2BD8A

Porcine pancreatic elastase complexed with beta-casomorphin-7 and arg-phe at ph 5.0 (50 min soak) and immersed in ph 9 buffer for 30 seconds
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analyses on intermediates in serine protease catalysis
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords beta-casomorphin-7
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bd8A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bd8A01
1EAWA 1LPGB 3SHAH 2EI8A 3KQBA 2XWBI 2VVVA 2ANYA 5EPNA 2BLVA 4AORA 1G30B 1A0JA 2OQ5A 3PB1E 1GMCG 1O5AB 1C5RA 3H7TA 4ABGA 3TITA 1OXGA 2AIQA 4INKA 1PPZA 3RLWH 4I8GA 1TWXB 4CRGA 3B9FH 1O3IA 4BXWA 1L1JA 1GVKB 2PLXA 1BMLA 1DITH 3TK9A 3TLOA 1AVXA 1W10U 3L33A 1Q2WA 1W11U 1ZGIA 2OC0A 4Y0ZE 3KF2A 3P8OA 1WYKA 2ZGCA 3G01A 3BTWE 1ARBA 1W12U 5BPEA 4A1XA 3GY4A 3E3TA 4LK4A 1HAVB 1YPLH 3T5FH 1BDAA 3A81A 3RMNH 1SLUB 3NKKA 3VPKA 1CSOE 2PWXA 1GG6C 5GCHG 4CHAB 1AKSA 2ZHEH 4ZKOU 1YCPM 2Z3DA 3JZ1B 4H4FA 4MPXA 5E8EH 5GWZA 2J2UA 3M61U 1QHRB 4AX9H 1OWDA 1QCPA 2R0LA 3MNCA 9ESTA 4K60A 3SQHE 2ZTXA 1Z8GA 5JBAS 2BYAX 1D6WA 1DICA 1O3GA 2ASUB 5AFZH 1AD8H 1P2JA 3U8OH 5SGAE 2ANKH 1Z6JH 2LNCA 2FIRH 3LGUA 1AWFH 1GBAA 2H5CA 4FUCA 3SV8A 1O2YA 1AUTC 2C93B 4KELA 4A1TA 1BT7A 4KTSA 2SGEE 4DG4A 1MAYA 1SB1H 2XBVA 1L2EA 1JXPA 3RXTA 1SHHB 1LHDH 3BF6H 5PTPA 1WTGH 3FVFB 2C3SA 3RXKA 3ZZ8A 2ZG0H 2P8OB 1FNIA 3MOCA 1DLKB 3TGIE 5LPRA 1E35B 2Y80A 5EQQA 4H6SB 2Z3EA 4JMYA 3E0NB 2Z9JA 1P10A 3RXBA 1NT1A 3BTEE 2PW8H 2P16A 5F03A 1SGIB 2WUCA 1B0FA 4X8VH 1HDTH 2QXGA 2TPIZ 6CHAB 2FEQH 1V2UT 4U01A 1XKAC 1LTOA 4A5TS 1GGDB 3A8DA 3VFEA 1Z8JB 1GI7B 2RA3A 2FPZA 5FPTA 1C2FA 3B23B 2UUKB 2VIWA 4CRDA 2J38A 2RA0A 1KXAA 3UWIA 1TE0A 1O2JA 2PTNA 3I78A 5JBBS 4AFSA 1SFQB 2VVCA 1TNKA 1V2VT 1ID5H 1LQEA 3C27B 1J15A 1T31A 2VWNA 1HYLA 1BUIA 1AQ7A 2ZO3H 3QWCH 3BEIB 2YNBA 3SBKA 2PSXA 3BG4B 1ABJH 1HIAB 4FVBA 2C8ZB 3A7WA 4XSKU 3VGCC 1OKXA 1VR1H 1DUEA 4AG1A 1G32B 1C5MD 4AYYB 1DXWA 4ABJA 4THNH 1WCZA 3F6UH 4O9VA 1CA0B 1D4PB 5LPFA 3BTME 2QF3A 1TBRH 1GBEA 1TNHA 4JZFH 3RU4E 1EPTC 3SJ8A 4BAOB 3LH1A 4DCDA 1UK3A 1TPAE 4MNVA 1DX5M 1HXFH 1K28D 4ZMAH 3RM0H 2CJIA 1UVPA 4LOYH 1O2WA 1AE8H 1P2QA 4Z0KA 1FIZA 1PQAA 2ZU1A 3PMBB 1GJ5H 3MO3A 1C4V2 3QTVH 2UWPA 1C1PA 3PYHA 3SW2B 4CREA 4FUIA 4X1QU 1KY9A 1EB1H 3I77A 2TGDA 2ODPA 2A32A 5T3HA 1W0ZU 1C1TA 1C5NH 1SFIA 3PM3A 1KLIH 2BDIA 4IC5A 5C67A 1AI8H 2BY5X 3SJOA 3RC5A 4WF8A 1ELEE 3LGVA 2ZU5A 4Y6DA 1F0TA 3SNBA 1MTVA 4X6MA 4UFFH 1QL7A 3AW1A 3M37A 3HKJB 1GDQA 2FLRH 4I33A 1VJAU 3M7QA 1BB0B 2VGCB 1XUHA 3VB3A 1UTKA 1MZDA 1G2MA 5C1XA 1XX9A 1ZPCA 2IN2A 4OS6A 2FYRA 4AG2A 1C4U2 1GHYH 1H8DH 1DWDH 1MQ5A 1AO5A 3SN8A 3ZZ6A 1TALA 2H9TH 4UE7H 1HFDA 1C5ZB 4TY6A 1A5HA 2ZFRH 1UTMA 2GCHG 4Y10E 1P09A 5GJ4B 2GZ7A 5CMXH 1O0DH 3H7OA 2XC5A 5EGMA 2YNAA 1LVOA 1VGCB 4KTUA 1GGDC 1K1IA 2K1QA 2XRCA 4SGAE 1BA8B 1P8VC 1O3CA 1IQKA 4WJG2 4JK6A 5AVDA 4IMZA 1UTJA 1EOJA 5TCCA 1CHOF 1UMAH 1MCTA 1FJSA 1G3DA 5GXPA 1YLDA 2XW9A 2V6NA 1K9OE 2Z9GA 4FVDA 3LOXA 1G3EA 1F5RA 3M5MA 2BVRH 3MYWA 1C5VA 3L3TA 2FLBH 1NZQH 3O8RA 3IWMA 3S7KB 6GCHG 4RKJB 4ZROA 4XBBA 5A0BA 2P94A 2ZFFH 5DO4H 1RTLA 3RMLH 1Z8RA 3ZZ9A 4AB9A 3P8FA 4JZEH 1K1OA 1CBWC 2JH6D 1WOFA 1HAVA 4AZ2B 1ZSJA 2G4TA 1DY9A 1L1NA 4IS5A 2BVSH 4YTAA 1V2MT 2UWLA 1IAUA 5AHGH 1C5SA 2Q1JA 3M3TA 3A89A 5L6NH 1MKWK 3FZZA 2PKSC 1SGYE 2G51A 1KYNA 3O8DA 2OCVB 1V2RT 1A0HB 1C5XB 2ANMH 1TB6H 4JCNA 3E0PB 5E2PA 3RXQA 3F68H 4YT7H 4JZIA 4TY7A 1Z1IA 1HJ8A 3E8LA 4R0IA 4MNXA 1HGTH 1SGTA 1PYTC 2I6QA 1P05A 4MG3A 1H9IE 1NM6A 4B2BA 1F92A 4I8KA 5JB9S 1E0FD 1CA0C 2DUCA 1P01A 4MQAA 4NSVA 1A1RA 1AHTH 1TIOA 2Y82A 3Q3YA 5A8XA 1HJ9A 2GX4A 2F83A 1PYTD 1RFNA 2XXLA 1FIWA 2A4QA 2ZU4A 2AFQB 3SI4H 2GD4B 1P04A 1P2OA 1P3CA 1O2NA 2GZ8A 3SO3A 3GY7A 3EDXB 3SV2H 4BAHB 4ASHA 3GY3A 2ZNKH 4BXSA 1SGEE 1U6QA 1GI5A 1MKXK 2QC2A 2B8OH 3ODDA 2XC0A 2ZPRA 4Y0YE 7ESTE 3R3GB 1C5QA 2FOMB 4NIVA 5AF9H 1SBWA 1C1OA 2PUXB 3Q3KA 2R3UA 3QX5H 2PR3A 5DP7A 5GIBA 1MCVA 2W26A 1XUKA 1J9CH 1PPFE 2RG3A 1Q3XA 1DT2A 2VIVA 2OTVA 2Y5GA 2W5EA 1ANCA 2OC8A 2FS8A 2BDAA 1KLJH 5C20A 2A5IA 4I7YH 1GHXH 2GT7A 1AZ8A 3MMGA 2BLQA 4D7FA 2GV7A 3BTTE 3M5NA 4BAQB 1EASA 3PROA 4BAMB 4YT6H 1YPHE 1NFYA 1SLWB 5FBIA 4B73A 1GBCA 1B7XB 1GMDG 1S6HA 2AMPA 2ZU3A 1NTPA 4A7IB 1SVPA 1KXEA 1C2JA 1BBRE 1CHOG 1FPCH 1WU1A 3KL6A 3STIA 2Y7XA 2ZI2H 1PPEE 4IMQA 1RTKA 4Y8XA 2P3FH 1UVUH 1BTPA 3SV9A 1BCUH 4LXBH 1CGHA 3TVJB 3FP7E 3M5OA 3SJKA 1QBVH 3UOPA 2NU3E 1AB9C 3NCLA 4B74A 4OGXA 3KN2A 3RUOA 3SNEA 1T32A 1F5LA 5A2MH 1P9SA 4I8JA 1ZRKA 2BD7A 2HGTH 1UVTH 1UK4A 3UREA 3RXOA 2WPIS 1UVOA 3QGNB 4ABAA 4J2YB 1X7AC 2A2QH 4LZ4B 2QCYA 3RXJA 1LVMA 2WINI 5C3NA 4Q7XA 4D9QA 1G37A 1OX1A 1TOCB 2Z6BD 1NFUA 1SGFG 2PKAB 4NA8A 4U30A 4IW4E 4NIYA 1BIOA 2R0KA 1ZJKA 1WTHD 2V0BA 5L2ZH 3TGKE 1QA7A 1BRCE 1IQHA 3GYMA 5C1UA 1NU9A 3NPSA 2BM2A 1TX6A 1RRKA 1WBGB 2D8WA 2AH4X 4BTIB 2VH0A 1JMOH 2J9NA 2W3IA 4X1SU 1GBLA 1MH0A 2AS9A 1TLDA 1GMHG 1AIXH 1LHGH 1EX3A 4YOGA 5FBEA 4ZHLU 4HZHA 3GY5A 4K2YA 1BHXB 2Z7FE 2VU8E 4HI3A 1VITF 1DFPA 2CHAB 2FI5E 1EJAA 4GCHG 5H4IB 3KEEA 4SGBE 2G00A 2H2ZA 1BTYA 4IC6A 