5E0JA

1.20 a resolution structure of norovirus 3cl protease in complex with a triazole-based macrocyclic (21-mer) inhibitor
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
174
structure length
174
Chain Sequence
HAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLTGANAKGMDLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design and synthesis of triazole-based macrocyclic inhibitors of norovirus protease: Structural, biochemical, spectroscopic, and antiviral studies.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Protease/protease inhibitor
molecule keywords Norovirus 3C-like protease
total genus 36
structure length 174
sequence length 174
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5e0jA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5e0jA01
5BRRE 1SGYE 1FY1A 1ZPZA 3SI4H 2OQUA 1OS8A 2BOKA 1C1NA 3SW2B 1C2LA 4ISLA 2OC8A 4X8UH 3E91A 1YF4A 1HJ8A 2VIPA 2EI6A 3MO9A 1GBAA 2V0BA 1ZSLA 2GD4B 5A0BA 3MO3A 3PLBA 1INCA 4DOQA 1FAKH 2R3UA 1BITA 1K21H 1LKAA 1O2XA 3A8CA 3BTEE 1K22H 4X2XA 1GJ7B 1TGCA 4I32A 3NPSA 1FI8A 1KXCA 1P2JA 2W26A 3E16B 5G4BA 2ZU3A 3ZZ8A 2O8LA 4ABFA 1SLXB 4OS6A 3GYLB 1O0DH 1FNIA 3D65E 3LH1A 1C2JA 3KN2A 1SQTA 2AGIX 3ZVBA 2QCYA 3BEFB 1CO7E 3RU4D 2CHAC 2P95A 4MPWA 1P12E 1RJXB 1LHDH 3RXSA 4JZ1A 3QGNB 1XX9A 1SFIA 1HJAC 1YLDA 2A4QA 3SORA 2BVSH 2R0LA 1BRCE 3LJOA 2F9PA 3OX7U 2V35A 1WYKA 3BTWE 3M3SA 1MAYA 3MU8A 1FIWA 2ESTE 2WPIS 1KSNA 7GCHF 3E90B 2VWNA 1RFNA 2IN2A 1RIWB 4MNVA 3ZVFA 3F68H 5T6GA 2TGDA 1FONA 2VWLA 1H9LB 4X2YA 3UNQA 1P11E 2W7SA 1Z6EA 2QXHA 3HK6B 3M3VA 1FPCH 1V2TT 1O2PA 1P0SH 1WTGH 2V6NA 3OY5U 5EODA 1PQ8A 4ABEA 4CRBA 6CHAC 1AU8A 3B9FH 2G5NA 1O3AA 3ENSB 5DGJA 1TGSZ 1O2IA 3LKWA 4I8HA 2VVUA 2GMTC 3GCOA 1T8OA 1MH0A 2TGPZ 4YOIA 1O5AB 1ABJH 2XTTB 1FY8E 1AN1E 4DCDA 4HFPB 3ZVDA 4YO9A 2XWAA 4UONA 5HM9A 1XVMA 3W94A 1QL7A 2BQ7B 4MPVA 4ABAA 3E1XB 3F9EA 3ZZCA 8KME2 1V2KT 2Y5GA 1B7XB 1GJ5H 1ZHMA 2VVVA 1OPHB 1P02A 3MNSA 4Y6DA 4AYVB 2O9QA 2BY5X 2PFEA 3QDZB 3IITA 1FPHH 1C2IA 2BYAX 1KIGH 5PTPA 3TNTA 3CS7A 1CA8B 4AFQA 4HGCA 4X1RU 4NZLA 2HALA 4IC6A 4NGAH 1NRNH 3V12A 5JPMH 2JH5D 2XBYA 4K1TA 4WMEA 1GI7B 4X1NU 2ZU1A 1OYQA 1EX3A 6LPRA 1UCYK 3HK3B 1A5HA 1BMLA 2BLWA 3EE0B 3RMMH 1YPKH 1VITH 4JZIA 4RKJB 3V7TA 1C5UA 2AERH 3HGNA 4BTTB 2FO9A 1O2HA 1EASA 4FU9A 3PROA 2ZC9H 5E0JA 1O5FH 3EAJA 3RU4T 3BN9A 2OD3B 1TX6A 1ID5H 1SGTA 2BDCA 2ZQ2A 2SGPE 2FOHA 1AFEH 4LZ1H 2ZGBH 1QURH 1YCPH 1Y3WA 3MHWU 1P03A 1QA7A 1ESBA 2F91A 5EOKA 4OGYA 3U8OH 1O2VA 2ZG0H 1G2LA 1BOQA 4A1TA 1YPJH 1C2DA 5AF9H 2ANYA 3BTHE 1S81A 1TLDA 1NROH 1C2EA 1VCQA 3P92A 4YLQH 3BTKE 2Y7XA 1GJCB 1C5OH 1MU8B 4M7GA 2ZDMA 3MFJA 1CU1A 3DUXH 1W12U 4F49A 4GPGA 1ARBA 2LPRA 1PPZA 3UY9A 1YKTA 3GY5A 2G4TA 1RTFB 2ALPA 4AFSA 1V2VT 4CHAB 2BY6X 4FU8A 2HVXA 1UTMA 4OS2A 3MH5A 1BJVA 1CBWB 1HIAA 1E36B 4NCYA 1PPHE 2ODYB 2SGEE 1C1RA 1W0ZU 1P3CA 4KP0A 1MTVA 1GG6B 4AG2A 1EAWA 2ZWLH 3U8RH 3STIA 1SFQB 1BA8B 1NESE 1TQ7B 4GHTA 2WYJA 3SNEA 1VITF 1BRAA 2CXVA 2R2MB 1O3MA 2PKSB 1EJNA 3A82A 3H7OA 2A5KA 2SFAA 3P95A 4OS5A 1Z6JH 3RU4E 4X1QU 2AIPA 4KKDA 1IHTH 3UWIA 3S69A 4DT7B 3QTVH 3M7QA 4THNH 2PUXB 1TRMA 2HNTC 1TPOA 1SC8U 1ZJDA 3RMNH 1GDNA 2ILNA 2K1QA 5HMAA 1P9SA 1TNIA 1KLJH 2C8XB 1C1TA 2A4GA 1ZRKA 4YZUA 1SGFG 1QFKH 3MMGA 4WXVA 5GDSH 1J9CH 1JMOH 3NWUA 2A5AA 1RXPA 3RXCA 1FIZA 2Y81A 5B6OA 2AS9A 2O8TA 1PQAA 2SNWA 1S83A 1XUGA 1P9UA 3AAVA 3A8DA 3H7TA 3PLKA 3SHAH 7ESTE 2A45B 1A2CH 4I8KA 1PYTD 4CR5A 3NUMA 4J1YA 4FXGH 2NU2E 4YT7H 1ZTLA 1O5BB 1SLWB 1D6RA 1ELTA 3ZVGA 4FUBA 1PJPA 1ZMLA 2VIQA 1NFYA 1GI9B 3LJJA 1FY3A 2Z9JA 3LGVA 5A0AE 4ABBA 1EAUA 5E2OA 3DHKH 3ZZDA 1HJ9A 1TGBA 3MH7A 2FIRH 1SGCA 1ZOMA 1GHWH 3B23B 4K5ZA 3D62A 1EPTC 5LPEA 5K0HA 1LQEA 1AE5A 1MTNC 3M37A 1GVKB 1G3DA 2FOBA 2Y80A 1UTJA 1QBOA 1BJUA 1QA0A 2KAIB 1G3BA 1AVXA 3QZQA 4A6LA 2PGBB 2I6QA 3ZZ6A 3URCA 1DLKB 3SU1A 1AB9B 2WINI 3KCGH 2ZHQH 1VZQH 3F9FA 1C5SA 2DUCA 1O33A 5AFZH 1QIXB 2EI7A 1GJAB 2QN5T 3K6ZA 5BPEA 3U1IB 1ZPBA 3AASA 2JH0D 1T7CA 4XBDA 4A92A 3PV4A 4WMDA 3RC5A 1TAWA 1C1WH 4BOHA 2OC7A 4U32A 1DUAA 3QO6A 1L4DA 1BDAA 2C8ZB 4UFEH 2QIQA 1KLTA 3BTFE 3K9XB 5C1XA 2GT8A 2NU0E 3Q76A 2XW9A 4NZQA 5DP9A 2FZZA 4ABDA 1TRNA 1NU9A 1O2GH 1HFDA 3KHVA 4ABGA 1ZSKA 1THSH 1ELBA 4B76A 1V3XA 1D6WA 3TGIE 4GHQA 1EP6A 1O3GA 5EQQA 4DY7B 3GCTG 4NA8A 1QB9A 2AMQA 1YBWA 2SGFE 1J8AA 4D9RA 2FOGA 1MTSA 1GI0A 2PSXA 1GHXH 2PLXA 1UCYE 8ESTE 1WQVH 4D7FA 1D4PB 1C1UH 1U6QA 1LKBA 3UOPA 2EEKA 5EPNA 2BX3A 2UUJB 1XXFA 1GJ8B 1E37B 1CT4E 1ELAA 1AZZA 1NY22 1C4U2 1L2EA 1KXDA 1TYNA 3FP6E 2QXGA 1TNLA 2ZDNA 2BD9A 2Z3CA 2J4IA 4RKOB 4ZUHA 4D9QA 3P8GA 4Y76A 3TLOA 1PPGE 3PTNA 4OS4A 2G00A 1ZYOA 1VCPA 2GCTC 2VIWA 1HLTH 1EPTA 2OBQA 3ZVAA 1E38B 1G36A 2LNCA 3RLYH 3VPKA 1CGIE 1H8DH 1OP2A 3P70B 3RXUA 2SNVA 3RXAA 2FYQA 3SV6A 1O2LA 4AGKA 1S84A 3KQCA 1HAHH 1FUJA 1EAXA 2HLCA 2TPIZ 1IQGA 2FMJA 4SGAE 2BM2A 1AFQB 3GICB 1KY9A 1TPAE 1LTOA 2VU8E 1EXFA 3M7UA 3RXIA 1HAIH 5HM2A 1K1OA 3HKJB 2GVFA 3SN8A 1P2KA 1DX5M 5C2ZA 1GBMA 1AWHB 1THRH 4IS5A 4BANB 1H4WA 2P16A 1TB6H 2QV1A 1G2MA 4I8GA 1QRXA 2ZHWH 1F5RA 1O32A 3JZ1B 7LPRA 2VH6A 1NFWA 4H6TA 2TGAA 3NCLA 2R9PA 