2BD8A

Porcine pancreatic elastase complexed with beta-casomorphin-7 and arg-phe at ph 5.0 (50 min soak) and immersed in ph 9 buffer for 30 seconds
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-casomorphin-7
publication title Structural analyses on intermediates in serine protease catalysis
pubmed doi rcsb
molecule tags Hydrolase
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bd8A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bd8A01
3SGBE 1O31A 1O32A 3Q76A 4YLUA 9ESTA 2VH0A 4DVAU 2I6QA 4NFEA 4TPIZ 1BRAA 1SSXA 2FI3E 5EQSA 2HGTH 4XFQA 4DY7B 2JH6D 1TA6A 1GPZA 1AGJA 3V7TA 1Z7KA 2WUBA 1V2VT 1D3QB 1FXYA 1O2IA 2TBSA 1AN1E 2A1DB 1THPB 3LKWA 3ZZ3A 1Z71A 3P8OA 2J2UA 1GHBG 4B76A 5T3HA 3RXPA 1SQTA 2A0QB 1ELCA 1C5ZB 5A8YA 1CGIE 3MHWU 2HNTE 1O2KA 1UK3A 4FXGH 2QYIA 1QB1A 3A83A 5A0AE 1MTSA 1OYTH 3GOVB 1F0UA 2AH4X 3SBKA 2ZFRH 1GJAB 3RM2H 2UWPA 4X1RU 2SNVA 3TK5A 1GJ6A 5TCAA 4Y10E 1YPHC 1O2QA 2FDAA 4IMZA 2B0FA 2IOTA 1IQMA 2VIPA 1L0ZA 3URDA 1V2NT 2VB0A 1ELTA 2BXTH 1KXCA 2O8WA 3SHCH 1VITH 3BTHE 1ZHRA 4CRCA 1O2UA 4NZQA 1Z8GA 1O2VA 1CGJE 4INHA 3VB7A 2ZEBA 1GBKA 1GJ5H 2AIPA 1L1JA 1QL8A 4K1SA 2GMTB 1IQJA 2UWLA 1TX6A 1TFXA 3GDVA 5JB9S 2VIVA 1BTUA 1EPTB 2A32A 3FVFB 1FDPA 4YOIA 1YC0A 4CR5A 1L4DA 1Z1IA 1P10A 3RMLH 1NY22 5HMAA 3PO1C 4Y79A 3ZVDA 3MNCA 1SGIB 4FUHA 3K65B 1YPJH 5LPEA 3SV8A 1YPEH 3A81A 1TYNA 3NXPA 4ABFA 1DPOA 1NRQH 2BY9X 2THFB 4NSYA 1QQ4A 4ZAEA 1E38B 1KSNA 2ZU4A 3W94A 1ZTKA 4O3UA 1QRWA 3TH3H 2FX4A 5EW1H 1A0HB 2W3KA 4Y0YE 4TYDA 3T5FH 3ZZ7A 1TNKA 3O8BA 2QN5T 4ISLA 3RXDA 1ANBA 1UJ1A 2WYJA 3ZZAA 2BLQA 1RD3B 5L2ZH 1C9TA 1S5SA 4JYTA 3RXOA 4OS2A 2FOMB 3RXCA 3SUEA 1A0LA 1Y3UA 2XCNA 3E90B 1FZZA 1P8VC 4DGJA 1OX1A 4HZHA 2ZPQA 5DK1A 2JKHA 1EASA 1W13U 3BEUA 4UFDH 1HJ8A 3BF6H 4ZHMU 2ZPRA 1LKAA 1TBRH 2XYAA 1ZR0A 4FUGA 4ZKOU 1LQEA 3NWUA 3DD2H 3LGVA 3NKKA 1KDQB 1QA7A 2WPIS 3SU4A 3QK1A 3NPSA 5FAHA 3A7WA 1TA2A 1UTNA 4WF8A 2FX6A 1PJPA 4ABAA 4X2VA 4DT7B 2HVXA 3LC5A 5E8EH 1BB0B 2WPJS 3A8DA 4JYUH 5DP8A 3RXRA 3A88A 2PW8H 4I8KA 2R9PA 3IG6B 3PYHA 3KQDA 4E05H 2F9VA 2ZF0H 1K1NA 4YESB 1O5FH 2V3OH 4AFUA 2C8YB 1K1MA 1NFYA 1P11E 2FLBH 2XW9A 5EG4A 1O2OA 3GDSA 5ABWA 3FZZA 3AW1A 1GBFA 1EQ9A 4BAHB 2A7JA 4B74A 4NWKA 4MPVA 2Q6DA 1ZMNA 1RIWC 1N1LA 2W7SA 1C1NA 4CREA 2D26C 2GD4B 2VVVA 5FHTA 1AKSB 1QBVH 5EODA 1C5YB 1LTOA 5DG6A 2VVUA 1YBWA 3E1XB 2W26A 1LHDH 1BCUH 3PV4A 4ZKRU 1FI8A 4KTCA 1ELGA 3MU5A 2GZ7A 4UFFH 3UOUA 2A31A 2ZGXH 1HJ9A 3P92A 3BTFE 1WAYB 3RXMA 4INLA 1YCPH 1GI2A 1TPOA 1Q31A 3HGPA 4JK5A 1B0FA 1GDNA 1BIOA 2JH0D 4BTTB 1Z1JA 1O3NA 1JIRA 2BX4A 1NFWA 3U8OH 1IQFA 1DUAA 4YT7H 3S7KB 1OOKB 2FOCA 1ZZZA 3SI3H 5AFZH 1V2PT 1AE8H 4SGAE 1Y8TA 1AE5A 1J16A 5C1YA 3E8LA 1C2MA 4HGCA 1MU8B 2HOBA 2Z9IA 1MAYA 4MNYA 1F5RA 1C1MA 1XM1A 4LK4A 2ZFPH 2ULLA 1LHEH 1SLUB 3URCA 2PUXB 2VIWA 4I33A 3SV9A 1MTWA 5BPEA 2C93B 4NCYA 2D2DA 1UTKA 3DFLA 3MH6A 5DP3A 1P9UA 2ZU2A 2TPIZ 4U32A 4A1TA 4K8YA 2DE9A 1OWHA 2LNCA 1BT7A 1W14U 4AG1A 1O36A 1QJ7B 4Y76A 5FCKA 1ABIH 1HAVA 5K7RA 3KCGH 1QJ1B 3MYWA 4THNH 1V2TT 3M5OA 1EAWA 1O3OA 3ZVGA 2QCYA 1WOFA 1BMMH 1YPHE 1AFEH 6GCHG 3QLPH 1PFXC 2AIQA 3S0NA 2STAE 2NU0E 3QGJA 1H1BA 3SOSA 2ZHQH 2ZDAH 2FM2A 1ZSLA 2GV6A 4K69A 2FTMA 5GDSH 4X1SU 5DGJA 2J92A 1UHBA 1AHTH 4ZHLU 3SU6A 1YF4A 1GI7B 4B73A 5E2PA 1JRTA 1P03A 4NIVA 4IN1A 1ESTA 1TABE 1W3CA 2AEIH 1H9LB 2Q1JA 3QWCH 4H42U 1GCTC 1V3XA 3SGQE 1GI6A 1O3GA 2FOHA 3RMOH 2SFAA 3ZZDA 3BTEE 4AFZA 4ZUHA 3S9CA 4NSVA 1GL0E 1V2MT 1TMUH 4NWLA 3GY3A 2P3UB 1SQAA 1EAUA 3HK3B 2QY0B 1P2OA 2QXIA 4WWYA 2OBQA 4KTSA 4FU8A 1ZOMA 1QL7A 3VB4A 2ZCLP 1PPGE 4AYVB 3RM0H 4IC5A 3ZZ5A 1UTPA 1WQVH 3RXIA 2CHAC 2PKSB 4BAQB 1K1JA 2BDBA 4HFPB 1WTHD 3AAVA 4D9RA 1C5NH 3ZYEA 1VJ9U 1ESAA 5GPIB 1PQ8A 1MQ5A 3EDXB 2Q6GA 1FNIA 5ESTE 6CHAB 2C8ZB 3CS7A 2GV7A 1VCPA 3MO9A 3DHKH 1HJAB 1EATA 1FPCH 2YNBA 5AVDA 1N8OC 4CRFA 3SNEA 1W0YH 4TPYA 4FVDA 2FLRH 1W8BH 2YOLA 3I77A 4ZXXH 1EP6A 4RN6A 2BOKA 1ACBE 3EGKH 3ITIA 3P70B 5C3NA 3E0PB 3K9XB 1MQ6A 2NU4E 4ISIH 3GY5A 2STBE 4BAKB 1FAKH 1BTZA 4M7GA 8ESTE 3ZVEA 1TMTH 1BRUP 4MVNA 5CHAB 1BRCE 1PQ5A 3A7XA 5DKMA 1MKWK 1P0SH 2FP7B 1Z8JB 1O39A 3AAUA 3GY6A 1HAXB 1CVWH 1GHXH 3EA9A 2GCTC 5F8XA 2P93A 1ABJH 4GHQA 2FWWA 1G30B 2C8XB 1UK2A 1BUIA 3ZZ9A 3SI4H 1D6RA 3M36A 1LVYA 1P2KA 3UQOA 3UNQA 1G32B 3TJUA 3OY5U 2VGCC 1BMLA 4X6NA 1OWJA 4BXWA 3KQBA 1IAUA 1C2LA 4NZLA 1V2JT 1MTUA 1ZGIA 5DP5A 3GICB 1XKBC 1P57B 1PYTD 2ILNA 4X8TH 1BZXE 2ZO3H 3A7TA 5EU8A 3M61U 1KXBA 1FMGA 1GMHF 1H8IH 3UNRA 4TWWA 3ODDA 3SNAA 1OWEA 3O8CA 1O2YA 4JZEH 5ETXA 2B7DH 4MTBA 3FP6E 1KXDA 2BD7A 1CBWC 3BTTE 2JETB 1ELBA 2ALVA 1TPPA 5EXMA 2UUJB 2BD9A 1E36B 2Z6BD 1A3EH 3RXGA 2ASUB 3TIUA 1HFDA 3BV9B 2BDYA 2SNWA 1GBLA 1ARCA 4K3JA 4O9VA 3D23A 4B2BA 2CMYA 4ABHA 2GCHG 2OD3B 3B23B 2P16A 3D65E 1GGDB 2BY5X 2HPQH 4Y7BA 1CU1A 4JZFH 1BTHH 4R8TB 3ZV9A 1DX5M 5E0JA 1CHGA 4Q7ZA 2GMTC 1QIXB 3M7QA 1RFNA 1ZMLA 1OWDA 1HAOH 1ZTJA 3SHAH 3LGWA 1LQDB 4DCDA 2VH6A 1EPTC 1KTSB 1A46H 1S6HA 4AG2A 1XUKA 3N7OA 2KAIA 2BD3A 1GI8B 2V35A 3FANA 3R3GB 2VU8E 1GBMA 5DPAA 2BVXH 2J95A 1OXGA 2A5IA 1ZPBA 1GHAG 3GYMA 2C8WB 4FU9A 