5A8YA

Crystal structure of human neutrophil elastase in complex with a dihydropyrimidone inhibitor
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
218
structure length
216
Chain Sequence
IVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potent and Selective Human Neutrophil Elastase Inhibitors with Novel Equatorial Ring Topology: In Vivo Efficacy of the Polar Pyrimidopyridazine Bay-8040 in a Pulmonary Arterial Hypertension Rat Model.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords NEUTROPHIL ELASTASE
total genus 43
structure length 216
sequence length 218
ec nomenclature ec 3.4.21.37: Leukocyte elastase.
pdb deposition date 2015-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5a8yA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5a8yA02
1GI6A 2VIPA 3GICB 1CT0E 3M5LA 3NPSA 1O2JA 2QAAA 5C1YA 2RDLA 3KL6A 1TE0A 1FJSA 1AU8A 5EODA 1AB9B 3STIA 1VGCB 3Q00A 1EKBB 3GCHC 1DWBH 3KN2A 4TPIZ 3V13A 4NA9H 2QY0B 1YF4A 1VGCC 2WV4A 3H5CB 1NZQH 3ZZAA 1H9IE 1SHHB 2ILNA 3RUOA 1J8AA 1V2JT 4K1TA 2I6SA 8GCHF 1OKXA 1VZQH 5FHTA 1O3FA 4GAWA 1PJPA 1W0ZU 2XWBI 5EGMA 2QCYA 1ARBA 1LHFH 2NU3E 3P8FA 1GVLA 4YESB 4DOQA 1GHBF 4LK4A 1AKSA 2FOHA 2FTMA 2ODPA 1SQAA 2WV5A 1UMAH 1CA8B 3PO1C 1GJ6A 3M5NA 1G3CA 5GJ4B 1BOQA 1BTYA 1OP2A 3EA7A 3AVZA 4WMDA 1AIXH 2H6MA 3A8CA 1SBWA 3SV8A 3EYDA 1YLCA 2H1UA 1BTWA 1F0SA 3NZIA 1XUJA 3MH6A 4Q80A 1EQ9A 4AYVB 1UTOA 1F0RA 1GCDA 1GI0A 1P05A 1O39A 2FOAA 2RG3A 4X1SU 3TK6A 3E8LA 4NIWA 5ESBA 1P2JA 5C1XA 2ZFPH 1PQAA 2WINI 1TYNA 1CU1A 4FU7A 4B2CA 3TK9A 1NRNH 1SB1H 2ZDAH 1A61H 3UWIA 4CBNA 1YLDA 7LPRA 2BOKA 4ABGA 2BLWA 1TNGA 3A7ZA 4X2XA 1BTUA 1FONA 2ZDLA 2M5TA 1O5GH 5JB8S 3R0FA 1O2MA 4ISIH 1AUTC 2BDAA 1G2LA 2UUYA 2TBSA 2ZA5A 1P2MA 1LHGH 1CHOF 3MNXA 2PHBA 1RTLA 2GGVB 3OY6U 3CENA 4JZDH 1HBTH 4OS6A 3URDA 1GGDC 4AX9H 4VGCC 3UR6A 1AHTH 2VVVA 1TPPA 3PROA 2A0QB 1O3JA 3D23A 4LZ4B 3JZ2B 4DCDA 4VGCB 1C2IA 3F9FA 1QQ4A 3SO3A 4D7GA 1LHDH 3IITA 3BG4B 1GVKB 1PQ7A 1ETTH 1TFXA 4LZ1H 1MTVA 1HDTH 2ZHWH 2F83A 1C2DA 4GHTA 4BTTB 1GJ7B 3WY8A 1UTNA 4Q7YA 5HMAA 2FTLE 3DHKH 1BUIA 3DA9B 4XE4A 1MU6B 2BD9A 4FUEA 2BQ7B 4IC6A 4DVAU 3ZZ8A 2PUXB 1O3IA 4XOJA 2Y7ZA 1GHAF 3H7TA 2NU0E 2Z94A 2VIOA 1L1GA 5TCCA 1OWDA 4OGYA 1O37A 1DT2A 3G01A 1KYNA 1HFDA 3A8DA 1W7XH 1FQ3A 2R0LA 4WY3A 1HRTH 1ANEA 5A8ZA 2QYIA 4U2WA 3UUZA 4INKA 1GDNA 5AFYH 3HPTB 2VH6A 2GZ8A 4UFDH 1C1WH 2HLCA 4X6PA 3A84A 1FY3A 1LHCH 1Y3YA 4NA7A 1U6QA 4JYVH 1GBEA 1UTQA 1S84A 1BQYA 4IC5A 4TWWA 4R0IA 2GVFA 1A0LA 3BIUH 1K1MA 3SN8A 4X2WA 1H8IH 4BTUB 3GCNA 2WUCA 2SGPE 2J2UA 3F68H 3F9EA 7GCHF 5DP7A 4B71A 1ZHMA 3ZV9A 4OS5A 1Y3XA 4X8UH 2D1JA 3C1KA 1NC6A 1W0YH 3V7TA 1OYQA 2DE8A 1QRWA 1C2HA 1SL3A 1AO5A 2FDAA 2V35A 2QA9E 2ANKH 2Y81A 5L2YH 3U98H 3PO1B 3QDZB 5DP9A 2ZU5A 5A09A 3NCLA 3ZZ6A 1GJCB 1TOMH 1WSSH 1Z71A 2O9QA 1B0EA 3RXVA 2FOMB 1HUTH 5C3NA 3GCTG 3GOVB 1DUEA 1HIAA 1P03A 5EXLA 2TIOA 1OP8A 3SV7A 1H9LB 3FVFB 4Y8ZA 2G51A 3RXPA 2GT7A 1FY8E 1K1NA 4SGAE 3RXBA 3P8OA 1CO7E 1T4VH 1UTLM 3O8CA 2BLOA 5K0HA 3FP8E 2AGGX 1MTNC 1A2CH 1LKAA 2VIDA 1C5UA 5HM2A 5T6DA 4BOHA 3SV6A 3SNDA 1P10A 3QN7A 4MG3A 1P12E 3ZZ7A 1RTKA 3RU4T 1KXCA 2CV3A 3AASA 3ATKA 1OWEA 1TGBA 1LVYA 5CMXH 1LKBA 1UCYK 3ESTA 1BTHH 1C5ZB 4H42U 5JYIA 1OPHB 2ZGJA 3HGNA 1NPMA 1WUNH 4I8KA 3BTDE 1W3CA 1FN6A 3TU7H 1IQJA 1V2RT 1C1NA 4A7IB 1C5LH 3E90B 1HAOH 3P8GA 2OQUA 3RU4E 3HGPA 4RKOB 1W2KH 3A87A 1CHOG 3B9FH 4IMQA 2Y6TA 1SVPA 2ZU3A 1KXFA 1K28D 1ELBA 1HXFH 4BAMB 3TNTA 1PPGE 3KNXA 3TJNA 4A6LA 2WPHS 2BY5X 3LT3A 1IAUA 5F8XA 2H9EH 5PTPA 1GHYH 1A5HA 1C9TA 4ZAEA 3I29A 1G30B 1OWHA 5E2PA 3F6UH 4MNWA 2ZGHA 3A88A 2FOGA 2FI4E 1KTSB 3P95A 5DP8A 1GWAA 1E36B 2XWAA 1T8NA 2FX4A 2W3KA 1F7ZA 1QTFA 2P16A 1Z1JA 1GHWH 3GDUA 3GY5A 4B2AA 1C1OA 1C5RA 3EDXB 3RXEA 1YPHE 3EA9A 5JPMH 1CT4E 1TMTH 2FMJA 2QXHA 1C5VA 3AW0A 1RGQA 2Z3EA 3ZZ3A 4NFEA 1PYTC 3LGVA 1BMMH 4BXSA 1KLJH 1SI5H 1THSH 3RMLH 1QA7A 4AB8A 1K1OA 3SHAH 5L6NH 1XMNB 3LPRA 1C5MD 3FP6E 1DS2E 4YT7H 3HK3B 2PV9B 1ZSKA 3MNBA 3A7WA 3DFLA 2C90B 4ABIA 4GLYA 5C67A 1ZMLA 1GBTA 5EQRA 1NROH 1YC0A 3LGWA 1BRUP 2W3IA 4TY6A 1GI1A 2C8WB 1ZMJA 1T8LA 3RXMA 3Q77A 3RMNH 4DGJA 2ZQ1A 1KDQB 3SGAE 3D62A 1S82A 3S9CA 1ANCA 2O8WA 2VVUA 1O3AA 1YCPK 4NIVA 3E1XB 1TRNA 4ZMAH 1MCVA 3QWCH 2QV1A 4IBLH 1JOUB 1EZSC 2QIQA 1QURH 1QBOA 1CGIE 1LCYA 2XRCA 1HIAB 3K6ZA 1HAZB 4ISLA 1TGNA 1QFKH 3E3TA 3LC3A 2BX4A 5GPIB 1GI8B 2F91A 6CHAC 3M5OA 3SU3A 4CH2B 1Z7KA 2HPQH 2BZ6H 1AGJA 2C3SA 2V3OH 4I8HA 1EB2A 1O5CB 1PQ8A 3MH7A 1EPTC 1VITF 4K2YA 2ZU1A 4GCHG 3A83A 1GG6B 2A5AA 4MPWA 3MMGA 2UWOA 4CREA 1CBWB 1C2KA 3SJ8A 1GG6C 1PPBH 4JK6A 5C1UA 2XC0A 2J9NA 5BPEA 1O2RA 1C5PA 2HALA 3NWUA 1BDAA 4WWYA 2ZGXH 2Z9KA 3QZQA 1O3BA 1PPZA 3GISB 2R2WU 3RLWH 2ZTYA 4HZHA 1GJ8B 2JETB 5HM9A 2W7SA 2C93B 3A81A 3TH4H 3SNBA 2FOFA 1ELGA 4KTSA 1K1JA 2ZF0H 3RMMH 3T26A 1UVUH 1WTGH 4NZQA 5EPNA 2OC8A 4AG2A 1MAYA 5IDKA 3U8OH 2CGAA 1O31A 1EZUC 1FI8A 2ZDKA 3RC6A 3EGKH 1AI8H 3L6PA 1AZ8A 2BY7X 3A7TA 4UEHH 7KMEH 4UFEH 2ANYA 3LKWA 1IQFA 9ESTA 3SZNA 4CHAC 1P9SA 3PMAB 1MTNB 1C2JA 1GMDF 4I7YH 2XNIA 3T2NA 2ZHDA 3LJJA 1IQKA 1C2MA 4M7GA 1HJ9A 2R2MB 4BAHB 3TPIZ 4IGDA 