2FM2A

Hcv ns3-4a protease domain complexed with a ketoamide inhibitor, sch446211
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
181
structure length
181
Chain Sequence
APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords NS3 protease/helicase
publication title Mutations conferring resistance to SCH6, a novel hepatitis C virus NS3/4A protease inhibitor. Reduced RNA replication fitness and partial rescue by second-site mutations
pubmed doi rcsb
source organism Hepatitis c virus
total genus 42
structure length 181
sequence length 181
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fm2A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2fm2A01
1O2OA 1D6WA 1MTWA 3SUGA 3Q00A 4ABFA 1TWXB 2FDAA 3SQEE 2AERH 1UVPA 1MZDA 1GI3A 2OINA 1S6HA 5AFZH 1AD8H 3E6PH 2ZFQH 3LPRA 1WSSH 5L2ZH 1VJAU 1XXDA 2M5TA 2UWLA 2EA3A 3OX7U 1JXPA 1SQAA 4DVAU 3IWMA 5G4BA 3STIA 1MU6B 3A86A 1X7AC 3ATMA 2Z9GA 3E16B 3OYPA 3ZZ8A 1OWDA 2EI6A 3D23A 4YT7H 4GCHG 2QF3A 3DA9B 4WVPE 3GY8A 3B9FH 2A4GA 3GY2A 3QGNB 3A85A 1EPTB 2QXGA 4FUGA 3DFLA 3HK6B 5HM9A 3F1SB 1HV7A 3NWUA 1A61H 2J38A 1NRRH 1GHWH 3FP6E 1ZTJA 2RA3A 5GWZA 1AN1E 2GT7A 1FONA 1H9HE 3PLPA 1SGTA 3LJOA 2CXVA 2ZKSA 1LPKB 4BOHA 1P2QA 1YLDA 1A4WH 1UHBB 5DGJA 2V3HH 4A5TS 2AGIX 2FOGA 1HJ9A 2VH0A 3RLYH 3UOPA 4E05H 4MTBA 1ZTLA 2A7CA 1C1TA 1FY1A 4JMYA 3K6YA 4I8JA 2BM2A 3TGKE 1FIWA 1SG8B 3KNXA 1QJ7B 3KQCA 1NFXA 5AFYH 1FZZA 1XX9A 3OU0A 1BTXA 2Y7XA 5B6LA 4YTAA 3LONA 2QXHA 3Q3KA 5GCHF 4A1XA 1AB9C 1C4V2 1Q2WA 2R0LA 2H2ZA 2H5DA 1MD8A 2ZDAH 4Z0KA 2P94A 1HAYB 2GMTC 2WPKS 3O8CA 5T6FA 2Y7ZA 1BBRH 3AVZA 2JETC 1BB0B 3AW0A 1CBWC 2ZPRA 2ZDVH 2GCTC 3M5LA 2SGQE 1V2QT 3PMHB 1KYNA 1GHAF 1TIOA 4Q7XA 2FYRA 1HCGA 5L2YH 2BY6X 4NA8A 2FOCA 1V2MT 1ZTKA 3E8LA 4MQAA 3ZZBA 3JZ2B 1HLTH 3VB6A 3KIDU 3T5FH 3O8RA 1SVPA 5GXPA 4KTCA 1OWKA 1GMDF 1EASA 1SGPE 2ZGXH 2G8TA 3QDZB 1DFPA 1O3DA 1LVBA 2BDAA 1GGDC 1ABJH 1TRMA 5H4IB 3TJNA 1W3CA 4K5ZA 3ZVEA 3SYJA 2WPIS 2VH6A 2ODPA 2J92A 3T62A 1GDNA 1D3QB 1G3BA 6GCHG 3U8OH 3PO1B 1TNKA 2C4FH 1BBRE 4HI3A 4F49A 1UMAH 4MDSA 4UONA 1UTQA 2VIDA 5FPYA 2AMPA 1GBFA 1XUIA 1LVYA 3HK3B 2ZWLH 1V2RT 1GCDA 1TONA 2ZHEH 3QLPH 4K8BA 3RU4T 4X2WA 1SSXA 2XRCA 4TPIZ 2P8OC 2A4RA 2Y80A 1HAZB 4H6SB 4R0IA 2W7UA 3RMOH 4AG1A 1RXPA 2Y5FA 1FLEE 3RXQA 2BQ6B 1EZXC 2CHAB 4ZKSU 5J4QA 1FAKH 1TBQH 2OK5A 5EOKA 2ZHQH 1YPMH 2HNTE 2BQ7B 2Z3EA 1NRNH 4AX9H 2P93A 2AMDA 3RXJA 1ELAA 1C1SA 1O30A 3RXFA 2D2DA 1GBHA 1W12U 3GY6A 2O8UA 2DE8A 3RXBA 2P3TB 2ZG0H 3K65B 4K1SA 5DKMA 3SU2A 1UTKA 2TIOA 3A82A 2A32A 1SBWA 3TNSA 1UTPA 1O38A 2OCVB 1QL7A 2HRVA 2ANKH 1DE7H 3RMMH 3RXIA 1Z1IA 4X6OA 3U8TH 3MNCA 2VIPA 4THNH 3TPIZ 5FX5A 2VIVA 1OOKB 4WWYA 1EZUC 3A8BA 1J17T 3LU9B 3P8NA 3BG4C 3BIVH 4OS5A 4KTSA 1KLIH 2QV1A 3M7UA 4O3TA 4AOQA 1CHGA 3SORA 3UR6A 3MH6A 2FI3E 3Q77A 4JYUH 4MLFB 3RXMA 4NGAH 4B75A 1QQUA 4K8YA 2NU1E 2H1UA 2GCHG 4XBDA 3JZ1B 1IQFA 1BJUA 1S85A 1QTFA 1UTNA 1O3MA 2A1DB 3GCHB 5L6NH 1BTYA 4TY6A 4Y7AA 2FYQA 1THRH 5LH8A 1YPHC 1UVUH 1BJVA 2C8WB 1ZSLA 1VZQH 1P2MA 1MTUA 3SW2B 4AZ2B 4ZUHA 1DLEA 3BEUA 3LDXH 4FUBA 2FOMB 5IDKA 1W11U 3ZZ9A 2VGCB 2UWPA 5T1VA 3GCTG 1BMAA 2LPRA 2WYGA 2SGFE 1P03A 3MFJA 1VCWA 1GI6A 1O5DH 4BAHB 3GISB 2WPMS 2V35A 4FUEA 4CRDA 2YNBA 1TGTA 1EOJA 4Y8XA 5LGOA 4JK6A 4MPUA 2G52A 1S81A 1GHBF 1GI2A 1P2OA 3UFAA 2HVXA 1H9LB 2FZZA 1SHHB 2RG3A 4OS1A 3MO9A 2PUQH 1CA8B 3GYLB 2VIWA 3AW1A 1UTMA 4AYYB 1G9IE 1UTLM 4NFEA 3A87A 2FODA 1J8AA 3RC6A 4I31A 4FUIA 1O3LA 3KHVA 3VGCC 5EW1H 3BN9A 5A09A 3TK5A 3EGKH 5F03A 1WAYB 2V0BA 1DWEH 3KL6A 3TIUA 1NZQH 3E1XB 1GJDB 1KLJH 3SGQE 4B73A 2QN5T 2GDDA 2ZFRH 1T8NA 1AU8A 1O37A 3H7OA 3UQOA 4Y79A 2AIQA 2TGAA 3TNTA 4CH8B 1QCPA 4GPGA 4X1QU 2BY8X 1E35B 1FN6A 1LKBA 1ZHMA 1P01A 1WQVH 1HIAA 5JBBS 3BIUH 1GVLA 5T6DA 2DE9A 1Z1JA 1EXFA 1DM4B 3TJOA 2ZNKH 1C5ZB 3S9AA 3LGIA 2CV3A 5C3NA 1BMLA 1XUHA 2WV5A 3KEEA 5E0HA 5FX6A 1OWEA 1HDTH 1DSUA 1MD7A 1KLTA 5EG4A 2W5EA 4ASHA 3KF2A 1HAVB 5EQQA 5DP5A 2HPQH 5GCHG 4E7RG 3KQEA 4O97A 1D9IA 1D6RA 1FDPA 3A8CA 2HPPH 3SU0A 2HNTC 5TCCA 1OPHB 2F9BH 3SNEA 4NZQA 2XXLA 2BDIA 3S7KB 1W7GH 1ZRKA 1CQQA 2KAIB 2R9PA 4CBOA 1VITG 1V2WT 3UY9A 5EQRA 2H9HA 2AGGX 2SGDE 3AK5A 5JBCS 4LZ4B 2BYAX 1C5OH 2ZDNA 4X6PA 1YP9A 5T6GA 2Z3CA 1DPOA 3SUDA 2AMQA 1P12E 2PTCE 2UUFB 1L1NA 1WTGH 3E91A 1BRUP 3ENSB 1FAXA 3ZZAA 3M37A 2Y6TA 4IC5A 1JIMA 2V3OH 4K69A 3SV8A 2ODQA 1TRNA 1MBQA 2ZTXA 1A0HB 4FUFA 1O2GH 4J1YA 2JH6D 1AKSA 1AB9B 1O3HA 1EAIA 4K2YA 1GMDG 1O3FA 1Y3XA 6CHAC 4MPVA 1O3JA 2GMTB 4X6NA 1CU1A 2ZPSA 5FPSA 3HKJB 5L30H 4MVNA 3B8JA 3GICB 1NO9H 3P8OA 1NRPH 1F5LA 2GZ8A 2VIOA 1DSTA 1CBWB 1ESBA 3FANA 1TGNA 5K7RA 1AVGH 3D49H 5JBAS 4OGYA 4YO9A 1IQKA 1O35A 1C5VA 4MG3A 1YF4A 2A5IA 3M35A 1P10A 3UIRA 5A8ZA 2FMJA 1H4WA 3PYHA 1NU7B 1N1LA 4ZHAA 1O5EH 3RXEA 5EGMA 2SGEE 2XWAA 1TB6H 4CRAA 1MMJN 4Y71A 4NSYA 5I46H 3EDXB 1TYNA 1GBIA 2AEIH 3N7OA 1GGDB 4JZ1A 3BTEE 3Q76A 1MU8B 2XBYA 3A89A 1C5UA 1O3KA 1ZJKA 3TH3H 4NIXA 3RXTA 2Z9JA 1DITH 9LPRA 2ZFPH 1AUJA 1ZGIA 3PMAB 1XMNB 1GBTA 3VXFH 4YM9A 1A0JA 4OM9A 4J2YB 1F92A 1TABE 2Z94A 3M36A 5C1YA 2C8XB 1G30B 3M3VA 2QY0B 1W8BH 1J16A 1BHXF 2PGQB 4ISOA 