA 1C1RA 2PTNA 5FBIA 3TJOA 3C27B 4R0IA 1TMTH 1UK4A 2Q6GA 4CRDA 1RIWC 2A2QH 2A2XH 1QB9A 4A5TS 3QK1A 1SLXB 3Q00A 4NCYA 1AQ7A 4ABFA 2KM0A 2V3OH 3RXUA 2BDGA 1D6RA 4INLA 3MFJA 4I33A 3SW2B 3FP8E 2LNCA 5TCAA 3BEIB 4UEHH 5I25A 3I77A 1ZYOA 1JBUH 3T62A 1QR3E 1GJ7B 1S6HA 1FPHH 1G3CA 1SLUB 2GZ7A 3TNSA 3EAJA 5FPTA 2JETC 1NPMA 4TPIZ 3ZZCA 3KQBA 1DWBH 2ZGJA 4FUEA 2F9NA 3GY4A 3HGPA 7KMEH 2AS9A 3MU0A 4CRBA 2UWOA 2Z9LA 1GMHF 1F5RA 1GBDA 1TX7A 1GMCF 4J2YB 4CR9A 3TH4H 1Z6JH 3SNDA 1HAOH 4F4OC 3MO6A 3MH4A 1IQHA 2B5TB 3KQCA 3URDA 1XUKA 2G81E 2OXSA 1OYQA 3VB7A 2VWNA 3GOVB 3OFND 5G4BA 1VGCC 3QO6A 1INCA 4IMQA 5DG6A 2GCHF 1DLKB 1P3EA 1GHVH 1SHYA 2PWXA 3DFLA 2PR3A 1AFQC 2THFB 3RUOA 1V2MT 1V2KT 1EZUC 1KLTA 1YGCH 2ZHDA 2Q6DA 1VCWA 4FOUC 1BB0B 3E0PB 3S9BA 2QAAA 1GL0E 2BQ6B 1PJPA 1Z1IA 1E37B 4XSKU 2BM2A 2M2AA 2WPHS 3SU5A 1IQEA 4WMFA 1V2UT 1BCUH 4JZDH 2GVFA 1P06A 4X1SU 5B6LA 1C1SA 4X8SH 5LGOA 1GBJA 3BEUA 1ORFA 3LPRA 3QX5H 2ZC9H 4WF8A 3A7XA 1CHOF 1H9IE 5T6GA 4YZUA 1FAXA 3KHVA 2H9TH 2ODQA 4DJZB 5FBEA 2CV3A 2VIOA 1ZSJA 2ZNKH 4B75A 1EPTB 3PLPA 3D49H 4AFSA 1Y59T 4X2XA 1LHEH 2FMJA 3IG6B 2SGEE 5AFYH 5F03A 3TK5A 4I7YH 3KEEA 4NA8A 4BTUB 3E3TA 1GHYH 1WOFA 2ZCLP 1Z71A 2GZ9A 4ABJA 3A82A 3DUXH 1LHGH 4TYDA 3F9FA 8KME2 3FKSD 2ULLA 2ZECA 4WMDA 1ELVA 2RFKC 1K1IA 1SGTA 1UHBB 3RXRA 3SU6A 3NK8A 1AVWA 4DOQA 4O3TA 1TBRH 1DXWA 3Q3XA 3MNXA 1FY8E 1EAXA 3TNTA 4GCHG 1T32A 1CGHA 3F9EA 2ODPA 3UAIC 3RXTA 3A84A 2KCYA 2HWLB 3HK3B 1G3BA 3ZYEA 3ZV8A 1UJ1A 1TNKA 1YPEH 5JBBS 2A4OA 3SU3A 1D3DB 3DA9B 1O2NA 3MI4A 2BDBA 1H8HD 1KY9A 1J15A 1J17T 2ZDAH 1TGSZ 3ZZBA 1O37A 2Z9GA 1ZHPA 3OX7U 3P8NA 1F7ZA 3BG4C 1GJ8B 1ELDE 2Z9KA 4YLQH 2EI8A 5FX6A 1L4ZA 3BTWE 3U1JB 