1TX7A 2ZKSA 4ABBA 1TGCA 2O8UA 1AVWA 2BXTH 1ZJKA 1BRCE 3R3GB 1BMAA 3LONA 4Y7AA 4TYDA 4XDEA 1CA0B 1YPEH 9LPRA 4O9VA 2A45B 4X0WU 2ZTXA 1KXEA 2K1QA 3V3MA 1MKWK 2XCFA 3S69A 3Q3XA 2CF9H 2I6QA 1KLTA 4KELA 3ELAH 3SUFA 1XUGA 4ZUHA 2THFB 4FUHA 1SGFG 1L2EA 1PPHE 2A4QA 1S85A 4A92A 4CRCA 1DLKB 2XTTB 1O2QA 1ETSH 4FVBA 4I8LA 3O8BA 1ZPZA 2NU1E 1PPFE 1DY9A 2AMPA 2ZWLH 1JMOH 5DP4A 1HJ8A 4X1PU 1ESAA 3M7UA 1FN8A 1IQNA 1FY4A 2ZFFH 3FZZA 1C4V2 1Z1IA 1T31A 3URCA 1C5OH 3BTEE 1SR5C 2HRVA 2ZGBH 2BD2A 1ZSLA 7ESTE 1EP5A 1EZXC 1GPZA 4KP0A 4OS1A 4ABJA 1A3BH 2FOCA 4JMYA 3GY7A 4LOYH 2EA3A 5EQSA 5EPYA 4XBBA 1YPJH 1MUEB 2A4OA 1AB9C 1QIXB 1ARCA 1S6HA 4PROA 3QLPH 1JIRA 2ZI2H 3FANA 4THNH 2LPRA 5C20A 3MYWA 2AIQA 1Q3XA 1TGTA 1SOTA 3SOSA 1ZPBA 3PLKA 2F9UA 2ANMH 1ORFA 3SU4A 1TLDA 1QGFA 1B0FA 1BRBE 3M3TA 4DIHH 2XXLA 1QB6A 4CR9A 1C1PA 1G2MA 3DD2H 1GI2A 2PLXA 1FPHH 2ASUB 1F2SE 3MO3A 2Z9LA 4GSOA 1GBHA 1HYLA 4WMEA 4BAOB 1AKSB 2FOEA 3T62A 1A46H 3MO6A 1P9UA 2ZDVH 5G4BA 4F49A 3BTFE 3DUXH 3VB4A 3LH1A 1PPCE 1Y5AT 5FX5A 2UUKB 1SGIB 3PLPA 1NU9A 2H9TH 3E6PH 1UO6A 1O2XA 1CE5A 1UK3A 3M3VA 4AFQA 8KME2 1AMHA 3KHVA 3VXFH 5K7RA 2YNAA 1RIWB 2G4UA 5HXFA 2AMDA 1FAKH 1C5XB 1WAYB 4I8GA 1NRRH 1ZSJA 2F9OA 1C2EA 3TVJB 5EOKA 1Z6JH 3LU9B 4NA8A 3E0NB 1O3CA 4ZHMU 1G3DA 3TITA 3OX7U 1GJ4H 4WXVA 2Z9GA 1C2GA 1LTOA 3KEEA 3SGQE 1EB1H 1CHGA 1PQ5A 2BMGB 2HNTE 1L1NA 1V2UT 2BB4A 2B9LA 2CMYA 1N6XA 4FUFA 4ISOA 1HAYB 1ZGIA 4HI3A 3UPEA 3SGBE 5E0HA 1TALA 1DVAH 1GHBG 3SBKA 1SG8B 4Z6AH 4Y7BA 2SGQE 1CA0C 1MH0A 2CN0H 1O36A 1UCYH 1WYKA 1GDQA 4AB9A 3HKIB 2A5IA 2QXGA 2BD4A 1NFXA 2XW9A 2VWMA 1C4Y2 3ATWA 3RXLA 1NTPA 4Y0YE 2BXUH 2B7DH 1D6WA 3ZV8A 3PMBB 2HNTC 3RXRA 4MLFB 3O8RA 1QRXA 3OY5U 3VB6A 1C5WB 3ATIA 4XFQA 1AE5A 2C8YB 4Y8YA 4MNYA 1O33A 2UUJB 1QBVH 4KKDA 4E05H 3D65E 3B8JA 1HJAB 1VJ9U 2RA3A 4Y11E 4OGXA 3L3TA 2BLVA 4B1TA 5EQQA 1SGTA 3PYHA 1GI5A 1JIMA 1GMCF 2FYRA 2XYAA 3T28A 1GMDG 4FUDA 3SNAA 5L2ZH 3PB1E 2BX3A 5FBEA 1A0JA 1QA0A 1FY5A 1O2OA 2PKSB 1N1LA 3EAJA 1E0FD 1A0HB 5E0JA 4YZUA 3SUDA 3M35A 1TNJA 4Y10E 3A7YA 1AFQC 4U32A 1O2SA 2H5DA 2AIPA 1G37A 1YPKH 3ZVEA 1WOFA 3P6ZB 1TOCB 1C1SA 1RRKA 1GBBA 1GJAB 1C5QA 5GXPA 5EW2H 1DSTA 1Q2WA 1ZZZA 2NWNA 2D26C 2A32A 3GY3A 4A5TS 1FAXA 3U8TH 2A31A 3K9XB 4Q2KA 4DY7B 3ODDA 4ABAA 2JH5D 3LIWA 4DURA 3OU0A 3MH4A 4AG1A 1SFQB 4CRGA 1FZZA 3GY2A 2H5CA 1NY22 3M7QA 2BY6X 1DITH 3BF6H 4X6NA 1FUJA 4NSYA 2FP7B 3M7TA 3GDVA 1H9HE 1K21H 4X1RU 3VGCB 1EUFA 2AS9A 2Z7FE 2FIRH 1ELVA 1C5TA 3ODFA 5EU8A 1YKTA 1YPGH 1BT7A 4ZH8A 1DANH 2A2XH 1GHAG 1VITG 1JRSA 1G32B 1ELDE 1XM1A 1UHBA 5AF9H 1FV9A 1SLVB 5C2ZA 3AAUA 1TRYA 2QXIA 2BVSH 1UVTH 1TIOA 1AQ7A 1DWEH 4Y8XA 2OC7A 1L4ZA 3SJOA 1P2KA 4FUBA 2VINA 1XKBC 4ABHA 1HPGA 2ALVA 3MU1A 5AFZH 4FXGH 1GBFA 1FXYA 3V0XA 5LH8A 1DPOA 1SGCA 1KSNA 3M36A 1KLIH 1WQSA 2VNTA 2ULLA 4SGBE 2ZIQH 1MKWH 2FZZA 3GCOA 5A2MH 4CRAA 2ZFQH 1IOEA 4BNRA 4XBCA 1BA8B 2EI8A 2BDGA 2G81E 2P8OC 1QJ1B 2OLGA 2ANWA 3BTTE 1S5SA 1H1BA 1O2VA 1ANDA 2LNCA 1Q31A 2FOBA 3U9AH 1GMHG 3SJIA 1TNKA 1S81A 1O2TA 1UVSH 3BTHE 1EATA 2GCHG 3RC5A 1ELTA 1TGSZ 1QL8A 3D49H 3LOXA 2WYJA 1THRH 3UWJH 2VVCA 3BG4C 1GBKA 1O5AB 4AFSA 3A8BA 1HAVB 2QF3A 1XUHA 4IN2A 1ZMNA 4A1VA 2PTNA 2Y5FA 3QGJA 1X7AC 3UOPA 1V2ST 3P8NA 6GCHF 1ZHPA 3MOCA 1DE7H 2V3HH 3RU4D 2GP9B 3T25A 2G5NA 5CHAC 2ZFSA 3A82A 1H8DH 1GI9B 5IYTA 2BTCE 1BJVA 4YT6H 2FO9A 1O3NA 4UONA 1C2FA 4O97A 1QR3E 3CS0A 5DPAA 1XVMA 5DKMA 3GYMA 1NRSH 2D2DA 2PKAB 1BZXE 3QX5H 1P04A 1GGDB 3A80A 3VB7A 3LGYA 2BOHB 3PTNA 1ESBA 1CGHA 2ODYB 4ZROA 5F8TA 1V2LT 3MH5A 1W7GH 1A3EH 1SC8U 1GBIA 1NRPH 4X1NU 3GY6A 4OS2A 4Q7ZA 3RXAA 1SFIA 4FUCA 4IW4E 3O8DA 3UTUH 3CS7A 1FPCH 2BD5A 1MQ6A 1SMFE 1XXDA 4F4OC 1HLTH 3ATLA 3SQHE 1O3LA 3OTJE 1V2VT 1BBRE 1LO6A 1NFUA 1UK2A 3BTGE 3B23B 3ZYEA 2XCNA 4XSKU 1ETRH 1AUJA 3SW2B 2P94A 1AWFH 4D7FA 3C27B 4ZHAA 4DT7B 1D9IA 4NZLA 2ZG0H 4FU9A 1TNLA 1UVOA 3BTME 4QT8C 1D4PB 2ZECA 1Y5UT 1W8BH 5EXMA 2NU2E 1GDUA 3OSYA 5JBBS 2O8LA 2GDEH 4HTCH 3KCGH 3FP7E 4DIIH 1O2NA 2Z9JA 2KAIA 5CE1A 1H4WA 1YCPH 4WJG2 3RC4A 1K1IA 2H2ZA 1YYY1 1NT1A 3KQDA 1O2GH 3IWMA 4O3TA 1F5RA 1UTPA 1SGQE 5AVDA 4X8SH 2IJOB 4KGAA 3GCHB 5JBTA 2XBXA 4U30A 1NO9H 4CBOA 1XVOA 4JYUH 4X8VH 2F9NA 3BTKE 4OS7A 1AD8H 3TGKE 4O03A 2J95A 2R3YA 2GZ7A 3PMHB 2QXJA 2ZU4A 2G8TA 3AW1A 8ESTE 3VGCC 2W7UA 2UWLA 1MQ5A 3FAOA 2A2QH 2ZDNA 1N8OB 1IQGA 1IQLA 1LQDB 5TCAA 1SSXA 2QN5T 2D8WA 4D9RA 2ZNKH 3E0PB 1HAHH 2ZFTA 2W26A 2J4IA 5FPSA 1KXBA 3KF2A 1Y59T 1GHZA 3QUMP 1JBUH 3MNCA 3NK8A 3GY4A 1NU7B 3ZZBA 2P8OB 5SGAE 3MU8A 2XBWA 1LQEA 3JZ1B 1A5IA 5J4QA 1YGCH 1L4DA 1PPEE 3GDSA 1QB9A 2FWWA 3VB5A 1TAWA 3F9HA 4OS4A 3K6YA 3FFGA 1KXDA 3BEFB 4UDWH 1IHSH 2VIWA 2BLQA 2Y82A 2ZC9H 1GI7B 5F03A 4TPYA 3MTYA 4NGAH 2KAIB 1WU1A 5A0CA 4X1QU 1O2ZA 2SGAA 3BTWE 4HGCA 1ANBA 4K60A 2PGQB 3DT0H 1O30A 3SUEA 3EE0B 3STJA 1P02A 2TRMA 1HAIH 2ZTZA 1O3KA 3UIRA 4KTUA 3L33A 1QL9A 3K2UA 5JBAS 5TJXA 1MKXK 1HNEE 3T27A 1GBCA 3TLOA 1W13U 2Y7XA 1BIOA 1O38A 1BITA 5GDSH 2VWNA 4RN6A 3M61U 2JH0D 2ZPQA 1Z8IB 2EEKA 3LJOA 2VJ1A 4E06H 2J94A 2Q6DA 5EG4A 4R8TB 3PM3A 3UOUA 5BRRE 3ZZDA 1EAXA 2O8TA 3RXJA 1MMJN 1C1MA 1EJNA 4Y71A 1EAIA 1DY8A 2SGEE 1TABE 1T8MA 