4JYTA 1GHYH 1C5PA 1C5MD 1GVZA 1OSSA 1Y3UA 1Z8JB 3BV9B 1Z7KA 3SOSA 1O3HA 1ACBE 1QL9A 4Q80A 1DWBH 4JK5A 3LDXH 1O2WA 4RN6A 1LPZB 2BOHB 1F0SA 3P17H 1A5IA 3IG6B 2A5IA 2BD8A 3TH2H 1HBTH 1SLVB 4ISNA 1QCPA 3UUZA 1NZQH 3U69H 1BMMH 2C93B 6ESTA 2Z6BD 5DJ7A 3W95A 4JZFH 1XKAC 3LPRA 2WV4A 1MCTA 1OP8A 1BRUP 2OUAA 3RXHA 2C4FH 4O3UA 2ZF0H 1O3NA 5L2YH 4IMQA 2GDEH 1S5SA 1C2FA 1LDTT 1Z1JA 3LC3A 4X1SU 3H5CB 1GG6C 3GCHC 4I8JA 2XXLA 1HAVA 3RXMA 1BMAA 1EZSC 3SJ9A 1QR3E 4KTUA 1SGEE 1BT7A 3GCNA 3KNXA 3C27B 3TH4H 3JZ2B 3UQVA 4I33A 1Y3VA 2A7JA 4CHAC 1IQLA 4NIYA 2BY8X 4B1TA 2WYGA 1E34B 2J95A 1P2IA 3A7WA 3TK5A 3ZZ9A 2AGEX 4X1PU 3RXOA 2OLGA 4TPYA 3GY2A 1O3PB 2ODPA 1TNJA 6GCHF 1TNGA 4WVPE 1NO9H 1JRSA 3EA8A 1AY6H 4A5TS 1A5GH 1GMDF 4ZHAA 1CT2E 1AE8H 1AFQC 1H8IH 2FOMB 1C9TA 1HGTH 2A4OA 2NWNA 4LOYH 2ZFQH 1T4VH 2FX6A 3FP7E 1UO6A 5T6FA 3RC6A 4LK4A 4YTAA 4R0IA 3SHCH 2BTCE 1V2MT 1NM6A 1Z8IB 1ANCA 3LGYA 4HI3A 3TJUA 1IQJA 5FPSA 5ESTE 3BTGE 1TALA 4FUGA 1GL1A 1FQ3A 5IDKA 3OU0A 4FVBA 2RDLA 1C1OA 2A4RA 2SGAA 3SV8A 4DG4A 1J17T 1GBLA 3AW0A 1TFXA 4OS1A 1OP0A 1EAIA 3M5OA 4WMFA 2ZGXH 4Q7ZA 3LIWA 1GI5A 1JOUB 1RS0A 4D8NA 1TMTH 2BD4A 2Z94A 1ZLRA 2ZO3H 2ZGJA 4JZDH 3T26A 1A3EH 4AB8A 2AIQA 5EPYA 3A7VA 1KTTB 1DWDH 4DJZB 1GDQA 1SQOA 2Y6TA 2B7DH 3VGCC 3LGWA 3LOXA 4PROA 1O2OA 2Q6GA 5FCKA 3SNBA 4Q7YA 4Q7XA 3A8BA 4IMZA 1O5DH 1LVBA 3MTYA 1ZHPA 2UUFB 1Z1IA 2PHBA 1DANH 3SU2A 4DVAU 1ZZZA 2FYRA 1D3TB 3FP8E 4ZAEA 3SV9A 1A4WH 2PWXA 4O03A 4YESB 3NZIA 3BSQA 3SQHE 3MWIU 1QGFA 3SUDA 2FOFA 3RXKA 7GCHG 5ESBA 3RXEA 1V2ST 3I77A 5JBBS 1E35B 1NS3A 2CF9H 3ZV9A 4X6MA 5EG4A 2FTLE 1CHOF 1P10A 1QBNA 2WPMS 1QJ1B 1BBRK 3KF2A 2D1JA 4X8VH 5JB8S 4FUEA 3FAOA 3ZZ7A 1GI6A 3SU5A 2CV3A 4A1XA 1F92A 2PW8H 4BNRA 1HXFH 2KAIA 5E0GA 1UVOA 3D23A 2YNBA 1KLIH 3TK6A 5J4QA 2WPHS 2J2UA 1SGNE 4ZMAH 3VFEA 3K65B 1BMNH 1DXPA 1SVPA 3MH6A 1AKSB 1DM4B 2FPZA 1QNJA 2BHGA 2CMYA 1OWJA 2BZ6H 4K8YA 5F8ZA 1EQ9A 2VH0A 1V2RT 2ZZUH 2HRVA 3V3MA 1CVWH 3LT3A 1MBQA 3BG4B 4XSKU 5EGMA 1GBKA 1KXAA 4MDSA 1V2WT 1DY9A 3WY8A 1K28D 4YM9A 1G3EA 1FN6A 5L6NH 3RMOH 1IOEA 1P01A 2ZEBA 4AX9H 3P8OA 4MQAA 2ASUB 4ZKSU 1LO6A 1YCPM 1EZUC 3SUGA 2J38A 4ZKNU 3A8AA 1AI8H 2OQ5A 1AKSA 1Q3XA 1ELGA 4YT6H 3RMLH 3GDUA 1P2OA 2TRMA 2UWLA 4UDWH 1AUJA 3STJA 2ZFPH 2QY0B 1GI3A 4NWKA 1O35A 3TPIZ 3RXVA 1CA0C 5A8XA 2OXSA 1XM1A 4ZHLU 2FTMA 2FOEA 2G55A 1TONA 1BHXF 1H9IE 1GMDG 1C1VH 3CS0A 3SBKA 3UWJH 5L30H 2Q6FA 1C1MA 2O8UA 3PWCA 2CJIA 1W13U 1O39A 1GBDA 3I78A 1BQYA 3HPTB 4Y8XA 2WPJS 1UVSH 1WU1A 1FN8A 1VJ9U 4MTBA 1QL8A 2Z3EA 1MTWA 1HUTH 3KGPA 1S0QA 1Z8RA 5I25A 3SU6A 4AGJA 3SGBE 1THPB 1GHAF 2PKAA 5JB9S 3TJVA 3E8LA 1H1BA 1K1JA 1UHBB 3LGIA 1TBZH 4FUHA 1TABE 4UFFH 3AAUA 4NSVA 1L1NA 3MNBA 5C1UA 1HAYB 1QB1A 2GCTB 1TPPA 3PO1C 4SGBE 1K1PA 1ZGIA 2HGTH 1SBWA 2H2ZA 5TCCA 1AGJA 1LQDB 4Y11E 1O3KA 5FPTA 1ARCA 1KYNA 1O2YA 4Z0KA 1A61H 4FUIA 1O3BA 2XC4A 3M7TA 1HAVB 1FXYA 1UVTH 2JH6D 1DDJA 1J14A 3A81A 1GHAG 1ABIH 1LHGH 4J2YB 1GHVH 3RXTA 1SGQE 3D49H 2BDBA 3PM3A 2A31A 5A8ZA 5GIBA 1O3OA 4A7IB 3E0PB 3T25A 1NRSH 4TPIZ 2ZIQH 1UTKA 3CENA 1NFXA 1X7AC 2SGQE 1F5KU 2BD2A 3EA9A 2ANMH 2QC2A 2BXUH 4XDEA 4Y10E 3E6PH 3GISB 1SB1H 3GCHB 4BAHB 3O8CA 5TCAA 1Y5UT 2JKHA 4X2VA 1MU6B 2B8OH 1E0FD 2GTBA 1B0FA 2J94A 1ZR0A 2G81E 2BX4A 1V2OT 1SLUB 2FX4A 3GY8A 5DKMA 5T3HA 4Y7BA 1SGIB 1QQUA 1DUEA 2P8OB 3SU3A 1LCYA 5T6DA 2WUCA 1V2QT 4ASHA 2H1UA 3U98H 1F0RA 1DLEA 1O3LA 1SGPE 2H5DA 5DG6A 4X8SH 1FZZA 3BG8A 3O8DA 5GJ4B 2D26C 1MBMA 2B5TB 3GYMA 1T8NA 2BMGB 2CN0H 2G51A 1ELVA 1EOJA 1DWEH 4BXWA 3QK1A 3BTQE 3EGKH 1CGJE 2ZDLA 1IQIA 4MVNA 1HJAB 2SGDE 1QTFA 4F4OC 3FANA 1ORFA 1P2QA 5AVDA 1SSXA 3HKIB 2D2DA 1YGCH 1IQKA 1HAXB 2ZFTA 3VB7A 3BTME 3MO6A 1BZXE 4CH8B 1BCUH 2Z7FE 3L3TA 3ATWA 1RTLA 2UUKB 3SUFA 1C1PA 1EKBB 1O5EH 2ZHDA 4WWYA 1C5NH 5FBEA 4ZROA 6GCHG 4KGAA 1S85A 3TJOA 5DP8A 1C5ZB 4K69A 4IN2A 1XUKA 1Y5AT 1EPTB 1ETTH 3SUEA 1O3IA 1D9IA 4AN7A 1MZDA 1ZRBA 1O2RA 2P93A 2ZU2A 1GBIA 1QHRB 3S9BA 1EZXC 2ZCLP 1CHOG 1XUFA 1ZHRA 1LHFH 2JETB 3ODFA 5FPYA 2FEQH 3BTTE 2BB4A 1TGNA 4IN1A 1DWCH 3URDA 3A86A 2V3HH 2BD7A 1O36A 3A7TA 3DD2H 4OGXA 2VGCB 1K1IA 3SO3A 2PTCE 3RXPA 3FVFB 2ZA5A 1TX7A 4B75A 3S0NA 2HWLB 4D7GA 3NXPA 2Z9LA 1CSOE 3ATIA 1P06A 1O5GH 4U2WA 2QYIA 2A2XH 5F6MA 4NFEA 4YLUA 1MKWH 3RXGA 1ANDA 1LMWB 2XWBI 1BTZA 4ISHH 5FXLA 1GI1A 4O3TA 2RA0A 2P8OC 1AD8H 3B8JA 3A83A 1AQ7A 4IGDA 5HGGA 5EU8A 1YLCA 3S7KB 2G4UA 2Z9KA 3LU9B 1O2QA 2GDDA 1GJ9B 1MD7A 1O38A 1OYTH 1Y3XA 1CBWC 1YPHE 3SJ8A 3ZYEA 4WH8A 2GKVE 3KIDU 1GBBA 1HB0B 3U9AH 4BAQB 1ZMJA 2Y5HA 1W3CA 3PB1E 4GCHG 2F9NA 2J9NA 2AGGX 3KQEA 3NK8A 2ZPSA 4AYYB 1FY4A 1AZ8A 4MNXA 3MU4A 4GUXA 2HPQH 2GZ7A 2VNTA 2FXRA 4X6PA 4FUJA 1C5LH 1CT0E 4E7RG 1HIAB 1GBTA 1ZTKA 4DGJA 1C5TA 1TNKA 1ANEA 3DFJA 5FX6A 4NA9H 1GCTB 2BZAA 3TITA 1KDQA 4XE4A 3G01A 3ZV8A 2ZHEH 3MI4A 1SQAA 1W14U 3OTJE 3KQBA 2STBE 1O2MA 1PPBH 4IC5A 1HAGE 1L1GA 1AWFH 5FX5A 4DURA 1G30B 1GMHF 5EQRA 3QUMP 4B2BA 1K1NA 4ZXYH 5SGAE 1GL0E 2OINA 1GJDB 3PLPA 2PTNA 2ZDVH 2FS8A 1CGHA 4MNWA 4ZHMU 1GGDB 1SG8B 5JBAS 1G3CA 4CH2B 1A46H 2C8YB 1XUJA 8GCHF 1YCPK 2C90B 1UTNA 2A32A 1C5YB 2GZ8A 3SV7A 3MU1A 4INKA 3UNSA 1MKXK 1HV7A 5J4SA 3CP7A 