2BD8A

Porcine pancreatic elastase complexed with beta-casomorphin-7 and arg-phe at ph 5.0 (50 min soak) and immersed in ph 9 buffer for 30 seconds
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords beta-casomorphin-7
publication title Structural analyses on intermediates in serine protease catalysis
pubmed doi rcsb
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bd8A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bd8A01
1BHXF 2QYIA 1C2KA 1MZDA 1O36A 1SFIA 4MVNA 5E0JA 1VGCB 5JB8S 1GHYH 1XX9A 3TH2H 2ZIQH 1AD8H 1EAUA 4U2WA 2ZFSA 1Y3WA 2P3UB 2QF3A 2ZECA 1P02A 1AUJA 1O3IA 1O33A 4JMYA 3P8GA 4NFEA 4RKOB 3SJOA 7LPRA 1RTFB 1TGSZ 3GCOA 2NU1E 1LCYA 3MU1A 4FU8A 4MPVA 4XBDA 2GX4A 5AVDA 1O2UA 4X2XA 4E7RG 1ANEA 4GCHG 4I8HA 1MKWH 1HIAA 1TGNA 1YGCH 3MU8A 5HGGA 4TWWA 5FCRA 3RXLA 2PUXB 1EB2A 4CRCA 3AAUA 5I25A 2YNAA 2ZFPH 4NSVA 1O2RA 3ESTA 2XBVA 3A84A 2BD3A 1O5EH 3MNSA 1O0DH 1EZXC 2ILNA 1D3PB 5A8ZA 3BTWE 1PQ5A 2HRVA 1QR3E 2CN0H 2EI8A 1BTPA 3V12A 1GDUA 2UWOA 1G3EA 2BDGA 1TAWA 3SJ8A 2I6SA 4ESTE 2M5TA 2ULLA 3LONA 1OX1A 5GPIB 3SU0A 3ZVAA 3SHCH 2PTCE 4OGYA 1L1NA 2RCEA 4NWKA 3A86A 4XE4A 2PSYA 1P2IA 4U01A 2VWNA 4HTCH 1O3MA 5L2YH 2J2UA 1F92A 3RXEA 4QT8C 2Q6GA 1YCPM 2ZTYA 2D26C 1C5MD 1C1VH 3GY2A 5JDUB 3S7HB 1DPOA 1UTKA 4CHAC 2BZAA 4ZAEA 1QJ1B 3ZV8A 1YCPH 1ZSKA 2ZEBA 4BAHB 3MU4A 1SVPA 1CO7E 2H5CA 1HJAC 3ATKA 1XXFA 3VB4A 4CH2B 2SGPE 3A85A 1FPHH 1S82A 4OS6A 1GBCA 3SZNA 2XC4A 3OY6U 1MKWK 1S6FA 4JK6A 1BMNH 2F83A 4Q7XA 1D3DB 2BX3A 5ESTE 3TK5A 5C20A 1O38A 2FS8A 3T2NA 3SV8A 1C2FA 1J14A 3UNQA 4AB9A 2R0LA 1QBVH 1CE5A 4O9VA 2QC2A 4A1TA 1P2JA 4D9QA 4X2WA 2XCFA 1P3EA 4FU7A 1EJMA 1XUFA 2H5DA 1BHXB 1C5PA 2AYWA 4CHAB 3PLKA 3MU5A 3GICB 2OQUA 1SOZA 4WMFA 1DSUA 3QGJA 3RXMA 2GMTB 2Z9GA 1ANCA 1CA0C 1V2ST 5C1UA 1K28D 1CGIE 1C1OA 3SV6A 4O97A 4GHTA 1HJ9A 2TGAA 2TGPZ 3S9CA 3WY8A 4K69A 2AMPA 1NRQH 1G3DA 3P8NA 1JBUH 1O3FA 3P6ZB 2YOLA 1UTOA 2XC0A 1PPHE 5EXMA 5DGJA 1NROH 4PROA 1FN8A 1CT0E 2FOFA 3VB7A 2FTMA 1AIXH 2BVXH 3TITA 4ABFA 3U9AH 5A8YA 1TX8A 3DA9B 3UPEA 2WYGA 1EX3A 1YCPK 2R2MB 1SGTA 1G9IE 1EASA 1FN6A 1HBTH 4A92A 1ZSJA 1KXFA 1Z7KA 1GJ9B 3GY7A 4GPGA 2PGQB 1UTPA 1BB0B 1FXYA 1C5RA 3BTEE 1GMCF 2ZWLH 3RXGA 5JBTA 2ZTXA 2XBWA 2ZQ1A 1CA0B 1MTVA 1ARCA 4XBCA 2ZPSA 3ZVFA 1QURH 2Y5HA 2CF8H 1P0SH 2Y7ZA 3TU7H 2ZKSA 2BLQA 2FLBH 4AYVB 2Z9JA 3ELAH 1TLDA 2OC0A 3RXFA 2AGEX 1S6HA 4X1NU 3GISB 1C5NH 1KXCA 3SGBE 1DANH 1O30A 2ZCLP 4BXSA 2AERH 4NIVA 1AFQC 1S85A 5T6GA 1GHZA 1OWEA 1EZQA 3F68H 1B0EA 3OTJE 1FNIA 2TRMA 2VIDA 1K1IA 1QBOA 1Y5AT 4E05H 2HOBA 3SUFA 4JZIA 1AGJA 4JYTA 3RXAA 1MU6B 2ZTZA 3FVFB 2FM2A 1AHTH 2VH0A 1RIWC 1XVOA 3TJOA 3FZZA 3NCLA 3OU0A 5CE1A 3F9EA 1YLCA 2BD8A 5EODA 2F9OA 2ALVA 2ZU1A 1G3BA 1DVAH 4JZDH 1FLEE 2BD4A 2ZGXH 3QN7A 1AI8H 3K6YA 4ZHAA 2O8WA 6CHAC 2QF0A 1D6WA 4H4FA 2EA3A 2SNWA 2VIVA 3A8AA 3NUMA 1AFQB 3AAVA 1GMDF 1B0FA 5DP9A 1DUAA 3HGNA 1N6XA 4IC6A 3A81A 5A8XA 1C1MA 1TX7A 1V2JT 3E8LA 1NRPH 3S9AA 1SLVB 1OYTH 1AWFH 1LHFH 2ANMH 1DICA 3D62A 3TIUA 2FIRH 1O2MA 3ZV9A 1FAXA 3UTUH 4JYUH 3ATWA 1RIWB 2B8OH 2P3TB 1SLWB 1NESE 3TH4H 1GBFA 5LPFA 2IJOB 4WJG2 3URDA 4ABIA 1TNHA 3F6UH 2GTBA 4ISOA 1O2JA 2IOTA 1TOMH 6CHAB 3SQHE 4JZEH 2WPMS 1BTUA 1OP8A 2A7CA 2C4FH 1W13U 4Z0KA 3ZZAA 4K1EA 2BY7X 4ZROA 1GMCG 2Y6TA 1GBIA 2KAIB 3SW2B 4DOQA 1K1JA 3ODDA 3SORA 3QUMP 2FOEA 3EYDA 4BAKB 1DM4B 2CV3A 3UIRA 2WYJA 1HRTH 2OINA 1CVWH 4OS4A 1LVOA 5ABWA 1GI4A 1HIAB 1GJ6A 1AO5A 3RDZA 1PFXC 1A3EH 1MBMA 1P12E 2VGCB 4I32A 5DG6A 2PTNA 2JKHA 3LC5A 1SBWA 4GAWA 2ZGJA 2NU0E 4I8KA 3ITIA 2OC1A 4A1XA 4MDSA 1GVLA 2BX4A 3SGQE 1IQLA 1W8BH 1C1QA 2H9EH 1V6DA 3LJJA 5SGAE 1BJVA 4A1VA 1ARBA 2G4UA 2AS9A 1K1PA 3DFLA 3SNCA 4CRAA 4YOJA 2D1JA 1O5GH 1DFPA 1XUJA 5IYTA 1GI2A 4DY7B 3U1JB 1N8OC 2FOBA 3SJ9A 3BEIB 2WPHS 2ZCKP 1GVKB 4B1TA 1EKBB 2XWBI 2ZHWH 1JXPA 1ABJH 1ZRKA 1THSH 4FVBA 3ZVGA 4ABGA 1GGDC 1X7AC 1ESTA 3RXBA 3EGKH 1A5HA 1OSSA 1VITF 2A32A 2VWMA 2H2ZA 1S0RA 3VGCC 4M7GA 2P8OC 2ZNKH 3AASA 2C93B 1ZOMA 3SU2A 1FY4A 3TGJE 4FVDA 1ZLRA 3Q3KA 1SI5H 3GY3A 2F9PA 3ENSB 1G30B 1GG6C 2HGTH 3PROA 4ABBA 2BMGB 2PKAA 1SQAA 4BAMB 2HPQH 4ASHA 3SGAE 4I7YH 1NC6A 1AKSB 4D7FA 1N8OB 4YLQH 2VJ1A 3GY4A 8LPRA 1LVYA 1D3TB 1JWTA 1HXEH 4MQAA 2PFEA 3M5MA 3TVJB 5TCAA 3UREA 5A0BA 1O3DA 1GGDB 2HLCA 3KQEA 3SUDA 3HGPA 2G52A 2J9NA 3VGCB 1LKBA 1G36A 2P8OB 4AOQA 5DPAA 1AFEH 1TBQH 2BD9A 4DGJA 2O8UA 3ZZ9A 1OXGA 2XCNA 4AB8A 3ZZ8A 4D7GA 4K8BA 1RXPA 1GHXH 1MAXA 3U8TH 1SGFA 1TB6H 1CHOF 1GG6B 4Q7ZA 3QDZB 1HUTH 2W3IA 4MNXA 3RXCA 2FEQH 5K0HA 2H6MA 1GDNA 1QL9A 3QGNB 1VCWA 1C4V2 1Y5UT 6ESTA 3RU4D 3SJIA 3ZVDA 1P2QA 1A46H 2PLXA 1UCYH 5C3NA 3NXPA 1P57B 1NTPA 1IQHA 2JH0D 3PTNA 4IS5A 1ABIH 2LNCA 3DD2H 2XWAA 1ORFA 2VVVA 1SHHB 1QRXA 1P01A 4KELA 3S0NA 5A2MH 1TPOA 2GCTC 1OS8A 3E16B 3K2UA 3OSYA 1QHRB 4X8TH 3ZYEA 2ZU4A 3FP7E 2R3YA 1LQDB 1LPZB 1ZTJA 4ZXYH 4BXWA 1ETSH 3BTGE 1A0JA 1A3BH 1GCDA 3NZIA 1ZMLA 1DUEA 3V3MA 5DK1A 3T28A 1EOJA 3MYWA 4AGKA 2HWLB 1HDTH 2VH6A 1UCYE 1V2VT 2FXRA 1H9HE 3B23B 3TJUA 1LHCH 2GD4B 5DO4H 1PPCE 1EP5A 3D49H 4YOGA 2BDHA 2P16A 3LGVA 4K60A 1C1WH 1VITG 1P04A 2IN2A 