2ZU3A 1TQ7B 5DO4H 1MTNB 3M7TA 3SUGA 4A1VA 4BAOB 2F9OA 1FLEE 1P3CA 4ASHA 1LPZB 1O5AB 5EGMA 3EQ0H 1HLTH 3GCOA 1BHXF 2ODQA 3K6YA 3TGJE 3A82A 4E7RG 4FUFA 1TNHA 1G3EA 1UO6A 1OP0A 1VGCB 3OYPA 4X0WU 3FZDA 2H9HA 3BTGE 2ZGHA 1G9IE 2ZGCA 1TNGA 3S69A 1TQ0B 3PMHB 4WXIA 1ID5H 3HPTB 1MUEB 1DM4B 2CF8H 1UCYH 3ZZBA 4GUXA 2BHGA 3A7ZA 1L4ZA 4LOYH 3KIDU 1SBWA 1C2JA 4JK6A 1YYY1 5L2YH 1MMJN 3BIUH 2A7HA 1C1TA 2Y80A 1DT2A 1O3BA 2FOGA 2FZZA 2ZQ1A 4ESTE 4QT8C 1WYKA 3UY9A 1Y3XA 1ELAA 1C2GA 2O8LA 3SV7A 5CE1A 2PGQB 1K9OE 2F9UA 4Y71A 1KLJH 4OGXA 5DP4A 1SGPE 1IQEA 3WY8A 1TAWA 1ANEA 4NG9H 1G36A 2BDHA 5FPYA 2UWOA 3BTDE 4LZ1H 2ZECA 1QBNA 1O3CA 3E0NB 5FXLA 3UQVA 1A5GH 4Q2KA 1SGEE 2ANKH 3LC3A 3TITA 3RXAA 1AIXH 3SUDA 1X7AC 2QV1A 2BD4A 3QO6A 1HRTH 4UE7H 1TLDA 1MKXH 1XUGA 2ZDLA 1OP2A 5EXNA 3V3MA 1S6FA 3A8AA 2ZHEH 1Z6JH 3QDZB 4Z0KA 1ZSKA 1EPTA 2ZDMA 1BQYA 4IS5A 3FP8E 3BTQE 1SOZA 4GAWA 4AB9A 1XVOA 2ODPA 1P12E 5C1XA 5DP9A 4CRBA 5AF9H 5JBTA 1C2FA 1ORFA 1AY6H 4X6PA 4B1TA 1GI4A 1VITF 2WV5A 1AUTC 1RXPA 2VIDA 1TRNA 2FOFA 3PWCA 3MTYA 1GJ8B 3TJVA 4U01A 2A45B 2ZTYA 1KXAA 3MH7A 1ETRH 1J15A 3HKJB 2XC0A 5SGAE 4CBNA 5CMXH 4X1PU 1MZDA 2P59A 1SLVB 1TALA 2BY7X 3ZZCA 1BBRH 1CA0B 1EB1H 2BLOA 1BRBE 2ANYA 2FOEA 4R0IA 4OS1A 2OLGA 2CXVA 2VIOA 3F9GA 2ZU5A 1Y59T 1YM0A 1C1QA 4YO9A 1YPKH 1LHGH 7LPRA 3AVZA 3JZ1B 1C5WB 3HK6B 2A2QH 2P3TB 2ZDVH 4UONA 3PROA 5L30H 1D6WA 1NRPH 2BQWB 2EI7A 2GGVB 2ZA5A 1FY1A 2BDGA 1DICA 2V6NA 4B75A 4AORA 4GHTA 1KDQA 1S83A 4GVUA 1ZJDA 3VEQB 3BTKE 4D9QA 1F7ZA 2G4TA 4AGKA 1AB9B 1O3IA 4MPUA 1NFUA 4JZ1A 6ESTA 3ZVFA 1Y3VA 3MU0A 3O8RA 1T31A 2CF9H 4INKA 1ZYOA 3VXEH 2H9EH 4X2WA 1AD8H 2F3CE 4KELA 9LPRA 2AGGX 2O8MA 2H6MA 5LGOA 4AN7A 1P2NA 1PYTC 1MD7A 3SU5A 1E37B 1HPGA 1DY9A 3A84A 2GX4A 3PMBB 1AO5A 5F8ZA 4RKOB 3SNCA 1EKBB 4NIXA 1UVUH 2BM2A 2WV4A 1SPJA 3UNSA 1AQ7A 2PTNA 1GG6B 3STJA 3Q77A 3DFJA 3TJNA 4XDEA 1K28D 2ZTZA 2AMPA 1AKSA 1TNJA 3LOXA 1SMFE 2ZZUH 3KEEA 3KQEA 1DOJA 1C4Y2 4AYYB 1CA8B 1O2JA 1UTOA 2OQ5A 1NO9H 2ALPA 4YOJA 1AUJA 2SGFE 1EX3A 3CS0A 3VB6A 2VWMA 2BVSH 2RDLA 3SJ8A 1CSOE 2QXJA 1O5CB 5AFYH 5I25A 1HAYB 4ABGA 3MNXA 1E35B 2B9LA 3U69H 3BG4B 2CGAA 2G5NA 4FUIA 4ISHH 1QB6A 4JCNA 1C4V2 5DP7A 3RMNH 1DS2E 1PPFE 4A92A 2VWLA 1A5IA 2ZHDA 3SN8A 1SGDE 4DG4A 3VFEA 1QL9A 1GI5A 3P6ZB 1SR5C 2ZFSA 3QUMP 3RP2A 1GDUA 1TMBH 2OCVB 3T62A 1C5QA 1UVSH 1XUHA 1GVLA 4D7GA 3BN9A 3IWMA 5GWZA 3RU4D 2A4OA 1UTQA 4X2YA 1NESE 1SB1H 6LPRA 1A1RA 3TLOA 3SV6A 1ESBA 1C5VA 1CHOF 1UTLM 3K6ZA 3BTWE 1V2OT 1SGRE 3ZVCA 2BZ6H 1VR1H 1WQSA 4H6SB 1O2GH 4ABBA 1C4U2 1DVAH 1WCZA 1ELEE 3A8BA 1HJAC 1YLDA 4TWYA 2OQUA 2G00A 4B2CA 1AFQB 1AI8H 3E91A 2XBWA 1NRRH 3MO6A 1NU9A 1HXFH 4X1NU 5JYIA 3T25A 3GY2A 3L33A 2W7UA 2OC1A 3FFGA 1G3BA 1TGNA 4KTUA 1HIAB 1VZQH 1RRKA 1O38A 1KXEA 4BXSA 2QGRA 2PLXA 3ZZ6A 1YP9A 4K1TA 4WMDA 2Z9GA 3A87A 4I8GA 4VGCC 4ABIA 1MBMA 1O2PA 1LMWB 1GHYH 1P2QA 1TBQH 1TB6H 3VGCC 3SZNA 2Z3EA 1NZQH 1O5DH 1MCTA 1O34A 5LPFA 4ZHAA 5HXFA 1O3MA 2QC2A 3A80A 1H9HE 4Y8ZA 1DSUA 5IDKA 3SO3A 1F0TA 1SFQB 4DW2U 2J9NA 3MOCA 4ZROA 1JIMA 3PO1B 8LPRA 1C2IA 4GSOA 1O2RA 1PQ7A 4FU7A 1RGQA 1UMAH 1BTWA 1QBOA 3UWIA 4RKJB 3M3VA 3Q3KA 1QB9A 2JETC 3SW2B 1FY3A 1TX7A 2IN2A 4NIYA 1HAPH 5H4IB 4CHAC 1YCPM 2UUFB 1EAXA 1P9SA 2PSXA 4AGJA 2YNAA 2FYQA 5FBEA 4NA8A 3W95A 1GBBA 1GMDF 2AMDA 1WV7H 2QIQA 5C2ZA 1S81A 3QTVH 1O2SA 3TNSA 5JDUB 1YPGH 2ZIQH 5JPMH 1EZQA 3BIVH 1ZTLA 4B2AA 2AGIX 4GCHF 2G55A 4YOGA 2XWBI 4MG3A 2Q6FA 2G81E 2G52A 1HAHH 3RXEA 5FX5A 3RXVA 1BTXA 2Z94A 3D49H 2BDAA 4TY7A 2DUCA 4J1YA 3F1SB 1Z6EA 4XOJA 1GJDB 4K1EA 1KIGH 3RC6A 3VPKA 4XE4A 3PLBA 3QTOH 4YM9A 1YCPK 4X8VH 5A8XA 4K60A 3A85A 3A89A 3SNBA 2J4IA 1SOTA 1GMCG 1IQHA 4H4FA 1FY4A 4E7NA 2Z3DA 5GCHF 3MH4A 2EI6A 2A2XH 4BAMB 5JBBS 4AFQA 2R0KA 1J9CH 1ANDA 3T28A 1GBDA 2VWOA 1XMNB 2ZI2H 4RSPA 1CT0E 4LZ4B 3A86A 1RIWB 8KME2 1IQKA 2AYWA 4Q80A 2A4QA 1GJ9B 1UK4A 4JZIA 1P06A 1ELDE 1O3EA 2BD2A 4U2WA 3EA7A 1TRMA 2WUCA 2HNTC 3KNXA 4O97A 2TGTA 4FUJA 4BTIB 3SV2H 5BRRE 5HGGA 2ZCHP 1CGHA 1GMCF 3BEFB 2FESH 5AHGH 3L6PA 3QN7A 2W5EA 1OWKA 3ATLA 4JZDH 1GMHG 2BQ7B 1C5TA 1HUTH 2RG3A 3GCHC 2FEQH 4MNVA 2ZTXA 5TCCA 3STIA 2ODYB 4ZKNU 1C5LH 1C1RA 3R0FA 1C5RA 2QA9E 3UREA 1S0RA 3GY7A 4KP0A 1IQNA 4I31A 4FVBA 1XKAC 3ZVBA 2BTCE 3A7VA 7ESTE 3G01A 2JH5D 1UVPA 1L1GA 4UFEH 1GBIA 1N6XA 3F68H 3VXFH 1G2MA 2P94A 1EAIA 1HB0B 3BG8A 1Z8RA 2W3IA 4WXVA 3UPEA 4I8LA 1AWHB 4NFFA 1PPCE 2D1JA 1SGFG 1O5EH 1LO6A 2OXSA 3S9AA 3QZRA 1O3FA 2Y6TA 2HPPH 2ZGBH 3GY8A 2ANWA 1PPZA 4UFGH 1LVMA 4O3TA 1NU7B 1DY8A 2ZFFH 4IC6A 4NA7A 1EZXC 2Y7XA 2XWAA 1H8DH 1CA0C 3TU7H 5K0HA 1Y5BT 2BY8X 1MU6B 1O2LA 1IOEA 4MPXA 2J94A 1TIOA 3PTBA 3LGIA 3ZV8A 2A7CA 2OBOA 1ZRKA 4H6TA 1Y3YA 1DWBH 5IYTA 5C5NA 1UVTH 4X8SH 5EQRA 1EZSC 1SHHB 3KN2A 1O2TA 3QX5H 2Z9KA 1S82A 1SQOA 4YT6H 1C5XB 5I46H 1S0QA 3QGNB 1O3PB 5T6FA 1ZLRA 2FMJA 1BTPA 2H9TH 3Q00A 5A2MH 1AU8A 1T7CA 5C67A 3VB3A 1GBEA 2ZCKP 4XBCA 2I6SA 2F9NA 1L2EA 2XBXA 4MNXA 1GJBB 1TGTA 1GHWH 2GKVE 1QA0A 1VJAU 1BITA 1MBQA 1G2LA 2QAAA 3BSQA 4WMEA 3SQEE 1W12U 2G5VA 1BMNH 1QJ6B 1EOJA 4K2YA 1YLCA 2BX3A 2TGPZ 4BOHA 1CT4E 4DJZB 3M5MA 2XTTB 3U8TH 