2WPKS 1BBRH 1VITH 3RDZA 1NM6A 1QBNA 1HJAC 3Q3YA 1HB0B 1WCZA 3I78A 4AFUA 5C5NA 2BVXH 1J9CH 4AGJA 1F0UA 5GCHG 3GY8A 3A7XA 4WXIA 1XKAC 3RM0H 1D3TB 2BQ6B 2VGCB 4FU8A 1OWJA 1OOKB 1T7CA 4WF8A 3RXSA 3AAVA 1AVGH 4BANB 4AZ2B 1A4WH 2SNVA 3F1SB 3HATH 1BJUA 5FCRA 2BQWB 3SNEA 1E37B 3SJ9A 2GD4B 1LPGB 1HV7A 1D3QB 3SU2A 2G55A 1FNIA 2BDIA 2FLBH 1ZTLA 1ZJDA 3GYLB 1E35B 5I25A 2B0FA 2C8XB 3M3SA 4LXBH 1O3PB 4YLUA 2Z3DA 1J17T 3NUMA 1E34B 2OCVB 2ZQ2A 1HAXB 2ZCHP 1BRAA 2A7JA 4Y79A 1C2LA 1P57B 2IN2A 2J92A 4B74A 2ZEBA 1O3EA 1BHXB 5DJ7A 1W11U 2FESH 5H4IB 1XUFA 2GCHF 4A1TA 1NESE 3RXTA 4FUIA 4GVUA 3Q3KA 1ZPCA 4KTCA 5C5OA 3SHCH 5A0AE 1YCPM 1HAGE 1J14A 1N6YA 1A7SA 4YO9A 1O5FH 1OXGA 2VU8E 3UNSA 4JZIA 3MWIU 1V2WT 3ZVCA 1VJAU 4X8TH 3ZVBA 3SU6A 3NXPA 3SUGA 2ALPA 1FY1A 1O3HA 3W94A 1MBQA 1F92A 1XXFA 1EASA 4AORA 4AOQA 2OINA 3PWCA 5FBIA 3TJOA 3SI4H 4AFZA 1OP0A 1G36A 1ZTJA 1GI4A 1O5DH 2WPIS 3S7KB 2PFEA 1YBWA 2AGIX 5FAHA 1UK4A 5FCKA 1JWTA 1P3CA 1EX3A 2GV7A 3S9AA 4ZXYH 2V0BA 1TA6A 1Z6EA 2BY9X 2BD3A 1T4UH 3HK6B 1ZOMA 1MAXA 2WPMS 1O2WA 1MTWA 3RXHA 2A5KA 3M37A 4CHAB 1OS8A 1ZGVA 3U69H 1GBMA 1QY6A 1MTSA 1RIWC 1AE8H 1RS0A 4UFFH 2QF0A 1L1JA 2OD3B 2B5TB 4AYYB 1YP9A 2DE9A 5JBCS 4ZKNU 1KTTB 4K1EA 3BTQE 4FUGA 4ASHA 3HKJB 3P17H 3RXCA 1P2QA 2HPPH 4JK5A 1V3XA 2GZ9A 1QB1A 1DSUA 1GL0E 5EXNA 1C5NH 1O34A 1UHBB 3P92A 5F8ZA 4NSVA 1C1VH 2ZGCA 1TPAE 2ZZUH 4INLA 3ZVAA 4B76A 4JZEH 3ZVGA 1ZTKA 3TJVA 1JXPA 1LHEH 1SGRE 2AFQB 1DOJA 2FX6A 4K5ZA 1C5SA 4K1SA 3ENSB 1FDPA 1M9UA 1P09A 1IQIA 2AMQA 2F3CE 4RSPA 1QCPA 4GHQA 4DJZB 1GJBB 3E91A 4GPGA 4CRBA 2ESTE 2Z9IA 3MU0A 1ABJH 3ATMA 3W95A 4X2VA 1SLUB 2BM2A 4I32A 2TGAA 8LPRA 5DO4H 4MPXA 1Y3WA 3UNQA 1OWIA 2WYGA 2FODA 1WTHD 1DUAA 3RXKA 4ESTE 3SORA 1TRMA 3TIUA 4H6TA 5T3HA 2ZPRA 3KQEA 1EJMA 3BIVH 4NIYA 2ZCLP 3DFJA 3QK1A 1V2QT 1C1QA 1EZQA 3EQ0H 4J1YA 3UQOA 2P95A 3SV9A 1MD8A 1GBLA 2AYWA 1DDJA 5ETXA 3QZRA 1T8OA 3PMJA 1O2HA 4NWLA 1W10U 1TPOA 3UY9A 1C1RA 2R0KA 2VIQA 3MNSA 4MPVA 4U01A 3TH2H 5ESTE 3K65B 1HAVA 1ELAA 4RKJB 2YNBA 2F9VA 2B8OH 2P3FH 3T29A 1V2OT 4D8NA 2BHGA 2YOLA 2C8ZB 2Y80A 1HXEH 1WQVH 1F5LA 4ABFA 1P06A 1GBJA 1SGFA 1SHYA 1TBQH 4CRFA 4NIXA 3UFAA 3LGIA 1G9IE 3H7OA 3EA8A 3RM2H 2BZAA 2CF8H 2UWPA 1XUIA 1EAUA 3SQEE 2GX4A 2P3TB 2BDBA 1CSOE 1V2KT 2GMTC 5DP5A 1ID5H 4AGKA 1BMLA 2Y5HA 2STAE 5A8YA 2A7HA 4HFPB 6LPRA 4Y6DA 1O2LA 4Q7XA 3LC5A 5E0GA 3BEUA 2HGTH 2PKSC 2GV6A 3A7VA 3UREA 3LH3A 2SNWA 4YOGA 1AFQB 2BDYA 2VIVA 4Y76A 2EI7A 3ITIA 1MCTA 1TMUH 3A89A 1ZRBA 2H9HA 1P2OA 5DP6A 1V2PT 1SPJA 1Z8RA 2OC1A 1SQTA 1P3EA 1D3DB 2GCTC 1YM0A 2STBE 1ELFA 1PFXC 3RXIA 4D76A 1AN1E 3A85A 5F6MA 5GIBA 1EPTB 2HVXA 1V2MT 2GTBA 3QGNB 2SFAA 2EI6A 1O3DA 1NFYA 3VEQB 1P2IA 2VH0A 2PWXA 2FI3E 5EW1H 2CHAC 5A8XA 2GT8A 1L0ZA 1DXPA 2ODQA 2XBVA 3BG8A 5AHGH 1GBDA 3ZZ4A 1EPTA 5GWZA 2OC0A 1OYTH 4BTIB 2BD7A 2Z6BD 2Q6GA 4ISNA 1TBZH 1GVZA 4X6MA 1FIZA 3MO9A 1KY9A 2ZPSA 5I46H 4FVDA 5A0BA 3TJUA 1SGDE 5L30H 1TQ0B 3UQVA 1TBRH 2TPIZ 4X2YA 4MNXA 4I33A 2AEIH 4ABDA 3A8AA 3PV4A 2EC9H 1CGJE 5B6OA 1ESTA 1UJ1A 3S9BA 3P70B 3VXEH 1QRZA 4YM9A 1VR1H 5ABWA 2FM2A 3MU4A 1QHRB 2TGDA 5FPYA 1K9OE 1MD7A 1GHXH 2AGEX 2QGRA 1WBGB 5DG6A 1QQUA 4K3JA 1BTXA 4MVNA 3TGIE 1GI3A 3QO6A 1P8VC 3S7HB 2OBOA 4ISHH 1GCTB 3TH3H 4ZXXH 1J15A 1BB0B 3RXQA 4Z0KA 3MU5A 3BEIB 1ELEE 1SGPE 1NN6A 1GCTC 2ZHFH 1O2IA 1RJXB 2TGPZ 2Q1JA 1OSSA 3OYPA 2OP9A 3TK5A 1IHTH 2V6NA 3PWBA 4ZKSU 3SI3H 3IG6B 1K1LA 4MDSA 3RXDA 1NRQH 2ZCKP 1GBAA 1O32A 1CT2E 5DGJA 2J38A 1S0QA 5GCHF 3F9GA 1Y3VA 2BDHA 3NKKA 2PKAA 4CR5A 1A1RA 4E7NA 4GCHF 3S0NA 1EOLA 1O2PA 4K8YA 1FMGA 2O8MA 2C4FH 3TNSA 4X6OA 1GL1A 3RP2A 1KXAA 1SGYE 5FXLA 1BMNH 2SGFE 5FX6A 4NCYA 4UFGH 2R9PA 2OQ5A 4MTBA 2UUFB 1EOJA 3KGPA 2FEQH 1ZLRA 2CJIA 4H4FA 3SU1A 2AERH 1V2TT 1DICA 2OUAA 2W5EA 1GMHF 2BY8X 5E8EH 5JDUB 4H6SB 1EXFA 1G3EA 3U1JB 1GHVH 2XBYA 3M5MA 1LPKB 2A4GA 1FLEE 2GMTB 3PTBA 7GCHG 1SGNE 1KIGH 1LMWB 1UTJA 1XUKA 1OWKA 1TA2A 3QTOH 1K22H 1ABIH 1VCWA 1RXPA 1K1PA 3MI4A 1C4U2 1TX6A 1UTMA 6GCHG 3RXUA 3V12A 4XBDA 2XC4A 6ESTA 1RTFB 1J16A 3UR9A 3VB3A 6CHAB 1HAPH 1DM4B 2IOTA 1AFEH 1B7XB 1P0SH 2A7CA 3RXGA 1BHXF 4FUJA 1O35A 4B73A 2GKVE 2ZU2A 1TNHA 4JYTA 1LPZB 1W12U 1DXWA 1C9PA 2F9PA 2FS9A 3KIDU 4WVPE 1AWHB 3ZZ9A 4UD9H 3UNRA 2PTCE 4O3UA 2ZHQH 2QC2A 4TWYA 1FIWA 1LVOA 1UCYE 1VCPA 4JCNA 3GCTF 4BXWA 3ZYDA 2CHAB 4ZKOU 4IS5A 2ZO3H 1ZR0A 1DFPA 1KDQA 2AH4X 2RA0A 2RCEA 3T5FH 1N8OC 1DX5M 1LVMA 2G5VA 1T32A 2TGTA 1UVPA 2VWOA 3BSQA 1NFWA 1D6RA 4K69A 4YLQH 1OX1A 2Y5GA 4J2YB 4ABEA 1GJ9B 1RD3B 4I8JA 1MZAA 3BV9B 3ZZCA 1GJ5H 2G00A 1TWXB 2IPHA 2BVRH 2FYQA 4A1XA 2JKHA 1SQOA 2OXSA 4K8BA 3QTVH 4CRDA 5LGOA 2XC5A 3U8RH 1O0DH 3BN9A 1ELCA 1CVWH 1HCGA 2R3UA 4WH6A 5DK1A 2GCTB 2FI5E 1ACBE 4NFFA 2WPJS 1B5GH 4ZHLU 1ZRKA 1UTKA 1DWCH 1SLXB 2J34A 2ZP0H 1Y3UA 1XX9A 2JH6D 1O3MA 1BTPA 1CQQA 4IN1A 1INCA 1CBWC 1BBRK 2P59A 2PW8H 1EP6A 3FZDA 3SU5A 5JB9S 2FPZA 4NG9H 4UE7H 1TONA 2P93A 4E7RG 2NU4E 3ZVDA 8GCHG 1VCQA 3SU0A 1IQEA 2PSYA 3RXOA 1O3OA 1S0RA 5CHAB 5DP3A 1PYTD 5HYOA 5LPFA 4DW2U 1Y5BT 2JETC 2FS8A 1YPHC 3KQCA 2BD8A 1QNJA 2OTVA 1ZYOA 3LGUA 4B2BA 3CP7A 1BCUH 1O3GA 1TPSA 2CXVA 3TGJE 1ZHRA 3VPKA 1IQMA 2PUQH 2BDCA 