5E0JA

1.20 a resolution structure of norovirus 3cl protease in complex with a triazole-based macrocyclic (21-mer) inhibitor
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
174
structure length
174
Chain Sequence
HAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLTGANAKGMDLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Norovirus 3C-like protease
publication title Structure-based design and synthesis of triazole-based macrocyclic inhibitors of norovirus protease: Structural, biochemical, spectroscopic, and antiviral studies.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Protease/protease inhibitor
total genus 36
structure length 174
sequence length 174
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5e0jA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5e0jA01
2Y82A 4OS1A 2ZEBA 1SLUB 2A45B 1YBWA 3ZZ3A 1W0ZU 2FOCA 1YCPH 2C8XB 1VCWA 1GBMA 3RMNH 2VWNA 2R2MB 1YLDA 2ZU5A 3UUZA 5AF9H 1A4WH 1C5ZB 1J9CH 1TNIA 3ATMA 4JCNA 1A2CH 3H7OA 3LC5A 1AZZA 1C5XB 1CHGA 1HAXB 1Z8JB 1QFKH 1VITG 1YYY1 2A1DB 2VGCC 1MZDA 2FZZA 1ZLRA 3QDZB 5GPIB 2OUAA 2PFEA 2A31A 1K22H 1MD8A 1TA6A 1V2JT 2AS9A 4ABEA 1S6FA 2PV9B 2ZKSA 5LPRA 1K1MA 4B73A 3VB7A 1BDAA 1GI6A 1IQLA 2Q1JA 1O2NA 1FIWA 3ZYDA 2Y5HA 2PSXA 3SQHE 3RLWH 1C2HA 1IAUA 2NU0E 1ZYOA 5FCKA 2VH0A 3NXPA 1ABJH 1QB1A 3VGCC 1HYLA 1GHXH 1C2LA 2BLOA 3PYHA 2CV3A 2H9TH 2AGEX 1GBBA 1K28D 4CHAB 4WXIA 3D65E 1FAXA 1O39A 4ZKSU 3SV6A 2FOMB 4CRAA 2J9NA 3ZV9A 3KEEA 3RMLH 3ZVCA 1SR5C 4B1TA 1UK2A 1HDTH 5EQRA 2ODQA 1GI1A 1AUJA 3K2UA 3E90B 4F49A 2WPJS 5EXNA 3MNSA 1O35A 2OBQA 2BHGA 1GI3A 1EJAA 5DO4H 4BXWA 2VGCB 1PQ5A 4Q80A 4AFZA 1P05A 1BRCE 1AE5A 3T2NA 3RU4T 4OS7A 2ZHQH 1S85A 1TNHA 7GCHF 1K21H 3V3MA 1O2RA 3TNSA 3PO1C 1ZGVA 2BY6X 3MO3A 4Y7AA 4NFEA 3TNTA 3IITA 1GDQA 4AYYB 4A5TS 2ZPSA 1V2RT 4I8LA 4JYTA 3BTHE 1MQ6A 3UY9A 4Y7BA 1TNLA 1EX3A 3MNBA 4DG4A 3VGCB 4FUJA 4ABJA 3MHWU 3Q77A 1F5LA 3BN9A 1GHZA 2OCVB 4D7FA 1G3EA 3SI3H 4UFGH 1E38B 2AERH 5JYIA 5HXFA 2ZHWH 1FUJA 1S81A 1D6WA 3QN7A 1AU8A 2XNIA 1RXPA 1AB9C 2W7UA 1JOUB 1OP0A 4JYVH 4AX9H 1GBHA 1CHOF 3M3TA 5ABWA 3LJOA 5EPNA 4ABDA 3KQEA 2P16A 1DWDH 2CJIA 2UUKB 1ELEE 1CGIE 3RXMA 3AW0A 1WBGB 5GJ4B 3RC5A 1BJVA 1S83A 4ABFA 1FAKH 2ZDMA 3AAUA 4I8JA 2XBVA 2A2XH 1GHBG 2ZFPH 3PO1B 1TLDA 1HB0B 2C3SA 4NA8A 3SU2A 1OWJA 1N6YA 3E3TA 2BQ7B 1TX7A 1BTYA 1GDNA 4K2YA 1ELTA 4INKA 1Y3VA 4NWLA 1O2XA 1T8NA 3ATKA 2ZU3A 1BUIA 5DP4A 2BXTH 3U8RH 2BB4A 1JBUH 1O5EH 3QZQA 4K8BA 4NA7A 1EAWA 4VGCC 5C1XA 1TPPA 1MAYA 1ZTKA 3BF6H 4TYDA 3ZV8A 1MKXH 4AFUA 1HAYB 1UO6A 4FU8A 5E0HA 1LVYA 2ZO3H 1C5YB 5DP7A 1QNJA 4NGAH 1A1RA 1V2UT 3LGUA 4AOQA 1W13U 2ZQ1A 1GMDF 2ZNKH 1D9IA 2ZFSA 3OSYA 5E2OA 4ZHLU 1P10A 1NT1A 2C90B 2J92A 1C9PA 1C1MA 1CU1A 1Y3YA 3STIA 4WMDA 5B6OA 2PW8H 1TRYA 3SUGA 4AG2A 2BOHB 3U98H 1GMHG 1QA0A 1C5PA 4YTAA 3RMOH 1MKWH 4ISIH 3SU4A 3LIWA 1FV9A 1F0RA 3HGPA 4D9RA 1KXAA 2NU3E 2J38A 2Z6BD 2XTTB 2FI5E 5SGAE 4DJZB 5HYOA 2ZI2H 1TWXB 1QJ1B 5A8XA 4E7NA 4XFQA 4Y79A 1KXDA 3RXPA 1Z8IB 2CXVA 1AE8H 1F2SE 3KNXA 1BTUA 4K60A 4YT6H 3RXIA 2V3OH 2HNTC 3C27B 1UVUH 1BBRH 4GVUA 3F1SB 2ULLA 1YPGH 2NU1E 1EJMA 1TA2A 2ILNA 1O3FA 3E16B 1CSOE 2ZPRA 1O2IA 4FXGH 1P2QA 2C93B 1KY9A 3TGJE 4Q7XA 4AZ2B 1XUFA 2FYQA 2P94A 4X1RU 2FOBA 3GCOA 4X8UH 4ZHMU 5EG4A 1V2ST 5A0BA 1GHBF 3ZVFA 3ZZDA 3RXRA 1SQTA 2QF0A 2GMTC 3A85A 1TABE 1GG6B 3KN2A 2YNBA 1DANH 5TCAA 4Q2KA 1XUGA 2GZ7A 5GCHG 2V3HH 4JMYA 3CS7A 2UWLA 3R3GB 4K8YA 4INHA 1EASA 1Y5BT 2BZAA 3Q76A 2BYAX 1FDPA 5C1UA 4Y6DA 2ZTXA 1QCPA 1LPZB 4MNVA 1RRKA 1Z7KA 1O3JA 5HMAA 1GBIA 1C2JA 1YLCA 2V35A 3SJOA 2J2UA 1G3CA 4X1PU 1OWKA 1VR1H 2ZDAH 8LPRA 1BIOA 1BRAA 1O2GH 3UREA 2PUQH 5ESBA 1GJCB 1GVLA 1OWIA 2ZG0H 1XKAC 4GUXA 4BTUB 2QIQA 3V7TA 2ZHEH 1J8AA 2FIRH 4UEHH 4FUDA 3FZZA 5T3HA 5EQQA 1O3IA 1PQ8A 1DOJA 4ISLA 4XBBA 6ESTA 1SI5H 4CRFA 1HAHH 4X6OA 1NO9H 2GMTB 2JKHA 1AWFH 3BIUH 1KLIH 1Q3XA 2AH4X 1OSSA 4MNWA 1PPHE 4BAOB 2ZU4A 5A2MH 2YNAA 3VXEH 4RN6A 1H9LB 1YP9A 3F68H 1BA8B 1O5DH 2OINA 3PROA 2PKSC 4J2YB 2QYIA 3U9AH 1AVGH 3BSQA 1AFQB 1GJ7B 1IQIA 3UQOA 4GCHF 1W3CA 1T31A 4A1XA 1C5UA 3ODFA 2BTCE 1IQHA 1ZJDA 3QX5H 2GCTC 1TQ0B 1V3XA 1PYTD 3SGQE 2ZCKP 3BV9B 3ZZBA 3MH5A 4M7GA 4IC6A 1C2DA 5C67A 4JZEH 3GDUA 1P9UA 1HRTH 5GCHF 1IQMA 4INLA 2XYAA 1HBTH 3A84A 3ENSB 3LC3A 1ZJKA 1HCGA 2CMYA 1F5RA 3MYWA 1P3EA 2GDDA 1ZGIA 3VFEA 5DK1A 1S82A 2OLGA 3LPRA 4FUFA 1O2PA 3S0NA 2GVFA 1YF4A 3BTGE 1EZQA 1ANEA 4FU9A 4BAHB 1BMLA 1EZXC 2UUJB 1C5NH 1SVPA 1PYTC 2GKVE 1LPKB 4H6SB 3T28A 1AMHA 1GMCG 1RS0A 1DVAH 4UFDH 3GICB 3ZZ4A 1YPKH 1KTSB 1AFEH 5K0HA 3RXVA 2Z7FE 2XBYA 2Z94A 3LOXA 2Z9KA 1P09A 3RU4E 3MU8A 2TGDA 4GPGA 4AGJA 2I6SA 3URCA 2PKSB 2B9LA 4I31A 2LNCA 5JBTA 1PJPA 1Y59T 4JYUH 1TX6A 3GY3A 1O3NA 1TNGA 5CE1A 3A7WA 1LMWB 4TPYA 3GCHC 1C5QA 1JRTA 1K1IA 2BM2A 2A4OA 1C1QA 5DP9A 3SO3A 2GCTB 4MQAA 3ZZ9A 1MCVA 2BDCA 4BAMB 4NA9H 3SJ8A 1DLEA 4ZH8A 1H9IE 1BZXE 1QBVH 4A6LA 1EKBB 4KTUA 5EXMA 1EPTC 1P04A 5A09A 3E0NB 1YKTA 2QXJA 5F8ZA 2BQ6B 3PLKA 5E8EH 1C1OA 1O2HA 1CA0C 3GY6A 3NWUA 1ZRKA 1AIXH 1IHSH 1WQSA 2AFQB 4B2BA 3RXJA 4OS5A 1O33A 1MKXK 5LH8A 1DS2E 5HGGA 3G01A 1ZOMA 3A81A 2R0LA 1L4DA 2ZTYA 