2ANMH 1AZZA 1W11U 2CV3A 3BEIB 1GCTB 5B6OA 3UOPA 2TIOA 3LJOA 3FAOA 3TVJB 1O3AA 1N6YA 1K22H 5C1UA 1QRXA 1BTYA 1QURH 2PHBA 3DA9B 4Y0ZE 1JOUB 1V2LT 3NZIA 4Y8XA 2VINA 2EI8A 1WTGH 2P8OB 1KY9A 1T4UH 4CRDA 4MQAA 2H1UA 1NT1A 2A5AA 1FN6A 2HRVA 3SU2A 1EOLA 3TNTA 4KGAA 1NRSH 5GIBA 1IQGA 1C5PA 1BDAA 2A4RA 1GBTA 1OKXA 1C5MD 1EJNA 1ZRBA 1AVWA 3UR6A 1P09A 3KL6A 4UDWH 2ZC9H 1A2CH 1VITG 1AZ8A 4D8NA 2J34A 1D3TB 2C4FH 1E34B 2XBVA 4ZKSU 1HAZB 1S85A 4FUCA 2CJIA 2FODA 3E6PH 1C9PA 3RC4A 1C2HA 1TOMH 1K1PA 1GHZA 2VIQA 2C90B 4UEHH 8GCHF 1C1OA 1PQAA 2SGAA 1ZHPA 3SORA 3ATMA 3OX7U 4NA9H 1LDTT 5HM9A 2K1QA 4F4OC 3FP7E 5F6MA 2SGQE 2GCTB 1K1LA 3ELAH 5E0GA 2B5TB 1RJXB 1HDTH 3ATKA 4LXBH 3SGAE 1TGCA 1SLWB 3P8NA 5GXPA 4OS7A 3TPIZ 7KMEH 3GDUA 4I32A 1OYQA 2VGCB 5JBCS 3L3TA 2LPRA 3RXJA 1C1UH 1GI1A 1GL1A 2RCEA 3GY4A 1AFQC 1IQLA 3I78A 3QZQA 4D7FA 1JXPA 2RA3A 1OPHB 4CH2B 2AERH 4NGAH 4WJG2 4AB8A 1XX9A 5LPRA 4IMQA 4AFSA 1A61H 1THSH 2Z7FE 3H5CB 3P8GA 2ZFTA 1XUIA 1CBWB 3F9FA 4WY3A 4JMYA 3UUZA 1ETTH 1TGBA 1GBJA 4O03A 3V13A 1QNJA 1FV9A 1F0SA 1INCA 4FUDA 4CBOA 1RTFB 2Y7ZA 1P2JA 1DDJA 1JMOH 3HKIB 4ZH8A 1C2DA 1V2KT 4MDSA 5T6DA 1UCYK 1HAGE 5DJ7A 1GHBF 4K8BA 1SC8U 2BLWA 3ODFA 1XXFA 2HLCA 4ABDA 1TNIA 1TBZH 1RS0A 4E06H 2XC5A 1O5GH 3RXLA 3LJJA 1F5LA 3RU4E 1O2NA 3GCTG 3RXFA 1CT2E 1B0EA 1DXPA 1QR3E 2C3SA 2GP9B 3AW0A 1A3BH 2XRCA 5F8TA 1F2SE 4OS5A 5A0CA 3SUFA 2ZHWH 3SJIA 1O37A 1ARBA 2B8OH 1UVOA 3NCLA 2FIRH 3CP7A 3TK9A 5EPYA 1BHXB 1NM6A 2G8TA 4A6LA 2BB4A 1GHVH 1V2QT 1SGTA 1O3JA 1FJSA 2BD8A 2VNTA 1D4PB 3EAJA 1PPBH 5EOKA 4Y11E 3U8RH 3D62A 4MLFB 1RTKA 3SJKA 2XC4A 3RXQA 3U1JB 1W0ZU 1K1OA 1LHFH 1MKXK 1Q3XA 1SGYE 3SJOA 2O8TA 1SI5H 1TPAE 3JZ2B 3GCTF 5LH8A 2FXRA 3MFJA 1GJ7B 4ZMAH 4MNWA 3A7YA 4WVPE 1LPKB 1F0RA 1KXFA 2BY6X 2XCFA 3H7OA 1GJCB 4A5TS 3KF2A 1EXFA 1S84A 2OC8A 3RLWH 1UCYE 1Z8IB 4PROA 1FY5A 1CHOG 3OU0A 2PSYA 3M5NA 3KQCA 4D76A 3E16B 2OUAA 1EJAA 4SGBE 2PV9B 2P95A 3PLKA 3B9FH 1HIAA 4FUEA 2GT8A 4AZ2B 2AFQB 4KKDA 2R3YA 3ZVAA 4AOQA 2PTCE 1FPHH 5E2OA 5EW2H 1BBRK 1F92A 3RXSA 4GLYA 1YGCH 2PFEA 2XNIA 1NS3A 1OP8A 3RXHA 1SLXB 2BDCA 1DANH 1BJVA 2R3UA 3EE0B 5PTPA 5GJ4B 1G3DA 3OSYA 3PM3A 5F03A 4A1XA 2PKSC 1DWCH 2Y82A 1A7SA 2PGBB 4K5ZA 1MCVA 2QXGA 1NPMA 1SHYA 1MAXA 3MNBA 1GVZA 2H2ZA 3PWBA 2AGEX 4WMFA 2AS9A 6CHAC 1V2UT 1TGSZ 3OY6U 1HGTH 4OS6A 2ZKSA 4Z6AH 3LGYA 2GTBA 2ESTE 2OC7A 1DWEH 2SGEE 3ATWA 1SGCA 1O2XA 1D3PB 3TJOA 1LKBA 4F49A 1O3DA 2FI4E 3RXTA 1T8OA 1ZJKA 1TRYA 2ZDNA 4ABJA 2BD5A 1H4WA 3M3TA 3RXUA 1KLTA 1O3LA 2R2WU 2Z9JA 1OSSA 1ZGVA 5CHAC 1FAXA 1QFKH 1HV7A 1QRZA 3MWIU 1GI3A 1NFXA 2BZAA 2R0LA 4I8JA 2ZU1A 4CH8B 1FY8E 2FTLE 2QXHA 2V3HH 1BBRE 2O9QA 4UD9H 5A8ZA 1O35A 1J14A 1W2KH 4Y8YA 2BQ6B 1P2IA 2R2MB 3PMAB 1DFPA 2TGAA 1NN6A 3E3TA 1FIZA 3UTUH 4NIWA 2IJOB 2M5TA 5J4QA 3AASA 1O2ZA 2Y5FA 1QCPA 1PPEE 1O3HA 1OS8A 1ZPCA 1GMDG 4OS4A 3PLPA 2ZHFH 3HATH 2SGPE 3U9AH 2XBYA 1KYNA 3M35A 1CO7E 1LVOA 1G3CA 3SNDA 1H9IE 1T8NA 1KTTB 1TE0A 2GVFA 3KHVA 3NK8A 2TRMA 1EB2A 1O2WA 2NU2E 1C1WH 4GCHG 2FS9A 1GJ4H 3EYDA 4Y6DA 2H5DA 1JRSA 2FS8A 5J4SA 3LH3A 1NTPA 1B7XB 3SU1A 1HXEH 2OTVA 1NRNH 1GI0A 1MKWH 3RDZA 1ZSJA 3MNSA 1T8MA 2SGDE 1JWTA 1IHSH 1T32A 1RTLA 1XXDA 1GGDC 1J17T 3P95A 2BVRH 3MU1A 2VJ1A 3LIWA 2FO9A 5L6NH 1G37A 3ENSB 1FQ3A 1O33A 1LVBA 2F9PA 1THRH 1MZAA 2P3FH 3RUOA 1W10U 2WINI 2HWLB 3ZZ8A 4BANB 1UTJA 1TONA 1WUNH 2BMGB 2ZFQH 3DUXH 5GCHG 1C5UA 3RXBA 4WH8A 3TGIE 1EUFA 3BTME 3T27A 2ZGJA 3MU4A 3UR9A 1O3KA 3IITA 1LCYA 1WU1A 3ZYDA 1XVMA 2RA0A 1HCGA 2NU1E 5HYOA 2F9BH 4HTCH 1A0JA 2OINA 3UIRA 1P05A 3S7HB 1DLKB 2D8WA 3GISB 3TK6A 3Q3XA 1MTNC 1ZPZA 3SJ9A 2GDEH 1MD8A 3U98H 3LGTA 4HI3A 4BNRA 1TX8A 2ZWLH 3P17H 2OC0A 3LDXH 6GCHF 2OP9A 2O8UA 2FOAA 4I8HA 1VGCC 1GDQA 1VCWA 3ATIA 5FPTA 1F5KU 1GCDA 1C5OH 2TGDA 3U1IB 2FOBA 2GZ9A 5EPNA 1AWFH 1QGFA 2XXLA 4Q7YA 3GCNA 2HALA 1A4WH 3V0XA 3V12A 1HAVB 4IBLH 3UFAA 2P8OC 3M7UA 2G4UA 3T29A 1ZHMA 4YLQH 2GT7A 2PKAA 3P8FA 4CRGA 2PUQH 1WSSH 2CN0H 5HM2A 3F6UH 2BXUH 2EA3A 2H5CA 3HGNA 1EZUC 3ZZ4A 1QQUA 1B5GH 1OWIA 3MMGA 4CRAA 1C1SA 2VWNA 2NWNA 5DP6A 1UHBB 3LONA 4DIIH 1A5HA 2HNTF 1HBTH 1PPHE 1C1VH 4IW4E 4X6OA 1Q2WA 1J8AA 1W7XH 1DUEA 1C2EA 3LH1A 1LPGB 5FPSA 1MTVA 3DT0H 1FUJA 3PB1E 5G4BA 5EQQA 2F91A 1FIWA 4CR9A 2VVCA 4XBDA 3EA8A 1ELFA 1QHRB 2WYGA 1DLEA 2ZDKA 2FPZA 2ZPSA 1DSTA 5FCRA 2Y81A 3CENA 5ESBA 1XUJA 1D3DB 1CE5A 2QF3A 1P01A 1AVXA 4B71A 3K2UA 1C5SA 4VGCB 2ZNKH 4J2YB 5C20A 4ZXYH 1HAIH 3M3SA 3VGCB 1BA8B 1BMAA 2DE8A 1ETSH 1SGQE 4Q7XA 1YPMH 1YPLH 2PKAB 3MH5A 1SG8B 4U30A 4IN2A 2BLVA 1K21H 4JYVH 5C5OA 4DIHH 1HYLA 3SU3A 2A4GA 5FX6A 1P3EA 1JBUH 3GYLB 3RC5A 1O2HA 2F83A 1U6QA 2IPHA 2ZG0H 4ISOA 3OTJE 1O2MA 1K2I1 3SU0A 1V2WT 4DURA 5EXLA 4ISNA 4ABEA 2BYAX 3LPRA 1V2RT 4CHAB 1SVPA 1TWXB 1GI9B 3H7TA 2GDDA 1P2MA 2EC9H 1V2ST 3M5LA 2PR3A 2J38A 2V0BA 3UWJH 2EEKA 1MH0A 1T4VH 5A0BA 2Y5GA 1C1PA 3C1KA 1AB9C 1AMHA 1ANCA 1KLIH 1YKTA 1EJMA 4OGYA 3TH2H 2WPKS 4YTAA 3RU4T 1XUFA 1GBAA 1UTMA 2BOHB 5JB8S 5JBAS 3I29A 4XSKU 1GWAA 1CQQA 3A8CA 4MPWA 4XBBA 1TPSA 1DWDH 2PWXA 1ZMJA 1O0DH 1DXWA 3Q3YA 3RMMH 1T8LA 1QTFA 4IGDA 5T6GA 3TH4H 3T26A 1LHCH 3C27B 3S9BA 2Y5HA 4TY6A 2BDIA 1HNEE 3MI4A 1O5BB 4AX9H 3F9EA 1FONA 2GCHF 2A5KA 1Y5AT 2NU3E 4X6MA 3VB5A 4DOQA 1GG6C 1WBGB 2Z3CA 3O8DA 4A7IB 5A09A 1M9UA 3PMJA 1V6DA 2WPLS 1BOQA 1GVKB 2FI5E 3MO3A 3RXKA 1IQIA 1SGNE 2CHAB 1NROH 3T2NA 1ELVA 3RLYH 8GCHG 2Z9LA 2G51A 5TJXA 2ZQ2A 1DITH 7GCHG 1TOCB 4X2XA 1W7GH 3TGKE 1DE7H 4BTUB 2GZ8A 1GHAF 1AVGH 3BG4C 3MU8A 5E0HA 3LGUA 2ZP0H 1P04A 1N8OB 3PTNA 1TNLA 2UUYA 2FYRA 1E0FD 1Y3WA 1Y5UT 1EP5A 3LU9B 1K1IA 2WPMS 4FUBA 2UUKB 4GPGA 1O30A 1QY6A 1D9IA 3B8JA 1BJUA 3KGPA 4X8UH 1IHTH 3ESTA 4X1QU 1L1NA 1SGFA 4YZUA 1FN8A 1SL3A 2KAIB 1VCQA 3NUMA 1C2KA 3M37A 4WH6A 1GBHA 3LT3A 5FBIA 4I7YH 3F9HA 1P02A 1NC6A 4Y7AA 1GBCA 3GCHB 7GCHF 3SQHE 1SFIA 2AMQA 2WPHS 2QF0A