1MKXH 1Y8TA 5T6GA 1QJ6B 1O5EH 1YPMH 1EAWA 4WH8A 3A86A 2A1DB 2F9BH 4CH8B 1W14U 3U1IB 1MU8B 1SLWB 4AN7A 2DUCA 1P01A 1RFNA 1BTZA 1K2I1 4NWKA 5HGGA 2FXRA 2G52A 2PGBB 4YOJA 1TQ7B 3ZZ5A 3N7OA 4JZFH 4D9QA 4MNVA 1D3PB 4BAKB 5T6FA 4WMFA 3LGTA 1MZDA 2P3UB 1AZZA 1S6FA 1YPLH 3SJKA 3SNCA 5LPRA 2OBQA 1WV7H 4ZKRU 1O2UA 1O5BB 1QJ7B 1IQHA 4INHA 4B75A 2G4TA 1DLEA 2WUBA 3I77A 4DG4A 5FPTA 3E16B 4JZ1A 4TY7A 2Z3CA 3RXFA 3SV2H 3MFJA 2ZFRH 1P11E 4MQAA 4YOIA 1GMCG 3PLBA 1THPB 2PR3A 1TNIA 1G3BA 1S83A 3KQBA 3ZVFA 1SGEE 2PSXA 2ZDMA 2WPLS 1EJAA 3Q76A 2BYAX 1O2YA 4Y0ZE 3LDXH 1A5GH 2Q6FA 3VFEA 4I31A 1C1TA 2SGDE 3MHWU 2VB0A 2GDDA 1AY6H 1LVBA 4YTAA 1JRTA 1TX8A 5E2OA 1V6DA 1Z8JB 1GJDB 1NS3A 1TB6H 1F5KU 1QL7A 1HGTH 1LDTT 1SOZA 4IMZA 2HOBA 1DWDH 4MPUA 1MBMA 1TMBH 2FLRH 1F0TA 5J4SA 2A4RA 2VGCC 1C5YB 4BAQB 1C1UH 3RMOH 1AVXA 3RLYH 1V2NT 2HNTF 1P2NA 4GUXA 1O2KA 5LPEA 2VWLA 1E38B 2ZHEH 1Z8GA 1MTUA 2HWLB
chains in the Genus database with same CATH superfamily
1GI6A 2VIPA 3GICB 1CT0E 3WW7A 3M5LA 3NPSA 1O2JA 2QAAA 5C1YA 2KX4A 2RDLA 2GJGA 3KL6A 1TE0A 1FJSA 1AU8A 5EODA 1AB9B 3STIA 1VGCB 3OEED 3Q00A 1EKBB 3GCHC 1DWBH 3KN2A 4TPIZ 3V13A 4NA9H 2JJ2D 2QY0B 1YF4A 1VGCC 2WV4A 3H5CB 1NZQH 3ZZAA 1H9IE 1SHHB 2ILNA 3RUOA 1J8AA 1V2JT 4K1TA 2I6SA 8GCHF 1OKXA 1VZQH 5FHTA 1O3FA 4GAWA 1PJPA 1W0ZU 2XWBI 5EGMA 2QCYA 3GS9A 1ARBA 1LHFH 2NU3E 3P8FA 1GVLA 4YESB 4DOQA 1GHBF 4LK4A 1AKSA 2FOHA 2FTMA 2ODPA 1SQAA 2WV5A 1UMAH 1CA8B 3PO1C 1GJ6A 3M5NA 1G3CA 5GJ4B 1BOQA 1BTYA 1OP2A 3EA7A 1E1RD 3AVZA 4WMDA 1AIXH 2H6MA 3A8CA 1SBWA 3SV8A 3EYDA 1YLCA 2H1UA 1BTWA 1SQRA 3F2GA 1F0SA 2F4LA 3NZIA 1XUJA 3MH6A 4Q80A 1EQ9A 4AYVB 1UTOA 1F0RA 1GCDA 1GI0A 1P05A 1O39A 2FOAA 2RG3A 4X1SU 3TK6A 3E8LA 4NIWA 5ESBA 1P2JA 2J97A 5C1XA 2ZFPH 1PQAA 2WINI 1TYNA 1CU1A 4FU7A 4B2CA 3TK9A 1NRNH 1SB1H 2ZDAH 2JIZD 1A61H 3UWIA 4CBNA 1YLDA 7LPRA 2BOKA 4ABGA 2BLWA 3OE7D 1TNGA 3A7ZA 4X2XA 1BTUA 1FONA 2ZDLA 2M5TA 1O5GH 5JB8S 3R0FA 1O2MA 4ISIH 1AUTC 2BDAA 1G2LA 2UUYA 2TBSA 2ZA5A 1YLNA 1P2MA 1LHGH 1CHOF 3MNXA 2PHBA 1RTLA 2GGVB 3OY6U 3CENA 4JZDH 1HBTH 4OS6A 3URDA 1GGDC 4AX9H 4VGCC 3UR6A 1AHTH 1TPPA 2VVVA 3PROA 2A0QB 1O3JA 3D23A 4LZ4B 3JZ2B 4DCDA 4VGCB 1C2IA 3F9FA 1QQ4A 3SO3A 4D7GA 1LHDH 3IITA 3BG4B 1GVKB 1PQ7A 1UW7A 1ETTH 1TFXA 4LZ1H 1MTVA 1HDTH 2ZHWH 2F83A 1C2DA 4GHTA 4BTTB 1GJ7B 3WY8A 1UTNA 4Q7YA 5HMAA 2FTLE 3DHKH 1BUIA 3DA9B 4XE4A 1MU6B 2BD9A 4FUEA 2BQ7B 4IC6A 4DVAU 3ZZ8A 2PUXB 1O3IA 4XOJA 2Y7ZA 1GHAF 3H7TA 2NU0E 2Z94A 2VIOA 2PP6A 1L1GA 5TCCA 1OWDA 4OGYA 1O37A 1DT2A 3G01A 1KYNA 1HFDA 3A8DA 1W7XH 1FQ3A 2R0LA 4WY3A 1HRTH 1ANEA 5A8ZA 3UB0A 2QYIA 3VG8A 4U2WA 3UUZA 4INKA 1GDNA 5AFYH 3HPTB 2VH6A 2GZ8A 4UFDH 1C1WH 2HLCA 4X6PA 3A84A 1FY3A 3H09A 1LHCH 1Y3YA 4NA7A 1U6QA 4JYVH 1GBEA 1UTQA 1S84A 1BQYA 4IC5A 4TWWA 2L6OA 4R0IA 2GVFA 5C0TA 1A0LA 3BIUH 1K1MA 3SN8A 4X2WA 1H8IH 4BTUB 3GCNA 2WUCA 2SGPE 2J2UA 3F68H 3F9EA 7GCHF 5DP7A 4B71A 1ZHMA 3ZV9A 3FO8D 4OS5A 1Y3XA 3SYJA 4X8UH 2D1JA 3C1KA 1NC6A 1W0YH 3V7TA 3DSPA 1OYQA 2DE8A 1QRWA 1C2HA 1SL3A 1AO5A 2FDAA 2QA9E 2V35A 2ANKH 2Y81A 5L2YH 3U98H 3PO1B 2WHXA 3QDZB 5GNDA 4XRNA 5DP9A 2ZU5A 5A09A 3NCLA 3ZZ6A 1GJCB 1TOMH 1WSSH 1Z71A 2O9QA 1B0EA 3RXVA 2J98A 2FOMB 1HUTH 5C3NA 3GCTG 3GOVB 1DUEA 5DN6D 1HIAA 1P03A 5EXLA 2TIOA 1OP8A 3SV7A 1H9LB 3FVFB 4Y8ZA 2G51A 3RXPA 2GT7A 1FY8E 1K1NA 4SGAE 3RXBA 3P8OA 1CO7E 1T4VH 1UTLM 3O8CA 2BLOA 5K0HA 3FP8E 2AGGX 1MTNC 1A2CH 1LKAA 2VIDA 1C5UA 5HM2A 5T6DA 4BOHA 3SV6A 3SNDA 1P10A 3QN7A 4MG3A 1P12E 3ZZ7A 1RTKA 3RU4T 1YWUA 1KXCA 2CV3A 3AASA 3ATKA 1OWEA 1TGBA 1LVYA 5CMXH 1LKBA 1UCYK 3ESTA 1BTHH 3U28C 1C5ZB 4H42U 5JYIA 1OPHB 2ZGJA 3HGNA 1NPMA 1WUNH 3EE7A 3BTDE 4I8KA 1W3CA 4ASUD 1FN6A 3TU7H 1IQJA 1V2RT 1C1NA 4A7IB 1C5LH 2IPQX 3E90B 1HAOH 1MABB 3P8GA 2OQUA 3RU4E 3HGPA 4RKOB 1W2KH 3A87A 1CHOG 3B9FH 4IMQA 2Y6TA 1SVPA 2ZU3A 3OAAD 1KXFA 1K28D 1H8ED 1ELBA 1HXFH 4BAMB 3TNTA 1PPGE 3KNXA 3TJNA 4A6LA 2WPHS 2BY5X 3LT3A 1IAUA 5F8XA 2H9EH 5PTPA 1GHYH 1A5HA 1C9TA 4ZAEA 1WXRA 3I29A 1G30B 1OWHA 5E2PA 3F6UH 4MNWA 2ZGHA 3A88A 2FOGA 2FI4E 1KTSB 3P95A 5DP8A 1GWAA 1E36B 2XWAA 1T8NA 2FX4A 1F7ZA 2W3KA 1QTFA 2P16A 1Z1JA 1GHWH 3GDUA 3GY5A 4B2AA 1C1OA 1C5RA 3EDXB 3RXEA 1YPHE 3EA9A 5JPMH 1CT4E 1TMTH 2FMJA 2QXHA 1C5VA 3AW0A 1RGQA 2Z3EA 3ZZ3A 4NFEA 1PYTC 3LGVA 1BMMH 4BXSA 3OTPA 1KLJH 1SI5H 1THSH 3RMLH 1QA7A 4AB8A 1K1OA 3SHAH 5L6NH 1XMNB 3LPRA 1C5MD 3FP6E 1DS2E 4YT7H 3HK3B 2PV9B 1ZSKA 3MNBA 3A7WA 3DFLA 2C90B 4ABIA 4GLYA 5C67A 1ZMLA 1GBTA 2YMSD 5EQRA 1NROH 1YC0A 3LGWA 4B6FA 1BRUP 2W3IA 4TY6A 1GI1A 2C8WB 1ZMJA 1T8LA 3RXMA 3Q77A 3RMNH 4DGJA 2ZQ1A 1KDQB 3SGAE 3D62A 1S82A 3S9CA 1ANCA 2O8WA 2VVUA 1O3AA 1YCPK 4NIVA 1W0JD 3E1XB 1TRNA 4ZMAH 1MCVA 3QWCH 3WWBA 2QV1A 4IBLH 1JOUB 2QE7D 1EZSC 2QIQA 1QURH 1QBOA 1CGIE 1LCYA 2XRCA 1HIAB 3K6ZA 1HAZB 4ISLA 1TGNA 1QFKH 3E3TA 3LC3A 2BX4A 5GPIB 1GI8B 2F91A 6CHAC 4M9FA 3M5OA 3SU3A 4CH2B 1Z7KA 2HPQH 2BZ6H 1AGJA 2C3SA 2V3OH 5HIZA 4I8HA 1EB2A 1O5CB 1PQ8A 3MH7A 1EPTC 1VITF 4K2YA 2ZU1A 4GCHG 5IK2D 3A83A 1GG6B 2A5AA 2XNDD 4MPWA 3MMGA 2UWOA 4CREA 1CBWB 1C2KA 3SJ8A 2K0QA 3ZIAD 1GG6C 1PPBH 3FOAA 3W1EA 4JK6A 5C1UA 2XC0A 2J9NA 5BPEA 1O2RA 