5A8YA

Crystal structure of human neutrophil elastase in complex with a dihydropyrimidone inhibitor
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
218
structure length
216
Chain Sequence
IVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potent and Selective Human Neutrophil Elastase Inhibitors with Novel Equatorial Ring Topology: In Vivo Efficacy of the Polar Pyrimidopyridazine Bay-8040 in a Pulmonary Arterial Hypertension Rat Model.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords NEUTROPHIL ELASTASE
total genus 43
structure length 216
sequence length 218
ec nomenclature ec 3.4.21.37: Leukocyte elastase.
pdb deposition date 2015-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5a8yA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5a8yA02
3K65B 2ZA5A 1GBLA 1W7XH 3LT3A 5AHGH 1LCYA 4ISIH 4F49A 2OCVB 5LPRA 1MU6B 4AFZA 1VITH 3GY5A 1C1WH 3RXOA 2WYJA 1DWDH 1KY9A 1RRKA 2WPHS 3V13A 1PPEE 4HFPB 3LJJA 1NFWA 2RA3A 1PPCE 4FUDA 1V2QT 5GWZA 1YPHE 1O32A 1GI0A 3T2NA 3URDA 4K1TA 2BY5X 3SU5A 3RMOH 3SUDA 4E7RG 1W12U 1A5GH 5TCCA 3RXAA 2A1DB 3RXSA 5EQSA 1UHBB 3T28A 1SLWB 4ISNA 2YNBA 4FUFA 1SLVB 5TCAA 1YYY1 1DFPA 2BLQA 4JK6A 1GBMA 3A7ZA 2QXIA 2XWAA 4X6OA 3ZVAA 2ZTYA 3MO9A 2VWNA 2ZC9H 4JK5A 1AFQB 3N7OA 1EPTB 4IW4E 1IQFA 4CBOA 2UWLA 1NTPA 4CR5A 3MO3A 4ABDA 2P16A 3F9EA 1QJ1B 2VVVA 1XX9A 3NZIA 2ZHEH 3L3TA 3SN8A 1QNJA 1UTKA 4X8TH 1FAXA 5GDSH 2PKSB 1C2DA 1KLTA 2WUCA 2Z6BD 2XBVA 4FU8A 1BRAA 1D3PB 1V2UT 1Z8JB 1CT2E 4BAMB 3GISB 4WWYA 1O2SA 1O33A 1O5CB 1W3CA 4INHA 4M7GA 3RXPA 3U1JB 1TMUH 2QF3A 2TBSA 1O37A 1WOFA 3UIRA 1TX8A 2A2XH 4I33A 3SJOA 1D6WA 3TLOA 1S84A 1BCUH 1Y5AT 2G5NA 5JYIA 1NRNH 1C5OH 3PB1E 4H6SB 1BRCE 2PTNA 1T32A 2QA9E 3ZZ3A 4BAKB 1NRSH 1BTPA 1ZPZA 2IJOB 3ODDA 1FLEE 3QX5H 2XCFA 3QN7A 4WH6A 1ZRBA 4JMYA 1VCWA 4IN2A 1DSUA 5EXMA 1HYLA 5A0BA 1K1IA 2GV7A 1GG6B 3UFAA 1THPB 1GGDC 1YLDA 1CHGA 1P2OA 3ZZ7A 2UUFB 3RXGA 4NFEA 1TONA 4AZ2B 4K69A 1Z8RA 3VPKA 4B75A 4FUHA 3BV9B 4AB8A 3BF6H 4NA9H 1AFQC 5A09A 3LH3A 2D26C 1NFYA 4JZFH 9ESTA 2QN5T 2Y5FA 1GMDF 2ALVA 2TGPZ 1FQ3A 1NC6A 3KN2A 2OD3B 1W0ZU 1MKXK 5EU8A 4KTCA 4JYVH 3LKWA 3PM3A 1K21H 3KQBA 1ZGIA 1UTQA 2D1JA 4X1RU 2VVUA 1ZR0A 1HFDA 3A89A 4GCHG 4B2BA 5A2MH 2HGTH 4UEHH 5K7RA 1SMFE 1NU7B 1FMGA 2ZP0H 4YOIA 2QC2A 2ANWA 2JETB 5JB8S 3QZQA 4MPUA 3STIA 2BDCA 4BNRA 1UTPA 3U69H 3BTME 3BG8A 3CS0A 3EA7A 1NFXA 1BTHH 3ZZBA 3UWJH 2VIPA 2ZQ1A 2Z3DA 4WVPE 3S7KB 4B2AA 4UFFH 4JZEH 4YLQH 5G4BA 2BD7A 1OS8A 2BLVA 4ABJA 5TJXA 1XVMA 4DVAU 4IBLH 4OS2A 1C4Y2 3ATWA 3RXDA 2W7UA 1PPFE 3OX7U 1UCYK 3LC5A 3RLWH 2FOMB 3FP6E 1VGCB 5FX5A 2P3FH 8GCHG 2SGPE 4TY6A 2HNTE 2HWLB 1IHSH 4DIIH 1TAWA 2Z9IA 2BD4A 3EA8A 3FP7E 1TA2A 1RTKA 1O2OA 1HIAA 4WMDA 1TMBH 2ZHWH 4CREA 4CR9A 1LMWB 4XE4A 1T31A 2ZDLA 2GV6A 1H1BA 2Q1JA 1F2SE 4FXGH 1V2PT 5E8EH 1Z71A 1IOEA 4IGDA 3Q76A 4Y10E 4WXIA 1LKBA 3ZYEA 1BOQA 2ZCKP 1MD8A 2IOTA 1DICA 1O2ZA 4MG3A 2BDAA 1O2JA 2VIVA 4X2WA 1ELFA 1Y3UA 1SPJA 1ELTA 1YLCA 1AE5A 1QBVH 3KIDU 4WF8A 1TGTA 3NXPA 1CE5A 2QGRA 4IMQA 1O2YA 3ZZ9A 1UCYH 3E0PB 2ZHFH 4LXBH 1ESTA 1J8AA 1OWJA 2O8MA 4TPIZ 2CMYA 1YGCH 4MPVA 1SGFA 1E34B 3DA9B 1C5TA 1UVPA 3TH4H 4Q2KA 3Q3XA 4ABBA 2UUYA 1TPOA 1SGDE 1EATA 3GCHC 3LGUA 1G36A 1TRMA 1V2ST 3AAVA 1L0ZA 1O3BA 2HPQH 1O3GA 1RS0A 2B5TB 2F9NA 3GDUA 3GY3A 1CA0C 3ELAH 3GY4A 3QWCH 1Y8TA 3M5NA 3P8NA 1CBWB 4Z0KA 1O2KA 3V0XA 5CE1A 2ZDVH 2G51A 3AW1A 2ANKH 2W5EA 1UVOA 1DS2E 3F9HA 1ELDE 1W7GH 3FZDA 1P05A 4ZAEA 4DG4A 4TWYA 3FANA 1Q3XA 4OS5A 1ETRH 2PSXA 2ZFTA 2ASUB 2VGCC 3R3GB 2CHAB 5F03A 3IWMA 2B0FA 1O3CA 1VZQH 1O2XA 1HGTH 1KDQA 1C5QA 2BDIA 3A81A 1K1NA 1ELBA 1RTLA 1Z8GA 1QBOA 1O5AB 1L1JA 1T4UH 2BLOA 4WY3A 3RXTA 4KELA 1SQOA 4BOHA 5AFZH 3UOPA 1V2NT 1RTFB 1FN8A 4TYDA 2GD4B 2A4GA 1UCYE 4YM9A 5ESTE 1ZLRA 5DP9A 1E35B 2ZO3H 4NWLA 4YOJA 5L2YH 2NU3E 1TNKA 1NRQH 1BZXE 2FX6A 5L30H 1HXEH 4TY7A 3O8DA 5JBTA 1G32B 1GDQA 2O8LA 1A0HB 2O9QA 1DVAH 1H8DH 3SU6A 1ABJH 4K2YA 3SJ8A 1GBJA 1EJMA 1O5GH 1SGCA 2C8YB 1TPSA 1DWCH 1O36A 1SSXA 1U6QA 1WV7H 3JZ2B 1MQ6A 3ZZDA 1SGEE 3S0NA 2C4FH 1LO6A 3MU8A 1C1OA 1JRSA 1O2HA 2AERH 1GJDB 5T6DA 1BUIA 1SBWA 3E6PH 1T8LA 1BHXB 1HV7A 1EX3A 2TGDA 4NIVA 2BM2A 4INLA 5F8TA 1QL9A 1NN6A 1EB1H 3LGYA 4VGCC 4ZH8A 1P2KA 4AFQA 1B7XB 3SO3A 2H5DA 3C27B 1EAXA 1IQLA 1LVBA 2QYIA 3SU1A 5DGJA 3M61U 2GKVE 2J95A 3DT0H 1ANBA 1DPOA 7KMEH 1TRYA 1MCTA 1F5LA 3M3VA 3M37A 3OU0A 4ZKOU 2VWLA 3B8JA 1MBMA 2AGGX 4F4OC 1TALA 2ZDKA 4XBCA 5JDUB 3ATKA 1O2RA 1C9PA 1KXEA 1UK4A 4DJZB 5HM2A 2P59A 1OPHB 2ZDAH 2F83A 3STJA 3T27A 3ITIA 1SHYA 5C20A 4AORA 1HAYB 2GGVB 4A6LA 1VCQA 4H4FA 1G3DA 2BD8A 2GCTB 1W2KH 2ZI2H 3SHAH 3TPIZ 1C5NH 2HVXA 2ZCHP 2ZFPH 4FVBA 1TQ0B 2ESTE 5C3NA 1GMCG 2Z9GA 1C2GA 1ETSH 7LPRA 1GI9B 1PQAA 1SGNE 1CA0B 2GT7A 1H4WA 3ZZAA 5EXLA 4GLYA 2WPJS 2SGFE 1ETTH 2QIQA 1LVMA 2G55A 4IS5A 1BQYA 1TBRH 2TIOA 4X2YA 1YPJH 3SUEA 1J14A 1NS3A 1EP5A 2GTBA 3M5OA 2PTCE 3S7HB 1YPMH 1ZZZA 2BZ6H 4XOJA 1PJPA 1UVSH 3SORA 3M7QA 1EOLA 1SGYE 2FX4A 3LH1A 4RKOB 3TGKE 2ZECA 4JZIA 5EPNA 4NFFA 4YLUA 1TRNA 3UQOA 1EAIA 1P57B 1Y3YA 1QTFA 3TH3H 4ABEA 1GI2A 1PFXC 3HKIB 1FY1A 1GBDA 1H8IH 2J9NA 2VB0A 3EDXB 