1O3JA 3MNXA 1MD8A 1GI7B 4LK4A 3MOCA 1C5UA 2ZA5A 3BTME 4WY3A 1Y3UA 2VIOA 1BITA 1P9SA 2BZ6H 3QO6A 1OWIA 2GCTB 5LGOA 1BJUA 2VIQA 4BNRA 3UR6A 3GYLB 1P9UA 1AE5A 1PPFE 3U8OH 2YNBA 4OS5A 1A1RA 3ZYDA 2H9TH 1PPGE 1HFDA 2BQ7B 2OP9A 1SMFE 3S9BA 4GLYA 1WSSH 3UY9A 1WV7H 2QY0B 1A0LA 1L0ZA 5FPTA 3T27A 1SL3A 1T32A 3SQEE 1BRUP 3RXTA 2A0QB 1NPMA 1NU9A 2PV9B 1XUKA 2O8MA 2HNTE 1V2OT 1UK3A 5DP6A 3EA7A 2V35A 2GV6A 1JMOH 3A7YA 2BDCA 2UUYA 4R0IA 1INCA 1EPTA 5EQRA 3EAJA 3UOUA 2C8YB 2ZDNA 1GJ8B 2BD7A 2D2DA 5J4SA 5F8TA 1CHOG 2FI5E 1GHAF 1GBBA 3MH5A 2BTCE 1SSXA 4E06H 1GMHF 1DLEA 1TRNA 4I8LA 2A4GA 2AMDA 6LPRA 1XMNB 3MMGA 1NRNH 1DX5M 2FODA 2A4OA 3E3TA 3RU4E 3LGWA 3ZZCA 2CHAB 3EDXB 1YKTA 2XRCA 1C2IA 1A61H 3A8BA 3MI4A 4CRFA 4Y10E 4CR5A 1M9UA 1THRH 1BTHH 4X2YA 2KAIA 4XSKU 1W3CA 1P3CA 1Y8TA 2PWXA 2VNTA 3ZZ4A 1V2NT 2OQ5A 1Q2WA 3P70B 1W7XH 4D76A 1O3AA 2JH5D 3KL6A 4NA9H 2BY9X 4FUIA 4WMEA 1VCPA 2ZDMA 3SNEA 2Y82A 3BIUH 4X1QU 2BB4A 2VINA 1XXDA 2ANKH 3BTKE 4RN6A 3RXKA 6GCHF 3G01A 2C3SA 4WVPE 1GBKA 1QNJA 4YTAA 1SLUB 3PB1E 3RXQA 2GCHF 3U98H 1AB9C 1A4WH 5F8ZA 1ID5H 3LIWA 3M35A 4THNH 1O2VA 2GDEH 3M3SA 2GGVB 1CBWC 1WTHD 2AIQA 4VGCC 4X8VH 2K1QA 3AVZA 4HZHA 1Y59T 2BDYA 3VB6A 1ZZZA 2ZC9H 4X8UH 4Y0ZE 1S0QA 2BDAA 4ZMAH 1DWBH 1YLDA 1TQ7B 1QL7A 1K21H 1AWHB 2Z9IA 4K3JA 2WUCA 1RTLA 3SI4H 1KXBA 1YBWA 3BG4C 4XOJA 2GKVE 1BQYA 5AFZH 2ZZUH 1TE0A 1QGFA 3SU3A 1TX6A 1C2LA 1ELFA 3CS7A 4GSOA 4NZQA 5GIBA 1E38B 3TK6A 3BSQA 4MNVA 1IOEA 1KXAA 1AB9B 1MQ6A 2Q1JA 4B73A 1BIOA 3P8OA 1BCUH 3KGPA 3FANA 2Z94A 5C5OA 2VIPA 3O8RA 1C9PA 4VGCB 3T26A 1AKSA 1C4Y2 3ZZ3A 1WOFA 3UFAA 1G3CA 2BY8X 1YPGH 1OKXA 3JZ2B 1UK2A 1GI3A 1KXDA 2R9PA 3NK8A 4JK5A 9LPRA 1GHAG 3KF2A 2Z3DA 4SGBE 1FUJA 2BM2A 1JIMA 1QFKH 2H9HA 2VWOA 2JETC 1Q31A 3M5NA 3SBKA 2FS9A 1Z1JA 7GCHF 2FX4A 1ZJDA 2PHBA 2ZFFH 3BG4B 1D9IA 4SGAE 2SGDE 2FTLE 1E36B 1SGFG 4NGAH 4JZFH 2P59A 3MO3A 4YT6H 3U1IB 1MH0A 3UR9A 1Y5BT 4Y0YE 3L3TA 5E0GA 2PKAB 1W11U 1SGYE 4NSYA 2CGAA 1ELTA 3E91A 2OC7A 4ABDA 5EPNA 2Y5FA 1BTZA 3LKWA 3VXEH 1RTKA 4UFFH 4Z6AH 3SNAA 3VEQB 1HJAB 2STAE 2SFAA 1ELCA 4ABEA 1D6RA 1HAHH 2ZPQA 5C1YA 3VPKA 4BAOB 1AZZA 4INKA 2EEKA 1ZSLA 6GCHG 1P06A 3MNBA 5EPYA 1IQKA 4NZLA 4CRDA 4WH6A 1GL1A 2ODYB 3BG8A 3I78A 4AORA 2JETB 2HALA 2GCHG 1AVXA 1UMAH 1EAIA 2FLRH 1GBDA 3SV7A 2J95A 1GBLA 1TABE 1IHSH 1HAVB 1KY9A 5TJXA 1MAYA 2Y80A 1C5YB 3E0PB 1DY9A 1MUEB 3L33A 3B8JA 4ABJA 1IQJA 5JYIA 5B6OA 3KQCA 2TGTA 5EXLA 3BTTE 3TPIZ 3RXUA 1YP9A 2C90B 4FUCA 4IW4E 1SGDE 1HCGA 1UK4A 4NA7A 1C2JA 1VJ9U 1GJ4H 2ZI2H 3PYHA 2DE8A 2H1UA 3QK1A 1UVSH 1TNKA 3IITA 3FP6E 1AUTC 1O5CB 4OS2A 5BPEA 4ZH8A 1BTXA 5DP4A 1GJAB 4F49A 1C4U2 2DE9A 1HJ8A 3RMOH 3KNXA 8KME2 5JBAS 1K9OE 1HAOH 1C5WB 1GJBB 4Y71A 4TPYA 3KQDA 4E7NA 1G2MA 2FOHA 5ETXA 5CHAC 2ANYA 3SU1A 4FUBA 1C5TA 1P11E 3MO6A 1O31A 3HATH 1VR1H 4U32A 5EOKA 1K2I1 1EUFA 1NS3A 2WUBA 4UFEH 1H4WA 1ZPCA 1DWCH 2C8ZB 2GDDA 3LGTA 3SN8A 4Y11E 3VB3A 2QXJA 1RJXB 4ZHMU 3O8DA 1GJ5H 4ABHA 1EPTC 7GCHG 1T31A 1DSTA 5E8EH 3RC4A 3GCTF 4KKDA 2GP9B 1FY3A 2FWWA 2W26A 1KTSB 1E34B 1FIWA 1H9LB 2VIWA 4LZ4B 1XUGA 3RU4T 2ZQ2A 5CHAB 2ZHQH 3LH3A 4TYDA 1GJDB 1MZAA 1PYTD 1F7ZA 3LH1A 3S7KB 4KTUA 1KSNA 1PPBH 4INHA 5EQSA 4AG1A 3STIA 1FMGA 1O5BB 4GVUA 3M7UA 4BTIB 1LPKB 1YPHE 4IN1A 2ZGBH 3VXFH 3UNSA 3TNTA 1GI1A 1TONA 4GHQA 4B74A 4FUFA 1V2UT 1CGHA 4NFFA 1YYY1 4FUJA 1S84A 1W2KH 3LJOA 1MD7A 5GJ4B 1SB1H 1EPTB 1O39A 3LGIA 5FPYA 1GHWH 1BTYA 1QY6A 2WPKS 1FY1A 2FPZA 3V0XA 1BRBE 4ZUHA 3RMLH 1LHEH 3PWCA 1P2MA 3M61U 3RXOA 1TYNA 2XNIA 1TNJA 2VB0A 3SUEA 1GBHA 2ANWA 1YPKH 3QWCH 1E37B 1Y3XA 3PO1C 3GDVA 4FUGA 4J1YA 4CRBA 3SUGA 3P92A 3OY5U 1EAXA 2G81E 4B71A 3GOVB 1HXFH 5TCCA 4X6MA 3RXRA 1LHGH 1C1NA 4YT7H 1ELGA 1K1LA 2JH6D 3Q76A 4F4OC 1TRMA 4R8TB 1K1NA 1O3BA 3T62A 1PPEE 3STJA 4YZUA 1TNGA 1T7CA 3DHKH 1IQFA 4RKJB 5AFYH 1UVUH 5GDSH 3MTYA 4HGCA 3V7TA 1EZUC 4NWLA 2ZU3A 1EQ9A 2A4RA 1JOUB 1XKAC 3SU4A 1OP2A 1UVPA 1C5ZB 2J38A 3PLPA 4A7IB 3SHAH 3L6PA 1NM6A 2ZDVH 2V3HH 3BEUA 3HPTB 4K8YA 3EQ0H 1TPPA 2VWLA 3E6PH 4IN2A 1AE8H 4DG4A 1ELAA 1GHVH 3PO1B 3LPRA 5DP7A 1GI8B 1TBZH 8GCHF 5H4IB 1W7GH 1FPCH 3RMMH 1O3NA 1BMAA 1O2PA 1HLTH 1U6QA 4AYYB 2TGDA 1J17T 3GCTG 3PMHB 2PW8H 5L30H 2A45B 1RRKA 4TY6A 2B9LA 4WXVA 2ZHDA 1V2KT 1MCTA 2FI3E 2I6QA 5A0AE 1DITH 5GXPA 2ZFTA 1JIRA 4YESB 4CH8B 4OS1A 2PGBB 3K6ZA 5A09A 4Y79A 1O37A 2QA9E 1SQTA 4B2CA 1QB6A 3MWIU 1AZ8A 4DW2U 1GMDG 1TPSA 4B75A 1BMMH 1C5XB 5EU8A 4X6PA 5EW1H 1HYLA 2OLGA 5EGMA 3KHVA 1FAKH 5EG4A 1MTNC 1SGIB 2FOMB 1ZMJA 5A0CA 1XVMA 1O2OA 5HM9A 1VZQH 1UVTH 4DIHH 1OWKA 1ZPZA 5F8XA 2LPRA 2ZFQH 4AFUA 5IDKA 4X2VA 3PM3A 1Z71A 2NU4E 1C5QA 1FIZA 1Z8IB 3MH4A 4ISIH 5C67A 1KIGH 1V2RT 1CT4E 4IGDA 7KMEH 3CS0A 3SNDA 1PQ7A 2F3CE 5GWZA 1GPZA 2CXVA 2HNTF 2QXHA 2RA3A 4O3TA 1V3XA 2ZDKA 2BHGA 3LGUA 1ETTH 1UTLM 4DJZB 3UQOA 1TQ0B 2Z7FE 5LH8A 3E1XB 4KTCA 1P2KA 2Z3EA 5E2PA 2P3FH 5FAHA 1GWAA 1F0UA 1BZXE 4Y7BA 3GCNA 3ZZ6A 4MNYA 4X1RU 1O2XA 1HAVA 1A5IA 1MTNB 2CMYA 2G00A 2SGFE 3D65E 2V6NA 2ZU5A 1VCQA 2PR3A 1T8NA 1ANDA 2Q6DA 3TLOA 2ZFRH 2VVUA 1C1RA 2QN5T 3LGYA 2ESTE 4UEHH 3RM0H 4BANB 4UFGH 1PQAA 3F9HA 1UTNA 1HAXB 