1GMCF 3PMHB 1HYLA 1SL3A 1GI8B 3C1KA 3GDSA 4O97A 1OWIA 2Z3DA 3SV2H 3O8BA 1IQEA 1WOFA 1K2I1 4NFFA 1T8MA 1VGCB 3DFLA 3OYPA 3M61U 1Y3YA 1L4ZA 1D3PB 4VGCB 1EJAA 1LVMA 1L1JA 1C1SA 1PYTC 2W5EA 4H42U 5C20A 4UD9H 1TGTA 1A0HB 8LPRA 4K2YA 3PMBB 1FAXA 1DVAH 3M36A 4K1SA 1VGCC 3E0NB 1GBCA 2R2WU 3TNSA 1O30A 1V2JT 1GBJA 3EA7A 2XYAA 1DFPA 1MUEB 4UE7H 3QWCH 1EB2A 1ETRH 2FI5E 1N8OB 3BIUH 4NIWA 1TQ0B 5CHAC 4NIXA 1JIMA 3UIRA 1PPFE 2QGRA 3UR9A 4AB9A 4DIHH 3ZZ3A 1WUNH 1BTWA 4JYUH 1GJBB 3GCTF 1GMHG 2UWOA 2VIOA 3RUOA 5L2ZH 1P2MA 4HZHA 5C5OA 3GY6A 3SU4A 1FY5A 3ODDA 3SNAA 1NRPH 1SOTA 4A1VA 2AMPA 1A3BH 1P3EA 3T5FH 4B73A 1UMAH 1ZPCA 5JBTA 2B9LA 5DPAA 1SPJA 1QY6A 4ESTE 3SQEE 1ZGVA 4KTSA 1ELEE 4YOJA 3Q3KA 2FOAA 1GJ6A 4FUDA 1XUHA 3TGKE 8GCHG 2G5VA 1SGFA 1EUFA 1N6XA 1T32A 1GBFA 1NFUA 2PGQB 1ETSH 1FDPA 5DP7A 2GX4A 3GY3A 4K8BA 5K7RA 3Q00A 2BD3A 5EW2H 1TWXB 2I6SA 4X8TH 1QRZA 2ZFFH 3R3GB 4X6NA 4H6SB 4B2AA 1LVYA 2PSYA 2XCNA 3RXJA 4IW4E 3TH3H 3SJIA 1GI2A 1YPHC 2HNTF 1ZMNA 3GOVB 3M35A 1TIOA 1RGQA 1C4Y2 1FLEE 2BDAA 4JK6A 1FJSA 2FDAA 3KL6A 2Q6DA 2W7UA 2F9UA 2XC0A 3K2UA 2FM2A 1NT1A 4YOGA 1C5RA 2GT7A 3RXRA 3SZNA 1KDQB 4LZ4B 4WXIA 3O8RA 1P05A 4TY6A 3UOUA 2VIVA 4ZH8A 4Y8YA 4BAKB 1KTSB 1C5VA 2FS9A 2W3IA 2GV6A 1D3DB 3R0FA 2ZFRH 1O2TA 1LHEH 2YNAA 2EI8A 4WY3A 1O2SA 3EYDA 4CRAA 3ZZ5A 5HYOA 1W10U 4IBLH 1V2PT 5GCHG 2P94A 2D8WA 3S9CA 4BXSA 1DE7H 1LVOA 3VXEH 4FU7A 2UWPA 5FCRA 3ATLA 1P09A 2GMTB 2Q1JA 2ANWA 1AO5A 2VB0A 4WF8A 1YM0A 4WH6A 2WPLS 3KEEA 5H4IB 5AHGH 9ESTA 1BUIA 1T31A 4I7YH 1C5QA 1CHGA 2ZP0H 2RG3A 3EDXB 3UFAA 4MPUA 1OWEA 1W7XH 2WUBA 5DK1A 1TOCB 1TMUH 1F0TA 3RM0H 1KXEA 5GPIB 3P8FA 5C1YA 2GCHF 1J16A 2H9EH 1GBEA 4R8TB 1QQ4A 3HATH 3PWBA 2QF0A 3ZZBA 4WJG2 1W2KH 4AOQA 2F9BH 2F83A 2ZCKP 1MKXH 3BEUA 5LPFA 1HNEE 1XVOA 1ESTA 5F8TA 5LH8A 5F03A 1GDUA 4GCHF 1YPEH 4U30A 2FP7B 4MG3A 1MMJN 3RM2H 2TGTA 1Z71A 4Y71A 3T2NA 2OTVA 4NG9H 3A89A 1F7ZA 2QA9E 1A0LA 1MTNB 1PQ7A 7KMEH 1EB1H 1N6YA 1WSSH 2FI4E 3MU0A 1WQSA 4ABJA 2P3FH 1OX1A 3RC4A 4Y0ZE 3GY7A 1CQQA 1O3FA 3ITIA 1LPKB 4ISIH 1MQ5A 1TNHA 2BDIA 1GJ4H 2HNTE 1TBRH 3L6PA 1YPLH 1SOZA 1YP9A 4CR9A 1RRKA 2Y5FA 1IQFA 1V2UT 1YPGH 3ATKA 4VGCC 4GAWA 1EP5A 2VWMA 3T27A 3QTOH 6CHAB 2Y82A 3DA9B 5E8EH 5EXLA 3A84A 2AH4X 2O8MA 1G37A 2ZHFH 4TWYA 2RCEA 1IQHA 3AW1A 1NN6A 1EATA 1ZTJA 4Y79A 2BVRH 3L33A 1TPSA 5DO4H 1IQNA 4ISOA 1TBQH 3QGJA 1T8LA 3EQ0H 2ZDKA 2VIDA 3OY6U 1UK2A 1A7SA 1S6HA 3K6YA 4MNYA 1CA0B 1QJ7B 2BVXH 3M5MA 2CHAB 1NU7B 3F1SB 4NSYA 5IYTA 3BEIB 4Z6AH 3ELAH 2EA3A 1G32B 1DY8A 2YOLA 3VGCB 2F9VA 2QXIA 2EC9H 1SMFE 1O5CB 2WV5A 3GY4A 1JRTA 1ELCA 2OC0A 1AUTC 2VGCC 5I46H 1BTPA 1UHBA 3T62A 4NA7A 5E2PA 2FLBH 1N8OC 1YPMH 2O8WA 2ZTYA 4CREA 5C5NA 3MOCA 1C2KA 1O34A 1W0YH 4TWWA 2OCVB 1W7GH 2G52A 1EJMA 4JZEH 1Y5BT 1GGDC 2ZU5A 2R3YA 2AMDA 3SU0A 1C2HA 5CE1A 1J15A 2BLVA 1GCDA 4CBNA 3SNCA 2H6MA 1C2GA 1JXPA 1GPZA 1BBRH 1DS2E 2QF3A 1NRRH 1QBVH 2H9HA 3AVZA 5DP5A 1VJAU 1W11U 3PMAB 1GI4A 3BG4C 3TU7H 1C5WB 1GHZA 1FMGA 2VVCA 1ZSJA 3UPEA 1UTPA 2XBWA 4K1EA 2BLQA 2ZCHP 1O2ZA 3F6UH 1O31A 3TVJB 1KXBA 1VR1H 4DIIH 5CMXH 2FODA 2XRCA 2DE8A 3IWMA 5EQSA 2FESH 1B0EA 4CRFA 4DW2U 3VB4A 3VXFH 1BBRE 3QZRA 1HPGA 2A0QB 2PKAB 2Z9IA 3PYHA 1GMCG 2BY9X 4KTCA 2A7HA 2C3SA 4INLA 5GXPA 2A2QH 3SI3H 3VB6A 4BTUB 4B74A 1L0ZA 1F5LA 1HAZB 2FWWA 2ZTXA 1AB9C 5F8XA 2IOTA 5HXFA 1ANBA 2STAE 1Y59T 3PMJA 1O2UA 1SGDE 3A7YA 3QLPH 3BTDE 5LPRA 3ATMA 3I29A 2V3OH 1IHSH 1K1LA 1TE0A 1Y8TA 1NC6A 2FI3E 3M5LA 4GVUA 5GCHF 3VEQB 1GWAA 1BIOA 2ZI2H 5JBCS 5EXMA 1CE5A 1BB0B 2BY7X 1WAYB 1S82A 2PUQH 2XBVA 2PV9B 1NRQH 1O37A 1SGRE 4E06H 1C1QA 1HXEH 1UK3A 1W8BH 1HAOH 3U8TH 1C5XB 2P3TB 2XNIA 5DP4A 5EXNA 4XOJA 3T28A 4Q2KA 2VJ1A 5DP3A 2ZECA 1RTKA 4XBBA 2BQWB 4INHA 3LONA 4X0WU 2XCFA 1TRYA 1GVLA 1DPOA 2ULLA 4JMYA 3PO1B 1EZQA 1OWDA 1XUIA 3KQDA 1RIWC 1XMNB 2GCHG 3TGJE 1UCYH 1HRTH 4FUCA 3RXDA 1TMBH 1YYY1 4UFGH 3T29A 2AFQB 2P59A 2ZPRA 1F0UA 4XFQA 3ZVEA 5LGOA 3SGAE 1C2MA 3U1JB 1O3CA 1S0RA 1DOJA 1MKWK 2XC5A 2CF8H 4B71A 3SNDA 4E05H 1UK4A 4AFZA 1F2SE 3F9GA 3S7HB 4H4FA 1GHBF 3N7OA 4ZKRU 2ZQ1A 1O3JA 1WV7H 1P2NA 4I8LA 2C8WB 1KXFA 2FLRH 4HTCH 3ZYDA 2Z9GA 4UFDH 2GP9B 2Y7ZA 3A7ZA 1T4UH 2IJOB 4ABHA 5C67A 1Z8GA 1JIRA 4XBCA 1SI5H 1BTXA 2PR3A 4GSOA 4LXBH 4K60A 1MAXA 1A0JA 2VWOA 1PPEE 2TBSA 2BLOA 3DT0H 1V2NT 4CBOA 3MH4A 2AEIH 2GZ9A 2ZU4A 1O3EA 1UTQA 3PTBA 1RD3B 1ZJKA 1UJ1A 3BF6H 4TYDA 5AFYH 1DITH 1OKXA 3SJOA 4E7NA 2M5TA 1MQ6A 1G9IE 1BHXB 3TIUA 1UTLM 3ZVCA 2J34A 4FUFA 1NTPA 5C3NA 1BTUA 1YC0A 4Y8ZA 1AVGH 2JETC 4AORA 2G8TA 3UREA 1MCVA 4U01A 5TJXA 1SHYA 3UNRA 1FV9A 1UVPA 2ZTZA 2FOCA 3A80A 5A09A 4UEHH 1Q31A 3P8NA 2BDYA 5ETXA 1C4V2 3TJNA 1V6DA 2CGAA 4Y7AA 2ZKSA 1HDTH 2F9OA 5A0CA 1ESAA 1UTOA 1MTUA 1WCZA 3RP2A 4ABIA 3F9HA 3QX5H 3ZZAA 1MZAA 4MLFB 4JCNA 1DSUA 2DE9A 3Q77A 3RXFA 2ZNKH 1TA2A 4X6OA 3ZZ4A 4ZXXH 3UR6A 2BQ6B 2A7CA 1QJ6B 4AZ2B 2NU1E 2ZFSA 3RXBA 1N1LA 4D76A 1QRWA 1O2JA 3MU5A 5FHTA 3E3TA 1K9OE 2W3KA 3A88A 3BIVH 3S9AA 2QAAA 1VITG 1VCWA 4MPXA 2ZPQA 4CRCA 5ABWA 3SJKA 2PKSC 1BTHH 2NU3E 1NPMA 1M9UA 3M3TA 1GBHA 3UTUH 2BD5A 2BDGA 1TOMH 1UVUH 1V2LT 2IPHA 4B2CA 2BDHA 2HOBA 1EOLA 1S6FA 5A8YA 3GDVA 3LGTA 1DICA 4TY7A 5E0HA 