1OOKB 1S81A 1O5FH 2IPHA 2D2DA 4FUIA 1BQYA 2BB4A 3QN7A 4AOQA 1E36B 4D76A 2FM2A 2Z9JA 1O2WA 2PKSB 3ODFA 1B0FA 1GI5A 4JK6A 1C9PA 8LPRA 3ZVAA 1WTGH 3PRBA 4LOYH 3ATLA 1C1TA 3KGPA 1A46H 1ABIH 2FTMA 5J4SA 3MU5A 2ZQ2A 3RXIA 1Q31A 1A5IA 2BY8X 1NROH 4BNRA 4ZKRU 1GBTA 4ZHMU 1P11E 2J92A 4WXIA 2CMYA 4Y76A 1PYTD 2ZDKA 2ZDMA 3D62A 1O2OA 2D26C 3QWCH 3URCA 6ESTA 1BRUP 1ZTJA 5EXMA 1YPLH 2W6ID 2ZU4A 1O5DH 3SGAE 1SB1H 1VITF 2P94A 4U30A 4BANB 3A8AA 2Q1JA 3KN2A 3NRLA 2CF8H 4FU9A 5HGGA 4DY7B 2DUCA 5H4IB 1BTHH 2GGVB 4MPWA 1TRNA 1YCPK 3RXJA 4FVDA 1V2ST 1SR5C 1AY6H 1MKWH 4D7GA 3S9CA 1SGPE 2Z3DA 2KCOA 3UWIA 1CA8B 1BTPA 1TGCA 1UVSH 2DE8A 3ATKA 3A85A 3OU0A 1FONA 2F83A 3I29A 3HATH 3T25A 2ZTXA 2CGAA 2WZQA 1ZMNA 1Y3UA 4CHAB 1O2IA 2SNVA 4KTUA 4FXGH 1H8IH 1AKSB 1NY22 2EQNA 2JJ1D 1DSUA 2A32A 5FPSA 2QF3A 1K21H 3U9AH 1KLIH 4HG6A 5F8XA 2AGIX 3RXFA 3BF6H 2BOHB 3GY5A 3PRDA 5CMXH 5GJ4B 1PPHE 3DT0H 3U28C 3VXFH 1GCTB 2GV7A 3VGCC 4B76A 5T1VA 1K1OA 2XBXA 1K1NA 1LO6A 2FI5E 2Z94A 3PV5A 1MQ6A 3P6ZB 3UY9A 1C2KA 2A7HA 2CHAB 1C5XB 1O2TA 2R0LA 1EOJA 1DM4B 3BTHE 2QE7D 3HKJB 3MH5A 1H9HE 4AFZA 1HAXB 1F0RA 3BTEE 2F91A 2VH6A 1SGRE 2FS9A 1LQDB 4IC5A 1DWDH 1O2GH 2XWAA 1OWDA 3O8CA 4ASUD 1HGTH 1O3BA 2WYJA 2ZCHP 4KELA 4K1TA 3SO3A 1NT1A 1O38A 1YPMH 4RSPA 5TCCA 3ELAH 2BY9X 2GT7A 3EE7A 3A89A 1ZSLA 2AMDA 3K6YA 2FI3E 3P8OA 2UWLA 1SOTA 3S7KB 3E90B 3SQHE 4GHQA 2F9VA 1QTFA 2YMSB 4CH8B 3QLPH 2A31A 3GCHB 1BTZA 4OGYA 1P2KA 1GI4A 2OBQA 3EA7A 3WY8A 1QY6A 3LJJA 3ZVCA 3A7YA 3E91A 1TRYA 1KXBA 2V0BA 3FAOA 3OY6U 4ASHA 5C0TA 1SMFE 1Z8JB 1RXPA 4OS1A 1CGJE 1V2PT 1O3GA 2SGDE 4GPGA 5GNDA 3U8OH 1BMAA 1YP9A 1RGQA 2GX4A 1AIXH 1CT4E 3SV8A 3F1SB 4X6MA 7GCHF 1ELCA 1RTKA 1K1LA 