4H42U 3U8RH 5ABWA 2BD4A 1GJDB 2R9PA 2ZZUH 1SPJA 2QGRA 2XBWA 2NWNA 3GCTG 1UVSH 4YO9A 2G8TA 1P12E 1HAIH 2PGQB 1GJ9B 3QN7A 4XBCA 2HALA 8KME2 1O33A 4B75A 2OLGA 2CHAC 3ZVCA 3KCGH 1QURH 4Y11E 3A7YA 1C4Y2 3D62A 3CS0A 2W3KA 2P59A 1O5BB 2XCNA 1Z71A 4R8TB 2ANWA 1LDTT 3TK5A 1E36B 1TX7A 2FP7B 1C1WH 1HJAC 1GI9B 1SGDE 4NSYA 1V2QT 1QBOA 2WPLS 1N6YA 1YC0A 2IJOB 1DE7H 1O2LA 3UUZA 1DSTA 4AGKA 1MBMA 1TQ7B 2AMQA 1G9IE 2FO9A 1T4UH 4K3JA 5FX6A 5E0JA 1K1NA 1O5CB 2B9LA 2O8UA 4B1TA 1XKBC 7GCHF 4X1RU 2Y7ZA 3MI4A 3QTOH 2F9BH 1A5GH 1QL9A 3CP7A 2TGAA 3ATLA 4ZKNU 1KLTA 3RXDA 1V3XA 2Z9LA 3A85A 1LVBA 4DIIH 3DFJA 1GI1A 1LQDB 1ELGA 1OYTH 2ILNA 4X6PA 3RU4T 4HGCA 3V12A 3PWCA 1TA2A 1C1MA 3D65E 2Y81A 1O2RA 3UTUH 2H9EH 3HATH 5B6OA 1VCWA 4WH6A 3BTQE 4ZHMU 3A8BA 1RGQA 2FI3E 3MO9A 2EA3A 3TJUA 2B0FA 1HUTH 3MU4A 5JBCS 1ZMJA 5IYTA 2GP9B 3GY2A 2FDAA 1E37B 1O39A 3EA7A 3S7HB 8GCHF 4JYVH 1Q31A 2FXRA 4ZXXH 4RKOB 1F2SE 1O2XA 1AFQC 1DOJA 2BDCA 5DP9A 2FOBA 5C2ZA 4Y7BA 4OGYA 3RXIA 2WPJS 1AWHB 2ZTYA 4TPYA 2PUQH 3UY9A 2OP9A 5CHAB 2G5VA 3SUEA 3T2NA 1TGCA 2CN0H 3NXPA 3ZV8A 8GCHG 5DP8A 1NFWA 4AFZA 1SGPE 3I29A 3LJOA 3O8CA 1TNGA 1QB9A 2G5NA 1QRXA 1TPOA 2GKVE 3TJOA 4CRCA 1ACBE 1QJ7B 2C8YB 1ZMNA 1NESE 3QZRA 3STJA 3S9CA 1C2KA 1Z7KA 2ZHQH 2UUYA 3NK8A 1DVAH 2ZDNA 4YLQH 1XUGA 3GDVA 1JWTA 1ZR0A 2BZ6H 1O3BA 4DURA 5DPAA 1C1VH 2FESH 1WUNH 2A4OA 2SNVA 2BDBA 1P11E 6ESTA 3ZVAA 2ZCHP 1CHGA 2GV6A 3BTFE 3K2UA 4JZ1A 3TPIZ 1DWEH 1YPKH 4FUEA 2FS9A 4NIWA 1UTLM 2O8MA 1M9UA 2ZA5A 2ZFQH 1GL1A 4I8HA 3OU0A 1TGSZ 1SGCA 1XUJA 1HAYB 5T6DA 5EQRA 3GCOA 5BRRE 1QA0A 3GY8A 6GCHF 5L30H 3N7OA 2BLOA 4U32A 2GDEH 4Y76A 2QXIA 2P3UB 1OP0A 3A80A 3JZ2B 5FPYA 3NZIA 4Q2KA 4BANB 4GPGA 1MU8B 4VGCB 2WV4A 2Q6DA 1XVMA 2OBQA 6LPRA 2NU0E 4TWWA 1FY5A 1LCYA 2VJ1A 1L1GA 1NN6A 1ZYOA 1TRMA 2BY8X 1MU6B 1O2MA 2ZFPH 1MTNC 1UHBA 3AW0A 1ZOMA 3QLPH 3QO6A 2JKHA 2FWWA 3UNRA 1D3QB 3SNDA 3MH7A 3CS7A 1UHBB 2ZIQH 3ZZ5A 5EODA 4X2XA 5TJXA 1O2OA 1SOTA 1KXCA 1F0RA 3SGAE 3RLYH 5EW2H 1A4WH 3M36A 2ZGXH 4UDWH 3NUMA 2FI4E 5T6GA 3F9FA 1EPTA 4FU9A 4LZ1H 2A5KA 3MNSA 3SUFA 1DY8A 1O5FH 4X6NA 1A46H 5EXLA 1GWAA 3UWJH 5E2OA 2CF8H 1K2I1 3A84A 3VB5A 1H8IH 4K8YA 4CH2B 3RXLA 3LC5A 1Y3VA 2Q6GA 2OXSA 1DS2E 4ISLA 1WQSA 1GI3A 3A8CA 2BXUH 4X2YA 4CR9A 7LPRA 3OY5U 3VB6A 4AFQA 3SU6A 2DE8A 3SU2A 2ZDLA 2ZCKP 1K1PA 2UWOA 3GYLB 3MFJA 3GCHB 2F9UA 3W94A 1C5YB 1C2MA 1SR5C 2FODA 3LKWA 1OWHA 4E06H 1ZTJA 1TGBA 3FP8E 1IQLA 1UCYE 2OUAA 4DGJA 3KNXA 1RTFB 5ESTE 1UJ1A 1V2JT 4HTCH 5DG6A 1O5DH 1ZTKA 3PTNA 3TNTA 4ABBA 2P8OC 1QGFA 2BDHA 3MH6A 1O31A 1YM0A 2GVFA 3IG6B 2EI6A 1AB9B 8LPRA 4FUGA 2O8LA 3RXPA 1N8OB 1AE5A 1B5GH 4X0WU 2C90B 1HCGA 1CU1A 1O3PB 1HBTH 4B76A 4AB8A 4XBDA 1GBIA 3P92A 1K1LA 1AUJA 1EP5A 2CXVA 3ELAH 1ANEA 3OYPA 3LU9B 1OS8A 1K22H 2DE9A 1INCA 1SSXA 1A2CH 1ZLRA 2VIPA 4XFQA 2BD8A 3D49H 4YZUA 4NGAH 3VGCB 4INLA 1FDPA 3AAVA 2NU2E 1ANDA 1O37A 3ENSB 1HV7A 3UPEA 4OS4A 2F9OA 2A2XH 1PQ7A 2QY0B 1TBQH 1GMDF 4Q7ZA 1O5EH 3ZV9A 1PPCE 4D76A 7GCHG 4O97A 3EE0B 1FAKH 5ETXA 8ESTE 1TRYA 2QF0A 3SJ9A 2BX3A 1GHBG 2D1JA 3RMMH 3B8JA 4DVAU 1L0ZA 3LPRA 1TABE 1YGCH 2NU1E 1QL8A 1UTOA 1W2KH 3A83A 1NY22 3BTDE 3QDZB 5T6FA 3BG8A 1P2NA 3ATKA 3RXRA 1GBHA 2AERH 3C1KA 3ZVFA 5EG4A 3LH3A 5JBTA 1V2ST 2A7JA 5J4SA 1OP8A 1YPGH 4X1NU 1O3DA 2D2DA 1V2LT 4Q7YA 3BV9B 1YP9A 1GJAB 4WWYA 3A88A 4FU8A 2TBSA 1GJ7B 2ZHWH 3SU4A 5C1YA 2QV1A 4NIXA 2CV3A 1ZMLA 3T26A 2BY6X 3GY6A 3MNXA 1C1NA 1AZZA 2QA9E 4X1PU 1GL0E 3UR6A 1A5IA 1ZGVA 2TGTA 1NU7B 2HPPH 1UTPA 1XXFA 3E90B 3FANA 2O8TA 1A3EH 4WMFA 3MU8A 1O2KA 3MO6A 1XUFA 3ZYEA 3U1IB 1L4ZA 1P0SH 4HFPB 3LGYA 1EAXA 4H6TA 3HPTB 3PMHB 1W7GH 3TJNA 2G81E 1O2GH 2W7SA 1VCQA 4MPWA 4JK5A 3TU7H 1GJ8B 1EXFA 3HKIB 2GGVB 5F8TA 4D7GA 1W0YH 3LT3A 1GVLA 2OQUA 1ZSKA 3FP6E 3RXUA 2AGIX 4CRFA 4YESB 3V3MA 1E34B 1S84A 2TGPZ 2A0QB 1TFXA 2Z9KA 1QJ6B 2BY9X 1IQGA 4UEHH 1GBKA 2HNTE 4FUHA 1W8BH 1GBJA 1C2IA 3LC3A 3UFAA 2G4UA 1EJMA 2XBXA 5FCKA 1RD3B 3EQ0H 2HNTC 1QNJA 4NFEA 4MNWA 1BMMH 4O03A 3Q77A 3HK3B 4WMEA 3VEQB 3A7XA 4ZHAA 3URDA 1THRH 1GBBA 1EQ9A 3PLBA 1O3AA 2FZZA 5A8ZA 1ETSH 4XDEA 1YCPK 4Y79A 3MHWU 1GCTB 3RXCA 1BTXA 1O3NA 2BB4A 1EZUC 5FCRA 1P2KA 2UUFB 2Z9IA 3DD2H 1GJ4H 2PV9B 3BG4C 1TGTA 5HGGA 4X8SH 1ABIH 2R2WU 1MBQA 1V2WT 2ZDKA 1ZHMA 3RXVA 1C1UH 4NCYA 4ISOA 2ODYB 3VXEH 2IOTA 4AN7A 2ZC9H 2FOEA 1BMAA 3PV4A 1W7XH 3P95A 1O3MA 2VNTA 5GPIB 3BEUA 1AVWA 2SGAA 1EZSC 3M35A 1QJ1B 2I6SA 3ZYDA 1F0UA 1BJUA 1QQUA 1UCYH 4FUFA 1ETTH 3QK1A 1OWIA 2SGPE 1ELFA 2C8XB 4NA7A 5EQSA 1QR3E 1ZZZA 1TPPA 1UTQA 4A1VA 2Y6TA 3VB7A 3RC4A 3MU5A 3SUGA 2FYQA 2F91A 1S5SA 2QXJA 1C5TA 1XMNB 3DFLA 1XXDA 4AYVB 3LGTA 1LKBA 4INHA 2P95A 1NFXA 3KIDU 1CT0E 2VH6A 2Z94A 2SGFE 3SOSA 3LGWA 2F9NA 2VIQA 4KP0A 3ZZ4A 1LKAA 4J1YA 1PPGE 1T8OA 1OWKA 1QY6A 2H9HA 1MTNB 1GDNA 2A4GA 2ZECA 1K1JA 2TIOA 2GZ9A 2BD2A 1H4WA 3HK6B 5DKMA 1SLXB 3ZVEA 3T62A 1P03A 1Z1JA 4MVNA 5GDSH 2FX6A 3EA8A 1GMCF 5JDUB 3ZZBA 3VXFH 1AGJA 3KQDA 3MU1A 1GMHF 2FMJA 4M7GA 1MTSA 3RDZA 1RJXB 5E0HA 3ZZAA 1SOZA 4GHTA 1IQNA 4RN6A 4BTUB 1MTUA 2HRVA 1FN6A 1SMFE 5DP3A 1SQOA 1F7ZA 1GG6B 4Y8YA 5C5OA 2A31A 1KXBA 1SLVB 1AU8A 2GTBA 