4LOYH 1OP2A 2VIQA 1TGNA 4LZ4B 1F7ZA 2FI4E 3A7YA 2GTBA 5AFZH 2BD5A 3RDZA 1LVBA 1HAOH 2QGRA 1H8IH 1OWEA 4GLYA 2GX4A 4JZIA 3LH3A 1GBAA 2BVXH 2ZFQH 2VWLA 1C4Y2 1P2MA 3OYPA 3BEIB 5JBBS 4AB8A 1DM4B 3GISB 3SU1A 6CHAB 3S9BA 3KQDA 3ZZCA 1V2OT 2VIPA 3TU7H 3F9HA 2OQUA 1O37A 1UHBB 1SGQE 1GCTB 1SQAA 1MKWK 1O3MA 2Y81A 3ZVGA 1BB0B 3LJJA 4MPXA 3PMAB 1TMUH 2Y7ZA 7LPRA 1S6HA 2XBXA 3M37A 1RIWB 3MTYA 8ESTE 3GCHB 3M7QA 1GHAG 1NRRH 4UE7H 1GDUA 2F9NA 1DY9A 2PGQB 2BDIA 2G5NA 3RXCA 4X2YA 1ARBA 3BTQE 2JETB 4B74A 4IMQA 3VB6A 2OXSA 3F9FA 1BBRK 1FY5A 1MTNC 3DUXH 1ABIH 3N7OA 1EPTB 4ZMAH 4B2AA 1FONA 1LHCH 1UTNA 4AG1A 1Z1IA 1TNKA 1CA0B 2SNWA 3E91A 2FLBH 1PPGE 4Q7YA 5L2ZH 4IGDA 3TJVA 3L6PA 1T8OA 2PKAA 3JZ2B 2BQWB 3UNSA 2BX4A 4XE4A 5DKMA 2ZA5A 1FN6A 2EI7A 1O30A 1WU1A 1OWDA 2G52A 1Q31A 2VNTA 1C2MA 4XOJA 1ETRH 1O2TA 1OWHA 1W14U 1ANBA 2GZ8A 1IOEA 1FN8A 1PPZA 2F9BH 2ZGCA 2KAIA 3A8BA 4DIIH 4AORA 1Y5AT 1G2MA 3ZVEA 2ANKH 3STJA 5DP5A 3RC6A 2Z9LA 3GYLB 4X6MA 4ZKOU 2ZZUH 3A83A 4FUGA 4AFSA 2FODA 3HPTB 4MG3A 1ACBE 1GI5A 1E37B 1O2WA 3TVJB 3TH2H 1DWCH 1S5SA 2Y5GA 4FUIA 2SGEE 1W12U 1MU6B 1AKSB 1MBMA 3K9XB 4NWKA 1Y3WA 4Y8YA 2BX3A 3UWIA 1OYTH 2BDAA 3A82A 9ESTA 1MTNB 3SJIA 1TRMA 5TJXA 4YLUA 2DE8A 1TBRH 1OOKB 1O3DA 2P8OB 5JB8S 1K1PA 2JH0D 3M36A 2J94A 1O38A 5FXLA 2D8WA 1D6RA 1YPHE 5EGMA 1C9TA 1Z8GA 2AIQA 3ZZ6A 1RTKA 2FX6A 1GJ6A 2CHAC 2O8MA 4B2CA 5I46H 1HGTH 1LKAA 2A5AA 3LONA 3RXTA 2ANMH 2NU2E 3W95A 1UVPA 1OXGA 3K6ZA 5A0CA 1EJNA 3URDA 4OGXA 3T25A 2OD3B 2STAE 5F8TA 1TMTH 4YM9A 3HKIB 1GJ9B 4QT8C 1SQOA 1XVOA 2GT7A 3ZZ8A 4E7RG 2NU4E 3M3SA 5AVDA 1EXFA 5LPFA 1C5SA 2GCHG 4BAQB 3MO6A 2ZDNA 4CRCA 1QL9A 1XUJA 1TPOA 4NCYA 4Q7ZA 2WUBA 1QBNA 1GI4A 1L1JA 1UTJA 1Y5UT 1BCUH 1DICA 1FLEE 2WV4A 4BANB 3V12A 1AO5A 3GCTG 1KYNA 4BXSA 1SSXA 2SGFE 1VCQA 3SUFA 1GL0E 1P0SH 3GY5A 1VITF 2ZPQA 1GPZA 1L1GA 4HFPB 1P01A 1UHBA 1P57B 4YLQH 1D3TB 2FYRA 1C1WH 4KGAA 2PLXA 1C5WB 2G81E 5DP8A 1WSSH 2P3UB 1XMNB 3QO6A 3TPIZ 4BAKB 1BTXA 4XDEA 2BXUH 5F6MA 1QQ4A 3Q3YA 1J16A 2Z3DA 1HFDA 1HIAA 2CHAB 1TGSZ 3LKWA 1QA7A 4B71A 1FPHH 3RXFA 4ABHA 1QIXB 1DUEA 2C8ZB 2TPIZ 1ELVA 3OY5U 2ZGHA 4Y0YE 4X8TH 5T6GA 2FP7B 3SGBE 3UNQA 1DT2A 1UK4A 4ZHAA 1BMAA 1ZSJA 5DGJA 1HV7A 4U32A 2BLQA 5H4IB 1V2TT 1FIZA 1MAXA 3DHKH 5F8XA 1CBWB 4ISOA 3TLOA 2TBSA 1P3CA 2OC8A 4AN7A 1CVWH 1K9OE 1N6XA 3PMHB 1C1VH 2VWOA 2ZQ2A 4ZXYH 1QRXA 3LU9B 2OC1A 2XCNA 1SGRE 4MPUA 4DW2U 3D49H 1MU8B 1BMMH 1G32B 3RXUA 1C5VA 3TH4H 1WTHD 3KGPA 4BTTB 4X2XA 2Y5FA 3ZVBA 1C2FA 1S0QA 5C2ZA 1QRWA 1P2NA 3TK9A 1B7XB 1O31A 2THFB 4XBCA 1V2WT 5J4SA 2Y7XA 1SMFE 2FO9A 2GCHF 2B8OH 2B7DH 1DSTA 2QAAA 1M9UA 2A4RA 2BVRH 3TJOA 1HAVB 2F91A 3ODDA 1C2GA 1GG6C 1G3DA 3DFLA 3LGVA 1G3BA 1HLTH 2GV7A 4Y8XA 4ISNA 3EA7A 3GCTF 4LXBH 2H2ZA 4DY7B 2HALA 4B76A 1J15A 1O3CA 1RTFB 1FQ3A 1NESE 3MH7A 2RG3A 2W3IA 1HAGE 1ETTH 4A92A 1SGCA 5GXPA 3FANA 3RXKA 4TWWA 1ZHRA 3MMGA 2ZC9H 4FUHA 1O5AB 3SN8A 4X6PA 2F3CE 1LKBA 2Q6DA 1MUEB 1PFXC 3BG4B 5G4BA 2Z3CA 1TB6H 3M5NA 1TE0A 1C1PA 1O2OA 2WYGA 3B8JA 2PR3A 3BTKE 3P8NA 4MNYA 2H1UA 4X1QU 2HWLB 2SGQE 1NC6A 3VB5A 1F0UA 1YCPK 3SZNA 3MI4A 4NSYA 1K1OA 2VH6A 1C5OH 3EAJA 2ZDVH 4B75A 1QQUA 3FAOA 2D1JA 3WY8A 2ZU1A 1AQ7A 1QJ6B 3BTEE 4TWYA 3S9CA 3TK5A 3UNRA 2WV5A 3M3VA 3DA9B 3P95A 3CS0A 2HRVA 1GVZA 3DT0H 4A7IB 4I8GA 1KXFA 3SOSA 1FZZA 3U8TH 3RMMH 3OY6U 8GCHG 1P2JA 1DPOA 1NTPA 1SOZA 5I25A 1GHYH 1AFQC 4TY7A 5C20A 1QB6A 4X0WU 3QLPH 4THNH 1DX5M 3EA8A 1HAZB 1P8VC 2I6QA 3AW1A 1Z6JH 1UCYE 1IHTH 4WMEA 3A88A 1GI9B 1MD7A 1NRNH 5JDUB 3S69A 2ZWLH 3GCNA 3RXAA 2VIOA 3D23A 5AFYH 4K1EA 1GJAB 2UWPA 1P9SA 4WMFA 1C4V2 1DUAA 1ARCA 2TGAA 1EP5A 3GY8A 1MMJN 4D8NA 1YPMH 2G4TA 1W7GH 1TALA 1DE7H 3P92A 3AAVA 1BMNH 3QGJA 4JZDH 1GMHF 1ZPCA 1O5CB 3VXFH 1W11U 2FOAA 1NU9A 2AIPA 1NROH 4AB9A 4UONA 1KXEA 3HGNA 1O3GA 1F0SA 3MH6A 5EW2H 2O8WA 2SFAA 2H5DA 5FX5A 4KKDA 5ESTE 4CH8B 4Y8ZA 3TITA 2BY7X 1WYKA 3BEUA 2WPKS 1E0FD 3QTVH 4MTBA 1C5LH 2VIVA 3TK6A 2RCEA 4A1VA 2QF3A 4H42U 2GDEH 1OYQA 5C1YA 4U01A 1KDQB 3UR9A 1ZHMA 1ELBA 3RM2H 3UOPA 2AMDA 1GBJA 4BTIB 1DWBH 3L33A 7KMEH 3A8CA 4X6NA 1EQ9A 3K65B 5EPYA 5TCCA 2R3UA 1SGNE 1TGBA 1LPGB 1O3OA 3PMJA 3ZVAA 3LGTA 2QA9E 2J4IA 3PB1E 1XXDA 1TRNA 3PTNA 1T4VH 3EYDA 3CENA 3JZ1B 2Z9IA 3F9GA 1PQ7A 1CT0E 5JBCS 3KIDU 2D2DA 4O3TA 3ZZAA 3P17H 2PSYA 1THRH 1QRZA 1T8LA 2VIWA 1FXYA 1P03A 2BDHA 3A8DA 3MNXA 3TJUA 3A8AA 1O3BA 3ZZ7A 4CRBA 3NK8A 1C1RA 2H6MA 2GD4B 2BY8X 5EODA 2BD7A 3PLBA 4X2WA 2A7CA 3A7XA 2TIOA 4ASHA 2XC5A 1VZQH 3Q3XA 1O3AA 1W10U 5J4QA 1O2KA 2W26A 3BIVH 2ZCHP 1GBLA 1WAYB 1UVSH 1O2ZA 3TGKE 5FX6A 4DOQA 1IQNA 2F9VA 2XCFA 2FOEA 1ZR0A 4Y71A 2W7SA 6CHAC 1C2EA 1P02A 1OPHB 3SU3A 2BLWA 3A86A 3SW2B 1GCTC 1RD3B 2HLCA 3S7KB 5CHAB 1GWAA 3H5CB 1CT4E 1V2LT 2ZFRH 1NFUA 5FPTA 4X8VH 4R0IA 4K1TA 4HTCH 1IQKA 4H4FA 1ELDE 3KCGH 1GBCA 1RIWC 2ZDKA 1WOFA 1WTGH 3LDXH 2AEIH 2DUCA 2XWAA 4MVNA 4UD9H 1QR3E 2BY9X 1G2LA 1C4U2 3MU1A 3RC4A 1MTWA 2BLVA 4FU7A 4ZAEA 2JETC 2BDBA 1CQQA 3SV9A 1X7AC 3UOUA 1ETSH 3A87A 3SGAE 5IDKA 1H1BA 1Y3XA 2D26C 2HPQH 2ANWA 3P8FA 4FUCA 4IBLH 1L0ZA 1TMBH 1NS3A 1ZPBA 1V2MT 4YOIA 1TOMH 5F03A 1BRUP 1BBRE 5EXLA 2BDGA 3QWCH 1UTPA 1Z6EA 3ATWA 4Y11E 1HUTH 