2ZU3A 5EJZA 3A7WA 3RMNH 5IDKA 1BITA 1FLEE 3F2GA 1P12E 5CHAB 4Y71A 1GCTC 4UFGH 2G5VA 3RXCA 1G2MA 4JYUH 3ZZ6A 2VIQA 1V2LT 3A80A 2Y5HA 1DE7H 4ZH8A 3SBKA 2FPZA 3T27A 1C1UH 3WWBA 2BTCE 3F3BA 2GMTB 3TJUA 3F9HA 1TFXA 1YPGH 3OY5U 1FPCH 5C17A 4ISLA 4ZXXH 1S5SA 1NTPA 1P2JA 2PFEA 1HXEH 1OKXA 1XUJA 2GCTB 4HZHA 1P09A 3SUFA 1TWXB 3B23B 3U98H 2J94A 1LCYA 1P2NA 3Q3KA 3TIUA 1BZXE 2BD4A 4CR5A 3L6PA 1NBMD 2OCVB 1SQRA 1XKAC 1EB1H 1BHXB 3M7UA 5LPFA 4F48B 2QXJA 4NIYA 3K65B 2BXUH 1P9SA 1EQ9A 3GCHC 3HGNA 5HKKD 4OS7A 1MMJN 1TPSA 2RA3A 1C4U2 3UFAA 2EY4C 3F68H 2K8IA 6GCHG 4Y11E 3V0XA 1O2QA 1C5TA 4MNYA 2ZFRH 3K9XB 1BIOA 1L1JA 3TGJE 1TLDA 1FUJA 2BX4A 4AB9A 3LC3A 1H8DH 3SV9A 3M5NA 5A8ZA 1T31A 3RXAA 1QB6A 3PTNA 2BX3A 3BTQE 2VVCA 3ITIA 3S69A 1BMLA 2J9NA 3RXLA 3EE0B 1HYLA 2QXGA 4UFEH 1ZHMA 1MTNC 3AW0A 3NXPA 3DCLA 1MABB 1E38B 1NBME 1CBWB 2K1QA 1DWEH 2J2UA 1XX9A 1YKTA 5HM9A 3FO8D 1CHGA 2ANMH 4ISIH 2TIOA 4H6TA 2ZPQA 4JYVH 4YO9A 2A4GA 2FX4A 2J98A 1O3EA 3FANA 3I78A 2RA0A 3RU4T 8ESTE 1UO6A 3RXGA 2HNTE 2GJGA 4FVBA 1BRBE 4I31A 2IPQX 4ISNA 1O5CB 4BAKB 1V2RT 4Z1MD 4DT7B 4B73A 1ETRH 1A3BH 2FYQA 3SV2H 1TMUH 2C4FH 1YLNA 1P04A 2C8YB 2AMQA 1OWJA 4NZQA 2GP9B 1KTTB 1HAIH 1O3CA 4WWYA 3M36A 4DIIH 1AU8A 3U8RH 3SNBA 2BY7X 8GCHG 1H4WA 2ZP0H 2R3UA 3DD2H 1G2LA 2SGPE 4TY7A 3ATIA 2FDAA 3M5OA 9LPRA 1A1RA 4JK5A 1SFIA 2BXTH 2J4IA 1AI8H 5A0BA 1ZSKA 1RIWB 5A0AE 5C67A 4B2AA 1UVTH 2ZFFH 2YNBA 1AFEH 1GDQA 2AMPA 2V3MA 5ABWA 4ISHH 5E0HA 5A2MH 1HAZB 1GJ4H 1TGNA 1A7SA 1BMFD 2NU4E 2ZHFH 2KFWA 3QDZB 4ZAEA 1UMAH 3E1XB 2FLBH 3F2FA 2TGPZ 4A1TA 1CBWC 1MD8A 1NFXA 1F5LA 3P70B 2BDIA 1YC0A 1V3XA 1HAVA 5KECA 2UUFB 4NSVA 3PB1E 1V2QT 2JETB 3BSQA 5CDFE 1O33A 3HPTB 