3BEFB 1MTNB 1KSNA 1EJAA 3MWIU 3TNSA 1GVLA 2QV1A 4A1XA 2P3UB 3PLKA 3HKJB 1HUTH 1OWIA 1BMAA 1P2JA 3E8LA 1H9IE 1TX7A 4MVNA 2EI8A 4Q80A 1CO7E 5E0HA 4CRBA 5E0GA 2WUBA 1O35A 2ZZUH 2O8TA 2GP9B 2Y5GA 1C2EA 2XRCA 1SLUB 4MTBA 1BRBE 1BB0B 2ZFSA 3RXVA 1UTMA 1GHWH 5T6FA 2OLGA 3ATIA 2PGQB 2O8WA 4H42U 1ANDA 1TOMH 3A86A 3T26A 3KGPA 1A4WH 1O3KA 1EZQA 2AS9A 9LPRA 2QF0A 1UTJA 2W7SA 1ZPCA 1PPGE 4NA7A 1ZSJA 1GHBG 1FPHH 1VITF 4YTAA 1KLJH 3SU0A 1J16A 1VR1H 3RC6A 1X7AC 3SJKA 1SOTA 2BZAA 4HTCH 5HGGA 2UWPA 6GCHF 4GHQA 1DSTA 1QGFA 2FWWA 3PMAB 3GICB 4YZUA 2VH6A 2ZEBA 5T3HA 3UNSA 1GBIA 1GBBA 1HNEE 4I8LA 2NU2E 4K8YA 2BD2A 1YC0A 1ZPBA 1Y3WA 3MOCA 1FPCH 1XXDA 3QO6A 1WQVH 4DIHH 1NY22 5DKMA 3TK5A 1GJ8B 1QQ4A 1FY4A 5AF9H 1WSSH 1FIWA 3MH5A 3OY5U 2PR3A 4D8NA 1SQAA 2H1UA 1K2I1 1O3OA 5J4QA 3SNBA 1V2OT 1TGCA 2OBQA 5C1XA 3U8OH 1WQSA 3OY6U 3EQ0H 3S9AA 3MHWU 3RMLH 1MTVA 2BVSH 2PLXA 1YCPK 2G8TA 1HAGE 4BXWA 3PWBA 3TIUA 1YPHC 2QAAA 2FODA 2AIPA 2STBE 3SQEE 1TNLA 4MQAA 4I32A 1MU8B 1PPBH 2ODYB 3NUMA 4ZHMU 1ZJKA 3FVFB 1AI8H 3O8CA 2XBYA 1B5GH 2ZCLP 3TK9A 2XBWA 4AGKA 1GI5A 1UVUH 3SZNA 2OQUA 4UONA 4VGCB 2QXHA 2H2ZA 4MNYA 1F7ZA 3P8FA 1A2CH 1HAHH 2M5TA 5DP6A 1NRRH 5FX6A 3SU3A 4Y7AA 1S6HA 5JBAS 1HAVA 1WTGH 1PPHE 3SNEA 4U30A 1F0UA 1EAWA 2BOHB 1WU1A 4U01A 1ZHPA 2FDAA 5AVDA 2ZU1A 2SGQE 1E36B 1P04A 3TJNA 1C5MD 1MQ5A 3BTQE 1HXFH 1VGCC 3QTOH 2J94A 4IMZA 4AFSA 2AMQA 3K9XB 5B6OA 2UUJB 3GOVB 1LVOA 2GCHG 4HGCA 1C2JA 1Z6JH 2G4UA 5I25A 5AFYH 4JYUH 1DY8A 1XMNB 5LPEA 1LDTT 4UE7H 2FYRA 5LH8A 5EG4A 1SHHB 2FP7B 3DFJA 3GY7A 1SQTA 1LVYA 1TNGA 3LPRA 1TABE 2OBOA 3VB6A 5C1UA 1C2FA 1FV9A 1TGSZ 3ATMA 3EYDA 5J4SA 2SGDE 1P2NA 1W8BH 1G2LA 1P2QA 1ZMLA 2BVRH 2VVCA 4JCNA 2PUXB 1V2WT 3RM0H 2FLBH 4FUCA 4WMEA 1SB1H 3SOSA 1YKTA 4ZKRU 2GDDA 2GT8A 1WBGB 2A32A 1BRUP 2FPZA 2ZQ2A 3L6PA 2RCEA 1SGIB 5JBCS 1O31A 1OKXA 1C2KA 5IYTA 3ATLA 4X1QU 1W0YH 3V3MA 1CVWH 4LOYH 3ZVEA 4CRAA 1GJ9B 1MAYA 1CA8B 2FMJA 2G81E 2XYAA 4ZXYH 2J38A 4NZQA 1JXPA 3A8DA 2BY7X 2A4OA 2BY9X 2XBXA 1B0EA 2R3YA 4K8BA 5CHAB 1BMLA 2HPPH 3ZVDA 2G00A 4A1TA 2C8ZB 1TA6A 2BMGB 3SNCA 4A5TS 5C5NA 1HJAB 1AWFH 1S0RA 2R0LA 2Y81A 2ZU2A 3AASA 5F8XA 3RUOA 4CH8B 4LZ4B 3S9CA 2Q6GA 1AGJA 3S9BA 2FOEA 2AMDA 2W3KA 3ODFA 5L2ZH 1ZHRA 3K6YA 3SV2H 1IHTH 5JBBS 4AFUA 3FFGA 1EJNA 4DCDA 3RXHA 4ABAA 3MI4A 1QRZA 3WY8A 2H9TH 3MYWA 2ZGBH 2VJ1A 2XXLA 3EE0B 1TYNA 1J9CH 2BQ6B 3VB7A 5C2ZA 1GVKB 1ANEA 3FZZA 1SGPE 1XVOA 5FPYA 2ZTZA 1DWEH 2AEIH 4ESTE 3A82A 4ISHH 3A7WA 1LQDB 2FXRA 1GDNA 1O2UA 3RDZA 1ELCA 1RJXB 2F91A 1UMAH 2BD9A 2V35A 1BTXA 1T7CA 1G3EA 1C4U2 1V2TT 1XKAC 1K1LA 1XKBC 5C1YA 4BXSA 1YBWA 2FI4E 1CT0E 5GCHG 1O3FA 1KTSB 3Q77A 3NCLA 1P8VC 2BQ7B 1C5ZB 3QLPH 1MKWH 3EGKH 2K1QA 1ARCA 3P8GA 1FY3A 3RLYH 6CHAC 3PMBB 3LGTA 1Y5UT 1C2LA 2Z9LA 3MNXA 3BTWE 4NSYA 4MNWA 1DUEA 3RXFA 1OYTH 1DDJA 3SQHE 1LHEH 1GI8B 3ESTA 3M36A 1K1OA 1KDQB 1O3MA 1VITG 2BQWB 1TX6A 3A85A 2GCHF 2J2UA 5F8ZA 2OQ5A 4BTTB 2IPHA 4Y8XA 5DG6A 1J17T 1Q31A 3ZVGA 1ZJDA 1ZSLA 5FAHA 5DP7A 1BTWA 2ANMH 3RMMH 1O3JA 1BBRK 2Y6TA 3W95A 4D9RA 5DP5A 2ZKSA 4D7FA 1MCVA 1KLIH 1JWTA 2BTCE 2BDHA 1BTYA 1GBFA 3K2UA 2ZFQH 1TPPA 1SGRE 1GBAA 4B74A 3CENA 2H5CA 3TU7H 5EW1H 2QY0B 1XUFA 2LNCA 1NROH 1DLEA 1GI4A 2WPMS 3MNBA 1BJVA 4Y11E 4MPWA 3SU2A 1BIOA 1EP6A 1O5FH 1UO6A 2GZ8A 4BAHB 3VGCC 2F9BH 3E3TA 1D4PB 3M5LA 7GCHF 3R0FA 3PMHB 3C1KA 5E2OA 2WPKS 2ZPSA 3AVZA 2XC4A 3LGVA 1C1RA 1GBEA 3TVJB 3V12A 1K1MA 3Q3KA 2R2WU 1O34A 1GDUA 1RGQA 1VCPA 3W94A 1P02A 3UREA 3F68H 4JZ1A 1C1SA 2ZGXH 3BIUH 3IG6B 3MU0A 4YT7H 1JOUB 1AUTC 3AW0A 4NCYA 4UFGH 3MTYA 2ZFFH 2KAIA 3UNRA 4XBBA 1O5BB 1Q2WA 1HIAB 4XDEA 3SBKA 2FTLE 4NIYA 4ZHAA 4YOGA 3OTJE 3UOUA 1GJBB 3ZV9A 4ASHA 4NIXA 5IDKA 1MTWA 1Z8IB 3NKKA 4Q7YA 1QA0A 4D76A 2OC0A 5DK1A 2GZ7A 3K6ZA 1Z1IA 1LHFH 1THRH 2A7CA 4E05H 2P8OB 4CRGA 2ZPQA 1QFKH 2GCTC 1ELGA 5L6NH 2EA3A 1QB9A 2A5KA 2Q6DA 3D23A 4ABIA 1BITA 2OTVA 5EPYA 2THFB 1BTZA 3B9FH 3MU4A 3O8BA 4B1TA 1GJCB 3TJVA 1C5RA 3RXLA 3URCA 1P2MA 1ZTJA 4Q7XA 4X6NA 2PGBB 5EODA 5DJ7A 1SC8U 4THNH 1TNIA 1N6XA 1TNHA 1GJ5H 5FXLA 4RSPA 3KQEA 1IQNA 1TGNA 2JH6D 1DITH 4FUIA 1OYQA 2ZU4A 1GJ7B 4Z6AH 4MPXA 2BDGA 1AMHA 4OS4A 1SFQB 3KNXA 1S82A 1ZOMA 1DUAA 1ELVA 3RXUA 1B0FA 3GCNA 4XSKU 1NRPH 2AH4X 1A5HA 1O2LA 1C1TA 1O2PA 1MBQA 3UR9A 1L1NA 4AGJA 1D9IA 2NU4E 1C5WB 2V3OH 4KTUA 1H9HE 1O5DH 2BD3A 2EEKA 3F6UH 1QL8A 2R3UA 4J2YB 4WH8A 1UVTH 2SNWA 4DW2U 1AE8H 1TBQH 3QGJA 1NM6A 3LOXA 5GJ4B 3RU4E 1GJAB 2QCYA 4MNVA 1XUIA 2JH0D 2CN0H 3QK1A 1O38A 1D3QB 1ZTKA 1CQQA 3V7TA 1C1PA 4TWWA 1F0SA 5FPSA 1BHXF 2ZHDA 6GCHG 3QTVH 3ZVCA 3NWUA 1XUKA 4GCHF 3ZVBA 1JBUH 3GCTF 4B71A 2BVXH 1HAZB 1WTHD 2EI6A 2F9OA 1F5RA 2FOCA 1E37B 4ZROA 4DURA 1A3BH 2V0BA 2A5IA 4AN7A 1GHBF 1OWEA 3RXBA 2H6MA 5BRRE 2FI3E 1AQ7A 1C1VH 2OC7A 3ZV8A 1O39A 1HRTH 1BMMH 3H5CB 2XW9A 3TJUA 3TGIE 3L33A 1PYTC 3QUMP 5FHTA 1C2HA 1KXBA 1D3DB 1HLTH 2G52A 4E7NA 3M3SA 4UFEH 1NESE 2BY6X 1WUNH 1FY5A 2ILNA 3UQVA 1S5SA 3BN9A 5EXNA 1LTOA 4OS6A 2BX4A 3F1SB 2ZIQH 3E90B 4R0IA 2VIQA 1FONA 4O3TA 4I8GA 2C90B 5A8XA 2D8WA 2VGCB 1ZMJA 4GPGA 1AN1E 3A83A 3PLPA 4ISOA 1AKSB 3TH2H 3P70B 2CF8H 3B23B 3VB3A 1QCPA 1TE0A 2BHGA 4ZHLU 1P03A 3SGQE 3GCTG 