chains in the Genus database with same CATH superfamily
3SGBE 1O31A 1O32A 3Q76A 4YLUA 9ESTA 2VH0A 4DVAU 2I6QA 4NFEA 4TPIZ 1BRAA 1SSXA 2FI3E 5EQSA 2HGTH 4XFQA 4DY7B 2JH6D 1TA6A 1GPZA 1AGJA 3V7TA 1Z7KA 2WUBA 1V2VT 1D3QB 1FXYA 1O2IA 2TBSA 1AN1E 2A1DB 1THPB 3LKWA 3ZZ3A 1Z71A 3P8OA 2J2UA 3UB0A 1GHBG 4B76A 5T3HA 3RXPA 1SQTA 2A0QB 1ELCA 1C5ZB 5A8YA 1CGIE 3MHWU 2HNTE 1O2KA 1UK3A 4FXGH 2QYIA 1QB1A 2KR7A 3A83A 5A0AE 1MTSA 1OYTH 3GOVB 1F0UA 2AH4X 4RT0A 3SBKA 2ZFRH 1GJAB 3RM2H 2UWPA 4X1RU 2SNVA 3TK5A 1GJ6A 5TCAA 4Y10E 1YPHC 1O2QA 2FDAA 4IMZA 2B0FA 2IOTA 1IQMA 2VIPA 1L0ZA 3URDA 1H8HD 1V2NT 2VB0A 1ELTA 2BXTH 1KXCA 2O8WA 3SHCH 1VITH 3BTHE 1ZHRA 4CRCA 1O2UA 2VBCA 4NZQA 1Z8GA 1O2VA 1CGJE 4INHA 3VB7A 2ZEBA 1GBKA 1GJ5H 2AIPA 1L1JA 1QL8A 3F2GA 4K1SA 1SQRA 2GMTB 1IQJA 2UWLA 1TX6A 1TFXA 3GDVA 5JB9S 2VIVA 1BTUA 1EPTB 1OHHD 2A32A 3FVFB 1FDPA 4YOIA 1YC0A 4CR5A 1L4DA 1Z1IA 1P10A 3RMLH 1NY22 5HMAA 3PO1C 4Y79A 3ZVDA 3MNCA 1SGIB 4FUHA 3K65B 1YPJH 5LPEA 3SV8A 1YPEH 3A81A 3WWBA 1TYNA 3NXPA 4ABFA 1DPOA 1NRQH 2BY9X 2THFB 4NSYA 1QQ4A 4ZAEA 1E38B 1KSNA 2ZU4A 3W94A 1ZTKA 4O3UA 1QRWA 3SYJA 3TH3H 2FX4A 5EW1H 1A0HB 2W3KA 4Y0YE 4TYDA 3T5FH 3ZZ7A 1TNKA 3O8BA 2QN5T 4ISLA 3RXDA 1ANBA 1UJ1A 2WYJA 3ZZAA 2BLQA 1RD3B 5L2ZH 1C9TA 1S5SA 4JYTA 3RXOA 4OS2A 2FOMB 3RXCA 3SUEA 1A0LA 1Y3UA 4HG6A 2XCNA 3E90B 1YWUA 1FZZA 1P8VC 4DGJA 1OX1A 4HZHA 2ZPQA 5DK1A 2JKHA 1EASA 1W13U 3BEUA 4UFDH 1HJ8A 1FX0B 3BF6H 4ZHMU 2ZPRA 1LKAA 1TBRH 2XYAA 1ZR0A 4FUGA 4ZKOU 1LQEA 3NWUA 3DD2H 3LGVA 3NKKA 1KDQB 1QA7A 2WPIS 3SU4A 3QK1A 3NPSA 5FAHA 3A7WA 1E79D 1TA2A 1UTNA 4WF8A 2FX6A 4Z1MD 1PJPA 4ABAA 4X2VA 4DT7B 2HVXA 3LC5A 5E8EH 1BB0B 2WPJS 3A8DA 4JYUH 5DP8A 3RXRA 3A88A 2PW8H 4I8KA 3F3BA 2R9PA 3IG6B 3PYHA 3KQDA 4E05H 2F9VA 2ZF0H 1K1NA 4YESB 1O5FH 2V3OH 4AFUA 2C8YB 1K1MA 1NFYA 1P11E 2FLBH 2XW9A 5EG4A 1O2OA 3GDSA 5ABWA 3FZZA 3AW1A 1GBFA 1EQ9A 4BAHB 2A7JA 2XOKD 4B74A 4NWKA 4MPVA 2Q6DA 1ZMNA 1RIWC 1N1LA 2W7SA 1C1NA 4CREA 2D26C 2GD4B 2VVVA 5FHTA 1AKSB 1QBVH 5EODA 1C5YB 1LTOA 5DG6A 2VVUA 1YBWA 4TSFD 3E1XB 2W26A 1LHDH 1BCUH 3PV4A 4ZKRU 1FI8A 4KTCA 1ELGA 3MU5A 2GZ7A 4UFFH 3UOUA 2A31A 1WXRA 2ZGXH 1HJ9A 3P92A 3BTFE 1WAYB 3RXMA 4INLA 1YCPH 1GI2A 1TPOA 1Q31A 3HGPA 4JK5A 1B0FA 1GDNA 1BIOA 2JH0D 4BTTB 1Z1JA 5B6LA 1O3NA 1JIRA 2BX4A 1NFWA 3U8OH 1IQFA 5C17A 1DUAA 2IJD1 4YT7H 3S7KB 1OOKB 2FOCA 1ZZZA 3SI3H 5AFZH 1V2PT 1AE8H 4SGAE 1Y8TA 1AE5A 1J16A 5C1YA 3E8LA 1C2MA 4HGCA 1MU8B 2HOBA 2Z9IA 1MAYA 4MNYA 1F5RA 1C1MA 1XM1A 4LK4A 2ZFPH 2ULLA 1LHEH 3U28C 1SLUB 3URCA 2PUXB 2VIWA 4I33A 3SV9A 1MTWA 5BPEA 2C93B 4NCYA 2D2DA 1UTKA 3DFLA 3MH6A 5DP3A 1P9UA 2ZU2A 2TPIZ 4U32A 4A1TA 4K8YA 2DE9A 1OWHA 2LNCA 1BT7A 1W14U 4AG1A 1O36A 1QJ7B 4Y76A 5FCKA 1ABIH 1HAVA 5K7RA 3KCGH 1QJ1B 3MYWA 4THNH 1V2TT 3M5OA 1EAWA 1O3OA 3ZVGA 2QCYA 1WOFA 1BMMH 1YPHE 1AFEH 6GCHG 3QLPH 1PFXC 2AIQA 3S0NA 2XNDD 2STAE 2NU0E 3QGJA 1EFRD 1H1BA 3SOSA 2ZHQH 2ZDAH 2FM2A 1ZSLA 2GV6A 4K69A 2FTMA 5GDSH 4X1SU 5DGJA 2J92A 1UHBA 1AHTH 4ZHLU 3SU6A 1YF4A 1GI7B 4B73A 5E2PA 1JRTA 1P03A 4NIVA 4IN1A 1ESTA 1TABE 1W3CA 2AEIH 1H9LB 2Q1JA 3QWCH 2KZ4A 4H42U 1GCTC 1V3XA 2WV9A 3SGQE 1GI6A 1O3GA 2FOHA 3RMOH 2SFAA 3ZZDA 3BTEE 4AFZA 4ZUHA 3S9CA 4NSVA 1GL0E 1V2MT 1TMUH 4NWLA 3GY3A 2P3UB 1SQAA 1EAUA 3CNRA 3HK3B 2QY0B 1P2OA 2QXIA 4WWYA 2OBQA 4KTSA 4FU8A 1ZOMA 1QL7A 3VB4A 2ZCLP 1PPGE 4AYVB 5C94A 3RM0H 4IC5A 3ZZ5A 1UTPA 1WQVH 3RXIA 2CHAC 2PKSB 4BAQB 5IK2D 1K1JA 2BDBA 4HFPB 1WTHD 3AAVA 3DCLA 4D9RA 1C5NH 3ZYEA 1VJ9U 1ESAA 5GPIB 1PQ8A 1MQ5A 3EDXB 2Q6GA 1FNIA 5ESTE 3F2FA 6CHAB 2C8ZB 3CS7A 2GV7A 1VCPA 3MO9A 3DHKH 1HJAB 1EATA 1FPCH 2YNBA 5AVDA 1N8OC 4CRFA 3SNEA 1W0YH 3W1EA 4TPYA 4FVDA 2FLRH 1W8BH 2F4LA 2YOLA 3I77A 4ZXXH 1EP6A 4RN6A 2BOKA 2JJ2D 1ACBE 3F0OA 3EGKH 3ITIA 3P70B 5C3NA 3E0PB 3K9XB 1MQ6A 2NU4E 4ISIH 3GY5A 2STBE 4BAKB 1FAKH 1BTZA 4M7GA 8ESTE 3ZVEA 4FETA 1TMTH 1BRUP 4MVNA 5CHAB 3SZEA 1BRCE 1PQ5A 3A7XA 5DKMA 1MKWK 1P0SH 2FP7B 1Z8JB 1O39A 3AAUA 3GY6A 2KFWA 1HAXB 1CVWH 1GHXH 3EA9A 2GCTC 5F8XA 2P93A 1ABJH 4GHQA 2FWWA 1G30B 2C8XB 1UK2A 2V7QD 1BUIA 3ZZ9A 3SI4H 1D6RA 3M36A 1LVYA 1P2KA 3UQOA 3UNQA 1G32B 3TJUA 3OY5U 2VGCC 1BMLA 4X6NA 1OWJA 4BXWA 3KQBA 1IAUA 1C2LA 4NZLA 1V2JT 1MTUA 1ZGIA 5DP5A 3GICB 1XKBC 1P57B 1PYTD 2ILNA 4X8TH 5HIZA 1BZXE 2ZO3H 3A7TA 5EU8A 3M61U 1KXBA 1FMGA 1GMHF 1H8IH 5C0TA 4TWWA 3UNRA 3ODDA 3SNAA 1OWEA 3O8CA 1O2YA 4JZEH 5ETXA 