3VB3A 2ZGHA 5JDUB 2OC1A 3RLWH 4O9VA 9LPRA 3LH3A 1TA6A 2GV7A 4QT8C 3ESTA 1O2KA 3A7XA 3UQOA 2HPPH 3A87A 3SGQE 1SHHB 5FBIA 3V13A 1DXWA 1OWHA 2H9TH 1P8VC 1IAUA 1XXDA 1HCGA 3LC5A 5FAHA 3FZDA 2ANKH 3RDZA 2XBXA 4NIVA 4AG1A 4CRGA 2ZGCA 3Q3XA 5GWZA 2GGVB 5DP6A 3MYWA 1TX8A 3V0XA 4RSPA 2ODQA 1Q2WA 1MD8A 2A1DB 4BTIB 2QXJA 1C9PA 4I31A 1WBGB 3M5NA 1AIXH 1PQ5A 1AVWA 2OBOA 1OXGA 2H5CA 4X2WA 4AFUA 1DSTA 2BXTH 3QN7A 1GCTC 4BAOB 4JYVH 4GLYA 2AYWA 4CRDA 1AHTH 1ELFA 5A2MH 3OSYA 4OS7A 4K3JA 1AMHA 4BAMB 4ZKOU 1O3DA 4KELA 1H9HE 2THFB 2VINA 1SR5C 3NKKA 2ZDAH 3A85A 3TK9A 3VB5A 1BRBE 3MNCA 1JWTA 1WTHD 1DT2A 1A1RA 2R0KA 1OWKA 1P57B 1JBUH 1XKBC 3FFGA 3MNXA 1K1MA 5JYIA 4FVDA 1O2NA 3FZZA 2P3UB 4Y0YE 2ALVA 2OP9A 2J92A 1QB6A 2UUYA 3Q3YA 1GHBG 3RXQA 1ELDE 5EW1H 1OOKB 1PPCE 2TIOA 1P04A 1BTYA 2RA3A 2F3CE 2NU4E 1LHCH 1LPGB 1PFXC 2B0FA 2WPKS 3HGPA 3LGUA 5CHAB 3RXLA 1B5GH 1D3QB 4NWLA 1IQMA 1HAPH 3P6ZB
chains in the Genus database with same CATH superfamily
5BRRE 3F3BA 1SGYE 1FY1A 1ZPZA 2HLDD 3SI4H 2OQUA 1OS8A 2BOKA 1C1NA 3SW2B 1C2LA 4ISLA 2OC8A 4X8UH 3E91A 1YF4A 1HJ8A 2VIPA 2EI6A 3MO9A 1GBAA 2V0BA 1ZSLA 2GD4B 5A0BA 3MO3A 3PLBA 1INCA 4DOQA 1FAKH 2HVYB 2R3UA 1BITA 2L74A 1K21H 1LKAA 1O2XA 3A8CA 3BTEE 1K22H 4X2XA 1GJ7B 1TGCA 4I32A 3NPSA 1FI8A 1KXCA 1P2JA 2W26A 3E16B 5G4BA 2ZU3A 3ZZ8A 2O8LA 4ABFA 1SLXB 3KYGA 4OS6A 3GYLB 1O0DH 1FNIA 3D65E 3LH1A 1C2JA 3KN2A 1SQTA 2AGIX 3ZVBA 2QCYA 3BEFB 1CO7E 3RU4D 2QE7D 2CHAC 2P95A 4MPWA 1P12E 1RJXB 1LHDH 3RXSA 4JZ1A 3QGNB 1XX9A 1SFIA 1HJAC 1YLDA 2A4QA 3SORA 2KM0A 2BVSH 2R0LA 1BRCE 3LJOA 2F9PA 3OX7U 2V35A 1WYKA 3BTWE 3M3SA 1MAYA 3F2FA 3MU8A 1FIWA 2ESTE 2WPIS 1KSNA 7GCHF 3E90B 2VWNA 1RFNA 2IN2A 1RIWB 4MNVA 3ZVFA 3F68H 5T6GA 2TGDA 1FONA 2VWLA 1H9LB 4X2YA 3UNQA 1P11E 2W7SA 1Z6EA 2QXHA 3HK6B 3M3VA 1FPCH 1V2TT 1O2PA 1P0SH 1WTGH 2V6NA 2K8IA 3OY5U 1PQ8A 5EODA 4ABEA 4CRBA 6CHAC 1AU8A 3B9FH 2G5NA 5CDFE 1O3AA 3ENSB 5DGJA 5KECA 1TGSZ 1O2IA 3LKWA 4I8HA 1SQRA 2VVUA 2GMTC 3GCOA 1T8OA 1MH0A 2TGPZ 4YOIA 1O5AB 1ABJH 2XTTB 1FY8E 1AN1E 4DCDA 5C94A 4ACBA 4P02A 4HFPB 3ZVDA 4YO9A 2XWAA 4UONA 1COWD 5HM9A 5KGOA 1XVMA 3W94A 1QL7A 2BQ7B 4MPVA 4ABAA 3E1XB 3F9EA 3ZZCA 8KME2 1V2KT 2Y5GA 1B7XB 1GJ5H 1ZHMA 2VVVA 1OPHB 1P02A 3MNSA 4Y6DA 4AYVB 2O9QA 2BY5X 2PFEA 3QDZB 4ACAA 3IITA 1FPHH 1C2IA 2BYAX 2J98A 1KIGH 5PTPA 3TNTA 3CS7A 1CA8B 4AFQA 4HGCA 4X1RU 4NZLA 1QZ8A 2HALA 4IC6A 4NGAH 1NRNH 4AC9A 3V12A 5JPMH 2JH5D 1YY3A 2XBYA 4K1TA 4WMEA 1GI7B 4X1NU 2ZU1A 1OYQA 1EX3A 6LPRA 1UCYK 3HK3B 1A5HA 1BMLA 2BLWA 3EE0B 3RMMH 1YPKH 1VITH 4JZIA 4RKJB 3MQKC 3V7TA 1C5UA 2AERH 3HGNA 4BTTB 2FO9A 1O2HA 1EASA 4FU9A 3PROA 2ZC9H 5E0JA 1O5FH 3EAJA 3RU4T 3BN9A 2OD3B 1TX6A 1ID5H 1SGTA 2BDCA 2ZQ2A 2SGPE 2FOHA 1AFEH 4LZ1H 2WHXA 2ZGBH 1S6LA 4M9FA 1QURH 1UW7A 1YCPH 1Y3WA 3MHWU 1P03A 1QA7A 1ESBA 2F91A 5EOKA 4OGYA 3U8OH 1O2VA 2ZG0H 1G2LA 1BOQA 4A1TA 1YPJH 1C2DA 5AF9H 3N99A 2ANYA 3BTHE 1S81A 1TLDA 1NROH 1C2EA 5EJ1A 1VCQA 3P92A 4YLQH 3BTKE 2Y7XA 1GJCB 1W0KD 1C5OH 1MU8B 4M7GA 2ZDMA 3MFJA 1CU1A 3DUXH 1W12U 4F49A 4GPGA 1ARBA 2LPRA 1PPZA 3UY9A 1YKTA 3GY5A 2G4TA 1RTFB 2ALPA 4AFSA 1V2VT 4CHAB 2BY6X 4FU8A 2HVXA 1UTMA 4OS2A 3MH5A 1BJVA 1CBWB 1HIAA 1E36B 4NCYA 1PPHE 2ODYB 2SGEE 4FOUC 1C1RA 1W0ZU 1P3CA 4KP0A 1MTVA 1GG6B 4AG2A 1EAWA 2ZWLH 3U8RH 3STIA 1SFQB 1BA8B 1NESE 1TQ7B 4GHTA 2WYJA 3SNEA 1VITF 1BRAA 2CXVA 2R2MB 1O3MA 2PKSB 1VKYA 1EJNA 3A82A 3H7OA 2A5KA 2SFAA 3P95A 4OS5A 1Z6JH 3RU4E 4X1QU 2AIPA 4KKDA 1IHTH 3UWIA 3S69A 4DT7B 3QTVH 3M7QA 4THNH 2PUXB 1TRMA 2HNTC 4TSFD 1TPOA 1SC8U 1ZJDA 3RMNH 1GDNA 2ILNA 2K1QA 5HMAA 1P9SA 1TNIA 1KLJH 1SKYE 2C8XB 1C1TA 2A4GA 1ZRKA 4YZUA 1SGFG 1QFKH 3MMGA 4WXVA 5GDSH 1J9CH 1JMOH 3NWUA 2A5AA 1RXPA 3RXCA 1FIZA 2Y81A 5B6OA 2AS9A 2O8TA 1PQAA 2SNWA 1S83A 1XUGA 1P9UA 3AAVA 3A8DA 3H7TA 3PLKA 3SHAH 7ESTE 2A45B 1A2CH 4I8KA 1PYTD 4CR5A 3NUMA 4J1YA 4FXGH 2NU2E 4YT7H 1ZTLA 1O5BB 1SLWB 1D6RA 2WV9A 1ELTA 3ZVGA 4FUBA 1PJPA 1ZMLA 2VIQA 1NFYA 1GI9B 3LJJA 1FY3A 2Z9JA 3LGVA 5A0AE 4ABBA 1EAUA 5E2OA 3DHKH 3ZZDA 1HJ9A 1TGBA 3MH7A 2FIRH 1SGCA 1ZOMA 1GHWH 3B23B 4K5ZA 3D62A 1EPTC 1K0HA 5LPEA 5K0HA 1LQEA 1AE5A 1MTNC 3M37A 5KEDA 1GVKB 1G3DA 5EIYA 3FOAA 2FOBA 2Y80A 1UTJA 1QBOA 1BJUA 1QA0A 2KAIB 1G3BA 1AVXA 3QZQA 4A6LA 2PGBB 2I6QA 3ZZ6A 3URCA 1DLKB 3SU1A 1AB9B 1W0JD 3OE7D 2WINI 2V3MA 3KCGH 2ZHQH 1VZQH 3F9FA 1C5SA 2DUCA 1O33A 5AFZH 1QIXB 2EI7A 1GJAB 2QN5T 3K6ZA 5BPEA 3U1IB 1ZPBA 3AASA 2JH0D 1T7CA 4XBDA 4A92A 1WXRA 3PV4A 4WMDA 3RC5A 1TAWA 1C1WH 4BOHA 2OC7A 4U32A 1DUAA 3QO6A 2F4LA 1L4DA 3EE7A 3CNRA 1BDAA 2C8ZB 4UFEH 2QIQA 1KLTA 3BTFE 1WDIA 3K9XB 5C1XA 2GT8A 2NU0E 3Q76A 2XW9A 2AHME 4NZQA 2FZZA 2PP6A 4ABDA 1TRNA 5DP9A 1NU9A 1O2GH 1HFDA 3KHVA 4ABGA 1ZSKA 1THSH 1ELBA 4B76A 1V3XA 1D6WA 3TGIE 4GHQA 1EP6A 1O3GA 5EQQA 4DY7B 3GCTG 4NA8A 1QB9A 2AMQA 1YBWA 2SGFE 1J8AA 4D9RA 2FOGA 2V7QD 1MTSA 1GI0A 2PSXA 1GHXH 2PLXA 1UCYE 8ESTE 1WQVH 4D7FA 1D4PB 1C1UH 1U6QA 1LKBA 3UOPA 2EEKA 5EPNA 2BX3A 2UUJB 1XXFA 1GJ8B 1E37B 1CT4E 1ELAA 1AZZA 1NY22 1C4U2 1L2EA 1KXDA 1TYNA 3FP6E 2QXGA 1TNLA 2ZDNA 5HIYA 2BD9A 2Z3CA 2J4IA 4RKOB 4ZUHA 4D9QA 3P8GA 4Y76A 3TLOA 4HG6A 1PPGE 3PTNA 4OS4A 2G00A 