1OP8A 1F92A 3PWCA 1INCA 1A1RA 3P6ZB 2ZDNA 2C8WB 4A92A 1FDPA 2Z3CA 1LQEA 1UTNA 5GPIB 3A7YA 1HJAC 2FOHA 3EA9A 5DO4H 4B2CA 2VIOA 3RP2A 4K5ZA 1AUJA 3GCHB 1YCPH 5T6GA 1SOZA 2C3SA 4X1SU 3A87A 1O2WA 4ISLA 3M3TA 5GCHF 1EPTC 3GDSA 1TB6H 4Y8YA 2OXSA 1T4VH 3SGBE 4NWKA 1F0RA 4GUXA 4A7IB 4A1VA 3DFLA 3SUFA 2OC1A 3G01A 1MZDA 1C5UA 1DX5M 4B73A 2R0KA 1V2KT 5A8YA 3KQCA 1CHOF 4K1SA 1ACBE 1W10U 1OP2A 2GZ9A 1QIXB 1P01A 3SJ9A 1YPEH 3FP8E 1AZ8A 1IQJA 1NO9H 2OUAA 3RXJA 1V2VT 3VFEA 1L2EA 2RDLA 1LHGH 1ELEE 3VB5A 3E1XB 1RFNA 1GHXH 1GHAF 2WV5A 2PHBA 1FN6A 5GIBA 3A84A 2ODQA 2A31A 2UWOA 2ZNKH 4BAOB 1NT1A 1P9SA 5DP8A 2Y5HA 1QJ7B 1EOJA 1AD8H 1EUFA 2ZU5A 3D62A 2H9EH 5SGAE 2FO9A 3VGCB 2NWNA 2QXJA 3DD2H 3NK8A 3MMGA 4Y6DA 3UWIA 1GGDB 5FCKA 1HDTH 4CBNA 3GDVA 5HXFA 3SNDA 3U9AH 2AFQB 1Z1JA 1EAUA 3RM2H 1A46H 1ARBA 1FI8A 1O2QA 3UR6A 2F9UA 1TNJA 4K60A 2FEQH 1C4V2 3P17H 1MTNC 2BLWA 4KKDA 2OC8A 2Y7XA 1E0FD 3ENSB 1YPKH 2CXVA 2JKHA 4ZKNU 4AG1A 5FBIA 1XUJA 1A7SA 3MO6A 1HAVB 1XM1A 3T29A 4WJG2 3RU4D 1FNIA 1ORFA 4KP0A 1C5SA 1L4DA 2ZPRA 2FM2A 2XCNA 1PYTD 1O2GH 3KCGH 5JB9S 2TPIZ 1DWBH 1AY6H 2QXGA 2J34A 4SGAE 1AB9B 4PROA 1C2MA 1O30A 2Z94A 4Y76A 3RXMA 2CHAC 1TGBA 1FUJA 2Y7ZA 1GMDG 1SLXB 1QA7A 1THSH 2CV3A 2B9LA 2SNVA 3SW2B 1ZHMA 4D9QA 1YM0A 2YNAA 3JZ1B 1IQEA 1SG8B 1GPZA 5ABWA 1WAYB 5PTPA 3HPTB 3DUXH 2LPRA 1XXFA 1W13U 2P95A 1C5PA 2P3TB 7ESTE 5I46H 2GMTC 4FVDA 2PKAA 1E38B 1TIOA 4X2VA 2P93A 1AB9C 1EZSC 2WPIS 1OWKA 3ZZ8A 3SI3H 5C5OA 2BDYA 2J92A 2WINI 5DP3A 1RXPA 3MH4A 4XFQA 1HJ8A 1DY9A 5ESBA 2ULLA 1SGTA 3BTDE 1QRWA 4X6PA 1G9IE 1QB1A 4MNXA 1ZYOA 2Z7FE 1L4ZA 4QT8C 1O3HA 4J1YA 3SNAA 1P9UA 2A4RA 3AAUA 1GCTB 3PYHA 1KXAA 1SI5H 2W3IA 1DANH 1LHDH 1N8OB 1Y5BT 4HZHA 1UK2A 1YP9A 1OX1A 2NU1E 3VXEH 2BB4A 1A5IA 1UHBA 3LONA 4Y7BA 3QZRA 1O3DA 1RIWB 2ZDMA 3HK6B 1PQ5A 1WYKA 1DM4B 1Z7KA 1D6RA 2HLCA 4ABFA 1MTSA 6CHAB 1IQMA 1EXFA 2HNTF 1GHYH 3A7XA 3BEIB 4AYYB 5GXPA 1QHRB 1UK3A 2A45B 4FU7A 3P8OA 2A7HA 1O2MA 1IQIA 4CHAC 3I77A 2Y82A 4Q7ZA 1BJUA 4E06H 1VJAU 3U8RH 5C67A 1C1MA 2ZG0H 4WMFA 1CSOE 4KGAA 2XWBI 1CGIE 5K0HA 3GCOA 1EZUC 4FUBA 5E2PA 8GCHF 6ESTA 3Q3YA 2VNTA 1KXDA 5LPFA 2TGAA 1HCGA 3OSYA 4X8SH 3PMJA 5A0CA 4B76A 1BT7A 1Z6EA 2G4TA 4BTIB 1AVWA 1QB6A 4MDSA 4NA8A 3SI4H 1QQUA 3DHKH 4X8UH 3TITA 1MH0A 3UTUH 2XTTB 4I8KA 2BXTH 3QDZB 1OP0A 2ZFRH 1IQHA 2FZZA 2JETC 3ZZ6A 1K1PA 5HMAA 1AZZA 1QBNA 1P12E 1S83A 1KTTB 1OOKB 4K1EA 4DY7B 2JH5D 2ZGJA 4O9VA 1GI1A 3BTFE 4SGBE 1O2VA 3BG4B 2I6QA 4AG2A 1MKXH 4CRDA 1A0LA 2VIWA 2BDBA 2V6NA 1HAOH 1O3AA 1TPAE 2OINA 3GYLB 2GVFA 1S81A 1YF4A 1DOJA 1GG6C 1AVXA 2CGAA 1OXGA 2VU8E 3RXKA 3F9FA 1XUHA 3BTEE 1GL0E 5CMXH 3M7TA 2BYAX 3FAOA 1MUEB 1G2MA 3M5MA 1M9UA 3GY2A 1FIZA 4UFDH 4FUEA 2R9PA 4NG9H 1S6FA 1V2LT 3E16B 5DP4A 2VH0A 3CP7A 1C2IA 2A4QA 2F9PA 2OP9A 3ZZ4A 1A0JA 1C1QA 3HGNA 3SV6A 2ALPA 4GVUA 1O3EA 1IQGA 1O2NA 4NSVA 4Y8ZA 4TPYA 1TFXA 1JRTA 5LGOA 1CHOG 1EZXC 4X1NU 4BANB 1F0TA 1C5LH 1G37A 1TOCB 2A5AA 1NFUA 7GCHG 2ZWLH 1GJ4H 3RC4A 3O8RA 4D7GA 4CH2B 2FTMA 3SJIA 3PLBA 3LU9B 3P95A 2VINA 3GY8A 4IC6A 1GHVH 2ZGHA 1SR5C 1QRXA 2XNIA 2Z3EA 4GHTA 1P3EA 4DOQA 1HBTH 3A8CA 3LGWA 1MAXA 1LHCH 1ZSKA 5H4IB 1AKSA 1FY8E 1SVPA 1KYNA 1EPTA 4I7YH 1GI3A 2CF9H 1OWDA 2C8XB 1JIMA 3KEEA 1EKBB 1QJ6B 3UY9A 3E0NB 5DPAA 1CGJE 2WYGA 2RA0A 1TWXB 1ABIH 1GMHG 1GJ6A 2PKAB 2PUQH 1V2RT 2ZGCA 3BG4C 1ELAA 1C5YB 3SV9A 1OSSA 5ETXA 4AOQA 1GCTC 3QGNB 3ZVFA 1G30B 4YESB 2SGAA 1RIWC 3RMNH 2ZHQH 1V3XA 8LPRA 1HAPH 1AHTH 1C5VA 8ESTE 1NPMA 2RG3A 1GHAG 1KXFA 3H7OA 3A7VA 1EB2A 1GMHF 1K9OE 3D49H 4HI3A 1GI6A 3A8BA 2FOBA 2EI7A 1ZGVA 3BIVH 1DLKB 3A80A 5EQQA 5FPTA 1RD3B 1P3CA 2UUKB 4DGJA 1FXYA 2A2QH 1OWHA 2AGIX 2FS9A 1HJ9A 1QURH 3A88A 5BPEA 3D65E 1C1NA 4O3UA 1P10A 2Q6FA 2FESH 2WV4A 3SHCH 2AIQA 3RU4T 2STAE 1GBKA 2A7JA 4BAQB 1AWHB 2KAIB 1BBRH 1FZZA 1D3TB 5A0AE 1QL7A 2I6SA 1V2JT 1LKAA 1NU9A 1WCZA 4YO9A 2VIDA 1JIRA 3M35A 1H9LB 3CS7A 3PO1B 3RXIA 2PWXA 4X1PU 5HYOA 2V3HH 1CT4E 4DT7B 1T8MA 2Z9KA 1P0SH 1IQKA 3SV7A 4X0WU 4ZXXH 1CBWC 2ZF0H 1Y3VA 4I8JA 3HGPA 2ANYA 3E91A 2BD5A 1N8OC 4GAWA 4H6TA 4RKJB 2PW8H 3OYPA 3ZZCA 1DXWA 2FLRH 3SUGA 2PFEA 3KF2A 3KQDA 3UNQA 3LDXH 4GSOA 4INKA 1SGQE 2BY8X 1LPGB 1HB0B 1T8NA 4ABGA 5EQRA 1BTUA 1KIGH 1HAIH 3HATH 3VB4A 2DE8A 3IITA 2P8OC 4XBDA 4Y71A 3RXRA 1GI7B 1V6DA 5F6MA 5HM9A 3MNCA 3MH6A 3ZZ5A 3RC5A 1PQ8A 1HAXB 3U8TH 1W14U 5JPMH 1MKWK 1KXCA 5EGMA 2ODPA 1YPLH 2IN2A 3NPSA 1AIXH 4Y0ZE 2GDEH 2FYQA 2TGTA 2ZU3A 2ZTXA 1EASA 3MFJA 1BBRE 5FCRA 4IN1A 1C1UH 1ZMNA 2FS8A 2VWOA 4X8VH 3ZYDA 3RXEA 3BTTE 2VWMA 1PQ7A 3H7TA 1TQ7B 2AYWA 1K28D 1XUGA 1NZQH 1S0QA 2AGEX 3HK3B 2F3CE 2TRMA 2HALA 3BTKE 4JZDH 3SGAE 1MD7A 1VJ9U 4YT6H 1MMJN 4UD9H 3MNSA 4WXVA 4CHAB 2W26A 4CRCA 2CJIA 1HPGA 3GY6A 4FU9A 4MLFB 1O5EH 3UPEA 3S69A 1AO5A 4LZ1H 4ZKSU 4OS7A 1JMOH 1GCDA 1LPKB 4NGAH 2J4IA 1S85A 1T8OA 1O2IA 1L1GA 3KL6A 4Y79A 4U32A 3EAJA 2NU0E 1ZRKA 4FUJA 4ZUHA 1MTUA 1GL1A 5E0JA 3A7TA 3P92A 5EOKA 1N1LA 4U2WA 1N6YA 1O2TA 2BOKA 2FOFA 1GMCF 3RXQA 3GYMA 3LJOA 4K3JA 3PV4A 4NIWA 1TMTH 4O97A 1BMNH 2P94A 1G3CA 1P2IA 1YPGH 4OGXA 2BX3A 1ZTLA 2FOAA 1ESBA 1FJSA 2FI5E 1IAUA 3I78A 3KHVA 1GBHA 1O3IA 1O0DH 3U98H 1AU8A 1A61H 1UTOA 