1QFKH 3SNCA 6CHAC 1O2HA 2B7DH 1N6XA 4NZQA 2V35A 1JIMA 1H9LB 3ATIA 1YPHC 1MKXH 2IPHA 1NO9H 3RXMA 3RP2A 1HIAA 4YLUA 1HAOH 1ELCA 1GHVH 3RXAA 5EXNA 1YKTA 1HAGE 2J92A 2GMTC 1C9TA 2AYWA 3BIUH 3A7VA 1EAUA 4D9RA 1TOMH 1VGCC 4WH8A 2BX4A 1ZTLA 3SI3H 3GCHC 2VIDA 3U69H 4NWLA 1TNJA 3SJIA 3V13A 4CH8B 1O2VA 1C2DA 5JYIA 2F3CE 2GDDA 1DANH 4TWYA 2PFEA 1MMJN 1T8LA 1HAZB 1C1QA 2GMTB 2Q6FA 1RIWC 2WUBA 1S85A 4JYTA 1AFQB 1EAIA 2BOKA 1AY6H 1YPMH 3H5CB 2ALPA 1A7SA 1TMTH 3PMAB 5JPMH 2J94A 1BBRH 2FM2A 4ABDA 3UQOA 1QRWA 4ZXYH 5FX5A 1IQJA 1O3FA 3PLPA 1MUEB 1O38A 3ZZ7A 1CVWH 1FN8A 4DOQA 4X2WA 3BSQA 2BD3A 2SGQE 2XWAA 1Y3WA 1GHWH 3F9HA 2SNWA 2AGGX 2Y5HA 1C2GA 4GHQA 3SU3A 3BTKE 1BITA 4AGJA 3SORA 2FOCA 3K9XB 2FTMA 3ATMA 4OS7A 2PKSB 1HPGA 3A82A 1KDQB 1V2PT 3SHCH 1O2SA 2BLWA 1QB6A 2FX4A 1FAXA 3RXEA 1AVGH 5J4QA 1FMGA 1MD7A 1ZPBA 4CBOA 1GPZA 1ARCA 1CBWB 2BOHB 1P06A 1T8NA 1AFEH 4ZKRU 1O3EA 2BZAA 4Y8ZA 2V3HH 2XYAA 5DP6A 1J8AA 5EXMA 2J34A 2BDGA 4A6LA 2W7UA 3EYDA 2BXTH 4KKDA 1FV9A 1S81A 2VGCC 3TH3H 4MDSA 3SGBE 4BOHA 1JIRA 1VZQH 4JZDH 3DHKH 4ABFA 2CMYA 3EGKH 1GDUA 2FOFA 3MWIU 4WY3A 3RXFA 3E91A 4I8LA 1GBMA 1K1MA 2HOBA 1NRRH 2BY7X 4O3UA 3A7ZA 1YLCA 4K69A 3W95A 1CT2E 3LONA 1ZPZA 3M3VA 1GCDA 3RM2H 3OY6U 2A45B 7KMEH 1IOEA 1EPTB 1YYY1 2ZGBH 1AKSB 3TJVA 4A92A 3UR9A 3K6ZA 1GHAF 2ZTZA 1SGFA 1XVOA 2XBYA 3BEFB 1QQ4A 1TGNA 4TPIZ 1ETRH 3QZQA 2FOHA 3ZZ3A 3GDSA 1PPBH 3S9AA 1DWCH 2JH5D 3BIVH 1HNEE 1ELAA 1DM4B 4DIHH 1S0QA 4F4OC 3KGPA 2WYJA 2VWMA 4WVPE 1ELBA 1GHBF 3TNSA 1FI8A 3OSYA 3QUMP 5HXFA 2WYGA 1Y5UT 1HXEH 1EB2A 1WV7H 1TMUH 2F9VA 3ZZDA 4UONA 2H6MA 3ODFA 2C4FH 1O3OA 1RS0A 2EI7A 3E1XB 4B2CA 1RIWB 5EOKA 1DPOA 2ZDAH 1LHEH 1C5WB 2PTCE 4IN1A 3ZZCA 1Y8TA 2XNIA 5A09A 4UFDH 2ZP0H 3BTHE 2HVXA 4CBNA 1ESTA 1NS3A 3F9GA 2A7CA 1PPHE 5K0HA 4UFEH 5GCHF 3GCNA 3FFGA 1VJ9U 2ZFSA 1CGIE 4FUDA 4UD9H 1O3JA 5F8ZA 1QIXB 2Z3CA 1O2TA 3KHVA 3Q00A 4NZLA 5HM2A 4IGDA 2GT8A 1FLEE 3WY8A 1GCTC 1J17T 1JOUB 2VVUA 4FU7A 1A3BH 1CA8B 4CRBA 1Y5AT 2ZWLH 3ITIA 3RXHA 1HRTH 4QT8C 1VCPA 3V0XA 4ESTE 3S9BA 2BQ7B 3AVZA 4KTCA 1YPJH 5CE1A 4MNYA 1C2LA 2VB0A 2GCTC 2WPHS 1TNLA 1TAWA 3U8TH 1KDQA 1GI4A 3DUXH 2QYIA 3SNAA 2ZGHA 2A5AA 3PTBA 2CGAA 1DDJA 1C2EA 3RC6A 1G36A 4E7NA 1TONA 5IDKA 1Y3YA 1SQTA 1NC6A 5DP4A 3UIRA 1ZRBA 5LGOA 1V2NT 3BN9A 2BD9A 1NPMA 5I25A 3ZVGA 5EW1H 2AEIH 4B71A 1FUJA 1D9IA 3DT0H 1ELVA 3LDXH 4GCHF 1L4DA 3DA9B 2C8WB 1VITG 3U98H 5F8XA 2M5TA 3ATWA 3HGPA 1FPHH 4WMDA 2ZQ1A 4WXVA 4NG9H 3LIWA 4Z6AH 1BTWA 2F9PA 2G55A 3AASA 1KXFA 2ZDVH 1BTHH 1O2PA 4BNRA 3MTYA 4BTTB 2QAAA 2WV5A 3SUDA 1F0SA 1D3TB 2G52A 4ZAEA 5ESBA 1O2QA 3TH2H 1O32A 1P2IA 1SG8B 4FUJA 4MLFB 3V7TA 4BAKB 2EEKA 2O9QA 1IHTH 3UNSA 2NU4E 1EATA 3MU0A 1MAXA 1Y3UA 1Y5BT 2ZDMA 5L2YH 1P02A 1TPSA 2ALVA 2TRMA 4YOJA 4MTBA 2B5TB 1AMHA 1BQYA 2ESTE 2H1UA 1OPHB 4I32A 1DLEA 3Q76A 4Q80A 1OWEA 2OD3B 5A0AE 1V2KT 5C5NA 1IQEA 2BQ6B 1FQ3A 4GUXA 1CT4E 2ZGJA 1SGRE 1LO6A 1NRPH 1GI6A 1E38B 1EZQA 4X8UH 4TYDA 4Y7AA 4ABHA 3EAJA 3PMJA 2OBOA 2V3OH 1O35A 2YOLA 4YOIA 1F5KU 2BMGB 1C5UA 1Y59T 5HM9A 2QXHA 2FTLE 1Z6EA 5TCAA 3URCA 3M3SA 1WAYB 4DT7B 1P9UA 4CR5A 1JBUH 5EU8A 4CRAA 3SU5A 5G4BA 1NRSH 1S82A 1ANBA 1W14U 4UFGH 1OSSA 1J16A 2FOAA 4IN2A 1B0EA 4IBLH 3T28A 1NROH 1BBRK 3LGIA 4FXGH 1OOKB 2VWLA 3PO1B 5DGJA 5CHAC 2JETC 2WPKS 1O2UA 3PLKA 2BVXH 1GI8B 3CENA 1FONA 3S69A 4AOQA 5AFYH 3SGQE 3GOVB 2ZEBA 2PSYA 1O2ZA 2BDYA 4X8TH 1W13U 4ZKSU 2D26C 3MH4A 3GDUA 1GBDA 1KTTB 1KIGH 4K1TA 1THSH 1TRNA 1OYQA 1SI5H 4E7RG 2XCFA 1GHAG 1O3HA 3OX7U 1UTNA 3R0FA 5JB8S 2R3YA 2XC4A 2ZFTA 1GBTA 1GHZA 2ODQA 3LJJA 2QN5T 1BHXF 2A1DB 1BRAA 2H5DA 4U2WA 1C1RA 1FY4A 2BTCE 2J95A 5FPSA 5FXLA 3S0NA 1NRQH 1C5OH 1MZAA 1O3KA 1O2IA 3UOUA 1D3DB 3E6PH 1D6RA 3AAUA 3ZVDA 1RXPA 3MH5A 1C1SA 3TH4H 1THPB 1MTWA 1AN1E 1XUIA 1IQIA 1ZSLA 3GISB 1GBFA 4D8NA 1P3EA 2HPQH 3P70B 1QRZA 3QGJA 1TMBH 4DW2U 3RXGA 4NWKA 5HYOA 1V6DA 4K5ZA 4NA9H 5I46H 2VINA 2AIPA 3K65B 1T8MA 1BOQA 5FHTA 4DY7B 2OC7A 1H1BA 2ULLA 3E16B 4XE4A 3OTJE 1LPZB 1TNIA 2AMDA 3KQCA 1H9HE 1EUFA 1LHFH 1ELTA 4ZUHA 3Q3XA 1CQQA 4OS2A 1DXPA 3UQVA 3SU0A 4OS5A 1MD8A 5DP5A 5HMAA 3TIUA 2P93A 1G3CA 5K7RA 5DK1A 3A86A 1HAHH 2LPRA 4ISHH 1CO7E 1O5GH 4YM9A 1NRNH 1GJ6A 1OP2A 1FY1A 4XOJA 2OINA 1YCPH 2A7HA 1DUAA 3U9AH 3TK6A 2SGDE 1BMNH 4F49A 1IQFA 1YF4A 1HB0B 2SFAA 1T4VH 1CGJE 1C5LH 4GSOA 3TGJE 1ESBA 4MPVA 3A7TA 3EA9A 1T7CA 1WQVH 5E0GA 3ZVBA 1A0LA 2ZPQA 1LPKB 1PQ8A 3U1JB 1Y3XA 2J4IA 4Y71A 2FOGA 1CE5A 2ZHFH 4VGCC 1D3PB 2VWOA 3VB4A 1BRBE 3GICB 3T29A 4O3TA 2PKAA 4PROA 4K1EA 1K21H 1UCYK 3FZDA 2GCHF 2HLCA 1LHCH 4ISIH 3A8AA 3ESTA 2ZPSA 3SU1A 1N1LA 4GAWA 3M7TA 2RCEA 3NWUA 4K1SA 1UO6A 1GI2A 2JH0D 2HNTF 1SQAA 2BHGA 1GI0A 2BQWB 1Z8IB 2PHBA 3P8GA 3PO1C 1V2OT 2ZCLP 1ORFA 2ZHDA 2KAIA 1MQ6A 2UUJB 1HLTH 1PQ5A 1W3CA 1GJBB 3M5LA 3PWBA 3F9EA 1HJAB 1IHSH 1O34A 3KQEA 1LVYA 3FAOA 1ZHPA 2WPMS 5F6MA 1WSSH 3SV6A 4GVUA 1QB1A 1S83A 3T25A 1ZJDA 4DJZB 4CHAC 3P6ZB 1MKWH 2JETB 1YBWA 1UK2A 1VITH 2VIOA 1BTZA 1DSUA 1S6FA 1SGQE 2Y5FA 2THFB 1TX8A 2P3TB 4MPUA 3D23A 1BRUP 2ZKSA 4ABIA 1P57B 1J14A 1C2HA 1OWJA 5A8YA 1C5PA 1SC8U 4JYUH 3T27A 1HAPH 3P17H 1ELDE 3K6YA 1V2TT 1BZXE 1KSNA 4NFFA 1TBZH 2A4RA 3SZNA 2BD5A 1FY3A 1FZZA 2KAIB 3HGNA 3RMOH 1JRSA 3RXSA 2AGEX 1TA6A 1ZHRA 2ZF0H 1BTUA 5EPYA 2QIQA 1QTFA 3MNBA 1GVZA 1FXYA 1HAXB 1TQ0B 1FY8E 3RU4D 1P2MA 3SV7A 5DJ7A 3GCTF 1GJCB 1KTSB 1N8OC 5LH8A 1SGNE 1PJPA 3SQEE 1O36A 1EOLA 3IITA 2STAE 2XTTB 1LMWB 4WXIA 3A87A 2R2MB 1XM1A 4AFUA 2ZQ2A 1A61H 1EJNA 2ZU2A 3L6PA 3M7UA 4B2AA 3O8BA 4RSPA 4X6OA 9LPRA 4OS1A 4FUBA 5A0CA 4E05H 4GLYA 1BJVA 2GCTB 4I31A 1G2LA 5LPEA 4KGAA 4ZH8A 3UNQA 1QBNA 1JRTA 2O8WA 1EZXC 1EKBB 2EC9H 1PFXC 2CF9H 1IQMA 1O3LA 1EP6A 4K8BA 1C9PA 3F1SB 2PGBB 1SHYA 1O30A 5FAHA 3P8NA 1DWBH 4ISNA 2HWLB 4X2VA 1S0RA 4ABEA 2RDLA 1KXDA 3BTGE 2OC1A 1YPEH 1TYNA 1G3BA 1ESAA 1SL3A 2STBE