1ZYOA 1VCPA 2GCTC 2VIWA 1HLTH 1EPTA 2OBQA 3ZVAA 1E38B 1G36A 2LNCA 3RLYH 3VPKA 1CGIE 1H8DH 1OP2A 3P70B 3RXUA 2SNVA 3RXAA 2FYQA 3SV6A 1O2LA 4AGKA 1S84A 3KQCA 1HAHH 1FUJA 1EAXA 2HLCA 2TPIZ 1IQGA 2FMJA 3KYFA 5DN6D 4SGAE 2BM2A 1AFQB 3GICB 1KY9A 1TPAE 1LTOA 2VU8E 1EXFA 3M7UA 4Q4LA 3RXIA 1HAIH 4RT0A 1K1OA 5HM2A 3HKJB 2GVFA 3SN8A 1P2KA 1DX5M 5C2ZA 1GBMA 2JJ2D 1AWHB 1THRH 4IS5A 4BANB 1H4WA 2P16A 1TB6H 2QV1A 1G2MA 4I8GA 1QRXA 2ZHWH 1F5RA 1O32A 3JZ1B 7LPRA 2VH6A 1NFWA 4H6TA 2TGAA 3NCLA 2R9PA 4JYTA 1GHYH 1C5PA 1C5MD 1GVZA 1OSSA 1Y3UA 1Z8JB 3BV9B 1Z7KA 3SOSA 1O3HA 1ACBE 1QL9A 4Q80A 1DWBH 4JK5A 3LDXH 1O2WA 4RN6A 1LPZB 2BOHB 1F0SA 3P17H 1A5IA 3N7EA 3IG6B 2A5IA 2BD8A 3TH2H 1HBTH 1SLVB 4ISNA 1QCPA 3UUZA 1NZQH 3DSPA 3U69H 1BMMH 2C93B 6ESTA 2Z6BD 5DJ7A 3W95A 4JZFH 1XKAC 3LPRA 2WV4A 1MCTA 1OP8A 1BRUP 2OUAA 3RXHA 2C4FH 4O3UA 2ZF0H 1O3NA 5L2YH 4IMQA 2GDEH 1S5SA 1C2FA 1LDTT 1Z1JA 3LC3A 4X1SU 3H5CB 1GG6C 3GCHC 4I8JA 2XXLA 1HAVA 3RXMA 1BMAA 1EZSC 2GJGA 3SJ9A 1QR3E 4KTUA 1SGEE 2L6OA 1BT7A 3GCNA 3KNXA 3C27B 3TH4H 2IPQX 3JZ2B 3UQVA 4I33A 1Y3VA 2A7JA 4CHAC 1IQLA 4NIYA 2BY8X 4B1TA 1KMHB 1E34B 2J95A 1P2IA 2WYGA 3A7WA 3TK5A 3ZZ9A 2AGEX 4X1PU 3RXOA 2OLGA 4FETA 4TPYA 3GY2A 1O3PB 2ODPA 1TNJA 6GCHF 1TNGA 4WVPE 1NO9H 1JRSA 3EA8A 2KR7A 1AY6H 4A5TS 1A5GH 1GMDF 4ZHAA 1CT2E 1AE8H 1AFQC 1H8IH 2FOMB 4XRNA 3W1EA 1C9TA 3SYJA 1HGTH 2A4OA 2NWNA 4LOYH 2ZFQH 1T4VH 2FX6A 3FP7E 3PV5A 1UO6A 5T6FA 3RC6A 4LK4A 4YTAA 4R0IA 3SHCH 2BTCE 2WSSD 1V2MT 1NM6A 1Z8IB 1ANCA 3LGYA 2YMSB 4HI3A 3TJUA 1IQJA 5FPSA 5ESTE 3BTGE 1TALA 4FUGA 1GL1A 1FQ3A 5IDKA 3OU0A 4FVBA 2RDLA 1C1OA 2A4RA 2J98B 2SGAA 2XOKD 3SV8A 4DG4A 1J17T 1GBLA 3AW0A 1TFXA 4OS1A 1OP0A 1EAIA 3M5OA 4WMFA 2ZGXH 4Q7ZA 3LIWA 1GI5A 1JOUB 1RS0A 4D8NA 1TMTH 2BD4A 2Z94A 1ZLRA 2ZO3H 2ZGJA 4JZDH 3T26A 1A3EH 4AB8A 2AIQA 5EPYA 3A7VA 1KTTB 1DWDH 1OHHD 4DJZB 1GDQA 1SQOA 2Y6TA 2B7DH 3VGCC 3LGWA 3LOXA 4PROA 1O2OA 2Q6GA 5FCKA 3SNBA 4Q7YA 4Q7XA 3A8BA 4IMZA 1O5DH 1LVBA 3MTYA 1ZHPA 2UUFB 1Z1IA 2PHBA 1DANH 3SU2A 4DVAU 1ZZZA 2FYRA 1D3TB 3FP8E 4ZAEA 3SV9A 1A4WH 2PWXA 4O03A 4YESB 3NZIA 3BSQA 1EFRD 3SQHE 3MWIU 1QGFA 3SUDA 2FOFA 3RXKA 3H09A 7GCHG 5ESBA 4ASUD 3RXEA 1V2ST 3I77A 5JBBS 1E35B 1NS3A 2CF9H 3ZV9A 4X6MA 5EG4A 2FTLE 1CHOF 1P10A 1QBNA 2WPMS 1FX0B 1QJ1B 1BBRK 3KF2A 2D1JA 4X8VH 5JB8S 4FUEA 3FAOA 3ZZ7A 1GI6A 3SU5A 2CV3A 4A1XA 1F92A 2PW8H 4BNRA 1HXFH 2KAIA 5E0GA 1UVOA 3D23A 2YNBA 1KLIH 3TK6A 5J4QA 2WPHS 2J2UA 1SGNE 4ZMAH 3VFEA 3K65B 1BMNH 1DXPA 1SVPA 3MH6A 1AKSB 1DM4B 2FPZA 1QNJA 2BHGA 2CMYA 1OWJA 2BZ6H 4K8YA 5F8ZA 1EQ9A 2VH0A 1V2RT 2ZZUH 2HRVA 3V3MA 1CVWH 3LT3A 1MBQA 3BG4B 4XSKU 5EGMA 1GBKA 1KXAA 4MDSA 1V2WT 1DY9A 3WY8A 1K28D 1YLNA 4YM9A 1G3EA 1FN6A 4YXWD 3RMOH 1IOEA 5L6NH 1P01A 2ZEBA 4AX9H 3P8OA 4MQAA 2ASUB 4ZKSU 1LO6A 1YCPM 1EZUC 3SUGA 2J38A 4ZKNU 3A8AA 1AI8H 2OQ5A 4ZCNA 5C0TA 1AKSA 1Q3XA 1ELGA 4YT6H 3RMLH 3GDUA 1P2OA 2TRMA 2UWLA 4UDWH 1AUJA 3STJA 2ZFPH 2QY0B 1GI3A 4NWKA 1O35A 3TPIZ 3RXVA 1CA0C 5A8XA 2OXSA 1XM1A 4ZHLU 2FTMA 2FOEA 2G55A 1TONA 1BHXF 1H9IE 1GMDG 1C1VH 4Z1MD 3CS0A 3SBKA 3UWJH 5L30H 2Q6FA 1C1MA 2O8UA 3PWCA 2CJIA 1W13U 1O39A 1GBDA 3I78A 1BQYA 3HPTB 4Y8XA 2WPJS 1UVSH 1WU1A 1FN8A 1VJ9U 4MTBA 1QL8A 2Z3EA 1MTWA 1HUTH 2KFWA 1S0QA 1Z8RA 3KGPA 5I25A 3SU6A 4AGJA 3SGBE 1THPB 1GHAF 2PKAA 5JB9S 3TJVA 3E8LA 1H1BA 1K1JA 1UHBB 3LGIA 1TBZH 4FUHA 1TABE 4UFFH 3AAUA 4NSVA 1L1NA 3MNBA 5C1UA 1HAYB 4RT1A 1QB1A 2GCTB 1TPPA 3PO1C 4SGBE 1K1PA 1ZGIA 2HGTH 1SBWA 2H2ZA 5TCCA 1AGJA 1LQDB 4Y11E 1O3KA 5FPTA 1ARCA 1KYNA 1O2YA 5EJZA 4Z0KA 1A61H 4FUIA 1O3BA 2XC4A 3M7TA 1HAVB 1FXYA 1UVTH 2JH6D 1DDJA 1J14A 3A81A 1GHAG 1ABIH 1LHGH 4Q63A 4J2YB 1GHVH 3RXTA 1SGQE 1MABB 3D49H 2BDBA 3PM3A 2A31A 5A8ZA 5GIBA 1O3OA 4A7IB 3E0PB 3T25A 1NRSH 4TPIZ 2ZIQH 5F53A 1UTKA 3CENA 1NFXA 1X7AC 2SGQE 1F5KU 2BD2A 3EA9A 2ANMH 2QC2A 2BXUH 4XDEA 4Y10E 3E6PH 3GISB 1SB1H 3GCHB 4BAHB 3O8CA 5TCAA 1Y5UT 2JKHA 4X2VA 1MU6B 2B8OH 1E0FD 2GTBA 1B0FA 2J94A 2CK3D 1ZR0A 2G81E 2BX4A 1V2OT 1SLUB 2FX4A 3GY8A 5DKMA 5T3HA 4OM9A 1SGIB 4Y7BA 1QQUA 1DUEA 2P8OB 3SU3A 1LCYA 3OAAD 5T6DA 2WUCA 1V2QT 4ASHA 2H1UA 2OK5A 5DSFA 3U98H 1F0RA 1DLEA 1O3LA 1SGPE 2H5DA 5DG6A 4X8SH 1FZZA 3BG8A 3O8DA 5GJ4B 2D26C 1MBMA 2B5TB 3GYMA 1T8NA 2BMGB 2CN0H 2G51A 1ELVA 1EOJA 1DWEH 4BXWA 3QK1A 3BTQE 3EGKH 5IK2D 5HIZA 1CGJE 2ZDLA 1IQIA 4MVNA 1HJAB 2SGDE 1QTFA 4F4OC 3FANA 1ORFA 1P2QA 5AVDA 1SSXA 3HKIB 2D2DA 1YGCH 1IQKA 1HAXB 2ZFTA 3VB7A 3BTME 3MO6A 1BZXE 4CH8B 1BCUH 2Z7FE 3L3TA 3ATWA 1RTLA 2UUKB 3SUFA 1C1PA 1EKBB 1O5EH 2ZHDA 4WWYA 1C5NH 5FBEA 4ZROA 6GCHG 4KGAA 1S85A 3TJOA 5DP8A 1C5ZB 4K69A 4IN2A 1XUKA 1Y5AT 1EPTB 1ETTH 3SUEA 1O3IA 1D9IA 4AN7A 3WWFA 1MZDA 1ZRBA 1O2RA 2P93A 2ZU2A 1GBIA 1QHRB 3DSGA 3S9BA 1EZXC 2ZCLP 1CHOG 1XUFA 1ZHRA 1LHFH 4F55A 2JETB 3ODFA 5FPYA 2FEQH 3BTTE 2BB4A 1TGNA 4IN1A 1DWCH 3URDA 3A86A 2V3HH 2BD7A 1O36A 3A7TA 3DD2H 4OGXA 2VGCB 1K1IA 3SO3A 2PTCE 3RXPA 3FVFB 2ZA5A 1TX7A 4B75A 3S0NA 2HWLB 4D7GA 3NXPA 2Z9LA 1CSOE 3ATIA 1P06A 1O5GH 4U2WA 2QYIA 2A2XH 5F6MA 4NFEA 4YLUA 1MKWH 3RXGA 1ANDA 1LMWB 2XWBI 1BTZA 4ISHH 5FXLA 1GI1A 4O3TA 2RA0A 2P8OC 1E1RD 1AD8H 3B8JA 3A83A 1AQ7A 4IGDA 