2WPMS 2EI6A 1WQVH 2F9OA 2P93A 1HAPH 1BTWA 3MU4A 2QC2A 1D4PB 3SQEE 2WPLS 2C4FH 3EE0B 4O03A 1TX8A 1IQEA 1OS8A 2Y6TA 2BD8A 4O9VA 3QGNB 1WV7H 2RA3A 2WPIS 3VB3A 2P3TB 1F5KU 1ZMJA 1QURH 3GYMA 1PQAA 1T7CA 3PTBA 1HJ9A 1A61H 4YZUA 1KSNA 3SORA 2CF8H 1TOCB 4LK4A 1C5RA 1Y8TA 5A8ZA 3RLYH 2Y80A 3SUEA 8KME2 1A0HB 1EAXA 3MNCA 2A5KA 4UFFH 1QL8A 1RTLA 3A80A 4MPWA 4NSVA 1AWHB 3HKJB 1GBEA 1XUHA 2BD3A 1Z71A 1GMCF 1V2NT 1JIRA 3PWCA 1NFYA 2QY0B 2Z9GA 1K1LA 1O3PB 2W5EA 2A7HA 4Z0KA 3BTME 1SGTA 3U1JB 3UTUH 2BDYA 2P8OC 3OTJE 1D3PB 4RSPA 3B23B 3MO9A 4D9QA 1O36A 4D7GA 1A5GH 1J14A 5DP3A 1EB1H 1TGCA 4WVPE 4Z6AH 2P95A 1XXFA 3SV7A 4GHQA 1AY6H 1LVOA 3GDVA 5L30H 2FPZA 1LHGH 3O8BA 1LDTT 1O2JA 5EQSA 1EAUA 3ZYEA 1DY8A 2H9HA 1VITH 3MOCA 1ZMNA 3H7TA 3RP2A 4CR9A 1SFQB 7GCHG 1AD8H 2VU8E 1TBZH 1KLTA 1SGIB 2ZGXH 3SBKA 1Z1JA 4FUBA 1FY4A 1GGDC 1O2LA 4NIXA 1CO7E 1H9HE 1GHWH 1V6DA 2ZFTA 1SG8B 1O2QA 1LTOA 2OC7A 3CP7A 1AVWA 1XM1A 2HOBA 3RXLA 3I77A 2GV6A 1JXPA 1GJ5H 1O32A 4ZROA 3M5OA 5FBIA 4A1TA 2FOHA 2ZECA 2ZU2A 3DD2H 1GBKA 3RXEA 1C1TA 1VJAU 4SGAE 1UVTH 4KTCA 1C2IA 1S0RA 2R3YA 2ZIQH 1QHRB 1E34B 4JZFH 2V0BA 3NCLA 1P2KA 2A32A 2NWNA 4K69A 2BD9A 4OS6A 3SJKA 2FX4A 3T62A 1H8DH 1CT2E 1VJ9U 2CGAA 4LZ1H 2J34A 1QTFA 4BOHA 1T4UH 1CHOG 1O5FH 2QV1A 2A7JA 1VGCB 4TPIZ 3P6ZB 5JBAS 4WJG2 4E06H 1NRSH 1O2YA 2XBWA 2ZDLA 1Z8RA 1FMGA 1L2EA 3A7TA 1GHAF 6GCHG 2WPHS 1GBDA 2WINI 1BHXF 5JB9S 3S9AA 2G00A 1U6QA 1D3DB 3SU5A 3SNBA 3UWJH 3K6YA 4UDWH 1ORFA 1EZSC 1GJBB 1P06A 2GZ9A 1OX1A 1SBWA 3IWMA 1G30B 4ABAA 1A3EH 1J17T 3E6PH 4CRDA 2WYJA 1TGTA 4ABBA 4O3UA 2PTNA 1THPB 1GBTA 1DSUA 2ZHDA 4I8KA 3SNAA 1GGDB 2AGGX 2FTLE 3O8CA 1XUIA 1A3BH 4MNXA 1CBWC 4MDSA 1JRSA 3DFJA 1SOTA 4HZHA 1LHEH 1ELFA 1O3HA 1A46H 4NIWA 5GIBA 2AMPA 1GHVH 5GDSH 1UCYH 2FS9A 2BD4A 4X1NU 4ABIA 3F9EA 3GOVB 4YO9A 3VEQB 2FM2A 4SGBE 1GL1A 2VVCA 2A4GA 1W0YH 3KQCA 1EOLA 1LQEA 3T5FH 2QCYA 1YPHC 1BRBE 1YGCH 2F83A 4DGJA 1O5BB 2SGPE 2PHBA 3LGIA 2F9UA 1XVMA 1ID5H 4DIHH 1B0EA 1DFPA 6LPRA 1BQYA 1H4WA 2HNTF 1GMDG 3BTFE 1T8MA 1LQDB 1ZTLA 5L2YH 2BZ6H 1EUFA 3RXSA 3A7VA 1CGHA 2PTCE 2H5CA 7ESTE 3M7TA 4WH8A 3QTOH 1SGFA 1E36B 3BTTE 4BNRA 2DE9A 3TIUA 1AN1E 1YM0A 1JWTA 4KELA 4O97A 1THSH 5FPSA 1UJ1A 2XW9A 1FI8A 2VWMA 1EPTA 2YOLA 4WF8A 3S7HB 4WH6A 2G55A 4AFQA 4K3JA 1LVMA 2JH5D 5BPEA 3TJNA 2Q6FA 2IJOB 2G5VA 1HXFH 2WUCA 2FMJA 1TPSA 2FLRH 2FOFA 1K1JA 1ZSLA 4ZUHA 1FJSA 2PUXB 1RGQA 1NRPH 3T26A 1ZRBA 1RJXB 4H6TA 5C5OA 6GCHF 1ELGA 4DURA 4GAWA 3LGYA 4JZ1A 1QGFA 3BG4C 5LGOA 1PPCE 2G51A 3MFJA 3L3TA 1LCYA 1EB2A 1SHHB 3C1KA 1FY1A 1K2I1 4IN1A 1L4ZA 1CE5A 2ZGJA 3EGKH 3I78A 3U1IB 1GCDA 1GJ8B 1QL7A 2AYWA 3BG8A 4Y10E 1IQFA 4F4OC 5FAHA 1LHDH 3T27A 5DG6A 1TQ7B 1P2IA 1IQGA 1KIGH 2BMGB 1MH0A 2SGAA 3RXOA 1NRQH 1N1LA 1AUTC 1C5MD 3BEFB 2W3KA 1YCPM 4ESTE 1DXPA 3NZIA 1AKSA 1SLWB 3LH1A 4CRGA 3SHAH 2R0KA 5C5NA 1SFIA 3QK1A 1C1UH 2FOGA 1EATA 1P11E 3FP7E 2HNTE 1QB9A 3P8GA 1SLXB 4D76A 1ESBA 1SGFG 1SGYE 1GVKB 4CR5A 3TH3H 2EI8A 1UTLM 1NPMA 1AB9B 1HNEE 2R9PA 1D3QB 4XSKU 1O2UA 1ZSKA 4HGCA 2IN2A 1W2KH 3HATH 4I32A 1UTOA 4I33A 5DJ7A 4YT7H 3AASA 3RUOA 3KL6A 1GJDB 2HPPH 1FNIA 3VB4A 1EZUC 1Y3UA 2ZCLP 5A8YA 2M5TA 4OS2A 2STBE 3P70B 3RXQA 1DLKB 3R0FA 3B9FH 1IQJA 1HJ8A 1WCZA 4MLFB 1ANCA 4IMZA 1O2MA 2FXRA 2VINA 3SJ9A 2VB0A 4GSOA 1PPFE 2UWOA 5LPEA 3E8LA 3M35A 3VPKA 1AZ8A 2BD2A 4Y0ZE 1SGDE 5DPAA 2PGBB 1V2KT 1V2VT 4DVAU 4FVBA 3ATLA 4IW4E 4NIVA 1V2QT 4GCHG 4VGCB 2ODYB 1BHXB 3PMBB 1GI2A 1A5IA 2BVSH 3SNDA 4DCDA 1MTSA 3GY7A 5K7RA 4RKJB 1F92A 2EA3A 2ZHFH 4NIYA 1A7SA 4JK5A 4X1SU 1SHYA 2Q6GA 2SGDE 1O3EA 3D62A 1K1NA 1UMAH 3GDSA 4I7YH 1BTZA 1ZHPA 1O0DH 1BJUA 1TNJA 4CREA 1YC0A 2ALVA 5A0AE 1O2VA 3ELAH 3LGWA 3V0XA 4R8TB 1WUNH 5T6DA 1MTUA 1S84A 3SU6A 3PLPA 2R2WU 5IYTA 3F6UH 1BOQA 4K5ZA 1GI7B 2OC0A 1KXBA 5L6NH 1GJ4H 2QXGA 1W8BH 4HI3A 4AYVB 1UK3A 2EEKA 2OQ5A 3GY4A 2ZP0H 1AVXA 1NN6A 1ESTA 3LT3A 1G9IE 1XUKA 3RXHA 2QXHA 1ESAA 1GBFA 2O8UA 1LHFH 1XX9A 1INCA 1W7XH 3QZRA 3NUMA 3Q00A 2FWWA 5HM2A 3FFGA 5E0JA 3UFAA 5BRRE 3QUMP 2JH6D 1TYNA 1XKBC 3RM0H 4K1SA 1QY6A 4ABGA 3SNCA 1MCTA 4I8HA 4X8SH 2AGIX 4ZKNU 1HJAC 2Z3EA 1T32A 1GI0A 1A5HA 1P2OA 3NKKA 4ZKRU 1BITA 1L1NA 5CHAC 1MBQA 4KTSA 1ELAA 2ALPA 2SNVA 5E0GA 3U69H 4YOJA 2RDLA 1HAVA 2GGVB 2FI3E 1B5GH 1C2KA 1HPGA 1SC8U 3MWIU 2FEQH 4OGYA 5JPMH 1VCPA 5GWZA 2TGTA 2BOKA 3I29A 2CN0H 1UCYK 5HM9A 3KHVA 2HVXA 4YESB 1YPEH 1G37A 1RFNA 5T6FA 1FY3A 4UFEH 1N8OC 3V13A 1JIMA 1ZMLA 3MH4A 1O3LA 2PKAB 3GY2A 2C8WB 2ESTE 3KF2A 8GCHF 4XBDA 1BTPA 1F0TA 3E0PB 1A0LA 5FHTA 3A7ZA 4FVDA 4OS4A 2ZFFH 1YPJH 2RA0A 1TBQH 1DDJA 1YPLH 1LO6A 3U8OH 2KAIB 3ZZ5A 3RXGA 2UUFB 3M5LA 1ELCA 4NZLA 4YOGA 2O8TA 1A0JA 2ZGBH 2FS8A 2GT8A 3O8DA 3UIRA 2P3FH 4U2WA 4WY3A 5EW1H 1MQ5A 1P12E 1ZTJA 2ODPA 3O8RA 1UTQA 3OX7U 2VIDA 2IOTA 2ZF0H 1MTVA 2TRMA 4JK6A 1HJAB 2OTVA 1B0FA 4Y76A 3M61U 4ZXXH 2TGPZ 2ZTZA 1QJ7B 3P8OA 3ESTA 4IC5A 1FY8E 4TY6A 1O34A 3HK3B 3IG6B 2A4QA 4CBOA 3SNEA 2HGTH 3UQVA 1TIOA 3EA9A 5EU8A 1Q2WA 2XWBI 2K1QA 1C1SA 1NZQH 1G36A 3KQBA 2XC4A 3RU4D 2C8YB 2F9PA 2OBOA 1OKXA 4WWYA 1TPAE 1TONA 3A89A 1KLJH 4X2VA 3ZVDA 3E1XB 1BTHH 1PPEE 2O8LA 2A5IA 2H9EH 2XXLA 2V6NA 5FBEA 2FTMA 1EP6A 3OU0A 2EC9H 