chains in the Genus database with same CATH superfamily
1EAWA 1LPGB 3SHAH 2EI8A 3KQBA 2XWBI 2VVVA 2ANYA 5EPNA 2BLVA 4AORA 1G30B 1A0JA 2OQ5A 3PB1E 1GMCG 1O5AB 1C5RA 3H7TA 4ABGA 3TITA 1OXGA 2AIQA 4INKA 1PPZA 3NRLA 4I8GA 3RLWH 1TWXB 4CRGA 3B9FH 3W1EA 1O3IA 4BXWA 1L1JA 1GVKB 2PLXA 1BMLA 1DITH 3TK9A 3TLOA 1AVXA 1W10U 3L33A 1Q2WA 1W11U 1ZGIA 2JIZD 2OC0A 4Y0ZE 3KF2A 3P8OA 1WYKA 2ZGCA 3G01A 3BTWE 1ARBA 1W12U 5BPEA 4A1XA 3GY4A 3E3TA 4LK4A 1HAVB 1YPLH 3T5FH 1BDAA 3A81A 1OHHD 3RMNH 1SLUB 3NKKA 3VPKA 5KEDA 1CSOE 2L6OA 2PWXA 1GG6C 5GCHG 4CHAB 1AKSA 2ZHEH 4ZKOU 1YCPM 2Z3DA 3JZ1B 4H4FA 4MPXA 5E8EH 5GWZA 2J2UA 1NBMD 3M61U 1QHRB 4AX9H 1OWDA 1QCPA 2R0LA 3MNCA 9ESTA 4K60A 3SQHE 2ZTXA 1Z8GA 5JBAS 2BYAX 1D6WA 1DICA 1O3GA 2ASUB 3EE7A 5AFZH 1AD8H 1P2JA 2J97A 3U8OH 5SGAE 2ANKH 4I86A 1Z6JH 2LNCA 2FIRH 3LGUA 1AWFH 1GBAA 2H5CA 4FUCA 3SV8A 1O2YA 1AUTC 2C93B 4KELA 4A1TA 1BT7A 4KTSA 2SGEE 4DG4A 1MAYA 1SB1H 2XBVA 5KECA 1L2EA 1JXPA 3RXTA 1SHHB 1LHDH 3BF6H 5PTPA 1WTGH 3FVFB 2C3SA 3RXKA 3ZZ8A 2ZG0H 1W0JD 2P8OB 1FNIA 4B6EA 3MOCA 1DLKB 3TGIE 5LPRA 1E35B 2Y80A 5EQQA 4H6SB 2Z3EA 4JMYA 3E0NB 2Z9JA 1P10A 3RXBA 1NT1A 3BTEE 2PW8H 2P16A 5F03A 1SGIB 2WUCA 1B0FA 4X8VH 1HDTH 2QXGA 5FL7D 2J98B 2TPIZ 6CHAB 2FEQH 1V2UT 4U01A 1XKAC 1S6LA 1LTOA 4A5TS 1GGDB 3A8DA 3VFEA 1Z8JB 1GI7B 2RA3A 2FPZA 5FPTA 1C2FA 3B23B 2UUKB 2VIWA 4CRDA 2J38A 2RA0A 1KXAA 3UWIA 1TE0A 1O2JA 2PTNA 3I78A 5JBBS 4AFSA 1SFQB 2VVCA 1TNKA 1V2VT 1ID5H 1LQEA 3C27B 1J15A 1T31A 2YMSD 2VWNA 1HYLA 1BUIA 1AQ7A 2ZO3H 3QWCH 3BEIB 2YNBA 3SBKA 2PSXA 3BG4B 1ABJH 1HIAB 4FVBA 2C8ZB 3A7WA 4XSKU 3VGCC 1OKXA 1VR1H 1DUEA 4AG1A 1G32B 1C5MD 4AYYB 5GNDA 4ABJA 1DXWA 4THNH 1WCZA 2K0QA 3F6UH 4O9VA 1CA0B 1D4PB 5LPFA 3BTME 3WWFA 2QF3A 3FO8D 1TBRH 1GBEA 1TNHA 4JZFH 3RU4E 1EPTC 3SJ8A 4BAOB 3LH1A 4DCDA 1UK3A 1TPAE 4MNVA 1DX5M 1HXFH 1K28D 1VKYA 4ZMAH 3RM0H 2CJIA 1UVPA 4LOYH 1O2WA 1AE8H 1P2QA 4Z0KA 1FIZA 1PQAA 2ZU1A 3PMBB 5EJ1A 1GJ5H 3MO3A 1C4V2 3QTVH 1MABB 2UWPA 1C1PA 3PYHA 4XRNA 3SW2B 3F0OA 4CREA 4FUIA 4X1QU 1K0HA 3DCLA 1KY9A 3KQ5A 1EB1H 3I77A 2TGDA 2ODPA 2A32A 5T3HA 1W0ZU 1C1TA 1C5NH 1SFIA 3PM3A 1KLIH 2BDIA 4IC5A 5C67A 1AI8H 2BY5X 3SJOA 3RC5A 4WF8A 1ELEE 3LGVA 2ZU5A 4Y6DA 1F0TA 3SNBA 1MTVA 4X6MA 4UFFH 1QL7A 2HLDD 3AW1A 3M37A 3HKJB 1GDQA 2FLRH 4I33A 1VJAU 3M7QA 1BB0B 1XUHA 2VGCB 3VB3A 1UTKA 1MZDA 1G2MA 5C1XA 1XX9A 1ZPCA 2IN2A 3FN8A 4OS6A 2FYRA 4AG2A 1C4U2 1GHYH 1H8DH 1DWDH 1MQ5A 1AO5A 3SN8A 3ZZ6A 1TALA 2H9TH 4UE7H 1HFDA 1C5ZB 4TY6A 1A5HA 2ZFRH 1UTMA 2GCHG 4Y10E 1P09A 5GJ4B 2GZ7A 5CMXH 1O0DH 3H7OA 2XC5A 5EGMA 5CDFE 2YNAA 1LVOA 1VGCB 4KTUA 2L74A 1GGDC 1K1IA 2K1QA 2WZQA 2XRCA 4SGAE 1BA8B 1P8VC 1O3CA 1IQKA 4WJG2 4JK6A 5AVDA 4IMZA 1UTJA 1EOJA 5TCCA 1CHOF 1UMAH 1MCTA 1FJSA 1G3DA 5GXPA 1YLDA 2XW9A 3FKSD 2V6NA 1K9OE 2Z9GA 4FVDA 3LOXA 1G3EA 1F5RA 3M5MA 2BVRH 3MYWA 1C5VA 3L3TA 2FLBH 1NZQH 3O8RA 3IWMA 3S7KB 6GCHG 4RKJB 4ZROA 4XBBA 1YWUA 5A0BA 2P94A 2ZFFH 5DO4H 1RTLA 3RMLH 1Z8RA 3ZZ9A 4AB9A 3P8FA 4JZEH 1K1OA 1CBWC 2VBCA 2JH6D 1WOFA 1HAVA 4AZ2B 4ZCNA 1ZSJA 2G4TA 4DT4A 1DY9A 1L1NA 4IS5A 2BVSH 4YTAA 1V2MT 2UWLA 1IAUA 5AHGH 1C5SA 2Q1JA 3M3TA 3A89A 5L6NH 1MKWK 3FZZA 2PKSC 1SGYE 2G51A 1KYNA 3O8DA 2OCVB 1V2RT 1A0HB 1C5XB 2ANMH 1TB6H 4JCNA 3E0PB 5E2PA 3RXQA 3F68H 4YT7H 4JZIA 4TY7A 1Z1IA 1HJ8A 3E8LA 4R0IA 4MNXA 1HGTH 1SGTA 1PYTC 2I6QA 1P05A 4MG3A 1H9IE 1NM6A 4B2BA 1F92A 4I8KA 5JB9S 1E0FD 1CA0C 2DUCA 1P01A 4MQAA 4NSVA 1A1RA 1AHTH 1TIOA 2Y82A 3Q3YA 5A8XA 1HJ9A 2GX4A 1UW7A 2F83A 1PYTD 1RFNA 2XXLA 1FIWA 2A4QA 2ZU4A 2AFQB 3SI4H 2GD4B 1P04A 1P2OA 1P3CA 5EJLA 5C0TA 1O2NA 2GZ8A 3SO3A 3GY7A 3DSPA 3EDXB 3SV2H 4BAHB 4ASHA 3GY3A 2ZNKH 3PRBA 4BXSA 1SGEE 1U6QA 1GI5A 1MKXK 2QC2A 2B8OH 3ODDA 2XC0A 2ZPRA 4Y0YE 7ESTE 3R3GB 1C5QA 2FOMB 4NIVA 5AF9H 2RFKC 1SBWA 1C1OA 2PUXB 3Q3KA 2R3UA 3QX5H 2PR3A 5DP7A 5GIBA 1MCVA 2W26A 1XUKA 1J9CH 1PPFE 2RG3A 1Q3XA 1DT2A 2QE7D 2VIVA 2OTVA 2Y5GA 2W5EA 1ANCA 2OC8A 2FS8A 2BDAA 1KLJH 5C20A 2A5IA 4I7YH 1GHXH 2GT7A 1AZ8A 3MMGA 2BLQA 4D7FA 2GV7A 3BTTE 3M5NA 4BAQB 1EASA 3PROA 4BAMB 4OM9A 4YT6H 1YPHE 1NFYA 1SLWB 5FBIA 4B73A 1GBCA 1B7XB 1GMDG 1S6HA 2AMPA 2ZU3A 1NTPA 4A7IB 1SVPA 1KXEA 1C2JA 1BBRE 1CHOG 1FPCH 1WU1A 3KL6A 3STIA 2Y7XA 2ZI2H 1PPEE 4IMQA 2KR7A 1RTKA 4Y8XA 2P3FH 1UVUH 1BTPA 3SV9A 1BCUH 4LXBH 1CGHA 3TVJB 3FP7E 3M5OA 3SJKA 1QBVH 3UOPA 2NU3E 1AB9C 3NCLA 4B6FA 4B74A 4OGXA 3KN2A 3RUOA 3SNEA 