1OWHA

Substituted 2-naphthamidine inhibitors of urokinase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Urokinase-type plasminogen activator
publication title Identification of Novel Binding Interactions in the Development of Potent, Selective 2-Naphthamidine Inhibitors of Urokinase. Synthesis, Structural Analysis, and SAR of N-Phenyl Amide 6-Substitution.
pubmed doi rcsb
source organism Homo sapiens
total genus 60
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1owhA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1owhA01
1DVAH 1ZLRA 1VZQH 1P09A 2ZDNA 3FAOA 5DK1A 1DUEA 1SLUB 4I31A 3VEQB 3F9GA 1AVXA 1FAKH 1NC6A 1KDQA 2XWBI 2G00A 1Z1JA 1FPHH 1KLIH 1G3DA 5EQSA 4UD9H 3BG8A 1NS3A 2XBYA 1NFXA 1LCYA 3EA7A 1BJUA 3RXIA 2W3IA 4K60A 1MCVA 3BSQA 3PB1E 1XUKA 3E3TA 2ZPSA 3SJ9A 2BQ7B 4JK5A 1MD8A 4JK6A 4XDEA 4RKJB 1PQ8A 1TB6H 2BDBA 2ANKH 3WY8A 1Y5UT 2C8WB 3LPRA 3Q3YA 4ABGA 3K2UA 1A3EH 2O8LA 1EB1H 5J4QA 3QDZB 1F0RA 3UY9A 4X1QU 2VWMA 1V2KT 5AFYH 3RXJA 3L6PA 4BOHA 3NZIA 1N8OB 1PQ7A 3W94A 5SGAE 3FP8E 4GLYA 2QXJA 1HDTH 1GBAA 3PMJA 1JRSA 2P8OC 4FUCA 2B0FA 2BB4A 4D8NA 1BMLA 4INLA 1H8IH 2G55A 1O2HA 4WH8A 1HLTH 1FIZA 2ULLA 1JWTA 2V6NA 3V3MA 1BBRH 2IN2A 5LGOA 2OC8A 2VWNA 1OWKA 4B74A 1C1MA 1GI9B 3HGNA 1MUEB 1O38A 3RM2H 3HGPA 2QXGA 1G2MA 2GT7A 2ZU5A 5DJ7A 1TPSA 2BOKA 2BLWA 1BRCE 2D8WA 2G81E 3PO1B 2A7HA 1DY9A 1SC8U 4D9QA 1CT4E 1EP6A 1A1RA 1DSTA 1J16A 4FUFA 2NU2E 4A1VA 1RS0A 2QIQA 5T3HA 4DIHH 1PPEE 4BNRA 5L2ZH 1YPGH 2VJ1A 2XXLA 4Y11E 1XVMA 1DWCH 3PTBA 3SUDA 1FPCH 1MTNC 1T8OA 2BD2A 3Q3KA 4X1SU 3ZVBA 3KQEA 3M3VA 4SGBE 2OUAA 2VU8E 3P70B 1FIWA 2PFEA 5T6FA 5EG4A 3BN9A 1P2MA 3P8NA 1C4V2 5DP3A 2ZCHP 4ZKOU 1C2GA 1SFIA 3SGQE 1E36B 3CP7A 1F92A 1TNHA 3A8BA 4O9VA 1P57B 1GDQA 3LH1A 2EI7A 3RXHA 2SGEE 3RLWH 2BX4A 1PJPA 2BDCA 1LTOA 