1C5PA 2HALA 3F3BA 3NWUA 1E79D 1BDAA 4WWYA 2ZGXH 2Z9KA 3QZQA 1O3BA 1PPZA 3GISB 2KM0A 2R2WU 3RLWH 2ZTYA 4HZHA 1GJ8B 2JETB 5HM9A 2W7SA 2C93B 3A81A 3TH4H 3SNBA 2FOFA 1ELGA 4KTSA 1K1JA 2ZF0H 3RMMH 3T26A 1UVUH 1WTGH 4NZQA 5EPNA 2OC8A 1SKYE 1MAYA 4AG2A 5IDKA 3U8OH 2CGAA 1O31A 1EZUC 1FI8A 2ZDKA 3RC6A 5KEDA 3EGKH 1AI8H 3L6PA 1AZ8A 2BY7X 3A7TA 4UEHH 7KMEH 4UFEH 2ANYA 3LKWA 1IQFA 9ESTA 3SZNA 4CHAC 1P9SA 3PMAB 1MTNB 1C2JA 1GMDF 4I7YH 2XNIA 3T2NA 2ZHDA 3LJJA 3PV2A 1IQKA 1C2MA 4M7GA 1HJ9A 2R2MB 4BAHB 3TPIZ 4IGDA 1TX7A 2ZKSA 4ABBA 2XOKD 1TGCA 2O8UA 1AVWA 2BXTH 1ZJKA 1BRCE 3R3GB 1BMAA 3LONA 3F2FA 4Y7AA 4TYDA 4XDEA 1CA0B 1YPEH 9LPRA 4O9VA 2A45B 4X0WU 2ZTXA 1KXEA 2K1QA 3V3MA 1MKWK 2XCFA 3S69A 3Q3XA 2CF9H 4HG6A 2I6QA 1KLTA 4KELA 3ELAH 4P00A 3SUFA 1XUGA 4ZUHA 2THFB 4FUHA 1SGFG 1L2EA 1PPHE 2A4QA 1S85A 4A92A 4CRCA 1DLKB 2XTTB 1O2QA 1ETSH 4FVBA 4I8LA 3O8BA 1ZPZA 2NU1E 1PPFE 1DY9A 2AMPA 2ZWLH 1JMOH 5DP4A 1HJ8A 4X1PU 1ESAA 3M7UA 1FN8A 1IQNA 1FY4A 2ZFFH 3FZZA 1K0HA 1C4V2 1Z1IA 1T31A 3URCA 1C5OH 3BTEE 1SR5C 2HRVA 2ZGBH 2BD2A 1ZSLA 7ESTE 3N7EA 1EP5A 1EZXC 1GPZA 4KP0A 4OS1A 4ABJA 1A3BH 2FOCA 4JMYA 3GY7A 4I86A 4LOYH 2EA3A 5EQSA 5EPYA 4XBBA 1YPJH 1MUEB 2A4OA 1AB9C 1QIXB 1ARCA 1S6HA 4PROA 3QLPH 1JIRA 2ZI2H 3FANA 4THNH 2KZ4A 2LPRA 5C20A 3MYWA 2AIQA 1Q3XA 1TGTA 3PV5A 1SOTA 3SOSA 5EJZA 1ZPBA 3PLKA 2F9UA 2ANMH 1ORFA 3SU4A 1TLDA 1QGFA 1B0FA 1BRBE 3M3TA 4DIHH 2XXLA 1QB6A 4CR9A 1C1PA 1G2MA 3DD2H 1GI2A 2PLXA 1FPHH 2ASUB 5HIYA 1F2SE 3MO3A 2Z9LA 4GSOA 1GBHA 1HYLA 4WMEA 4BAOB 1AKSB 2FOEA 3T62A 1A46H 3MO6A 1P9UA 2ZDVH 5G4BA 4F49A 3BTFE 3DUXH 3VB4A 3LH1A 1PPCE 1Y5AT 5FX5A 2UUKB 1SGIB 3PLPA 5CDFE 1NU9A 2H9TH 3E6PH 1UO6A 1O2XA 1CE5A 1UK3A 2W6JD 3M3VA 5B6LA 4AFQA 8KME2 1AMHA 5EJ1A 3KHVA 3VXFH 5K7RA 2YNAA 1RIWB 2G4UA 2KCAA 2AMDA 5HXFA 1FAKH 1C5XB 1WAYB 4I8GA 1NRRH 1ZSJA 2F9OA 1C2EA 3TVJB 5EOKA 1Z6JH 3LU9B 4NA8A 4RT1A 4ACBA 3E0NB 1O3CA 4ZHMU 1G3DA 3TITA 3OX7U 1GJ4H 4WXVA 2Z9GA 1YY3A 1C2GA 4XD7D 1LTOA 5EIYA 2K8IA 3KEEA 4OM9A 3SGQE 1EB1H 1CHGA 1PQ5A 2BMGB 2HNTE 1L1NA 1V2UT 2BB4A 2B9LA 2CMYA 1N6XA 4FUFA 4ISOA 1HAYB 1ZGIA 4HI3A 3UPEA 3SGBE 5E0HA 1TALA 1DVAH 5C17A 1GHBG 5C94A 3SBKA 1SG8B 4Z6AH 4Y7BA 2SGQE 1CA0C 1MH0A 2CN0H 1O36A 1UCYH 1WYKA 1GDQA 4AB9A 3HKIB 2A5IA 2QXGA 2BD4A 1NFXA 3PRDA 2XW9A 2VWMA 1C4Y2 3ATWA 3RXLA 1NTPA 4Y0YE 2BXUH 2B7DH 1D6WA 3ZV8A 3PMBB 2HNTC 3RXRA 4MLFB 3O8RA 1QRXA 3OY5U 3VB6A 4TSFD 1C5WB 3ATIA 4XFQA 1AE5A 2C8YB 4Y8YA 4MNYA 1O33A 2UUJB 1QBVH 4KKDA 4E05H 3D65E 3B8JA 1HJAB 1VKYA 1VJ9U 2RA3A 4Y11E 4OGXA 3L3TA 4RI0A 2BLVA 4B1TA 5EQQA 1SGTA 3PYHA 1GI5A 1JIMA 1GMCF 2FYRA 2XYAA 3T28A 1GMDG 4FUDA 3SNAA 5L2ZH 3PB1E 2BX3A 5FBEA 1A0JA 1QA0A 1FY5A 1O2OA 2PKSB 1N1LA 3EAJA 1E0FD 1A0HB 5E0JA 4YZUA 3SUDA 3M35A 1TNJA 4Y10E 3A7YA 1AFQC 4U32A 1O2SA 2H5DA 2AIPA 1G37A 1YPKH 1FX0B 3ZVEA 1WOFA 3P6ZB 1TOCB 1C1SA 1RRKA 1GBBA 1GJAB 1C5QA 5GXPA 5EW2H 1DSTA 1Q2WA 1ZZZA 2NWNA 2D26C 2A32A 3GY3A 4A5TS 1FAXA 3U8TH 3NRLA 2A31A 3K9XB 4Q2KA 4DY7B 3ODDA 4ABAA 2JH5D 3LIWA 4DURA 3OU0A 3MH4A 4AG1A 1SFQB 2YMSC 4CRGA 1FZZA 3GY2A 2H5CA 1NY22 1OHHD 3M7QA 2BY6X 1DITH 3BF6H 4X6NA 1FUJA 4NSYA 2FP7B 3M7TA 3GDVA 1H9HE 1K21H 4X1RU 3VGCB 1EUFA 2AS9A 2Z7FE 2FIRH 1ELVA 1C5TA 2WSSD 3ODFA 5EU8A 1YKTA 1YPGH 1BT7A 4ZH8A 1DANH 2A2XH 1GHAG 1VITG 1JRSA 1G32B 1ELDE 2KR7A 1XM1A 1UHBA 5AF9H 1FV9A 1SLVB 5C2ZA 3AAUA 1TRYA 2QXIA 2BVSH 1UVTH 1TIOA 1AQ7A 1DWEH 3FN8A 4Y8XA 2OC7A 1L4ZA 3SJOA 1P2KA 4FUBA 2VINA 1XKBC 4ABHA 1HPGA 2ALVA 3MU1A 5AFZH 1NBME 4FXGH 1GBFA 1FXYA 3V0XA 5LH8A 1DPOA 1SGCA 1KSNA 3M36A 1KLIH 1WQSA 2HLDD 2VNTA 2ULLA 4SGBE 2ZIQH 1MKWH 2FZZA 3GCOA 5A2MH 4CRAA 2ZFQH 1IOEA 4BNRA 4XBCA 1BA8B 2EI8A 2BDGA 2G81E 2P8OC 1QJ1B 3F2HA 2OLGA 2ANWA 3BTTE 1S5SA 1H1BA 1O2VA 1ANDA 2LNCA 1Q31A 2FOBA 3U9AH 1GMHG 3SJIA 1TNKA 1S81A 1O2TA 1UVSH 2KCPA 1EATA 2GCHG 3BTHE 3RC5A 1ELTA 1TGSZ 1QL8A 3D49H 3LOXA 2WYJA 1THRH 3UWJH 2VVCA 3BG4C 1GBKA 1O5AB 4AFSA 3A8BA 1HAVB 2QF3A 1XUHA 4IN2A 1ZMNA 4A1VA 2PTNA 2Y5FA 3QGJA 1X7AC 3UOPA 1V2ST 3P8NA 6GCHF 1ZHPA 3MOCA 1DE7H 2V3HH 3RU4D 2GP9B 3T25A 2G5NA 5HKKD 5CHAC 2ZFSA 3A82A 1H8DH 1GI9B 5IYTA 2BTCE 1BJVA 4YT6H 2FO9A 1O3NA 4UONA 1C2FA 4O97A 1QR3E 3CS0A 5DPAA 1XVMA 5DKMA 3GYMA 1NRSH 2D2DA 3F0PA 2PKAB 1BZXE 3QX5H 1P04A 1GGDB 3A80A 3VB7A 3LGYA 2BOHB 3PTNA 1ESBA 1CGHA 2ODYB 4ZROA 5F8TA 1V2LT 3MH5A 1W7GH 1A3EH 1SC8U 1GBIA 1NRPH 2QF5A 4X1NU 3GY6A 4OS2A 4Q7ZA 3RXAA 1SFIA 4FUCA 4IW4E 3O8DA 3UTUH 3CS7A 1FPCH 2BD5A 1MQ6A 1SMFE 1XXDA 4F4OC 1HLTH 3ATLA 3SQHE 1O3LA 3OTJE 1S6LA 1V2VT 1BBRE 1LO6A 3UAIC 5KGOA 1NFUA 1UK2A 3BTGE 3B23B 3ZYEA 2XCNA 4XSKU 1ETRH 1AUJA 3SW2B 2P94A 1AWFH 4D7FA 3C27B 4ZHAA 4DT7B 1D9IA 5CHBA 4NZLA 2ZG0H 4FU9A 1TNLA 1UVOA 3BTME 4QT8C 1D4PB 2ZECA 1Y5UT 1W8BH 5EXMA 2NU2E 1GDUA 3OSYA 5JBBS 2O8LA 2GDEH 4HTCH 3KCGH 3FP7E 4DIIH 1O2NA 1NBMD 2Z9JA 2KAIA 5CE1A 2KFWA 1H4WA 1YCPH 4WJG2 3RC4A 1K1IA 2H2ZA 1YYY1 1NT1A 3KQDA 1O2GH 3IWMA 4O3TA 2V7QD 1F5RA 1UTPA 1SGQE 5AVDA 4X8SH 2IJOB 4KGAA 3GCHB 5JBTA 2XBXA 4U30A 1NO9H 4CBOA 1XVOA 4JYUH 4X8VH 2F9NA 3BTKE 4OS7A 1AD8H 3TGKE 4O03A 2J95A 2R3YA 2GZ7A 3PMHB 2KCYA 2QXJA 3DCLA 2ZU4A 2G8TA 3AW1A 8ESTE 