1T32A 1F5LA 2KCYA 5A2MH 1P9SA 2QF4A 4I8JA 1ZRKA 2BD7A 2HGTH 1UVTH 1UK4A 3UREA 3RXOA 2WPIS 1UVOA 3QGNB 4ABAA 4J2YB 1X7AC 2A2QH 4LZ4B 2QCYA 3RXJA 1LVMA 2WINI 5C3NA 4Q7XA 4D9QA 1G37A 1OX1A 1TOCB 2Z6BD 1NFUA 1SGFG 2PKAB 4NA8A 4U30A 4IW4E 4NIYA 1BIOA 2R0KA 1ZJKA 1WTHD 2V0BA 5L2ZH 3TGKE 1QA7A 1BRCE 2W6JD 1IQHA 3GYMA 5C1UA 1NU9A 3NPSA 2BM2A 1TX6A 1RRKA 1WBGB 2D8WA 2AH4X 4BTIB 2VH0A 1JMOH 2J9NA 2W3IA 4X1SU 1GBLA 2AHME 1MH0A 2AS9A 1TLDA 1GMHG 1AIXH 1LHGH 1EX3A 4YOGA 5FBEA 4ZHLU 4HZHA 3GY5A 4K2YA 1BHXB 2Z7FE 2VU8E 4HI3A 2GJGA 1VITF 1DFPA 2CHAB 2FI5E 1EJAA 4GCHG 5H4IB 3KEEA 4SGBE 2G00A 2H2ZA 1BTYA 4IC6A 4H42U 3F2GA 3U8RH 2BD4A 5ABWA 1GJDB 2R9PA 2ZZUH 1SPJA 2QGRA 2XBWA 2NWNA 3GCTG 1UVSH 4YO9A 2G8TA 1P12E 1HAIH 2PGQB 1GJ9B 3QN7A 4XBCA 2HALA 8KME2 1O33A 4B75A 2OLGA 2CHAC 3ZVCA 1YY3A 3KCGH 1QURH 4Y11E 3A7YA 1C4Y2 3D62A 3CS0A 2W3KA 2P59A 1O5BB 2XCNA 1Z71A 4R8TB 2ANWA 1LDTT 3TK5A 1E36B 1TX7A 2FP7B 1C1WH 1HJAC 3OE7D 1GI9B 1SGDE 4NSYA 1V2QT 1QBOA 2WPLS 1N6YA 1YC0A 2IJOB 1DE7H 1O2LA 3UUZA 1DSTA 4AGKA 1MBMA 3U28C 1TQ7B 2AMQA 1G9IE 2FO9A 1T4UH 4K3JA 5FX6A 5E0JA 1K1NA 1O5CB 2B9LA 2O8UA 4B1TA 1XKBC 7GCHF 4X1RU 2Y7ZA 3MI4A 3QTOH 2F9BH 1A5GH 1QL9A 3CP7A 2TGAA 3ATLA 4ZKNU 4FETA 1KLTA 3RXDA 1V3XA 2Z9LA 3A85A 1LVBA 4DIIH 3DFJA 1GI1A 1LQDB 1ELGA 1OYTH 2ILNA 4X6PA 3RU4T 4HGCA 3V12A 3PWCA 1TA2A 1C1MA 3D65E 2Y81A 1O2RA 3UTUH 2H9EH 3HATH 5B6OA 1VCWA 4WH6A 3BTQE 4ZHMU 3A8BA 1RGQA 2FI3E 3MO9A 2EA3A 3TJUA 2B0FA 1HUTH 5C94A 3MU4A 5JBCS 1ZMJA 5IYTA 2GP9B 3GY2A 2FDAA 1E37B 1O39A 3EA7A 3WWBA 3S7HB 8GCHF 4JYVH 4RT0A 1Q31A 2FXRA 4ZXXH 4RKOB 1F2SE 1O2XA 1AFQC 1DOJA 2BDCA 5DP9A 2FOBA 5C2ZA 4Y7BA 4OGYA 3RXIA 2WPJS 1AWHB 2ZTYA 4TPYA 2PUQH 3GS9A 3F2FA 3UY9A 2OP9A 5CHAB 2G5VA 3SUEA 2WHXA 3T2NA 1TGCA 2CN0H 3NXPA 3ZV8A 8GCHG 5DP8A 1NFWA 4AFZA 1SGPE 3I29A 3LJOA 3O8CA 1TNGA 3SZEA 1QB9A 2G5NA 1QRXA 1TPOA 2GKVE 3TJOA 4CRCA 1ACBE 1QJ7B 2C8YB 1ZMNA 1NESE 3QZRA 3STJA 3S9CA 1C2KA 1Z7KA 2ZHQH 2UUYA 3NK8A 1DVAH 2ZDNA 4YLQH 1XUGA 3GDVA 1JWTA 1ZR0A 2BZ6H 3OTPA 1O3BA 4DURA 5DPAA 1C1VH 2FESH 1WUNH 2A4OA 2SNVA 2BDBA 1P11E 6ESTA 3ZVAA 2ZCHP 1CHGA 2GV6A 3BTFE 3K2UA 4JZ1A 3TPIZ 1DWEH 1YPKH 4FUEA 2FS9A 4NIWA 1UTLM 2O8MA 1M9UA 2ZA5A 2ZFQH 1GL1A 4I8HA 3OU0A 1TGSZ 1SGCA 1XUJA 1HAYB 5T6DA 5EQRA 3GCOA 5BRRE 1QA0A 3GY8A 6GCHF 5L30H 3N7OA 2BLOA 4U32A 2GDEH 4Y76A 2QXIA 2P3UB 1OP0A 3A80A 3JZ2B 5FPYA 3NZIA 4Q2KA 4BANB 4GPGA 1MU8B 4VGCB 2WV4A 2Q6DA 1XVMA 2OBQA 6LPRA 2NU0E 4TWWA 1FY5A 1LCYA 2VJ1A 1L1GA 1NN6A 1ZYOA 1TRMA 2BY8X 1MU6B 1O2MA 2ZFPH 1MTNC 1UHBA 3AW0A 1ZOMA 3QLPH 3QO6A 4ASUD 4Q63A 2JKHA 2FWWA 1H8HD 3UNRA 1D3QB 3SNDA 4TT3D 3MH7A 3CS7A 1UHBB 2ZIQH 3ZZ5A 5EODA 4X2XA 5TJXA 1O2OA 1SOTA 1KXCA 1F0RA 3SGAE 3RLYH 5EW2H 1A4WH 3M36A 2ZGXH 4UDWH 3NUMA 2FI4E 5T6GA 3F9FA 1EPTA 4FU9A 4LZ1H 2A5KA 3MNSA 3SUFA 1DY8A 1O5FH 4X6NA 2RDEA 1A46H 5EXLA 1GWAA 3UWJH 5E2OA 2CF8H 1K2I1 3A84A 3VB5A 1H8IH 4K8YA 4CH2B 3RXLA 3LC5A 1Y3VA 2Q6GA 2OXSA 1DS2E 4ISLA 1WQSA 1GI3A 3A8CA 2BXUH 4X2YA 4CR9A 7LPRA 3OY5U 4Q4LA 3VB6A 4AFQA 3SU6A 1E1QD 2DE8A 3SU2A 2ZDLA 2PP6A 2ZCKP 1K1PA 2UWOA 3GYLB 3MFJA 3GCHB 2F9UA 3W94A 1C5YB 1C2MA 1SR5C 2FODA 3LKWA 1OWHA 4E06H 1ZTJA 1TGBA 3FP8E 1IQLA 1UCYE 2OUAA 4DGJA 3KNXA 2LELA 1RTFB 2WV9A 5ESTE 1UJ1A 1V2JT 4HTCH 5DG6A 1O5DH 1ZTKA 3PTNA 3TNTA 4ABBA 2P8OC 1QGFA 1WXRA 2BDHA 3MH6A 1O31A 1YM0A 2GVFA 3IG6B 2EI6A 1AB9B 2LP6A 8LPRA 4FUGA 2O8LA 3RXPA 1N8OB 1AE5A 1B5GH 4X0WU 2C90B 1HCGA 1CU1A 1O3PB 1HBTH 4B76A 4AB8A 4XBDA 1GBIA 3P92A 1K1LA 1AUJA 1EP5A 2CXVA 3ELAH 1ANEA 3OYPA 3LU9B 1OS8A 1K22H 2DE9A 1INCA 1SSXA 1A2CH 1ZLRA 2VIPA 4XFQA 2BD8A 3D49H 4YZUA 4NGAH 3VGCB 4INLA 1FDPA 3AAVA 2NU2E 1ANDA 1O37A 3ENSB 1HV7A 3UPEA 4OS4A 2F9OA 2A2XH 1PQ7A 2QY0B 1TBQH 1GMDF 2XOKD 4Q7ZA 1O5EH 3ZV9A 1PPCE 4D76A 7GCHG 3N7EA 4O97A 3EE0B 1FAKH 5ETXA 8ESTE 1TRYA 2QF0A 3SJ9A 2BX3A 1GHBG 2D1JA 3RMMH 3B8JA 4DVAU 1L0ZA 3LPRA 1TABE 1YGCH 2NU1E 1QL8A 1UTOA 3MQKC 1W2KH 3A83A 1NY22 3BTDE 3ZIAD 3QDZB 5T6FA 3BG8A 1P2NA 3ATKA 3RXRA 1GBHA 2AERH 3C1KA 5HKKD 3ZVFA 5EG4A 2K8IA 3LH3A 5JBTA 1V2ST 2A7JA 3UAIC 5J4SA 1OP8A 1YPGH 4X1NU 1O3DA 2D2DA 1V2LT 4Q7YA 3BV9B 1YP9A 1GJAB 4WWYA 3A88A 3KYGA 4FU8A 2TBSA 1GJ7B 2ZHWH 3SU4A 5C1YA 2QV1A 4NIXA 2CV3A 1ZMLA 3T26A 2BY6X 3GY6A 3MNXA 1C1NA 1AZZA 2QA9E 4X1PU 1GL0E 3UR6A 1A5IA 1ZGVA 2TGTA 1NU7B 2HPPH 1UTPA 1XXFA 3E90B 3FANA 2O8TA 1A3EH 4WMFA 3MU8A 1O2KA 3MO6A 1XUFA 3ZYEA 3U1IB 1L4ZA 1P0SH 4HFPB 3LGYA 1EAXA 4H6TA 3HPTB 3PMHB 1W7GH 4RI0A 3TJNA 2G81E 1O2GH 5CHBA 2W7SA 1VCQA 4MPWA 4JK5A 3TU7H 1GJ8B 1EXFA 3HKIB 2GGVB 1BMFD 5F8TA 4D7GA 1W0YH 3LT3A 1GVLA 2OQUA 1ZSKA 2JJ2D 3FP6E 3RXUA 2AGIX 4CRFA 4YESB 3V3MA 1E34B 1S84A 2TGPZ 2A0QB 1TFXA 2Z9KA 1QJ6B 2BY9X 1IQGA 4UEHH 1GBKA 2HNTE 4FUHA 1W8BH 1GBJA 1C2IA 3LC3A 5C0UA 3UFAA 2G4UA 1EJMA 2XBXA 5FCKA 1RD3B 3EQ0H 2HNTC 1QNJA 3WW7A 4NFEA 4MNWA 1BMMH 4O03A 3Q77A 3HK3B 4WMEA 3VEQB 3A7XA 4ZHAA 3URDA 1THRH 1GBBA 1EQ9A 3PLBA 5B6LA 1O3AA 4HG6A 2FZZA 5A8ZA 1ETSH 4XDEA 1YCPK 2KX4A 4Y79A 3MHWU 1GCTB 3RXCA 1BTXA 1O3NA 2BB4A 1EZUC 5FCRA 1P2KA 5DN6D 2UUFB 2Z9IA 3DD2H 1GJ4H 2PV9B 3BG4C 1TGTA 