5A8ZA 2F9VA 3TNTA 3Q00A 1YCPM 1Y59T 3U1IB 2DUCA 2O8UA 4ZMAH 2GX4A 3M7UA 1ANCA 3UUZA 3PTBA 1W11U 1F5KU 2HRVA 3VEQB 3PTNA 3RXCA 4KTSA 1P09A 1EQ9A 1PPZA 2Y80A 2G5VA 1DE7H 3VXFH 4AB9A 2PV9B 4I8HA 2DE9A 2GMTB 4ABHA 1GBCA 1O3NA 4AX9H 2HNTC 2D2DA 3LIWA 4AYVB 2SFAA 3PROA 1TBZH 2SGEE 1CGHA 2H9HA 4JYTA 4X6MA 1V2MT 3TJOA 1SL3A 2AMPA 1O3LA 3MU1A 4BTUB 6LPRA 3A8AA 1P11E 3F9GA 1GWAA 2HOBA 1BA8B 2FOGA 3T62A 1Y3XA 1K1JA 2WPLS 4O03A 2B8OH 4CRFA 2Z9JA 3MH7A 1LPZB 2FIRH 1QR3E 3TGJE 1O3PB 3SV8A 3BTGE 1TLDA 4UDWH 8KME2 4FUGA 5FBEA 3LGIA 4I31A 4R8TB 1UTLM 1DXPA 2PSYA 3T25A 1ID5H 1QY6A 4IC5A 1AVGH 3MU5A 1GHZA 2PKSC 4OS1A 1BDAA 1P06A 2R2MB 3SU4A 4Y0YE 3T5FH 3BEUA 1SGFG 4LK4A 4X2XA 2C93B 4NZLA 1J15A 3LC3A 1ESAA 1GVZA 5EW2H 3BTHE 3PO1C 2EC9H 3BSQA 1FAKH 2B7DH 4OGYA 2A0QB 1DT2A 1A3EH 2XC0A 1GBTA 2XC5A 1AFEH 1SFIA 1UJ1A 1C5XB 1K22H 1MZAA 5CHAC 2BXUH 1CU1A 1G3BA 3TK6A 2YOLA 1C9TA 3I29A 4RN6A
chains in the Genus database with same CATH superfamily
3K65B 2ZA5A 2RDEA 1GBLA 1W7XH 3LT3A 5AHGH 1LCYA 4ISIH 4F49A 2OCVB 5LPRA 1MU6B 4AFZA 1VITH 3GY5A 1C1WH 3RXOA 2WYJA 2KR7A 1DWDH 1KY9A 1RRKA 2WPHS 3V13A 1PPEE 4HFPB 3LJJA 1NFWA 2RA3A 1PPCE 4FUDA 1V2QT 5GWZA 1YPHE 1O32A 1GI0A 3T2NA 3URDA 4K1TA 2BY5X 3SU5A 3RMOH 3SUDA 3KQ5A 4E7RG 1W12U 1A5GH 5TCCA 3RXAA 2A1DB 3RXSA 5EQSA 1UHBB 3T28A 1SLWB 4ISNA 2YNBA 4FUFA 1SLVB 4FOUC 1YYY1 1DFPA 2BLQA 5TCAA 4JK6A 1GBMA 1QZ8A 3A7ZA 2QXIA 2XWAA 4X6OA 3ZVAA 2ZTYA 3MO9A 2VWNA 2ZC9H 4JK5A 1AFQB 3N7OA 1EPTB 4IW4E 1IQFA 3SZEA 4CBOA 2UWLA 1SKYE 1NTPA 1E1QD 4CR5A 3MO3A 4ABDA 2P16A 3F9EA 1QJ1B 2VVVA 1XX9A 3NZIA 2ZHEH 3L3TA 3SN8A 1QNJA 1UTKA 4X8TH 1FAXA 5GDSH 3EE7A 2PKSB 1C2DA 1KLTA 2WUCA 2Z6BD 2XBVA 4FU8A 1BRAA 1D3PB 1V2UT 1Z8JB 1CT2E 4BAMB 3GISB 4WWYA 1O2SA 1O33A 1MABB 1O5CB 1W3CA 4INHA 4M7GA 3RXPA 3U1JB 1TMUH 2QF3A 1NBME 2TBSA 1O37A 1WOFA 3UIRA 1TX8A 2A2XH 4I33A 3SJOA 1D6WA 3TLOA 1S84A 1BCUH 1Y5AT 2G5NA 5JYIA 1NRNH 1C5OH 3PB1E 4H6SB 1BRCE 2PTNA 1T32A 2QA9E 3N99A 3ZZ3A 4BAKB 1NRSH 1BTPA 1ZPZA 2IJOB 3ODDA 1FLEE 3QX5H 2XCFA 3QN7A 4WH6A 1ZRBA 4JMYA 1VCWA 4IN2A 2J5UA 1DSUA 5EXMA 1HYLA 5A0BA 1K1IA 2GV7A 1GG6B 3UFAA 1THPB 1GGDC 1YLDA 5CDFE 3FO8D 1CHGA 1P2OA 3ZZ7A 2UUFB 3RXGA 4NFEA 1TONA 1COWD 4AZ2B 4K69A 1Z8RA 3VPKA 4B75A 4FUHA 3BV9B 4AB8A 3BF6H 4NA9H 1AFQC 5A09A 3LH3A 2D26C 1NFYA 4JZFH 3F3BA 9ESTA 2QN5T 2Y5FA 1GMDF 2ALVA 2TGPZ 1FQ3A 1NC6A 3KN2A 2OD3B 1W0ZU 1MKXK 5EU8A 4KTCA 4JYVH 3LKWA 3PM3A 1K21H 3KQBA 1ZGIA 1UTQA 2D1JA 4X1RU 2VVUA 1ZR0A 1HFDA 3A89A 4GCHG 4B2BA 5A2MH 2HGTH 4UEHH 5K7RA 1SMFE 1VKYA 1NU7B 1FMGA 2ZP0H 4YOIA 2QC2A 2ANWA 2JETB 5JB8S 3QZQA 1S6LA 4MPUA 3STIA 2BDCA 4BNRA 1UTPA 3U69H 3BTME 3BG8A 3CS0A 3EA7A 1NFXA 1BTHH 2WHXA 3ZZBA 1YWUA 3UWJH 2VIPA 2ZQ1A 2Z3DA 4WVPE 3S7KB 4B2AA 4UFFH 4JZEH 4YLQH 5EIYA 5G4BA 2BD7A 1OS8A 2BLVA 4ABJA 5TJXA 1XVMA 4DVAU 4IBLH 4OS2A 1C4Y2 3ATWA 3RXDA 2W7UA 1PPFE 3OX7U 1UCYK 3LC5A 3RLWH 2FOMB 3FP6E 1VGCB 5FX5A 2P3FH 8GCHG 2SGPE 4TY6A 2HNTE 2HWLB 1IHSH 4DIIH 1TAWA 2Z9IA 2BD4A 3EA8A 3FP7E 1TA2A 1RTKA 1O2OA 1HIAA 4WMDA 1TMBH 2ZHWH 4CREA 4CR9A 1LMWB 4XE4A 1T31A 2ZDLA 2GV6A 1H1BA 2Q1JA 1F2SE 4FXGH 1V2PT 5E8EH 1Z71A 1IOEA 1EFRD 4IGDA 1SQRA 3Q76A 4Y10E 3OEED 1LKBA 4WXIA 3ZYEA 1BOQA 2ZCKP 1MD8A 2IOTA 1DICA 1O2ZA 4MG3A 2BDAA 1O2JA 3UB0A 2VIVA 4X2WA 1ELFA 1Y3UA 1SPJA 1ELTA 1YLCA 1AE5A 1QBVH 3KIDU 3NRLA 4WF8A 1TGTA 3NXPA 1CE5A 2QGRA 4IMQA 1O2YA 3ZZ9A 1UCYH 3E0PB 2ZHFH 1BMFD 4LXBH 1ESTA 1J8AA 1OWJA 2O8MA 4TPIZ 2CMYA 1YGCH 4MPVA 1SGFA 1E34B 3DA9B 1C5TA 1UVPA 3TH4H 4Q2KA 3Q3XA 4ABBA 2UUYA 1TPOA 1SGDE 1EATA 3GCHC 3LGUA 1G36A 1TRMA 1V2ST 3AAVA 1L0ZA 1O3BA 2HPQH 1O3GA 1RS0A 2B5TB 2F9NA 3GDUA 3GY3A 1CA0C 3ELAH 3GY4A 3QWCH 1Y8TA 3M5NA 3P8NA 1CBWB 4Z0KA 1O2KA 3V0XA 5CE1A 2ZDVH 2G51A 3AW1A 2ANKH 2W5EA 3F2GA 1UVOA 1DS2E 3F9HA 1ELDE 1W7GH 3FZDA 1P05A 4ZAEA 4DG4A 4TWYA 3FANA 1Q3XA 4OS5A 1ETRH 2PSXA 2ZFTA 2ASUB 2VGCC 3R3GB 2CHAB 5F03A 3IWMA 2B0FA 1O3CA 1VZQH 1O2XA 1HGTH 1KDQA 1C5QA 2BDIA 3A81A 1K1NA 1ELBA 1RTLA 1Z8GA 1QBOA 1O5AB 1L1JA 1T4UH 2BLOA 4WY3A 3RXTA 4KELA 1SQOA 4BOHA 5AFZH 3UOPA 1V2NT 1RTFB 2KCAA 1FN8A 4TYDA 2GD4B 2A4GA 1UCYE 4YM9A 5ESTE 1ZLRA 5DP9A 1E35B 2ZO3H 4NWLA 4YOJA 5L2YH 2NU3E 1TNKA 1NRQH 1BZXE 2FX6A 5L30H 1HXEH 4TY7A 3O8DA 5JBTA 1G32B 1GDQA 2O8LA 1A0HB 2O9QA 1DVAH 1H8DH 3SU6A 1ABJH 4K2YA 3SJ8A 1GBJA 1EJMA 1O5GH 1SGCA 2XOKD 2C8YB 1TPSA 1DWCH 1O36A 1SSXA 1U6QA 1WV7H 3JZ2B 1MQ6A 3ZZDA 1SGEE 3S0NA 2JJ2D 2C4FH 1LO6A 3MU8A 1C1OA 4TT3D 1JRSA 4Q63A 2M2AA 1O2HA 2AERH 1GJDB 5T6DA 1BUIA 1SBWA 2EY4C 3E6PH 1T8LA 1BHXB 1HV7A 1EX3A 2TGDA 4NIVA 2BM2A 4INLA 5HIYA 5F8TA 1QL9A 1NN6A 2J98B 1EB1H 3LGYA 4VGCC 4ZH8A 1P2KA 4AFQA 1B7XB 3SO3A 2H5DA 3C27B 1EAXA 1IQLA 1LVBA 2QYIA 3SU1A 5DGJA 3M61U 2GKVE 2J95A 3DT0H 1ANBA 1DPOA 7KMEH 2J97A 1TRYA 1MCTA 1F5LA 3M3VA 3M37A 3OU0A 4ZKOU 2VWLA 3B8JA 1MBMA 2AGGX 4F4OC 1TALA 2ZDKA 4XBCA 5JDUB 3ATKA 1O2RA 1C9PA 1KXEA 1UK4A 4DJZB 5HM2A 2P59A 1OPHB 2ZDAH 2F83A 3STJA 3T27A 3ITIA 1SHYA 5C20A 4AORA 1HAYB 2GGVB 4A6LA 1VCQA 4H4FA 1G3DA 2BD8A 2GCTB 1W2KH 2ZI2H 3SHAH 3TPIZ 1C5NH 2HVXA 2ZCHP 2ZFPH 4FVBA 1TQ0B 2ESTE 5C3NA 1GMCG 4ASUD 2Z9GA 1C2GA 2IPQX 