3JZ2B 4CH2B 1P2QA 3GCOA 1OP0A 3DFJA 3MTYA 5C20A 1J9CH 4NFEA 2ZGCA 5FL7D 1C5PA 4CRAA 5ESBA 3QTVH 1Y3YA 1XUIA 3STJA 5C1UA 1J14A 1WUNH 3UTUH 1CU1A 1MUEB 1ESAA 3RLWH 5GDSH 4AX9H 1O2UA 3CS7A 2W7SA 3PV2A 2FOMB 1HJAC 4GCHF 1O31A 4WH8A 1N1LA 2PHBA 2VU8E 1VGCB 2QN5T 2WV5A 3BTTE 1SFQB 3G01A 1UVPA 4X0WU 2EEKA 2V6NA 5L6NH 1AFQB 1O3JA 1COWD 2VVUA 3F0OA 3RC4A 1QA7A 1GI8B 1MKXK 1V2OT 1FNIA 1O3FA 6CHAB 3PROA 1GBAA 1GHWH 1Y8TA 3JZ1B 1E1QD 1XM1A 1O3IA 2YOLA 2F9UA 4BAHB 3GY6A 1ZLRA 3T26A 2XW9A 4AN7A
chains in the Genus database with same CATH topology
1BJVA 3A83A 1OWIA 2WPLS 4BXSA 3UQVA 5T3HA 3SGQE 1Q2WA 3UWJH 2ZU2A 1DY8A 4O97A 1X7AC 4I8GA 1BBRK 5FX5A 1T8MA 1P03A 2WYGA 4RKJB 5L2ZH 2H2ZA 2Z6BD 4X2YA 4KTSA 1QB1A 1AHTH 2ZFPH 1NFYA 4B1TA 3MYWA 4WVPE 2ZG0H 1NC6A 1ZJKA 5FAHA 3TITA 1Z1JA 1O35A 3BTDE 1UVUH 1GL1A 1YLDA 1WQSA 4VGCC 2VWOA 1BJUA 1O30A 4TWWA 4NA7A 2W26A 2ALPA 3KQEA 2QC2A 1AE5A 2AEIH 4ABDA 4WXVA 1DDJA 1ZMJA 5IYTA 2G55A 1FY3A 2A5AA 3VB3A 1PQ8A 2EA3A 4ZHAA 4CBNA 3T28A 3Q77A 5GXPA 5EOKA 3VB5A 1EAUA 2PLXA 4GSOA 1V2WT 1D4PB 3TVJB 5C5OA 1QL7A 1GDNA 2Y7XA 4YLUA 1QFKH 3ZZ9A 3PMJA 1MU6B 1DICA 4IC6A 2A45B 3EGKH 1EJMA 1YPJH 1HIAA 2RDLA 3W94A 1NRSH 1ARCA 4KP0A 2HGTH 4BAOB 4DIHH 1QL9A 6CHAC 3BN9A 3SU1A 1HFDA 1Y3VA 1GHBG 1RRKA 1GJAB 3A7ZA 2FWWA 5I46H 4CREA 3RDZA 1O2MA 1A61H 1QJ6B 4DW2U 3OSYA 1V2VT 2GD4B 4WH6A 1T8OA 5DP3A 1P2IA 1ESTA 4Y8XA 4IN2A 2AIPA 3O8DA 3H5CB 4K8BA 2A7CA 3BG4B 4K5ZA 4ZKNU 2TGTA 1MTWA 5HMAA 1EPTA 1O2LA 2Q6FA 3E16B 2PSXA 4Q2KA 4A6LA 1A0HB 2FOGA 3IWMA 2BLQA 1NRPH 7ESTE 1QHRB 4X6PA 1DT2A 4MNWA 1E34B 1TGTA 1AD8H 1O3HA 3LDXH 1CQQA 1FY1A 1GI0A 5F8ZA 1DSTA 4X2WA 3ZVEA 5TJXA 2SNWA 1QCPA 2F9OA 1Z7KA 2VH0A 