1AZZA 3A83A 2OCVB 4BXWA 1NZQH 3UWIA 2NWNA 5AVDA 2FLRH 5A0AE 1A4WH 1ZHMA 1GG6B 3FP7E 3U1JB 1CE5A 1IQNA 1MCTA 5C1UA 1DICA 1HXFH 1SGDE 1DLKB 2Y82A 2Y5GA 3RXGA 1TGBA 3UNQA 1H1BA 4GAWA 5AFZH 2RA0A 3VGCB 1C1NA 3PM3A 1BB0B 2H9TH 4NZQA 2VVCA 2Z94A 2A32A 4TY6A 5F8ZA 3PLKA 4INHA 1V2NT 4DIIH 1ZGVA 3U8RH 1ZTKA 1O2KA 3A82A 2O8UA 1DFPA 1C2LA 2F83A 3UOUA 1CU1A 1KTSB 1O0DH 1MH0A 4JMYA 2GKVE 3VB4A 5IDKA 2F9PA 1T32A 1YBWA 5LPEA 1YCPM 1O2GH 1SGNE 2BYAX 3OX7U 4YM9A 3QN7A 4IMQA 1OOKB 5DP4A 1IQLA 1NU9A 3OY6U 3M5NA 1LVBA 1PPHE 3QGNB 3VFEA 4HZHA 3VXFH 4I7YH 1T8NA 1PYTD 1AQ7A 4B1TA 1T8MA 4YLUA 3SHCH 1MKWK 2R2MB 1C1PA 1EPTC 1RTKA 3KHVA 2ODPA 1AMHA 1EAUA 4KELA 4CH8B 4DOQA 1F5LA 1OP0A 1AFQC 4UFFH 1Y5BT 2FX4A 1VCPA 1GBCA 3GY6A 1A3BH 2ZPQA 1HAYB 2FX6A 2FS9A 1KXDA 2B8OH 2KAIB 4B2AA 1FY1A 1EAWA 3TH2H 1WQSA 2FOHA 3DFJA 2A45B 1AFEH 3L3TA 1C2JA 1GBHA 1ID5H 4ABIA 1AIXH 3UOPA 3GICB 1G32B 4E7NA 4ZKNU 1KLTA 3RP2A 4X8SH 1BMMH 2BVXH 4CR5A 5FBIA 1GJ9B 4KTUA 1W12U 3FP6E 2ZDLA 4HTCH 2J9NA 4B71A 3EA9A 1H9IE 4BXSA 1QA7A 1C2FA 1C9PA 1L0ZA 5A8ZA 3S0NA 1IQIA 1OWHA 3RU4T 1GHBG 3N7OA 1GBIA 5JBTA 3QLPH 1ESTA 1W8BH 2HPPH 1BTYA 1TRYA 3CS0A 1KXEA 2F9NA 4AN7A 1RTLA 2Y7ZA 1BT7A 1TOMH 4A7IB 1LHEH 1P9SA 1MZDA 2H9HA 1NRNH 1ANCA 2ANMH 1FJSA 2WYJA 5GJ4B 1C1VH 1XVOA 2AYWA 4Q7ZA 1SSXA 1QL9A 1VITH 4MNYA 1GI0A 2TPIZ 1O2OA 2QV1A 2HPQH 1K9OE 2G51A 3BEFB 1Y3WA 1O39A 1ABIH 3S9BA 1ELFA 4CRGA 1K1OA 1D4PB 1ELBA 1O5FH 4MLFB 2H5CA 3FFGA 4O97A 1MKWH 4OGXA 1UK3A 3TGKE 3RXBA 3P8FA 1DANH 1GI6A 4ZXXH 1C1WH 1FZZA 2A1DB 3P8OA 1GHBF 3RU4E 4E7RG 2WPJS 1ZPZA 2HNTE 3LT3A 2P93A 3FVFB 3ZZAA 1Y5AT 1QHRB 2FI5E 2O9QA 5DG6A 2DUCA 4XBBA 4NZLA 1O2TA 3KGPA 1C5PA 4CRBA 1IQFA 2SNVA 1GBLA 1EKBB 3IWMA 5T6DA 1DM4B 1GMHG 4AGJA 1C5RA 1C5ZB 1ELDE 2TRMA 3A8CA 4BANB 1OKXA 1O2LA 2KAIA 2FDAA 4AG2A 2YNAA 3MU4A 