5HGGA 4X8SH 1ABIH 2R2WU 1MBQA 1V2WT 3PV2A 2ZDKA 1ZHMA 3RXVA 1C1UH 4NCYA 4ISOA 2ODYB 3VXEH 2IOTA 4AN7A 2ZC9H 2FOEA 1BMAA 3PV4A 1W7XH 3P95A 1O3MA 2IPQX 2VNTA 5GPIB 3BEUA 1AVWA 2SGAA 1EZSC 3M35A 1QJ1B 2I6SA 3ZYDA 2KZ4A 1F0UA 1BJUA 1QQUA 1UCYH 4FUFA 1ETTH 3QK1A 2JDID 1OWIA 5HIZA 2SGPE 1ELFA 1NBME 2C8XB 2EY4C 4NA7A 5EQSA 1QR3E 1ZZZA 1TPPA 1UTQA 4A1VA 2Y6TA 3VB7A 3RC4A 3MU5A 3SUGA 2FYQA 2F91A 2IJD1 1S5SA 2W6ID 2QXJA 1C5TA 1XMNB 3DFLA 1XXDA 4AYVB 3LGTA 1LKBA 4INHA 2P95A 1NFXA 3KIDU 1CT0E 2VH6A 2Z94A 2SGFE 3SOSA 3LGWA 2F9NA 2VIQA 4KP0A 3ZZ4A 1LKAA 4J1YA 1PPGE 1T8OA 1OWKA 1QY6A 2H9HA 1MTNB 1GDNA 3PV5A 2A4GA 2ZECA 1K1JA 5EIYA 2TIOA 2GZ9A 2BD2A 1H4WA 3HK6B 5DKMA 1SLXB 3ZVEA 3T62A 1P03A 1Z1JA 4MVNA 5GDSH 2FX6A 3EA8A 1GMCF 5JDUB 3ZZBA 3VXFH 1AGJA 3KQDA 3MU1A 1GMHF 2FMJA 4M7GA 1MTSA 3RDZA 1RJXB 5E0HA 3ZZAA 1SOZA 4GHTA 1IQNA 4RN6A 4BTUB 1MTUA 2HRVA 1FN6A 1SMFE 5DP3A 1SQOA 1F7ZA 1GG6B 4Y8YA 5C5OA 2A31A 1KXBA 1SLVB 1AU8A 2GTBA 1QFKH 2M2AA 3SNCA 2KCPA 6CHAC 1O2HA 2B7DH 1N6XA 4NZQA 2V35A 1JIMA 1H9LB 3ATIA 1YPHC 1MKXH 4AC9A 2IPHA 1NO9H 1SKYE 3RXMA 3RP2A 1HIAA 4YLUA 1HAOH 1ELCA 1GHVH 3RXAA 5EXNA 1YKTA 1HAGE 2J92A 2GMTC 1C9TA 2AYWA 3BIUH 5EJZA 3A7VA 1EAUA 4D9RA 1TOMH 1VGCC 4WH8A 2BX4A 1ZTLA 3SI3H 3GCHC 1KMHB 4XD7D 2VIDA 3U69H 4NWLA 1TNJA 3SJIA 3V13A 4F55A 4CH8B 1O2VA 1C2DA 5JYIA 2F3CE 2GDDA 1DANH 4TWYA 2PFEA 1MMJN 1T8LA 1HAZB 1C1QA 2GMTB 2Q6FA 1RIWC 2WUBA 1S85A 4JYTA 1AFQB 1EAIA 2BOKA 1AY6H 1YPMH 3H5CB 2ALPA 1A7SA 1TMTH 3PMAB 5JPMH 2J94A 4M9FA 1BBRH 3N99A 2FM2A 4ABDA 3UQOA 1QRWA 4ZXYH 5FX5A 1IQJA 1O3FA 3PLPA 1MUEB 1O38A 3ZZ7A 1CVWH 1FN8A 4DOQA 4X2WA 3BSQA 2BD3A 2SGQE 2XWAA 1Y3WA 1GHWH 3F9HA 2SNWA 2AGGX 2Y5HA 1C2GA 4GHQA 3SU3A 3BTKE 1BITA 4AGJA 3SORA 2FOCA 3K9XB 2FTMA 3ATMA 4OS7A 2PKSB 1HPGA 3A82A 1KDQB 1V2PT 3SHCH 1O2SA 2BLWA 3UB0A 1QB6A 2FX4A 1FAXA 3CNRA 1AVGH 3RXEA 1FMGA 5J4QA 1MD7A 1ZPBA 4CBOA 1GPZA 1ARCA 1CBWB 2BOHB 1P06A 1T8NA 1AFEH 4ZKRU 1O3EA 2BZAA 4Y8ZA 2V3HH 2XYAA 5DP6A 1J8AA 5EXMA 2J34A 3OFND 2BDGA 4A6LA 2W7UA 3EYDA 2BXTH 4KKDA 1FV9A 1S81A 2VGCC 3TH3H 4MDSA 3SGBE 4BOHA 1JIRA 1VZQH 4JZDH 3DHKH 4ABFA 2CMYA 3EGKH 1GDUA 1EFRD 2FOFA 3MWIU 4WY3A 3RXFA 3E91A 4I8LA 1GBMA 2WSSD 1K1MA 2HOBA 1NRRH 2BY7X 4O3UA 3A7ZA 1YLCA 4K69A 3W95A 1CT2E 3LONA 1ZPZA 3M3VA 1GCDA 3RM2H 3OY6U 2A45B 3VG8A 7KMEH 1IOEA 1EPTB 1YYY1 2ZGBH 1AKSB 3TJVA 4A92A 3UR9A 3K6ZA 1GHAF 2ZTZA 1SGFA 1XVOA 2XBYA 3BEFB 1QQ4A 1TGNA 4TPIZ 1ETRH 3QZQA 2FOHA 3ZZ3A 3GDSA 1PPBH 3S9AA 1DWCH 2JH5D 3BIVH 1HNEE 1ELAA 1DM4B 4DIHH 1S0QA 4F4OC 3KGPA 2WYJA 2VWMA 4WVPE 1ELBA 1GHBF 3TNSA 1FI8A 2QF5A 3OSYA 4ACAA 3QUMP 5HXFA 5KGOA 2WYGA 1Y5UT 1HXEH 1EB2A 1WV7H 1TMUH 2F9VA 3ZZDA 4UONA 2H6MA 3ODFA 2C4FH 1O3OA 1RS0A 2EI7A 2KCAA 3E1XB 4B2CA 1RIWB 5EOKA 1DPOA 2ZDAH 1LHEH 1C5WB 2PTCE 4IN1A 5HIYA 3ZZCA 1Y8TA 2XNIA 5A09A 4UFDH 2ZP0H 3BTHE 2HVXA 5T1VA 4CBNA 1ESTA 1NS3A 3F9GA 2A7CA 1PPHE 5K0HA 4UFEH 5GCHF 3GCNA 3FFGA 1VJ9U 2ZFSA 1CGIE 4FUDA 4UD9H 1O3JA 5F8ZA 1COWD 1QIXB 2Z3CA 1O2TA 3KHVA 3Q00A 4NZLA 5HM2A 2J98A 4IGDA 2GT8A 1FLEE 3WY8A 1GCTC 1J17T 1JOUB 2VVUA 4FU7A 1A3BH 1CA8B 4CRBA 4RT1A 1Y5AT 2ZWLH 3ITIA 3RXHA 1HRTH 4QT8C 1VCPA 3V0XA 4ESTE 3S9BA 2BQ7B 3AVZA 4KTCA 1YPJH 1SQRA 4MNYA 5CE1A 1C2LA 2VB0A 2GCTC 2WPHS 1TNLA 1TAWA 3U8TH 1KDQA 1GI4A 3DUXH 2QYIA 3SNAA 2ZGHA 2A5AA 3PTBA 2CGAA 1DDJA 1C2EA 3RC6A 2J5UA 1G36A 4E7NA 1TONA 5IDKA 1Y3YA 1SQTA 1NC6A 5DP4A 3UIRA 1ZRBA 5LGOA 1V2NT 3BN9A 2BD9A 1NPMA 5I25A 3ZVGA 5EW1H 2AEIH 4B71A 1FUJA 1D9IA 3DT0H 1ELVA 3LDXH 2HVYB 4GCHF 1L4DA 3DA9B 2C8WB 1VITG 3U98H 5F8XA 2M5TA 3ATWA 3HGPA 1FPHH 4WMDA 2ZQ1A 4WXVA 4NG9H 3LIWA 4Z6AH 1BTWA 2F9PA 2G55A 3AASA 3SYJA 4ACBA 1KXFA 2ZDVH 1BTHH 1O2PA 4BNRA 3MTYA 4BTTB 2QAAA 2WV5A 4YXWD 3SUDA 1F0SA 1D3TB 2G52A 4ZAEA 5ESBA 1O2QA 3TH2H 1O32A 1P2IA 1SG8B 4FUJA 4MLFB 3V7TA 4BAKB 2EEKA 2O9QA 1IHTH 3UNSA 2NU4E 2KCOA 1EATA 3MU0A 1MAXA 1Y3UA 1Y5BT 2ZDMA 5L2YH 1P02A 1TPSA 2ALVA 2TRMA 4YOJA 4MTBA 2B5TB 1AMHA 1BQYA 2ESTE 2H1UA 5IK2D 1OPHB 4I32A 1DLEA 3Q76A 4Q80A 1OWEA 2OD3B 5A0AE 1V2KT 5C5NA 2KM0A 1IQEA 2BQ6B 1FQ3A 4GUXA 1CT4E 2ZGJA 1SGRE 1LO6A 1NRPH 3F3BA 1GI6A 1E38B 1EZQA 4X8UH 4TYDA 4Y7AA 4ABHA 3EAJA 3PMJA 2OBOA 2V3OH 1O35A 2YOLA 4YOIA 1F5KU 2BMGB 1C5UA 1Y59T 5HM9A 2QXHA 2FTLE 1Z6EA 5TCAA 3URCA 3M3SA 1WAYB 4DT7B 1P9UA 4CR5A 1JBUH 5EU8A 4CRAA 3SU5A 5G4BA 1NRSH 1S82A 1ANBA 4P02A 1W14U 4UFGH 1OSSA 1J16A 2FOAA 4IN2A 2WPDD 1B0EA 4IBLH 3T28A 1NROH 1BBRK 3LGIA 4FXGH 1OOKB 2VWLA 3PO1B 5DGJA 5CHAC 2JETC 2WPKS 1O2UA 3PLKA 2BVXH 1GI8B 3CENA 1FONA 3S69A 2EQNA 4AOQA 5AFYH 3SGQE 3GOVB 2ZEBA 2PSYA 1O2ZA 1E1RD 2BDYA 4X8TH 1W13U 4ZKSU 2D26C 3MH4A 4TSFD 5DSFA 3GDUA 1GBDA 1KTTB 1KIGH 4K1TA 1THSH 1TRNA 1OYQA 1SI5H 4E7RG 2XCFA 1GHAG 1O3HA 3OX7U 1UTNA 3R0FA 5JB8S 2R3YA 2XC4A 2ZFTA 1GBTA 1GHZA 2ODQA 3LJJA 2YMSC 2QN5T 1BHXF 2A1DB 1BRAA 2H5DA 4U2WA 1C1RA 1FY4A 2BTCE 2J95A 5FPSA 5FXLA 3S0NA 1NRQH 1C5OH 1MZAA 1O3KA 1O2IA 1W0KD 3UOUA 1D3DB 3E6PH 1D6RA 3AAUA 3ZVDA 1RXPA 3MH5A 1C1SA 3TH4H 1THPB 1MTWA 1AN1E 1XUIA 1IQIA 1ZSLA 3GISB 1GBFA 4D8NA 1P3EA 2HPQH 3P70B 1QRZA 3QGJA 1TMBH 3PRDA 