2OP9A 1N8OB 3SUDA 3FVFB 3HK6B 1TAWA 3SV2H 4IS5A 1CA8B 3SI4H 1DITH 5FPYA 5AHGH 5CMXH 4E05H 3M5MA 1EAIA 4IN2A 1ZZZA 2VJ1A 3Q3KA 1SGEE 3RXDA 3PV4A 3MU5A 1MZAA 5C3NA 2PWXA 3TGIE 4RKOB 2A2QH 3M7UA 4J1YA 2P59A 3FZDA 1DXWA 3UR6A 2ANYA 2J95A 2G4UA 2VVUA 1C5TA 1SLVB 3EQ0H 3SU0A 2B0FA 1AGJA 4KP0A 4AGKA 4CH2B 2QN5T 1HAIH 1SPJA 3AVZA 1TFXA 4DT7B 1C1NA 3FP8E 5ETXA 1EOJA 2GP9B 4FUEA 2LPRA 1BT7A 1V2PT 1HXEH 3NPSA 1NM6A 3EDXB 3SHCH 1NFWA 1ZPZA 2B5TB 2VVVA 1GI8B 2UUYA 5DP6A 1UVOA 2A0QB 3ATIA 1AI8H 5EOKA 2XRCA 2ASUB 3FP6E 4NG9H 1E35B 1O5GH 4PROA 1QBOA 2O9QA 5FCRA 1SL3A 1CGJE 2CF9H 1ANDA 1SB1H 1PPBH 4WXVA 1KDQA 3RXBA 1O3KA 1AHTH 9LPRA 1NY22 3ITIA 2BY5X 1UTKA 3BTWE 4MPVA 2XC0A 2AMQA 4ISHH 5E2PA 3UPEA 1KXCA 2Z9JA 3SV8A 1HIAB 3BTDE 3T29A 1VGCC 2G8TA 5PTPA 3W94A 4NFFA 1UTMA 1OP8A 1FPCH 1KTTB 2IPHA 1NU7B 4CHAC 4CBNA 1NFXA 4NZQA 3PM3A 3MU0A 2FDAA 1JMOH 3PWBA 1DWEH 4GHTA 1O2SA 4U30A 2QXIA 1SGPE 2FESH
chains in the Genus database with same CATH superfamily
3F0OA 1SKYE 2Y82A 4OS1A 2ZEBA 1SLUB 2A45B 1YBWA 3ZZ3A 1W0ZU 2FOCA 1YCPH 2C8XB 1VCWA 1GBMA 3RMNH 2VWNA 2R2MB 1YLDA 2ZU5A 3UUZA 5AF9H 1A4WH 1C5ZB 1J9CH 1TNIA 3ATMA 4JCNA 1A2CH 3H7OA 3LC5A 1AZZA 2F4LA 1C5XB 1CHGA 1HAXB 1Z8JB 1QFKH 1VITG 1YYY1 2A1DB 2VGCC 1MZDA 2FZZA 1ZLRA 3QDZB 5GPIB 2OUAA 2PFEA 2A31A 1K22H 1MD8A 1TA6A 1V2JT 2AS9A 4ABEA 1S6FA 2PV9B 2ZKSA 5LPRA 1K1MA 4B73A 3VB7A 1BDAA 1GI6A 1IQLA 2Q1JA 1O2NA 1FIWA 3ZYDA 2Y5HA 5CHBA 2PSXA 3FO8D 5EJZA 3SQHE 3RLWH 1C2HA 1IAUA 2NU0E 1ZYOA 5FCKA 2VH0A 3NXPA 1ABJH 1QB1A 3N7DA 3VGCC 1HYLA 1GHXH 1C2LA 2KCOA 2BLOA 3PYHA 2CV3A 2H9TH 2AGEX 1GBBA 1K28D 4CHAB 4TT3D 4WXIA 3D65E 1FAXA 1O39A 4ZKSU 3SV6A 2FOMB 4CRAA 2J9NA 3ZV9A 3KEEA 3RMLH 2YMSD 3ZVCA 1SR5C 4B1TA 1UK2A 1HDTH 5EQRA 2ODQA 2JDID 1GI1A 1FX0B 1AUJA 3K2UA 3E90B 4F49A 2WPJS 5EXNA 3MNSA 3ZIAD 1O35A 3PV5A 2OBQA 5HKKD 2BHGA 1GI3A 1EJAA 5DO4H 4BXWA 2VGCB 1PQ5A 4Q80A 1YWUA 4AFZA 1P05A 1BRCE 1AE5A 3T2NA 3RU4T 4OS7A 2ZHQH 1S85A 1TNHA 7GCHF 1K21H 3V3MA 1O2RA 3TNSA 3PO1C 1ZGVA 2BY6X 3MO3A 4Y7AA 4NFEA 3TNTA 3IITA 1GDQA 4AYYB 5FL7D 4A5TS 1EFRD 2ZPSA 2HVYB 1V2RT 2K8IA 4I8LA 4JYTA 3BTHE 1MQ6A 3UY9A 4Y7BA 1TNLA 1EX3A 3MNBA 4DG4A 3VGCB 4FUJA 4ABJA 3MHWU 3Q77A 1F5LA 3BN9A 1GHZA 2OCVB 4D7FA 1G3EA 3SI3H 4UFGH 1E38B 2AERH 5JYIA 5HXFA 2ZHWH 1FUJA 2J98B 1S81A 1D6WA 3QN7A 1AU8A 2XNIA 1RXPA 1AB9C 2W7UA 1JOUB 1OP0A 4JYVH 4AX9H 2VBCA 2V3MA 1GBHA 1CHOF 3M3TA 5ABWA 3LJOA 5EPNA 4ABDA 3OAAD 3KQEA 2P16A 2QE7D 1DWDH 2CJIA 2UUKB 1ELEE 1CGIE 3RXMA 3AW0A 1WBGB 5GJ4B 3RC5A 1BJVA 1S83A 4ABFA 3SZEA 1FAKH 2ZDMA 3N99A 3AAUA 4I8JA 2XBVA 2A2XH 1GHBG 2ZFPH 3PO1B 1TLDA 1HB0B 2C3SA 4NA8A 1E79D 3SU2A 1OWJA 1N6YA 3E3TA 2BQ7B 1TX7A 3GS9A 1BTYA 1GDNA 4K2YA 1ELTA 4INKA 1Y3VA 4NWLA 1O2XA 1T8NA 3ATKA 2ZU3A 1BUIA 5DP4A 1WXRA 2BXTH 3U8RH 2BB4A 1JBUH 1O5EH 3QZQA 4K8BA 4NA7A 1EAWA 1OHHD 4VGCC 5C1XA 1TPPA 3FOAA 4RT0A 1MAYA 1ZTKA 3BF6H 4TYDA 3ZV8A 1MKXH 4AFUA 1HAYB 1UO6A 4FU8A 5E0HA 1LVYA 2ZO3H 1C5YB 5DP7A 1QNJA 4NGAH 1A1RA 1V2UT 3LGUA 4AOQA 1W13U 2ZQ1A 1GMDF 2ZNKH 1D9IA 2ZFSA 3OSYA 5E2OA 4ZHLU 1P10A 1NT1A 2C90B 2J92A 1C9PA 1C1MA 1CU1A 1Y3YA 3STIA 4WMDA 5B6OA 2PW8H 1TRYA 3SUGA 4AG2A 2BOHB 3U98H 1GMHG 1QA0A 1C5PA 4YTAA 3RMOH 1MKWH 4ISIH 3SU4A 3LIWA 1FV9A 1F0RA 3HGPA 4D9RA 1KXAA 4YXWD 2NU3E 2J38A 2Z6BD 2XTTB 2FI5E 5SGAE 4DJZB 5HYOA 2ZI2H 1TWXB 1QJ1B 5A8XA 4E7NA 4XFQA 4Y79A 5CDFE 1KXDA 3RXPA 1Z8IB 2CXVA 1AE8H 1F2SE 1WDIA 3KNXA 1BTUA 4K60A 4YT6H 3RXIA 2V3OH 2HNTC 3C27B 1UVUH 1BBRH 4GVUA 3F1SB 2ULLA 1YPGH 2NU1E 1EJMA 1TA2A 2ILNA 1O3FA 3E16B 1CSOE 2ZPRA 1O2IA 4FXGH 1P2QA 2C93B 1KY9A 3TGJE 4Q7XA 4AZ2B 1NBMD 2WHXA 1XUFA 2FYQA 2P94A 4X1RU 2FOBA 3GCOA 4X8UH 4ZHMU 5EG4A 1V2ST 5A0BA 1GHBF 3ZVFA 3ZZDA 3RXRA 1SQTA 2QF0A 2GMTC 3A85A 1TABE 1GG6B 3KN2A 2YNBA 3FN8A 1DANH 5TCAA 4Q2KA 1XUGA 2GZ7A 5GCHG 2F43B 2V3HH 4JMYA 3CS7A 2UWLA 3R3GB 5C17A 4K8YA 4INHA 1EASA 3NRLA 1Y5BT 2BZAA 3Q76A 2BYAX 1FDPA 5C1UA 4Y6DA 2ZTXA 1QCPA 1LPZB 4MNVA 1RRKA 1Z7KA 1O3JA 5HMAA 1GBIA 1C2JA 1YLCA 2V35A 3SJOA 2J2UA 2V7QD 1G3CA 4X1PU 1OWKA 1VR1H 2ZDAH 8LPRA 1BIOA 1BRAA 1O2GH 3UREA 2PUQH 5ESBA 1GJCB 1GVLA 1OWIA 4ZCNA 2ZG0H 1XKAC 4GUXA 4BTUB 2QIQA 2HLDD 3V7TA 2ZHEH 1J8AA 2FIRH 4UEHH 4FUDA 3FZZA 5T3HA 5EQQA 1O3IA 1PQ8A 1DOJA 4ISLA 4XBBA 6ESTA 1SI5H 4CRFA 3WW7A 1HAHH 4X6OA 1NO9H 2GMTB 2JKHA 1AWFH 3BIUH 1KLIH 1Q3XA 2AH4X 1OSSA 4MNWA 1PPHE 4BAOB 2ZU4A 5A2MH 2YNAA 3F2GA 4RN6A 3VXEH 1H9LB 1YP9A 3F68H 5F53A 1BA8B 1O5DH 2OINA 3PROA 2PKSC 4J2YB 2QYIA 3U9AH 1AVGH 3BSQA 1AFQB 2W6ID 1GJ7B 1IQIA 3UQOA 4GCHF 1W3CA 1T31A 4A1XA 1C5UA 3ODFA 2BTCE 1IQHA 1ZJDA 3QX5H 2GCTC 1TQ0B 1V3XA 1PYTD 3SGQE 2ZCKP 3BV9B 3ZZBA 3MH5A 4M7GA 4IC6A 1C2DA 2QF5A 5C67A 4JZEH 3GDUA 1P9UA 1HRTH 5GCHF 1IQMA 4Z1MD 4INLA 2XYAA 1HBTH 3A84A 3ENSB 3LC3A 1ZJKA 1HCGA 2CMYA 1F5RA 3KYGA 3MYWA 4I86A 1P3EA 2GDDA 1ZGIA 3VFEA 5DK1A 1S82A 2OLGA 3LPRA 4FUFA 1O2PA 3S0NA 2GVFA 1YF4A 3BTGE 1EZQA 1ANEA 4FU9A 4BAHB 1BMLA 1EZXC 2UUJB 1C5NH 1SVPA 1PYTC 2WSSD 2GKVE 1LPKB 4H6SB 3T28A 1AMHA 1GMCG 1RS0A 1DVAH 4UFDH 3GICB 3ZZ4A 1YPKH 1KTSB 1AFEH 5K0HA 3RXVA 2Z7FE 2XBYA 2Z94A 3LOXA 2Z9KA 1P09A 3RU4E 3MU8A 2TGDA 4GPGA 4AGJA 