3VGCC 2W7UA 2UWLA 1MQ5A 3FAOA 2A2QH 2ZDNA 1N8OB 1IQGA 1IQLA 1LQDB 3KQ5A 5TCAA 1SSXA 2QN5T 2D8WA 4D9RA 2ZNKH 3E0PB 1HAHH 2ZFTA 2W26A 2J4IA 5FPSA 1KXBA 3KF2A 1Y59T 1GHZA 3QUMP 1JBUH 2LELA 3MNCA 4Z1MD 3NK8A 3GY4A 1NU7B 3ZZBA 2P8OB 5SGAE 3MU8A 2XBWA 1LQEA 3DSGA 3JZ1B 1A5IA 5J4QA 1YGCH 1L4DA 1PPEE 3GDSA 1QB9A 2FWWA 3VB5A 1TAWA 3F9HA 4OS4A 3K6YA 3FFGA 2WZQA 1KXDA 3BEFB 4UDWH 1IHSH 2VIWA 2BLQA 2Y82A 2ZC9H 1GI7B 5F03A 4TPYA 3MTYA 4NGAH 2KAIB 1WU1A 5A0CA 4X1QU 1O2ZA 3MQKC 2SGAA 3BTWE 4HGCA 1ANBA 4K60A 1E1QD 2PGQB 3DT0H 1O30A 3SUEA 3EE0B 3STJA 1P02A 2TRMA 1HAIH 2ZTZA 3WWFA 1O3KA 3UIRA 4KTUA 3L33A 1QL9A 1QZ8A 3K2UA 5TJXA 1MKXK 2AHME 5JBAS 1HNEE 3T27A 1GBCA 3TLOA 1W13U 2Y7XA 1BIOA 1O38A 1BITA 5GDSH 2VWNA 4RN6A 3M61U 2JH0D 2ZPQA 1Z8IB 2EEKA 3LJOA 2VJ1A 4E06H 2J94A 2Q6DA 5EG4A 4R8TB 3PM3A 3UOUA 5BRRE 3ZZDA 1EAXA 2O8TA 2RDEA 3RXJA 1MMJN 1C1MA 1EJNA 4Y71A 1EAIA 1DY8A 2SGEE 1TABE 1T8MA 2WPKS 1BBRH 1VITH 3RDZA 1NM6A 1QBNA 1HJAC 3Q3YA 1HB0B 1WCZA 3I78A 4AFUA 5C5NA 2BVXH 1J9CH 3FKSD 4AGJA 1F0UA 5GCHG 3GY8A 3A7XA 4WXIA 1XKAC 3RM0H 1D3TB 2BQ6B 2VGCB 4FU8A 5F53A 1OWJA 1OOKB 1T7CA 4WF8A 3RXSA 3AAVA 1AVGH 4BANB 4AZ2B 1WDIA 1A4WH 2SNVA 3F1SB 3HATH 1BJUA 5FCRA 2BQWB 1W0KD 3SNEA 1E37B 3SJ9A 2GD4B 1LPGB 1HV7A 1D3QB 3SU2A 2G55A 1FNIA 2BDIA 2FLBH 1ZTLA 1ZJDA 3GYLB 1E35B 5I25A 2B0FA 2C8XB 3M3SA 4LXBH 1O3PB 4YLUA 2Z3DA 1J17T 3NUMA 1E34B 2OCVB 2ZQ2A 1HAXB 2VBCA 1BRAA 2ZCHP 2A7JA 4Y79A 1C2LA 1P57B 2IN2A 3DSOA 2J92A 3OFND 2ZEBA 4B74A 1O3EA 1BHXB 2YMSB 5DJ7A 1W11U 2FESH 5H4IB 1XUFA 2GCHF 4A1TA 1NESE 3RXTA 4FUIA 4GVUA 3Q3KA 1ZPCA 4KTCA 5C5OA 3SHCH 5A0AE 1YCPM 1HAGE 1J14A 1N6YA 1A7SA 4YO9A 1O5FH 1OXGA 2VU8E 3UNSA 4JZIA 3MWIU 1V2WT 3ZVCA 1VJAU 4X8TH 3ZVBA 3SU6A 3NXPA 3SUGA 2ALPA 1FY1A 1O3HA 3W94A 1MBQA 1F92A 1XXFA 1EASA 4AORA 4AOQA 2OINA 3PWCA 5FBIA 3TJOA 3SI4H 4AFZA 1OP0A 1G36A 1ZTJA 5FL7D 1GI4A 1O5DH 2WPIS 3S7KB 2PFEA 1YBWA 2AGIX 5FAHA 1UK4A 5FCKA 1JWTA 1P3CA 1EX3A 2GV7A 3S9AA 4ZXYH 2V0BA 1TA6A 1Z6EA 2BY9X 2BD3A 1T4UH 3HK6B 1ZOMA 1KMHB 1MAXA 5EJLA 2WPMS 1O2WA 1MTWA 3RXHA 2A5KA 3M37A 4CHAB 1OS8A 1ZGVA 3U69H 1GBMA 1QY6A 1MTSA 1RIWC 1AE8H 2M2AA 1RS0A 4UFFH 2QF0A 1L1JA 2OD3B 2B5TB 4AYYB 1YP9A 2DE9A 5JBCS 4ZKNU 1KTTB 4K1EA 3BTQE 4FUGA 4ASHA 3HKJB 3P17H 3RXCA 1P2QA 2HPPH 4JK5A 1V3XA 2GZ9A 1QB1A 1DSUA 1GL0E 5EXNA 1C5NH 1O34A 1UHBB 3P92A 3N7DA 5F8ZA 4NSVA 1C1VH 2ZGCA 1TPAE 2ZZUH 4INLA 3ZVAA 4F55A 4Q4LA 4B76A 4JZEH 3ZVGA 1ZTKA 3TJVA 1JXPA 1LHEH 1SGRE 2AFQB 1DOJA 2FX6A 4K5ZA 1C5SA 4K1SA 3ENSB 1FDPA 1M9UA 1P09A 1IQIA 2AMQA 2F3CE 3AK5A 4RSPA 1QCPA 4GHQA 4DJZB 2JJ1D 1GJBB 3E91A 4FOUC 4GPGA 4CRBA 2ESTE 2Z9IA 3MU0A 1ABJH 4ACAA 4RT0A 3ATMA 3W95A 4X2VA 1SLUB 2BM2A 4I32A 2TGAA 8LPRA 5DO4H 4MPXA 1Y3WA 3UNQA 1OWIA 2WYGA 2FODA 1WTHD 1DUAA 3RXKA 4ESTE 3SORA 1TRMA 3TIUA 4H6TA 5T3HA 2ZPRA 3KQEA 1EJMA 3BIVH 4NIYA 2ZCLP 3DFJA 3QK1A 1V2QT 1C1QA 1EZQA 3EQ0H 4J1YA 3UQOA 2P95A 3OEHD 3SV9A 1MD8A 1GBLA 2AYWA 1DDJA 5ETXA 3QZRA 1T8OA 3PMJA 1O2HA 4NWLA 1W10U 1TPOA 3UY9A 1C1RA 5DSFA 2R0KA 2VIQA 3MNSA 4MPVA 4U01A 3TH2H 5ESTE 3K65B 1HAVA 1ELAA 4RKJB 2YNBA 2F9VA 2B8OH 2P3FH 3T29A 1V2OT 1EFRD 4D8NA 2BHGA 2YOLA 2C8ZB 2Y80A 1HXEH 1WQVH 1F5LA 4ABFA 1P06A 1GBJA 1SGFA 1SHYA 1TBQH 4CRFA 4NIXA 3UFAA 3LGIA 3SZEA 1G9IE 3H7OA 3EA8A 3RM2H 2BZAA 2CF8H 2UWPA 1XUIA 1EAUA 3SQEE 2GX4A 2P3TB 2BDBA 1CSOE 1V2KT 2GMTC 5DP5A 1ID5H 4AGKA 1BMLA 2Y5HA 2STAE 5A8YA 2A7HA 4HFPB 6LPRA 4Y6DA 1O2LA 4Q7XA 3LC5A 5E0GA 2OK5A 3BEUA 2HGTH 2PKSC 2GV6A 3A7VA 3UREA 3LH3A 2SNWA 4YOGA 1AFQB 2BDYA 2VIVA 4Y76A 2EI7A 3ITIA 1MCTA 1TMUH 3A89A 1ZRBA 2H9HA 2WV9A 1P2OA 5DP6A 1V2PT 2HVYB 1SPJA 1Z8RA 2OC1A 1SQTA 4F48B 1P3EA 1D3DB 2GCTC 1YM0A 2STBE 1ELFA 1PFXC 3RXIA 4D76A 1AN1E 3A85A 5F6MA 5GIBA 1EPTB 2JDID 2HVXA 1V2MT 2RFKC 2GTBA 3QGNB 3KYGA 2SFAA 2EI6A 1O3DA 1NFYA 3VEQB 1P2IA 2J5UA 2PWXA 2FI3E 2VH0A 5EW1H 2CHAC 5A8XA 2GT8A 1L0ZA 1DXPA 2ODQA 2XBVA 3BG8A 5AHGH 1GBDA 3ZZ4A 1EPTA 5GWZA 2OC0A 1OYTH 4BTIB 2BD7A 2Z6BD 3PRBA 4Q63A 2Q6GA 4ISNA 1TBZH 1GVZA 4X6MA 2LP6A 1FIZA 3MO9A 1KY9A 2ZPSA 5I46H 4FVDA 5A0BA 3TJUA 1SGDE 1H8HD 5L30H 1TQ0B 3UQVA 1TBRH 2TPIZ 4X2YA 4MNXA 4I33A 2AEIH 4ABDA 3A8AA 3PV4A 2EC9H 1CGJE 2IJD1 5B6OA 1ESTA 1UJ1A 3S9BA 3P70B 3VXEH 1QRZA 4YM9A 1VR1H 5ABWA 2FM2A 3MU4A 1QHRB 2TGDA 5FPYA 1K9OE 1MD7A 1GHXH 2AGEX 2QGRA 1WBGB 5DG6A 1QQUA 4K3JA 1BTXA 4MVNA 3TGIE 1GI3A 3QO6A 1P8VC 2W6ID 3S7HB 2OBOA 4ISHH 1GCTB 3TH3H 4ZXXH 1J15A 4B6EA 1BB0B 4FETA 3RXQA 4Z0KA 3MU5A 3BEIB 1ELEE 1SGPE 1NN6A 1GCTC 2ZHFH 1O2IA 1RJXB 2TGPZ 2Q1JA 1OSSA 3OYPA 2OP9A 3TK5A 1IHTH 2V6NA 3PWBA 4ZKSU 3SI3H 3IG6B 1K1LA 4MDSA 3RXDA 1NRQH 2ZCKP 1GBAA 2CK3D 1O32A 2J98B 1CT2E 5DGJA 2J38A 1S0QA 5GCHF 3F9GA 1Y3VA 2BDHA 3NKKA 2F43B 2PKAA 4CR5A 1A1RA 4E7NA 4GCHF 3S0NA 1EOLA 1O2PA 4K8YA 1FMGA 2O8MA 2C4FH 3TNSA 4X6OA 1GL1A 3RP2A 1KXAA 1SGYE 5FXLA 1BMNH 2SGFE 1BMFD 5FX6A 4NCYA 2EY4C 4UFGH 2R9PA 2OQ5A 4MTBA 2UUFB 1EOJA 3KGPA 2FEQH 1ZLRA 2CJIA 4H4FA 3SU1A 2AERH 1V2TT 1DICA 2OUAA 2W5EA 1GMHF 2BY8X 5E8EH 5JDUB 4H6SB 1EXFA 1G3EA 3U1JB 1GHVH 2XBYA 3M5MA 1LPKB 2A4GA 1FLEE 2GMTB 3PTBA 7GCHG 1SGNE 1KIGH 1LMWB 1UTJA 1XUKA 1OWKA 1TA2A 3QTOH 