3P92A 1SPJA 2P8OC 3VB4A 1O3OA 2ZFTA 2BY6X 4THNH 2C90B 3SUEA 2FZZA 5A09A 2B8OH 1EJAA 4MDSA 1SOZA 2QXIA 5EU8A 4UONA 3MNSA 1THPB 1DS2E 3LH1A 1DITH 4DURA 1ANCA 3SJIA 4JZEH 4Y10E 1C1OA 2YNAA 2BHGA 1ZMLA 1BTYA 5L30H 1GI1A 4NWLA 4AG1A 9ESTA 1V2JT 4XDEA 1O39A 1T4VH 1NU9A 2FOEA 5FPYA 2PKAB 1LVYA 2XRCA 1KXAA 1ZTKA 3MNBA 1W13U 1VITH 5AF9H 1DPOA 3FP7E 1AWHB 2PGQB 4DGJA 1A4WH 1MBMA 1L1NA 4YOIA 2AERH 3GY7A 1GJBB 3ZVDA 2O8TA 1H1BA 4K60A 1ZGIA 3RMOH 1NU7B 2PSYA 4BOHA 2VINA 1C1QA 1A0LA 2TGDA 2Y81A 3RXBA 4YT6H 4CRCA 3RXSA 1KIGH 3T5FH 1CGIE 1IHSH 4AFUA 3H7TA 1FY5A 1HBTH 3VGCB 3TU7H 3RXOA 1ZGVA 1YPHE 1GVLA 1W2KH 3TJVA 1LVOA 2BLVA 3TLOA 5DK1A 3C1KA 1ELAA 4CRFA 3PV4A 2O8LA 2BD2A 1GMDG 1TA2A 1EZSC 4MNXA 1IHTH 1AVXA 1TQ0B 1DANH 1DX5M 4NFFA 2BVSH 3GY8A 5C3NA 2BD3A 1DVAH 4OGXA 1EZQA 4CRGA 3A81A 2QA9E 1HAYB 4O9VA 3UQOA 3V7TA 3KIDU 3UNQA 1B0EA 5K0HA 2ZQ1A 4YOJA 1D6WA 4MG3A 4XOJA 2HRVA 5E2PA 4UDWH 1Z8IB 3ZZ8A 4LXBH 6GCHF 1UTKA 3TH2H 4Y0ZE 3GDUA 3SUGA 4X1RU 3ZZ5A 4I8JA 4NSYA 4U2WA 4YOGA 2HNTC 1C5MD 1AZ8A 2FOHA 4X2VA 1AKSA 1L1GA 1PPZA 1SGNE 2QV1A 2ZI2H 1C5SA 2XTTB 2ZTZA 4Y79A 2STAE 1MKXH 2KAIB 3BTME 3TK9A 1D3PB 1DXPA 3ATMA 4B2BA 2D1JA 2BDAA 1HNEE 1QJ7B 1W0ZU 1GJCB 1W0YH 3LOXA 1EJNA 1XUHA 1MZAA 3UUZA 4FUBA 2B9LA 2V3HH 1KSNA 3QTOH 1GBKA 5GPIB 2XNIA 3PM3A 3A7TA 1FIWA 1P2MA 2OQUA 4X1QU 1ZPZA 3VPKA 1W11U 3EYDA 1RTLA 2W7UA 1GI7B 4IMZA 5C1YA 4K1SA 1EOLA 3VEQB 2WPJS 1BBRH 1S0QA 2XC4A 1GVZA 1QBNA 4MPUA 5JYIA 3MU4A 1TPOA 4YM9A 5FCRA 1BOQA 1GBFA 1NM6A 1WQVH 1LQEA 4JZFH 3S9AA 1C1PA 1RFNA 1TABE 3LKWA 1C2DA 4ZHLU 5DGJA 1VCQA 1D3TB 3M7QA 3RP2A 8GCHF 3RXHA 4I32A 2FP7B 1AUJA 2W3KA 3K2UA 3PMBB 4A7IB 5E8EH 1TNJA 1O3MA 2W3IA 1UTJA 