2B7DH 4MTBA 3FP6E 1KXDA 2BD7A 1CBWC 3BTTE 2JETB 1ELBA 2ALVA 1TPPA 5EXMA 2UUJB 2BD9A 1E36B 2Z6BD 1A3EH 3RXGA 2ASUB 3TIUA 1HFDA 3BV9B 2BDYA 2SNWA 1GBLA 1ARCA 4K3JA 4O9VA 3D23A 4B2BA 1E1RD 2CMYA 4ABHA 2GCHG 2OD3B 3B23B 2P16A 3D65E 1GGDB 2BY5X 2HPQH 4Y7BA 1CU1A 3GS9A 4JZFH 1BTHH 4R8TB 3ZV9A 1DX5M 5E0JA 1CHGA 4Q7ZA 2GMTC 1QIXB 3M7QA 1RFNA 1ZMLA 1OWDA 1HAOH 1ZTJA 3SHAH 1NBMD 1LQDB 3LGWA 4DCDA 2VH6A 2RFKC 1EPTC 1KTSB 1A46H 1S6HA 4AG2A 1XUKA 1W0JD 3N7OA 2KAIA 2BD3A 1GI8B 2V35A 3FANA 3R3GB 1KMHB 2VU8E 1GBMA 5DPAA 2BVXH 2J95A 1OXGA 2A5IA 2HVYB 1ZPBA 3KQ5A 1GHAG 2WHXA 2JIZD 2C8WB 3GYMA 4FU9A 4OM9A 2ZU3A 1TQ7B 5DO4H 1MTNB 3M7TA 3SUGA 4A1VA 4BAOB 2F9OA 1FLEE 1P3CA 4ASHA 1LPZB 1O5AB 5EGMA 3EQ0H 1HLTH 3GCOA 1BHXF 2ODQA 3K6YA 3TGJE 3A82A 4E7RG 4FUFA 1TNHA 1G3EA 1UO6A 2GJGA 1W0KD 1OP0A 1VGCB 3OYPA 4X0WU 3FZDA 2H9HA 3BTGE 2ZGHA 1G9IE 2ZGCA 1TNGA 3S69A 1TQ0B 3PMHB 4WXIA 1ID5H 3HPTB 1MUEB 1DM4B 2CF8H 1UCYH 3ZZBA 4GUXA 2BHGA 3A7ZA 1L4ZA 4LOYH 3KIDU 1SBWA 1C2JA 4JK6A 1YYY1 5L2YH 1MMJN 3FKSD 3NRLA 3BIUH 2A7HA 1C1TA 2Y80A 1DT2A 1O3BA 2FOGA 2FZZA 2ZQ1A 4ESTE 4QT8C 1WYKA 3UY9A 1Y3XA 1ELAA 1C2GA 2O8LA 3SV7A 5CE1A 1K9OE 2PGQB 2F9UA 4Y71A 1KLJH 4OGXA 5DP4A 1SGPE 1IQEA 3WY8A 1TAWA 1ANEA 4NG9H 1G36A 2BDHA 5FPYA 2UWOA 3BTDE 4LZ1H 2ZECA 2WZQA 1QBNA 1O3CA 3E0NB 5FXLA 2KM0A 3UQVA 1A5GH 4P00A 4Q2KA 1SGEE 2ANKH 3LC3A 3TITA 3RXAA 1AIXH 3SUDA 1X7AC 2QV1A 2BD4A 3QO6A 1HRTH 4UE7H 1TLDA 2KCOA 1MKXH 1XUGA 2ZDLA 1OP2A 5EXNA 3V3MA 1S6FA 3A8AA 2ZHEH 1Z6JH 3QDZB 4Z0KA 1ZSKA 1EPTA 2ZDMA 1BQYA 4IS5A 3FP8E 3BTQE 1SOZA 4GAWA 4AB9A 1XVOA 2ODPA 1P12E 5C1XA 5DP9A 2RDEA 4CRBA 5AF9H 5JBTA 1C2FA 1ORFA 1AY6H 4X6PA 4B1TA 1GI4A 1VITF 2WV5A 1AUTC 1RXPA 3VG8A 2VIDA 1TRNA 2FOFA 3PWCA 3KYFA 3MTYA 1GJ8B 3TJVA 4U01A 2A45B 2ZTYA 1KXAA 3MH7A 1ETRH 1J15A 3HKJB 2XC0A 5SGAE 4CBNA 5CMXH 4X1PU 1MZDA 2P59A 3H09A 1SLVB 1TALA 2BY7X 3ZZCA 1BBRH 1CA0B 1EB1H 2BLOA 1BRBE 2ANYA 2FOEA 4R0IA 4OS1A 2OLGA 3PV2A 2CXVA 2VIOA 3F9GA 2PP6A 2ZU5A 1Y59T 1YM0A 1C1QA 4YO9A 1YPKH 1LHGH 7LPRA 3AVZA 3JZ1B 1C5WB 3HK6B 2A2QH 3OFND 2P3TB 2ZDVH 4UONA 3PROA 5L30H 1D6WA 1NRPH 2BQWB 2EI7A 2GGVB 4ACBA 2ZA5A 1FY1A 2BDGA 1DICA 2V6NA 4B75A 4AORA 4GHTA 1KDQA 1S83A 4GVUA 1ZJDA 3VEQB 3BTKE 4D9QA 1F7ZA 2G4TA 4AGKA 1AB9B 1O3IA 4MPUA 1NFUA 4JZ1A 6ESTA 2KCYA 3ZVFA 1Y3VA 3MU0A 3O8RA 1T31A 2CF9H 3N7DA 4INKA 1ZYOA 3VXEH 2H9EH 4X2WA 1AD8H 2F3CE 3DSOA 4KELA 9LPRA 2AGGX 2O8MA 2H6MA 5LGOA 4AN7A 1P2NA 1PYTC 1MD7A 3SU5A 1E37B 1HPGA 1DY9A 3A84A 2GX4A 3PMBB 1AO5A 5F8ZA 4RKOB 3SNCA 1EKBB 4NIXA 1UVUH 2BM2A 2WV4A 1SPJA 4Q63A 3UNSA 1AQ7A 2PTNA 1GG6B 3STJA 3Q77A 3DFJA 3TJNA 4XDEA 1K28D 2ZTZA 2AMPA 1AKSA 1TNJA 3LOXA 1SMFE 2ZZUH 3KEEA 4AC9A 3KQEA 1UW7A 1DOJA 1C4Y2 4AYYB 1CA8B 1O2JA 4Q4LA 1UTOA 2OQ5A 1NO9H 2ALPA 4YOJA 1AUJA 2SGFE 1EX3A 3CS0A 3VB6A 2VWMA 2BVSH 2RDLA 3SJ8A 1CSOE 2QXJA 5KECA 1O5CB 5AFYH 5I25A 3FO8D 1HAYB 4ABGA 3MNXA 1E35B 2B9LA 3U69H 3BG4B 2CGAA 2G5NA 4FUIA 4ISHH 1QB6A 4JCNA 1C4V2 5DP7A 3RMNH 1DS2E 1PPFE 4A92A 2VWLA 1A5IA 2ZHDA 3SN8A 1SGDE 4DG4A 3VFEA 1QL9A 1GI5A 1H8ED 3P6ZB 1SR5C 2ZFSA 3QUMP 3RP2A 1GDUA 1TMBH 2OCVB 3T62A 1C5QA 1UVSH 1XUHA 1GVLA 4D7GA 3BN9A 3IWMA 5GWZA 3RU4D 2A4OA 1UTQA 4X2YA 1NESE 1SB1H 6LPRA 3FOAA 1A1RA 2QF5A 3TLOA 3SV6A 1ESBA 1C5VA 1CHOF 1UTLM 3K6ZA 3BTWE 1V2OT 1SGRE 3ZVCA 2BZ6H 1VR1H 1WQSA 4H6SB 1O2GH 4ABBA 1C4U2 1DVAH 1WCZA 1ELEE 3A8BA 1HJAC 1YLDA 4TWYA 2OQUA 2G00A 4B2CA 1AFQB 5HIYA 1AI8H 3E91A 2XBWA 1NRRH 3MO6A 1NU9A 1HXFH 4X1NU 5JYIA 3T25A 3GY2A 3L33A 2W7UA 2OC1A 3FFGA 1G3BA 1TGNA 2KCPA 4KTUA 1HIAB 1VZQH 1RRKA 1O38A 1KXEA 4BXSA 2QGRA 2PLXA 4RI0A 3ZZ6A 1YP9A 4K1TA 4WMDA 2Z9GA 3A87A 4I8GA 4VGCC 4ABIA 1MBMA 1O2PA 1LMWB 1GHYH 1P2QA 3WW7A 1TBQH 1TB6H 3VGCC 3SZNA 2Z3EA 1NZQH 1O5DH 1MCTA 1O34A 5LPFA 4ZHAA 2CK3D 5HXFA 1O3MA 2QC2A 3A80A 1H9HE 3MQKC 4Y8ZA 1DSUA 5IDKA 3SO3A 1F0TA 1SFQB 4DW2U 2J9NA 3OTPA 4F48B 3MOCA 1COWD 4ZROA 2YMSB 1JIMA 3PO1B 8LPRA 1C2IA 4GSOA 1O2RA 1PQ7A 4FU7A 1RGQA 1UMAH 1BTWA 1QBOA 3UWIA 4RKJB 3M3VA 3Q3KA 1QB9A 2JETC 3SW2B 1FY3A 1TX7A 2IN2A 4NIYA 1HAPH 5H4IB 4CHAC 1YCPM 2UUFB 1EAXA 1P9SA 2PSXA 4AGJA 2YNAA 2FYQA 5FBEA 4NA8A 3W95A 1GBBA 1GMDF 2AMDA 1WV7H 2W6ID 2QIQA 5C2ZA 1S81A 3QTVH 1O2SA 3TNSA 2L74A 5JDUB 1YPGH 2ZIQH 5JPMH 2AHME 1EZQA 3BIVH 1QZ8A 1ZTLA 4B2AA 1WDIA 2AGIX 4GCHF 2G55A 4YOGA 2XWBI 1E1QD 4MG3A 4FOUC 2Q6FA 2G81E 2G52A 1HAHH 3RXEA 5FX5A 3RXVA 1BTXA 2Z94A 3D49H 2BDAA 4TY7A 2DUCA 4J1YA 3F1SB 1Z6EA 4XOJA 1GJDB 4K1EA 1KIGH 3RC6A 3VPKA 4XE4A 3PLBA 3QTOH 2J5UA 4YM9A 1YCPK 4X8VH 5A8XA 3ZIAD 4K60A 3A85A 1BMFD 3A89A 3SNBA 2J4IA 1SOTA 1GMCG 1IQHA 4H4FA 5KEDA 5EJLA 1FY4A 3N99A 4E7NA 2Z3DA 5GCHF 3MH4A 2EI6A 2A2XH 4BAMB 5JBBS 4AFQA 2R0KA 1J9CH 1ANDA 3T28A 1GBDA 2VWOA 5FL7D 1XMNB 2ZI2H 4RSPA 1CT0E 4LZ4B 3A86A 1RIWB 8KME2 1IQKA 2AYWA 4Q80A 2A4QA 1GJ9B 1UK4A 4JZIA 1P06A 1ELDE 1O3EA 3DSPA 2BD2A 4U2WA 3EA7A 1TRMA 2WUCA 2HNTC 2EY4C 3KNXA 4O97A 2TGTA 4FUJA 4BTIB 3SV2H 5BRRE 5HGGA 2ZCHP 1CGHA 1GMCF 3BEFB 2FESH 5AHGH 3L6PA 3QN7A 2W5EA 3KYGA 1OWKA 3ATLA 4JZDH 1GMHG 2BQ7B 1C5TA 1HUTH 2RG3A 3GCHC 2FEQH 3OAAD 4MNVA 2ZTXA 