5HGGA 5EU8A 1YLCA 3S7KB 2G4UA 2Z9KA 3LU9B 1O2QA 2GDDA 1GJ9B 1MD7A 1O38A 1OYTH 1Y3XA 1CBWC 1YPHE 3SJ8A 3ZYEA 4WH8A 2GKVE 3KIDU 1GBBA 1HB0B 3U9AH 4BAQB 1ZMJA 2Y5HA 1W3CA 3PB1E 4GCHG 2F9NA 2J9NA 2AGGX 3KQEA 3NK8A 2ZPSA 4AYYB 1FY4A 1AZ8A 2LP6A 4MNXA 3MU4A 4GUXA 2HPQH 2GZ7A 2VNTA 2FXRA 4X6PA 4FUJA 1C5LH 1CT0E 4E7RG 1HIAB 1GBTA 1ZTKA 4DGJA 1C5TA 1TNKA 1ANEA 3DFJA 5FX6A 4NA9H 1GCTB 2BZAA 3TITA 1KDQA 2KCOA 4XE4A 3G01A 3ZV8A 2ZHEH 3MI4A 1SQAA 1W14U 3OTJE 3KQBA 2STBE 1O2MA 4I86A 1PPBH 4IC5A 1HAGE 1L1GA 1AWFH 5FX5A 4DURA 1G30B 3ZIAD 1GMHF 5EQRA 3QUMP 4B2BA 1K1NA 4ZXYH 5SGAE 1GL0E 2OINA 1GJDB 3PLPA 2PTNA 2ZDVH 2FS8A 2WPDD 1CGHA 4MNWA 4ZHMU 1GGDB 1SG8B 5JBAS 1G3CA 4CH2B 1A46H 2C8YB 1XUJA 8GCHF 1YCPK 2C90B 1UTNA 2A32A 1C5YB 2GZ8A 3SV7A 3MU1A 4INKA 3UNSA 1MKXK 1HV7A 5J4SA 3CP7A 1GMCF 3PMHB 1HYLA 1SL3A 1GI8B 3C1KA 3GDSA 4O97A 1OWIA 2Z3DA 3SV2H 3O8BA 1IQEA 1WOFA 1K2I1 4NFFA 1T8MA 1VGCB 3DFLA 3OYPA 3M61U 1Y3YA 1L4ZA 1D3PB 4VGCB 1EJAA 1LVMA 1L1JA 1C1SA 1PYTC 2W5EA 4H42U 5C20A 4UD9H 1TGTA 3N7DA 1A0HB 8LPRA 4K2YA 3FKSD 3PMBB 1FAXA 1DVAH 3M36A 4K1SA 1VGCC 3E0NB 1GBCA 2R2WU 3TNSA 1O30A 1V2JT 1GBJA 3EA7A 2XYAA 1DFPA 1MUEB 4UE7H 3QWCH 1EB2A 1ETRH 2FI5E 1N8OB 3BIUH 4NIWA 1TQ0B 5CHAC 4NIXA 1JIMA 2J5UA 3UIRA 1PPFE 2QGRA 3F2HA 3UR9A 4AB9A 4DIHH 2QF5A 3ZZ3A 1WUNH 1BTWA 4JYUH 1GJBB 3GCTF 1GMHG 2UWOA 2VIOA 3RUOA 5L2ZH 1P2MA 4HZHA 5C5OA 3GY6A 3SU4A 1FY5A 3ODDA 3SNAA 1NRPH 1SOTA 4A1VA 2AMPA 1A3BH 1P3EA 2QF4A 3T5FH 4B73A 1UMAH 1ZPCA 5JBTA 2B9LA 5DPAA 1SPJA 5B6LA 1QY6A 4ESTE 3SQEE 1ZGVA 4KTSA 1ELEE 4YOJA 3Q3KA 2FOAA 1GJ6A 4FUDA 1XUHA 3TGKE 8GCHG 2G5VA 1SGFA 1EUFA 1N6XA 1T32A 1GBFA 3PV2A 1NFUA 2PGQB 1ETSH 1FDPA 5DP7A 2GX4A 3GY3A 3DSOA 4K8BA 5K7RA 3Q00A 2BD3A 5EW2H 1TWXB 2I6SA 4X8TH 1QRZA 2ZFFH 4P00A 3R3GB 4X6NA 4H6SB 4B2AA 1LVYA 2PSYA 2XCNA 3RXJA 4IW4E 3TH3H 3SJIA 1GI2A 5GNDA 1YPHC 2HNTF 1BMFD 1ZMNA 3GOVB 3M35A 1TIOA 1RGQA 1C4Y2 1FLEE 2BDAA 4JK6A 1FJSA 2FDAA 3KL6A 3NRLA 2Q6DA 2W7UA 2F9UA 2XC0A 2XNDD 2FM2A 3K2UA 1NT1A 4YOGA 1C5RA 2GT7A 3RXRA 3SZNA 1KDQB 4LZ4B 4WXIA 3O8RA 1P05A 4TY6A 3UOUA 2VIVA 4ZH8A 4Y8YA 4BAKB 1KTSB 1C5VA 4TT3D 2FS9A 2W3IA 2GV6A 1D3DB 3R0FA 2JJ1D 2ZFRH 1O2TA 1H8ED 1LHEH 2YNAA 2EI8A 4WY3A 1O2SA 3EYDA 4CRAA 3ZZ5A 5HYOA 1W10U 4IBLH 1V2PT 5GCHG 1E1QD 2P94A 2D8WA 3S9CA 2M2AA 4BXSA 1DE7H 1LVOA 3VXEH 4FU7A 2UWPA 5FCRA 3ATLA 1P09A 2GMTB 2Q1JA 2ANWA 1AO5A 2VB0A 4WF8A 2KCYA 1YM0A 4WH6A 2WPLS 3KEEA 5H4IB 5AHGH 3PRDA 2YMSC 9ESTA 2W6ID 1BUIA 1T31A 4I7YH 1C5QA 1CHGA 2ZP0H 2RG3A 2KCAA 2KCPA 2LELA 3EDXB 4MPUA 3UFAA 1OWEA 1W7XH 2WUBA 5DK1A 1TOCB 1TMUH 1F0TA 4B6EA 1YWUA 3RM0H 1KXEA 5GPIB 3P8FA 5C1YA 2GCHF 1J16A 2H9EH 1GBEA 4R8TB 1QQ4A 3HATH 3PWBA 2QF0A 3ZZBA 4WJG2 1W2KH 4AOQA 4B6FA 2F9BH 2F83A 2ZCKP 1MKXH 3BEUA 2YMSD 5LPFA 1HNEE 1XVOA 1ESTA 5F8TA 5LH8A 5F03A 1GDUA 4GCHF 1YPEH 4U30A 2FP7B 4MG3A 1MMJN 3RM2H 2TGTA 1Z71A 4Y71A 3T2NA 3UB0A 3F2GA 2OTVA 4NG9H 3A89A 1F7ZA 2QA9E 1A0LA 1MTNB 1PQ7A 7KMEH 1EB1H 1N6YA 1WSSH 2FI4E 3MU0A 1WQSA 4ABJA 2P3FH 1OX1A 3RC4A 3OEHD 4Y0ZE 3GY7A 1CQQA 1O3FA 3ITIA 1LPKB 4ISIH 1MQ5A 1TNHA 2BDIA 1GJ4H 2HNTE 3SZEA 1TBRH 3L6PA 1YPLH 3U28C 1SOZA 1YP9A 4CR9A 1RRKA 2Y5FA 1IQFA 1V2UT 4F48B 1YPGH 3ATKA 4VGCC 4GAWA 1EP5A 2VWMA 3KQ5A 3T27A 3QTOH 6CHAB 2Y82A 3DA9B 5E8EH 5EXLA 3A84A 2AH4X 2O8MA 1G37A 2ZHFH 4TWYA 2RCEA 1IQHA 3OEED 3AW1A 1NN6A 1EATA 1ZTJA 4Y79A 2BVRH 3L33A 1TPSA 5DO4H 1IQNA 4ISOA 1TBQH 3QGJA 1T8LA 3EQ0H 2ZDKA 2VIDA 3OY6U 1UK2A 1A7SA 1S6HA 3K6YA 4MNYA 1CA0B 1QJ7B 2BVXH 3M5MA 2CHAB 1NU7B 2EY4C 3F1SB 4NSYA 5IYTA 3BEIB 4Z6AH 3ELAH 2EA3A 1G32B 1DY8A 2YOLA 3VGCB 2F9VA 2QXIA 2EC9H 1SMFE 1O5CB 2WV5A 3GY4A 1JRTA 2K0QA 1ELCA 3WWBA 2OC0A 1AUTC 2VGCC 5I46H 1BTPA 1UHBA 3T62A 1NBME 4NA7A 5E2PA 2FLBH 1N8OC 1YPMH 2O8WA 2ZTYA 4CREA 5C5NA 3MOCA 1C2KA 1O34A 4RI0A 1W0YH 4TWWA 2OCVB 1W7GH 2G52A 1EJMA 4JZEH 1Y5BT 2F43B 1GGDC 2ZU5A 2R3YA 2AMDA 3SU0A 1C2HA 5CE1A 1J15A 2BLVA 1GCDA 4CBNA 3SNCA 2H6MA 1C2GA 1JXPA 1GPZA 1BBRH 1DS2E 2QF3A 1NBMD 1NRRH 1QBVH 2H9HA 3AVZA 5DP5A 1VJAU 1W11U 3PMAB 1GI4A 3BG4C 3TU7H 1C5WB 1GHZA 1FMGA 2W6JD 2VVCA 1ZSJA 3UPEA 1UTPA 2XBWA 4K1EA 2BLQA 2ZCHP 1O2ZA 3F6UH 1O31A 3TVJB 1KXBA 1VR1H 4DIIH 5CMXH 2FODA 2XRCA 2DE8A 2EQNA 3IWMA 5EQSA 2FESH 1B0EA 4CRFA 4DW2U 3VB4A 3VXFH 1BBRE 3QZRA 1HPGA 2A0QB 2PKAB 2Z9IA 3PYHA 1GMCG 2BY9X 4KTCA 2A7HA 2C3SA 4INLA 5GXPA 2A2QH 3SI3H 3VB6A 4BTUB 4B74A 5HKKD 1L0ZA 1F5LA 1HAZB 2FWWA 2ZTXA 1AB9C 3F0OA 5F8XA 2IOTA 5HXFA 1ANBA 3WW7A 2STAE 1Y59T 3PMJA 1O2UA 2KX4A 1SGDE 3A7YA 3QLPH 3FO8D 3BTDE 5LPRA 3ATMA 3DCLA 3I29A 2V3OH 1IHSH 1K1LA 1TE0A 1Y8TA 1NC6A 2FI3E 3M5LA 4GVUA 5CHBA 5EJLA 5GCHF 3OFND 3VEQB 1GWAA 1BIOA 2ZI2H 5JBCS 5EXMA 1CE5A 1BB0B 2BY7X 2J97A 1WAYB 1S82A 2PUQH 2XBVA 2PV9B 1NRQH 1O37A 1SGRE 4E06H 1C1QA 1HXEH 1UK3A 1W8BH 1HAOH 3U8TH 5T1VA 1C5XB 2P3TB 2XNIA 5DP4A 2WZQA 4XOJA 5EXNA 3T28A 4Q2KA 2VJ1A 5DP3A 2ZECA 1RTKA 4XBBA 2BQWB 4INHA 3LONA 4X0WU 2XCFA 1TRYA 1GVLA 3OTPA 1DPOA 2ULLA 5C0UA 4JMYA 3PO1B 1EZQA 1OWDA 1XUIA 3KQDA 1RIWC 1XMNB 2GCHG 3TGJE 1UCYH 1HRTH 4FUCA 2VBCA 3RXDA 1TMBH 1YYY1 4UFGH 3T29A 2AFQB 2P59A 2ZPRA 1F0UA 4XFQA 3ZVEA 5LGOA 3SGAE 