4K1EA 4UDWH 2F9BH 3VXEH 4RSPA 1ETRH 1Q31A 1ZSJA 2DE9A 1DITH 5LPFA 3T2NA 1O2VA 4YOGA 5EODA 1ZYOA 1A5IA 1RD3B 2P16A 1O3MA 3P92A 1GJ4H 1VITG 2ANYA 1BHXB 3F9FA 3GCTG 2OBQA 3RXEA 1THSH 1ELTA 3LDXH 4XFQA 4UFEH 2J4IA 1NRPH 1T31A 2P3FH 2VWLA 3I29A 2BY9X 1UK4A 4MPUA 3FANA 3C27B 3MHWU 1C5TA 1DS2E 2PSXA 1UTLM 1L1GA 6CHAB 2ZHWH 3L33A 2A4OA 2AIQA 1NPMA 1XXDA 1GMHF 3JZ2B 1QJ6B 2RDLA 2AH4X 4GSOA 1HAZB 4FUEA 1QB1A 1CGIE 3ZVCA 3PLBA 1C5MD 1UVUH 4NIXA 3RC6A 2HOBA 3SU5A 1JIMA 1SQOA 3M7QA 3LGIA 1V2MT 2G52A 1V2RT 3IG6B 1P2JA 1O3NA 3SJOA 1SGRE 1Z6EA 4Y79A 1OYQA 1O2ZA 1NFYA 2XCFA 1AUTC 4HFPB 3UNRA 2AEIH 1EAIA 3GCHB 6ESTA 3GCTF 3GOVB 2Y5FA 4ZKRU 2OTVA 1DPOA 2BZ6H 1D3PB 5J4SA 1NO9H 2AIPA 1EZQA 1HAHH 4FUDA 3KN2A 2C8YB 3D65E 1G3BA 3SU3A 2BXUH 3QZQA 1G36A 1V2PT 2HGTH 7KMEH 1C5YB 2V3OH 1S85A 4CHAC 4Y6DA 5A09A 3A81A 3UUZA 3ZVDA 2BLOA 1HUTH 2ZGXH 3RXTA 2VH6A 1O2UA 1GBJA 2Q6FA 2PV9B 1YP9A 1P12E 2HRVA 1MAYA 1OWDA 4CREA 3ZZ5A 2FOEA 3DA9B 5K7RA 2OLGA 1ETSH 1C1SA 4UFDH 4NIWA 3K6YA 3S7KB 2ZG0H 5HXFA 4CRDA 1HAGE 1SLWB 3MNBA 1V2QT 5GWZA 2H6MA 1ESAA 1TYNA 4OS2A 1DLEA 2BDAA 5GDSH 2GZ7A 4B76A 1A0HB 1QRWA 2H2ZA 3UPEA 1OX1A 1TNIA 4CRFA 1T4VH 5GIBA 2ZGHA 3M61U 2A7CA 1TX8A 1IAUA 1JIRA 1WBGB 5FPTA 4AORA 4K1SA 4BTUB 1RIWB 4A92A 4NIVA 3A87A 1WUNH 4U2WA 1WSSH 1FY4A 2JKHA 1BJVA 5E0GA 3UWJH 1D9IA 4ZHAA 1UCYE 3GDVA 1GWAA 1RXPA 3RM0H 1ZOMA 3MU5A 1OYTH 1Z8RA 1E37B 1ANBA 1UVSH 1THRH 2XTTB 3SNBA 2F9VA 3DHKH 4ISIH 1BDAA 4ABAA 3ELAH 1ZRBA 1BTPA 5GPIB 1FXYA 5I46H 3AVZA 7ESTE 4ZHMU 3S9CA 2P94A 1Y3YA 2CHAB 1DWDH 1MMJN 4Z0KA 2TGDA 4TPIZ 4A1XA 1OSSA 3PLPA 4KTCA 1ZTLA 2Y80A 2Z9JA 3MH4A 3GCOA 1IOEA 5GCHG 1TA6A 1HYLA 1AB9C 1TGSZ 1EX3A 5A8YA 3SQEE 2JETC 1VGCC 2UUKB 4AYYB 1CA0C 1BBRE 2DE8A 2ZGBH 3ATKA 3E16B 3MNXA 1LPKB 4AFSA 1N6YA 4CRCA 2ZFQH 3SU4A 2PW8H 4ABHA 1PPBH 3A80A 