5TCCA 3STIA 2ODYB 4ZKNU 1C5LH 1C1RA 3R0FA 1C5RA 2QA9E 3UREA 1S0RA 2WPDD 3GY7A 4KP0A 1IQNA 4I31A 4FVBA 1XKAC 3ZVBA 2BTCE 3A7VA 7ESTE 3G01A 2JH5D 1UVPA 1L1GA 4UFEH 2YMSD 1GBIA 1N6XA 3F68H 3VXFH 1G2MA 2P94A 1EAIA 1HB0B 3BG8A 1Z8RA 2W3IA 4WXVA 3UPEA 4I8LA 1AWHB 4NFFA 1PPCE 4M9FA 2D1JA 1SGFG 1O5EH 1LO6A 2OXSA 2EQNA 3S9AA 3QZRA 1O3FA 2Y6TA 2HPPH 2ZGBH 3GY8A 2ANWA 1PPZA 4UFGH 1LVMA 4O3TA 1NU7B 1DY8A 2ZFFH 4IC6A 4NA7A 1EZXC 2Y7XA 2XWAA 1H8DH 1CA0C 3TU7H 5K0HA 1Y5BT 2BY8X 1MU6B 1O2LA 1IOEA 4MPXA 2J94A 1TIOA 3PTBA 3LGIA 3ZV8A 2A7CA 2OBOA 1ZRKA 4H6TA 1Y3YA 1DWBH 5IYTA 5C5NA 1UVTH 4X8SH 5EQRA 1EZSC 1SHHB 3KN2A 1O2TA 3QX5H 2Z9KA 1S82A 1SQOA 4YT6H 1C5XB 5I46H 1S0QA 3QGNB 1O3PB 5T6FA 1ZLRA 2FMJA 1BTPA 2H9TH 3Q00A 5A2MH 1AU8A 1T7CA 5C67A 1K0HA 3VB3A 1GBEA 4F55A 2ZCKP 4XBCA 2I6SA 2F9NA 1L2EA 2XBXA 4MNXA 1GJBB 1TGTA 1GHWH 2QF4A 2GKVE 5EJZA 1QA0A 1VJAU 1BITA 1MBQA 1G2LA 2QAAA 3BSQA 4WMEA 3SQEE 1W12U 2G5VA 1BMNH 1QJ6B 1EOJA 2LP6A 4K2YA 1YLCA 2BX3A 2TGPZ 4BOHA 1CT4E 5EJ1A 4XD7D 3M5MA 3PRBA 4DJZB 2XTTB 3U8TH 2ANMH 1AZZA 1W11U 2CV3A 3BEIB 1GCTB 1S6LA 5B6OA 3UOPA 2TIOA 3UAIC 3LJOA 3FAOA 3TVJB 1O3AA 1N6YA 1K22H 5C1UA 1QRXA 1BTYA 1QURH 2PHBA 3DA9B 4Y0ZE 1JOUB 1V2LT 3NZIA 3F2HA 4Y8XA 2VINA 2EI8A 1WTGH 2P8OB 1KY9A 1T4UH 4CRDA 4MQAA 2H1UA 1NT1A 2A5AA 1FN6A 2HRVA 3SU2A 1EOLA 3TNTA 4KGAA 1NRSH 5GIBA 1IQGA 1C5PA 1BDAA 2A4RA 1GBTA 1OKXA 1C5MD 1EJNA 1ZRBA 1AVWA 3UR6A 1P09A 3KL6A 4UDWH 2ZC9H 1A2CH 1VITG 1AZ8A 4D8NA 2J34A 1D3TB 2C4FH 1E34B 2XBVA 4ZKSU 1HAZB 1S85A 4FUCA 2CJIA 2FODA 3E6PH 1C9PA 3RC4A 1C2HA 1TOMH 1K1PA 2J98B 1GHZA 2VIQA 2C90B 4UEHH 8GCHF 1C1OA 1PQAA 2SGAA 1ZHPA 3SORA 3ATMA 3OX7U 4NA9H 1LDTT 5HM9A 4B6FA 2K1QA 4F4OC 3FP7E 5F6MA 2SGQE 2GCTB 1K1LA 3ELAH 5E0GA 2B5TB 1RJXB 1HDTH 3ATKA 4LXBH 3SGAE 1TGCA 1SLWB 3P8NA 5GXPA 4OS7A 3TPIZ 7KMEH 3GDUA 4I32A 1OYQA 2VGCB 5JBCS 3L3TA 2LPRA 3RXJA 1C1UH 1GI1A 1GL1A 2RCEA 3GY4A 1AFQC 1IQLA 3I78A 3QZQA 4D7FA 1JXPA 2RA3A 1OPHB 4CH2B 2AERH 4NGAH 4WJG2 4AB8A 4B6EA 1XX9A 5LPRA 4IMQA 4AFSA 1A61H 1THSH 2Z7FE 3H5CB 3P8GA 4XRNA 2ZFTA 1XUIA 1CBWB 3F9FA 4WY3A 4JMYA 3UUZA 1ETTH 1TGBA 1GBJA 4O03A 3V13A 1QNJA 4I86A 1FV9A 1F0SA 1INCA 1VKYA 4FUDA 4CBOA 1YLNA 1RTFB 2Y7ZA 1P2JA 1DDJA 1JMOH 3HKIB 4ZH8A 1C2DA 3DSGA 1V2KT 4MDSA 5T6DA 1UCYK 1HAGE 5DJ7A 1GHBF 4K8BA 1SC8U 2BLWA 3ODFA 1XXFA 2HLCA 4ABDA 1TNIA 1TBZH 1RS0A 4E06H 2XC5A 1O5GH 3RXLA 3LJJA 1F5LA 3RU4E 1O2NA 3GCTG 3RXFA 1CT2E 1B0EA 1DXPA 1QR3E 2C3SA 2GP9B 3AW0A 1A3BH 2XRCA 5F8TA 1F2SE 4OS5A 5A0CA 3SUFA 2YMSC 2ZHWH 3SJIA 1O37A 1ARBA 2B8OH 1UVOA 3NCLA 2FIRH 3CP7A 3TK9A 5EPYA 1BHXB 1NM6A 2G8TA 4A6LA 2BB4A 1GHVH 1V2QT 1SGTA 1O3JA 1FJSA 2BD8A 2VNTA 1D4PB 3EAJA 5EIYA 1PPBH 5EOKA 4Y11E 3U8RH 3D62A 4MLFB 5HKKD 1RTKA 3SJKA 2XC4A 3EE7A 3RXQA 3U1JB 1W0ZU 1K1OA 1LHFH 1MKXK 1Q3XA 1SGYE 3SJOA 2O8TA 1SI5H 1TPAE 3JZ2B 3GCTF 5LH8A 2FXRA 3MFJA 1GJ7B 4RT1A 4ZMAH 4MNWA 3A7YA 4WVPE 1LPKB 1F0RA 1KXFA 2BY6X 2XCFA 3H7OA 1GJCB 4A5TS 3KF2A 1EXFA 1S84A 2OC8A 3RLWH 1UCYE 1Z8IB 4PROA 1FY5A 1CHOG 3OU0A 2PSYA 3M5NA 3KQCA 4D76A 3E16B 2OUAA 1EJAA 4SGBE 2PV9B 2P95A 3PLKA 3B9FH 1HIAA 4FUEA 2GT8A 4AZ2B 2AFQB 4KKDA 2R3YA 3PRDA 3ZVAA 4AOQA 3OEED 2PTCE 3N7EA 1FPHH 5E2OA 5EW2H 1BBRK 1F92A 3RXSA 4GLYA 1YGCH 2PFEA 2XNIA 1NS3A 1OP8A 3RXHA 1SLXB 2BDCA 1DANH 1BJVA 2KX4A 2R3UA 3EE0B 5PTPA 5GJ4B 1G3DA 3OSYA 3PM3A 5F03A 4A1XA 1DWCH 2PKSC 2Y82A 1A7SA 2PGBB 4K5ZA 1MCVA 2QXGA 1NPMA 1SHYA 1MAXA 3MNBA 1GVZA 2H2ZA 3PWBA 2AGEX 4WMFA 2AS9A 6CHAC 1V2UT 1TGSZ 3OY6U 1HGTH 4OS6A 2ZKSA 4Z6AH 3LGYA 2GTBA 1SKYE 2ESTE 2OC7A 1DWEH 2SGEE 3ATWA 2J97A 1SGCA 1O2XA 1D3PB 3TJOA 1LKBA 4F49A 1O3DA 2FI4E 3RXTA 1T8OA 1ZJKA 1TRYA 2ZDNA 4ABJA 2BD5A 1H4WA 3M3TA 3RXUA 1KLTA 1O3LA 2R2WU 2Z9JA 1OSSA 1ZGVA 5CHAC 2IPQX 1FAXA 1QFKH 1HV7A 1QRZA 3MWIU 1GI3A 1NFXA 2BZAA 2R0LA 4I8JA 2ZU1A 4CH8B 1FY8E 2V3MA 2FTLE 2QXHA 2V3HH 1BBRE 2O9QA 4UD9H 5A8ZA 1O35A 1J14A 1W2KH 4Y8YA 2BQ6B 1P2IA 2R2MB 3PMAB 1DFPA 2TGAA 1NN6A 3E3TA 1FIZA 3UTUH 4NIWA 2IJOB 5DSFA 2M5TA 5J4QA 3AASA 1O2ZA 2Y5FA 1QCPA 1PPEE 1O3HA 1OS8A 1ZPCA 1GMDG 4OS4A 3PLPA 2ZHFH 3HATH 2SGPE 3U9AH 2XBYA 1KYNA 3M35A 1CO7E 1LVOA 1G3CA 3SNDA 1H9IE 2L6OA 2W6JD 1T8NA 1KTTB 1TE0A 2GVFA 3KHVA 3NK8A 2TRMA 1EB2A 1O2WA 2NU2E 1C1WH 1YY3A 4GCHG 2FS9A 1GJ4H 3EYDA 4Y6DA 2H5DA 1JRSA 2FS8A 5J4SA 3LH3A 1NTPA 1B7XB 4TT3D 3SU1A 1HXEH 2OTVA 1NRNH 1GI0A 1MKWH 3RDZA 1ZSJA 3MNSA 1T8MA 2SGDE 1JWTA 1IHSH 2F43B 1T32A 1RTLA 1XXDA 1GGDC 1J17T 3P95A 2BVRH 3MU1A 2VJ1A 3LIWA 2FO9A 5L6NH 1G37A 3ENSB 1FQ3A 1O33A 1LVBA 2F9PA 1THRH 1MZAA 2P3FH 3RUOA 1W10U 2WINI 2HWLB 3ZZ8A 4BANB 1UTJA 1TONA 1WUNH 2BMGB 2ZFQH 3DUXH 5GCHG 1C5UA 3RXBA 4WH8A 3TGIE 1EUFA 3BTME 3T27A 2ZGJA 3MU4A 3UR9A 1O3KA 3IITA 1LCYA 1WU1A 3ZYDA 1XVMA 2RA0A 1HCGA 2NU1E 5HYOA 2F9BH 4HTCH 1A0JA 2OINA 3UIRA 1P05A 3S7HB 1DLKB 2D8WA 3GISB 3TK6A 3Q3XA 1MTNC 1ZPZA 3SJ9A 2GDEH 1MD8A 3U98H 3LGTA 4HI3A 4BNRA 1TX8A 2ZWLH 3P17H 2OC0A 3LDXH 6GCHF 2OP9A 2O8UA 2FOAA 4I8HA 1VGCC 1GDQA 5C0UA 1VCWA 3ATIA 5FPTA 1F5KU 1GCDA 1C5OH 2TGDA 3U1IB 2FOBA 2GZ9A 5EPNA 1AWFH 1QGFA 2XXLA 4Q7YA 3GCNA 2HALA 1A4WH 3V0XA 