3IWMA 2FMJA 3B9FH 3RLYH 5JB9S 1C5OH 1ZTLA 1LVMA 5DP3A 1GVZA 4FU9A 1W0YH 4BTUB 1V2LT 1PPZA 5F6MA 2SGAA 2WPJS 3RP2A 8GCHG 1L4DA 3A87A 3BV9B 1O5AB 5JBCS 2BLVA 1ESAA 1V2MT 2R2WU 1MKXH 1A2CH 3RXHA 1QJ7B 4ABAA 3ZZ7A 3TGKE 4WH8A 3ODFA 2Z3CA 1P03A 2FOGA 3E0NB 2BD5A 3RMNH 1BOQA 4Q7YA 1SGRE 2FI4E 1FONA 4B76A 4MLFB 1TGCA 1NT1A 1O3GA 2BVRH 3KQBA 5FBIA 2B0FA 1NFYA 2CF9H 4IMZA 2ZHFH 3D23A 5E2OA 1ACBE 1F5LA 5CMXH 4J2YB 1SGCA 1P05A 2UWPA 4GUXA 2BYAX 3UOPA 2G55A 4AN7A 1KLTA 4I31A 4FUEA 2QXGA 3BTQE 4ISLA 1G2LA 1ZMNA 2IPHA 1P09A 3RM2H 1XKBC 3M3TA 1VGCC 5C1XA 4NCYA 5K7RA 2FDAA 1H9IE 1S5SA 4BTTB 3MFJA 3ZVBA 2HNTC 1LQEA 1ELDE 1UCYK 1SR5C 4ISNA 4AG2A 2O9QA 1UHBA 1OP0A 1ZRBA 1ZGIA 3M37A 3H7TA 3KN2A 1HPGA 3W94A 4X0WU 4BOHA 5EW2H 5L2ZH 2F9BH 2SGQE 3RC5A 3U69H 8ESTE 1QJ6B 2WINI 2WV4A 1O3PB 1C5VA 5T6DA 1FI8A 1SHYA 5JBBS 3MHWU 3PMAB 3RXPA 1NN6A 3T29A 2ALPA 2BQWB 1ESBA 2W7UA 3JZ1B 1MKXK 1KYNA 1HAZB 3HK6B 4H42U 2OTVA 1KLJH 1O32A 1AY6H 2AGIX 4IC5A 4I8GA 1HAIH 1SPJA 2FP7B 2OUAA 2RDLA 3PWBA 4YOIA 1ZPBA 5LPEA 1K22H 1IQNA 3F1SB 4MPWA 3SO3A 5J4QA 4X1PU 3M5OA 2QCYA 2Y7XA 3SU5A 3EA8A 1C2MA 2A5IA 1BRCE 2A2XH 4JZ1A 1WBGB 4DURA 1QL8A 2GZ9A 2PKSC 1IAUA 4LZ1H 1W0ZU 3U8RH 3BTHE 1Z6JH 5DKMA 2WPIS 3M36A 4B2AA 1EZSC 1MTSA 1CGJE 1G32B 1MTWA 1O2YA 5AF9H 1NY22 2XTTB 3LU9B 3Q77A 3M5LA 1RD3B 1LHDH 3SV9A 1O2ZA 3A7TA 3QTVH 2G5NA 1TRYA 1QIXB 4IMQA 2UWLA 5AHGH 5EXNA 4DIIH 1NFUA 1RS0A 3TNSA 3GY5A 1O3HA 3SV2H 3I77A 1UO6A 3AW1A 4ZXXH 3RC6A 4Q2KA 4AGJA 2G5VA 1Q3XA 1O2TA 3MNCA 2BY5X 5ESBA 2TPIZ 1THPB 3IG6B 4AZ2B 2V3OH 2ZF0H 4D8NA 1O35A 2PKSB 3EE0B 3BTFE 1LKAA 1GBTA 2GVFA 1UTMA 2GT7A 3PLBA 2FOAA 3ATIA 1H8IH 2A2QH 3PMBB 4JCNA 2BLWA 2OXSA 3K9XB 4MNWA 1O2GH 4YO9A 1T8OA 1JRSA 3MH6A 5FBEA 2A4QA 3SU6A 1N1LA 2ZO3H 1W12U 3OYPA 2PUQH 3M7TA 1CBWB 2J34A 2OBOA 3HKJB 1GHBF 3EA9A 2A7JA 2QAAA 5C5NA 1E0FD 3A7WA 1KTTB 1Z8GA 1SQOA 5HYOA 1MU8B 1QTFA 2AFQB 1GMHG 1TA2A 2GT8A 2G8TA 1BRAA 1Z1IA 3UWJH 1XUIA 1FZZA 2UUKB 1LVBA 1A0HB 1DXWA 4KGAA 5JPMH 1FY5A 2GMTC 1AQ7A 1C5LH 2AH4X 4X6OA 1S83A 2QXIA 2QGRA 2XBXA 3QLPH 1GBAA 1OWDA 4FXGH 1C9TA 1WYKA 2O8LA 3MO9A 5PTPA 2J94A 1TMBH 3QTOH 1GI9B 1GDQA 3W95A 1DT2A 4U30A 3V13A 3TJNA 2FYQA 1XM1A 4Y76A 4NA8A 5E0HA 2XW9A 1O3KA 1QQUA 4TWYA 3GCHC 1Y3VA 1P8VC 3QX5H 3A7XA 1HNEE 1V2TT 3RXVA 1PQ8A 1WQSA 3A89A 1RGQA 3C27B 3RXJA 2FO9A 3BIVH 2EI7A 3TJVA 1L4ZA 2OC8A 1O2LA 1FDPA 1H8DH 2A1DB 2ZHEH 2FX6A 2NU2E 1QQ4A 1WU1A 3GDUA 1ZYOA 1NFWA 1WUNH 1P10A 4UE7H 1C2GA 2BXTH 1BUIA 5L6NH 3GY8A 1NZQH 1TALA 1ZHRA 4FUHA 1CA8B 2FZZA 1DXPA 1DWDH 1ZR0A 1IQEA 1AU8A 1TNLA 1C2HA 1QA7A 1E35B 1GBMA 1KDQB 3GCHB 1NFXA 3FAOA 4NIYA 1DE7H 4TY7A 2XBYA 2HPPH 1SGNE 1NO9H 1GL0E 1GI6A 1TA6A 3MU0A 1QB9A 2SGEE 2GV7A 1TGBA 4AFQA 1GBEA 3TGIE 1GHBG 2ZDAH 4WF8A 1HGTH 4ZHLU 3T25A 1SGPE 1ELBA 2EC9H 1TNIA 1G37A 1GJCB 3FFGA 1QB1A 5FXLA 2FYRA 1ZJKA 3R3GB 3P8FA 4KTSA 2W7SA 1TOCB 2AEIH 1T4UH 2XXLA 3Q3XA 1EATA 1SGQE 2UUJB 1LO6A 1LPGB 4ISHH 1P2OA 1NRSH 3HK3B 4O03A 2V0BA 5BRRE 3BTDE 3UUZA 1EAWA 2J4IA 4Y8XA 1ELVA 1L1GA 1O3EA 1S81A 1LDTT 2Z6BD 3N7OA 3NKKA 1QRZA 1JRTA 1OPHB 2QIQA 4XBBA 4K5ZA 3A8CA 2D8WA 4XFQA 4ZKSU 1YPHC 2ZDLA 4LXBH 1EB1H 4AFSA 1TIOA 2W3KA 1O2NA 1GI5A 4A5TS 4NG9H 1UHBB 2SNVA 1EP6A 4Y8YA 1KLIH 3CP7A 5HXFA 3ATMA 1O34A 1SFQB 1YM0A 2AIPA 2B5TB 2BQ6B 2BXUH 1ZGVA 1J8AA 2P94A 2OBQA 1WQVH 4YM9A 5FPSA 2P95A 3M3VA 1T4VH 2ZPRA 4DVAU 3KCGH 4HI3A 1LTOA 2Z9KA 3O8CA 2BDIA 2FOCA 2F9UA 1BTWA 3I29A 4DCDA 2RA0A 3H7OA 1SC8U 1F5KU 2Y81A 5T6FA 1YPMH 4XDEA 1C1UH 1QRWA 1C2DA 3Q3YA 1D3QB 4KP0A 3KEEA 4INLA 2VGCC 4FUDA 2R0KA 3VFEA 1UVOA 2F9VA 1O3CA 4UDWH 1BBRH 1DY8A 1CHGA 1YPJH 4K2YA 3ZVCA 1MTUA 2VU8E 1NRRH 3URCA 1EXFA 3A8DA 1ZHMA 1C2EA 4X1SU 4LOYH 1T8MA 1ZHPA 2ZG0H 4WXIA 1A7SA 1O2SA 2C8WB 5FX6A 1GI0A 3F9FA 2BD2A 5DJ7A 1HAYB 1MBQA 4MPUA 4YLUA 4TPIZ 1OYQA 1CU1A 1LMWB 3LC3A 1V2WT 4MTBA 1TMTH 4MG3A 3P17H 1BBRE 3Q00A 2VVCA 5HMAA 2BDBA 3SNBA 1DLKB 2G4TA 1GJ7B 1HB0B 2ZU2A 1F0RA 2AGGX 4Y6DA 3TK9A 1AN1E 1ETRH 7ESTE 3MH7A 4ZKOU 1T8LA 1AVWA 1QCPA 4UFDH 1J9CH 1KXEA 1O5DH 5LPRA 1WTGH 3LDXH 1PYTC 2O8TA 1Z8RA 3UNRA 3QZRA 3E90B 2R3UA 1SLXB 4OGXA 5C2ZA 3UWIA 1F2SE 2XYAA 4I33A 2P93A 3QZQA 4ZKNU 1HAPH 1OOKB 3HKIB 3RLWH 1V2QT 1ZTKA 2TIOA 2RG3A 2FESH 4CBNA 1GCTC 1O2QA 1K1MA 1P2NA 3F9GA 1C1PA 1VJAU 1BBRK 1OWJA 5I46H 2HVXA 2W5EA 1W10U 1N6YA 1TPAE 1O2WA 4UD9H 2OCVB 5DP8A 2A5KA 3LT3A 2BY6X 4ZKRU 2F91A 2BOHB 3ZVEA 3A82A 1BA8B 2AMQA 3ZZ5A 2OD3B 4K1TA 3RXSA 4BAQB 1RFNA 1TMUH 2F9NA 5GCHF 2CJIA 1UTQA 2WV5A 1C1SA 1F5RA 2G51A 2QV1A 3GYMA 3RXIA 1D4PB 3ZZBA 3A80A 5F03A 2GZ7A 1YC0A 3KIDU 3PV4A 1YPEH 2UUFB 2ASUB 3A7ZA 4JYVH 3OX7U 3FZDA 4CR9A 5FCKA 1NU7B 5HM2A 1GCTB 4IBLH 1Y3YA 1HAGE 1SGEE 3SJKA 4AFZA 4X6NA 1CSOE 3RUOA 1FJSA 4Q80A 4I8JA 1O2HA 2ZGCA 3RXDA 2BLOA 4NIWA 1GBJA 1FY8E 2STBE 2B7DH 4H6SB 2TBSA 3A88A 2DUCA 3PMJA 4HFPB 1EJAA 3A83A 3GDSA 4NIXA 1TFXA 4UONA 1IQIA 1KDQA 1B7XB 1ANBA 1IQMA 1W14U 3SOSA 1H1BA 1WCZA 2Z9LA 1QBNA 2EI6A 4Y7AA 1BDAA 1BT7A 2THFB 1O5FH 1TGTA 4OS7A 1FQ3A 4CRGA 4RSPA 1O2IA 1TBRH 1CQQA 3M7QA 1QA0A 2BOKA 1SG8B 1C5SA 1VITH 4X8SH 5FHTA 4D9RA 1C1TA 1V2PT 5EQQA 1L2EA 2NU3E 4GCHF 3UQVA 3C1KA 4H6TA 3ZZDA 1PJPA 3K65B 1DDJA 4CREA 3O8BA 2ZGHA 4O3UA 4WWYA 3VB5A 4B2BA 1FV9A 1IHTH 2NWNA 1O3LA 1O3OA 1UJ1A 2A31A 1IQGA 1MMJN 3DT0H 3LOXA 3R0FA 3S69A 1DOJA 1HV7A 2XC5A 3AW0A 3GY6A 5DP5A 5FX5A 3BF6H 1SOTA 1F0TA 4Y8ZA 3DFJA 3FP8E 3TH3H 4A6LA 2ZCHP 3PTBA 2A5AA 1OWHA 3A7VA 1DS2E 1MCVA 2GZ8A 2Q6FA 3H5CB 1ELEE 1MQ5A 1L1JA 1YPLH 1XUHA 4WMDA 1TWXB 1B5GH 1Z8JB 1BMLA 1DWEH 1A5GH 3BN9A 1J16A 2BVSH 1O2KA 5GCHG 3BEFB 3DUXH 5G4BA 1K1OA 3NPSA 3P95A 1WAYB 4DT7B 2ODPA 1AVGH 1EOLA 3NWUA 3T5FH 1J15A 2PSXA 5T3HA 3CENA 1UTJA 2CHAC 2ODQA 2Y5GA 4K1SA 2C8XB 4MPXA 2A7HA 2WPLS 2ZP0H 1Z6EA 2J92A 4AX9H 9ESTA 1AMHA 3SI3H 1F0SA 4CBOA 1EJNA 3ATLA 1YF4A 1CT2E