1NRSH 3M3TA 2P8OB 2ULLA 3S9BA 4A92A 1AVWA 2P95A 3MNSA 4Y7BA 5F6MA 2ASUB 3BG8A 3UNRA 2R0KA 4M9FA 2WPHS 2QCYA 2CGAA 1Q31A 4FXGH 4JZEH 5C20A 2HNTF 4I8HA 2GTBA 1XUKA 3RP2A 1IAUA 3MU4A 1L1GA 4X1SU 2FEQH 1UCYK 3F9EA 4UFEH 3GDSA 3C1KA 3I29A 1BCUH 3O8DA 3U1JB 1VR1H 1L0ZA 2PKAA 1W10U 1ZGVA 1V2UT 2BD2A 2BVXH 5DJ7A 1ABIH 1V2LT 5A2MH 2Z7FE 4X8VH 1D3TB 5FBIA 1EQ9A 2OUAA 1BTWA 3CS0A 1BTZA 1QIXB 5EPNA 2RCEA 1GHZA 2W7SA 4OS7A 1MKXK 1NROH 1JWTA 1PQ5A 1QY6A 3A80A 1C5TA 1VGCC 1H8IH 2VWLA 1ZPCA 1QRWA 2FI5E 1K1JA 4X2XA 3E3TA 1ZMJA 4OS4A 3MH7A 2GVFA 1OP0A 2EI8A 2TPIZ 3QWCH 5DO4H 1QB6A 2VINA 1F5KU 3BG4B 4D8NA 1DY8A 2C8YB 1SGIB 1WYKA 3HGNA 4FVDA 3B23B 2Y5HA 3LC3A 1O2NA 1GG6B 2ZGCA 1C1QA 3EAJA 3KN2A 1DOJA 1SQTA 1GDUA 1KSNA 1H8DH 1FY3A 2AIPA 2BVSH 2SNVA 4K1TA 2BLVA 1ZHPA 1ZSJA 1F5RA 1DICA 1PPCE 1MZAA 5JB9S 2XBWA 4VGCB 1THSH 4AORA 2Z3DA 3MTYA 3SZNA 3LH1A 2V6NA 4NCYA 4Y10E 2B9LA 1DS2E 4B6FA 2UUKB 1NS3A 2ZHFH 1GI7B 3AAVA 4ESTE 1CA0C 1SLWB 1TLDA 1XXFA 2CJIA 4WMDA 5EU8A 2QAAA 1OYQA 1F0UA 3P17H 3SBKA 2R2WU 1TNLA 1B0FA 1DWCH 1AFQB 1C5SA 2K1QA 1GJ4H 1XKAC 2UWOA 1GI4A 1HBTH 1FY4A 4Q2KA 4WMFA 1NFUA 1C1PA 2HOBA 2BD5A 4Q80A 3MU5A 1C1VH 3Q3XA 3ATIA 5HXFA 3VGCB 3MU1A 4CR5A 1V2JT 4XOJA 3GYMA 3LJJA 1IQMA 1DY9A 2FOFA 1GBDA 3M61U 2IJOB 2BZ6H 1BZXE 1SGQE 2FS8A 1YPHE 3AASA 1FUJA 1TOCB 1TPPA 4ZKRU 1HJAC 3SUFA 1AO5A 1OWJA 1Y3VA 1RIWC 1UCYH 2ZU3A 3NCLA 4DURA 4NIYA 3MMGA 3S0NA 1HPGA 2O8LA 3RXAA 1BRBE 4BTUB 3QN7A 1BHXB 1EAWA 1ZJDA 4XBCA 1GJ7B 3K9XB 1LPGB 1ELDE 2BLQA 1ARBA 3LGTA 3RXOA 2WV4A 1EPTA 2XWBI 3O8BA 2ZTZA 3PROA 3SI4H 1MKXH 3ZV8A 1Q3XA 2PW8H 2OLGA 3VFEA 5DP9A 3ATLA 1K2I1 3TU7H 1ELFA 3MHWU 3P6ZB 2YNAA 2ZHWH 1O2JA 2GGVB 5JYIA 3PLBA 1O3CA 5ESTE 5JB8S 1MTNB 1UHBA 3RMLH 1FPHH 3HKIB 4KGAA 3DFJA 2G81E 1DLKB 1C2KA 3RXCA 3SUEA 1V2ST 1BDAA 1AHTH 1A1RA 2UUYA 4DG4A 4ISHH 5GPIB 3ZZ5A 4X1NU 1V6DA 3E90B 1K28D 1EATA 1PQAA 3LT3A 1TA2A 1AVXA 1GHXH 1UVOA 1AMHA 1JMOH 1SGNE 3R3GB 1QL9A 4IC6A 4ZH8A 3TK6A 4TY7A 6CHAB 1EKBB 2XCNA 1K9OE 3SO3A 1P11E 4JZIA 1EP6A 4NFFA 3P8FA 2OXSA 2FX4A 3U9AH 3ZVAA 3CENA 4CBNA 2SNWA 4FU7A 1GWAA 1Y3YA 2C90B 1QGFA 1O2TA 5AF9H 1FXYA 2BVRH 3NZIA 5JPMH 1F0TA 1AFEH 6ESTA 2ANYA 2XW9A 5DG6A 1ELGA 2NU2E 2Q6FA 1NM6A 3SNDA 1O3NA 1C9PA 2ZQ1A 1EB1H 3DHKH 2Z9KA 4LZ1H 1DWDH 1AE5A 1LMWB 1O3BA 1LPZB 4DJZB 9ESTA 4ZHMU 1RTFB 1T32A 1CGHA 2ZA5A 3PB1E 2WYJA 3A7WA 1HXEH 5BPEA 1JOUB 1EAXA 2BZAA 1TX8A 2RA0A 2ZFSA 4YOIA 2HLCA 2PSYA 3ZVBA 2FTLE 2BDCA 1IQJA 2BXUH 2XCFA 4I8LA 4A7IB 4FU9A 1GVKB 4PROA 1MCVA 1KXCA 1YPLH 2OBQA 2UUJB 2FM2A 1OX1A 1CVWH 5DP4A 1O36A 2Q6GA 2FWWA 3A88A 1BRCE 2ZU2A 3BEIB 5PTPA 4KKDA 5LPEA 2XBXA 3GY3A 1YM0A 3BTME 1HNEE 1F2SE 1C5XB 2ZU5A 3BF6H 5DK1A 2C93B 1EOLA 3BTKE 1IQIA 1ZRBA 1O3AA 1D4PB 1MUEB 1OKXA 2R2MB 3MWIU 1ESTA 3F9GA 2ZGBH 5IYTA 4CRFA 2TGDA 1PJPA 1Z8JB 2YOLA 1O2YA 2TGPZ 3P92A 4Y6DA 3VB7A 1TGBA 4TWWA 1TGSZ 1TMUH 3LH3A 2STAE 1PPEE 1P9UA 2HALA 2ZF0H 1SOZA 3A7VA 1ELVA 1GJ9B 1XUGA 1HAPH 3V12A 5FPTA 2ZHDA 3A7TA 1QB9A 3PTBA 1O2SA 1KTSB 2ZPQA 1NU9A 3A7YA 1NFWA 4X1RU 4BTIB 3ZVGA 7GCHF 5FHTA 2G51A 1P0SH 1O0DH 3UTUH 1S0RA 3RXUA 1GMCF 1DDJA 3SV9A 1DX5M 3WY8A 1SLVB 5FCKA 4CHAC 1VGCB 1ELEE 3ITIA 1BMMH 1TX6A 5ABWA 3BEFB 5A0CA 3UUZA 2Z9LA 4UD9H 1IQGA 1ETTH 1JBUH 1S0QA 4GHQA 1YCPM 3TH4H 2CF9H 7LPRA 2A5KA 3QK1A 3S9CA 1AGJA 2JH5D 4INKA 4FUCA 1BTHH 3A83A 2BD7A 4UFDH 3LGUA 3GDVA 3HGPA 3FFGA 1GBEA 2BDGA 1V2PT 2BOKA 2H9TH 2VVUA 3NUMA 4ABEA 8LPRA 2XTTB 1NY22 1ZHRA 2BX3A 3G01A 1ID5H 2A5AA 5FBEA 5CMXH 2FESH 2STBE 1VCPA 1PPFE 1O2KA 2Y82A 1VITH 4DW2U 3SHCH 4MNVA 3M5NA 3P95A 1ANBA 2ZP0H 2LNCA 1HYLA 2BMGB 2ZDLA 2OC1A 2EC9H 1YPEH 1GMHF 4WH6A 1GBAA 1TBZH 2ZCKP 4U30A 2ZGJA 1VJ9U 5E0GA 4ZKOU 1HAIH 1J15A 3ZZ4A 3ODDA 1CA0B 1PFXC 2ZU4A 1O2WA 1WV7H 2B7DH 3V0XA 2A0QB 1C5RA 2PGBB 1QURH 1SI5H 4FUJA 1Y3UA 3A7ZA 4H42U 3FAOA 1MTSA 2CMYA 3EA8A 5DP8A 1C1OA 4BTTB 1NPMA 1TPSA 1LHGH 3FZZA 1EB2A 4OGXA 3RC5A 1KXFA 2G4TA 2F91A 4WF8A 1XVMA 1YPJH 4NZLA 4B6EA 3GDUA 3OY5U 1CT4E 4XSKU 1E38B 4DCDA 4GSOA 3OSYA 3STJA 4YOJA 3H7TA 4GVUA 4IBLH 1YCPK 1ELBA 1UO6A 1Z6JH 1KDQB 1QJ6B 4ZAEA 1M9UA 3SU5A 2WUBA 1A0LA 1ARCA 2P3FH 1C2GA 1GHAG 1NFYA 2VWMA 4D9QA 1TOMH 5C5NA 1HJAB 2BY5X 1O2IA 3PV5A 3E0NB 1AIXH 1Y5UT 2BDBA 1YYY1 2F9NA 3BTWE 3F68H 5B6OA 1A7SA 1FV9A 1TBRH 1HAGE 3ZZ6A 4JZDH 3L33A 1Z8IB 2AGEX 4X8SH 5HYOA 1LHDH 1KTTB 4Y76A 1Z8GA 1OWHA 1UTJA 1C4U2 2PWXA 4LK4A 4E06H 5I25A 2OP9A 2JETB 1J9CH 1W14U 3LGVA 3PTNA 2C8ZB 1IQLA 1ANCA 2GCTB 4UE7H 1ZSKA 2GDEH 3SN8A 1GI1A 3AAUA 1W7XH 4HGCA 5JBTA 1TPAE 3RXVA 4QT8C 1C1NA 1HAVA 1CGJE 4JCNA 3PV2A 1TX7A 1P2JA 5C1UA 1TQ7B 4ISLA 1LVOA 4IW4E 4MNYA 3SNCA 2IN2A 3E0PB 1HUTH 1ELTA 3UQVA 5DP6A 2J4IA 2TGTA 3SI3H 1THPB 2KAIA 4B2CA 5EXNA 4D76A 2ILNA 1NESE 5TJXA 1C1WH 3ATWA 2BY9X 4O9VA 2XC0A 2F83A 1WCZA 5BRRE 2WUCA 3EA7A 4FU8A 3ZVCA 2BLOA 3KCGH 1O2HA 1TA6A 5F8TA 3H09A 3VEQB 2G55A 4RN6A 1FY8E 1QFKH 2BHGA 8GCHF 2WHXA 1NRQH 3MNXA 3ZYEA 1MAYA 3SU4A 2GV7A 2SGPE 3NXPA 1GBCA 3W94A 3V13A 2GT8A 2BY7X 2JKHA 1PQ8A 2A2QH 3ATKA 3GY5A 4WMEA 1HAOH 1GBBA 1K22H 1MH0A 1RTKA 1G2MA 4O3UA 2A4QA 1WU1A 3W95A 2ZQ2A 4ISIH 1WXRA 3ZYDA 1IHSH 2FOAA 1ANEA 1G3CA 