5JBTA 1L0ZA 1QQUA 1SLVB 1ZR0A 2PV9B 1C9TA 4X8VH 4GVUA 2A5IA 1C2IA 4X1PU 1PPFE 3SNCA 1EAWA 4Z6AH 2P59A 1TONA 1WYKA 2GZ8A 3MU8A 1KYNA 4MPXA 4FUHA 3UR9A 2M5TA 2GTBA 1JMOH 1FJSA 1GJDB 2ZPSA 1GHAG 4NIXA 4ABBA 1LHFH 5DJ7A 1KXCA 1HAPH 4K2YA 1CT2E 2ZGXH 4Q80A 1GHXH 1F92A 1MD7A 3ZVFA 1HJ9A 4U32A 1BTUA 1MTNB 4ABAA 1O2RA 1BT7A 3ZVGA 3P17H 1N6YA 1IQGA 1GBIA 3RU4D 1PQ7A 4O03A 4XFQA 4GUXA 3LU9B 3A86A 2CN0H 4K69A 2I6SA 1O3DA 1ELBA 4JMYA 1WTHD 3A87A 4LZ1H 1CE5A 1G30B 2FODA 4YESB 5F8TA 4MPVA 3GCTG 2ZFSA 2FOFA 4B2CA 1ZHRA 3MWIU 1G3EA 2NU1E 3SQEE 1JOUB 1QURH 2OUAA 2ZTYA 1TMBH 1FZZA 1UTOA 2EC9H 1FY4A 2V35A 5DO4H 2FX6A 3ZZ3A 3FZZA 4U01A 1SSXA 2FEQH 4RKOB 2BQ7B 1EKBB 2FLRH 1GBCA 3SJOA 3RU4E 1BDAA 4Y7BA 3P8GA 1AB9C 1G9IE 1UTNA 3R0FA 4HGCA 5A8YA 1A2CH 2SGAA 4ZMAH 3TK6A 2FTLE 5E0JA 1W7GH 4A1VA 1FN8A 2XYAA 1WBGB 1UVOA 1UCYK 4NG9H 3MH7A 3A7VA 1TOCB 1O2JA 3HKIB 3TJNA 1LKAA 5E0GA 1N8OC 1C2EA 1MH0A 4ABIA 3ZZAA 5JBAS 4CBOA 2A4RA 1AWFH 1GJ9B 1T4UH 4MNVA 2FXRA 2ASUB 4XBBA 5T6FA 1D3QB 1TBQH 2C8WB 2ZU5A 4NGAH 4ABHA 2ZO3H 2UUKB 5A8XA 1NS3A 1OWKA 5DP6A 2VVVA 1RS0A 2ESTE 2BMGB 1BUIA 1GI6A 1W12U 1VR1H 3PLBA 1O3AA 4YT7H 1SGQE 1FIZA 2VIVA 3SHAH 1HRTH 1C5VA 1KDQA 1ANEA 1AUTC 1A5GH 3AASA 3LC5A 3MO3A 1OWHA 1PPCE 1HDTH 2WPKS 1CO7E 5LH8A 1SG8B 2OBOA 4INKA 1ETTH 1HJAB 3PMAB 1W14U 1P01A 1MBQA 1VJ9U 3MOCA 4E05H 3A88A 4JZ1A 3TPIZ 2Y5FA 1OPHB 3SNAA 1EP6A 1GHBF 1NZQH 3PMHB 1IQFA 1GBLA 2GT8A 1O2XA 4FUGA 2O8UA 1GDUA 2VB0A 2A7JA 1YBWA 2BZAA 1O3PB 2J95A 1MZDA 1QRXA 5T6DA 1HAGE 1S85A 1D9IA 4NZLA 2ZHQH 1GBMA 2GDEH 4PROA 3UOUA 2WPIS 1XXDA 3MU1A 1YCPH 4MTBA 2TPIZ 2G51A 2ALVA 1GI3A 3ODDA 5EG4A 1AN1E 2EI6A 3UR6A 4ESTE 1K22H 1ZOMA 3W95A 3A8BA 3SUDA 