1C2MA 3U1JB 1O3CA 1S0RA 1DOJA 1MKWK 2XC5A 2CF8H 4B71A 3SNDA 4E05H 1UK4A 4AFZA 1F2SE 2JIZD 3F9GA 3S7HB 4H4FA 1GHBF 3N7OA 4ZKRU 2ZQ1A 1O3JA 1WV7H 3UAIC 1P2NA 4I8LA 2C8WB 1KXFA 2FLRH 4HTCH 3ZYDA 1E79D 2Z9GA 4UFDH 2GP9B 2Y7ZA 3A7ZA 1T4UH 2IJOB 4ABHA 5C67A 1Z8GA 1JIRA 3GS9A 4XBCA 2KZ4A 1SI5H 1BTXA 2PR3A 4GSOA 4LXBH 5FL7D 4K60A 1MAXA 1A0JA 2VWOA 1PPEE 2TBSA 2BLOA 3DT0H 1V2NT 2JDID 4CBOA 3MH4A 2AEIH 2GZ9A 2ZU4A 1O3EA 1UTQA 3PTBA 1RD3B 1ZJKA 1UJ1A 3BF6H 4TYDA 5AFYH 1DITH 1OKXA 3SJOA 4E7NA 2M5TA 1MQ6A 1G9IE 1BHXB 3TIUA 1UTLM 3ZVCA 2J34A 4FUFA 1NTPA 5C3NA 1BTUA 1YC0A 4Y8ZA 1AVGH 2JETC 4AORA 2G8TA 3UREA 1MCVA 4U01A 5TJXA 1SHYA 3UNRA 1FV9A 1UVPA 2ZTZA 2FOCA 3A80A 5A09A 4UEHH 1Q31A 3P8NA 2BDYA 5ETXA 1C4V2 3TJNA 1V6DA 2CGAA 4Y7AA 2ZKSA 1HDTH 3VG8A 2F9OA 5A0CA 1ESAA 1UTOA 1MTUA 5C17A 1WCZA 3RP2A 4ABIA 4XD7D 3F9HA 3QX5H 3ZZAA 1MZAA 4MLFB 4JCNA 1DSUA 2DE9A 3Q77A 3RXFA 2ZNKH 2RFKC 1TA2A 4X6OA 3ZZ4A 4ZXXH 3UR6A 2BQ6B 2A7CA 1QJ6B 4AZ2B 2NU1E 2ZFSA 3RXBA 1N1LA 4D76A 1QRWA 1O2JA 3MU5A 5FHTA 3E3TA 1K9OE 2W3KA 3A88A 3BIVH 3S9AA 2QAAA 1VITG 1VCWA 4MPXA 2ZPQA 4CRCA 5ABWA 3SJKA 2PKSC 1BTHH 2NU3E 1NPMA 1M9UA 3M3TA 1GBHA 3UTUH 2BD5A 2BDGA 1TOMH 1UVUH 1V2LT 2IPHA 4B2CA 2BDHA 2HOBA 1EOLA 1S6FA 5A8YA 3GDVA 3LGTA 1DICA 4TY7A 5E0HA 3VB3A 2ZGHA 5JDUB 2OC1A 3RLWH 4O9VA 9LPRA 3LH3A 1TA6A 2GV7A 4QT8C 3ESTA 1O2KA 3A7XA 3UQOA 2HPPH 3A87A 3SGQE 1SHHB 5FBIA 3V13A 1DXWA 2IJD1 1OWHA 2H9TH 1P8VC 1IAUA 1XXDA 1HCGA 3LC5A 5FAHA 3FZDA 2ANKH 3RDZA 2XBXA 4NIVA 4AG1A 4CRGA 2ZGCA 3Q3XA 5GWZA 2GGVB 5DP6A 3MYWA 1TX8A 3V0XA 4DT4A 4RSPA 2ODQA 1Q2WA 1MD8A 3FN8A 2A1DB 4BTIB 2QXJA 1C9PA 4I31A 1WBGB 3M5NA 1AIXH 1PQ5A 1AVWA 2OBOA 1OXGA 2H5CA 4X2WA 4AFUA 1DSTA 2BXTH 2RDEA 3QN7A 1GCTC 4BAOB 4JYVH 4GLYA 2AYWA 4CRDA 1AHTH 1ELFA 5A2MH 3OSYA 3PRBA 4OS7A 4K3JA 1AMHA 4BAMB 4ZKOU 1O3DA 4KELA 1H9HE 2THFB 2VINA 1SR5C 3NKKA 2ZDAH 3A85A 3TK9A 3VB5A 1BRBE 3MNCA 1JWTA 1WTHD 1DT2A 1A1RA 2R0KA 1OWKA 1P57B 1JBUH 1XKBC 3FFGA 3MNXA 1K1MA 5JYIA 4FVDA 1O2NA 3FZZA 2P3UB 4Y0YE 1H8HD 3F0PA 2ALVA 2OP9A 2J92A 3AK5A 1QB6A 2UUYA 3Q3YA 1GHBG 3RXQA 1ELDE 5EW1H 1OOKB 1PPCE 2TIOA 1P04A 1BTYA 2RA3A 2F3CE 2NU4E 1LHCH 1LPGB 1PFXC 2B0FA 2WPKS 3HGPA 3LGUA 5CHAB 3RXLA 1B5GH 1D3QB 4NWLA 1IQMA 1HAPH 3P6ZB
chains in the Genus database with same CATH topology
5BRRE 1SGYE 1FY1A 1ZPZA 3SI4H 2OQUA 1OS8A 2BOKA 1C1NA 3SW2B 1C2LA 4ISLA 2OC8A 4X8UH 3E91A 1YF4A 1HJ8A 2VIPA 2EI6A 3MO9A 1GBAA 2V0BA 1ZSLA 2GD4B 5A0BA 3MO3A 3PLBA 1INCA 4DOQA 1FAKH 2R3UA 1BITA 1K21H 1LKAA 1O2XA 3A8CA 3BTEE 1K22H 4X2XA 1GJ7B 1TGCA 4I32A 3NPSA 1FI8A 1KXCA 1P2JA 2W26A 3E16B 5G4BA 2ZU3A 3ZZ8A 2O8LA 4ABFA 1SLXB 4OS6A 3GYLB 1O0DH 1FNIA 3D65E 3LH1A 1C2JA 3KN2A 1SQTA 2AGIX 3ZVBA 2QCYA 3BEFB 1CO7E 3RU4D 2CHAC 2P95A 4MPWA 1P12E 1RJXB 1LHDH 3RXSA 4JZ1A 3QGNB 1XX9A 1SFIA 1HJAC 1YLDA 2A4QA 3SORA 2BVSH 2R0LA 1BRCE 3LJOA 2F9PA 3OX7U 2V35A 1WYKA 3BTWE 3M3SA 1MAYA 3MU8A 1FIWA 2ESTE 2WPIS 1KSNA 7GCHF 3E90B 2VWNA 1RFNA 2IN2A 1RIWB 4MNVA 3ZVFA 3F68H 5T6GA 2TGDA 1FONA 2VWLA 1H9LB 4X2YA 3UNQA 1P11E 2W7SA 1Z6EA 2QXHA 3HK6B 3M3VA 1FPCH 1V2TT 1O2PA 1P0SH 1WTGH 2V6NA 3OY5U 5EODA 1PQ8A 4ABEA 4CRBA 6CHAC 1AU8A 3B9FH 2G5NA 1O3AA 3ENSB 5DGJA 1TGSZ 1O2IA 3LKWA 4I8HA 2VVUA 2GMTC 3GCOA 1T8OA 1MH0A 2TGPZ 4YOIA 1O5AB 1ABJH 2XTTB 1FY8E 1AN1E 4DCDA 4HFPB 3ZVDA 4YO9A 2XWAA 4UONA 5HM9A 1XVMA 3W94A 1QL7A 2BQ7B 4MPVA 4ABAA 3E1XB 3F9EA 3ZZCA 8KME2 1V2KT 2Y5GA 1B7XB 1GJ5H 1ZHMA 2VVVA 1OPHB 1P02A 3MNSA 4Y6DA 4AYVB 2O9QA 2BY5X 2PFEA 3QDZB 3IITA 1FPHH 1C2IA 2BYAX 1KIGH 5PTPA 3TNTA 3CS7A 1CA8B 4AFQA 4HGCA 4X1RU 4NZLA 2HALA 4IC6A 4NGAH 1NRNH 3V12A 5JPMH 2JH5D 2XBYA 4K1TA 4WMEA 1GI7B 4X1NU 2ZU1A 1OYQA 1EX3A 6LPRA 1UCYK 3HK3B 1A5HA 1BMLA 2BLWA 3EE0B 3RMMH 1YPKH 1VITH 4JZIA 4RKJB 3V7TA 1C5UA 2AERH 3HGNA 4BTTB 2FO9A 1O2HA 1EASA 4FU9A 3PROA 2ZC9H 5E0JA 1O5FH 3EAJA 3RU4T 3BN9A 2OD3B 1TX6A 1ID5H 1SGTA 2BDCA 2ZQ2A 2SGPE 2FOHA 1AFEH 4LZ1H 2ZGBH 1QURH 1YCPH 1Y3WA 3MHWU 1P03A 1QA7A 1ESBA 2F91A 5EOKA 4OGYA 3U8OH 1O2VA 2ZG0H 1G2LA 1BOQA 4A1TA 1YPJH 1C2DA 5AF9H 2ANYA 3BTHE 1S81A 1TLDA 1NROH 1C2EA 1VCQA 3P92A 4YLQH 3BTKE 2Y7XA 1GJCB 1C5OH 1MU8B 4M7GA 2ZDMA 3MFJA 1CU1A 3DUXH 1W12U 4F49A 4GPGA 1ARBA 2LPRA 1PPZA 3UY9A 1YKTA 3GY5A 2G4TA 1RTFB 2ALPA 4AFSA 1V2VT 4CHAB 2BY6X 4FU8A 2HVXA 1UTMA 4OS2A 3MH5A 1BJVA 1CBWB 1HIAA 1E36B 4NCYA 1PPHE 2ODYB 2SGEE 1C1RA 1W0ZU 1P3CA 4KP0A 1MTVA 1GG6B 4AG2A 1EAWA 2ZWLH 3U8RH 3STIA 1SFQB 1BA8B 1NESE 1TQ7B 4GHTA 2WYJA 3SNEA 1VITF 1BRAA 2CXVA 2R2MB 1O3MA 2PKSB 1EJNA 3A82A 3H7OA 2A5KA 2SFAA 3P95A 4OS5A 1Z6JH 3RU4E 4X1QU 2AIPA 4KKDA 1IHTH 3UWIA 3S69A 4DT7B 3QTVH 3M7QA 4THNH 2PUXB 1TRMA 2HNTC 1TPOA 1SC8U 1ZJDA 3RMNH 1GDNA 2ILNA 2K1QA 5HMAA 1P9SA 1TNIA 1KLJH 2C8XB 1C1TA 2A4GA 1ZRKA 4YZUA 1SGFG 1QFKH 3MMGA 4WXVA 5GDSH 1J9CH 1JMOH 3NWUA 2A5AA 1RXPA 3RXCA 1FIZA 2Y81A 5B6OA 2AS9A 2O8TA 1PQAA 2SNWA 1S83A 1XUGA 1P9UA 3AAVA 3A8DA 3H7TA 3PLKA 3SHAH 7ESTE 2A45B 1A2CH 4I8KA 1PYTD 4CR5A 3NUMA 4J1YA 4FXGH 2NU2E 4YT7H 1ZTLA 1O5BB 1SLWB 1D6RA 1ELTA 3ZVGA 4FUBA 1PJPA 1ZMLA 2VIQA 1NFYA 1GI9B 3LJJA 1FY3A 2Z9JA 3LGVA 5A0AE 4ABBA 1EAUA 5E2OA 3DHKH 3ZZDA 1HJ9A 