2J9NA 4H4FA 1WOFA 3RXSA 5EQSA 1P2NA 1BMNH 1C2MA 1F0RA 1PQ7A 4CRBA 2A45B 4YT6H 4JYTA 1C9TA 4ABBA 1T31A 5TCAA 4JYVH 4B71A 2Z9IA 1C5NH 2QF0A 3M3SA 5HM2A 3A84A 1S6FA 2ALVA 2OQ5A 3VB3A 3QGJA 4DY7B 3FP7E 1GL0E 1O2MA 5F8XA 4I8GA 3C27B 4X8TH 2O8TA 1G36A 2BD4A 1BITA 5EXLA 3TK9A 1YCPH 4AFQA 4B2AA 1GJ8B 1U6QA 4X6MA 3RXRA 4BAQB 3GCHC 3BTFE 1LDTT 3GY7A 2B0FA 3BV9B 1EP5A 5GIBA 1C2HA 1TGCA 3RLWH 2HGTH 5CE1A 4IN1A 3CP7A 2VU8E 2EEKA 4CR9A 2OC7A 1SFQB 5C2ZA 2P3UB 5E2OA 2OD3B 2VWNA 1C5WB 1QBVH 2VGCC 5FXLA 2PUXB 1JIRA 1P2KA 1O3OA 4AGJA 7GCHG 3SJIA 2O9QA 3TJUA 1IHTH 1BRAA 3MU0A 2ZGHA 1SFIA 1AE8H 1HB0B 7KMEH 4O03A 2GCHF 1O3PB 2H9EH 1EUFA 1TNJA 2GZ9A 2ZO3H 3QO6A 4U32A 2D26C 1P2IA 4AGKA 1TNHA 3TVJB 2FLBH 1UK4A 3PWBA 3SJOA 1WBGB 2PSXA 1GHBG 1ETRH 1L2EA 3T2NA 1GBJA 4WXVA 2FPZA 2WZQA 3TGJE 1C2EA 4DIIH 4A1VA 4Y0ZE 1GHYH 1HJ8A 1FI8A 4OS6A 3GCTF 3RMNH 4ZROA 4NSVA 4K60A 3DD2H 1P57B 3ZV9A 5GDSH 5HMAA 5FAHA 2I6SA 4ABGA 4D9RA 2BOHB 1C1UH 1TNGA 3D62A 2TRMA 4CHAB 1IQHA 1O2PA 1A5HA 1EAUA 2ZDMA 4CRCA 1XUFA 1K1LA 1SGRE 4JZFH 2EI7A 2H6MA 4X8UH 1RFNA 4XBBA 4Y8ZA 3SGAE 1LQDB 3F6UH 1K1PA 3P8GA 3K2UA 1GMHG 4ISNA 1TRYA 1G2LA 1ZMLA 2F9VA 1V3XA 2ESTE 5AHGH 2J94A 1TQ0B 2B5TB 4UEHH 1QJ1B 1KXBA 4K3JA 1GBMA 1SGCA 3MOCA 1DUEA 2XBVA 1QQ4A 1HGTH 2WPLS 3QZRA 4A6LA 3UWJH 5EW2H 1O2XA 4IMQA 4HZHA 1SPJA 2ANMH 4H6TA 1H1BA 4AFSA 5C5OA 3OTJE 1T4UH 2W3KA 4DGJA 3GY4A 4LXBH 1GVZA 4E7NA 1LTOA 3MO3A 3TITA 3PMBB 1GI8B 1PPGE 1O33A 4AB9A 1BT7A 1DUAA 3M7TA 1V2VT 3T29A 3TJVA 3BTTE 3KQDA 1AWFH 1C1RA 1O5AB 4NWKA 3RM2H 3V3MA 4MNWA 4BXWA 2GP9B 3EA9A 4Q7ZA 3RXHA 5E2PA 1TALA 3GCNA 3SJ9A 2PV9B 4BXSA 4TWYA 1SMFE 2Q1JA 3QTOH 1QL8A 1DXPA 3NK8A 1B5GH 3U8RH 2F4LA 1HAHH 1GJBB 1WQSA 4OS2A 1MBMA 1INCA 3MNBA 3RXGA 1SGFA 2VJ1A 2AYWA 4YOGA 2QXIA 1L4DA 1GI9B 1UTOA 3IITA 2XC4A 3K6ZA 1VITF 1W0ZU 4B74A 4FVBA 2J95A 1GI5A 1W0YH 3ZVDA 5DP7A 1NTPA 3SQHE 1P3EA 1TE0A 1UCYE 5T3HA 4AYVB 1XKBC 3D65E 4MNXA 1QR3E 2VIQA 4GAWA 1C5QA 1CGIE 5C1XA 2A7JA 1SGFG 3OTPA 3ZVFA 4AFUA 1ZPBA 2PHBA 1GJ6A 5DPAA 2FXRA 1GHVH 3V7TA 1ZYOA 2P16A 2PKSC 3KQBA 4YESB 2ALPA 1MCTA 4FUDA 2Q6DA 3A7XA 4WJG2 1PPHE 3RC4A 5A8YA 4NIWA 1UK2A 1HFDA 1FMGA 1ZLRA 1QA7A 2FS9A 2QXJA 1SGYE 3GOVB 1A46H 1T4VH 3VB5A 1GCTC 3LOXA 1J14A 1DANH 3M7QA 1V2KT 4YZUA 3SOSA 2F3CE 1P3CA 1EX3A 3F9FA 3T26A 1C5YB 8GCHG 1AY6H 2A7HA 1BA8B 1ORFA 4XE4A 3UOUA 1BUIA 3MH4A 3NPSA 2GV6A 3QTVH 4GHTA 1MAXA 4X2VA 1LQEA 1O2UA 6LPRA 2ZI2H 3SV6A 4DOQA 1BQYA 2ODYB 2O8MA 3LKWA 5FCRA 5F8ZA 2PFEA 1SL3A 5AVDA 4NA9H 2VNTA 2O8WA 4MPXA 4RKJB 1YBWA 2XNIA 1C5MD 5CHAC 2ZEBA 5E0JA 2D8WA 2G00A 4M7GA 4IS5A 1TMTH 3FZDA 3SU3A 1NC6A 1V2TT 3QX5H 5JDUB 1UVSH 2FOBA 4NWLA 4ZHLU 2H5CA 2VVCA 2VVVA 4HTCH 1IQNA 4D7FA 2A31A 3DT0H 1HAXB 1QRZA 2D1JA 4B76A 1L1JA 3ZZCA 1F7ZA 1O39A 1OP2A 1O2LA 1SLUB 2THFB 1A5GH 2FP7B 2WINI 1K21H 4KTUA 1D3PB 1C2LA 2QYIA 1SQOA 3RU4E 1AQ7A 2ZFTA 4KELA 4ABDA 1UJ1A 3Q3YA 1JRSA 2G4UA 1SB1H 1A3EH 1MTVA 4X2YA 1C4Y2 1HXFH 4A1TA 3RM0H 1BTPA 1DWBH 1ANDA 1AWHB 1KXDA 1LCYA 2W3IA 1RRKA 1FIZA 1P09A 1GBLA 2IJD1 2G5NA 2QC2A 4XDEA 1QB1A 2FO9A 1QA0A 1DT2A 1QBOA 1HRTH 2FX6A 1AZZA 2ZFFH 1Y59T 2TBSA 1PPZA 3LGWA 2BTCE 1KY9A 3MH5A 4U2WA 3EE0B 1GG6C 1DVAH 1IQEA 1LVMA 3DUXH 4DIHH 1XVOA 2GX4A 5EXMA 1N8OC 3HATH 4JK5A 1P8VC 3P70B 1TNIA 2PLXA 3A8AA 2W26A 1G3DA 1O2VA 1ESAA 1GI0A 3LGYA 4RSPA 3RXKA 1SC8U 4VGCC 3UREA 2XC5A 1E0FD 3U69H 3LC5A 5SGAE 1AUTC 1YPKH 3RDZA 1HIAB 1CHOF 4I8KA 3BTDE 3HPTB 1W13U 1CE5A 1N6XA 4MPWA 4Y11E 1RD3B 1VCQA 4BNRA 1EZSC 3SV2H 3URCA 1EPTC 3U98H 4I7YH 1YGCH 1O34A 5A8XA 1T8LA 1GJAB 1AFQC 1G3EA 2CF8H 2PR3A 1LHFH 2NU3E 8KME2 3BTQE 2G5VA 1NN6A 3ZZ3A 1P9SA 2BD8A 2NWNA 4ZKNU 5GJ4B 1P05A 2BQWB 4B2BA 3BTGE 1XUJA 2ZCLP 1RS0A 2BX4A 3EYDA 2HWLB 2BB4A 4ABJA 5EPYA 1BOQA 2Y81A 1P04A 1QRXA 1LKAA 1WTHD 3SU1A 1G37A 1FPCH 4SGAE 1BIOA 3CS7A 4ZXXH 1TAWA 3UNQA 4Y8YA 4GCHF 3T27A 2SFAA 4D7GA 4GLYA 1ACBE 3BTHE 2GD4B 4BAKB 4BAMB 1Z71A 2ZECA 1TPOA 3S7HB 1LHEH 4WY3A 1ELCA 2VB0A 5J4SA 3IG6B 1C2IA 3MI4A 3VPKA 1RTLA 1QNJA 1O5FH 3F9HA 1AKSB 3UPEA 1E36B 1T8OA 1ZR0A 1GDQA 5A0BA 2FI4E 3QUMP 1ZPZA 3BSQA 2FLRH 4IMZA 1Y5AT 3RUOA 2J34A 3M5OA 3MO6A 2BDHA 1SGDE 2IPHA 4ABAA 2J2UA 1C2DA 2R3YA 3SV7A 1GJCB 2JH0D 1CSOE 2ZCHP 1Z6EA 4UFGH 3UNSA 1FY5A 2AS9A 4R8TB 2BXTH 2SGAA 3ZZ7A 1UVTH 4BAOB 2OC0A 2FIRH 3ODFA 5LPFA 4INHA 4F4OC 4I32A 1YPGH 3UWIA 4X0WU 3RXDA 1RIWB 1CT0E 1GL1A 1MTNC 1S84A 1YC0A 4Q7YA 1A3BH 1AI8H 2ZTYA 2ZU1A 2B8OH 3TGIE 2VBCA 1Y3WA 5ESBA 1O5BB 1MQ6A 2WV9A 2QIQA 1EZQA 1MKWK 2ZC9H 4ABHA 5HGGA 5DP3A 1PPBH 1ZMNA 3URDA 4AFZA 2Z6BD 1W2KH 1O3IA 1A2CH 8ESTE 1ETSH 3PO1C 1C5PA 2Y5GA 1XM1A 1O5GH 4LOYH 1OYTH 1RGQA 1SGEE 1O32A 4CRGA 3SJKA 5LPRA 1AZ8A 4YLUA 4YLQH 4AN7A 1K1IA 1K1NA 3LIWA 1OP8A 1E34B 1SOTA 1C2JA 1DXWA 1OSSA 4ABIA 1S82A 3RU4D 1O2ZA 2PTNA 2C3SA 2I6QA 3U1IB 1C5LH 1Z8RA 2BDYA 3A8DA 1UK3A 2GKVE 1KIGH 1A5IA 1O5CB 2IOTA 1LO6A 3MYWA 4NIVA 4ZXYH 4CREA 3KGPA 1KDQA 4WXIA 1IOEA 4Z6AH 2CHAC 3I78A 5A0AE 1OWIA 1MQ5A 6GCHF 4FUHA 1OXGA 1EJNA 4XFQA 1OS8A 2NU0E 2R3UA 1P06A 1JRTA 1FNIA 2PKSB 5ETXA 5GNDA 1GJ5H 2FOEA 1C2FA 1Z7KA 1YKTA 1L4ZA 1EJMA 1SR5C 4TPYA 4RI0A 2F9UA 2PKAB 4RKOB 