chains in the Genus database with same CATH superfamily
1BHXF 2QYIA 2VBCA 1C2KA 1MZDA 1O36A 1SFIA 4MVNA 4XRNA 5E0JA 1VGCB 5JB8S 1GHYH 1XX9A 1SQRA 3TH2H 2ZIQH 1AD8H 1EAUA 4U2WA 2ZFSA 1Y3WA 2P3UB 2QF3A 2ZECA 1P02A 1AUJA 1O3IA 1O33A 4JMYA 3P8GA 4NFEA 4RKOB 3SJOA 7LPRA 1RTFB 1TGSZ 3GCOA 3PV2A 2NU1E 1LCYA 3MU1A 4FU8A 4MPVA 4XBDA 5EJ1A 2GX4A 5AVDA 1O2UA 4X2XA 4E7RG 1ANEA 4GCHG 4I8HA 4F55A 1MKWH 5HIYA 1HIAA 1TGNA 1YGCH 5B6LA 5DN6D 3MU8A 5HGGA 4TWWA 5FCRA 3RXLA 2PUXB 1EB2A 4CRCA 3AAUA 5I25A 2YNAA 2ZFPH 4NSVA 1O2RA 3ESTA 2XBVA 4P00A 3A84A 2BD3A 1O5EH 3MNSA 1O0DH 1EZXC 2ILNA 1D3PB 5A8ZA 3BTWE 1PQ5A 2HRVA 1QR3E 2CN0H 2EI8A 1BTPA 3V12A 1GDUA 2UWOA 1G3EA 2BDGA 1TAWA 3SJ8A 2I6SA 4ESTE 2M5TA 2ULLA 3FOAA 3LONA 1OX1A 5GPIB 3SU0A 3ZVAA 3SHCH 2PTCE 4OGYA 1L1NA 2KCPA 2RCEA 4NWKA 3A86A 4XE4A 2PSYA 4ASUD 1P2IA 2KFWA 4U01A 2VWNA 4HTCH 1O3MA 5L2YH 2J2UA 1F92A 3RXEA 4QT8C 2Q6GA 1YCPM 2ZTYA 2D26C 1C5MD 1C1VH 3GY2A 3OTPA 5JDUB 3S7HB 1DPOA 1UTKA 4CHAC 2BZAA 4ZAEA 1QJ1B 3ZV8A 1YCPH 1ZSKA 2ZEBA 4BAHB 3MU4A 1SVPA 1CO7E 2H5CA 1HJAC 3ATKA 1XXFA 3VB4A 4CH2B 2SGPE 3A85A 1FPHH 1S82A 4OS6A 1GBCA 3SZNA 2XC4A 3OY6U 1MKWK 1S6FA 4JK6A 1BMNH 2F83A 4Q7XA 1D3DB 2BX3A 5ESTE 3TK5A 1FX0B 2WSSD 5C20A 1O38A 2FS8A 3T2NA 3SV8A 1C2FA 1J14A 2CK3D 3UNQA 4AB9A 2R0LA 1QBVH 4RT0A 1CE5A 4O9VA 2QC2A 4A1TA 1P2JA 4D9QA 4X2WA 2GJGA 2XCFA 1P3EA 4FU7A 1EJMA 1XUFA 2H5DA 1BHXB 1C5PA 2AYWA 4CHAB 3PLKA 1KMHB 3MU5A 3GICB 2OQUA 1SOZA 4WMFA 1DSUA 3QGJA 4FETA 3RXMA 2GMTB 2Z9GA 1ANCA 1CA0C 1V2ST 5C1UA 1K28D 1CGIE 1C1OA 3SV6A 4O97A 4GHTA 1HJ9A 2TGAA 2TGPZ 3S9CA 3DSGA 4K69A 3WY8A 2AMPA 1NRQH 1G3DA 3P8NA 1JBUH 1O3FA 3P6ZB 2YOLA 1UTOA 2XC0A 1PPHE 5EXMA 5DGJA 1NROH 4PROA 1FN8A 1CT0E 2FOFA 3VB7A 2FTMA 1AIXH 2BVXH 3TITA 4ABFA 3U9AH 5A8YA 1TX8A 3DA9B 3UPEA 2WYGA 1EX3A 1YCPK 5KEDA 2R2MB 1SGTA 1G9IE 1EASA 1FN6A 1HBTH 4A92A 1ZSJA 1KXFA 1Z7KA 1GJ9B 3GY7A 4GPGA 3W1EA 2PGQB 1UTPA 1BB0B 1FXYA 1C5RA 3BTEE 1GMCF 2ZWLH 3RXGA 5JBTA 2ZTXA 2XBWA 2ZQ1A 1CA0B 1MTVA 1ARCA 4XBCA 2ZPSA 3ZVFA 1QURH 2Y5HA 2CF8H 1P0SH 2Y7ZA 3TU7H 2ZKSA 2BLQA 2FLBH 4AYVB 2Z9JA 3ELAH 1TLDA 2OC0A 3RXFA 2AGEX 1S6HA 4X1NU 3GISB 1C5NH 1KXCA 3SGBE 1DANH 1O30A 2ZCLP 4BXSA 2AERH 4NIVA 1AFQC 1S85A 5T6GA 1GHZA 1OWEA 1EZQA 3F68H 1B0EA 3OTJE 1FNIA 2TRMA 2VIDA 1K1IA 1QBOA 1Y5AT 4E05H 2HOBA 3SUFA 4JZIA 5T1VA 1AGJA 4JYTA 3RXAA 5F53A 1MU6B 2ZTZA 3FVFB 2FM2A 1AHTH 2VH0A 4B6EA 1RIWC 1XVOA 3TJOA 3FZZA 3NCLA 3OU0A 5CE1A 3F9EA 1YLCA 1YWUA 5EJLA 2BD8A 5EODA 2F9OA 2ALVA 2ZU1A 1G3BA 1DVAH 4JZDH 1FLEE 2BD4A 2ZGXH 3QN7A 1AI8H 3K6YA 4ZHAA 2O8WA 6CHAC 2QF0A 1D6WA 4H4FA 2EA3A 2SNWA 2VIVA 3A8AA 3NUMA 1AFQB 3AAVA 1GMDF 1B0FA 5DP9A 1DUAA 3HGNA 1N6XA 2J97A 4IC6A 3A81A 5A8XA 1C1MA 1TX7A 1V2JT 3E8LA 1NRPH 3S9AA 1SLVB 1OYTH 1AWFH 1LHFH 2ANMH 3FN8A 1DICA 3D62A 3TIUA 2FIRH 1O2MA 3ZV9A 1FAXA 3UTUH 4JYUH 3ATWA 1RIWB 2B8OH 2P3TB 1SLWB 1NESE 3TH4H 1GBFA 5LPFA 2IJOB 4WJG2 3URDA 4ABIA 1TNHA 3F6UH 2GTBA 4ISOA 2L6OA 1O2JA 2IOTA 1TOMH 6CHAB 3SQHE 4JZEH 2WPMS 1BTUA 1OP8A 2A7CA 2C4FH 1W13U 4Z0KA 3ZZAA 4K1EA 2BY7X 2K0QA 4ZROA 1GMCG 2Y6TA 1GBIA 2KAIB 3SW2B 4DOQA 1K1JA 2L74A 3ODDA 3SORA 3QUMP 2FOEA 3EYDA 4BAKB 1DM4B 2CV3A 3UIRA 2WYJA 1HRTH 2OINA 1CVWH 4OS4A 1LVOA 5ABWA 1GI4A 1HIAB 1GJ6A 1AO5A 3RDZA 1H8HD 1PFXC 1A3EH 1MBMA 1P12E 2VGCB 4I32A 5DG6A 2PTNA 2JKHA 3LC5A 2KCAA 1SBWA 4GAWA 2ZGJA 2NU0E 4I8KA 3ITIA 4TSFD 2OC1A 4A1XA 4MDSA 1GVLA 2BX4A 3SGQE 1IQLA 1W8BH 1C1QA 2H9EH 5KECA 3OEHD 1V6DA 3LJJA 5SGAE 1BJVA 4A1VA 1ARBA 2G4UA 2AS9A 1K1PA 3DFLA 3SNCA 4CRAA 4YOJA 2D1JA 1O5GH 1DFPA 1XUJA 5IYTA 1GI2A 4DY7B 3U1JB 1N8OC 2FOBA 3SJ9A 3BEIB 2WPHS 2ZCKP 1GVKB 2KCOA 4B1TA 1EKBB 2XWBI 2ZHWH 1JXPA 1ABJH 1ZRKA 1THSH 4FVBA 3ZVGA 4ABGA 1GGDC 1X7AC 1ESTA 3RXBA 3EGKH 1A5HA 1OSSA 1VITF 2A32A 2VWMA 2H2ZA 1S0RA 3VGCC 4M7GA 2P8OC 5EIYA 2ZNKH 3AASA 2C93B 1ZOMA 3SU2A 1FY4A 3TGJE 4FVDA 1ZLRA 2WPDD 3Q3KA 1SI5H 3GY3A 2PP6A 1BMFD 2F9PA 3ENSB 1G30B 1GG6C 2HGTH 3PROA 4ABBA 2BMGB 2PKAA 1SQAA 4BAMB 2HPQH 4ASHA 3SGAE 4I7YH 1NC6A 1AKSB 4D7FA 1N8OB 2YMSC 4YLQH 2VJ1A 3GY4A 8LPRA 2HLDD 1LVYA 1D3TB 1JWTA 1HXEH 4MQAA 2PFEA 3M5MA 3TVJB 5TCAA 3UREA 5A0BA 1O3DA 1GGDB 2HLCA 3KQEA 3SUDA 3HGPA 2G52A 2J9NA 3VGCB 1LKBA 1G36A 2P8OB 4AOQA 4ACBA 1MABB 5DPAA 1AFEH 1TBQH 2BD9A 4DGJA 2O8UA 3ZZ9A 1OXGA 2XCNA 4AB8A 3ZZ8A 4D7GA 3OFND 4K8BA 1RXPA 1GHXH 1MAXA 3U8TH 1SGFA 3OAAD 1TB6H 1CHOF 1GG6B 