2I6SA 3URCA 2PKSB 2B9LA 4I31A 2LNCA 5JBTA 1PJPA 1Y59T 4JYUH 1TX6A 3GY3A 1O3NA 1TNGA 5CE1A 3A7WA 1LMWB 4TPYA 3GCHC 1C5QA 1JRTA 1K1IA 2BM2A 2A4OA 1C1QA 5DP9A 3SO3A 2GCTB 4MQAA 3ZZ9A 1MCVA 2BDCA 3DSGA 4BAMB 4NA9H 3SJ8A 1DLEA 4ZH8A 1H9IE 1BZXE 1QBVH 4A6LA 1EKBB 4KTUA 5EXMA 1EPTC 1P04A 5A09A 3E0NB 1YKTA 2QXJA 5F8ZA 2BQ6B 3PLKA 5E8EH 1C1OA 1O2HA 1CA0C 3GY6A 3NWUA 1ZRKA 1AIXH 1IHSH 1WQSA 2AFQB 4B2BA 2JIZD 3RXJA 4OS5A 1O33A 1MKXK 5LH8A 1DS2E 5HGGA 3G01A 1ZOMA 3A81A 2R0LA 1L4DA 2ZTYA 4LOYH 1OP2A 2VIQA 1TGNA 4LZ4B 3OE7D 1F7ZA 2FI4E 2GJGA 3A7YA 2GTBA 5AFZH 2BD5A 3RDZA 1LVBA 1HAOH 2QGRA 1H8IH 1OWEA 4GLYA 3F0PA 2GX4A 4JZIA 3LH3A 1GBAA 2BVXH 2ZFQH 2VWLA 1C4Y2 1P2MA 3OYPA 3BEIB 5JBBS 4AB8A 1DM4B 3GISB 3SU1A 6CHAB 3S9BA 3KQDA 3ZZCA 1V2OT 2VIPA 3TU7H 3F9HA 2OQUA 1O37A 1UHBB 1SGQE 1GCTB 2RDEA 1SQAA 3MQKC 1MKWK 1O3MA 2Y81A 3ZVGA 1BB0B 3LJJA 4MPXA 3PMAB 1TMUH 2Y7ZA 7LPRA 1S6HA 2XBXA 3M37A 1RIWB 3MTYA 8ESTE 3GCHB 3M7QA 1GHAG 1NRRH 4UE7H 1GDUA 2F9NA 1DY9A 2PGQB 2BDIA 2G5NA 1KMHB 4FOUC 3RXCA 4X2YA 1ARBA 3BTQE 2JETB 4B74A 4IMQA 3VB6A 2OXSA 3F9FA 1BBRK 1FY5A 1MTNC 3DUXH 1ABIH 3N7OA 1EPTB 4ZMAH 4B2AA 1FONA 1LHCH 1UTNA 4AG1A 1Z1IA 1TNKA 1CA0B 2SNWA 3E91A 2FLBH 1PPGE 4Q7YA 5L2ZH 4IGDA 3TJVA 3L6PA 1T8OA 2PKAA 3JZ2B 2BQWB 3UNSA 2BX4A 4XE4A 5DKMA 2ZA5A 1FN6A 2EI7A 1O30A 1WU1A 1OWDA 2G52A 1Q31A 2VNTA 1C2MA 4XOJA 1ETRH 1O2TA 1OWHA 5DN6D 1W14U 1ANBA 5C0UA 2GZ8A 1IOEA 1FN8A 1PPZA 2F9BH 2ZGCA 2KAIA 3A8BA 4DIIH 4AORA 1Y5AT 1G2MA 4FETA 3ZVEA 3OEED 2ANKH 3STJA 5DP5A 3RC6A 2Z9LA 3GYLB 1W0JD 4X6MA 4ZKOU 2ZZUH 3A83A 4FUGA 4AFSA 2FODA 2IPQX 3HPTB 4MG3A 1ACBE 1GI5A 1E37B 5EJLA 1O2WA 3TVJB 3TH2H 1DWCH 1S5SA 2Y5GA 4FUIA 2SGEE 1W12U 1MU6B 1AKSB 1MBMA 3K9XB 4NWKA 1Y3WA 4Y8YA 2BX3A 3UWIA 1OYTH 2BDAA 3A82A 9ESTA 1MTNB 3SJIA 1TRMA 5TJXA 4YLUA 2DE8A 1TBRH 1OOKB 1O3DA 2P8OB 5JB8S 1K1PA 2JH0D 3M36A 2J94A 1O38A 5FXLA 2D8WA 1D6RA 3DSOA 1YPHE 5EGMA 2KM0A 1C9TA 1Z8GA 2AIQA 5T1VA 3ZZ6A 1RTKA 2FX6A 1GJ6A 2CHAC 2O8MA 4B2CA 5I46H 1HGTH 1LKAA 2A5AA 3LONA 3RXTA 2ANMH 2NU2E 3W95A 1UVPA 1OXGA 3K6ZA 5A0CA 2RFKC 1EJNA 3URDA 4OGXA 3T25A 4RT1A 2OD3B 2STAE 5F8TA 1TMTH 4YM9A 3HKIB 3F2FA 1GJ9B 4QT8C 1SQOA 1XVOA 2GT7A 3ZZ8A 4HG6A 4E7RG 2NU4E 3M3SA 5AVDA 2QF4A 1EXFA 3KYFA 1C5SA 5LPFA 2GCHG 4BAQB 3MO6A 2ZDNA 4CRCA 1QL9A 1XUJA 1TPOA 4NCYA 4Q7ZA 2WUBA 1QBNA 1GI4A 1L1JA 1UTJA 1Y5UT 1BCUH 1DICA 1FLEE 2WV4A 4BANB 3V12A 1AO5A 3GCTG 1KYNA 4BXSA 1SSXA 2SGFE 1VCQA 3SUFA 1GL0E 1P0SH 3GY5A 1VITF 2ZPQA 1GPZA 1L1GA 4HFPB 1P01A 1UHBA 1P57B 4YLQH 1D3TB 2FYRA 1VKYA 1C1WH 1COWD 4KGAA 2PLXA 1C5WB 2G81E 5DP8A 1WSSH 2KR7A 2P3UB 1XMNB 2KCYA 3QO6A 3TPIZ 4BAKB 1BTXA 4XDEA 2BXUH 5F6MA 1QQ4A 3Q3YA 1J16A 2Z3DA 1HFDA 1HIAA 2CHAB 1TGSZ 3LKWA 1QA7A 5KEDA 3DSPA 4B71A 1FPHH 3RXFA 4ABHA 1QIXB 5HIYA 1DUEA 2C8ZB 2TPIZ 1ELVA 2J5UA 3OY5U 2ZGHA 4Y0YE 4X8TH 5T6GA 2FP7B 3SGBE 3UNQA 1DT2A 1UK4A 4ZHAA 1BMAA 1ZSJA 4P00A 1HV7A 5DGJA 4U32A 2BLQA 4Q63A 5H4IB 1V2TT 1FIZA 1MAXA 3DHKH 1BMFD 5F8XA 1CBWB 4ISOA 3TLOA 2TBSA 1P3CA 2OC8A 4AN7A 1CVWH 1K9OE 1N6XA 3PMHB 1C1VH 2VWOA 2ZQ2A 4ZXYH 1QRXA 3LU9B 2OC1A 2XCNA 1SGRE 4MPUA 4DW2U 3D49H 1MU8B 1BMMH 1G32B 3RXUA 1C5VA 3TH4H 1WTHD 3KGPA 4BTTB 4X2XA 2Y5FA 3ZVBA 1C2FA 1S0QA 5C2ZA 1QRWA 1P2NA 3TK9A 1B7XB 1O31A 2THFB 4XBCA 1V2WT 5J4SA 2Y7XA 1SMFE 2FO9A 2GCHF 2B8OH 2B7DH 1DSTA 2QAAA 1M9UA 2A4RA 2BVRH 3TJOA 1HAVB 2F91A 3ODDA 1C2GA 1GG6C 1G3DA 3DFLA 3LGVA 1G3BA 1HLTH 2GV7A 4Y8XA 4ISNA 3EA7A 3GCTF 4LXBH 2H2ZA 4DY7B 3DCLA 2HALA 2W6JD 4B76A 1J15A 1O3CA 1RTFB 1FQ3A 1NESE 3MH7A 2RG3A 2W3IA 1HAGE 1ETTH 4A92A 1SGCA 5KGOA 5GXPA 3FANA 3RXKA 4TWWA 1ZHRA 3MMGA 2ZC9H 4FUHA 1O5AB 3SN8A 4X6PA 2F3CE 1LKBA 2LELA 2Q6DA 1MUEB 1PFXC 3BG4B 5G4BA 2Z3CA 1TB6H 3M5NA 1TE0A 1C1PA 1K0HA 1O2OA 2WYGA 3B8JA 2PR3A 3BTKE 3P8NA 4MNYA 2H1UA 4X1QU 2HWLB 2SGQE 1NC6A 3VB5A 1F0UA 1YCPK 3SZNA 3MI4A 4NSYA 1NBME 1K1OA 2VH6A 1C5OH 3EAJA 2ZDVH 4B75A 1QQUA 1E1RD 3FAOA 2D1JA 3WY8A 2ZU1A 1AQ7A 1QJ6B 3BTEE 4TWYA 3S9CA 3TK5A 3UNRA 2WV5A 3M3VA 3DA9B 3P95A 3CS0A 2HRVA 1GVZA 3DT0H 4A7IB 4I8GA 1KXFA 3SOSA 1FZZA 3U8TH 3RMMH 3OY6U 8GCHG 1P2JA 1DPOA 1NTPA 1SOZA 5I25A 1GHYH 1AFQC 4TY7A 5C20A 1QB6A 4X0WU 3QLPH 2J98A 4THNH 1DX5M 3EA8A 1HAZB 1P8VC 2I6QA 3AW1A 1Z6JH 1UCYE 1IHTH 4WMEA 3A88A 1GI9B 1MD7A 1NRNH 5JDUB 3S69A 2ZWLH 3GCNA 3RXAA 2VIOA 3D23A 5AFYH 4K1EA 1GJAB 2UWPA 2KFWA 1P9SA 4WMFA 1C4V2 1DUAA 1ARCA 2TGAA 1EP5A 3GY8A 1MMJN 4D8NA 1YPMH 1H8ED 2G4TA 1W7GH 1TALA 1DE7H 3P92A 3AAVA 1BMNH 3QGJA 4JZDH 1GMHF 1ZPCA 1O5CB 3VXFH 1W11U 2FOAA 1NU9A 2AIPA 1NROH 4AB9A 4UONA 1KXEA 1H8HD 3HGNA 1O3GA 1F0SA 3MH6A 5EW2H 2O8WA 2CK3D 2SFAA 2H5DA 5FX5A 4KKDA 5ESTE 4CH8B 4Y8ZA 3TITA 2BY7X 3EE7A 4Q4LA 1WYKA 3BEUA 5GNDA 2WPKS 1E0FD 3QTVH 4MTBA 1C5LH 2VIVA 3TK6A 2RCEA 4A1VA 2QF3A 4H42U 2GDEH 1OYQA 5C1YA 4U01A 1KDQB 3UR9A 1ZHMA 2K0QA 1ELBA 3RM2H 3UOPA 2AMDA 1GBJA 4BTIB 1DWBH 3L33A 3UB0A 7KMEH 3A8CA 4X6NA 1EQ9A 3K65B 5EPYA 5TCCA 2R3UA 1SGNE 1TGBA 1LPGB 1O3OA 3PMJA 3ZVAA 3LGTA 2QA9E 2J4IA 3PB1E 1XXDA 1TRNA 3PTNA 1T4VH 3EYDA 3CENA 1YLNA 3JZ1B 2Z9IA 3F9GA 1PQ7A 1MABB 1CT0E 5JBCS 3KIDU 2D2DA 4O3TA 3ZZAA 3P17H 2PSYA 1THRH 1QRZA 3WWFA 1T8LA 