1K22H 1ABIH 1VCWA 1RXPA 4P02A 1K1PA 3MI4A 1C4U2 1TX6A 1UTMA 6GCHG 3RXUA 3V12A 4XBDA 2XC4A 6ESTA 1RTFB 1J16A 3UR9A 3VB3A 6CHAB 1HAPH 1DM4B 2IOTA 2KCOA 1AFEH 1B7XB 1P0SH 2A7CA 1COWD 3RXGA 1BHXF 4FUJA 1O35A 4B73A 2GKVE 2ZU2A 1TNHA 4JYTA 1LPZB 1W12U 1DXWA 1C9PA 2F9PA 2FS9A 3KIDU 4WVPE 1AWHB 3ZZ9A 4UD9H 3UNRA 2PTCE 4O3UA 2ZHQH 2QC2A 4TWYA 1FIWA 1LVOA 1UCYE 1VCPA 4JCNA 3GCTF 4BXWA 3ZYDA 2CHAB 4ZKOU 4IS5A 2ZO3H 1ZR0A 1DFPA 1KDQA 2AH4X 2RA0A 2RCEA 3T5FH 1N8OC 1DX5M 1LVMA 2G5VA 1T32A 2TGTA 1UVPA 2VWOA 3BSQA 1NFWA 1D6RA 4K69A 4YLQH 1OX1A 2Y5GA 4J2YB 4ABEA 1GJ9B 1RD3B 4I8JA 1MZAA 3BV9B 3ZZCA 1GJ5H 2G00A 2V3MA 1TWXB 2IPHA 2BVRH 2FYQA 4A1XA 2JKHA 1SQOA 2OXSA 4K8BA 3QTVH 4CRDA 5LGOA 2XC5A 3U8RH 1O0DH 3BN9A 1ELCA 1CVWH 1HCGA 2R3UA 3N99A 4WH6A 5DK1A 2GCTB 2FI5E 1ACBE 4NFFA 2WPJS 1B5GH 4ZHLU 1ZRKA 1UTKA 1DWCH 1SLXB 2J34A 2ZP0H 1Y3UA 1XX9A 2JH6D 1O3MA 1BTPA 1CQQA 4IN1A 1INCA 1CBWC 1BBRK 2P59A 2PW8H 1EP6A 3FZDA 3SU5A 5JB9S 2FPZA 2EQNA 4NG9H 4UE7H 1TONA 2P93A 4E7RG 2NU4E 3ZVDA 8GCHG 1VCQA 3SU0A 1IQEA 2PSYA 3RXOA 1O3OA 1S0RA 5CHAB 5DP3A 1PYTD 5HYOA 5LPFA 3CNRA 4DW2U 1Y5BT 2JETC 2WPDD 2FS8A 1YPHC 3KQCA 2BD8A 1QNJA 2OTVA 1ZYOA 3LGUA 4B2BA 5KECA 3CP7A 1BCUH 1O3GA 1TPSA 2CXVA 3TGJE 1ZHRA 3VPKA 1IQMA 4TT3D 2PUQH 2BDCA 1MKXH 1Y8TA 5T6GA 1QJ6B 1O5EH 1YPMH 1EAWA 4WH8A 3A86A 2A1DB 2F9BH 4CH8B 1W14U 3U1IB 1MU8B 2QF4A 1SLWB 4AN7A 2DUCA 1P01A 4ZCNA 1RFNA 1BTZA 1K2I1 5T1VA 4NWKA 5HGGA 2FXRA 2G52A 2PGBB 4YOJA 1TQ7B 3ZZ5A 3N7OA 4JZFH 4D9QA 4MNVA 1D3PB 4BAKB 5T6FA 4WMFA 3LGTA 1MZDA 2P3UB 1AZZA 1S6FA 1YPLH 3SJKA 3SNCA 5LPRA 2OBQA 1WV7H 4ZKRU 1O2UA 1O5BB 1QJ7B 1IQHA 4INHA 4AC9A 4B75A 2G4TA 1DLEA 2WUBA 3I77A 4DG4A 5FPTA 3E16B 4JZ1A 4TY7A 4YXWD 2Z3CA 2L74A 3RXFA 3SV2H 3MFJA 2ZFRH 1P11E 4MQAA 4YOIA 1GMCG 3PLBA 3KYFA 1THPB 2PR3A 1TNIA 1G3BA 1S83A 3KQBA 3ZVFA 1SGEE 2PSXA 2ZDMA 2WPLS 1EJAA 3F0OA 3Q76A 2BYAX 1O2YA 4Y0ZE 3LDXH 1A5GH 2Q6FA 3VFEA 4I31A 1C1TA 2SGDE 3MHWU 2VB0A 2GDDA 1AY6H 1LVBA 4YTAA 1JRTA 1TX8A 5E2OA 1V6DA 1Z8JB 1GJDB 1NS3A 1TB6H 1F5KU 1QL7A 1HGTH 1LDTT 1SOZA 4IMZA 2HOBA 1DWDH 4MPUA 1MBMA 1TMBH 2FLRH 1F0TA 5J4SA 2A4RA 2VGCC 5C0UA 1C5YB 4BAQB 1C1UH 3RMOH 1AVXA 3RLYH 1V2NT 2HNTF 4DT4A 1P2NA 4GUXA 1O2KA 5LPEA 2VWLA 1E38B 2ZHEH 1Z8GA 1MTUA 2HWLB
chains in the Genus database with same CATH topology
1GI6A 2VIPA 3GICB 1CT0E 3M5LA 3NPSA 1O2JA 2QAAA 5C1YA 2RDLA 3KL6A 1TE0A 1FJSA 1AU8A 5EODA 1AB9B 3STIA 1VGCB 3Q00A 1EKBB 3GCHC 1DWBH 3KN2A 4TPIZ 3V13A 4NA9H 2QY0B 1YF4A 1VGCC 2WV4A 3H5CB 1NZQH 3ZZAA 1H9IE 1SHHB 2ILNA 3RUOA 1J8AA 1V2JT 4K1TA 2I6SA 8GCHF 1OKXA 1VZQH 5FHTA 1O3FA 4GAWA 1PJPA 1W0ZU 2XWBI 5EGMA 2QCYA 1ARBA 1LHFH 2NU3E 3P8FA 1GVLA 4YESB 4DOQA 1GHBF 4LK4A 1AKSA 2FOHA 2FTMA 2ODPA 1SQAA 2WV5A 1UMAH 1CA8B 3PO1C 1GJ6A 3M5NA 1G3CA 5GJ4B 1BOQA 1BTYA 1OP2A 3EA7A 3AVZA 4WMDA 1AIXH 2H6MA 3A8CA 1SBWA 3SV8A 3EYDA 1YLCA 2H1UA 1BTWA 1F0SA 3NZIA 1XUJA 3MH6A 4Q80A 1EQ9A 4AYVB 1UTOA 1F0RA 1GCDA 1GI0A 1P05A 1O39A 2FOAA 2RG3A 4X1SU 3TK6A 3E8LA 4NIWA 5ESBA 1P2JA 5C1XA 2ZFPH 1PQAA 2WINI 1TYNA 1CU1A 4FU7A 4B2CA 3TK9A 1NRNH 1SB1H 2ZDAH 1A61H 3UWIA 4CBNA 1YLDA 7LPRA 2BOKA 4ABGA 2BLWA 1TNGA 3A7ZA 4X2XA 1BTUA 1FONA 2ZDLA 2M5TA 1O5GH 5JB8S 3R0FA 1O2MA 4ISIH 1AUTC 2BDAA 1G2LA 2UUYA 2TBSA 2ZA5A 1P2MA 1LHGH 1CHOF 3MNXA 2PHBA 1RTLA 2GGVB 3OY6U 3CENA 4JZDH 1HBTH 4OS6A 3URDA 1GGDC 4AX9H 4VGCC 3UR6A 1AHTH 2VVVA 1TPPA 3PROA 2A0QB 1O3JA 3D23A 4LZ4B 3JZ2B 4DCDA 4VGCB 1C2IA 3F9FA 1QQ4A 3SO3A 4D7GA 1LHDH 3IITA 3BG4B 1GVKB 1PQ7A 1ETTH 1TFXA 4LZ1H 1MTVA 1HDTH 2ZHWH 2F83A 1C2DA 4GHTA 4BTTB 1GJ7B 3WY8A 1UTNA 4Q7YA 5HMAA 2FTLE 3DHKH 1BUIA 3DA9B 4XE4A 1MU6B 2BD9A 4FUEA 2BQ7B 4IC6A 4DVAU 3ZZ8A 2PUXB 1O3IA 4XOJA 2Y7ZA 1GHAF 3H7TA 2NU0E 2Z94A 2VIOA 1L1GA 5TCCA 1OWDA 4OGYA 1O37A 1DT2A 3G01A 1KYNA 1HFDA 3A8DA 1W7XH 1FQ3A 2R0LA 4WY3A 1HRTH 1ANEA 5A8ZA 2QYIA 4U2WA 3UUZA 4INKA 1GDNA 5AFYH 3HPTB 2VH6A 2GZ8A 4UFDH 1C1WH 2HLCA 4X6PA 3A84A 1FY3A 1LHCH 1Y3YA 4NA7A 1U6QA 4JYVH 1GBEA 1UTQA 1S84A 1BQYA 4IC5A 4TWWA 4R0IA 2GVFA 1A0LA 3BIUH 1K1MA 3SN8A 4X2WA 1H8IH 4BTUB 3GCNA 2WUCA 2SGPE 2J2UA 3F68H 3F9EA 7GCHF 5DP7A 4B71A 1ZHMA 3ZV9A 4OS5A 1Y3XA 4X8UH 2D1JA 3C1KA 1NC6A 1W0YH 3V7TA 1OYQA 2DE8A 1QRWA 1C2HA 1SL3A 1AO5A 2FDAA 2V35A 2QA9E 2ANKH 2Y81A 5L2YH 3U98H 3PO1B 3QDZB 5DP9A 2ZU5A 5A09A 3NCLA 3ZZ6A 1GJCB 1TOMH 1WSSH 1Z71A 2O9QA 1B0EA 3RXVA 2FOMB 1HUTH 5C3NA 3GCTG 3GOVB 1DUEA 1HIAA 1P03A 5EXLA 2TIOA 1OP8A 3SV7A 1H9LB 3FVFB 4Y8ZA 2G51A 3RXPA 2GT7A 1FY8E 1K1NA 4SGAE 3RXBA 3P8OA 1CO7E 1T4VH 1UTLM 3O8CA 2BLOA 5K0HA 3FP8E 2AGGX 1MTNC 1A2CH 1LKAA 2VIDA 1C5UA 5HM2A 5T6DA 4BOHA 3SV6A 3SNDA 1P10A 3QN7A 4MG3A 1P12E 3ZZ7A 1RTKA 3RU4T 1KXCA 2CV3A 3AASA 3ATKA 1OWEA 1TGBA 1LVYA 5CMXH 1LKBA 1UCYK 3ESTA 1BTHH 1C5ZB 4H42U 5JYIA 1OPHB 2ZGJA 3HGNA 1NPMA 1WUNH 4I8KA 3BTDE 1W3CA 1FN6A 3TU7H 1IQJA 1V2RT 1C1NA 4A7IB 1C5LH 3E90B 1HAOH 3P8GA 2OQUA 3RU4E 3HGPA 4RKOB 1W2KH 3A87A 1CHOG 3B9FH 4IMQA 2Y6TA 1SVPA 2ZU3A 1KXFA 1K28D 1ELBA 1HXFH 4BAMB 3TNTA 1PPGE 3KNXA 3TJNA 4A6LA 2WPHS 2BY5X 3LT3A 1IAUA 5F8XA 2H9EH 5PTPA 1GHYH 1A5HA 1C9TA 4ZAEA 3I29A 1G30B 1OWHA 5E2PA 3F6UH 4MNWA 2ZGHA 3A88A 