1TGBA 3MH7A 2FIRH 1SGCA 1ZOMA 1GHWH 3B23B 4K5ZA 3D62A 1EPTC 5LPEA 5K0HA 1LQEA 1AE5A 1MTNC 3M37A 1GVKB 1G3DA 2FOBA 2Y80A 1UTJA 1QBOA 1BJUA 1QA0A 2KAIB 1G3BA 1AVXA 3QZQA 4A6LA 2PGBB 2I6QA 3ZZ6A 3URCA 1DLKB 3SU1A 1AB9B 2WINI 3KCGH 2ZHQH 1VZQH 3F9FA 1C5SA 2DUCA 1O33A 5AFZH 1QIXB 2EI7A 1GJAB 2QN5T 3K6ZA 5BPEA 3U1IB 1ZPBA 3AASA 2JH0D 1T7CA 4XBDA 4A92A 3PV4A 4WMDA 3RC5A 1TAWA 1C1WH 4BOHA 2OC7A 4U32A 1DUAA 3QO6A 1L4DA 1BDAA 2C8ZB 4UFEH 2QIQA 1KLTA 3BTFE 3K9XB 5C1XA 2GT8A 2NU0E 3Q76A 2XW9A 4NZQA 5DP9A 2FZZA 4ABDA 1TRNA 1NU9A 1O2GH 1HFDA 3KHVA 4ABGA 1ZSKA 1THSH 1ELBA 4B76A 1V3XA 1D6WA 3TGIE 4GHQA 1EP6A 1O3GA 5EQQA 4DY7B 3GCTG 4NA8A 1QB9A 2AMQA 1YBWA 2SGFE 1J8AA 4D9RA 2FOGA 1MTSA 1GI0A 2PSXA 1GHXH 2PLXA 1UCYE 8ESTE 1WQVH 4D7FA 1D4PB 1C1UH 1U6QA 1LKBA 3UOPA 2EEKA 5EPNA 2BX3A 2UUJB 1XXFA 1GJ8B 1E37B 1CT4E 1ELAA 1AZZA 1NY22 1C4U2 1L2EA 1KXDA 1TYNA 3FP6E 2QXGA 1TNLA 2ZDNA 2BD9A 2Z3CA 2J4IA 4RKOB 4ZUHA 4D9QA 3P8GA 4Y76A 3TLOA 1PPGE 3PTNA 4OS4A 2G00A 1ZYOA 1VCPA 2GCTC 2VIWA 1HLTH 1EPTA 2OBQA 3ZVAA 1E38B 1G36A 2LNCA 3RLYH 3VPKA 1CGIE 1H8DH 1OP2A 3P70B 3RXUA 2SNVA 3RXAA 2FYQA 3SV6A 1O2LA 4AGKA 1S84A 3KQCA 1HAHH 1FUJA 1EAXA 2HLCA 2TPIZ 1IQGA 2FMJA 4SGAE 2BM2A 1AFQB 3GICB 1KY9A 1TPAE 1LTOA 2VU8E 1EXFA 3M7UA 3RXIA 1HAIH 5HM2A 1K1OA 3HKJB 2GVFA 3SN8A 1P2KA 1DX5M 5C2ZA 1GBMA 1AWHB 1THRH 4IS5A 4BANB 1H4WA 2P16A 1TB6H 2QV1A 1G2MA 4I8GA 1QRXA 2ZHWH 1F5RA 1O32A 3JZ1B 7LPRA 2VH6A 1NFWA 4H6TA 2TGAA 3NCLA 2R9PA 4JYTA 1GHYH 1C5PA 1C5MD 1GVZA 1OSSA 1Y3UA 1Z8JB 3BV9B 1Z7KA 3SOSA 1O3HA 1ACBE 1QL9A 4Q80A 1DWBH 4JK5A 3LDXH 1O2WA 4RN6A 1LPZB 2BOHB 1F0SA 3P17H 1A5IA 3IG6B 2A5IA 2BD8A 3TH2H 1HBTH 1SLVB 4ISNA 1QCPA 3UUZA 1NZQH 3U69H 1BMMH 2C93B 6ESTA 2Z6BD 5DJ7A 3W95A 4JZFH 1XKAC 3LPRA 2WV4A 1MCTA 1OP8A 1BRUP 2OUAA 3RXHA 2C4FH 4O3UA 2ZF0H 1O3NA 5L2YH 4IMQA 2GDEH 1S5SA 1C2FA 1LDTT 1Z1JA 3LC3A 4X1SU 3H5CB 1GG6C 3GCHC 4I8JA 2XXLA 1HAVA 3RXMA 1BMAA 1EZSC 3SJ9A 1QR3E 4KTUA 1SGEE 1BT7A 3GCNA 3KNXA 3C27B 3TH4H 3JZ2B 3UQVA 4I33A 1Y3VA 2A7JA 4CHAC 1IQLA 4NIYA 2BY8X 4B1TA 2WYGA 1E34B 2J95A 1P2IA 3A7WA 3TK5A 3ZZ9A 2AGEX 4X1PU 3RXOA 2OLGA 4TPYA 3GY2A 1O3PB 2ODPA 1TNJA 6GCHF 1TNGA 4WVPE 1NO9H 1JRSA 3EA8A 1AY6H 4A5TS 1A5GH 1GMDF 4ZHAA 1CT2E 1AE8H 1AFQC 1H8IH 2FOMB 1C9TA 1HGTH 2A4OA 2NWNA 4LOYH 2ZFQH 1T4VH 2FX6A 3FP7E 1UO6A 5T6FA 3RC6A 4LK4A 4YTAA 4R0IA 3SHCH 2BTCE 1V2MT 1NM6A 1Z8IB 1ANCA 3LGYA 4HI3A 3TJUA 1IQJA 5FPSA 5ESTE 3BTGE 1TALA 4FUGA 1GL1A 1FQ3A 5IDKA 3OU0A 4FVBA 2RDLA 1C1OA 2A4RA 2SGAA 3SV8A 4DG4A 1J17T 1GBLA 3AW0A 1TFXA 4OS1A 1OP0A 1EAIA 3M5OA 4WMFA 2ZGXH 4Q7ZA 3LIWA 1GI5A 1JOUB 1RS0A 4D8NA 1TMTH 2BD4A 2Z94A 1ZLRA 2ZO3H 2ZGJA 4JZDH 3T26A 1A3EH 4AB8A 2AIQA 5EPYA 3A7VA 1KTTB 1DWDH 4DJZB 1GDQA 1SQOA 2Y6TA 2B7DH 3VGCC 3LGWA 3LOXA 4PROA 1O2OA 2Q6GA 5FCKA 3SNBA 4Q7YA 4Q7XA 3A8BA 4IMZA 1O5DH 1LVBA 3MTYA 1ZHPA 2UUFB 1Z1IA 2PHBA 1DANH 3SU2A 4DVAU 1ZZZA 2FYRA 1D3TB 3FP8E 4ZAEA 3SV9A 1A4WH 2PWXA 4O03A 4YESB 3NZIA 3BSQA 3SQHE 3MWIU 1QGFA 3SUDA 2FOFA 3RXKA 7GCHG 5ESBA 3RXEA 1V2ST 3I77A 5JBBS 1E35B 1NS3A 2CF9H 3ZV9A 4X6MA 5EG4A 2FTLE 1CHOF 1P10A 1QBNA 2WPMS 1QJ1B 1BBRK 3KF2A 2D1JA 4X8VH 5JB8S 4FUEA 3FAOA 3ZZ7A 1GI6A 3SU5A 2CV3A 4A1XA 1F92A 2PW8H 4BNRA 1HXFH 2KAIA 5E0GA 1UVOA 3D23A 2YNBA 1KLIH 3TK6A 5J4QA 2WPHS 2J2UA 1SGNE 4ZMAH 3VFEA 3K65B 1BMNH 1DXPA 1SVPA 3MH6A 1AKSB 1DM4B 2FPZA 1QNJA 2BHGA 2CMYA 1OWJA 2BZ6H 4K8YA 5F8ZA 1EQ9A 2VH0A 1V2RT 2ZZUH 2HRVA 3V3MA 1CVWH 3LT3A 1MBQA 3BG4B 4XSKU 5EGMA 1GBKA 1KXAA 4MDSA 1V2WT 1DY9A 3WY8A 1K28D 4YM9A 1G3EA 1FN6A 5L6NH 3RMOH 1IOEA 1P01A 2ZEBA 4AX9H 3P8OA 4MQAA 2ASUB 4ZKSU 1LO6A 1YCPM 1EZUC 3SUGA 2J38A 4ZKNU 3A8AA 1AI8H 2OQ5A 1AKSA 1Q3XA 1ELGA 4YT6H 3RMLH 3GDUA 1P2OA 2TRMA 2UWLA 4UDWH 1AUJA 3STJA 2ZFPH 2QY0B 1GI3A 4NWKA 1O35A 3TPIZ 3RXVA 1CA0C 5A8XA 2OXSA 1XM1A 4ZHLU 2FTMA 2FOEA 2G55A 1TONA 1BHXF 1H9IE 1GMDG 1C1VH 3CS0A 3SBKA 3UWJH 5L30H 2Q6FA 1C1MA 2O8UA 3PWCA 2CJIA 1W13U 1O39A 1GBDA 3I78A 1BQYA 3HPTB 4Y8XA 2WPJS 1UVSH 1WU1A 1FN8A 1VJ9U 4MTBA 1QL8A 2Z3EA 1MTWA 1HUTH 3KGPA 1S0QA 1Z8RA 5I25A 3SU6A 4AGJA 3SGBE 1THPB 1GHAF 2PKAA 5JB9S 3TJVA 3E8LA 1H1BA 1K1JA 1UHBB 3LGIA 1TBZH 4FUHA 1TABE 4UFFH 3AAUA 4NSVA 1L1NA 3MNBA 5C1UA 1HAYB 1QB1A 2GCTB 1TPPA 3PO1C 4SGBE 1K1PA 1ZGIA 2HGTH 1SBWA 2H2ZA 5TCCA 1AGJA 1LQDB 4Y11E 1O3KA 5FPTA 1ARCA 1KYNA 1O2YA 4Z0KA 1A61H 4FUIA 1O3BA 2XC4A 3M7TA 1HAVB 1FXYA 1UVTH 2JH6D 1DDJA 1J14A 3A81A 1GHAG 1ABIH 1LHGH 4J2YB 1GHVH 3RXTA 1SGQE 3D49H 2BDBA 3PM3A 2A31A 5A8ZA 5GIBA 1O3OA 4A7IB 3E0PB 3T25A 1NRSH 4TPIZ 2ZIQH 1UTKA 3CENA 1NFXA 1X7AC 2SGQE 1F5KU 2BD2A 3EA9A 2ANMH 2QC2A 2BXUH 4XDEA 4Y10E 3E6PH 3GISB 1SB1H 3GCHB 4BAHB 3O8CA 5TCAA 1Y5UT 2JKHA 4X2VA 1MU6B 2B8OH 1E0FD 2GTBA 1B0FA 2J94A 1ZR0A 2G81E 2BX4A 1V2OT 1SLUB 2FX4A 3GY8A 5DKMA 5T3HA 4Y7BA 1SGIB 1QQUA 1DUEA 2P8OB 3SU3A 1LCYA 5T6DA 2WUCA 1V2QT 4ASHA 2H1UA 3U98H 1F0RA 1DLEA 1O3LA 1SGPE 2H5DA 5DG6A 4X8SH 1FZZA 3BG8A 3O8DA 5GJ4B 2D26C 1MBMA 2B5TB 3GYMA 1T8NA 2BMGB 2CN0H 2G51A 1ELVA 1EOJA 1DWEH 4BXWA 3QK1A 3BTQE 3EGKH 1CGJE 2ZDLA 1IQIA 4MVNA 1HJAB 2SGDE 1QTFA 4F4OC 3FANA 1ORFA 1P2QA 5AVDA 1SSXA 3HKIB 2D2DA 1YGCH 1IQKA