2VIWA 1FXYA 1P03A 2BDHA 3A8DA 3MNXA 3TJUA 3A8AA 1O3BA 3ZZ7A 4CRBA 3NK8A 1C1RA 2OK5A 2H6MA 2GD4B 2BY8X 5EODA 2BD7A 3PLBA 4X2WA 2A7CA 3A7XA 2TIOA 4ASHA 2XC5A 1VZQH 3Q3XA 1O3AA 1W10U 5J4QA 1O2KA 2W26A 3BIVH 3VG8A 2ZCHP 1GBLA 3CNRA 1WAYB 2WPDD 1UVSH 1O2ZA 3TGKE 5FX6A 4DOQA 1IQNA 2F9VA 2XCFA 2FOEA 1ZR0A 4Y71A 2W7SA 6CHAC 1C2EA 1P02A 1OPHB 3SU3A 5IK2D 2BLWA 3A86A 3SW2B 1GCTC 1RD3B 2HLCA 3S7KB 5C94A 5CHAB 2KX4A 1GWAA 3H5CB 1CT4E 1V2LT 2ZFRH 1NFUA 5FPTA 4X8VH 4R0IA 4K1TA 4HTCH 1IQKA 4H4FA 1ELDE 3KCGH 1GBCA 1RIWC 2ZDKA 1WOFA 1WTGH 2EY4C 3LDXH 2AEIH 2DUCA 2XWAA 4MVNA 4UD9H 1QR3E 2BY9X 1G2LA 1C4U2 3MU1A 3RC4A 3PV2A 1MTWA 2BLVA 4FU7A 4ZAEA 2JETC 2BDBA 1CQQA 3SV9A 1X7AC 2KZ4A 3UOUA 1ETSH 3A87A 3SGAE 5IDKA 1H1BA 1Y3XA 2D26C 2HPQH 2ANWA 3P8FA 2XOKD 4FUCA 4IBLH 1L0ZA 1TMBH 1NS3A 1ZPBA 1V2MT 4YOIA 1TOMH 5F03A 1BRUP 3OTPA 1BBRE 5EXLA 2BDGA 3QWCH 1UTPA 1Z6EA 3ATWA 4Y11E 1HUTH 2WPMS 2EI6A 4RI0A 1WQVH 2F9OA 2P93A 1HAPH 1BTWA 3MU4A 2QC2A 1D4PB 3SQEE 2WPLS 2C4FH 3EE0B 4O03A 2XNDD 1TX8A 1IQEA 1OS8A 2Y6TA 2BD8A 4O9VA 3QGNB 1WV7H 2RA3A 2WPIS 3VB3A 2P3TB 1F5KU 1ZMJA 1QURH 3GYMA 1PQAA 1T7CA 3PTBA 1HJ9A 1A61H 4YZUA 1KSNA 3SORA 2CF8H 1TOCB 4LK4A 1C5RA 1Y8TA 5A8ZA 3RLYH 2Y80A 3SUEA 8KME2 1A0HB 1EAXA 3MNCA 2A5KA 4UFFH 1QL8A 1RTLA 3A80A 4MPWA 4NSVA 1AWHB 3HKJB 1GBEA 1XUHA 2BD3A 2L6OA 1Z71A 1GMCF 1V2NT 1JIRA 3PWCA 1NFYA 2QY0B 2Z9GA 1K1LA 1O3PB 2W5EA 2A7HA 4Z0KA 3BTME 1SGTA 3U1JB 3UTUH 2BDYA 2P8OC 3OTJE 1D3PB 4RSPA 3B23B 3MO9A 4D9QA 1O36A 4D7GA 1A5GH 1J14A 1E1QD 5DP3A 1EB1H 1TGCA 4WVPE 4Z6AH 2P95A 1XXFA 3SV7A 4GHQA 2M2AA 1AY6H 1LVOA 3GDVA 5L30H 2FPZA 1LHGH 3O8BA 1LDTT 1O2JA 5EQSA 1EAUA 3ZYEA 1DY8A 2H9HA 1VITH 3MOCA 1ZMNA 3H7TA 3RP2A 4CR9A 1SFQB 7GCHG 1AD8H 2VU8E 1TBZH 4AC9A 1KLTA 1SGIB 2ZGXH 1W0KD 3SBKA 1Z1JA 4FUBA 1FY4A 1GGDC 1O2LA 4NIXA 1CO7E 1H9HE 1GHWH 1V6DA 2ZFTA 1SG8B 1O2QA 1LTOA 2OC7A 2AHME 1AVWA 1XM1A 3CP7A 2HOBA 3RXLA 3I77A 2GV6A 1JXPA 1GJ5H 1O32A 4TSFD 4ZROA 3M5OA 5FBIA 4A1TA 2FOHA 2ZECA 2ZU2A 3DD2H 1GBKA 2LP6A 3RXEA 1C1TA 1VJAU 4SGAE 1UVTH 4KTCA 1C2IA 1S0RA 2R3YA 2ZIQH 1QHRB 1E34B 4JZFH 2V0BA 3NCLA 1P2KA 2A32A 2NWNA 4K69A 2BD9A 2J97A 4OS6A 3SJKA 2FX4A 3T62A 1H8DH 1CT2E 1VJ9U 2CGAA 4LZ1H 2IJD1 2J34A 1QTFA 4BOHA 1T4UH 1CHOG 1O5FH 2QV1A 2A7JA 1VGCB 4TPIZ 3P6ZB 5JBAS 4WJG2 4E06H 1NRSH 2KCAA 1O2YA 2XBWA 1Z8RA 2ZDLA 4XD7D 1FMGA 1L2EA 3A7TA 1GHAF 6GCHG 2WPHS 1GBDA 2WINI 1BHXF 5JB9S 3S9AA 2G00A 1U6QA 1D3DB 4P02A 3SU5A 3SNBA 3UWJH 5B6LA 3K6YA 4UDWH 1ORFA 1EZSC 1GJBB 1P06A 2GZ9A 1OX1A 1SBWA 3IWMA 1G30B 4ABAA 1A3EH 1J17T 3E6PH 4CRDA 3U28C 2WYJA 1TGTA 4ABBA 4O3UA 2PTNA 1THPB 1GBTA 1DSUA 2ZHDA 4I8KA 3SNAA 1GGDB 2AGGX 2FTLE 3O8CA 1XUIA 1A3BH 4MNXA 1CBWC 4MDSA 1JRSA 3DFJA 1SOTA 4HZHA 1LHEH 1ELFA 1O3HA 1A46H 4NIWA 5GIBA 2AMPA 1GHVH 5DSFA 5GDSH 1UCYH 2FS9A 2BD4A 4X1NU 4ABIA 3F9EA 3GOVB 4YO9A 3VEQB 2FM2A 4SGBE 1GL1A 2VVCA 2A4GA 1W0YH 3KQCA 1EOLA 1LQEA 3T5FH 2QCYA 2YMSC 1YPHC 1BRBE 1YGCH 2F83A 3F2HA 4DGJA 1O5BB 2SGPE 2PHBA 3LGIA 2F9UA 1XVMA 1ID5H 4DIHH 1B0EA 1DFPA 6LPRA 1BQYA 1H4WA 2HNTF 1GMDG 3BTFE 1T8MA 1LQDB 1ZTLA 5L2YH 2BZ6H 1EUFA 3RXSA 3A7VA 1CGHA 2PTCE 2H5CA 7ESTE 1QZ8A 3M7TA 4WH8A 3QTOH 1SGFA 1E36B 3BTTE 4BNRA 2DE9A 3TIUA 1AN1E 1YM0A 1JWTA 4KELA 4O97A 1THSH 5FPSA 1UJ1A 2XW9A 1FI8A 2VWMA 1EPTA 2YOLA 4WF8A 3S7HB 4WH6A 2G55A 4AFQA 4K3JA 1LVMA 2JH5D 5BPEA 4DT4A 3TJNA 2Q6FA 2IJOB 2G5VA 1HXFH 2WUCA 2FMJA 1TPSA 2EQNA 2FLRH 2FOFA 1K1JA 1ZSLA 4ZUHA 5HIZA 1FJSA 2PUXB 1RGQA 1NRPH 3T26A 1ZRBA 1RJXB 4H6TA 5C5OA 6GCHF 2WZQA 1ELGA 4DURA 4GAWA 3LGYA 4JZ1A 1QGFA 3BG4C 5LGOA 1PPCE 2G51A 3MFJA 3L3TA 1LCYA 1EB2A 1SHHB 3C1KA 1FY1A 1K2I1 4IN1A 1L4ZA 1CE5A 2ZGJA 3EGKH 3I78A 3U1IB 1GCDA 1GJ8B 1QL7A 2AYWA 3BG8A 2YMSB 1IQFA 4Y10E 4F4OC 5FAHA 1LHDH 3T27A 2WV9A 5DG6A 1TQ7B 1P2IA 1IQGA 1KIGH 2BMGB 1MH0A 2SGAA 3RXOA 1NRQH 1N1LA 1AUTC 1C5MD 3BEFB 2W3KA 1YCPM 4ESTE 1DXPA 3NZIA 1AKSA 1SLWB 3LH1A 4CRGA 3SHAH 5C0TA 2R0KA 5C5NA 4F48B 1SFIA 3QK1A 1C1UH 2FOGA 1EATA 1P11E 3FP7E 2HNTE 1QB9A 3P8GA 1SLXB 4D76A 1ESBA 1SGFG 1SGYE 1GVKB 4CR5A 3TH3H 2EI8A 1YY3A 1S6LA 1UTLM 2KCPA 1NPMA 1AB9B 1HNEE 2R9PA 1D3QB 4XSKU 1O2UA 1ZSKA 4HGCA 2IN2A 1W2KH 3HATH 4I32A 1UTOA 4I33A 5DJ7A 4YT7H 3AASA 3RUOA 3KL6A 1GJDB 2HPPH 1FNIA 3VB4A 1EZUC 1Y3UA 2ZCLP 5A8YA 2M5TA 4OS2A 2STBE 3P70B 3RXQA 5KECA 1DLKB 3R0FA 3B9FH 1IQJA 1HJ8A 1WCZA 4MLFB 1ANCA 4IMZA 1O2MA 2FXRA 2VINA 3SJ9A 2VB0A 4GSOA 1PPFE 2UWOA 5LPEA 3E8LA 3M35A 3VPKA 1AZ8A 2BD2A 4Y0ZE 1SGDE 5DPAA 2PGBB 1V2KT 1V2VT 4DVAU 4FVBA 3ATLA 4IW4E 4NIVA 1V2QT 4GCHG 4VGCB 2ODYB 1BHXB 3PMBB 1GI2A 1A5IA 2BVSH 3SNDA 4DCDA 1MTSA 3GY7A 5K7RA 4RKJB 1F92A 2EA3A 2ZHFH 4NIYA 1A7SA 4JK5A 4X1SU 1SHYA 2Q6GA 2SGDE 1O3EA 3D62A 1K1NA 1UMAH 3GDSA 4I7YH 1BTZA 1ZHPA 1O0DH 1BJUA 1TNJA 3N7EA 4CREA 1YC0A 2ALVA 5A0AE 1O2VA 3ELAH 3LGWA 3V0XA 4R8TB 1WUNH 5T6DA 1MTUA 1S84A 3SU6A 3PLPA 4ACAA 2R2WU 5IYTA 3F6UH 1BOQA 4K5ZA 1GI7B 2OC0A 1KXBA 5L6NH 1GJ4H 2QXGA 1W8BH 4HI3A 4AYVB 1UK3A 2EEKA 2OQ5A 3GY4A 2ZP0H 1AVXA 1NN6A 1ESTA 3LT3A 4XRNA 1G9IE 1XUKA 3RXHA 4ASUD 2QXHA 1ESAA 1GBFA 3PRDA 5EIYA 2O8UA 1LHFH 1XX9A 1INCA 1W7XH 3QZRA 3NUMA 3Q00A 2FWWA 5HM2A 