4DW2U 3RXGA 4NWKA 5HYOA 1V6DA 2F4LA 4K5ZA 4NA9H 5I46H 2VINA 2AIPA 3K65B 1T8MA 3F0PA 1BOQA 3KYFA 5FHTA 4DY7B 2OC7A 1H1BA 2ULLA 3E16B 4XE4A 3OTJE 1LPZB 1TNIA 2AMDA 3KQCA 1H9HE 1EUFA 1LHFH 1ELTA 4ZUHA 4Z1MD 3Q3XA 1CQQA 4OS2A 1DXPA 3UQVA 3SU0A 4OS5A 1MD8A 5DP5A 5HMAA 1FX0B 3TIUA 2P93A 2OK5A 1G3CA 5K7RA 5DK1A 4F48B 3A86A 1HAHH 2LPRA 4ISHH 1CO7E 1O5GH 4YM9A 4FOUC 1NRNH 1GJ6A 1OP2A 1FY1A 1QZ8A 4XOJA 2OINA 1YCPH 3H09A 2A7HA 1DUAA 3U9AH 3TK6A 2SGDE 1BMNH 4F49A 1IQFA 1YF4A 1HB0B 2SFAA 1T4VH 1CGJE 1C5LH 4GSOA 3TGJE 1ESBA 4MPVA 3A7TA 3EA9A 3OAAD 1T7CA 1WQVH 5E0GA 3ZVBA 1A0LA 2ZPQA 1LPKB 1PQ8A 2JJ1D 3U1JB 1Y3XA 2J4IA 4Y71A 2FOGA 1CE5A 3AK5A 2ZHFH 4VGCC 1D3PB 2VWOA 3VB4A 1BRBE 3GICB 3T29A 4O3TA 2PKAA 4PROA 4K1EA 1K21H 1UCYK 3FZDA 2GCHF 2HLCA 1LHCH 4ISIH 3A8AA 3ESTA 2ZPSA 3SU1A 1N1LA 4GAWA 3M7TA 2RCEA 3NWUA 4K1SA 5C17A 1UO6A 3DSGA 1GI2A 2JH0D 2HNTF 1SQAA 2BHGA 1GI0A 2BQWB 1Z8IB 2PHBA 3P8GA 3PO1C 1H8ED 1V2OT 1ORFA 2ZCLP 2ZHDA 2KAIA 1MQ6A 2UUJB 1HLTH 1PQ5A 1W3CA 1GJBB 3FOAA 3M5LA 3PWBA 3F9EA 1YLNA 1HJAB 1IHSH 1O34A 3KQEA 1LVYA 3FAOA 1ZHPA 2WPMS 5F6MA 1WSSH 3SV6A 4GVUA 1QB1A 1S83A 3T25A 1ZJDA 4P00A 4DJZB 3F2HA 4CHAC 3P6ZB 1MKWH 2JETB 1YBWA 1UK2A 1VITH 2VIOA 1BTZA 1DSUA 1S6FA 1SGQE 2Y5FA 2THFB 1TX8A 2P3TB 4MPUA 3D23A 1BRUP 2ZKSA 4ABIA 1P57B 1J14A 1C2HA 1OWJA 5A8YA 1C5PA 1SC8U 4JYUH 3T27A 1HAPH 3P17H 1ELDE 3K6YA 1V2TT 1BZXE 1KSNA 2F43B 4NFFA 1TBZH 2A4RA 3SZNA 2BD5A 1FY3A 1FZZA 2KAIB 3HGNA 3RMOH 1JRSA 3RXSA 2AGEX 1TA6A 1ZHRA 2ZF0H 5F53A 1BTUA 5EPYA 2QIQA 2V3MA 1QTFA 3MNBA 1GVZA 1FXYA 1HAXB 1E79D 1TQ0B 1FY8E 3RU4D 1P2MA 3SV7A 5DJ7A 3GCTF 1GJCB 1KTSB 1N8OC 2YMSB 5LH8A 1SGNE 1PJPA 3SQEE 1O36A 1EOLA 3IITA 2STAE 2XTTB 1LMWB 4WXIA 3A87A 2R2MB 1XM1A 1WDIA 4AFUA 2ZQ2A 2V7QD 1A61H 2XNDD 1EJNA 2ZU2A 2KFWA 3L6PA 3M7UA 4B2AA 3DSOA 3O8BA 4RSPA 4X6OA 9LPRA 4OS1A 4FUBA 2CK3D 5A0CA 4E05H 4GLYA 1BJVA 2GCTB 4I31A 1G2LA 5LPEA 4KGAA 4ZH8A 3UNQA 1QBNA 1JRTA 2O8WA 1EZXC 3OEED 1EKBB 2EC9H 1PFXC 3N7DA 2CF9H 1IQMA 1O3LA 1EP6A 4K8BA 1C9PA 3F1SB 2PGBB 1SHYA 1O30A 5FAHA 3P8NA 1DWBH 4ISNA 2HWLB 4X2VA 1S0RA 4ABEA 2RDLA 1KXDA 3BTGE 2OC1A 1YPEH 1TYNA 1G3BA 3OEHD 1ESAA 1SL3A 2STBE
chains in the Genus database with same CATH topology
1EAWA 1LPGB 3SHAH 2EI8A 3KQBA 2XWBI 2VVVA 2ANYA 5EPNA 2BLVA 4AORA 1G30B 1A0JA 2OQ5A 3PB1E 1GMCG 1O5AB 1C5RA 3H7TA 4ABGA 3TITA 1OXGA 2AIQA 4INKA 1PPZA 3RLWH 4I8GA 1TWXB 4CRGA 3B9FH 1O3IA 4BXWA 1L1JA 1GVKB 2PLXA 1BMLA 1DITH 3TK9A 3TLOA 1AVXA 1W10U 3L33A 1Q2WA 1W11U 1ZGIA 2OC0A 4Y0ZE 3KF2A 3P8OA 1WYKA 2ZGCA 3G01A 3BTWE 1ARBA 1W12U 5BPEA 4A1XA 3GY4A 3E3TA 4LK4A 1HAVB 1YPLH 3T5FH 1BDAA 3A81A 3RMNH 1SLUB 3NKKA 3VPKA 1CSOE 2PWXA 1GG6C 5GCHG 4CHAB 1AKSA 2ZHEH 4ZKOU 1YCPM 2Z3DA 3JZ1B 4H4FA 4MPXA 5E8EH 5GWZA 2J2UA 3M61U 1QHRB 4AX9H 1OWDA 1QCPA 2R0LA 3MNCA 9ESTA 4K60A 3SQHE 2ZTXA 1Z8GA 5JBAS 2BYAX 1D6WA 1DICA 1O3GA 2ASUB 5AFZH 1AD8H 1P2JA 3U8OH 5SGAE 2ANKH 1Z6JH 2LNCA 2FIRH 3LGUA 1AWFH 1GBAA 2H5CA 4FUCA 3SV8A 1O2YA 1AUTC 2C93B 4KELA 4A1TA 1BT7A 4KTSA 2SGEE 4DG4A 1MAYA 1SB1H 2XBVA 1L2EA 1JXPA 3RXTA 1SHHB 1LHDH 3BF6H 5PTPA 1WTGH 3FVFB 2C3SA 3RXKA 3ZZ8A 2ZG0H 2P8OB 1FNIA 3MOCA 1DLKB 3TGIE 5LPRA 1E35B 2Y80A 5EQQA 4H6SB 2Z3EA 4JMYA 3E0NB 2Z9JA 1P10A 3RXBA 1NT1A 3BTEE 2PW8H 2P16A 5F03A 1SGIB 2WUCA 1B0FA 4X8VH 1HDTH 2QXGA 2TPIZ 6CHAB 2FEQH 1V2UT 4U01A 1XKAC 1LTOA 4A5TS 1GGDB 3A8DA 3VFEA 1Z8JB 1GI7B 2RA3A 2FPZA 5FPTA 1C2FA 3B23B 2UUKB 2VIWA 4CRDA 2J38A 2RA0A 1KXAA 3UWIA 1TE0A 1O2JA 2PTNA 3I78A 5JBBS 4AFSA 1SFQB 2VVCA 1TNKA 1V2VT 1ID5H 1LQEA 3C27B 1J15A 1T31A 2VWNA 1HYLA 1BUIA 1AQ7A 2ZO3H 3QWCH 3BEIB 2YNBA 3SBKA 2PSXA 3BG4B 1ABJH 1HIAB 4FVBA 2C8ZB 3A7WA 4XSKU 3VGCC 1OKXA 1VR1H 1DUEA 4AG1A 1G32B 1C5MD 4AYYB 1DXWA 4ABJA 4THNH 1WCZA 3F6UH 4O9VA 1CA0B 1D4PB 5LPFA 3BTME 2QF3A 1TBRH 1GBEA 1TNHA 4JZFH 3RU4E 1EPTC 3SJ8A 4BAOB 3LH1A 4DCDA 1UK3A 1TPAE 4MNVA 1DX5M 1HXFH 1K28D 4ZMAH 3RM0H 2CJIA 1UVPA 4LOYH 1O2WA 1AE8H 1P2QA 4Z0KA 1FIZA 1PQAA 2ZU1A 3PMBB 1GJ5H 3MO3A 1C4V2 3QTVH 2UWPA 1C1PA 3PYHA 3SW2B 4CREA 4FUIA 4X1QU 1KY9A 1EB1H 3I77A 2TGDA 2ODPA 2A32A 5T3HA 1W0ZU 1C1TA 1C5NH 1SFIA 3PM3A 1KLIH 2BDIA 4IC5A 5C67A 1AI8H 2BY5X 3SJOA 3RC5A 4WF8A 1ELEE 3LGVA 2ZU5A 4Y6DA 1F0TA 3SNBA 1MTVA 4X6MA 4UFFH 1QL7A 3AW1A 3M37A 3HKJB 1GDQA 2FLRH 4I33A 1VJAU 3M7QA 1BB0B 2VGCB 1XUHA 3VB3A 1UTKA 1MZDA 1G2MA 5C1XA 1XX9A 1ZPCA 2IN2A 4OS6A 2FYRA 4AG2A 1C4U2 1GHYH 1H8DH 1DWDH 1MQ5A 1AO5A 3SN8A 3ZZ6A 1TALA 2H9TH 4UE7H 1HFDA 1C5ZB 4TY6A 1A5HA 2ZFRH 1UTMA 2GCHG 4Y10E 1P09A 5GJ4B 2GZ7A 5CMXH 1O0DH 3H7OA 2XC5A 5EGMA 2YNAA 1LVOA 1VGCB 4KTUA 1GGDC 1K1IA 2K1QA 2XRCA 4SGAE 1BA8B 1P8VC 1O3CA 1IQKA 4WJG2 4JK6A 5AVDA 4IMZA 1UTJA 1EOJA 5TCCA 1CHOF 1UMAH 1MCTA 1FJSA 1G3DA 5GXPA 1YLDA 2XW9A 2V6NA 1K9OE 2Z9GA 4FVDA 3LOXA 1G3EA 1F5RA 3M5MA 2BVRH 3MYWA 1C5VA 3L3TA 2FLBH 1NZQH 3O8RA 3IWMA 3S7KB 6GCHG 4RKJB 4ZROA 4XBBA 5A0BA 2P94A 2ZFFH 5DO4H 1RTLA 3RMLH 1Z8RA 3ZZ9A 4AB9A 3P8FA 4JZEH 1K1OA 1CBWC 2JH6D 1WOFA 1HAVA 4AZ2B 1ZSJA 2G4TA 1DY9A 1L1NA 4IS5A 2BVSH 4YTAA 1V2MT 2UWLA 1IAUA 5AHGH 1C5SA 2Q1JA 3M3TA 3A89A 5L6NH 1MKWK 