4Q7ZA 3QDZB 1HUTH 2W3IA 4MNXA 3RXCA 2FEQH 5K0HA 2H6MA 1GDNA 1QL9A 3QGNB 1VCWA 1C4V2 1Y5UT 6ESTA 2YMSB 3RU4D 3SJIA 1P2QA 3ZVDA 1SKYE 1A46H 2PLXA 1UCYH 5C3NA 3NXPA 1P57B 1NTPA 1IQHA 2JH0D 3PTNA 4IS5A 1ABIH 2LNCA 3DD2H 2XWAA 1ORFA 2VVVA 1SHHB 1QRXA 1P01A 4KELA 3S0NA 5A2MH 1TPOA 2GCTC 1OS8A 3E16B 3K2UA 3OSYA 3WWFA 1QHRB 4X8TH 3ZYEA 2ZU4A 3FP7E 2R3YA 1LQDB 1LPZB 5C0UA 1ZTJA 4ZXYH 4BXWA 1ETSH 3BTGE 1A0JA 1A3BH 1GCDA 3NZIA 1ZMLA 1DUEA 3V3MA 5DK1A 3F2HA 3T28A 1EOJA 3MYWA 4AGKA 2HWLB 1HDTH 2VH6A 1UCYE 1V2VT 2FXRA 1H9HE 3B23B 3TJUA 1LHCH 2GD4B 5DO4H 1PPCE 1EP5A 3D49H 4YOGA 2BDHA 2P16A 3LGVA 4K60A 1C1WH 1VITG 1P04A 2QE7D 4YXWD 2IN2A 1O3JA 3MNXA 1MD8A 1GI7B 4LK4A 3MOCA 1C5UA 2ZA5A 3BTME 4WY3A 1Y3UA 2VIOA 1BITA 1P9SA 3DSOA 2BZ6H 3QO6A 1OWIA 2GCTB 5LGOA 1BJUA 2VIQA 4BNRA 3UR6A 3GYLB 1P9UA 1AE5A 1PPFE 3U8OH 2YNBA 4OS5A 1A1RA 3ZYDA 2H9TH 1PPGE 1HFDA 2BQ7B 2OP9A 1SMFE 3S9BA 2V3MA 2XOKD 4GLYA 1WSSH 3UY9A 1WV7H 2QY0B 1A0LA 1L0ZA 5FPTA 3T27A 2JIZD 1SL3A 1T32A 3SQEE 1BRUP 3RXTA 2A0QB 1NPMA 1NU9A 2PV9B 1XUKA 4F48B 2O8MA 2HNTE 1V2OT 1UK3A 5DP6A 3EA7A 1COWD 2V35A 2GV6A 1JMOH 3A7YA 2M2AA 2BDCA 3ZIAD 2UUYA 4R0IA 3AK5A 1INCA 1EPTA 5EQRA 2F43B 3EAJA 3UOUA 2C8YB 2ZDNA 1GJ8B 2BD7A 2D2DA 5J4SA 5F8TA 1CHOG 2FI5E 1GHAF 1GBBA 3MH5A 4Z1MD 2BTCE 1SSXA 4E06H 1GMHF 1DLEA 1TRNA 4I8LA 2A4GA 2AMDA 6LPRA 1XMNB 3MMGA 1NRNH 1DX5M 2FODA 2A4OA 3E3TA 3RU4E 3LGWA 3ZZCA 2CHAB 3EDXB 1YKTA 1NBME 1C2IA 2XRCA 1A61H 3A8BA 3MI4A 4CRFA 4Y10E 4CR5A 1M9UA 1THRH 4B6FA 1BTHH 4X2YA 2KAIA 4XSKU 1EFRD 1W3CA 1P3CA 1Y8TA 2PWXA 2VNTA 3ZZ4A 1V2NT 2OQ5A 1Q2WA 3P70B 1W7XH 4D76A 1O3AA 2JH5D 3KL6A 4NA9H 2BY9X 4FUIA 4WMEA 1VCPA 2ZDMA 3SNEA 2Y82A 3BIUH 4X1QU 2BB4A 2VINA 1XXDA 2ANKH 3BTKE 4RN6A 3RXKA 6GCHF 3G01A 2C3SA 4WVPE 1GBKA 1QNJA 4YTAA 1SLUB 3PB1E 3RXQA 2GCHF 3U98H 1AB9C 1A4WH 5F8ZA 1ID5H 3LIWA 3M35A 4THNH 1O2VA 2GDEH 3M3SA 2GGVB 1CBWC 1WTHD 2AIQA 4VGCC 4X8VH 2K1QA 3AVZA 4HZHA 1Y59T 2BDYA 3VB6A 1ZZZA 2ZC9H 4X8UH 4Y0ZE 1S0QA 2BDAA 4ZMAH 1DWBH 1YLDA 1TQ7B 1QL7A 1K21H 1AWHB 2Z9IA 4K3JA 2WUCA 1RTLA 3SI4H 1KXBA 1WDIA 1YBWA 3BG4C 4XOJA 2GKVE 1BQYA 5AFZH 2ZZUH 1TE0A 1QGFA 3SU3A 1TX6A 1C2LA 1ELFA 3CS7A 4GSOA 4NZQA 5GIBA 1E38B 3TK6A 3BSQA 4MNVA 1IOEA 1KXAA 1AB9B 1MQ6A 2Q1JA 4B73A 3KYGA 1BIOA 3P8OA 1BCUH 3KGPA 3FANA 1OHHD 2Z94A 5C5OA 2VIPA 3O8RA 1C9PA 4VGCB 2RDEA 3T26A 1AKSA 1C4Y2 4P02A 1WOFA 3ZZ3A 3UFAA 1G3CA 2BY8X 1YPGH 1OKXA 3JZ2B 1UK2A 1GI3A 1KXDA 2R9PA 3NK8A 4JK5A 9LPRA 1GHAG 3KF2A 2Z3DA 4SGBE 1FUJA 2BM2A 1JIMA 1QFKH 2H9HA 2VWOA 2JETC 1Q31A 3M5NA 3SBKA 2FS9A 1Z1JA 7GCHF 2FX4A 1ZJDA 2PHBA 2ZFFH 3BG4B 1D9IA 4SGAE 2SGDE 2FTLE 1E36B 1SGFG 4NGAH 4JZFH 2P59A 4OM9A 3MO3A 4YT6H 3U1IB 1MH0A 3UR9A 1Y5BT 4Y0YE 3L3TA 5E0GA 2PKAB 1W11U 1SGYE 4NSYA 2CGAA 1ELTA 2HVYB 3E91A 2OC7A 4ABDA 3F0OA 4M9FA 2XNDD 5EPNA 2Y5FA 1BTZA 3LKWA 3VXEH 1RTKA 4UFFH 4Z6AH 3SNAA 3VEQB 1HJAB 2STAE 2SFAA 1ELCA 4ABEA 1D6RA 1HAHH 2ZPQA 5C1YA 3VPKA 4BAOB 1AZZA 4INKA 2EEKA 1ZSLA 6GCHG 1P06A 1VKYA 3MNBA 5EPYA 1IQKA 4NZLA 4CRDA 4WH6A 1GL1A 2ODYB 3BG8A 3I78A 4AORA 2JETB 2HALA 2GCHG 1AVXA 1UMAH 1EAIA 2FLRH 1GBDA 2OK5A 3SV7A 2J95A 1GBLA 4AC9A 1TABE 1IHSH 1HAVB 1KY9A 5TJXA 1MAYA 2Y80A 1C5YB 3E0PB 1DY9A 1MUEB 3L33A 3B8JA 4ABJA 1IQJA 5JYIA 5B6OA 3KQCA 2TGTA 5EXLA 3BTTE 3TPIZ 3RXUA 1YP9A 2C90B 4FUCA 4IW4E 1SGDE 1HCGA 1UK4A 4NA7A 1C2JA 1VJ9U 1GJ4H 2ZI2H 3PYHA 2DE8A 2H1UA 3QK1A 1UVSH 1TNKA 3IITA 3FP6E 1AUTC 1O5CB 4OS2A 5BPEA 4ZH8A 1BTXA 5DP4A 1GJAB 4F49A 1C4U2 2DE9A 1HJ8A 3RMOH 3KNXA 8KME2 5JBAS 1K9OE 1HAOH 1C5WB 1GJBB 4Y71A 4TPYA 3KQDA 4E7NA 2WZQA 2LELA 1G2MA 2FOHA 5ETXA 5CHAC 2ANYA 3SU1A 4FUBA 1C5TA 1P11E 3MO6A 1O31A 3HATH 1VR1H 4U32A 5EOKA 1K2I1 1EUFA 1NS3A 2WUBA 4UFEH 1H4WA 1ZPCA 1DWCH 2C8ZB 2GDDA 3LGTA 3SN8A 4Y11E 3VB3A 2QXJA 3F3BA 1RJXB 4ZHMU 2KR7A 3O8DA 1GJ5H 4ABHA 1EPTC 7GCHG 4XD7D 1T31A 1DSTA 5E8EH 3RC4A 3GCTF 4KKDA 2GP9B 1FY3A 2FWWA 2W26A 1KTSB 2IJD1 1E34B 1FIWA 1W0JD 1H9LB 2VIWA 4LZ4B 1XUGA 3RU4T 2ZQ2A 5CHAB 2ZHQH 3LH3A 4TYDA 1GJDB 3SZEA 1MZAA 1PYTD 1F7ZA 3LH1A 3S7KB 4KTUA 1KSNA 1PPBH 4INHA 5EQSA 4AG1A 3STIA 1FMGA 1O5BB 4GVUA 3M7UA 4BTIB 1LPKB 1YPHE 4IN1A 2ZGBH 3VXFH 3UNSA 3TNTA 1GI1A 1TONA 4GHQA 4B74A 4FUFA 1V2UT 1CGHA 4NFFA 1YYY1 3F2FA 4FUJA 1S84A 1W2KH 3LJOA 3FO8D 1MD7A 5GJ4B 1SB1H 1EPTB 1O39A 2JJ2D 3LGIA 5FPYA 1GHWH 1BTYA 1QY6A 1UW7A 2WPKS 1FY1A 2FPZA 3V0XA 1BRBE 4ZUHA 3RMLH 1LHEH 3PWCA 1P2MA 3M61U 3RXOA 1TYNA 2XNIA 1TNJA 2VB0A 3SUEA 1GBHA 2ANWA 1YPKH 3QWCH 1E37B 1YY3A 1Y3XA 3PO1C 3GDVA 4FUGA 4J1YA 4CRBA 3SUGA 3P92A 3OY5U 1EAXA 2G81E 4B71A 3GOVB 1HXFH 5TCCA 4X6MA 3RXRA 1LHGH 1C1NA 4FOUC 1ELGA 1K1LA 2JH6D 3Q76A 4F4OC 1TRMA 4R8TB 4YT7H 1K1NA 1O3BA 3T62A 2RFKC 1PPEE 4I86A 3STJA 4YZUA 1TNGA 1T7CA 3DHKH 1IQFA 4RKJB 5AFYH 1UVUH 5GDSH 3MTYA 4HGCA 3V7TA 1EZUC 4NWLA 2ZU3A 1EQ9A 2A4RA 1JOUB 1XKAC 3SU4A 1OP2A 1UVPA 1C5ZB 2J38A 3PLPA 4A7IB 3SHAH 3L6PA 1NM6A 2ZDVH 2LP6A 2V3HH 3KQ5A 3BEUA 3HPTB 4K8YA 3EQ0H 1TPPA 2VWLA 3PV5A 3E6PH 4IN2A 1AE8H 4DG4A 1ELAA 1K0HA 1GHVH 3PO1B 2KM0A 3LPRA 5DP7A 1GI8B 1TBZH 8GCHF 2KX4A 5H4IB 1W7GH 1FPCH 3RMMH 1O3NA 1BMAA 