4B1TA 4U01A 1O3GA 3FP8E 2GZ7A 1O2RA 4UFFH 2P59A 2NU4E 3A81A 3ELAH 1K1OA 4ZMAH 4AB8A 1GCTB 2BD9A 1SHYA 1CO7E 3VXEH 2BLWA 1O3EA 4IGDA 4Y0YE 3SGBE 1P02A 5C67A 2F9OA 1PYTC 3VB4A 3S69A 3SJ8A 4NA7A 1EJAA 1V2OT 4UDWH 2A4OA 1ZZZA 1S83A 1T7CA 1GPZA 1RJXB 2RDLA 3ESTA 3L3TA 1LHCH 3M5MA 1K1MA 1PYTD 1WUNH 2DUCA 3L6PA 1B0EA 4I33A 1FQ3A 4KP0A 1KXEA 7ESTE 1GBKA 1TFXA 3PV4A 1NT1A 4SGBE 1N6YA 1H9IE 3SNBA 3I77A 2OTVA 5CHAB 1G32B 3QZQA 2XYAA 2ZZUH 1Y5BT 1F0SA 2VWOA 1Y8TA 2BD3A 1D3DB 5K0HA 1TMBH 2OBOA 2QGRA 1YLCA 4INLA 3FVFB 4CH2B 1CT2E 3H5CB 1QBNA 1T8MA 3TH2H 4TYDA 3SNAA 3NKKA 4K1EA 1FN8A 3SHAH 1BBRK 1V2NT 4WH8A 3RXPA 2FOHA 1O2QA 1KXAA 1QHRB 4GUXA 2WPJS 5E8EH 1FJSA 2AFQB 1MKWH 2OQUA 1BTUA 1O31A 1GMCG 2QA9E 4X1PU 4AG2A 2A2XH 3PWCA 3UR9A 3SZEA 2ZDKA 2FTMA 3EQ0H 4HFPB 2CN0H 3R0FA 4IN2A 2ANWA 3T28A 3T25A 1E37B 1ZOMA 2ZIQH 3SU6A 3PLKA 1CHOG 2OC8A 3PMJA 3PM3A 2F9PA 1B7XB 3MU8A 4NG9H 3TLOA 3ZZDA 4BANB 3OY6U 1C1MA 2AH4X 3RXLA 1S5SA 3GCOA 5EODA 4DT7B 1N8OB 1SLXB
chains in the Genus database with same CATH superfamily
1O2OA 1D6WA 1MTWA 3SUGA 3Q00A 4ABFA 1TWXB 2FDAA 3SQEE 2AERH 1UVPA 1MZDA 1GI3A 2OINA 1S6HA 5AFZH 1AD8H 3E6PH 2JJ2D 2ZFQH 3LPRA 1WSSH 5L2ZH 1VJAU 1XXDA 2M5TA 2UWLA 2EA3A 3OX7U 1JXPA 1SQAA 4DVAU 3IWMA 5G4BA 3STIA 1MU6B 3A86A 1X7AC 3ATMA 2Z9GA 3E16B 3OYPA 3ZZ8A 1OWDA 2EI6A 3D23A 4YT7H 4GCHG 2QF3A 3DA9B 4WVPE 3GY8A 3B9FH 2A4GA 3GY2A 3QGNB 3A85A 1EPTB 2QXGA 4FUGA 3DFLA 3HK6B 5HM9A 3F1SB 1HV7A 3NWUA 1A61H 2J38A 1NRRH 1GHWH 3FP6E 1ZTJA 2RA3A 5GWZA 1AN1E 2GT7A 1FONA 1H9HE 3PLPA 1SGTA 3LJOA 2CXVA 2ZKSA 1LPKB 4BOHA 3PRDA 1P2QA 4RT0A 1YLDA 1A4WH 1UHBB 5DGJA 2V3HH 4A5TS 2AGIX 2FOGA 1HJ9A 2VH0A 3RLYH 3UOPA 4E05H 4MTBA 2L74A 1ZTLA 2A7CA 1C1TA 1FY1A 4JMYA 3K6YA 4I8JA 2BM2A 3TGKE 1FIWA 1SG8B 3KNXA 1QJ7B 3KQCA 1YWUA 1NFXA 5AFYH 1FZZA 1XX9A 3OU0A 1BTXA 2Y7XA 5B6LA 4YTAA 3LONA 2QXHA 3Q3KA 5GCHF 4A1XA 1AB9C 1C4V2 1Q2WA 2R0LA 2H2ZA 2H5DA 1MD8A 2ZDAH 4Z0KA 2P94A 1HAYB 2GMTC 2WPKS 3O8CA 5T6FA 2Y7ZA 1BBRH 3AVZA 2JETC 1BB0B 3AW0A 1CBWC 2ZPRA 2ZDVH 2GCTC 3M5LA 2SGQE 1V2QT 3PMHB 1KYNA 1GHAF 2M2AA 1TIOA 4Q7XA 2FYRA 1HCGA 5L2YH 2BY6X 4NA8A 2FOCA 1V2MT 1ZTKA 3E8LA 4MQAA 3F0OA 3ZZBA 3JZ2B 1HLTH 3VB6A 3KIDU 3T5FH 3O8RA 1SVPA 5GXPA 4KTCA 1OWKA 1GMDF 1EASA 1SGPE 2ZGXH 2G8TA 3QDZB 1DFPA 1O3DA 1LVBA 2BDAA 1GGDC 1ABJH 1TRMA 5H4IB 3TJNA 1W3CA 4K5ZA 3SYJA 3ZVEA 2WPIS 2VH6A 2ODPA 2J92A 3T62A 1GDNA 1D3QB 1G3BA 6GCHG 3U8OH 3PO1B 1TNKA 2C4FH 1BBRE 4HI3A 4F49A 1UMAH 4MDSA 4UONA 1UTQA 1MABB 2VIDA 5FPYA 2AMPA 1GBFA 1XUIA 1LVYA 3HK3B 2ZWLH 1V2RT 1GCDA 1TONA 2ZHEH 3QLPH 4K8BA 3RU4T 4X2WA 1SSXA 2XRCA 4TPIZ 2P8OC 2A4RA 2Y80A 1HAZB 2YMSD 4H6SB 4R0IA 2W7UA 3RMOH 4AG1A 1RXPA 2Y5FA 1FLEE 3RXQA 2BQ6B 1EZXC 2CHAB 2V7QD 4ZKSU 5J4QA 1FAKH 1TBQH 2OK5A 5EOKA 2ZHQH 1YPMH 2HNTE 1COWD 2BQ7B 2Z3EA 1NRNH 4AX9H 2P93A 2AMDA 3RXJA 1ELAA 1C1SA 1O30A 3RXFA 2RFKC 2D2DA 1GBHA 1W12U 3GY6A 2O8UA 2DE8A 3RXBA 2P3TB 2ZG0H 3K65B 4K1SA 5DKMA 3SU2A 1UTKA 2TIOA 3A82A 2A32A 1SBWA 3TNSA 4ACAA 1UTPA 1O38A 2OCVB 1QL7A 2HRVA 2ANKH 1DE7H 3RMMH 3RXIA 1Z1IA 4X6OA 3U8TH 3MNCA 2VIPA 4THNH 4F55A 3TPIZ 5FX5A 2VIVA 1OOKB 4WWYA 1EZUC 3A8BA 3OEED 1J17T 3LU9B 3UAIC 3P8NA 3BG4C 1YLNA 3BIVH 3FN8A 4OS5A 4KTSA 1KLIH 2QV1A 3M7UA 4O3TA 4AOQA 1CHGA 3SORA 3UR6A 3MH6A 2FI3E 3Q77A 4JYUH 4MLFB 3RXMA 4NGAH 4B75A 1QQUA 4K8YA 2NU1E 2H1UA 2GCHG 4XBDA 3JZ1B 1IQFA 1BJUA 1S85A 1QTFA 1UTNA 1O3MA 2A1DB 3GCHB 5L6NH 1BTYA 4TY6A 4Y7AA 2FYQA 4YXWD 1THRH 5LH8A 1YPHC 1UVUH 1BJVA 2C8WB 4HG6A 1ZSLA 1VZQH 1P2MA 1MTUA 3SW2B 4AZ2B 4ZUHA 1DLEA 3BEUA 3LDXH 4FUBA 5C17A 2FOMB 5IDKA 1W11U 3ZZ9A 2VGCB 2UWPA 5T1VA 3GCTG 1BMAA 2LPRA 2WYGA 2SGFE 1P03A 3MFJA 1VCWA 1GI6A 1O5DH 4BAHB 3GISB 2WPMS 2V35A 4FUEA 4CRDA 2YNBA 1TGTA 1EOJA 4Y8XA 5LGOA 4JK6A 4MPUA 2G52A 1S81A 1GHBF 1GI2A 1P2OA 3UFAA 2QE7D 2HVXA 1H9LB 2FZZA 1SHHB 2RG3A 4OS1A 3MO9A 2PUQH 1CA8B 3GYLB 2VIWA 3AW1A 1UTMA 4AYYB 1G9IE 1UTLM 4NFEA 3A87A 2FODA 1J8AA 3RC6A 4I31A 4FUIA 1O3LA 3KHVA 3VGCC 5EW1H 3BN9A 5A09A 3TK5A 3EGKH 5F03A 1WAYB 2V0BA 1DWEH 3KL6A 3TIUA 1NZQH 3E1XB 2IPQX 2J5UA 1GJDB 1KLJH 3SGQE 4B73A 2QN5T 2GDDA 2ZFRH 1T8NA 1AU8A 1O37A 3H7OA 3UQOA 4Y79A 2AIQA 2TGAA 3TNTA 4CH8B 1QCPA 4GPGA 4X1QU 2BY8X 1E35B 1FN6A 1LKBA 1ZHMA 2KCAA 1P01A 1WQVH 1HIAA 5JBBS 3BIUH 1GVLA 5T6DA 2DE9A 1Z1JA 1EXFA 1DM4B 3TJOA 2ZNKH 1C5ZB 3S9AA 3LGIA 2CV3A 5C3NA 1BMLA 1XUHA 2WV5A 3KEEA 5E0HA 5FX6A 1OWEA 1HDTH 1DSUA 1MD7A 1KLTA 5EG4A 2W5EA 4ASHA 3KF2A 1HAVB 5EQQA 5DP5A 2HPQH 5GCHG 2K0QA 2WSSD 4E7RG 3KQEA 4O97A 1D9IA 1D6RA 1FDPA 3A8CA 2HPPH 3WWBA 3SU0A 2HNTC 5TCCA 1OPHB 2F9BH 3SNEA 3OAAD 4NZQA 2XXLA 2BDIA 3S7KB 1W7GH 1ZRKA 1CQQA 2KAIB 2R9PA 4CBOA 1VITG 1V2WT 3UY9A 5EQRA 2H9HA 2AGGX 2SGDE 3AK5A 5JBCS 4LZ4B 2BYAX 1C5OH 2ZDNA 4X6PA 1YP9A 3OFND 5T6GA 2Z3CA 1DPOA 3SUDA 2AMQA 1P12E 2PTCE 2UUFB 1L1NA 1WTGH 3E91A 1BRUP 3ENSB 1FAXA 3ZZAA 3M37A 2Y6TA 4IC5A 1JIMA 2V3OH 4K69A 3SV8A 2ODQA 1TRNA 1MBQA 2ZTXA 1A0HB 4FUFA 1O2GH 4J1YA 2JH6D 1AKSA 1AB9B 1O3HA 1EAIA 4K2YA 1GMDG 1O3FA 1Y3XA 6CHAC 2LP6A 4MPVA 1O3JA 2GMTB 4X6NA 1CU1A 2ZPSA 5FPSA 3HKJB 5L30H 4MVNA 4P02A 3B8JA 3GICB 1NO9H 3P8OA 1NRPH 