3FZZA 2PKSC 1SGYE 2G51A 1KYNA 3O8DA 2OCVB 1V2RT 1A0HB 1C5XB 2ANMH 1TB6H 4JCNA 3E0PB 5E2PA 3RXQA 3F68H 4YT7H 4JZIA 4TY7A 1Z1IA 1HJ8A 3E8LA 4R0IA 4MNXA 1HGTH 1SGTA 1PYTC 2I6QA 1P05A 4MG3A 1H9IE 1NM6A 4B2BA 1F92A 4I8KA 5JB9S 1E0FD 1CA0C 2DUCA 1P01A 4MQAA 4NSVA 1A1RA 1AHTH 1TIOA 2Y82A 3Q3YA 5A8XA 1HJ9A 2GX4A 2F83A 1PYTD 1RFNA 2XXLA 1FIWA 2A4QA 2ZU4A 2AFQB 3SI4H 2GD4B 1P04A 1P2OA 1P3CA 1O2NA 2GZ8A 3SO3A 3GY7A 3EDXB 3SV2H 4BAHB 4ASHA 3GY3A 2ZNKH 4BXSA 1SGEE 1U6QA 1GI5A 1MKXK 2QC2A 2B8OH 3ODDA 2XC0A 2ZPRA 4Y0YE 7ESTE 3R3GB 1C5QA 2FOMB 4NIVA 5AF9H 1SBWA 1C1OA 2PUXB 3Q3KA 2R3UA 3QX5H 2PR3A 5DP7A 5GIBA 1MCVA 2W26A 1XUKA 1J9CH 1PPFE 2RG3A 1Q3XA 1DT2A 2VIVA 2OTVA 2Y5GA 2W5EA 1ANCA 2OC8A 2FS8A 2BDAA 1KLJH 5C20A 2A5IA 4I7YH 1GHXH 2GT7A 1AZ8A 3MMGA 2BLQA 4D7FA 2GV7A 3BTTE 3M5NA 4BAQB 1EASA 3PROA 4BAMB 4YT6H 1YPHE 1NFYA 1SLWB 5FBIA 4B73A 1GBCA 1B7XB 1GMDG 1S6HA 2AMPA 2ZU3A 1NTPA 4A7IB 1SVPA 1KXEA 1C2JA 1BBRE 1CHOG 1FPCH 1WU1A 3KL6A 3STIA 2Y7XA 2ZI2H 1PPEE 4IMQA 1RTKA 4Y8XA 2P3FH 1UVUH 1BTPA 3SV9A 1BCUH 4LXBH 1CGHA 3TVJB 3FP7E 3M5OA 3SJKA 1QBVH 3UOPA 2NU3E 1AB9C 3NCLA 4B74A 4OGXA 3KN2A 3RUOA 3SNEA 1T32A 1F5LA 5A2MH 1P9SA 4I8JA 1ZRKA 2BD7A 2HGTH 1UVTH 1UK4A 3UREA 3RXOA 2WPIS 1UVOA 3QGNB 4ABAA 4J2YB 1X7AC 2A2QH 4LZ4B 2QCYA 3RXJA 1LVMA 2WINI 5C3NA 4Q7XA 4D9QA 1G37A 1OX1A 1TOCB 2Z6BD 1NFUA 1SGFG 2PKAB 4NA8A 4U30A 4IW4E 4NIYA 1BIOA 2R0KA 1ZJKA 1WTHD 2V0BA 5L2ZH 3TGKE 1QA7A 1BRCE 1IQHA 3GYMA 5C1UA 1NU9A 3NPSA 2BM2A 1TX6A 1RRKA 1WBGB 2D8WA 2AH4X 4BTIB 2VH0A 1JMOH 2J9NA 2W3IA 4X1SU 1GBLA 1MH0A 2AS9A 1TLDA 1GMHG 1AIXH 1LHGH 1EX3A 4YOGA 5FBEA 4ZHLU 4HZHA 3GY5A 4K2YA 1BHXB 2Z7FE 2VU8E 4HI3A 1VITF 1DFPA 2CHAB 2FI5E 1EJAA 4GCHG 5H4IB 3KEEA 4SGBE 2G00A 2H2ZA 1BTYA 4IC6A 4H42U 3U8RH 5ABWA 2BD4A 1GJDB 2R9PA 2ZZUH 1SPJA 2QGRA 2XBWA 2NWNA 3GCTG 1UVSH 4YO9A 2G8TA 1P12E 1HAIH 2PGQB 1GJ9B 3QN7A 4XBCA 2HALA 8KME2 1O33A 4B75A 2OLGA 2CHAC 3ZVCA 3KCGH 1QURH 4Y11E 3A7YA 1C4Y2 3D62A 3CS0A 2W3KA 2P59A 1O5BB 2XCNA 1Z71A 4R8TB 2ANWA 1LDTT 3TK5A 1E36B 1TX7A 2FP7B 1C1WH 1HJAC 1GI9B 1SGDE 4NSYA 1V2QT 1QBOA 2WPLS 1N6YA 1YC0A 2IJOB 1DE7H 1O2LA 3UUZA 1DSTA 4AGKA 1MBMA 1TQ7B 2AMQA 1G9IE 2FO9A 1T4UH 4K3JA 5FX6A 5E0JA 1K1NA 1O5CB 2B9LA 2O8UA 4B1TA 1XKBC 7GCHF 4X1RU 2Y7ZA 3MI4A 3QTOH 2F9BH 1A5GH 1QL9A 3CP7A 2TGAA 3ATLA 4ZKNU 1KLTA 3RXDA 1V3XA 2Z9LA 3A85A 1LVBA 4DIIH 3DFJA 1GI1A 1LQDB 1ELGA 1OYTH 2ILNA 4X6PA 3RU4T 4HGCA 3V12A 3PWCA 1TA2A 1C1MA 3D65E 2Y81A 1O2RA 3UTUH 2H9EH 3HATH 5B6OA 1VCWA 4WH6A 3BTQE 4ZHMU 3A8BA 1RGQA 2FI3E 3MO9A 2EA3A 3TJUA 2B0FA 1HUTH 3MU4A 5JBCS 1ZMJA 5IYTA 2GP9B 3GY2A 2FDAA 1E37B 1O39A 3EA7A 3S7HB 8GCHF 4JYVH 1Q31A 2FXRA 4ZXXH 4RKOB 1F2SE 1O2XA 1AFQC 1DOJA 2BDCA 5DP9A 2FOBA 5C2ZA 4Y7BA 4OGYA 3RXIA 2WPJS 1AWHB 2ZTYA 4TPYA 2PUQH 3UY9A 2OP9A 5CHAB 2G5VA 3SUEA 3T2NA 1TGCA 2CN0H 3NXPA 3ZV8A 8GCHG 5DP8A 1NFWA 4AFZA 1SGPE 3I29A 3LJOA 3O8CA 1TNGA 1QB9A 2G5NA 1QRXA 1TPOA 2GKVE 3TJOA 4CRCA 1ACBE 1QJ7B 2C8YB 1ZMNA 1NESE 3QZRA 3STJA 3S9CA 1C2KA 1Z7KA 2ZHQH 2UUYA 3NK8A 1DVAH 2ZDNA 4YLQH 1XUGA 3GDVA 1JWTA 1ZR0A 2BZ6H 1O3BA 4DURA 5DPAA 1C1VH 2FESH 1WUNH 2A4OA 2SNVA 2BDBA 1P11E 6ESTA 3ZVAA 2ZCHP 1CHGA 2GV6A 3BTFE 3K2UA 4JZ1A 3TPIZ 1DWEH 1YPKH 4FUEA 2FS9A 4NIWA 1UTLM 2O8MA 1M9UA 2ZA5A 2ZFQH 1GL1A 4I8HA 3OU0A 1TGSZ 1SGCA 1XUJA 1HAYB 5T6DA 5EQRA 3GCOA 5BRRE 1QA0A 3GY8A 6GCHF 5L30H 3N7OA 2BLOA 4U32A 2GDEH 4Y76A 2QXIA 2P3UB 1OP0A 3A80A 3JZ2B 5FPYA 3NZIA 4Q2KA 4BANB 4GPGA 1MU8B 4VGCB 2WV4A 2Q6DA 1XVMA 2OBQA 6LPRA 2NU0E 4TWWA 1FY5A 1LCYA 2VJ1A 1L1GA 1NN6A 1ZYOA 1TRMA 2BY8X 1MU6B 1O2MA 2ZFPH 1MTNC 1UHBA 3AW0A 1ZOMA 3QLPH 3QO6A 2JKHA 2FWWA 3UNRA 1D3QB 3SNDA 3MH7A 3CS7A 1UHBB 2ZIQH 3ZZ5A 5EODA 4X2XA 5TJXA 1O2OA 1SOTA 1KXCA 1F0RA 3SGAE 3RLYH 5EW2H 1A4WH 3M36A 2ZGXH 4UDWH 3NUMA 2FI4E 5T6GA 3F9FA 1EPTA 4FU9A 4LZ1H 2A5KA 3MNSA 3SUFA 1DY8A 1O5FH 4X6NA 1A46H 5EXLA 1GWAA 3UWJH 5E2OA 2CF8H 1K2I1 3A84A 3VB5A 1H8IH 4K8YA 4CH2B 3RXLA 3LC5A 1Y3VA 2Q6GA 2OXSA 1DS2E 4ISLA 1WQSA 1GI3A 3A8CA 2BXUH 4X2YA 4CR9A 7LPRA 3OY5U 3VB6A 4AFQA 3SU6A 2DE8A 3SU2A 2ZDLA 2ZCKP 1K1PA 2UWOA 3GYLB 3MFJA 3GCHB 2F9UA 3W94A 1C5YB 1C2MA 1SR5C 2FODA 3LKWA 1OWHA 4E06H 1ZTJA 1TGBA 3FP8E 1IQLA 1UCYE 2OUAA 4DGJA 3KNXA 1RTFB 5ESTE 1UJ1A 1V2JT 4HTCH 5DG6A 1O5DH 1ZTKA 3PTNA 3TNTA 4ABBA 2P8OC 1QGFA 2BDHA 3MH6A 1O31A 1YM0A 2GVFA 3IG6B 2EI6A 1AB9B 8LPRA 4FUGA 2O8LA 3RXPA 1N8OB 1AE5A 1B5GH 4X0WU 2C90B 1HCGA 1CU1A 1O3PB 1HBTH 4B76A 4AB8A 4XBDA 1GBIA 3P92A 1K1LA 1AUJA 1EP5A 2CXVA 3ELAH 1ANEA 3OYPA 3LU9B 1OS8A 1K22H 2DE9A 1INCA 1SSXA 1A2CH 1ZLRA 2VIPA 4XFQA 2BD8A 3D49H 4YZUA 4NGAH 3VGCB 4INLA 1FDPA 3AAVA 2NU2E 1ANDA 1O37A 3ENSB 1HV7A 3UPEA 4OS4A 2F9OA 2A2XH 1PQ7A 2QY0B 1TBQH 1GMDF 4Q7ZA 1O5EH 3ZV9A 1PPCE 4D76A 7GCHG 4O97A 3EE0B 1FAKH 5ETXA 8ESTE 1TRYA 2QF0A 3SJ9A 2BX3A 1GHBG 2D1JA 3RMMH 3B8JA 4DVAU 1L0ZA 3LPRA 1TABE 1YGCH 2NU1E 1QL8A 1UTOA 1W2KH 3A83A 1NY22 3BTDE 3QDZB 5T6FA 3BG8A 1P2NA 3ATKA 3RXRA 1GBHA 2AERH 3C1KA 3ZVFA 5EG4A 3LH3A 5JBTA 1V2ST 2A7JA 5J4SA 1OP8A 1YPGH 4X1NU 1O3DA 2D2DA 1V2LT 4Q7YA 3BV9B 1YP9A 1GJAB 4WWYA 3A88A 4FU8A