3PROA 3SZNA 3GDUA 1AVWA 2PLXA 2XC0A 1C2EA 5TCAA 1P2OA 2FYRA 4I8HA 1SHHB 3RMMH 3P6ZB 1S6FA 3LGYA 2VVUA 1YPHE 1Y3XA 5JBBS 3EA8A 1SPJA 1IQHA 4WJG2 4DT7B 4ZAEA 2J92A 4ESTE 3RXFA 5GCHF 2FXRA 3G01A 2AMPA 1TPAE 2PSYA 2FO9A 2ZTXA 2PGBB 4FU9A 3SUGA 5ESTE 4D9RA 4JZFH 5A8XA 1CHGA 5E0JA 2W26A 1J8AA 1ELEE 4WVPE 2BOHB 3QO6A 4U32A 3T27A 4GCHG 4XE4A 1F5KU 2WV4A 3A89A 1D3QB 1MQ6A 1QFKH 5F03A 1S81A 3D23A 1GMDG 1H4WA 2Z9KA 4FUHA 4IMZA 4JYUH 2GMTC 2RA3A 4Y76A 1ZSKA 3K9XB 3SJ8A 2Z9IA 5T6GA 3VB3A 1AY6H 1TPOA 2P8OB 2G4TA 1ARCA 1O2QA 3A7WA 3U1IB 2D1JA 3PMBB 1EZSC 3NPSA 1ESBA 2JH6D 1P0SH 1EOJA 4Y8ZA 3SW2B 1JOUB 3GY5A 3LJJA 4NGAH 5L6NH 3AAUA 2BTCE 1C1TA 4MTBA 1GCTC 2XBVA 2ZCLP 1TOCB 4ISNA 1JMOH 3H5CB 4AYVB 1SB1H 2NU1E 1BRUP 3SHAH 4NWKA 3ZV8A 1NESE 5AHGH 1SGYE 1ZMLA 1XUFA 1Z1IA 2ZC9H 5DGJA 3NXPA 1UTJA 1YPJH 2VH0A 3BIVH 1W2KH 2A4GA 3SV2H 2R2WU 4VGCC 1Z8JB 1BIOA 4GCHF 2VGCC 4PROA 1O2IA 3ZVFA 4BAOB 4Y7BA 1GJ6A 4TWYA 1WTHD 1UTOA 1GMDF 2WV5A 4IW4E 1GI8B 2GTBA 2GX4A 2UWLA 1GJDB 1MTNB 3B9FH 2BY6X 3LGUA 5L30H 2GV6A 1O3OA 2W5EA 1YC0A 1L2EA 3KIDU 1SGEE 1FNIA 3CS7A 1QL8A 2TBSA 2GCTC 4UEHH 3ZV9A 5ETXA 3AAVA 2P3UB 3BG4C 1G9IE 1UVOA 2UWPA 5EU8A 1GJ7B 4OS4A 1HXEH 3A85A 3ATLA 1MTVA 1UTPA 1G3EA 2GVFA 4RN6A 1OXGA 1P10A 1ZHPA 4JZ1A 1HV7A 1C1OA 2J34A 3OTJE 4Y0YE 4LK4A 2A4RA 3BTEE 1QBOA 1TRNA 3SJKA 4A5TS 1YKTA 4GPGA 1P2IA 3MO3A 1BHXF 2JH0D 2QXHA 5FX5A 2OC1A 3FZDA 5TCCA 2XYAA 4ZH8A 1DUAA 1EZXC 1T8LA 4FUIA 3O8BA 2A5IA 5GXPA 2BLVA 2HLCA 1TBQH 2AERH 3UR6A 3SORA 4WF8A 3ZZ7A 5EPNA 2THFB 3A7TA 3TITA 4MNVA 2J95A 1K21H 5EXMA 1EP5A 4AFUA 3MYWA 1QCPA 1O3JA 1UTQA 4BTIB 4DGJA 2HNTC 5JB9S 1AZ8A 5I25A 1GI2A 1ZMNA 3GY3A 3M7UA 1HRTH 1F2SE 3QK1A 1TGTA 1FN8A 2BD8A 3NCLA 2FEQH 5C5NA 2BQ6B 2V3HH 1XUGA 3P95A 3F9HA 1AKSB 2ZIQH 3GY4A 3T26A 2BXTH 2BLQA 1QL7A 2CV3A 1EPTB 