4BTTB 1GBEA 3ZZ7A 4J1YA 3NUMA 4ABEA 4VGCB 3ESTA 1OX1A 1J16A 1K9OE 2P16A 2VJ1A 3GCNA 1FXYA 2F3CE 1C4Y2 1OS8A 4ZXYH 5JB8S 1O5GH 2OLGA 3SI4H 3B8JA 1TIOA 1GVKB 2Y7ZA 3RXVA 1LVMA 2XC0A 1MTVA 3AAUA 5LPRA 2BDYA 3QZQA 3KQDA 1GI9B 1EATA 3L33A 4JYTA 4AFQA 2UUJB 2HALA 1MCTA 1B7XB 3RXKA 4UFFH 3A8DA 3SJ8A 3T29A 1LDTT 1IQNA 4WMEA 1C5UA 3ZZ4A 4ZKSU 1TGBA 4GAWA 1NRQH 3FVFB 3RC6A 3E6PH 2QGRA 2O8WA 1GI2A 1QGFA 2VIWA 4Y8YA 4GLYA 5GCHG 4B71A 1NRNH 2QY0B 1O0DH 4TPYA 3VB6A 4BAQB 2G4UA 1AMHA 2BLOA 2J38A 1S82A 4IBLH 1O3LA 1CT0E 1SC8U 3LIWA 1LVBA 2B0FA 3MNCA 1BBRE 3SHCH 5A0CA 1RTFB 2IJOB 5JDUB 3L3TA 3M7TA 1BMMH 3LGYA 2ANWA 1W7XH 1P3CA 4FU7A 1ZPCA 4BXWA 4GHTA 1YYY1 1GMDF 1RJXB 1ARBA 4FUFA 1O5EH 2PW8H 1SGIB 3STIA 2P8OB 3S7HB 3RC5A 1BMNH 1ZPBA 3SJKA 1MTUA 1GG6C 3V13A 2RG3A 1ZZZA 5C1XA 2BD9A 3U69H 5C2ZA 3RM0H 1PYTC 3EDXB 1DOJA 3RXEA 1LPZB 2WUBA 4D9QA 1SGYE 5L2YH 4Z0KA 3CP7A 1C2GA 7LPRA 3RLYH 2VGCC 2OC1A 3GICB 4IGDA 2ANKH 2IOTA 1Y5AT 1QBOA 1K28D 5EODA 3O8BA 1OXGA 2G00A 1BTWA 1L2EA 2JH5D 2O8MA 1TA6A 2AYWA 5DKMA 1DFPA 2BVRH 4AZ2B 1Z8RA 1QIXB 1H9LB 1YLCA 1C5LH 1EB2A 3UNRA 3LGVA 1HUTH 5EQQA 1AGJA 4ZROA 4F49A 1A5HA 1GBHA 1UCYH 3LH3A 3SN8A 5ESTE 4YTAA 1HIAB 2A0QB 1M9UA 1PPBH 4E7RG 2R0KA 3RMLH 4AB8A 3RXDA 3TGIE 1TNGA 3SI3H 1THSH 3RM2H 3H7OA 1IAUA 4JCNA 1FI8A 1O36A 5AFZH 4AG2A 3GDVA 3F6UH 1O34A 2Y80A 2TRMA 3SZNA 1J8AA 3BIUH 1T7CA 3AAVA 1MU8B 1UHBA 1SGEE 2Z3CA 3BIVH 2JH6D 4M7GA 1LPGB 1KXDA 2BQWB 1ABJH 2ZHWH 1SGDE 1K1MA 2BDHA 4Y8ZA 1LHCH 3EA8A 4JZIA 4WJG2 4AGKA 1GGDB 1CA0B 1JWTA 3CS0A 2QCYA 2BY5X 2NU3E 2XBVA 3RXPA 4OS4A 2GKVE 2PKAA 5PTPA 2ZIQH 4ZUHA 4ZKOU 5B6OA 1QRWA 1TNLA 3M3TA 1P10A 2ZU1A 4X8TH 3NPSA 1P9UA 1NESE 1IQLA 