3V12A 1HAVB 4IBLH 3UFAA 2P8OC 3M7UA 2G4UA 3T29A 1ZHMA 4YLQH 2GT7A 5CDFE 2PKAA 3P8FA 4CRGA 2PUQH 1WSSH 2CN0H 5HM2A 3F6UH 2BXUH 2EA3A 2H5CA 3HGNA 1EZUC 3ZZ4A 1QQUA 3OEHD 1B5GH 1OWIA 3MMGA 4CRAA 1C1SA 2VWNA 2NWNA 5DP6A 1UHBB 2K0QA 1NBME 3LONA 4P02A 4DIIH 1A5HA 2HNTF 2QE7D 1HBTH 1PPHE 1C1VH 4IW4E 4X6OA 1Q2WA 1J8AA 1W7XH 4ACAA 1DUEA 1C2EA 3LH1A 1LPGB 5FPSA 1MTVA 3DT0H 1FUJA 3FN8A 3PB1E 5EQQA 5G4BA 5T1VA 2F91A 1FIWA 4CR9A 2VVCA 4XBDA 3AK5A 3EA8A 1ELFA 1QHRB 2WYGA 1DLEA 2ZDKA 2FPZA 2ZPSA 1DSTA 5FCRA 2Y81A 3CENA 5ESBA 1XUJA 1D3DB 1CE5A 2QF3A 1P01A 1AVXA 4B71A 3K2UA 1C5SA 4VGCB 2ZNKH 4J2YB 5C20A 4ZXYH 1HAIH 2WSSD 3M3SA 3VGCB 1BA8B 1BMAA 2DE8A 1ETSH 1SGQE 4Q7XA 1YPMH 1YPLH 2PKAB 3MH5A 1SG8B 4U30A 2M2AA 4IN2A 2BLVA 1K21H 4JYVH 5C5OA 4DIHH 1HYLA 3SU3A 4ZCNA 2A4GA 5FX6A 1P3EA 1JBUH 3GYLB 3RC5A 1O2HA 1MABB 2K8IA 2F83A 1U6QA 2IPHA 2ZG0H 3F0PA 4YXWD 4ISOA 3OTJE 1O2MA 1K2I1 3SU0A 1V2WT 4DURA 5EXLA 4ISNA 4ABEA 2BYAX 3WWFA 3LPRA 1V2RT 4CHAB 1SVPA 1TWXB 1GI9B 5CHBA 3H7TA 5F53A 2GDDA 1P2MA 2EC9H 1V2ST 3M5LA 2PR3A 2J38A 2V0BA 3UWJH 2EEKA 3OE7D 2LELA 1MH0A 1T4VH 5A0BA 2Y5GA 1C1PA 3C1KA 1AB9C 1AMHA 1ANCA 1KLIH 1YKTA 1EJMA 4OGYA 3TH2H 2WPKS 4YTAA 3RU4T 1XUFA 1GBAA 1UTMA 2BOHB 5GNDA 5JB8S 5JBAS 3I29A 4XSKU 1GWAA 1CQQA 3A8CA 4MPWA 4XBBA 1TPSA 1DWDH 2JDID 2PWXA 4ASUD 1ZMJA 1O0DH 2J98A 1DXWA 3Q3YA 3RMMH 1T8LA 1QTFA 4IGDA 5T6GA 3TH4H 3T26A 1LHCH 3C27B 3S9BA 2Y5HA 4TY6A 5KGOA 2BDIA 1HNEE 5DN6D 3MI4A 1O5BB 4AX9H 3F9EA 1FONA 2GCHF 2A5KA 1Y5AT 2NU3E 4X6MA 3VB5A 4DOQA 1GG6C 1WBGB 2Z3CA 3O8DA 4DT4A 4A7IB 5A09A 1M9UA 3PMJA 1V6DA 2WPLS 1BOQA 1GVKB 2FI5E 3MO3A 3RXKA 1IQIA 1SGNE 2CHAB 2HLDD 1NROH 3T2NA 1ELVA 3RLYH 8GCHG 2Z9LA 2G51A 5TJXA 2ZQ2A 1DITH 7GCHG 1TOCB 4X2XA 1W7GH 3TGKE 1DE7H 4BTUB 2GZ8A 1GHAF 1AVGH 3BG4C 3MU8A 5E0HA 3LGUA 2OK5A 2ZP0H 1P04A 1N8OB 3PTNA 1TNLA 2UUYA 3PV5A 2FYRA 1E0FD 1Y3WA 1Y5UT 1EP5A 2KCAA 3LU9B 1K1IA 2WPMS 4FUBA 2UUKB 4GPGA 1O30A 1QY6A 1D9IA 3B8JA 1BJUA 3KGPA 4X8UH 1IHTH 3ESTA 4X1QU 1L1NA 1SGFA 4YZUA 1FN8A 1SL3A 2KAIB 1VCQA 3NUMA 1C2KA 3M37A 4WH6A 1GBHA 3LT3A 5FBIA 4I7YH 3F9HA 1P02A 2JJ1D 1NC6A 4Y7AA 1GBCA 3GCHB 7GCHF 3SQHE 1SFIA 2AMQA 2WPHS 2QF0A
chains in the Genus database with same CATH topology
3SGBE 1O31A 1O32A 3Q76A 4YLUA 9ESTA 2VH0A 4DVAU 2I6QA 4NFEA 4TPIZ 1BRAA 1SSXA 2FI3E 5EQSA 2HGTH 4XFQA 4DY7B 2JH6D 1TA6A 1GPZA 1AGJA 3V7TA 1Z7KA 2WUBA 1V2VT 1D3QB 1FXYA 1O2IA 2TBSA 1AN1E 2A1DB 1THPB 3LKWA 3ZZ3A 1Z71A 3P8OA 2J2UA 1GHBG 4B76A 5T3HA 3RXPA 1SQTA 2A0QB 1ELCA 1C5ZB 5A8YA 1CGIE 3MHWU 2HNTE 1O2KA 1UK3A 4FXGH 2QYIA 1QB1A 3A83A 5A0AE 1MTSA 1OYTH 3GOVB 1F0UA 2AH4X 3SBKA 2ZFRH 1GJAB 3RM2H 2UWPA 4X1RU 2SNVA 3TK5A 1GJ6A 5TCAA 4Y10E 1YPHC 1O2QA 2FDAA 4IMZA 2B0FA 2IOTA 1IQMA 2VIPA 1L0ZA 3URDA 1V2NT 2VB0A 1ELTA 2BXTH 1KXCA 2O8WA 3SHCH 1VITH 3BTHE 1ZHRA 4CRCA 1O2UA 4NZQA 1Z8GA 1O2VA 1CGJE 4INHA 3VB7A 2ZEBA 1GBKA 1GJ5H 2AIPA 1L1JA 1QL8A 4K1SA 2GMTB 1IQJA 2UWLA 1TX6A 1TFXA 3GDVA 5JB9S 2VIVA 1BTUA 1EPTB 2A32A 3FVFB 1FDPA 4YOIA 1YC0A 4CR5A 1L4DA 1Z1IA 1P10A 3RMLH 1NY22 5HMAA 3PO1C 4Y79A 3ZVDA 3MNCA 1SGIB 4FUHA 3K65B 1YPJH 5LPEA 3SV8A 1YPEH 3A81A 1TYNA 3NXPA 4ABFA 1DPOA 1NRQH 2BY9X 2THFB 4NSYA 1QQ4A 4ZAEA 1E38B 1KSNA 2ZU4A 3W94A 1ZTKA 4O3UA 1QRWA 3TH3H 2FX4A 5EW1H 1A0HB 2W3KA 4Y0YE 4TYDA 3T5FH 3ZZ7A 1TNKA 3O8BA 2QN5T 4ISLA 3RXDA 1ANBA 1UJ1A 2WYJA 3ZZAA 2BLQA 1RD3B 5L2ZH 1C9TA 1S5SA 4JYTA 3RXOA 4OS2A 2FOMB 3RXCA 3SUEA 1A0LA 1Y3UA 2XCNA 3E90B 1FZZA 1P8VC 4DGJA 1OX1A 4HZHA 2ZPQA 5DK1A 2JKHA 1EASA 1W13U 3BEUA 4UFDH 1HJ8A 3BF6H 4ZHMU 2ZPRA 1LKAA 1TBRH 2XYAA 1ZR0A 4FUGA 4ZKOU 1LQEA 3NWUA 3DD2H 3LGVA 3NKKA 1KDQB 1QA7A 2WPIS 3SU4A 3QK1A 3NPSA 5FAHA 3A7WA 1TA2A 1UTNA 4WF8A 2FX6A 1PJPA 4ABAA 4X2VA 4DT7B 2HVXA 3LC5A 5E8EH 1BB0B 2WPJS 3A8DA 4JYUH 5DP8A 3RXRA 3A88A 2PW8H 4I8KA 2R9PA 3IG6B 3PYHA 3KQDA 4E05H 2F9VA 2ZF0H 1K1NA 4YESB 1O5FH 2V3OH 4AFUA 2C8YB 1K1MA 1NFYA 1P11E 2FLBH 2XW9A 5EG4A 1O2OA 3GDSA 5ABWA 3FZZA 3AW1A 1GBFA 1EQ9A 4BAHB 2A7JA 4B74A 4NWKA 4MPVA 2Q6DA 1ZMNA 1RIWC 1N1LA 2W7SA 1C1NA 4CREA 2D26C 2GD4B 2VVVA 5FHTA 1AKSB 1QBVH 5EODA 1C5YB 1LTOA 5DG6A 2VVUA 1YBWA 3E1XB 2W26A 1LHDH 1BCUH 3PV4A 4ZKRU 1FI8A 4KTCA 1ELGA 3MU5A 2GZ7A 4UFFH 3UOUA 2A31A 2ZGXH 1HJ9A 3P92A 3BTFE 1WAYB 3RXMA 4INLA 1YCPH 1GI2A 1TPOA 1Q31A 3HGPA 4JK5A 1B0FA 1GDNA 1BIOA 2JH0D 4BTTB 1Z1JA 1O3NA 1JIRA 2BX4A 1NFWA 3U8OH 1IQFA 1DUAA 4YT7H 3S7KB 1OOKB 2FOCA 1ZZZA 3SI3H 5AFZH 1V2PT 1AE8H 4SGAE 1Y8TA 1AE5A 1J16A 5C1YA 3E8LA 1C2MA 4HGCA 1MU8B 2HOBA 2Z9IA 1MAYA 4MNYA 1F5RA 1C1MA 1XM1A 4LK4A 2ZFPH 2ULLA 1LHEH 1SLUB 3URCA 2PUXB 2VIWA 4I33A 3SV9A 1MTWA 5BPEA 2C93B 4NCYA 2D2DA 1UTKA 3DFLA 3MH6A 5DP3A 1P9UA 2ZU2A 2TPIZ 4U32A 4A1TA 4K8YA 2DE9A 1OWHA 2LNCA 1BT7A 1W14U 4AG1A 1O36A 1QJ7B 4Y76A 5FCKA 1ABIH 1HAVA 5K7RA 3KCGH 1QJ1B 3MYWA 4THNH 1V2TT 3M5OA 1EAWA 1O3OA 3ZVGA 2QCYA 1WOFA 1BMMH 1YPHE 1AFEH 6GCHG 3QLPH 1PFXC 2AIQA 3S0NA 2STAE 2NU0E 3QGJA 1H1BA 3SOSA 2ZHQH 2ZDAH 2FM2A 1ZSLA 2GV6A 4K69A 2FTMA 5GDSH 4X1SU 5DGJA 2J92A 1UHBA 1AHTH 4ZHLU 3SU6A 1YF4A 1GI7B 4B73A 5E2PA 1JRTA 1P03A 4NIVA 4IN1A 1ESTA 1TABE 