1O2PA 1HLTH 1U6QA 3FKSD 4AYYB 2TGDA 1J17T 3GCTG 3PMHB 2PW8H 5L30H 2A45B 1RRKA 4TY6A 2B9LA 2QF4A 1W0KD 3F0PA 4WXVA 2ZHDA 1V2KT 1MCTA 2FI3E 2I6QA 3N99A 5A0AE 1DITH 5GXPA 2ZFTA 1JIRA 4YESB 4CH8B 4OS1A 2PGBB 3K6ZA 5A09A 4Y79A 1O37A 2QA9E 1SQTA 4B2CA 1QB6A 3MWIU 1AZ8A 4DW2U 5C0TA 1GMDG 1TPSA 4B75A 1BMMH 1C5XB 5EU8A 4X6PA 5EW1H 1HYLA 2OLGA 5EGMA 3KHVA 3CNRA 1FAKH 5EG4A 1MTNC 1SGIB 2FOMB 1ZMJA 5A0CA 2V7QD 1XVMA 1O2OA 5HM9A 1VZQH 1UVTH 4DIHH 1OWKA 1ZPZA 5F8XA 2LPRA 2ZFQH 4AFUA 5IDKA 4X2VA 3PM3A 1Z71A 2NU4E 1C5QA 1FIZA 1Z8IB 3MH4A 4ISIH 5C67A 1KIGH 1V2RT 1CT4E 4IGDA 7KMEH 3CS0A 3OE7D 3SNDA 1PQ7A 2F3CE 5C94A 5GWZA 2F4LA 1GPZA 2CXVA 2HNTF 2QXHA 2RA3A 4O3TA 1V3XA 1YLNA 2ZDKA 2BHGA 3LGUA 1ETTH 1UTLM 4DJZB 3UQOA 1TQ0B 2Z7FE 5LH8A 3E1XB 4KTCA 1P2KA 2Z3EA 5E2PA 2P3FH 5FAHA 1GWAA 1F0UA 1BZXE 4Y7BA 2KZ4A 3GCNA 3ZZ6A 4MNYA 4X1RU 1O2XA 3DSPA 1HAVA 1A5IA 1MTNB 2CMYA 2G00A 2SGFE 2J98A 3D65E 2V6NA 2ZU5A 1VCQA 2PR3A 1T8NA 4RI0A 1ANDA 2Q6DA 3TLOA 5HKKD 2ZFRH 2VVUA 1C1RA 2QN5T 3LGYA 2ESTE 4UEHH 3RM0H 4BANB 4UFGH 1PQAA 3F9HA 1UTNA 1HAXB 3IWMA 2FMJA 3B9FH 3RLYH 5JB9S 1C5OH 1ZTLA 1LVMA 5DP3A 1GVZA 4FU9A 1W0YH 4BTUB 1V2LT 1PPZA 5F6MA 2SGAA 2WPJS 3RP2A 8GCHG 1L4DA 3A87A 3BV9B 1O5AB 4ZCNA 5JBCS 2BLVA 1ESAA 1V2MT 2R2WU 1MKXH 1A2CH 3RXHA 5C17A 1QJ7B 4ABAA 3ZZ7A 3TGKE 4WH8A 2JJ1D 3ODFA 2Z3CA 1P03A 2FOGA 3E0NB 2BD5A 3RMNH 1BOQA 4DT4A 2J5UA 4Q7YA 1SGRE 2FI4E 1FONA 4B76A 4MLFB 1TGCA 1NT1A 1O3GA 2BVRH 3KQBA 5FBIA 2B0FA 4TT3D 1NFYA 2CF9H 4IMZA 2ZHFH 3D23A 5E2OA 1ACBE 1F5LA 5CMXH 4J2YB 1E79D 1P05A 1SGCA 2UWPA 2BYAX 4GUXA 3UOPA 2G55A 4AN7A 1KLTA 4I31A 4FUEA 2QXGA 3BTQE 4ISLA 1G2LA 1ZMNA 2IPHA 1P09A 3RM2H 3WWBA 1XKBC 3M3TA 1VGCC 5C1XA 4NCYA 5K7RA 2FDAA 1H9IE 1S5SA 4BTTB 3MFJA 3ZVBA 2HNTC 1LQEA 1ELDE 1UCYK 1SR5C 4ISNA 4AG2A 2O9QA 1UHBA 1OP0A 1ZRBA 1ZGIA 3M37A 3H7TA 3KN2A 1HPGA 3W94A 4X0WU 4BOHA 5EW2H 5L2ZH 2F9BH 2SGQE 3RC5A 3U69H 8ESTE 1QJ6B 2WINI 2WV4A 1O3PB 1C5VA 5T6DA 1FI8A 1SHYA 5JBBS 3MHWU 3PMAB 3RXPA 1NN6A 3T29A 2ALPA 2BQWB 1ESBA 2W7UA 3DCLA 3JZ1B 1MKXK 1KYNA 2EY4C 1HAZB 3HK6B 4H42U 2OTVA 1KLJH 1O32A 1AY6H 2AGIX 4IC5A 2W6ID 4I8GA 1HAIH 1SPJA 2FP7B 2OUAA 2RDLA 3PWBA 4YOIA 1ZPBA 3MQKC 5LPEA 1K22H 1IQNA 3F1SB 4MPWA 1S6LA 2KCYA 3N7DA 3SO3A 5J4QA 4X1PU 3M5OA 3KYFA 2QCYA 2Y7XA 3SU5A 3EA8A 1C2MA 2A5IA 1BRCE 2A2XH 4JZ1A 1WBGB 4DURA 1QL8A 2GZ9A 2PKSC 1IAUA 4LZ1H 1W0ZU 3U8RH 3BTHE 1Z6JH 2WHXA 5DKMA 2WPIS 3M36A 4B2AA 1EZSC 1MTSA 1CGJE 1G32B 1MTWA 1O2YA 5FL7D 5AF9H 1NY22 2XTTB 3LU9B 3Q77A 3M5LA 1RD3B 1LHDH 3SV9A 1O2ZA 3A7TA 3QTVH 2G5NA 1TRYA 1QIXB 4IMQA 2UWLA 5AHGH 5EXNA 4DIIH 1NFUA 1RS0A 3TNSA 3GY5A 1O3HA 3SV2H 3I77A 1UO6A 3AW1A 4ZXXH 3RC6A 4Q2KA 3F2GA 4AGJA 2G5VA 1Q3XA 1O2TA 3MNCA 2BY5X 5ESBA 2TPIZ 1THPB 3OEED 3IG6B 4AZ2B 2V3OH 2ZF0H 4D8NA 1O35A 2PKSB 3EE0B 3U28C 5EJZA 3BTFE 1LKAA 1GBTA 2GVFA 1UTMA 2GT7A 3PLBA 2FOAA 3ATIA 1H8IH 2A2QH 3PMBB 4JCNA 2BLWA 2OXSA 3K9XB 4MNWA 1O2GH 4YO9A 1T8OA 1JRSA 3MH6A 5FBEA 2A4QA 3SU6A 1N1LA 2ZO3H 1W12U 3OYPA 2PUQH 3M7TA 1CBWB 2J34A 2OBOA 3HKJB 1GHBF 3EA9A 2A7JA 2QAAA 5C5NA 1E0FD 3A7WA 1KTTB 1Z8GA 1SQOA 5HYOA 1MU8B 1QTFA 2AFQB 1GMHG 1TA2A 2GT8A 2K8IA 2G8TA 1BRAA 1Z1IA 3UWJH 1XUIA 1FZZA 2UUKB 1LVBA 1A0HB 1DXWA 4KGAA 2IPQX 5JPMH 1FY5A 2GMTC 1AQ7A 1C5LH 2AH4X 4X6OA 1S83A 2QXIA 2QGRA 2XBXA 3QLPH 1GBAA 1OWDA 4FXGH 1C9TA 1WYKA 2O8LA 3MO9A 5PTPA 2J94A 1TMBH 3QTOH 1GI9B 1GDQA 3W95A 1DT2A 4U30A 3V13A 3TJNA 2FYQA 1XM1A 4Y76A 4NA8A 5E0HA 2XW9A 1O3KA 1QQUA 4TWYA 3GCHC 1Y3VA 1P8VC 3QX5H 3A7XA 1HNEE 1V2TT 3RXVA 1PQ8A 1WQSA 3A89A 1RGQA 3C27B 3RXJA 2FO9A 3BIVH 2J98B 2EI7A 3TJVA 1L4ZA 2OC8A 1O2LA 1FDPA 1H8DH 1H8ED 2A1DB 3NRLA 2ZHEH 2FX6A 5IK2D 2NU2E 1QQ4A 1WU1A 2WV9A 3GDUA 1ZYOA 1NFWA 3UAIC 1WUNH 1P10A 4UE7H 1C2GA 2BXTH 1E1QD 1BUIA 5L6NH 3GY8A 1NZQH 1TALA 1ZHRA 4FUHA 1CA8B 2FZZA 1DXPA 1DWDH 1ZR0A 1IQEA 1AU8A 2AHME 3H09A 1TNLA 1C2HA 5KGOA 1QA7A 1E35B 1GBMA 1KDQB 3GCHB 1NFXA 3FAOA 4NIYA 1DE7H 4TY7A 2XBYA 2HPPH 1SGNE 1NO9H 1GL0E 1GI6A 1TA6A 3MU0A 2W6JD 1QB9A 2SGEE 2GV7A 1TGBA 4AFQA 1GBEA 3TGIE 1GHBG 2ZDAH 4WF8A 1HGTH 4ZHLU 3T25A 1SGPE 1ELBA 2EC9H 1TNIA 1G37A 1GJCB 3FFGA 3EE7A 1QB1A 5FXLA 2FYRA 1ZJKA 3R3GB 3P8FA 4KTSA 2W7SA 1TOCB 2AEIH 1T4UH 2XXLA 3Q3XA 1EATA 1SGQE 2UUJB 1LO6A 1LPGB 4ISHH 1P2OA 1NRSH 3HK3B 4O03A 2V0BA 5BRRE 3BTDE 3UUZA 1EAWA 2J4IA 4Y8XA 1ELVA 1L1GA 1O3EA 1S81A 1LDTT 2Z6BD 3N7OA 3NKKA 1QRZA 1JRTA 1OPHB 2QIQA 4XBBA 4K5ZA 3A8CA 2D8WA 4XFQA 4ZKSU 1YPHC 2ZDLA 4LXBH 1EB1H 4AFSA 1TIOA 2W3KA 1O2NA 1GI5A 4A5TS 4NG9H 1UHBB 2SNVA 1EP6A 4Y8YA 1KLIH 3CP7A 5HXFA 3ATMA 1O34A 1SFQB 1YM0A 2AIPA 2B5TB 2BQ6B 2BXUH 5HIZA 1ZGVA 1J8AA 2P94A 2OBQA 1WQVH 4YM9A 5FPSA 2P95A 3M3VA 1T4VH 2ZPRA 4DVAU 3KCGH 4HI3A 1LTOA 2Z9KA 3O8CA 2BDIA 2FOCA 2F9UA 1BTWA 3I29A 4DCDA 2RA0A 3H7OA 1SC8U 1F5KU 2Y81A 5T6FA 1YPMH 1WXRA 4XDEA 1C1UH 1QRWA 1C2DA 3Q3YA 1D3QB 4KP0A 3KEEA 4INLA 2VGCC 4FUDA 2R0KA 3VFEA 1UVOA 5DSFA 2F9VA 2YMSD 4ACAA 1O3CA 4UDWH 1BBRH 1DY8A 2EQNA 1CHGA 1YPJH 4K2YA 3ZVCA 1MTUA 2VU8E 1NRRH 3URCA 1EXFA 3A8DA 1ZHMA 1C2EA 4X1SU 4LOYH 1T8MA 1ZHPA 2ZG0H 4WXIA 4RT1A 1A7SA 1O2SA 