2CJIA 1EP5A 2XCNA 5FXLA 1GHAF 2PUXB 1C2FA 5EQSA 3LJOA 1O2ZA 4FUCA 4KTCA 1ID5H 4FUJA 1GHZA 3PTBA 1MQ5A 1SL3A 1FQ3A 1E0FD 4BTIB 3PWCA 1W8BH 4H42U 4X6OA 1OYTH 1FDPA 5FCKA 1TNIA 2FI4E 3UREA 1SLWB 1C2HA 4AGJA 1F0SA 4I8HA 3K6ZA 1ELEE 1QL8A 2A1DB 3BTGE 1AZZA 1ELTA 1Z6EA 3T2NA 2QYIA 6LPRA 2G5NA 2J34A 1V6DA 4AYYB 3GCTF 1BA8B 1NFUA 2O9QA 1PQAA 3FP6E 2ZZUH 4MVNA 1TPAE 2ZDNA 3CENA 4E7NA 1O32A 3UPEA 2AIQA 4Y6DA 2F9PA 4LZ4B 3BTFE 1XUGA 3LONA 3ZZDA 1OP2A 2P95A 1EPTC 1EASA 4E06H 3TGKE 4SGAE 5C5NA 1GGDC 1CA0C 1HV7A 2R2MB 2QXHA 1SGFA 2HNTF 5CE1A 3F9GA 1O2YA 3Q76A 1P05A 2ZPRA 1E35B 1GMHG 2OD3B 2ZA5A 1GMCG 1QBVH 3UNSA 2TGAA 3PO1B 1VCPA 1ACBE 1C2MA 4INHA 5BPEA 2BVXH 1P8VC 5EGMA 3P95A 2NWNA 1GCDA 2AGGX 1O2PA 3GDSA 2OP9A 3NZIA 2ZFQH 2OINA 2KAIA 4TWYA 1XVOA 4NIVA 1P02A 5HYOA 1C1VH 1U6QA 2GCHG 5EPNA 2ZWLH 1C5QA 3QGNB 2C3SA 2C8XB 2ZCKP 2C93B 2FO9A 3UIRA 1B5GH 1O3KA 1TAWA 3GYMA 4HI3A 1TBZH 2XWBI 1SVPA 1UTMA 5EXLA 1LHDH 2H5CA 1ZRKA 3A8CA 3PYHA 1XMNB 2PTCE 3U1IB 1TRMA 4MQAA 2G8TA 2VIPA 1JIRA 1DLEA 1ANBA 1P2OA 3B9FH 3HK6B 1K2I1 1YCPM 1K1PA 2VWMA 2RCEA 4A92A 3LGWA 1FV9A 1C1NA 1F2SE 1C1WH 1V2NT 2ZGHA 5DPAA 1HPGA 1CHOG 2ZF0H 2BZ6H 1ESBA 3O8RA 1F0TA 2G52A 1YF4A 3SOSA 1CVWH 1DUAA 1HB0B 2SGQE 2PKSC 1LPKB 3E0NB 4K8YA 3M3SA 1HAHH 1KTSB 4XBDA 3DHKH 1GPZA 1EXFA 1ZTLA 3KL6A 2G4TA 5HM2A 3IITA 4AYVB 3EA9A 1ANDA 4KKDA 3RXMA 1DUEA 1UTPA 4XE4A 1AB9B 2BLWA 5LPEA 3SV7A 1HLTH 1NO9H 1GBBA 1HJ8A 1RD3B 3PO1C 5EW1H 4D7FA 2C8ZB 3SV6A 1ETSH 1UTQA 1IOEA 3MO9A 4Q7ZA 1PQ5A 3UOPA 5F6MA 1W3CA 1G32B 3D23A 1F0UA 1N8OB 2W5EA 4XBCA 2R3YA 2F9BH 1C5RA 1KLJH 2H9EH 3ENSB 4ISOA 1KXEA 1TALA 2WV4A 3LT3A 4O3UA 4UD9H 3RMMH 4H6SB 2I6QA 1FN6A 4TY6A 3M5LA 4OS5