1F5LA 2GZ8A 2VIOA 1DSTA 1CBWB 1ESBA 3FANA 1TGNA 5K7RA 1AVGH 3FKSD 3D49H 5JBAS 4OGYA 4YO9A 1IQKA 1O35A 1C5VA 4MG3A 1YF4A 2A5IA 3M35A 1P10A 3UIRA 5A8ZA 2FMJA 1H4WA 3PYHA 1NU7B 3KYFA 1N1LA 4ZHAA 1O5EH 3RXEA 5EGMA 2SGEE 2XWAA 1TB6H 4CRAA 1MMJN 4Y71A 4NSYA 5I46H 3EDXB 1TYNA 1GBIA 2AEIH 3N7OA 1GGDB 4JZ1A 3BTEE 3Q76A 1MU8B 2XBYA 3A89A 1C5UA 1O3KA 1ZJKA 3TH3H 4NIXA 3RXTA 2Z9JA 1DITH 3NRLA 9LPRA 2ZFPH 1AUJA 1ZGIA 3F2FA 3PMAB 1XMNB 1GBTA 3VXFH 4YM9A 1A0JA 4OM9A 2YMSB 4J2YB 1F92A 1TABE 2Z94A 3M36A 5C1YA 2C8XB 1G30B 3M3VA 2QY0B 1W8BH 1J16A 1BHXF 1W0KD 2PGQB 4ISOA 1NRSH 3M3TA 2P8OB 2ULLA 3S9BA 4A92A 1AVWA 2P95A 3MNSA 4Y7BA 5F6MA 1YY3A 2ASUB 3BG8A 3UNRA 2R0KA 4M9FA 2WPHS 2QCYA 3W1EA 2CGAA 1Q31A 4FXGH 4JZEH 5C20A 2HNTF 4I8HA 2GTBA 1XUKA 3RP2A 1IAUA 3MU4A 1L1GA 4X1SU 2FEQH 1UCYK 3F9EA 4UFEH 3GDSA 3C1KA 3I29A 1BCUH 3O8DA 2K8IA 3U1JB 1VR1H 1L0ZA 2PKAA 1W10U 1ZGVA 1E1QD 1V2UT 2BD2A 2BVXH 5DJ7A 1ABIH 1V2LT 5A2MH 2Z7FE 4X8VH 1D3TB 5FBIA 1EQ9A 2OUAA 1BTWA 3CS0A 2QF5A 1BTZA 1QIXB 5EPNA 2RCEA 1GHZA 2W7SA 4OS7A 1MKXK 1NROH 1JWTA 1PQ5A 1QY6A 3A80A 1C5TA 1VGCC 1H8IH 2VWLA 1ZPCA 1QRWA 2FI5E 1K1JA 4X2XA 3E3TA 1ZMJA 4OS4A 3MH7A 2GVFA 1OP0A 2EI8A 2TPIZ 3QWCH 5DO4H 1QB6A 2VINA 1F5KU 3BG4B 4D8NA 1DY8A 2C8YB 1SGIB 1WYKA 3HGNA 4FVDA 3B23B 2Y5HA 3LC3A 1O2NA 1GG6B 2ZGCA 1C1QA 3EAJA 3KN2A 1DOJA 1SQTA 1GDUA 2J98B 1KSNA 1H8DH 1FY3A 2AIPA 2BVSH 2SNVA 4K1TA 3U28C 2BLVA 1ZHPA 1ZSJA 1F5RA 3WW7A 3ZIAD 1DICA 1PPCE 1MZAA 5JB9S 2XBWA 4VGCB 1THSH 3WWFA 4AORA 2Z3DA 3F0PA 3MTYA 3SZNA 3LH1A 2V6NA 4NCYA 4Y10E 2B9LA 1DS2E 4B6FA 2UUKB 1NS3A 2ZHFH 1GI7B 3AAVA 4ESTE 1CA0C 1SLWB 1TLDA 1XXFA 2CJIA 4WMDA 5EU8A 2QAAA 5HKKD 1OYQA 1F0UA 3P17H 3SBKA 2R2WU 1TNLA 1B0FA 1DWCH 5C0UA 1AFQB 1C5SA 2K1QA 1GJ4H 4TSFD 1XKAC 2UWOA 1GI4A 1HBTH 1FY4A 4Q2KA 4WMFA 1NFUA 1WDIA 1C1PA 2HOBA 2BD5A 4Q80A 3MU5A 1C1VH 3Q3XA 3ATIA 5HXFA 3VGCB 3MU1A 4CR5A 1V2JT 4XOJA 3GYMA 3LJJA 1IQMA 1DY9A 2FOFA 1GBDA 3M61U 2IJOB 2BZ6H 1BZXE 1SGQE 2FS8A 1YPHE 2AHME 3AASA 1FUJA 1TOCB 1TPPA 4ZKRU 1HJAC 3N7EA 3SUFA 1AO5A 1OWJA 1Y3VA 1RIWC 1UCYH 2ZU3A 3NCLA 4DURA 4NIYA 3MMGA 3S0NA 1HPGA 2O8LA 3RXAA 1BRBE 4BTUB 4DT4A 3QN7A 1BHXB 1EAWA 1ZJDA 4XBCA 1GJ7B 3K9XB 1LPGB 1ELDE 2BLQA 1ARBA 3LGTA 3RXOA 2WV4A 1EPTA 2XWBI 3O8BA 2ZTZA 3PROA 3SI4H 1MKXH 3ZV8A 1Q3XA 2PW8H 2OLGA 3VFEA 5DP9A 3ATLA 1K2I1 3TU7H 1ELFA 3MHWU 3P6ZB 2YNAA 2ZHWH 1O2JA 2GGVB 5JYIA 3PLBA 1O3CA 5ESTE 5JB8S 1MTNB 1UHBA 3RMLH 1FPHH 3HKIB 4KGAA 3DFJA 2G81E 1DLKB 1C2KA 3RXCA 3SUEA 1V2ST 1BDAA 1AHTH 1A1RA 2UUYA 4DG4A 4ISHH 5GPIB 3ZZ5A 4X1NU 1V6DA 3E90B 1K28D 1EATA 1PQAA 3LT3A 1TA2A 2V3MA 1AVXA 1GHXH 1UVOA 1AMHA 1JMOH 1SGNE 3R3GB 1QL9A 4IC6A 5F53A 4ZH8A 3TK6A 4TY7A 6CHAB 1EKBB 2JJ1D 2XCNA 1K9OE 3SO3A 1P11E 4JZIA 1EP6A 4NFFA 3P8FA 2OXSA 2FX4A 3U9AH 3ZVAA 3CENA 4CBNA 1SQRA 2SNWA 4FU7A 1GWAA 1Y3YA 2C90B 1QGFA 1O2TA 1KMHB 5AF9H 1FXYA 2BVRH 3NZIA 5JPMH 1F0TA 1AFEH 6ESTA 2ANYA 2XW9A 5DG6A 1ELGA 2NU2E 2Q6FA 1NM6A 3SNDA 1O3NA 1C9PA 2ZQ1A 1EB1H 3DHKH 2Z9KA 4LZ1H 1DWDH 1AE5A 1LMWB 1O3BA 1LPZB 4DJZB 9ESTA 4ZHMU 1RTFB 1T32A 1CGHA 2ZA5A 3PB1E 5HIYA 2WYJA 3A7WA 1HXEH 5BPEA 1JOUB 5IK2D 1EAXA 2BZAA 1TX8A 2RA0A 2ZFSA 4YOIA 2HLCA 2PSYA 3ZVBA 2FTLE 2BDCA 1IQJA 2BXUH 2XCFA 4I8LA 4A7IB 4FU9A 1GVKB 4PROA 1MCVA 1KXCA 1YPLH 2OBQA 2UUJB 2FM2A 2KM0A 1OX1A 1CVWH 5DP4A 1O36A 2Q6GA 2FWWA 3A88A 1BRCE 2ZU2A 3BEIB 5PTPA 4KKDA 5LPEA 2XBXA 3GY3A 1YM0A 3BTME 1HNEE 1F2SE 1C5XB 2ZU5A 1BMFD 3BF6H 5DK1A 2C93B 1EOLA 3BTKE 1IQIA 1ZRBA 1O3AA 1D4PB 1MUEB 1OKXA 5KECA 2R2MB 3MWIU 1ESTA 3F9GA 2ZGBH 5IYTA 4CRFA 2TGDA 1PJPA 4ACBA 1Z8JB 2YOLA 1O2YA 2TGPZ 3P92A 4Y6DA 3VB7A 1TGBA 4TWWA 1TGSZ 1TMUH 3LH3A 1W0JD 2STAE 1PPEE 1P9UA 2HALA 2ZF0H 1SOZA 3A7VA 1ELVA 1GJ9B 1XUGA 1HAPH 3V12A 5FPTA 2ZHDA 3A7TA 1QB9A 3PTBA 1O2SA 1KTSB 2ZPQA 1NU9A 3A7YA 1NFWA 4X1RU 4BTIB 5KGOA 3ZVGA 7GCHF 5FHTA 2G51A 1P0SH 1O0DH 3UTUH 1S0RA 3RXUA 1GMCF 1DDJA 3SV9A 1DX5M 3WY8A 1SLVB 5FCKA 4CHAC 1VGCB 1ELEE 3ITIA 1BMMH 1TX6A 5ABWA 3BEFB 2RDEA 2KFWA 5A0CA 3UUZA 2Z9LA 4UD9H 1IQGA 1ETTH 1JBUH 1S0QA 4GHQA 1YCPM 3TH4H 2CF9H 7LPRA 2A5KA 3QK1A 3S9CA 1AGJA 2JH5D 4INKA 4FUCA 1BTHH 3A83A 2BD7A 4UFDH 3LGUA 3GDVA 3HGPA 3FFGA 1GBEA 2BDGA 1V2PT 2BOKA 2H9TH 2VVUA 3NUMA 4ABEA 8LPRA 2XTTB 1NY22 1ZHRA 2BX3A 3G01A 1ID5H 2A5AA 5FBEA 5CMXH 2FESH 2STBE 1VCPA 1PPFE 1O2KA 2Y82A 1VITH 4DW2U 3FO8D 3SHCH 4MNVA 3M5NA 3P95A 1ANBA 2ZP0H 2LNCA 1HYLA 2BMGB 2ZDLA 2OC1A 2EC9H 1YPEH 1GMHF 4WH6A 1GBAA 1TBZH 2ZCKP 4U30A 2ZGJA 1VJ9U 5E0GA 4ZKOU 1HAIH 5EJZA 1J15A 3ZZ4A 3ODDA 1CA0B 1PFXC 2ZU4A 1O2WA 1WV7H 2B7DH 3V0XA 2A0QB 1C5RA 2PGBB 1QURH 1SI5H 4FUJA 1Y3UA 3A7ZA 4H42U 3FAOA 1MTSA 2CMYA 3EA8A 5DP8A 1C1OA 4BTTB 1NPMA 1TPSA 1LHGH 3FZZA 1EB2A 4OGXA 3RC5A 1KXFA 2G4TA 2F91A 4WF8A 1XVMA 1YPJH 4NZLA 4B6EA 3GDUA 3OY5U 1CT4E 4XSKU 1E38B 4DCDA 4GSOA 3OSYA 3STJA 4YOJA 3H7TA 4GVUA 4IBLH 5DN6D 1YCPK 1ELBA 1UO6A 1Z6JH 1KDQB 1QJ6B 4ZAEA 2KZ4A 1M9UA 3SU5A 2WUBA 1A0LA 1ARCA 2P3FH 1C2GA 1GHAG 1NFYA 2VWMA 2QF4A 4D9QA 1TOMH 5C5NA 1HJAB 2BY5X 1O2IA 3PV5A 3E0NB 1AIXH 1Y5UT 2BDBA 3MQKC 1YYY1 2F9NA 3BTWE 3F68H 5B6OA 1A7SA 1FV9A 1TBRH 1HAGE 3ZZ6A 4JZDH 