3FFGA 5E0JA 3UFAA 5BRRE 3QUMP 3WWBA 2JH6D 1TYNA 1XKBC 4B6FA 3RM0H 4K1SA 1QY6A 3OEHD 4ABGA 3SNCA 2JJ1D 1MCTA 4I8HA 4X8SH 2AGIX 3SYJA 4ZKNU 1HJAC 2Z3EA 1T32A 1GI0A 1A5HA 1P2OA 3NKKA 4ZKRU 1BITA 1L1NA 5CHAC 1MBQA 4KTSA 1ELAA 2ALPA 2SNVA 5E0GA 2L74A 3U69H 4YOJA 2RDLA 1HAVA 2GGVB 2FI3E 1B5GH 1C2KA 1HPGA 1SC8U 3MWIU 2FEQH 1UW7A 4OGYA 5JPMH 1VCPA 5GWZA 2TGTA 2BOKA 3I29A 2CN0H 1UCYK 5HM9A 3KHVA 2HVXA 4YESB 1YPEH 1G37A 3F3BA 1RFNA 5T6FA 1FY3A 4UFEH 1N8OC 3V13A 1JIMA 1ZMLA 3MH4A 1O3LA 2PKAB 3GY2A 2C8WB 2ESTE 3KF2A 8GCHF 4XBDA 1BTPA 1F0TA 3E0PB 1A0LA 5FHTA 3A7ZA 4FVDA 4OS4A 2ZFFH 1YPJH 2RA0A 1TBQH 1DDJA 1YPLH 1LO6A 3U8OH 2KAIB 4ACBA 3ZZ5A 3RXGA 2UUFB 3M5LA 1ELCA 4NZLA 4YOGA 2O8TA 1A0JA 2ZGBH 2FS8A 2GT8A 3O8DA 3UIRA 2P3FH 4U2WA 4WY3A 5EW1H 1MQ5A 1P12E 1ZTJA 2ODPA 3O8RA 1UTQA 3OX7U 2VIDA 2IOTA 2ZF0H 1MTVA 2TRMA 4JK6A 5EJ1A 1HJAB 2OTVA 1B0FA 4Y76A 3M61U 4ZXXH 2TGPZ 2ZTZA 1QJ7B 3P8OA 3ESTA 4IC5A 1FY8E 4TY6A 1O34A 3HK3B 3IG6B 2A4QA 4CBOA 3PRBA 3SNEA 2HGTH 3UQVA 1TIOA 3EA9A 5EU8A 1Q2WA 2XWBI 2K1QA 1C1SA 1NZQH 1G36A 3KQBA 2XC4A 3RU4D 2C8YB 2F9PA 2OBOA 1OKXA 4WWYA 1TPAE 1TONA 3A89A 1KLJH 4X2VA 3ZVDA 3E1XB 1BTHH 1PPEE 2O8LA 2PP6A 2A5IA 2H9EH 2XXLA 2V6NA 5FBEA 2FTMA 1EP6A 3OU0A 2EC9H 2OP9A 1N8OB 3SUDA 3AK5A 3FVFB 3HK6B 1TAWA 3SV2H 4IS5A 1CA8B 3SI4H 1DITH 5FPYA 5AHGH 5CMXH 4M9FA 3M5MA 1EAIA 4IN2A 4E05H 1ZZZA 2VJ1A 3Q3KA 1SGEE 3RXDA 3PV4A 3MU5A 1MZAA 5C3NA 4B6EA 2PWXA 3TGIE 4RKOB 2A2QH 3H09A 1SQRA 3M7UA 2P59A 3FZDA 4J1YA 1DXWA 3UR6A 2ANYA 2J95A 2G4UA 2VVUA 4OM9A 1C5TA 1SLVB 3EQ0H 3SU0A 2B0FA 1AGJA 4KP0A 4AGKA 4CH2B 2QN5T 1HAIH 1SPJA 3AVZA 1TFXA 4DT7B 1C1NA 3FP8E 5ETXA 1EOJA 2GP9B 2JJ2D 4FUEA 2LPRA 1BT7A 1V2PT 1HXEH 3NPSA 1NM6A 3EDXB 3SHCH 1NFWA 1ZPZA 2B5TB 2VVVA 1GI8B 2UUYA 5DP6A 1UVOA 2A0QB 3ATIA 1AI8H 5EOKA 2XRCA 2ASUB 3FP6E 3FKSD 3OFND 4NG9H 3W1EA 1E35B 1O5GH 4PROA 1QBOA 2O9QA 5FCRA 1SL3A 1CGJE 2CF9H 1ANDA 1SB1H 1PPBH 3KQ5A 4WXVA 1KDQA 3RXBA 1O3KA 1AHTH 9LPRA 1NY22 3ITIA 2BY5X 1UTKA 3BTWE 4MPVA 2XC0A 2AMQA 4ISHH 5E2PA 3UPEA 1KXCA 2Z9JA 3SV8A 1HIAB 3BTDE 3T29A 1VGCC 3UAIC 4F55A 2G8TA 5PTPA 3W94A 4NFFA 1UTMA 1OP8A 1FPCH 1KTTB 2IPHA 1NU7B 4CHAC 4CBNA 1NFXA 4NZQA 3PM3A 3MU0A 2FDAA 1JMOH 3PWBA 1DWEH 4GHTA 1O2SA 4U30A 2QXIA 1SGPE 2FESH
chains in the Genus database with same CATH topology
2Y82A 4OS1A 2ZEBA 1SLUB 2A45B 1YBWA 3ZZ3A 1W0ZU 2FOCA 1YCPH 2C8XB 1VCWA 1GBMA 3RMNH 2VWNA 2R2MB 1YLDA 2ZU5A 3UUZA 5AF9H 1A4WH 1C5ZB 1J9CH 1TNIA 3ATMA 4JCNA 1A2CH 3H7OA 3LC5A 1AZZA 1C5XB 1CHGA 1HAXB 1Z8JB 1QFKH 1VITG 1YYY1 2A1DB 2VGCC 1MZDA 2FZZA 1ZLRA 3QDZB 5GPIB 2OUAA 2PFEA 2A31A 1K22H 1MD8A 1TA6A 1V2JT 2AS9A 4ABEA 1S6FA 2PV9B 2ZKSA 5LPRA 1K1MA 4B73A 3VB7A 1BDAA 1GI6A 1IQLA 2Q1JA 1O2NA 1FIWA 3ZYDA 2Y5HA 2PSXA 3SQHE 3RLWH 1C2HA 1IAUA 2NU0E 1ZYOA 5FCKA 2VH0A 3NXPA 1ABJH 1QB1A 3VGCC 1HYLA 1GHXH 1C2LA 2BLOA 3PYHA 2CV3A 2H9TH 2AGEX 1GBBA 1K28D 4CHAB 4WXIA 3D65E 1FAXA 1O39A 4ZKSU 3SV6A 2FOMB 4CRAA 2J9NA 3ZV9A 3KEEA 3RMLH 3ZVCA 1SR5C 4B1TA 1UK2A 1HDTH 5EQRA 2ODQA 1GI1A 1AUJA 3K2UA 3E90B 4F49A 2WPJS 5EXNA 3MNSA 1O35A 2OBQA 2BHGA 1GI3A 1EJAA 5DO4H 4BXWA 2VGCB 1PQ5A 4Q80A 4AFZA 1P05A 1BRCE 1AE5A 3T2NA 3RU4T 4OS7A 2ZHQH 1S85A 1TNHA 7GCHF 1K21H 3V3MA 1O2RA 3TNSA 3PO1C 1ZGVA 2BY6X 3MO3A 4Y7AA 4NFEA 3TNTA 3IITA 1GDQA 4AYYB 4A5TS 2ZPSA 1V2RT 4I8LA 4JYTA 3BTHE 1MQ6A 3UY9A 4Y7BA 1TNLA 1EX3A 3MNBA 4DG4A 3VGCB 4FUJA 4ABJA 3MHWU 3Q77A 1F5LA 3BN9A 1GHZA 2OCVB 4D7FA 1G3EA 3SI3H 4UFGH 1E38B 2AERH 5JYIA 5HXFA 2ZHWH 1FUJA 1S81A 1D6WA 3QN7A 1AU8A 2XNIA 1RXPA 1AB9C 2W7UA 1JOUB 1OP0A 4JYVH 4AX9H 1GBHA 1CHOF 3M3TA 5ABWA 3LJOA 5EPNA 4ABDA 3KQEA 2P16A 1DWDH 2CJIA 2UUKB 1ELEE 1CGIE 3RXMA 3AW0A 1WBGB 5GJ4B 3RC5A 1BJVA 1S83A 4ABFA 1FAKH 2ZDMA 3AAUA 4I8JA 2XBVA 2A2XH 1GHBG 2ZFPH 3PO1B 1TLDA 1HB0B 2C3SA 4NA8A 3SU2A 1OWJA 1N6YA 3E3TA 2BQ7B 1TX7A 1BTYA 1GDNA 4K2YA 1ELTA 4INKA 1Y3VA 4NWLA 1O2XA 1T8NA 3ATKA 2ZU3A 1BUIA 5DP4A 2BXTH 3U8RH 2BB4A 1JBUH 1O5EH 3QZQA 4K8BA 4NA7A 1EAWA 4VGCC 5C1XA 1TPPA 1MAYA 1ZTKA 3BF6H 4TYDA 3ZV8A 1MKXH 4AFUA 1HAYB 1UO6A 4FU8A 5E0HA 1LVYA 2ZO3H 1C5YB 5DP7A 1QNJA 4NGAH 1A1RA 1V2UT 3LGUA 4AOQA 1W13U 2ZQ1A 1GMDF 2ZNKH 1D9IA 2ZFSA 3OSYA 5E2OA 4ZHLU 1P10A 1NT1A 2C90B 2J92A 1C9PA 1C1MA 1CU1A 1Y3YA 3STIA 4WMDA 5B6OA 2PW8H 1TRYA 3SUGA 4AG2A 2BOHB 3U98H 1GMHG 1QA0A 1C5PA 4YTAA 3RMOH 1MKWH 4ISIH 3SU4A 3LIWA 1FV9A 1F0RA 3HGPA 4D9RA 1KXAA 2NU3E 2J38A 2Z6BD 2XTTB 2FI5E 5SGAE 4DJZB 5HYOA 2ZI2H 1TWXB 1QJ1B 5A8XA 4E7NA 4XFQA 4Y79A 1KXDA 3RXPA 1Z8IB 2CXVA 1AE8H 1F2SE 3KNXA 1BTUA 4K60A 4YT6H 3RXIA 2V3OH 2HNTC 3C27B 1UVUH 1BBRH 4GVUA 3F1SB 2ULLA 1YPGH 2NU1E 1EJMA 1TA2A 2ILNA 1O3FA 3E16B 1CSOE 2ZPRA 1O2IA 4FXGH 1P2QA 2C93B 1KY9A 3TGJE 4Q7XA 4AZ2B 1XUFA 2FYQA 2P94A 4X1RU 2FOBA 3GCOA 4X8UH 4ZHMU 5EG4A 1V2ST 5A0BA 1GHBF 3ZVFA 3ZZDA 3RXRA 1SQTA 2QF0A 2GMTC 3A85A 1TABE 1GG6B 3KN2A 2YNBA 1DANH 5TCAA 4Q2KA 1XUGA 2GZ7A 5GCHG 2V3HH 4JMYA 3CS7A 2UWLA 3R3GB 4K8YA 4INHA 1EASA 1Y5BT 2BZAA 3Q76A 2BYAX 1FDPA 5C1UA 4Y6DA 2ZTXA 1QCPA 1LPZB 4MNVA 1RRKA 1Z7KA 1O3JA 5HMAA 1GBIA 1C2JA 1YLCA 2V35A 3SJOA 2J2UA 1G3CA 4X1PU 1OWKA 1VR1H 2ZDAH 8LPRA 1BIOA 1BRAA 1O2GH 