1ETSH 7LPRA 1GI9B 1PQAA 1SGNE 1CA0B 2GT7A 1H4WA 3ZZAA 5EXLA 4GLYA 2WPJS 2SGFE 1ETTH 2QIQA 1LVMA 2G55A 4IS5A 1BQYA 1TBRH 2TIOA 4X2YA 1YPJH 3SUEA 1J14A 1NS3A 1EP5A 2GTBA 3M5OA 2PTCE 3S7HB 1YPMH 1ZZZA 2BZ6H 4XOJA 1PJPA 1UVSH 3SORA 3M7QA 1EOLA 1SGYE 2FX4A 3LH1A 4RKOB 3TGKE 2ZECA 4JZIA 5EPNA 4NFFA 4YLUA 1TRNA 3UQOA 1EAIA 2IJD1 1P57B 1Y3YA 1QTFA 3TH3H 4ABEA 1GI2A 1PFXC 3HKIB 1FY1A 1GBDA 1H8IH 2J9NA 2VB0A 3EDXB 3BEFB 1MTNB 1KSNA 1EJAA 3MWIU 3TNSA 4DT4A 1GVLA 2QV1A 4A1XA 2P3UB 3PLKA 3HKJB 2KM0A 1HUTH 1OWIA 1BMAA 1P2JA 3E8LA 1H9IE 1TX7A 4MVNA 3FN8A 2EI8A 4Q80A 1CO7E 5E0HA 4CRBA 5E0GA 2WUBA 1O35A 2ZZUH 2O8TA 2GP9B 2K8IA 2Y5GA 1C2EA 5C0TA 2XRCA 1UW7A 1SLUB 4MTBA 1BRBE 1BB0B 2ZFSA 3RXVA 2J98A 1UTMA 1GHWH 5T6FA 2OLGA 3ATIA 2PGQB 2O8WA 4H42U 1ANDA 1TOMH 3A86A 3T26A 3KGPA 1A4WH 1O3KA 1EZQA 2AS9A 9LPRA 2QF0A 1UTJA 2W7SA 1ZPCA 1PPGE 4NA7A 1ZSJA 1GHBG 2QE7D 1FPHH 1VITF 4YTAA 1KLJH 3SU0A 1J16A 1VR1H 3RC6A 1X7AC 3SJKA 3CNRA 3DCLA 1YLNA 1SOTA 2BZAA 4HTCH 5HGGA 2UWPA 5F53A 6GCHF 4GHQA 1DSTA 1QGFA 2FWWA 3PMAB 3GICB 4YZUA 2VH6A 2ZEBA 5T3HA 3UNSA 2KCOA 1GBIA 1GBBA 1HNEE 4I8LA 2NU2E 4K8YA 2BD2A 4I86A 1YC0A 1ZPBA 1Y3WA 3MOCA 1FPCH 1XXDA 3QO6A 1WQVH 4DIHH 1NY22 5DKMA 3TK5A 1GJ8B 1QQ4A 1FY4A 5AF9H 1WSSH 1FIWA 3MH5A 3OY5U 2PR3A 4D8NA 1SQAA 2H1UA 1K2I1 1O3OA 5J4QA 3SNBA 1WXRA 1V2OT 1TGCA 2OBQA 2V7QD 5C1XA 3U8OH 1WQSA 3OY6U 3EQ0H 3S9AA 2HVYB 3MHWU 3RMLH 1MTVA 2BVSH 2PLXA 1YCPK 2G8TA 1HAGE 3OFND 3PWBA 3TIUA 4BXWA 3MQKC 1YPHC 2QAAA 2FODA 2AIPA 2STBE 2W6JD 3SQEE 1TNLA 4MQAA 3VG8A 3DSGA 4I32A 1MU8B 1PPBH 2ODYB 3NUMA 4ZHMU 1ZJKA 5C0UA 3FVFB 1AI8H 3O8CA 2XBYA 2AHME 1B5GH 1YY3A 2ZCLP 3TK9A 2XBWA 4AGKA 1GI5A 1UVUH 3SZNA 3OTPA 2OQUA 4UONA 4VGCB 2QXHA 2H2ZA 4MNYA 1F7ZA 3P8FA 1A2CH 1HAHH 2M5TA 5DP6A 1NRRH 5FX6A 3SU3A 4Y7AA 1S6HA 5JBAS 1HAVA 1WTGH 1PPHE 3SNEA 4U30A 1F0UA 1EAWA 2BOHB 1WU1A 4U01A 1ZHPA 2FDAA 5AVDA 2ZU1A 2SGQE 1E36B 1P04A 3TJNA 1C5MD 1MQ5A 3BTQE 1HXFH 1VGCC 3QTOH 2J94A 4IMZA 4AFSA 2AMQA 3K9XB 5B6OA 2UUJB 3GOVB 1LVOA 2GCHG 4HGCA 1C2JA 1Z6JH 2G4UA 5I25A 5AFYH 4JYUH 1DY8A 1XMNB 5LPEA 1LDTT 4UE7H 2FYRA 5LH8A 5EG4A 1SHHB 2FP7B 3DFJA 4Q4LA 3GY7A 1SQTA 1LVYA 1TNGA 3LPRA 1TABE 2OBOA 3VB6A 5C1UA 1C2FA 1FV9A 1TGSZ 3N7DA 3ATMA 3EYDA 5J4SA 2SGDE 1P2NA 1W8BH 1G2LA 1P2QA 1ZMLA 2BVRH 2VVCA 4JCNA 2PUXB 1V2WT 3RM0H 2FLBH 4FUCA 4WMEA 1SB1H 3SOSA 1YKTA 4ZKRU 2GDDA 2GT8A 1WBGB 2A32A 1BRUP 2FPZA 2ZQ2A 3L6PA 2RCEA 1SGIB 5JBCS 3KYFA 5KEDA 3F2HA 1O31A 1OKXA 1C2KA 5GNDA 2LELA 5IYTA 3ATLA 3FKSD 4XD7D 4X1QU 1W0YH 3V3MA 1CVWH 2K0QA 4LOYH 3ZVEA 4CRAA 1GJ9B 1MAYA 1CA8B 1FX0B 2FMJA 2G81E 2XYAA 4ZXYH 2J38A 4NZQA 1JXPA 3A8DA 2BY7X 2A4OA 2BY9X 2XBXA 1B0EA 2R3YA 4K8BA 5CHAB 1BMLA 2HPPH 3ZVDA 2G00A 4A1TA 2C8ZB 1TA6A 2BMGB 3SNCA 4A5TS 5C5NA 1HJAB 1AWFH 1S0RA 2R0LA 2Y81A 2ZU2A 3AASA 5F8XA 3RUOA 4CH8B 4LZ4B 3S9CA 2Q6GA 1AGJA 3S9BA 2FOEA 2AMDA 2W3KA 3ODFA 5L2ZH 1ZHRA 3K6YA 3SV2H 1IHTH 5JBBS 4AFUA 3FFGA 1EJNA 4DCDA 3RXHA 4ABAA 3MI4A 4P02A 4F48B 1QRZA 3WY8A 3N7EA 2H9TH 3MYWA 2ZGBH 2VJ1A 2XXLA 2VBCA 3EE0B 1TYNA 1J9CH 2BQ6B 3VB7A 5C2ZA 1GVKB 1ANEA 3FZZA 1SGPE 3H09A 1XVOA 5FPYA 2ZTZA 3W1EA 1DWEH 2AEIH 4ESTE 3A82A 4ISHH 3A7WA 1LQDB 2FXRA 1GDNA 1O2UA 3RDZA 1ELCA 3F0PA 1RJXB 2F91A 2GJGA 1UMAH 2BD9A 2V35A 1BTXA 1T7CA 1G3EA 1C4U2 1V2TT 4OM9A 1XKAC 1K1LA 1XKBC 2HLDD 5C1YA 4BXSA 1YBWA 2FI4E 1K0HA 1CT0E 5GCHG 1O3FA 3PV5A 1KTSB 3Q77A 4RT1A 3NCLA 1P8VC 2BQ7B 1C5ZB 3QLPH 1MKWH 3EGKH 2K1QA 1ARCA 3P8GA 1FY3A 2L74A 3RLYH 6CHAC 3PMBB 3LGTA 1Y5UT 1C2LA 2Z9LA 3MNXA 3BTWE 4NSYA 4MNWA 1DUEA 1KMHB 3RXFA 1OYTH 1DDJA 3SQHE 1LHEH 1GI8B 2QF4A 3ESTA 3M36A 1K1OA 1KDQB 1O3MA 1VITG 2BQWB 1TX6A 3A85A 2GCHF 2J2UA 5F8ZA 2OQ5A 4BTTB 2IPHA 4Y8XA 5DG6A 1J17T 1Q31A 3ZVGA 1ZJDA 1ZSLA 5FAHA 5DP7A 1BTWA 2ANMH 3RMMH 1O3JA 1BBRK 2Y6TA 3W95A 4D9RA 5DP5A 2ZKSA 4D7FA 5IK2D 1MCVA 1KLIH 1JWTA 2BTCE 2BDHA 1BTYA 1GBFA 3K2UA 2ZFQH 1TPPA 1SGRE 1GBAA 4B74A 3CENA 2H5CA 3TU7H 5EW1H 2QY0B 1XUFA 2LNCA 1NROH 1DLEA 1GI4A 2WPMS 5EJZA 3MNBA 5HKKD 1BJVA 4Y11E 4MPWA 3SU2A 1BIOA 1EP6A 1O5FH 1UO6A 2GZ8A 4BAHB 3VGCC 2F9BH 3E3TA 1D4PB 3M5LA 7GCHF 3R0FA 3PMHB 3C1KA 5E2OA 2WPKS 2ZPSA 3AVZA 2XC4A 3LGVA 1C1RA 1GBEA 3TVJB 3V12A 2EQNA 1K1MA 3Q3KA 2R2WU 1O34A 1GDUA 1RGQA 1VCPA 3W94A 2RFKC 1P02A 3UREA 3F68H 4JZ1A 1C1SA 2ZGXH 3BIUH 3IG6B 3MU0A 2F4LA 4YT7H 1JOUB 1AUTC 3AW0A 4NCYA 3OEHD 4UFGH 3MTYA 2W6ID 2ZFFH 2KAIA 3UNRA 4XBBA 1O5BB 1Q2WA 3ZIAD 1HIAB 4XDEA 3SBKA 2FTLE 4NIYA 4ZHAA 4YOGA 3OTJE 3UOUA 1GJBB 3ZV9A 4ASHA 4NIXA 5IDKA 1MTWA 3WW7A 1Z8IB 3NKKA 4Q7YA 1QA0A 4D76A 2OC0A 2LP6A 5DK1A 2GZ7A 3K6ZA 1Z1IA 1LHFH 1THRH 2A7CA 4E05H 2P8OB 4CRGA 2ZPQA 1QFKH 2GCTC 1ELGA 5L6NH 2EA3A 1QB9A 2A5KA 2Q6DA 3D23A 4ABIA 1BITA 2OTVA 2WZQA 5EPYA 2THFB 1BTZA 3B9FH 3MU4A 3O8BA 4B1TA 1GJCB 3TJVA 1C5RA 3RXLA 3URCA 1P2MA 1ZTJA 1E79D 2KX4A 4Q7XA 4X6NA 2PGBB 5EODA 5DJ7A 1SC8U 4THNH 1TNIA 1N6XA 1TNHA 1GJ5H 5FXLA 4RSPA 3KQEA 1IQNA 1TGNA 2JH6D 1DITH 4FUIA 4Z1MD 1OYQA 2ZU4A 1GJ7B 4Z6AH 4MPXA 2BDGA 1AMHA 4OS4A 1SFQB 3KNXA 1S82A 1ZOMA 1DUAA 1ELVA 3RXUA 1B0FA 3GCNA 4XSKU 1NRPH 2AH4X 1A5HA 1O2LA 1C1TA 1O2PA 1MBQA 3UR9A 1L1NA 4AGJA 1D9IA 2NU4E 