3L33A 1Z8IB 2AGEX 4X8SH 5HYOA 1LHDH 1KTTB 4Y76A 1Z8GA 1OWHA 1UTJA 1C4U2 2PWXA 4LK4A 4E06H 5I25A 2OP9A 2JETB 1J9CH 1W14U 3LGVA 3PTNA 2C8ZB 1IQLA 1ANCA 2GCTB 4UE7H 1ZSKA 2GDEH 3SN8A 1GI1A 3AAUA 1W7XH 4HGCA 5JBTA 1TPAE 3RXVA 4QT8C 3GS9A 1C1NA 1HAVA 1CGJE 4JCNA 3PV2A 1TX7A 3PRBA 1P2JA 3DSOA 5C1UA 1TQ7B 4ISLA 1LVOA 4IW4E 4MNYA 3SNCA 2IN2A 3E0PB 1HUTH 1ELTA 3UQVA 5DP6A 2J4IA 2TGTA 3SI3H 1THPB 2KAIA 4B2CA 5EXNA 4D76A 2ILNA 1NESE 5TJXA 1C1WH 3ATWA 2BY9X 4O9VA 4TT3D 2XC0A 2F83A 1WCZA 5BRRE 2WUCA 3EA7A 4FU8A 3ZVCA 2BLOA 3KCGH 1O2HA 1TA6A 3H09A 5F8TA 3VEQB 2G55A 4RN6A 1FY8E 1QFKH 2BHGA 8GCHF 2WHXA 2PP6A 1NRQH 3MNXA 3ZYEA 1MAYA 3SU4A 2GV7A 2SGPE 3NXPA 1GBCA 3W94A 3V13A 2GT8A 2BY7X 2JKHA 1PQ8A 2A2QH 3ATKA 3GY5A 4WMEA 1HAOH 2W6JD 1GBBA 1K22H 1MH0A 1RTKA 1G2MA 4O3UA 2A4QA 1WU1A 3W95A 2ZQ2A 4ISIH 1WXRA 3ZYDA 1IHSH 2FOAA 1ANEA 1G3CA 2J9NA 4H4FA 1WOFA 3RXSA 5EQSA 1P2NA 1BMNH 1C2MA 1F0RA 1PQ7A 4CRBA 2A45B 4YT6H 4JYTA 1C9TA 4ABBA 1T31A 5TCAA 4JYVH 4B71A 2Z9IA 5C0TA 1C5NH 2QF0A 3M3SA 5HM2A 3A84A 1S6FA 2ALVA 2OQ5A 3VB3A 3QGJA 4DY7B 3FP7E 1GL0E 1O2MA 5F8XA 4I8GA 3C27B 4X8TH 2O8TA 1FX0B 1G36A 2BD4A 4Q63A 1BITA 5EXLA 3TK9A 1YCPH 4AFQA 2LELA 4B2AA 1GJ8B 1U6QA 4X6MA 3RXRA 4BAQB 3GCHC 3BTFE 1LDTT 3GY7A 2B0FA 3BV9B 1EP5A 5GIBA 1C2HA 1TGCA 3RLWH 2HGTH 5CE1A 4IN1A 3CP7A 2VU8E 2L6OA 2EEKA 4CR9A 2OC7A 1SFQB 5C2ZA 2P3UB 5E2OA 2OD3B 2VWNA 1C5WB 1QBVH 2VGCC 5FXLA 2PUXB 1JIRA 1P2KA 1O3OA 4AGJA 7GCHG 3SJIA 2O9QA 3TJUA 1IHTH 1BRAA 3MU0A 2ZGHA 1SFIA 1AE8H 1HB0B 7KMEH 4O03A 2GCHF 1O3PB 2H9EH 1EUFA 1TNJA 2GZ9A 2ZO3H 3QO6A 4U32A 2D26C 1P2IA 4AGKA 1TNHA 3TVJB 2FLBH 1UK4A 3PWBA 3SJOA 1WBGB 2PSXA 1GHBG 1ETRH 1L2EA 3T2NA 3VG8A 1GBJA 4WXVA 2FPZA 2WZQA 3TGJE 1C2EA 4DIIH 4A1VA 4Y0ZE 1GHYH 1HJ8A 1FI8A 4OS6A 3GCTF 3RMNH 4ZROA 4NSVA 4K60A 3DD2H 1P57B 3ZV9A 5GDSH 5HMAA 5FAHA 2I6SA 4ABGA 4D9RA 2BOHB 1C1UH 1TNGA 3D62A 2TRMA 4CHAB 1IQHA 1O2PA 1A5HA 1EAUA 4XRNA 2ZDMA 4CRCA 1XUFA 1K1LA 2GJGA 1SGRE 4JZFH 2EI7A 2H6MA 4X8UH 1RFNA 4XBBA 4Y8ZA 3SGAE 1LQDB 3F6UH 1K1PA 5C94A 3P8GA 3K2UA 1GMHG 4ISNA 1TRYA 1G2LA 1ZMLA 2F9VA 1V3XA 2ESTE 5AHGH 2J94A 1TQ0B 2B5TB 4UEHH 1QJ1B 1KXBA 4K3JA 1GBMA 1SGCA 2EY4C 3MOCA 1DUEA 2XBVA 1QQ4A 1HGTH 2WPLS 3QZRA 4A6LA 3UWJH 5EW2H 1O2XA 4IMQA 2J98A 4HZHA 1SPJA 2ANMH 4H6TA 1H1BA 4AFSA 5C5OA 3OTJE 1T4UH 2W3KA 3EE7A 4DGJA 3GY4A 4LXBH 1GVZA 4E7NA 1LTOA 3MO3A 3TITA 3PMBB 1GI8B 1PPGE 1O33A 4AB9A 1BT7A 1DUAA 3KQ5A 3M7TA 1V2VT 3T29A 3TJVA 3BTTE 4I86A 3KQDA 1AWFH 1C1RA 1O5AB 4NWKA 3RM2H 3V3MA 4MNWA 4BXWA 2GP9B 3EA9A 4Q7ZA 3RXHA 5E2PA 1TALA 3GCNA 3SJ9A 2PV9B 4BXSA 4TWYA 1SMFE 2Q1JA 3QTOH 1QL8A 1DXPA 3NK8A 1B5GH 3U8RH 4ZCNA 2F4LA 1HAHH 3F3BA 1GJBB 1WQSA 4OS2A 1MBMA 1INCA 3MNBA 3RXGA 1SGFA 2VJ1A 2AYWA 4YOGA 2QXIA 5CHBA 1L4DA 1GI9B 1UTOA 3IITA 2XC4A 3K6ZA 1VITF 1W0ZU 4B74A 4FVBA 2J95A 1GI5A 1W0YH 3ZVDA 5DP7A 1EFRD 1NTPA 3SQHE 1P3EA 5EJLA 1UW7A 1TE0A 1UCYE 3CNRA 5T3HA 4AYVB 1XKBC 3D65E 4MNXA 1QR3E 2VIQA 4GAWA 1C5QA 1CGIE 5C1XA 2A7JA 1SGFG 3OTPA 3ZVFA 4AFUA 1ZPBA 2PHBA 1GJ6A 5DPAA 2FXRA 1GHVH 3V7TA 1ZYOA 2P16A 2PKSC 4FETA 3KQBA 4YESB 2ALPA 1MCTA 4FUDA 2Q6DA 3A7XA 4WJG2 1PPHE 3RC4A 5A8YA 4NIWA 1UK2A 1HFDA 1FMGA 1ZLRA 1QA7A 2FS9A 2QXJA 1SGYE 3GOVB 1A46H 1T4VH 3VB5A 1GCTC 3LOXA 1J14A 1DANH 3M7QA 1V2KT 4YZUA 3SOSA 2F3CE 1P3CA 1EX3A 3F9FA 3T26A 1C5YB 2YMSC 1E79D 8GCHG 1AY6H 2A7HA 1BA8B 1ORFA 4XE4A 3UOUA 1BUIA 3DCLA 3MH4A 5FL7D 3NPSA 2GV6A 3QTVH 4GHTA 1MAXA 4X2VA 1LQEA 1O2UA 6LPRA 2ZI2H 3SV6A 4DOQA 1BQYA 2ODYB 2O8MA 3LKWA 5FCRA 5F8ZA 2PFEA 1SL3A 5AVDA 4NA9H 2VNTA 2O8WA 4MPXA 4RKJB 1YBWA 2XNIA 1C5MD 5CHAC 2ZEBA 5E0JA 2D8WA 2G00A 4M7GA 4IS5A 1TMTH 3FZDA 3SU3A 1NC6A 1V2TT 3QX5H 5JDUB 1UVSH 2FOBA 4NWLA 4ZHLU 2H5CA 2VVCA 2VVVA 4HTCH 1IQNA 4D7FA 4AC9A 2A31A 3DT0H 1HAXB 1QRZA 2D1JA 4B76A 1L1JA 3ZZCA 3N7DA 1F7ZA 1O39A 4ASUD 1OP2A 2KCPA 1O2LA 1SLUB 2THFB 1A5GH 1QZ8A 2FP7B 2WINI 1K21H 4KTUA 1D3PB 4RT1A 1C2LA 2QYIA 1SQOA 3RU4E 1AQ7A 2ZFTA 4KELA 4ABDA 1UJ1A 3Q3YA 1JRSA 2G4UA 1SB1H 3F2GA 1A3EH 1MTVA 4X2YA 1C4Y2 1HXFH 4A1TA 3RM0H 1BTPA 1DWBH 1ANDA 1AWHB 1KXDA 1LCYA 2W3IA 1RRKA 1FIZA 1P09A 1GBLA 2IJD1 2G5NA 2QC2A 4XDEA 1QB1A 2FO9A 1QA0A 2JIZD 1DT2A 1QBOA 1HRTH 2FX6A 1S6LA 1AZZA 2ZFFH 1Y59T 2TBSA 1PPZA 3LGWA 2BTCE 1KY9A 3MH5A 4U2WA 3EE0B 1GG6C 1DVAH 1IQEA 1LVMA 3DUXH 4DIHH 1XVOA 2GX4A 5EXMA 1N8OC 1NBME 3HATH 4JK5A 1P8VC 3P70B 1TNIA 2PLXA 3A8AA 2W26A 2KR7A 1G3DA 1O2VA 1ESAA 1GI0A 3LGYA 4RSPA 3RXKA 1SC8U 4VGCC 3UREA 2F43B 2XC5A 1E0FD 3U69H 3LC5A 5SGAE 1AUTC 1YPKH 3RDZA 1HIAB 1CHOF 4I8KA 3BTDE 4Z1MD 2XNDD 3HPTB 1W13U 1CE5A 1N6XA 4MPWA 4Y11E 4XD7D 1RD3B 1VCQA 4BNRA 1EZSC 3SV2H 3URCA 1EPTC 3U98H 4I7YH 1YGCH 1O34A 5A8XA 1T8LA 1GJAB 1AFQC 1G3EA 2CF8H 2PR3A 1LHFH 2NU3E 8KME2 3BTQE 2G5VA 1NN6A 3ZZ3A 5HIZA 1P9SA 2BD8A 2NWNA 4ZKNU 5GJ4B 1P05A 2BQWB 4B2BA 3BTGE 1XUJA 2ZCLP 1RS0A 2BX4A 1VKYA 2HWLB 3EYDA 2BB4A 4ABJA 5EPYA 1BOQA 2Y81A 1P04A 1QRXA 1LKAA 1WTHD 3SU1A 1G37A 1FPCH 4SGAE 1BIOA 3CS7A 4ZXXH 1TAWA 3UNQA 4Y8YA 4GCHF 3T27A 2SFAA 4D7GA 4GLYA 1ACBE 3BTHE 2GD4B 4BAKB 4BAMB 1Z71A 2ZECA 1TPOA 3S7HB 1LHEH 4WY3A 1OHHD 1ELCA 2VB0A 5J4SA 