2FOGA 2FI4E 1KTSB 3P95A 5DP8A 1GWAA 1E36B 2XWAA 1T8NA 2FX4A 2W3KA 1F7ZA 1QTFA 2P16A 1Z1JA 1GHWH 3GDUA 3GY5A 4B2AA 1C1OA 1C5RA 3EDXB 3RXEA 1YPHE 3EA9A 5JPMH 1CT4E 1TMTH 2FMJA 2QXHA 1C5VA 3AW0A 1RGQA 2Z3EA 3ZZ3A 4NFEA 1PYTC 3LGVA 1BMMH 4BXSA 1KLJH 1SI5H 1THSH 3RMLH 1QA7A 4AB8A 1K1OA 3SHAH 5L6NH 1XMNB 3LPRA 1C5MD 3FP6E 1DS2E 4YT7H 3HK3B 2PV9B 1ZSKA 3MNBA 3A7WA 3DFLA 2C90B 4ABIA 4GLYA 5C67A 1ZMLA 1GBTA 5EQRA 1NROH 1YC0A 3LGWA 1BRUP 2W3IA 4TY6A 1GI1A 2C8WB 1ZMJA 1T8LA 3RXMA 3Q77A 3RMNH 4DGJA 2ZQ1A 1KDQB 3SGAE 3D62A 1S82A 3S9CA 1ANCA 2O8WA 2VVUA 1O3AA 1YCPK 4NIVA 3E1XB 1TRNA 4ZMAH 1MCVA 3QWCH 2QV1A 4IBLH 1JOUB 1EZSC 2QIQA 1QURH 1QBOA 1CGIE 1LCYA 2XRCA 1HIAB 3K6ZA 1HAZB 4ISLA 1TGNA 1QFKH 3E3TA 3LC3A 2BX4A 5GPIB 1GI8B 2F91A 6CHAC 3M5OA 3SU3A 4CH2B 1Z7KA 2HPQH 2BZ6H 1AGJA 2C3SA 2V3OH 4I8HA 1EB2A 1O5CB 1PQ8A 3MH7A 1EPTC 1VITF 4K2YA 2ZU1A 4GCHG 3A83A 1GG6B 2A5AA 4MPWA 3MMGA 2UWOA 4CREA 1CBWB 1C2KA 3SJ8A 1GG6C 1PPBH 4JK6A 5C1UA 2XC0A 2J9NA 5BPEA 1O2RA 1C5PA 2HALA 3NWUA 1BDAA 4WWYA 2ZGXH 2Z9KA 3QZQA 1O3BA 1PPZA 3GISB 2R2WU 3RLWH 2ZTYA 4HZHA 1GJ8B 2JETB 5HM9A 2W7SA 2C93B 3A81A 3TH4H 3SNBA 2FOFA 1ELGA 4KTSA 1K1JA 2ZF0H 3RMMH 3T26A 1UVUH 1WTGH 4NZQA 5EPNA 2OC8A 4AG2A 1MAYA 5IDKA 3U8OH 2CGAA 1O31A 1EZUC 1FI8A 2ZDKA 3RC6A 3EGKH 1AI8H 3L6PA 1AZ8A 2BY7X 3A7TA 4UEHH 7KMEH 4UFEH 2ANYA 3LKWA 1IQFA 9ESTA 3SZNA 4CHAC 1P9SA 3PMAB 1MTNB 1C2JA 1GMDF 4I7YH 2XNIA 3T2NA 2ZHDA 3LJJA 1IQKA 1C2MA 4M7GA 1HJ9A 2R2MB 4BAHB 3TPIZ 4IGDA 1TX7A 2ZKSA 4ABBA 1TGCA 2O8UA 1AVWA 2BXTH 1ZJKA 1BRCE 3R3GB 1BMAA 3LONA 4Y7AA 4TYDA 4XDEA 1CA0B 1YPEH 9LPRA 4O9VA 2A45B 4X0WU 2ZTXA 1KXEA 2K1QA 3V3MA 1MKWK 2XCFA 3S69A 3Q3XA 2CF9H 2I6QA 1KLTA 4KELA 3ELAH 3SUFA 1XUGA 4ZUHA 2THFB 4FUHA 1SGFG 1L2EA 1PPHE 2A4QA 1S85A 4A92A 4CRCA 1DLKB 2XTTB 1O2QA 1ETSH 4FVBA 4I8LA 3O8BA 1ZPZA 2NU1E 1PPFE 1DY9A 2AMPA 2ZWLH 1JMOH 5DP4A 1HJ8A 4X1PU 1ESAA 3M7UA 1FN8A 1IQNA 1FY4A 2ZFFH 3FZZA 1C4V2 1Z1IA 1T31A 3URCA 1C5OH 3BTEE 1SR5C 2HRVA 2ZGBH 2BD2A 1ZSLA 7ESTE 1EP5A 1EZXC 1GPZA 4KP0A 4OS1A 4ABJA 1A3BH 2FOCA 4JMYA 3GY7A 4LOYH 2EA3A 5EQSA 5EPYA 4XBBA 1YPJH 1MUEB 2A4OA 1AB9C 1QIXB 1ARCA 1S6HA 4PROA 3QLPH 1JIRA 2ZI2H 3FANA 4THNH 2LPRA 5C20A 3MYWA 2AIQA 1Q3XA 1TGTA 1SOTA 3SOSA 1ZPBA 3PLKA 2F9UA 2ANMH 1ORFA 3SU4A 1TLDA 1QGFA 1B0FA 1BRBE 3M3TA 4DIHH 2XXLA 1QB6A 4CR9A 1C1PA 1G2MA 3DD2H 1GI2A 2PLXA 1FPHH 2ASUB 1F2SE 3MO3A 2Z9LA 4GSOA 1GBHA 1HYLA 4WMEA 4BAOB 1AKSB 2FOEA 3T62A 1A46H 3MO6A 1P9UA 2ZDVH 5G4BA 4F49A 3BTFE 3DUXH 3VB4A 3LH1A 1PPCE 1Y5AT 5FX5A 2UUKB 1SGIB 3PLPA 1NU9A 2H9TH 3E6PH 1UO6A 1O2XA 1CE5A 1UK3A 3M3VA 4AFQA 8KME2 1AMHA 3KHVA 3VXFH 5K7RA 2YNAA 1RIWB 2G4UA 5HXFA 2AMDA 1FAKH 1C5XB 1WAYB 4I8GA 1NRRH 1ZSJA 2F9OA 1C2EA 3TVJB 5EOKA 1Z6JH 3LU9B 4NA8A 3E0NB 1O3CA 4ZHMU 1G3DA 3TITA 3OX7U 1GJ4H 4WXVA 2Z9GA 1C2GA 1LTOA 3KEEA 3SGQE 1EB1H 1CHGA 1PQ5A 2BMGB 2HNTE 1L1NA 1V2UT 2BB4A 2B9LA 2CMYA 1N6XA 4FUFA 4ISOA 1HAYB 1ZGIA 4HI3A 3UPEA 3SGBE 5E0HA 1TALA 1DVAH 1GHBG 3SBKA 1SG8B 4Z6AH 4Y7BA 2SGQE 1CA0C 1MH0A 2CN0H 1O36A 1UCYH 1WYKA 1GDQA 4AB9A 3HKIB 2A5IA 2QXGA 2BD4A 1NFXA 2XW9A 2VWMA 1C4Y2 3ATWA 3RXLA 1NTPA 4Y0YE 2BXUH 2B7DH 1D6WA 3ZV8A 3PMBB 2HNTC 3RXRA 4MLFB 3O8RA 1QRXA 3OY5U 3VB6A 1C5WB 3ATIA 4XFQA 1AE5A 2C8YB 4Y8YA 4MNYA 1O33A 2UUJB 1QBVH 4KKDA 4E05H 3D65E 3B8JA 1HJAB 1VJ9U 2RA3A 4Y11E 4OGXA 3L3TA 2BLVA 4B1TA 5EQQA 1SGTA 3PYHA 1GI5A 1JIMA 1GMCF 2FYRA 2XYAA 3T28A 1GMDG 4FUDA 3SNAA 5L2ZH 3PB1E 2BX3A 5FBEA 1A0JA 1QA0A 1FY5A 1O2OA 2PKSB 1N1LA 3EAJA 1E0FD 1A0HB 5E0JA 4YZUA 3SUDA 3M35A 1TNJA 4Y10E 3A7YA 1AFQC 4U32A 1O2SA 2H5DA 2AIPA 1G37A 1YPKH 3ZVEA 1WOFA 3P6ZB 1TOCB 1C1SA 1RRKA 1GBBA 1GJAB 1C5QA 5GXPA 5EW2H 1DSTA 1Q2WA 1ZZZA 2NWNA 2D26C 2A32A 3GY3A 4A5TS 1FAXA 3U8TH 2A31A 3K9XB 4Q2KA 4DY7B 3ODDA 4ABAA 2JH5D 3LIWA 4DURA 3OU0A 3MH4A 4AG1A 1SFQB 4CRGA 1FZZA 3GY2A 2H5CA 1NY22 3M7QA 2BY6X 1DITH 3BF6H 4X6NA 1FUJA 4NSYA 2FP7B 3M7TA 3GDVA 1H9HE 1K21H 4X1RU 3VGCB 1EUFA 2AS9A 2Z7FE 2FIRH 1ELVA 1C5TA 3ODFA 5EU8A 1YKTA 1YPGH 1BT7A 4ZH8A 1DANH 2A2XH 1GHAG 1VITG 1JRSA 1G32B 1ELDE 1XM1A 1UHBA 5AF9H 1FV9A 1SLVB 5C2ZA 3AAUA 1TRYA 2QXIA 2BVSH 1UVTH 1TIOA 1AQ7A 1DWEH 4Y8XA 2OC7A 1L4ZA 3SJOA 1P2KA 4FUBA 2VINA 1XKBC 4ABHA 1HPGA 2ALVA 3MU1A 5AFZH 4FXGH 1GBFA 1FXYA 3V0XA 5LH8A 1DPOA 1SGCA 1KSNA 3M36A 1KLIH 1WQSA 2VNTA 2ULLA 4SGBE 2ZIQH 1MKWH 2FZZA 3GCOA 5A2MH 4CRAA 2ZFQH 1IOEA 4BNRA 4XBCA 1BA8B 2EI8A 2BDGA 2G81E 2P8OC 1QJ1B 2OLGA 2ANWA 3BTTE 1S5SA 1H1BA 1O2VA 1ANDA 2LNCA 1Q31A 2FOBA 3U9AH 1GMHG 3SJIA 1TNKA 1S81A 1O2TA 1UVSH 3BTHE 1EATA 2GCHG 3RC5A 1ELTA 1TGSZ 1QL8A 3D49H 3LOXA 2WYJA 1THRH 3UWJH 2VVCA 3BG4C 1GBKA 1O5AB 4AFSA 3A8BA 1HAVB 2QF3A 1XUHA 4IN2A 1ZMNA 4A1VA 2PTNA 2Y5FA 3QGJA 1X7AC 3UOPA 1V2ST 3P8NA 6GCHF 1ZHPA 3MOCA 1DE7H 2V3HH 3RU4D 2GP9B 3T25A 2G5NA 5CHAC 2ZFSA 3A82A 1H8DH 1GI9B 5IYTA 2BTCE 1BJVA 4YT6H 2FO9A 1O3NA 4UONA 1C2FA 4O97A 1QR3E 3CS0A 5DPAA 1XVMA 5DKMA 3GYMA 1NRSH 2D2DA 2PKAB 1BZXE 3QX5H 1P04A 1GGDB 3A80A 3VB7A 3LGYA 2BOHB 3PTNA 1ESBA 1CGHA 2ODYB 4ZROA 5F8TA 1V2LT 3MH5A 1W7GH 1A3EH 1SC8U 1GBIA 1NRPH 4X1NU 3GY6A 4OS2A 4Q7ZA 3RXAA 1SFIA 4FUCA 4IW4E 3O8DA 3UTU