1C5WB 2V3OH 4KTUA 1H9HE 1O5DH 2BD3A 2EEKA 3F6UH 1QL8A 2R3UA 4J2YB 4WH8A 1UVTH 2L6OA 2SNWA 4DW2U 1AE8H 1TBQH 3QGJA 1NM6A 3LOXA 5GJ4B 3RU4E 1GJAB 2QCYA 4MNVA 1XUIA 2JH0D 2CN0H 3QK1A 1O38A 1D3QB 1ZTKA 2OK5A 1CQQA 3V7TA 1C1PA 4TWWA 1F0SA 5FPSA 1BHXF 2ZHDA 6GCHG 3QTVH 3ZVCA 3NWUA 1XUKA 4GCHF 3ZVBA 1JBUH 3GCTF 4B71A 2YMSC 2BVXH 1HAZB 1WTHD 2EI6A 2F9OA 1F5RA 2FOCA 1E37B 4ZROA 4DURA 1A3BH 2V0BA 2A5IA 4AN7A 1GHBF 1OWEA 3RXBA 2H6MA 5BRRE 2FI3E 1AQ7A 1C1VH 2OC7A 3ZV8A 1O39A 4F55A 1HRTH 1BMMH 3H5CB 2XW9A 3TJUA 3TGIE 3L33A 1PYTC 3QUMP 5FHTA 1C2HA 1KXBA 1D3DB 1HLTH 2G52A 4E7NA 3M3SA 4UFEH 1NESE 2BY6X 1WUNH 1FY5A 2ILNA 3UQVA 1S5SA 3BN9A 5EXNA 2CK3D 1LTOA 4OS6A 2BX4A 3F1SB 2ZIQH 3E90B 4R0IA 2VIQA 1FONA 4O3TA 4I8GA 2C90B 5A8XA 2D8WA 2VGCB 1ZMJA 4GPGA 1AN1E 3A83A 3PLPA 3PV2A 4ISOA 1AKSB 3TH2H 3P70B 2CF8H 3OAAD 3B23B 3VB3A 1QCPA 1TE0A 2BHGA 4ZHLU 1P03A 3SGQE 3GCTG 1OP8A 3F0OA 1F92A 3PWCA 1INCA 1A1RA 3P6ZB 2ZDNA 2C8WB 4A92A 1FDPA 2Z3CA 1LQEA 1UTNA 5GPIB 3A7YA 2JIZD 1HJAC 2FOHA 3EA9A 5DO4H 4B2CA 2VIOA 3RP2A 4K5ZA 1AUJA 3GCHB 1YCPH 5T6GA 1SOZA 2C3SA 4X1SU 3A87A 1O2WA 4ISLA 3M3TA 5GCHF 1EPTC 3GDSA 1TB6H 4Y8YA 2OXSA 1T4VH 3SGBE 4NWKA 1F0RA 4GUXA 4A7IB 4A1VA 3DFLA 3SUFA 2OC1A 3G01A 1MZDA 1C5UA 2F43B 1DX5M 4B73A 2R0KA 1V2KT 5A8YA 3KQCA 4XRNA 1CHOF 4K1SA 1ACBE 1W10U 1OP2A 2GZ9A 1QIXB 1P01A 3SJ9A 1YPEH 3FP8E 1AZ8A 1IQJA 1NO9H 2OUAA 3RXJA 1V2VT 3VFEA 4B6EA 1L2EA 2RDLA 1LHGH 1ELEE 3VB5A 3E1XB 1RFNA 1GHXH 1GHAF 3F2FA 2WV5A 2PHBA 1FN6A 5GIBA 3A84A 2ODQA 2A31A 2UWOA 2ZNKH 4BAOB 1NT1A 1P9SA 5DP8A 2Y5HA 1QJ7B 1EOJA 1AD8H 1EUFA 2ZU5A 3D62A 2H9EH 5SGAE 2FO9A 3VGCB 2NWNA 2QXJA 3DD2H 3NK8A 3MMGA 4Y6DA 3UWIA 2V3MA 1GGDB 5FCKA 1HDTH 5DSFA 4CBNA 3GDVA 5HXFA 3SNDA 3U9AH 2AFQB 1Z1JA 1EAUA 3RM2H 1A46H 4TSFD 1ARBA 1FI8A 1O2QA 3UR6A 2F9UA 2WPDD 1TNJA 4K60A 2FEQH 1C4V2 3P17H 1MTNC 2BLWA 4KKDA 2OC8A 2Y7XA 1E0FD 3ENSB 1YPKH 2CXVA 2JKHA 4ZKNU 4AG1A 5FBIA 1XUJA 1A7SA 3MO6A 1HAVB 1XM1A 3T29A 4WJG2 3RU4D 1FNIA 1ORFA 5C94A 4KP0A 1C5SA 1L4DA 2ZPRA 2FM2A 2XCNA 1PYTD 1O2GH 3KCGH 5JB9S 2TPIZ 1DWBH 1AY6H 2QXGA 2J34A 4SGAE 1AB9B 4PROA 1C2MA 1O30A 2Z94A 4Y76A 3RXMA 2CHAC 1TGBA 1FUJA 2Y7ZA 5B6LA 1GMDG 1SLXB 1QA7A 1THSH 2CV3A 2B9LA 2SNVA 3SW2B 1ZHMA 4D9QA 1YM0A 2YNAA 3JZ1B 1IQEA 1SG8B 1GPZA 5ABWA 1WAYB 5PTPA 3HPTB 3DUXH 2LPRA 1XXFA 1W13U 2P95A 1C5PA 2P3TB 7ESTE 5I46H 2GMTC 4FVDA 2PKAA 1E38B 1TIOA 4X2VA 2P93A 1AB9C 1EZSC 2WPIS 1OWKA 3ZZ8A 3SI3H 5C5OA 2BDYA 2J92A 2WINI 5DP3A 1RXPA 3MH4A 4XFQA 1HJ8A 1DY9A 5ESBA 2ULLA 1SGTA 3BTDE 1QRWA 4X6PA 1G9IE 1QB1A 4MNXA 1ZYOA 2Z7FE 1L4ZA 4QT8C 1O3HA 4J1YA 3SNAA 1P9UA 2A4RA 3AAUA 1GCTB 3PYHA 1KXAA 1SI5H 2W3IA 1DANH 1LHDH 1N8OB 1Y5BT 2JDID 4HZHA 1UK2A 1YP9A 1OX1A 2NU1E 3VXEH 2BB4A 1A5IA 1UHBA 3LONA 4Y7BA 3QZRA 1O3DA 1RIWB 2ZDMA 3GS9A 1PQ5A 1WYKA 1DM4B 3FOAA 3HK6B 1Z7KA 1D6RA 2HLCA 4ABFA 1MTSA 6CHAB 1IQMA 1EXFA 2HNTF 1GHYH 3A7XA 3BEIB 4AYYB 5GXPA 1QHRB 1UK3A 2A45B 4FU7A 3P8OA 2A7HA 1O2MA 1IQIA 4CHAC 3I77A 2Y82A 4Q7ZA 1BJUA 4E06H 1VJAU 3U8RH 5C67A 1C1MA 2ZG0H 4WMFA 1CSOE 4KGAA 1CGIE 2XWBI 5K0HA 3GCOA 1EZUC 4FUBA 5E2PA 5KECA 8GCHF 6ESTA 3Q3YA 2VNTA 1KXDA 5LPFA 2TGAA 1HCGA 3OSYA 4X8SH 3PMJA 5A0CA 4B76A 1BT7A 4M9FA 2XNDD 1H8HD 1Z6EA 2G4TA 4BTIB 1AVWA 1QB6A 2KCPA 4MDSA 4NA8A 3SI4H 1QQUA 3DHKH 4X8UH 3TITA 1MH0A 3UTUH 4RT0A 2XTTB 4I8KA 2BXTH 3QDZB 1OP0A 2ZFRH 1IQHA 2FZZA 2JETC 3ZZ6A 1K1PA 5HMAA 1AZZA 1QBNA 1P12E 4RI0A 5C17A 1S83A 1KTTB 1OOKB 4K1EA 4DY7B 2JH5D 2ZGJA 1WDIA 4O9VA 1GI1A 3BTFE 4SGBE 4B6FA 1O2VA 3BG4B 2I6QA 4AG2A 1MKXH 4CRDA 2WSSD 1A0LA 2VIWA 2BDBA 2V6NA 1HAOH 1O3AA 1TPAE 2OINA 3GYLB 2GVFA 1S81A 3DSOA 1YF4A 1DOJA 1GG6C 1AVXA 2CGAA 1OXGA 2VU8E 3RXKA 3F9FA 1XUHA 3BTEE 1GL0E 5CMXH 3M7TA 2BYAX 3FAOA 1MUEB 1G2MA 3M5MA 1M9UA 3GY2A 1FIZA 4UFDH 4FUEA 2R9PA 4NG9H 1S6FA 1V2LT 3E16B 5DP4A 2VH0A 3CP7A 1C2IA 2A4QA 2F9PA 2OP9A 3ZZ4A 1A0JA 1C1QA 3HGNA 3SV6A 2ALPA 4GVUA 1O3EA 1IQGA 1O2NA 4NSVA 2KZ4A 4Y8ZA 4TPYA 1TFXA 1JRTA 5LGOA 1CHOG 1EZXC 4X1NU 4BANB 1F0TA 1C5LH 1G37A 1TOCB 2A5AA 1NFUA 7GCHG 2ZWLH 1GJ4H 3RC4A 3O8RA 4D7GA 4CH2B 2FTMA 3SJIA 3PLBA 4AC9A 3LU9B 3P95A 2VINA 3GY8A 4IC6A 1GHVH 2ZGHA 1SR5C 1QRXA 2XNIA 2Z3EA 4GHTA 1P3EA 4DOQA 1HBTH 3A8CA 3LGWA 1MAXA 1LHCH 1ZSKA 5H4IB 1AKSA 1FY8E 1SVPA 1KYNA 1EPTA 4I7YH 1GI3A 2CF9H 1OWDA 2C8XB 1JIMA 3KEEA 2KCYA 1EKBB 1QJ6B 3UY9A 3E0NB 5DPAA 1CGJE 2WYGA 4ZCNA 2RA0A 1TWXB 1ABIH 1GMHG 1GJ6A 2PKAB 2PUQH 1V2RT 2YMSB 2ZGCA 3BG4C 1ELAA 1C5YB 3SV9A 1OSSA 2KFWA 5ETXA 4AOQA 1GCTC 3QGNB 3ZVFA 1G30B 4YESB 2SGAA 1RIWC 3RMNH 2ZHQH 1V3XA 8LPRA 1HAPH 1AHTH 1C5VA 8ESTE 1NPMA 2RG3A 1GHAG 1KXFA 3H7OA 3A7VA 1EB2A 1GMHF 1K9OE 3D49H 5T1VA 4HI3A 1GI6A 3A8BA 2FOBA 2EI7A 1ZGVA 3BIVH 1DLKB 3A80A 5EQQA 5FPTA 1RD3B 1P3CA 2UUKB 3OE7D 1W0KD 4DGJA 1FXYA 2A2QH 1OWHA 2AGIX 2FS9A 1HJ9A 1QURH 3A88A 5BPEA 3D65E 1C1NA 4O3UA 1P10A 2Q6FA 2FESH 2WV4A 3SHCH 2AIQA 4ACAA 3RU4T 2STAE 1GBKA 5CHBA 2A7JA 4BAQB 1AWHB 2KAIB 1BBRH 1FZZA 1D3TB 5A0AE 1QL7A 2I6SA 1V2JT 1LKAA 1NU9A 1WCZA 2WV9A 4YO9A 2VIDA 1JIRA 3M35A 1H9LB 3CS7A 3PO1B 3RXIA 2PWXA 4X1PU 5HYOA 2V3HH 1CT4E 3DSPA 4DT7B 1T8MA 2Z9KA 1P0SH 3U28C 1IQKA 3SV7A 