5EJ1A 3IG6B 1C2IA 3MI4A 3VPKA 1RTLA 1QNJA 1O5FH 2KX4A 1AKSB 3F9HA 3UPEA 1E36B 1T8OA 2HLDD 1ZR0A 1GDQA 5A0BA 2FI4E 3QUMP 1ZPZA 3BSQA 2FLRH 4IMZA 1Y5AT 3RUOA 2W6ID 2J34A 3M5OA 3MO6A 2BDHA 1SGDE 2IPHA 4ABAA 2J2UA 1C2DA 2R3YA 3SV7A 1GJCB 2JH0D 1CSOE 2ZCHP 1Z6EA 4UFGH 3UNSA 1FY5A 2AS9A 4R8TB 2BXTH 2SGAA 3ZZ7A 4Q4LA 1UVTH 4BAOB 2OC0A 2FIRH 3ODFA 5LPFA 4INHA 4F4OC 4I32A 1YPGH 3UWIA 4X0WU 3OE7D 3RXDA 1RIWB 1CT0E 2KCYA 1GL1A 1MTNC 1S84A 2KCOA 1YC0A 4Q7YA 1A3BH 1AI8H 2VBCA 2ZU1A 2B8OH 2ZTYA 3TGIE 1Y3WA 5ESBA 1O5BB 1MQ6A 2WV9A 2QIQA 1EZQA 1MKWK 2ZC9H 4ABHA 5HGGA 5DP3A 1PPBH 1ZMNA 3URDA 4AFZA 1K0HA 3OEHD 2Z6BD 3F2HA 1W2KH 1O3IA 1SKYE 1A2CH 8ESTE 2HVYB 1ETSH 3PO1C 1C5PA 2Y5GA 1XM1A 1O5GH 4LOYH 1OYTH 1RGQA 1SGEE 1O32A 4CRGA 3SJKA 5LPRA 1AZ8A 4YLUA 4YLQH 4AN7A 1K1IA 1K1NA 3LIWA 1OP8A 1E34B 1SOTA 1C2JA 1DXWA 1OSSA 4ABIA 1S82A 3RU4D 1O2ZA 2PTNA 2C3SA 2I6QA 3U1IB 1C5LH 1Z8RA 2BDYA 3A8DA 1UK3A 2GKVE 1KIGH 1A5IA 1O5CB 2IOTA 1LO6A 3MYWA 2J97A 4NIVA 4ZXYH 4CREA 3KGPA 1KDQA 4WXIA 1IOEA 4Z6AH 5KEDA 2CHAC 3I78A 5A0AE 1OWIA 1MQ5A 6GCHF 4FUHA 1OXGA 1EJNA 4XFQA 1OS8A 2NU0E 3N99A 2R3UA 1P06A 3UB0A 1JRTA 1FNIA 2PKSB 5ETXA 5GNDA 1GJ5H 1H8ED 2FOEA 1C2FA 1Z7KA 1YKTA 1L4ZA 1EJMA 1SR5C 4RI0A 4TPYA 5DSFA 2F9UA 2PKAB 4RKOB 4B1TA 4U01A 1NBMD 4FOUC 1O3GA 3FP8E 2GZ7A 1O2RA 4UFFH 2P59A 2NU4E 2JDID 3A81A 1K1OA 3ELAH 4ZMAH 4AB8A 1GCTB 2BD9A 1SHYA 2WPDD 1CO7E 3VXEH 2BLWA 1O3EA 4IGDA 4Y0YE 3SGBE 1P02A 5C67A 2F9OA 1PYTC 3VB4A 3S69A 3SJ8A 4NA7A 1EJAA 1V2OT 4UDWH 2A4OA 1ZZZA 1S83A 1T7CA 1GPZA 1RJXB 1E1RD 2RDLA 3ESTA 3FOAA 3L3TA 1LHCH 3M5MA 1K1MA 1PYTD 1WUNH 2DUCA 3L6PA 1B0EA 4I33A 1FQ3A 4KP0A 1KXEA 7ESTE 1GBKA 1TFXA 4P00A 3KYGA 3PV4A 1NT1A 4SGBE 1N6YA 1H9IE 3SNBA 3I77A 5CDFE 2OTVA 5CHAB 1G32B 3QZQA 2XYAA 2ZZUH 1Y5BT 1F0SA 2VWOA 1Y8TA 2BD3A 1D3DB 5K0HA 1TMBH 2OBOA 2QGRA 1YLCA 4INLA 3FVFB 2XOKD 4CH2B 1CT2E 3H5CB 1QBNA 2EQNA 1T8MA 3TH2H 1H8HD 4TYDA 4F48B 3SNAA 3NKKA 4K1EA 1FN8A 3DSGA 3SHAH 1BBRK 1V2NT 4WH8A 3DSPA 3RXPA 2FOHA 1O2QA 1KXAA 1QHRB 4GUXA 2WPJS 5E8EH 1FJSA 2AFQB 1MKWH 2OQUA 1BTUA 1O31A 1GMCG 2QA9E 4X1PU 4AG2A 2A2XH 3PWCA 3SZEA 3UR9A 2ZDKA 2FTMA 3EQ0H 4HFPB 2CN0H 3R0FA 4IN2A 2ANWA 3T28A 3T25A 1E37B 1ZOMA 2ZIQH 3SU6A 3PLKA 1CHOG 2OC8A 3PMJA 3PM3A 2F9PA 1B7XB 3MU8A 4NG9H 3TLOA 3ZZDA 4BANB 3OY6U 1C1MA 2CK3D 2AH4X 3RXLA 1S5SA 3GCOA 5EODA 4DT7B 5EIYA 1N8OB 1SLXB
chains in the Genus database with same CATH topology
1O2OA 1D6WA 1MTWA 3SUGA 3Q00A 4ABFA 1TWXB 2FDAA 3SQEE 2AERH 1UVPA 1MZDA 1GI3A 2OINA 1S6HA 5AFZH 1AD8H 3E6PH 2ZFQH 2JJ2D 3LPRA 1WSSH 5L2ZH 1VJAU 1XXDA 2M5TA 2UWLA 2EA3A 3OX7U 1JXPA 1SQAA 4DVAU 3IWMA 5G4BA 3STIA 1MU6B 3A86A 1X7AC 3ATMA 2Z9GA 3E16B 3OYPA 3ZZ8A 1OWDA 2EI6A 3D23A 4YT7H 4GCHG 2QF3A 3DA9B 4WVPE 3GY8A 3B9FH 2A4GA 3GY2A 3QGNB 3A85A 1EPTB 2QXGA 4FUGA 3DFLA 3HK6B 5HM9A 3F1SB 1HV7A 3NWUA 1A61H 2J38A 1NRRH 1GHWH 3FP6E 1ZTJA 2RA3A 5GWZA 1AN1E 2GT7A 1FONA 1H9HE 3PLPA 1SGTA 3LJOA 2CXVA 2ZKSA 1LPKB 4BOHA 3PRDA 1P2QA 1YLDA 1A4WH 1UHBB 5DGJA 2V3HH 4A5TS 2AGIX 2FOGA 1HJ9A 2VH0A 3RLYH 3UOPA 4E05H 4MTBA 1ZTLA 2A7CA 1C1TA 1FY1A 4JMYA 3K6YA 4I8JA 2BM2A 3TGKE 1FIWA 1SG8B 3KNXA 1QJ7B 3KQCA 1NFXA 5AFYH 1FZZA 1XX9A 3OU0A 1BTXA 2Y7XA 5B6LA 4YTAA 3LONA 2QXHA 3Q3KA 5GCHF 4A1XA 1AB9C 1C4V2 1Q2WA 2R0LA 2H2ZA 2H5DA 1MD8A 2ZDAH 4Z0KA 2P94A 1HAYB 2GMTC 2WPKS 3O8CA 5T6FA 2Y7ZA 1BBRH 3AVZA 2JETC 1BB0B 3AW0A 1CBWC 2ZPRA 2ZDVH 2GCTC 3M5LA 2SGQE 1V2QT 3PMHB 1KYNA 1GHAF 2M2AA 1TIOA 4Q7XA 2FYRA 1HCGA 5L2YH 2BY6X 4NA8A 2FOCA 1V2MT 1ZTKA 3E8LA 4MQAA 3F0OA 3ZZBA 3JZ2B 1HLTH 3VB6A 3KIDU 3T5FH 3O8RA 1SVPA 5GXPA 4KTCA 1OWKA 1GMDF 1EASA 1SGPE 2ZGXH 2G8TA 3QDZB 1DFPA 1O3DA 1LVBA 2BDAA 1GGDC 1ABJH 1TRMA 5H4IB 3TJNA 1W3CA 4K5ZA 3ZVEA 3SYJA 2WPIS 2VH6A 2ODPA 2J92A 3T62A 1GDNA 1D3QB 1G3BA 6GCHG 3U8OH 3PO1B 1TNKA 2C4FH 1BBRE 4HI3A 4F49A 1UMAH 4MDSA 4UONA 1UTQA 2VIDA 5FPYA 1MABB 2AMPA 1GBFA 1XUIA 1LVYA 3HK3B 2ZWLH 1V2RT 1GCDA 1TONA 2ZHEH 3QLPH 4K8BA 3RU4T 4X2WA 1SSXA 2XRCA 4TPIZ 2P8OC 2A4RA 2Y80A 1HAZB 4H6SB 2YMSD 4R0IA 2W7UA 3RMOH 4AG1A 1RXPA 2Y5FA 1FLEE 3RXQA 2BQ6B 1EZXC 2CHAB 4ZKSU 5J4QA 2V7QD 1FAKH 1TBQH 2OK5A 5EOKA 2ZHQH 1YPMH 2HNTE 1COWD 2BQ7B 2Z3EA 1NRNH 4AX9H 2P93A 2AMDA 3RXJA 1ELAA 1C1SA 1O30A 3RXFA 2D2DA 1GBHA 1W12U 3GY6A 2O8UA 2DE8A 3RXBA 2P3TB 2ZG0H 3K65B 4K1SA 5DKMA 3SU2A 1UTKA 2TIOA 3A82A 2A32A 1SBWA 3TNSA 1UTPA 1O38A 2OCVB 1QL7A 2HRVA 2ANKH 1DE7H 3RMMH 3RXIA 1Z1IA 4X6OA 3U8TH 3MNCA 2VIPA 4THNH 4F55A 3TPIZ 5FX5A 2VIVA 1OOKB 4WWYA 1EZUC 3A8BA 3OEED 1J17T 3LU9B 3P8NA 3BG4C 3BIVH 3FN8A 4OS5A 4KTSA 1KLIH 2QV1A 3M7UA 4O3TA 4AOQA 1CHGA 3SORA 3UR6A 3MH6A 2FI3E 3Q77A 4JYUH 4MLFB 3RXMA 4NGAH 4B75A 1QQUA 4K8YA 2NU1E 2H1UA 2GCHG 4XBDA 3JZ1B 1IQFA 1BJUA 1S85A 1QTFA 1UTNA 1O3MA 2A1DB 3GCHB 5L6NH 1BTYA 4TY6A 4Y7AA 2FYQA 4YXWD 1THRH 5LH8A 1YPHC 1UVUH 1BJVA 2C8WB 1ZSLA 1VZQH 1P2MA 1MTUA 3SW2B 4AZ2B 4ZUHA 1DLEA 3BEUA 3LDXH 4FUBA 5C17A 2FOMB 5IDKA 1W11U 3ZZ9A 2VGCB 2UWPA 5T1VA 3GCTG 1BMAA 2LPRA 2WYGA 2SGFE 1P03A 3MFJA 1VCWA 1GI6A 1O5DH 4BAHB 3GISB 2WPMS 2V35A 4FUEA 4CRDA 2YNBA 1TGTA 1EOJA 4Y8XA 5LGOA 4JK6A 4MPUA 2G52A 1S81A 1GHBF 