2C8WB 5FX6A 1GI0A 3F9FA 2BD2A 5DJ7A 1HAYB 1MBQA 4MPUA 4YLUA 4TPIZ 1OYQA 1CU1A 1LMWB 3LC3A 1V2WT 4MTBA 1TMTH 4MG3A 3P17H 1BBRE 3Q00A 2VVCA 3N7EA 5HMAA 2BDBA 3SNBA 1DLKB 2G4TA 1GJ7B 1HB0B 2ZU2A 1F0RA 2AGGX 4Y6DA 3TK9A 1AN1E 1ETRH 3SYJA 7ESTE 3MH7A 4ZKOU 1T8LA 1AVWA 1QCPA 4UFDH 1J9CH 1KXEA 1O5DH 5LPRA 1WTGH 3LDXH 1PYTC 2O8TA 1Z8RA 3UNRA 4Q4LA 3QZRA 3E90B 2R3UA 1SLXB 4OGXA 5C2ZA 3UWIA 1F2SE 2XYAA 4I33A 2P93A 3QZQA 4ZKNU 1HAPH 1OOKB 3HKIB 4Q63A 3RLWH 1V2QT 1ZTKA 2TIOA 2RG3A 2FESH 4CBNA 1GCTC 1O2QA 5CDFE 1K1MA 1P2NA 3F9GA 1C1PA 1VJAU 3WW7A 1BBRK 1OWJA 5I46H 2HVXA 2W5EA 1W10U 1N6YA 1TPAE 4HG6A 1O2WA 3VG8A 4UD9H 2OCVB 5DP8A 2A5KA 3LT3A 2BY6X 4ZKRU 2F91A 2BOHB 3ZVEA 3A82A 1BA8B 2AMQA 3ZZ5A 2OD3B 4K1TA 3RXSA 4BAQB 1RFNA 1TMUH 2F9NA 5GCHF 2CJIA 1UTQA 2WV5A 1C1SA 1F5RA 2G51A 2QV1A 3GYMA 5CHBA 3RXIA 1D4PB 3ZZBA 3A80A 5F03A 2GZ7A 1YC0A 3KIDU 3PV4A 1YPEH 2UUFB 2ASUB 5GNDA 3A7ZA 4JYVH 3OX7U 3FZDA 4CR9A 3PRDA 5FCKA 1NU7B 5HM2A 1GCTB 4IBLH 1Y3YA 1HAGE 1SGEE 3SJKA 4AFZA 1QZ8A 4X6NA 1CSOE 3RUOA 1FJSA 4Q80A 4I8JA 1O2HA 2ZGCA 3RXDA 2BLOA 4NIWA 1GBJA 1FY8E 2STBE 3GS9A 2B7DH 4H6SB 2TBSA 3A88A 2DUCA 3PMJA 4HFPB 1EJAA 3A83A 3GDSA 4NIXA 1TFXA 4UONA 3PRBA 1IQIA 1KDQA 1B7XB 1ANBA 1IQMA 1W14U 3SOSA 1H1BA 1WCZA 2Z9LA 1QBNA 2EI6A 4Y7AA 1BDAA 1BT7A 2THFB 1O5FH 1NBMD 1TGTA 4OS7A 1FQ3A 4CRGA 4RSPA 1O2IA 1TBRH 1CQQA 3M7QA 1QA0A 2BOKA 1SG8B 1C5SA 1VITH 4X8SH 5FHTA 4D9RA 1C1TA 1V2PT 5EQQA 1L2EA 2NU3E 4GCHF 3UQVA 3C1KA 4H6TA 3ZZDA 1PJPA 3K65B 1DDJA 4CREA 3O8BA 2ZGHA 4O3UA 4WWYA 3VB5A 4B2BA 1FV9A 1IHTH 2NWNA 1O3LA 1O3OA 1UJ1A 2A31A 1IQGA 1MMJN 3DT0H 3LOXA 3R0FA 3S69A 1DOJA 1HV7A 2QF5A 2XC5A 3AW0A 3GY6A 5DP5A 5FX5A 3BF6H 1SOTA 1F0TA 4Y8ZA 3DFJA 3FP8E 3TH3H 4A6LA 2ZCHP 3PTBA 2A5AA 1OWHA 3A7VA 1DS2E 1MCVA 2GZ8A 2Q6FA 3H5CB 1ELEE 1MQ5A 1L1JA 1YPLH 1XUHA 4WMDA 2JDID 1TWXB 1B5GH 1Z8JB 1BMLA 3UB0A 1DWEH 1E1RD 1A5GH 3BN9A 1J16A 2BVSH 1O2KA 5GCHG 3BEFB 3DUXH 5G4BA 1K1OA 3NPSA 3P95A 1WAYB 4DT7B 2ODPA 1AVGH 1EOLA 3NWUA 3T5FH 1J15A 2PSXA 5T3HA 3CENA 1UTJA 2CHAC 2ODQA 2Y5GA 4K1SA 2C8XB 4MPXA 2A7HA 2WPLS 2ZP0H 1Z6EA 2J92A 4AX9H 9ESTA 1AMHA 3SI3H 1F0SA 4CBOA 1EJNA 3ATLA 1YF4A 1CT2E
chains in the Genus database with same CATH topology
1BHXF 2QYIA 1C2KA 1MZDA 1O36A 1SFIA 4MVNA 5E0JA 1VGCB 5JB8S 1GHYH 1XX9A 3TH2H 2ZIQH 1AD8H 1EAUA 4U2WA 2ZFSA 1Y3WA 2P3UB 2QF3A 2ZECA 1P02A 1AUJA 1O3IA 1O33A 4JMYA 3P8GA 4NFEA 4RKOB 3SJOA 7LPRA 1RTFB 1TGSZ 3GCOA 2NU1E 1LCYA 3MU1A 4FU8A 4MPVA 4XBDA 2GX4A 5AVDA 1O2UA 4X2XA 4E7RG 1ANEA 4GCHG 4I8HA 1MKWH 1HIAA 1TGNA 1YGCH 3MU8A 5HGGA 4TWWA 5FCRA 3RXLA 2PUXB 1EB2A 4CRCA 3AAUA 5I25A 2YNAA 2ZFPH 4NSVA 1O2RA 3ESTA 2XBVA 3A84A 2BD3A 1O5EH 3MNSA 1O0DH 1EZXC 2ILNA 1D3PB 5A8ZA 3BTWE 1PQ5A 2HRVA 1QR3E 2CN0H 2EI8A 1BTPA 3V12A 1GDUA 2UWOA 1G3EA 2BDGA 1TAWA 3SJ8A 2I6SA 4ESTE 2M5TA 2ULLA 3LONA 1OX1A 5GPIB 3SU0A 3ZVAA 3SHCH 2PTCE 4OGYA 1L1NA 2RCEA 4NWKA 3A86A 4XE4A 2PSYA 1P2IA 4U01A 2VWNA 4HTCH 1O3MA 5L2YH 2J2UA 1F92A 3RXEA 4QT8C 2Q6GA 1YCPM 2ZTYA 2D26C 1C5MD 1C1VH 3GY2A 5JDUB 3S7HB 1DPOA 1UTKA 4CHAC 2BZAA 4ZAEA 1QJ1B 3ZV8A 1YCPH 1ZSKA 2ZEBA 4BAHB 3MU4A 1SVPA 1CO7E 2H5CA 1HJAC 3ATKA 1XXFA 3VB4A 4CH2B 2SGPE 3A85A 1FPHH 1S82A 4OS6A 1GBCA 3SZNA 2XC4A 3OY6U 1MKWK 1S6FA 4JK6A 1BMNH 2F83A 4Q7XA 1D3DB 2BX3A 5ESTE 3TK5A 5C20A 1O38A 2FS8A 3T2NA 3SV8A 1C2FA 1J14A 3UNQA 4AB9A 2R0LA 1QBVH 1CE5A 4O9VA 2QC2A 4A1TA 1P2JA 4D9QA 4X2WA 2XCFA 1P3EA 4FU7A 1EJMA 1XUFA 2H5DA 1BHXB 1C5PA 2AYWA 4CHAB 3PLKA 3MU5A 3GICB 2OQUA 1SOZA 4WMFA 1DSUA 3QGJA 3RXMA 2GMTB 2Z9GA 1ANCA 1CA0C 1V2ST 5C1UA 1K28D 1CGIE 1C1OA 3SV6A 4O97A 4GHTA 1HJ9A 2TGAA 2TGPZ 3S9CA 3WY8A 4K69A 2AMPA 1NRQH 1G3DA 3P8NA 1JBUH 1O3FA 3P6ZB 2YOLA 1UTOA 2XC0A 1PPHE 5EXMA 5DGJA 1NROH 4PROA 1FN8A 1CT0E 2FOFA 3VB7A 2FTMA 1AIXH 2BVXH 3TITA 4ABFA 3U9AH 5A8YA 1TX8A 3DA9B 3UPEA 2WYGA 1EX3A 1YCPK 2R2MB 1SGTA 1G9IE 1EASA 1FN6A 1HBTH 4A92A 1ZSJA 1KXFA 1Z7KA 1GJ9B 3GY7A 4GPGA 2PGQB 1UTPA 1BB0B 1FXYA 1C5RA 3BTEE 1GMCF 2ZWLH 3RXGA 5JBTA 2ZTXA 2XBWA 2ZQ1A 1CA0B 1MTVA 1ARCA 4XBCA 2ZPSA 3ZVFA 1QURH 2Y5HA 2CF8H 1P0SH 2Y7ZA 3TU7H 2ZKSA 2BLQA 2FLBH 4AYVB 2Z9JA 3ELAH 1TLDA 2OC0A 3RXFA 2AGEX 1S6HA 4X1NU 3GISB 1C5NH 1KXCA 3SGBE 1DANH 1O30A 2ZCLP 4BXSA 2AERH 4NIVA 1AFQC 1S85A 5T6GA 1GHZA 1OWEA 1EZQA 3F68H 1B0EA 3OTJE 1FNIA 2TRMA 2VIDA 1K1IA 1QBOA 1Y5AT 4E05H 2HOBA 3SUFA 4JZIA 1AGJA 4JYTA 3RXAA 1MU6B 2ZTZA 3FVFB 2FM2A 1AHTH 2VH0A 1RIWC 1XVOA 3TJOA 3FZZA 3NCLA 3OU0A 5CE1A 3F9EA 1YLCA 2BD8A 5EODA 2F9OA 2ALVA 2ZU1A 1G3BA 1DVAH 4JZDH 1FLEE 2BD4A 2ZGXH 3QN7A 1AI8H 3K6YA 4ZHAA 2O8WA 6CHAC 2QF0A 1D6WA 4H4FA 2EA3A 2SNWA 2VIVA 3A8AA 3NUMA 1AFQB 3AAVA 1GMDF 1B0FA 5DP9A 1DUAA 3HGNA 1N6XA 4IC6A 3A81A 5A8XA 1C1MA 1TX7A 1V2JT 3E8LA 1NRPH 3S9AA 1SLVB 1OYTH 1AWFH 1LHFH 2ANMH 1DICA 3D62A 3TIUA 2FIRH 1O2MA 3ZV9A 1FAXA 3UTUH 4JYUH 3ATWA 1RIWB 2B8OH 2P3TB 1SLWB 1NESE 3TH4H 1GBFA 5LPFA 2IJOB 4WJG2 3URDA 4ABIA 1TNHA 3F6UH 2GTBA 4ISOA 1O2JA 2IOTA 1TOMH 6CHAB 3SQHE 4JZEH 2WPMS 1BTUA 1OP8A 2A7CA 2C4FH 1W13U 4Z0KA 3ZZAA 4K1EA 2BY7X 4ZROA 1GMCG 2Y6TA 1GBIA 2KAIB 3SW2B 4DOQA 1K1JA 