4X0WU 4ZXXH 1CBWC 2ZF0H 1Y3VA 4I8JA 3HGPA 2ANYA 3E91A 2BD5A 1N8OC 4GAWA 4H6TA 4RKJB 2PW8H 3OYPA 3ZZCA 1DXWA 2FLRH 3SUGA 2PFEA 3KF2A 3KQDA 3UNQA 3LDXH 4GSOA 4INKA 1SGQE 2BY8X 1LPGB 4YXWD 1HB0B 1H8ED 1T8NA 4FETA 4ABGA 5EQRA 1BTUA 1KIGH 1HAIH 3HATH 3VB4A 2DE8A 3IITA 2JJ1D 2P8OC 4XBDA 4Y71A 3RXRA 1GI7B 1V6DA 5F6MA 5HM9A 3AK5A 3MNCA 3MH6A 3ZZ5A 3RC5A 1PQ8A 1HAXB 3U8TH 1W14U 5JPMH 1MKWK 1KXCA 5EGMA 2ODPA 1YPLH 2IN2A 3PRDA 3NPSA 1AIXH 4Y0ZE 2GDEH 3KYGA 2FYQA 2TGTA 2ZU3A 2ZTXA 1EASA 3MFJA 1BBRE 5FCRA 4IN1A 1C1UH 1ZMNA 4HG6A 2FS8A 2VWOA 4X8VH 3ZYDA 3RXEA 3BTTE 2VWMA 1PQ7A 3H7TA 5FL7D 1E1RD 1TQ7B 2AYWA 1K28D 1XUGA 1NZQH 1S0QA 2AGEX 3HK3B 2F3CE 5HIZA 2TRMA 2HALA 3BTKE 4JZDH 3SGAE 1MD7A 1VJ9U 4YT6H 1MMJN 4UD9H 3MNSA 4WXVA 4CHAB 2W26A 4CRCA 2CJIA 1HPGA 3GY6A 4FU9A 4MLFB 1O5EH 3UPEA 3S69A 1AO5A 4LZ1H 4ZKSU 4OS7A 1JMOH 1GCDA 1LPKB 4NGAH 2J4IA 5DN6D 1S85A 1T8OA 2YMSD 1O2IA 1L1GA 3KL6A 4Y79A 4U32A 3EAJA 2NU0E 1ZRKA 4FUJA 5EJLA 4ZUHA 1MTUA 1GL1A 5E0JA 3WWFA 3A7TA 3P92A 5EOKA 1N1LA 4U2WA 1N6YA 1O2TA 2BOKA 2FOFA 1GMCF 3RXQA 3GYMA 3LJOA 4K3JA 3PV4A 4NIWA 1TMTH 4O97A 1BMNH 2P94A 1G3CA 1P2IA 1YPGH 4OGXA 1NBMD 2BX3A 1ZTLA 2FOAA 1ESBA 1FJSA 2FI5E 1IAUA 3I78A 3KHVA 1GBHA 1O3IA 1O0DH 3UAIC 3U98H 1AU8A 1A61H 1UTOA 5A8ZA 2F9VA 3TNTA 3Q00A 5EJ1A 1YCPM 1Y59T 3U1IB 2DUCA 3PRBA 2O8UA 4ZMAH 2GX4A 3M7UA 1ANCA 3UUZA 3PTBA 1W11U 1F5KU 2HRVA 3VEQB 3PTNA 3RXCA 4KTSA 1P09A 1EQ9A 1PPZA 2Y80A 2G5VA 1DE7H 3VXFH 4AB9A 2PV9B 4I8HA 2DE9A 2GMTB 4ABHA 1GBCA 1O3NA 4AX9H 2HNTC 2D2DA 3LIWA 4AYVB 2SFAA 3PROA 1TBZH 2SGEE 1CGHA 2H9HA 4JYTA 4X6MA 1V2MT 3TJOA 1SL3A 2AMPA 1O3LA 3MU1A 4BTUB 6LPRA 3A8AA 4P00A 1P11E 3F9GA 1GWAA 2HOBA 1BA8B 2FOGA 3T62A 1Y3XA 1K1JA 2WPLS 4O03A 2B8OH 4CRFA 2Z9JA 3MH7A 1LPZB 2FIRH 1QR3E 3TGJE 1O3PB 3SV8A 3BTGE 1TLDA 4UDWH 8KME2 4FUGA 3SYJA 4ACBA 5FBEA 3LGIA 4I31A 4R8TB 1UTLM 1DXPA 2PSYA 3T25A 1ID5H 1QY6A 4IC5A 1AVGH 3MU5A 1GHZA 2PKSC 4OS1A 1BDAA 1P06A 2R2MB 3SU4A 4Y0YE 3T5FH 3BEUA 1SGFG 4LK4A 4X2XA 2C93B 2QF5A 4NZLA 1J15A 3LC3A 1ESAA 1GVZA 5EW2H 3BTHE 3PO1C 1W0JD 2EC9H 3BSQA 1FAKH 2B7DH 4OGYA 3WWBA 2A0QB 2PP6A 1DT2A 5KGOA 1A3EH 1OHHD 2XC0A 1GBTA 2XC5A 1AFEH 1SFIA 1UJ1A 1C5XB 1K22H 1MZAA 5CHAC 2BXUH 1CU1A 1G3BA 3TK6A 2YOLA 1C9TA 3I29A 4RN6A
chains in the Genus database with same CATH topology
3K65B 2ZA5A 1GBLA 1W7XH 3LT3A 5AHGH 1LCYA 4ISIH 4F49A 2OCVB 5LPRA 1MU6B 4AFZA 1VITH 3GY5A 1C1WH 3RXOA 2WYJA 1DWDH 1KY9A 1RRKA 2WPHS 3V13A 1PPEE 4HFPB 3LJJA 1NFWA 2RA3A 1PPCE 4FUDA 1V2QT 5GWZA 1YPHE 1O32A 1GI0A 3T2NA 3URDA 4K1TA 2BY5X 3SU5A 3RMOH 3SUDA 4E7RG 1W12U 1A5GH 5TCCA 3RXAA 2A1DB 3RXSA 5EQSA 1UHBB 3T28A 1SLWB 4ISNA 2YNBA 4FUFA 1SLVB 5TCAA 1YYY1 1DFPA 2BLQA 4JK6A 1GBMA 3A7ZA 2QXIA 2XWAA 4X6OA 3ZVAA 2ZTYA 3MO9A 2VWNA 2ZC9H 4JK5A 1AFQB 3N7OA 1EPTB 4IW4E 1IQFA 4CBOA 2UWLA 1NTPA 4CR5A 3MO3A 4ABDA 2P16A 3F9EA 1QJ1B 2VVVA 1XX9A 3NZIA 2ZHEH 3L3TA 3SN8A 1QNJA 1UTKA 4X8TH 1FAXA 5GDSH 2PKSB 1C2DA 1KLTA 2WUCA 2Z6BD 2XBVA 4FU8A 1BRAA 1D3PB 1V2UT 1Z8JB 1CT2E 4BAMB 3GISB 4WWYA 1O2SA 1O33A 1O5CB 1W3CA 4INHA 4M7GA 3RXPA 3U1JB 1TMUH 2QF3A 2TBSA 1O37A 1WOFA 3UIRA 1TX8A 2A2XH 4I33A 3SJOA 1D6WA 3TLOA 1S84A 1BCUH 1Y5AT 2G5NA 5JYIA 1NRNH 1C5OH 3PB1E 4H6SB 1BRCE 2PTNA 1T32A 2QA9E 3ZZ3A 4BAKB 1NRSH 1BTPA 1ZPZA 2IJOB 3ODDA 1FLEE 3QX5H 2XCFA 3QN7A 4WH6A 1ZRBA 4JMYA 1VCWA 4IN2A 1DSUA 5EXMA 1HYLA 5A0BA 1K1IA 2GV7A 1GG6B 3UFAA 1THPB 1GGDC 1YLDA 1CHGA 1P2OA 3ZZ7A 2UUFB 3RXGA 4NFEA 1TONA 4AZ2B 4K69A 1Z8RA 3VPKA 4B75A 4FUHA 3BV9B 4AB8A 3BF6H 4NA9H 1AFQC 5A09A 3LH3A 2D26C 1NFYA 4JZFH 9ESTA 2QN5T 2Y5FA 1GMDF 2ALVA 2TGPZ 1FQ3A 1NC6A 3KN2A 2OD3B 1W0ZU 1MKXK 5EU8A 4KTCA 4JYVH 3LKWA 3PM3A 1K21H 3KQBA 1ZGIA 1UTQA 2D1JA 4X1RU 2VVUA 1ZR0A 1HFDA 3A89A 4GCHG 4B2BA 5A2MH 2HGTH 4UEHH 5K7RA 1SMFE 1NU7B 1FMGA 2ZP0H 4YOIA 2QC2A 2ANWA 2JETB 5JB8S 3QZQA 4MPUA 3STIA 2BDCA 4BNRA 1UTPA 3U69H 3BTME 3BG8A 3CS0A 3EA7A 1NFXA 1BTHH 3ZZBA 3UWJH 2VIPA 2ZQ1A 2Z3DA 4WVPE 3S7KB 4B2AA 4UFFH 4JZEH 4YLQH 5G4BA 2BD7A 1OS8A 2BLVA 4ABJA 5TJXA 1XVMA 4DVAU 4IBLH 4OS2A 1C4Y2 3ATWA 3RXDA 2W7UA 1PPFE 3OX7U 1UCYK 3LC5A 3RLWH 2FOMB 3FP6E 1VGCB 5FX5A 2P3FH 8GCHG 2SGPE 4TY6A 2HNTE 2HWLB 1IHSH 4DIIH 1TAWA 2Z9IA 2BD4A 3EA8A 3FP7E 1TA2A 1RTKA 1O2OA 1HIAA 4WMDA 1TMBH 2ZHWH 4CREA 4CR9A 1LMWB 4XE4A 1T31A 2ZDLA 2GV6A 1H1BA 2Q1JA 1F2SE 4FXGH 1V2PT 5E8EH 1Z71A 1IOEA 4IGDA 3Q76A 4Y10E 4WXIA 1LKBA 3ZYEA 1BOQA 2ZCKP 1MD8A 2IOTA 1DICA 1O2ZA 4MG3A 2BDAA 1O2JA 2VIVA 4X2WA 1ELFA 1Y3UA 1SPJA 1ELTA 1YLCA 1AE5A 1QBVH 3KIDU 4WF8A 1TGTA 3NXPA 1CE5A 2QGRA 4IMQA 1O2YA 3ZZ9A 1UCYH 3E0PB 2ZHFH 4LXBH 1ESTA 1J8AA 1OWJA 2O8MA 4TPIZ 2CMYA 1YGCH 4MPVA 1SGFA 1E34B 3DA9B 1C5TA 1UVPA 3TH4H 4Q2KA 3Q3XA 4ABBA 2UUYA 1TPOA 1SGDE 1EATA 3GCHC 3LGUA 1G36A 1TRMA 1V2ST 3AAVA 1L0ZA 1O3BA 2HPQH 1O3GA 1RS0A 2B5TB 2F9NA 3GDUA 3GY3A 1CA0C 3ELAH 3GY4A 3QWCH 1Y8TA 3M5NA 3P8NA 1CBWB 4Z0KA 1O2KA 3V0XA 5CE1A 2ZDVH 2G51A 3AW1A 2ANKH 2W5EA 1UVOA 1DS2E 3F9HA 1ELDE 1W7GH 3FZDA 1P05A 4ZAEA 4DG4A 4TWYA 3FANA 1Q3XA 4OS5A 1ETRH 2PSXA 2ZFTA 2ASUB 2VGCC 3R3GB 2CHAB 5F03A 3IWMA 2B0FA 1O3CA 1VZQH 1O2XA 1HGTH 1KDQA 1C5QA 2BDIA 3A81A 1K1NA 