1GI2A 1P2OA 3UFAA 2QE7D 2HVXA 1H9LB 2FZZA 1SHHB 2RG3A 4OS1A 3MO9A 2PUQH 1CA8B 3GYLB 2VIWA 3AW1A 1UTMA 4AYYB 1G9IE 1UTLM 4NFEA 3A87A 2FODA 1J8AA 3RC6A 4I31A 4FUIA 1O3LA 3KHVA 3VGCC 5EW1H 3BN9A 5A09A 3TK5A 3EGKH 5F03A 1WAYB 2V0BA 1DWEH 3KL6A 3TIUA 1NZQH 3E1XB 2J5UA 1GJDB 1KLJH 3SGQE 4B73A 2QN5T 2GDDA 2ZFRH 1T8NA 1AU8A 1O37A 3H7OA 3UQOA 4Y79A 2AIQA 2TGAA 3TNTA 4CH8B 1QCPA 4GPGA 4X1QU 2BY8X 1E35B 1FN6A 1LKBA 1ZHMA 2KCAA 1P01A 1WQVH 1HIAA 5JBBS 3BIUH 1GVLA 5T6DA 2DE9A 1Z1JA 1EXFA 1DM4B 3TJOA 2ZNKH 1C5ZB 3S9AA 3LGIA 2CV3A 5C3NA 1BMLA 1XUHA 2WV5A 3KEEA 5E0HA 5FX6A 1OWEA 1HDTH 1DSUA 1MD7A 1KLTA 5EG4A 2W5EA 4ASHA 3KF2A 1HAVB 5EQQA 5DP5A 2HPQH 5GCHG 2K0QA 2WSSD 4E7RG 3KQEA 4O97A 1D9IA 1D6RA 1FDPA 3A8CA 2HPPH 3WWBA 3SU0A 2HNTC 5TCCA 1OPHB 2F9BH 3SNEA 3OAAD 4NZQA 2XXLA 2BDIA 3S7KB 1W7GH 1ZRKA 1CQQA 2KAIB 2R9PA 4CBOA 1VITG 1V2WT 3UY9A 5EQRA 2H9HA 2AGGX 2SGDE 3AK5A 5JBCS 4LZ4B 2BYAX 1C5OH 2ZDNA 4X6PA 1YP9A 5T6GA 3OFND 2Z3CA 1DPOA 3SUDA 2AMQA 1P12E 2PTCE 2UUFB 1L1NA 1WTGH 3E91A 1BRUP 3ENSB 1FAXA 3ZZAA 3M37A 2Y6TA 4IC5A 1JIMA 2V3OH 4K69A 3SV8A 2ODQA 1TRNA 1MBQA 2ZTXA 1A0HB 4FUFA 1O2GH 4J1YA 2JH6D 1AKSA 1AB9B 1O3HA 1EAIA 4K2YA 1GMDG 1O3FA 1Y3XA 6CHAC 4MPVA 1O3JA 2GMTB 4X6NA 1CU1A 2ZPSA 5FPSA 3HKJB 5L30H 4MVNA 3B8JA 3GICB 1NO9H 3P8OA 1NRPH 1F5LA 2GZ8A 2VIOA 1DSTA 1CBWB 1ESBA 3FANA 1TGNA 5K7RA 1AVGH 3FKSD 3D49H 5JBAS 4OGYA 4YO9A 1IQKA 1O35A 1C5VA 4MG3A 1YF4A 2A5IA 3M35A 1P10A 3UIRA 5A8ZA 2FMJA 1H4WA 3PYHA 1NU7B 1N1LA 4ZHAA 1O5EH 3RXEA 5EGMA 2SGEE 2XWAA 1TB6H 4CRAA 1MMJN 4Y71A 4NSYA 5I46H 3EDXB 1TYNA 1GBIA 2AEIH 3N7OA 1GGDB 4JZ1A 3BTEE 3Q76A 1MU8B 2XBYA 3A89A 1C5UA 1O3KA 1ZJKA 3TH3H 4NIXA 3RXTA 2Z9JA 1DITH 3NRLA 9LPRA 2ZFPH 1AUJA 1ZGIA 3PMAB 3F2FA 1XMNB 1GBTA 3VXFH 4YM9A 1A0JA 4OM9A 4J2YB 2YMSB 1F92A 1TABE 2Z94A 3M36A 5C1YA 2C8XB 1G30B 3M3VA 2QY0B 1W8BH 1J16A 1BHXF 1W0KD 2PGQB 4ISOA 1NRSH 3M3TA 2P8OB 2ULLA 3S9BA 4A92A 1AVWA 2P95A 3MNSA 4Y7BA 5F6MA 2ASUB 3BG8A 3UNRA 2R0KA 4M9FA 2WPHS 2QCYA 3W1EA 2CGAA 1Q31A 4FXGH 4JZEH 5C20A 2HNTF 4I8HA 2GTBA 1XUKA 3RP2A 1IAUA 3MU4A 1L1GA 4X1SU 2FEQH 1UCYK 3F9EA 4UFEH 3GDSA 3C1KA 3I29A 1BCUH 3O8DA 2K8IA 3U1JB 1VR1H 1L0ZA 2PKAA 1W10U 1ZGVA 1E1QD 1V2UT 2BD2A 2BVXH 5DJ7A 1ABIH 1V2LT 5A2MH 2Z7FE 4X8VH 1D3TB 5FBIA 1EQ9A 2OUAA 1BTWA 3CS0A 2QF5A 1BTZA 1QIXB 5EPNA 2RCEA 1GHZA 2W7SA 4OS7A 1MKXK 1NROH 1JWTA 1PQ5A 1QY6A 3A80A 1C5TA 1VGCC 1H8IH 2VWLA 1ZPCA 1QRWA 2FI5E 1K1JA 4X2XA 3E3TA 1ZMJA 4OS4A 3MH7A 2GVFA 1OP0A 2EI8A 2TPIZ 3QWCH 5DO4H 1QB6A 2VINA 1F5KU 3BG4B 4D8NA 1DY8A 2C8YB 1SGIB 1WYKA 3HGNA 4FVDA 3B23B 2Y5HA 3LC3A 1O2NA 1GG6B 2ZGCA 1C1QA 3EAJA 3KN2A 1DOJA 1SQTA 1GDUA 1KSNA 1H8DH 1FY3A 2AIPA 2BVSH 2SNVA 4K1TA 2BLVA 1ZHPA 1ZSJA 1F5RA 3WW7A 3ZIAD 1DICA 1PPCE 1MZAA 5JB9S 2XBWA 4VGCB 1THSH 3WWFA 4AORA 2Z3DA 3F0PA 3MTYA 3SZNA 3LH1A 2V6NA 4NCYA 4Y10E 2B9LA 1DS2E 4B6FA 2UUKB 1NS3A 2ZHFH 1GI7B 3AAVA 4ESTE 1CA0C 1SLWB 1TLDA 1XXFA 2CJIA 4WMDA 5EU8A 2QAAA 5HKKD 1OYQA 1F0UA 3P17H 3SBKA 2R2WU 1TNLA 1B0FA 1DWCH 5C0UA 1AFQB 1C5SA 2K1QA 1GJ4H 4TSFD 1XKAC 2UWOA 1GI4A 1HBTH 1FY4A 4Q2KA 4WMFA 1NFUA 1C1PA 2HOBA 2BD5A 4Q80A 3MU5A 1C1VH 3Q3XA 3ATIA 5HXFA 3VGCB 3MU1A 4CR5A 1V2JT 4XOJA 3GYMA 3LJJA 1IQMA 1DY9A 2FOFA 1GBDA 3M61U 2IJOB 2BZ6H 1BZXE 1SGQE 2FS8A 1YPHE 2AHME 3AASA 1FUJA 1TOCB 1TPPA 4ZKRU 1HJAC 3N7EA 3SUFA 1AO5A 1OWJA 1Y3VA 1RIWC 1UCYH 2ZU3A 3NCLA 4DURA 4NIYA 3MMGA 3S0NA 1HPGA 2O8LA 3RXAA 1BRBE 4BTUB 4DT4A 3QN7A 1BHXB 1EAWA 1ZJDA 4XBCA 1GJ7B 3K9XB 1LPGB 1ELDE 2BLQA 1ARBA 3LGTA 3RXOA 2WV4A 1EPTA 2XWBI 3O8BA 2ZTZA 3PROA 3SI4H 1MKXH 3ZV8A 1Q3XA 2PW8H 2OLGA 3VFEA 5DP9A 3ATLA 1K2I1 3TU7H 1ELFA 3MHWU 3P6ZB 2YNAA 2ZHWH 1O2JA 2GGVB 5JYIA 3PLBA 1O3CA 5ESTE 5JB8S 1MTNB 1UHBA 3RMLH 1FPHH 3HKIB 4KGAA 3DFJA 2G81E 1DLKB 1C2KA 3RXCA 3SUEA 1V2ST 1BDAA 1AHTH 1A1RA 2UUYA 4DG4A 4ISHH 5GPIB 3ZZ5A 4X1NU 1V6DA 3E90B 1K28D 1EATA 1PQAA 3LT3A 1TA2A 1AVXA 1GHXH 1UVOA 1AMHA 1JMOH 1SGNE 3R3GB 1QL9A 4IC6A 4ZH8A 5F53A 3TK6A 4TY7A 6CHAB 1EKBB 2JJ1D 2XCNA 1K9OE 3SO3A 1P11E 4JZIA 1EP6A 4NFFA 3P8FA 2OXSA 2FX4A 3U9AH 3ZVAA 3CENA 4CBNA 2SNWA 4FU7A 1GWAA 1Y3YA 2C90B 1QGFA 1O2TA 1KMHB 5AF9H 1FXYA 2BVRH 3NZIA 5JPMH 1F0TA 1AFEH 6ESTA 2ANYA 2XW9A 5DG6A 1ELGA 2NU2E 2Q6FA 1NM6A 3SNDA 1O3NA 1C9PA 2ZQ1A 1EB1H 3DHKH 2Z9KA 4LZ1H 1DWDH 1AE5A 1LMWB 1O3BA 1LPZB 4DJZB 9ESTA 4ZHMU 1RTFB 1T32A 1CGHA 2ZA5A 3PB1E 2WYJA 3A7WA 1HXEH 5BPEA 1JOUB 5IK2D 1EAXA 2BZAA 1TX8A 2RA0A 2ZFSA 4YOIA 2HLCA 2PSYA 3ZVBA 2FTLE 2BDCA 1IQJA 2BXUH 2XCFA 4I8LA 4A7IB 4FU9A 1GVKB 4PROA 1MCVA 1KXCA 1YPLH 2OBQA 2UUJB 2FM2A 2KM0A 1OX1A 1CVWH 5DP4A 1O36A 2Q6GA 2FWWA 3A88A 1BRCE 2ZU2A 3BEIB 5PTPA 4KKDA 5LPEA 2XBXA 3GY3A 1YM0A 3BTME 1HNEE 1F2SE 1C5XB 2ZU5A 1BMFD 3BF6H 5DK1A 2C93B 1EOLA 3BTKE 1IQIA 1ZRBA 1O3AA 1D4PB 1MUEB 1OKXA 2R2MB 3MWIU 1ESTA 3F9GA 2ZGBH 5IYTA 4CRFA 2TGDA 1PJPA 1Z8JB 2YOLA 1O2YA 2TGPZ 3P92A 4Y6DA 3VB7A 1TGBA 4TWWA 1TGSZ 1TMUH 3LH3A 1W0JD 2STAE 1PPEE 1P9UA 2HALA 2ZF0H 1SOZA 3A7VA 1ELVA 1GJ9B 1XUGA 1HAPH 3V12A 5FPTA 2ZHDA 3A7TA 1QB9A 3PTBA 1O2SA 1KTSB 2ZPQA 1NU9A 3A7YA 1NFWA 4X1RU 4BTIB 3ZVGA 7GCHF 5FHTA 2G51A 1P0SH 1O0DH 3UTUH