3ODDA 3SORA 3QUMP 2FOEA 3EYDA 4BAKB 1DM4B 2CV3A 3UIRA 2WYJA 1HRTH 2OINA 1CVWH 4OS4A 1LVOA 5ABWA 1GI4A 1HIAB 1GJ6A 1AO5A 3RDZA 1PFXC 1A3EH 1MBMA 1P12E 2VGCB 4I32A 5DG6A 2PTNA 2JKHA 3LC5A 1SBWA 4GAWA 2ZGJA 2NU0E 4I8KA 3ITIA 2OC1A 4A1XA 4MDSA 1GVLA 2BX4A 3SGQE 1IQLA 1W8BH 1C1QA 2H9EH 1V6DA 3LJJA 5SGAE 1BJVA 4A1VA 1ARBA 2G4UA 2AS9A 1K1PA 3DFLA 3SNCA 4CRAA 4YOJA 2D1JA 1O5GH 1DFPA 1XUJA 5IYTA 1GI2A 4DY7B 3U1JB 1N8OC 2FOBA 3SJ9A 3BEIB 2WPHS 2ZCKP 1GVKB 4B1TA 1EKBB 2XWBI 2ZHWH 1JXPA 1ABJH 1ZRKA 1THSH 4FVBA 3ZVGA 4ABGA 1GGDC 1X7AC 1ESTA 3RXBA 3EGKH 1A5HA 1OSSA 1VITF 2A32A 2VWMA 2H2ZA 1S0RA 3VGCC 4M7GA 2P8OC 2ZNKH 3AASA 2C93B 1ZOMA 3SU2A 1FY4A 3TGJE 4FVDA 1ZLRA 3Q3KA 1SI5H 3GY3A 2F9PA 3ENSB 1G30B 1GG6C 2HGTH 3PROA 4ABBA 2BMGB 2PKAA 1SQAA 4BAMB 2HPQH 4ASHA 3SGAE 4I7YH 1NC6A 1AKSB 4D7FA 1N8OB 4YLQH 2VJ1A 3GY4A 8LPRA 1LVYA 1D3TB 1JWTA 1HXEH 4MQAA 2PFEA 3M5MA 3TVJB 5TCAA 3UREA 5A0BA 1O3DA 1GGDB 2HLCA 3KQEA 3SUDA 3HGPA 2G52A 2J9NA 3VGCB 1LKBA 1G36A 2P8OB 4AOQA 5DPAA 1AFEH 1TBQH 2BD9A 4DGJA 2O8UA 3ZZ9A 1OXGA 2XCNA 4AB8A 3ZZ8A 4D7GA 4K8BA 1RXPA 1GHXH 1MAXA 3U8TH 1SGFA 1TB6H 1CHOF 1GG6B 4Q7ZA 3QDZB 1HUTH 2W3IA 4MNXA 3RXCA 2FEQH 5K0HA 2H6MA 1GDNA 1QL9A 3QGNB 1VCWA 1C4V2 1Y5UT 6ESTA 3RU4D 3SJIA 3ZVDA 1P2QA 1A46H 2PLXA 1UCYH 5C3NA 3NXPA 1P57B 1NTPA 1IQHA 2JH0D 3PTNA 4IS5A 1ABIH 2LNCA 3DD2H 2XWAA 1ORFA 2VVVA 1SHHB 1QRXA 1P01A 4KELA 3S0NA 5A2MH 1TPOA 2GCTC 1OS8A 3E16B 3K2UA 3OSYA 1QHRB 4X8TH 3ZYEA 2ZU4A 3FP7E 2R3YA 1LQDB 1LPZB 1ZTJA 4ZXYH 4BXWA 1ETSH 3BTGE 1A0JA 1A3BH 1GCDA 3NZIA 1ZMLA 1DUEA 3V3MA 5DK1A 3T28A 1EOJA 3MYWA 4AGKA 2HWLB 1HDTH 2VH6A 1UCYE 1V2VT 2FXRA 1H9HE 3B23B 3TJUA 1LHCH 2GD4B 5DO4H 1PPCE 1EP5A 3D49H 4YOGA 2BDHA 2P16A 3LGVA 4K60A 1C1WH 1VITG 1P04A 2IN2A 1O3JA 3MNXA 1MD8A 1GI7B 4LK4A 3MOCA 1C5UA 2ZA5A 3BTME 4WY3A 1Y3UA 2VIOA 1BITA 1P9SA 2BZ6H 3QO6A 1OWIA 2GCTB 5LGOA 1BJUA 2VIQA 4BNRA 3UR6A 3GYLB 1P9UA 1AE5A 1PPFE 3U8OH 2YNBA 4OS5A 1A1RA 3ZYDA 2H9TH 1PPGE 1HFDA 2BQ7B 2OP9A 1SMFE 3S9BA 4GLYA 1WSSH 3UY9A 1WV7H 2QY0B 1A0LA 1L0ZA 5FPTA 3T27A 1SL3A 1T32A 3SQEE 1BRUP 3RXTA 2A0QB 1NPMA 1NU9A 2PV9B 1XUKA 2O8MA 2HNTE 1V2OT 1UK3A 5DP6A 3EA7A 2V35A 2GV6A 1JMOH 3A7YA 2BDCA 2UUYA 4R0IA 1INCA 1EPTA 5EQRA 3EAJA 3UOUA 2C8YB 2ZDNA 1GJ8B 2BD7A 2D2DA 5J4SA 5F8TA 1CHOG 2FI5E 1GHAF 1GBBA 3MH5A 2BTCE 1SSXA 4E06H 1GMHF 1DLEA 1TRNA 4I8LA 2A4GA 2AMDA 6LPRA 1XMNB 3MMGA 1NRNH 1DX5M 2FODA 2A4OA 3E3TA 3RU4E 3LGWA 3ZZCA 2CHAB 3EDXB 1YKTA 2XRCA 1C2IA 1A61H 3A8BA 3MI4A 4CRFA 4Y10E 4CR5A 1M9UA 1THRH 1BTHH 4X2YA 2KAIA 4XSKU 1W3CA 1P3CA 1Y8TA 2PWXA 2VNTA 3ZZ4A 1V2NT 2OQ5A 1Q2WA 3P70B 1W7XH 4D76A 1O3AA 2JH5D 3KL6A 4NA9H 2BY9X 4FUIA 4WMEA 1VCPA 2ZDMA 3SNEA 2Y82A 3BIUH 4X1QU 2BB4A 2VINA 1XXDA 2ANKH 3BTKE 4RN6A 3RXKA 6GCHF 3G01A 2C3SA 4WVPE 1GBKA 1QNJA 4YTAA 1SLUB 3PB1E 3RXQA 2GCHF 3U98H 1AB9C 1A4WH 5F8ZA 1ID5H 3LIWA 3M35A 4THNH 1O2VA 2GDEH 3M3SA 2GGVB 1CBWC 1WTHD 2AIQA 4VGCC 4X8VH 2K1QA 3AVZA 4HZHA 1Y59T 2BDYA 3VB6A 1ZZZA 2ZC9H 4X8UH 4Y0ZE 1S0QA 2BDAA 4ZMAH 1DWBH 1YLDA 1TQ7B 1QL7A 1K21H 1AWHB 2Z9IA 4K3JA 2WUCA 1RTLA 3SI4H 1KXBA 1YBWA 3BG4C 4XOJA 2GKVE 1BQYA 5AFZH 2ZZUH 1TE0A 1QGFA 3SU3A 1TX6A 1C2LA 1ELFA 3CS7A 4GSOA 4NZQA 5GIBA 1E38B 3TK6A 3BSQA 4MNVA 1IOEA 1KXAA 1AB9B 1MQ6A 2Q1JA 4B73A 1BIOA 3P8OA 1BCUH 3KGPA 3FANA 2Z94A 5C5OA 2VIPA 3O8RA 1C9PA 4VGCB 3T26A 1AKSA 1C4Y2 3ZZ3A 1WOFA 3UFAA 1G3CA 2BY8X 1YPGH 1OKXA 3JZ2B 1UK2A 1GI3A 1KXDA 2R9PA 3NK8A 4JK5A 9LPRA 1GHAG 3KF2A 2Z3DA 4SGBE 1FUJA 2BM2A 1JIMA 1QFKH 2H9HA 2VWOA 2JETC 1Q31A 3M5NA 3SBKA 2FS9A 1Z1JA 7GCHF 2FX4A 1ZJDA 2PHBA 2ZFFH 3BG4B 1D9IA 4SGAE 2SGDE 2FTLE 1E36B 1SGFG 4NGAH 4JZFH 2P59A 3MO3A 4YT6H 3U1IB 1MH0A 3UR9A 1Y5BT 4Y0YE 3L3TA 5E0GA 2PKAB 1W11U 1SGYE 4NSYA 2CGAA 1ELTA 3E91A 2OC7A 4ABDA 5EPNA 2Y5FA 1BTZA 3LKWA 3VXEH 1RTKA 4UFFH 4Z6AH 3SNAA 3VEQB 1HJAB 2STAE 2SFAA 1ELCA 4ABEA 1D6RA 1HAHH 2ZPQA 5C1YA 3VPKA 4BAOB 1AZZA 4INKA 2EEKA 1ZSLA 6GCHG 1P06A 3MNBA 5EPYA 1IQKA 4NZLA 4CRDA 4WH6A 1GL1A 2ODYB 3BG8A 3I78A 4AORA 2JETB 2HALA 2GCHG 1AVXA 1UMAH 1EAIA 2FLRH 1GBDA 3SV7A 2J95A 1GBLA 1TABE 1IHSH 1HAVB 1KY9A 5TJXA 1MAYA 2Y80A 1C5YB 3E0PB 1DY9A 1MUEB 3L33A 3B8JA 4ABJA 1IQJA 5JYIA 5B6OA 3KQCA 2TGTA 5EXLA 3BTTE 3TPIZ 3RXUA 1YP9A 2C90B 4FUCA 4IW4E 1SGDE 1HCGA 1UK4A 4NA7A 1C2JA 1VJ9U 1GJ4H 2ZI2H 3PYHA 2DE8A 2H1UA 3QK1A 1UVSH 1TNKA 3IITA 3FP6E 1AUTC 1O5CB 4OS2A 5BPEA 4ZH8A 1BTXA 5DP4A 1GJAB 4F49A 1C4U2 2DE9A 1HJ8A 3RMOH 3KNXA 8KME2 5JBAS 1K9OE 1HAOH 1C5WB 1GJBB 4Y71A 4TPYA 3KQDA 4E7NA 1G2MA 2FOHA 5ETXA 5CHAC 2ANYA 3SU1A 4FUBA 1C5TA 1P11E 3MO6A 1O31A 3HATH 1VR1H 4U32A 5EOKA 1K2I1 1EUFA 1NS3A 2WUBA 4UFEH 1H4WA 1ZPCA 1DWCH 2C8ZB 2GDDA 3LGTA 3SN8A 4Y11E 3VB3A 2QXJA 1RJXB 4ZHMU 3O8DA 1GJ5H 4ABHA 1EPTC 7GCHG 1T31A 1DSTA 5E8EH 3RC4A 3GCTF 4KKDA 2GP9B 1FY3A 2FWWA 2W26A 1KTSB 1E34B 1FIWA 1H9LB 2VIWA 4LZ4B 1XUGA 3RU4T 2ZQ2A 5CHAB 2ZHQH 3LH3A 4TYDA 1GJDB 1MZAA 1PYTD 1F7ZA 3LH1A 3S7KB 4KTUA 1KSNA 1PPBH 4INHA 5EQSA 4AG1A 3STIA 1FMGA 1O5BB 4GVUA 3M7UA 4BTIB 1LPKB 1YPHE 4IN1A 2ZGBH 3VXFH 3UNSA 3TNTA 1GI1A 1TONA 4GHQA 4B74A 4FUFA 1V2UT 1CGHA