1W3CA 2AEIH 1H9LB 2Q1JA 3QWCH 4H42U 1GCTC 1V3XA 3SGQE 1GI6A 1O3GA 2FOHA 3RMOH 2SFAA 3ZZDA 3BTEE 4AFZA 4ZUHA 3S9CA 4NSVA 1GL0E 1V2MT 1TMUH 4NWLA 3GY3A 2P3UB 1SQAA 1EAUA 3HK3B 2QY0B 1P2OA 2QXIA 4WWYA 2OBQA 4KTSA 4FU8A 1ZOMA 1QL7A 3VB4A 2ZCLP 1PPGE 4AYVB 3RM0H 4IC5A 3ZZ5A 1UTPA 1WQVH 3RXIA 2CHAC 2PKSB 4BAQB 1K1JA 2BDBA 4HFPB 1WTHD 3AAVA 4D9RA 1C5NH 3ZYEA 1VJ9U 1ESAA 5GPIB 1PQ8A 1MQ5A 3EDXB 2Q6GA 1FNIA 5ESTE 6CHAB 2C8ZB 3CS7A 2GV7A 1VCPA 3MO9A 3DHKH 1HJAB 1EATA 1FPCH 2YNBA 5AVDA 1N8OC 4CRFA 3SNEA 1W0YH 4TPYA 4FVDA 2FLRH 1W8BH 2YOLA 3I77A 4ZXXH 1EP6A 4RN6A 2BOKA 1ACBE 3EGKH 3ITIA 3P70B 5C3NA 3E0PB 3K9XB 1MQ6A 2NU4E 4ISIH 3GY5A 2STBE 4BAKB 1FAKH 1BTZA 4M7GA 8ESTE 3ZVEA 1TMTH 1BRUP 4MVNA 5CHAB 1BRCE 1PQ5A 3A7XA 5DKMA 1MKWK 1P0SH 2FP7B 1Z8JB 1O39A 3AAUA 3GY6A 1HAXB 1CVWH 1GHXH 3EA9A 2GCTC 5F8XA 2P93A 1ABJH 4GHQA 2FWWA 1G30B 2C8XB 1UK2A 1BUIA 3ZZ9A 3SI4H 1D6RA 3M36A 1LVYA 1P2KA 3UQOA 3UNQA 1G32B 3TJUA 3OY5U 2VGCC 1BMLA 4X6NA 1OWJA 4BXWA 3KQBA 1IAUA 1C2LA 4NZLA 1V2JT 1MTUA 1ZGIA 5DP5A 3GICB 1XKBC 1P57B 1PYTD 2ILNA 4X8TH 1BZXE 2ZO3H 3A7TA 5EU8A 3M61U 1KXBA 1FMGA 1GMHF 1H8IH 3UNRA 4TWWA 3ODDA 3SNAA 1OWEA 3O8CA 1O2YA 4JZEH 5ETXA 2B7DH 4MTBA 3FP6E 1KXDA 2BD7A 1CBWC 3BTTE 2JETB 1ELBA 2ALVA 1TPPA 5EXMA 2UUJB 2BD9A 1E36B 2Z6BD 1A3EH 3RXGA 2ASUB 3TIUA 1HFDA 3BV9B 2BDYA 2SNWA 1GBLA 1ARCA 4K3JA 4O9VA 3D23A 4B2BA 2CMYA 4ABHA 2GCHG 2OD3B 3B23B 2P16A 3D65E 1GGDB 2BY5X 2HPQH 4Y7BA 1CU1A 4JZFH 1BTHH 4R8TB 3ZV9A 1DX5M 5E0JA 1CHGA 4Q7ZA 2GMTC 1QIXB 3M7QA 1RFNA 1ZMLA 1OWDA 1HAOH 1ZTJA 3SHAH 3LGWA 1LQDB 4DCDA 2VH6A 1EPTC 1KTSB 1A46H 1S6HA 4AG2A 1XUKA 3N7OA 2KAIA 2BD3A 1GI8B 2V35A 3FANA 3R3GB 2VU8E 1GBMA 5DPAA 2BVXH 2J95A 1OXGA 2A5IA 1ZPBA 1GHAG 3GYMA 2C8WB 4FU9A 2ZU3A 1TQ7B 5DO4H 1MTNB 3M7TA 3SUGA 4A1VA 4BAOB 2F9OA 1FLEE 1P3CA 4ASHA 1LPZB 1O5AB 5EGMA 3EQ0H 1HLTH 3GCOA 1BHXF 2ODQA 3K6YA 3TGJE 3A82A 4E7RG 4FUFA 1TNHA 1G3EA 1UO6A 1OP0A 1VGCB 3OYPA 4X0WU 3FZDA 2H9HA 3BTGE 2ZGHA 1G9IE 2ZGCA 1TNGA 3S69A 1TQ0B 3PMHB 4WXIA 1ID5H 3HPTB 1MUEB 1DM4B 2CF8H 1UCYH 3ZZBA 4GUXA 2BHGA 3A7ZA 1L4ZA 4LOYH 3KIDU 1SBWA 1C2JA 4JK6A 1YYY1 5L2YH 1MMJN 3BIUH 2A7HA 1C1TA 2Y80A 1DT2A 1O3BA 2FOGA 2FZZA 2ZQ1A 4ESTE 4QT8C 1WYKA 3UY9A 1Y3XA 1ELAA 1C2GA 2O8LA 3SV7A 5CE1A 2PGQB 1K9OE 2F9UA 4Y71A 1KLJH 4OGXA 5DP4A 1SGPE 1IQEA 3WY8A 1TAWA 1ANEA 4NG9H 1G36A 2BDHA 5FPYA 2UWOA 3BTDE 4LZ1H 2ZECA 1QBNA 1O3CA 3E0NB 5FXLA 3UQVA 1A5GH 4Q2KA 1SGEE 2ANKH 3LC3A 3TITA 3RXAA 1AIXH 3SUDA 1X7AC 2QV1A 2BD4A 3QO6A 1HRTH 4UE7H 1TLDA 1MKXH 1XUGA 2ZDLA 1OP2A 5EXNA 3V3MA 1S6FA 3A8AA 2ZHEH 1Z6JH 3QDZB 4Z0KA 1ZSKA 1EPTA 2ZDMA 1BQYA 4IS5A 3FP8E 3BTQE 1SOZA 4GAWA 4AB9A 1XVOA 2ODPA 1P12E 5C1XA 5DP9A 4CRBA 5AF9H 5JBTA 1C2FA 1ORFA 1AY6H 4X6PA 4B1TA 1GI4A 1VITF 2WV5A 1AUTC 1RXPA 2VIDA 1TRNA 2FOFA 3PWCA 3MTYA 1GJ8B 3TJVA 4U01A 2A45B 2ZTYA 1KXAA 3MH7A 1ETRH 1J15A 3HKJB 2XC0A 5SGAE 4CBNA 5CMXH 4X1PU 1MZDA 2P59A 1SLVB 1TALA 2BY7X 3ZZCA 1BBRH 1CA0B 1EB1H 2BLOA 1BRBE 2ANYA 2FOEA 4R0IA 4OS1A 2OLGA 2CXVA 2VIOA 3F9GA 2ZU5A 1Y59T 1YM0A 1C1QA 4YO9A 1YPKH 1LHGH 7LPRA 3AVZA 3JZ1B 1C5WB 3HK6B 2A2QH 2P3TB 2ZDVH 4UONA 3PROA 5L30H 1D6WA 1NRPH 2BQWB 2EI7A 2GGVB 2ZA5A 1FY1A 2BDGA 1DICA 2V6NA 4B75A 4AORA 4GHTA 1KDQA 1S83A 4GVUA 1ZJDA 3VEQB 3BTKE 4D9QA 1F7ZA 2G4TA 4AGKA 1AB9B 1O3IA 4MPUA 1NFUA 4JZ1A 6ESTA 3ZVFA 1Y3VA 3MU0A 3O8RA 1T31A 2CF9H 4INKA 1ZYOA 3VXEH 2H9EH 4X2WA 1AD8H 2F3CE 4KELA 9LPRA 2AGGX 2O8MA 2H6MA 5LGOA 4AN7A 1P2NA 1PYTC 1MD7A 3SU5A 1E37B 1HPGA 1DY9A 3A84A 2GX4A 3PMBB 1AO5A 5F8ZA 4RKOB 3SNCA 1EKBB 4NIXA 1UVUH 2BM2A 2WV4A 1SPJA 3UNSA 1AQ7A 2PTNA 1GG6B 3STJA 3Q77A 3DFJA 3TJNA 4XDEA 1K28D 2ZTZA 2AMPA 1AKSA 1TNJA 3LOXA 1SMFE 2ZZUH 3KEEA 3KQEA 1DOJA 1C4Y2 4AYYB 1CA8B 1O2JA 1UTOA 2OQ5A 1NO9H 2ALPA 4YOJA 1AUJA 2SGFE 1EX3A 3CS0A 3VB6A 2VWMA 2BVSH 2RDLA 3SJ8A 1CSOE 2QXJA 1O5CB 5AFYH 5I25A 1HAYB 4ABGA 3MNXA 1E35B 2B9LA 3U69H 3BG4B 2CGAA 2G5NA 4FUIA 4ISHH 1QB6A 4JCNA 1C4V2 5DP7A 3RMNH 1DS2E 1PPFE 4A92A 2VWLA 1A5IA 2ZHDA 3SN8A 1SGDE 4DG4A 3VFEA 1QL9A 1GI5A 3P6ZB 1SR5C 2ZFSA 3QUMP 3RP2A 1GDUA 1TMBH 2OCVB 3T62A 1C5QA 1UVSH 1XUHA 1GVLA 4D7GA 3BN9A 3IWMA 5GWZA 3RU4D 2A4OA 1UTQA 4X2YA 1NESE 1SB1H 6LPRA 1A1RA 3TLOA 3SV6A 1ESBA 1C5VA 1CHOF 1UTLM 3K6ZA 3BTWE 1V2OT 1SGRE 3ZVCA 2BZ6H 1VR1H 1WQSA 4H6SB 1O2GH 4ABBA 1C4U2 1DVAH 1WCZA 1ELEE 3A8BA 1HJAC 1YLDA 4TWYA 2OQUA 2G00A 4B2CA 1AFQB 1AI8H 3E91A 2XBWA 1NRRH 3MO6A 1NU9A 1HXFH 4X1NU 5JYIA 3T25A 3GY2A 3L33A 2W7UA 2OC1A 3FFGA 1G3BA 1TGNA 4KTUA 1HIAB 1VZQH 1RRKA 1O38A 1KXEA 4BXSA 2QGRA 2PLXA 3ZZ6A 1YP9A 4K1TA 4WMDA 2Z9GA 3A87A 4I8GA 4VGCC 4ABIA 1MBMA 1O2PA 1LMWB 1GHYH 1P2QA 1TBQH 1TB6H 3VGCC 3SZNA 2Z3EA 1NZQH 1O5DH 1MCTA 1O34A 5LPFA 4ZHAA 5HXFA 1O3MA 2QC2A 3A80A 1H9HE 4Y8ZA 1DSUA 5IDKA 3SO3A 1F0TA 1SFQB 4DW2U 2J9NA 3MOCA 4ZROA 1JIMA 3PO1B 8LPRA 1C2IA 4GSOA 1O2RA 1PQ7A 4FU7A 1RGQA 1UMAH 1BTWA 1QBOA 3UWIA 4RKJB 3M3VA 3Q3KA 1QB9A 2JETC 3SW2B 1FY3A 1TX7A 2IN2A 4NIYA 1HAPH 5H4IB 4CHAC 1YCPM 2UUFB 1EAXA 1P9SA 2PSXA 4AGJA 2YNAA 2FYQA 5FBEA 4NA8A 3W95A 1GBBA 1GMDF 2AMDA 1WV7H 2QIQA 5C2ZA 1S81A 3QTVH 1O2SA