3UREA 2PUQH 5ESBA 1GJCB 1GVLA 1OWIA 2ZG0H 1XKAC 4GUXA 4BTUB 2QIQA 3V7TA 2ZHEH 1J8AA 2FIRH 4UEHH 4FUDA 3FZZA 5T3HA 5EQQA 1O3IA 1PQ8A 1DOJA 4ISLA 4XBBA 6ESTA 1SI5H 4CRFA 1HAHH 4X6OA 1NO9H 2GMTB 2JKHA 1AWFH 3BIUH 1KLIH 1Q3XA 2AH4X 1OSSA 4MNWA 1PPHE 4BAOB 2ZU4A 5A2MH 2YNAA 3VXEH 4RN6A 1H9LB 1YP9A 3F68H 1BA8B 1O5DH 2OINA 3PROA 2PKSC 4J2YB 2QYIA 3U9AH 1AVGH 3BSQA 1AFQB 1GJ7B 1IQIA 3UQOA 4GCHF 1W3CA 1T31A 4A1XA 1C5UA 3ODFA 2BTCE 1IQHA 1ZJDA 3QX5H 2GCTC 1TQ0B 1V3XA 1PYTD 3SGQE 2ZCKP 3BV9B 3ZZBA 3MH5A 4M7GA 4IC6A 1C2DA 5C67A 4JZEH 3GDUA 1P9UA 1HRTH 5GCHF 1IQMA 4INLA 2XYAA 1HBTH 3A84A 3ENSB 3LC3A 1ZJKA 1HCGA 2CMYA 1F5RA 3MYWA 1P3EA 2GDDA 1ZGIA 3VFEA 5DK1A 1S82A 2OLGA 3LPRA 4FUFA 1O2PA 3S0NA 2GVFA 1YF4A 3BTGE 1EZQA 1ANEA 4FU9A 4BAHB 1BMLA 1EZXC 2UUJB 1C5NH 1SVPA 1PYTC 2GKVE 1LPKB 4H6SB 3T28A 1AMHA 1GMCG 1RS0A 1DVAH 4UFDH 3GICB 3ZZ4A 1YPKH 1KTSB 1AFEH 5K0HA 3RXVA 2Z7FE 2XBYA 2Z94A 3LOXA 2Z9KA 1P09A 3RU4E 3MU8A 2TGDA 4GPGA 4AGJA 2I6SA 3URCA 2PKSB 2B9LA 4I31A 2LNCA 5JBTA 1PJPA 1Y59T 4JYUH 1TX6A 3GY3A 1O3NA 1TNGA 5CE1A 3A7WA 1LMWB 4TPYA 3GCHC 1C5QA 1JRTA 1K1IA 2BM2A 2A4OA 1C1QA 5DP9A 3SO3A 2GCTB 4MQAA 3ZZ9A 1MCVA 2BDCA 4BAMB 4NA9H 3SJ8A 1DLEA 4ZH8A 1H9IE 1BZXE 1QBVH 4A6LA 1EKBB 4KTUA 5EXMA 1EPTC 1P04A 5A09A 3E0NB 1YKTA 2QXJA 5F8ZA 2BQ6B 3PLKA 5E8EH 1C1OA 1O2HA 1CA0C 3GY6A 3NWUA 1ZRKA 1AIXH 1IHSH 1WQSA 2AFQB 4B2BA 3RXJA 4OS5A 1O33A 1MKXK 5LH8A 1DS2E 5HGGA 3G01A 1ZOMA 3A81A 2R0LA 1L4DA 2ZTYA 4LOYH 1OP2A 2VIQA 1TGNA 4LZ4B 1F7ZA 2FI4E 3A7YA 2GTBA 5AFZH 2BD5A 3RDZA 1LVBA 1HAOH 2QGRA 1H8IH 1OWEA 4GLYA 2GX4A 4JZIA 3LH3A 1GBAA 2BVXH 2ZFQH 2VWLA 1C4Y2 1P2MA 3OYPA 3BEIB 5JBBS 4AB8A 1DM4B 3GISB 3SU1A 6CHAB 3S9BA 3KQDA 3ZZCA 1V2OT 2VIPA 3TU7H 3F9HA 2OQUA 1O37A 1UHBB 1SGQE 1GCTB 1SQAA 1MKWK 1O3MA 2Y81A 3ZVGA 1BB0B 3LJJA 4MPXA 3PMAB 1TMUH 2Y7ZA 7LPRA 1S6HA 2XBXA 3M37A 1RIWB 3MTYA 8ESTE 3GCHB 3M7QA 1GHAG 1NRRH 4UE7H 1GDUA 2F9NA 1DY9A 2PGQB 2BDIA 2G5NA 3RXCA 4X2YA 1ARBA 3BTQE 2JETB 4B74A 4IMQA 3VB6A 2OXSA 3F9FA 1BBRK 1FY5A 1MTNC 3DUXH 1ABIH 3N7OA 1EPTB 4ZMAH 4B2AA 1FONA 1LHCH 1UTNA 4AG1A 1Z1IA 1TNKA 1CA0B 2SNWA 3E91A 2FLBH 1PPGE 4Q7YA 5L2ZH 4IGDA 3TJVA 3L6PA 1T8OA 2PKAA 3JZ2B 2BQWB 3UNSA 2BX4A 4XE4A 5DKMA 2ZA5A 1FN6A 2EI7A 1O30A 1WU1A 1OWDA 2G52A 1Q31A 2VNTA 1C2MA 4XOJA 1ETRH 1O2TA 1OWHA 1W14U 1ANBA 2GZ8A 1IOEA 1FN8A 1PPZA 2F9BH 2ZGCA 2KAIA 3A8BA 4DIIH 4AORA 1Y5AT 1G2MA 3ZVEA 2ANKH 3STJA 5DP5A 3RC6A 2Z9LA 3GYLB 4X6MA 4ZKOU 2ZZUH 3A83A 4FUGA 4AFSA 2FODA 3HPTB 4MG3A 1ACBE 1GI5A 1E37B 1O2WA 3TVJB 3TH2H 1DWCH 1S5SA 2Y5GA 4FUIA 2SGEE 1W12U 1MU6B 1AKSB 1MBMA 3K9XB 4NWKA 1Y3WA 4Y8YA 2BX3A 3UWIA 1OYTH 2BDAA 3A82A 9ESTA 1MTNB 3SJIA 1TRMA 5TJXA 4YLUA 2DE8A 1TBRH 1OOKB 1O3DA 2P8OB 5JB8S 1K1PA 2JH0D 3M36A 2J94A 1O38A 5FXLA 2D8WA 1D6RA 1YPHE 5EGMA 1C9TA 1Z8GA 2AIQA 3ZZ6A 1RTKA 2FX6A 1GJ6A 2CHAC 2O8MA 4B2CA 5I46H 1HGTH 1LKAA 2A5AA 3LONA 3RXTA 2ANMH 2NU2E 3W95A 1UVPA 1OXGA 3K6ZA 5A0CA 1EJNA 3URDA 4OGXA 3T25A 2OD3B 2STAE 5F8TA 1TMTH 4YM9A 3HKIB 1GJ9B 4QT8C 1SQOA 1XVOA 2GT7A 3ZZ8A 4E7RG 2NU4E 3M3SA 5AVDA 1EXFA 5LPFA 1C5SA 2GCHG 4BAQB 3MO6A 2ZDNA 4CRCA 1QL9A 1XUJA 1TPOA 4NCYA 4Q7ZA 2WUBA 1QBNA 1GI4A 1L1JA 1UTJA 1Y5UT 1BCUH 1DICA 1FLEE 2WV4A 4BANB 3V12A 1AO5A 3GCTG 1KYNA 4BXSA 1SSXA 2SGFE 1VCQA 3SUFA 1GL0E 1P0SH 3GY5A 1VITF 2ZPQA 1GPZA 1L1GA 4HFPB 1P01A 1UHBA 1P57B 4YLQH 1D3TB 2FYRA 1C1WH 4KGAA 2PLXA 1C5WB 2G81E 5DP8A 1WSSH 2P3UB 1XMNB 3QO6A 3TPIZ 4BAKB 1BTXA 4XDEA 2BXUH 5F6MA 1QQ4A 3Q3YA 1J16A 2Z3DA 1HFDA 1HIAA 2CHAB 1TGSZ 3LKWA 1QA7A 4B71A 1FPHH 3RXFA 4ABHA 1QIXB 1DUEA 2C8ZB 2TPIZ 1ELVA 3OY5U 2ZGHA 4Y0YE 4X8TH 5T6GA 2FP7B 3SGBE 3UNQA 1DT2A 1UK4A 4ZHAA 1BMAA 1ZSJA 5DGJA 1HV7A 4U32A 2BLQA 5H4IB 1V2TT 1FIZA 1MAXA 3DHKH 5F8XA 1CBWB 4ISOA 3TLOA 2TBSA 1P3CA 2OC8A 4AN7A 1CVWH 1K9OE 1N6XA 3PMHB 1C1VH 2VWOA 2ZQ2A 4ZXYH 1QRXA 3LU9B 2OC1A 2XCNA 1SGRE 4MPUA 4DW2U 3D49H 1MU8B 1BMMH 1G32B 3RXUA 1C5VA 3TH4H 1WTHD 3KGPA 4BTTB 4X2XA 2Y5FA 3ZVBA 1C2FA 1S0QA 5C2ZA 1QRWA 1P2NA 3TK9A 1B7XB 1O31A 2THFB 4XBCA 1V2WT 5J4SA 2Y7XA 1SMFE 2FO9A 2GCHF 2B8OH 2B7DH 1DSTA 2QAAA 1M9UA 2A4RA 2BVRH 3TJOA 1HAVB 2F91A 3ODDA 1C2GA 1GG6C 1G3DA 3DFLA 3LGVA 1G3BA 1HLTH 2GV7A 4Y8XA 4ISNA 3EA7A 3GCTF 4LXBH 2H2ZA 4DY7B 2HALA 4B76A 1J15A 1O3CA 1RTFB 1FQ3A 1NESE 3MH7A 2RG3A 2W3IA 1HAGE 1ETTH 4A92A 1SGCA 5GXPA 3FANA 3RXKA 4TWWA 1ZHRA 3MMGA 2ZC9H 4FUHA 1O5AB 3SN8A 4X6PA 2F3CE 1LKBA 2Q6DA 1MUEB 1PFXC 3BG4B 5G4BA 2Z3CA 1TB6H 3M5NA 1TE0A 1C1PA 1O2OA 2WYGA 3B8JA 2PR3A 3BTKE 3P8NA 4MNYA 2H1UA 4X1QU 2HWLB 2SGQE 1NC6A 3VB5A 1F0UA 1YCPK 3SZNA 3MI4A 4NSYA 1K1OA 2VH6A 1C5OH 3EAJA 2ZDVH 4B75A 1QQUA 3FAOA 2D1JA 3WY8A 2ZU1A 1AQ7A 1QJ6B 3BTEE 4TWYA 3S9CA 3TK5A 3UNRA 2WV5A 3M3VA 3DA9B 3P95A 3CS0A 2HRVA 1GVZA 3DT0H 4A7IB 4I8GA 1KXFA 3SOSA 1FZZA 3U8TH 3RMMH 3OY6U 8GCHG 1P2JA 1DPOA 1NTPA 1SOZA 5I25A 1GHYH 1AFQC 4TY7A 5C20A 1QB6A 4X0WU 3QLPH 4THNH 1DX5M 3EA8A 1HAZB 1P8VC 2I6QA 3AW1A 1Z6JH 1UCYE 1IHTH 4WMEA 3A88A 1GI9B 1MD7A 1NRNH 5JDUB 3S69A 2ZWLH 3GCNA 3RXAA 2VIOA 3D23A 5AFYH 4K1EA 1GJAB 2UWPA 1P9SA 4WMFA 1C4V2 1DUAA 1ARCA 2TGAA 1EP5A 3GY8A 1MMJN 4D8NA 1YPMH 2G4TA 1W7GH 1TALA 1DE7H