1ELBA 1RTLA 1Z8GA 1QBOA 1O5AB 1L1JA 1T4UH 2BLOA 4WY3A 3RXTA 4KELA 1SQOA 4BOHA 5AFZH 3UOPA 1V2NT 1RTFB 1FN8A 4TYDA 2GD4B 2A4GA 1UCYE 4YM9A 5ESTE 1ZLRA 5DP9A 1E35B 2ZO3H 4NWLA 4YOJA 5L2YH 2NU3E 1TNKA 1NRQH 1BZXE 2FX6A 5L30H 1HXEH 4TY7A 3O8DA 5JBTA 1G32B 1GDQA 2O8LA 1A0HB 2O9QA 1DVAH 1H8DH 3SU6A 1ABJH 4K2YA 3SJ8A 1GBJA 1EJMA 1O5GH 1SGCA 2C8YB 1TPSA 1DWCH 1O36A 1SSXA 1U6QA 1WV7H 3JZ2B 1MQ6A 3ZZDA 1SGEE 3S0NA 2C4FH 1LO6A 3MU8A 1C1OA 1JRSA 1O2HA 2AERH 1GJDB 5T6DA 1BUIA 1SBWA 3E6PH 1T8LA 1BHXB 1HV7A 1EX3A 2TGDA 4NIVA 2BM2A 4INLA 5F8TA 1QL9A 1NN6A 1EB1H 3LGYA 4VGCC 4ZH8A 1P2KA 4AFQA 1B7XB 3SO3A 2H5DA 3C27B 1EAXA 1IQLA 1LVBA 2QYIA 3SU1A 5DGJA 3M61U 2GKVE 2J95A 3DT0H 1ANBA 1DPOA 7KMEH 1TRYA 1MCTA 1F5LA 3M3VA 3M37A 3OU0A 4ZKOU 2VWLA 3B8JA 1MBMA 2AGGX 4F4OC 1TALA 2ZDKA 4XBCA 5JDUB 3ATKA 1O2RA 1C9PA 1KXEA 1UK4A 4DJZB 5HM2A 2P59A 1OPHB 2ZDAH 2F83A 3STJA 3T27A 3ITIA 1SHYA 5C20A 4AORA 1HAYB 2GGVB 4A6LA 1VCQA 4H4FA 1G3DA 2BD8A 2GCTB 1W2KH 2ZI2H 3SHAH 3TPIZ 1C5NH 2HVXA 2ZCHP 2ZFPH 4FVBA 1TQ0B 2ESTE 5C3NA 1GMCG 2Z9GA 1C2GA 1ETSH 7LPRA 1GI9B 1PQAA 1SGNE 1CA0B 2GT7A 1H4WA 3ZZAA 5EXLA 4GLYA 2WPJS 2SGFE 1ETTH 2QIQA 1LVMA 2G55A 4IS5A 1BQYA 1TBRH 2TIOA 4X2YA 1YPJH 3SUEA 1J14A 1NS3A 1EP5A 2GTBA 3M5OA 2PTCE 3S7HB 1YPMH 1ZZZA 2BZ6H 4XOJA 1PJPA 1UVSH 3SORA 3M7QA 1EOLA 1SGYE 2FX4A 3LH1A 4RKOB 3TGKE 2ZECA 4JZIA 5EPNA 4NFFA 4YLUA 1TRNA 3UQOA 1EAIA 1P57B 1Y3YA 1QTFA 3TH3H 4ABEA 1GI2A 1PFXC 3HKIB 1FY1A 1GBDA 1H8IH 2J9NA 2VB0A 3EDXB 3BEFB 1MTNB 1KSNA 1EJAA 3MWIU 3TNSA 1GVLA 2QV1A 4A1XA 2P3UB 3PLKA 3HKJB 1HUTH 1OWIA 1BMAA 1P2JA 3E8LA 1H9IE 1TX7A 4MVNA 2EI8A 4Q80A 1CO7E 5E0HA 4CRBA 5E0GA 2WUBA 1O35A 2ZZUH 2O8TA 2GP9B 2Y5GA 1C2EA 2XRCA 1SLUB 4MTBA 1BRBE 1BB0B 2ZFSA 3RXVA 1UTMA 1GHWH 5T6FA 2OLGA 3ATIA 2PGQB 2O8WA 4H42U 1ANDA 1TOMH 3A86A 3T26A 3KGPA 1A4WH 1O3KA 1EZQA 2AS9A 9LPRA 2QF0A 1UTJA 2W7SA 1ZPCA 1PPGE 4NA7A 1ZSJA 1GHBG 1FPHH 1VITF 4YTAA 1KLJH 3SU0A 1J16A 1VR1H 3RC6A 1X7AC 3SJKA 1SOTA 2BZAA 4HTCH 5HGGA 2UWPA 6GCHF 4GHQA 1DSTA 1QGFA 2FWWA 3PMAB 3GICB 4YZUA 2VH6A 2ZEBA 5T3HA 3UNSA 1GBIA 1GBBA 1HNEE 4I8LA 2NU2E 4K8YA 2BD2A 1YC0A 1ZPBA 1Y3WA 3MOCA 1FPCH 1XXDA 3QO6A 1WQVH 4DIHH 1NY22 5DKMA 3TK5A 1GJ8B 1QQ4A 1FY4A 5AF9H 1WSSH 1FIWA 3MH5A 3OY5U 2PR3A 4D8NA 1SQAA 2H1UA 1K2I1 1O3OA 5J4QA 3SNBA 1V2OT 1TGCA 2OBQA 5C1XA 3U8OH 1WQSA 3OY6U 3EQ0H 3S9AA 3MHWU 3RMLH 1MTVA 2BVSH 2PLXA 1YCPK 2G8TA 1HAGE 4BXWA 3PWBA 3TIUA 1YPHC 2QAAA 2FODA 2AIPA 2STBE 3SQEE 1TNLA 4MQAA 4I32A 1MU8B 1PPBH 2ODYB 3NUMA 4ZHMU 1ZJKA 3FVFB 1AI8H 3O8CA 2XBYA 1B5GH 2ZCLP 3TK9A 2XBWA 4AGKA 1GI5A 1UVUH 3SZNA 2OQUA 4UONA 4VGCB 2QXHA 2H2ZA 4MNYA 1F7ZA 3P8FA 1A2CH 1HAHH 2M5TA 5DP6A 1NRRH 5FX6A 3SU3A 4Y7AA 1S6HA 5JBAS 1HAVA 1WTGH 1PPHE 3SNEA 4U30A 1F0UA 1EAWA 2BOHB 1WU1A 4U01A 1ZHPA 2FDAA 5AVDA 2ZU1A 2SGQE 1E36B 1P04A 3TJNA 1C5MD 1MQ5A 3BTQE 1HXFH 1VGCC 3QTOH 2J94A 4IMZA 4AFSA 2AMQA 3K9XB 5B6OA 2UUJB 3GOVB 1LVOA 2GCHG 4HGCA 1C2JA 1Z6JH 2G4UA 5I25A 5AFYH 4JYUH 1DY8A 1XMNB 5LPEA 1LDTT 4UE7H 2FYRA 5LH8A 5EG4A 1SHHB 2FP7B 3DFJA 3GY7A 1SQTA 1LVYA 1TNGA 3LPRA 1TABE 2OBOA 3VB6A 5C1UA 1C2FA 1FV9A 1TGSZ 3ATMA 3EYDA 5J4SA 2SGDE 1P2NA 1W8BH 1G2LA 1P2QA 1ZMLA 2BVRH 2VVCA 4JCNA 2PUXB 1V2WT 3RM0H 2FLBH 4FUCA 4WMEA 1SB1H 3SOSA 1YKTA 4ZKRU 2GDDA 2GT8A 1WBGB 2A32A 1BRUP 2FPZA 2ZQ2A 3L6PA 2RCEA 1SGIB 5JBCS 1O31A 1OKXA 1C2KA 5IYTA 3ATLA 4X1QU 1W0YH 3V3MA 1CVWH 4LOYH 3ZVEA 4CRAA 1GJ9B 1MAYA 1CA8B 2FMJA 2G81E 2XYAA 4ZXYH 2J38A 4NZQA 1JXPA 3A8DA 2BY7X 2A4OA 2BY9X 2XBXA 1B0EA 2R3YA 4K8BA 5CHAB 1BMLA 2HPPH 3ZVDA 2G00A 4A1TA 2C8ZB 1TA6A 2BMGB 3SNCA 4A5TS 5C5NA 1HJAB 1AWFH 1S0RA 2R0LA 2Y81A 2ZU2A 3AASA 5F8XA 3RUOA 4CH8B 4LZ4B 3S9CA 2Q6GA 1AGJA 3S9BA 2FOEA 2AMDA 2W3KA 3ODFA 5L2ZH 1ZHRA 3K6YA 3SV2H 1IHTH 5JBBS 4AFUA 3FFGA 1EJNA 4DCDA 3RXHA 4ABAA 3MI4A 1QRZA 3WY8A 2H9TH 3MYWA 2ZGBH 2VJ1A 2XXLA 3EE0B 1TYNA 1J9CH 2BQ6B 3VB7A 5C2ZA 1GVKB 1ANEA 3FZZA 1SGPE 1XVOA 5FPYA 2ZTZA 1DWEH 2AEIH 4ESTE 3A82A 4ISHH 3A7WA 1LQDB 2FXRA 1GDNA 1O2UA 3RDZA 1ELCA 1RJXB 2F91A 1UMAH 2BD9A 2V35A 1BTXA 1T7CA 1G3EA 1C4U2 1V2TT 1XKAC 1K1LA 1XKBC 5C1YA 4BXSA 1YBWA 2FI4E 1CT0E 5GCHG 1O3FA 1KTSB 3Q77A 3NCLA 1P8VC 2BQ7B 1C5ZB 3QLPH 1MKWH 3EGKH 2K1QA 1ARCA 3P8GA 1FY3A 3RLYH 6CHAC 3PMBB 3LGTA 1Y5UT 1C2LA 2Z9LA 3MNXA 3BTWE 4NSYA 4MNWA 1DUEA 3RXFA 1OYTH 1DDJA 3SQHE 1LHEH 1GI8B 3ESTA 3M36A 1K1OA 1KDQB 1O3MA 1VITG 2BQWB 1TX6A 3A85A 2GCHF 2J2UA 5F8ZA 2OQ5A 4BTTB 2IPHA 4Y8XA 5DG6A 1J17T 1Q31A 3ZVGA 1ZJDA 1ZSLA 5FAHA 5DP7A 1BTWA 2ANMH 3RMMH 1O3JA 1BBRK 2Y6TA 3W95A 4D9RA 5DP5A 2ZKSA 4D7FA 1MCVA 1KLIH 1JWTA 2BTCE 2BDHA 1BTYA 1GBFA 3K2UA 2ZFQH 1TPPA 1SGRE 1GBAA 4B74A 3CENA 2H5CA 3TU7H 5EW1H 2QY0B 1XUFA 2LNCA 1NROH 1DLEA 1GI4A 2WPMS 3MNBA 1BJVA 4Y11E 4MPWA 3SU2A 1BIOA 1EP6A 1O5FH 1UO6A 2GZ8A 4BAHB 3VGCC 2F9BH 3E3TA 1D4PB 3M5LA 7GCHF 3R0FA 3PMHB 3C1KA 5E2OA 2WPKS 2ZPSA 3AVZA 2XC4A 3LGVA 1C1RA 1GBEA 3TVJB 3V12A 1K1MA 3Q3KA 2R2WU 1O34A 1GDUA 1RGQA 1VCPA 3W94A 1P02A 3UREA 3F68H 4JZ1A 1C1SA 2ZGXH 3BIUH 3IG6B 3MU0A 4YT7H 1JOUB 1AUTC 3AW0A 4NCYA 4UFGH 3MTYA 2ZFFH 2KAIA 3UNRA 4XBBA 1O5BB 1Q2WA 1HIAB 4XDEA 3SBKA 2FTLE 4NIYA 4ZHA