1INCA 4WMEA 1ACBE 3TVJB 2ZGJA 2CF8H 1BRAA 2Y6TA 1AFQB 4IN1A 1E35B 2ZU1A 1NN6A 1WAYB 1UTMA 1BITA 1C4U2 3A88A 3LC5A 1EQ9A 1YGCH 3MU0A 4AG1A 3BEUA 4K8YA 4NA7A 1TAWA 3U98H 1EJAA 4R0IA 3LONA 3BTME 1P11E 1F7ZA 4BAQB 1VCWA 8ESTE 1CVWH 3ATIA 1J9CH 4YOJA 1HB0B 2XW9A 2LNCA 2YNBA 4J1YA 1UVTH 3T5FH 3URDA 1NRSH 2ANWA 2ZDMA 9ESTA 1L1JA 1UJ1A 3SU1A 2PGQB 4BAKB 3ZVGA 3OYPA 2RCEA 3EAJA 1RGQA 7GCHG 1MD7A 1TALA 3RXPA 1BQYA 1S84A 5IYTA 4TWWA 1AGJA 2C3SA 2ZI2H 2HVXA 1O35A 3O8RA 3I78A 2WPLS 1V2ST 4X6OA 2GP9B 2QAAA 3AW0A 3ZZ3A 4JYVH 3HK6B 5FCRA 2FOMB 1A0LA 1O3AA 5HMAA 3PMHB 2TGTA 1OWJA 4ZROA 5BRRE 3GISB 1L4ZA 1YF4A 3E0PB 3F6UH 1GI4A 1SBWA 1GJAB 4FUBA 1NFWA 2FIRH 1HFDA 1SGPE 1AE8H 1HBTH 1PPZA 1CT0E 1UO6A 1OWIA 5JDUB 1QBNA 3BTKE 3BTTE 2BD5A 1LHFH 1K1IA 2BY5X 2FM2A 2XBWA 2ZQ2A 2GZ8A 1G3CA 1ZMJA 3EQ0H 2WPMS 3BTHE 1V2UT 2J94A 3RLYH 1O2WA 4M7GA 1T7CA 3BTWE 1K1NA 8KME2 3FZZA 3KCGH 3NUMA 1H9LB 1AKSA 1FY3A 1P2QA 1GMCG 1K1LA 2ZZUH 1EPTA 3S9AA 1KXBA 1HIAB 3U9AH 3STIA 2QCYA 3M7TA 1S6HA 1C5NH 1DWEH 1UTNA 3RMLH 1P9UA 4DURA 1TONA 1AVGH 1A0JA 1C5SA 1ARBA 4UONA 3KL6A 4XOJA 1GDUA 4E06H 1RFNA 1Z7KA 1TNKA 1GHAG 3R3GB 1O2PA 2WUCA 2CJIA 4MVNA 5CE1A 3SNCA 3UR9A 2ODYB 2BX3A 1FUJA 2C93B 2SGPE 3ITIA 3UQOA 1O5AB 5HGGA 3MFJA 3TLOA 1CHOG 3SV7A 1SR5C 4ISLA 2GGVB 2FODA 3MNCA 3E0NB 2Q1JA 2FWWA 2AGEX 2BQWB 3EDXB 1CGHA 3SU6A 2F3CE 3SUEA 2ZNKH 1LQEA 2FOAA 4AX9H 2QF3A 4D76A 1IHSH 2B7DH 3A84A 1Z8IB 2CN0H 1CSOE 3RMOH 3SOSA 3UREA 2G5VA 1BUIA 1GMCF 4K3JA 5C1XA 1SI5H 1P8VC 1MBQA 1KTTB 2XWAA 2C4FH 3ATWA 3K6ZA 3SGAE 2OC0A 1HJAC 3RXCA 1V2VT 2XNIA 2UUFB 3F1SB 3VB5A 4B2CA 3HK3B 3M5OA 4TYDA 3SO3A 3RXLA 4WWYA 1WCZA 6CHAC 2ZWLH 1GHAF 4SGAE 1U6QA 3TK6A 3DFLA 3GYMA 1DDJA 2BDHA 1QQUA 4YOIA 1SLXB 1BTXA 3TJOA 2WPKS 5A0CA 3VB7A 1GI1A 5DP7A 3SQHE 4Z6AH 1VITF 5K0HA 5TJXA 5DKMA 3A86A 2F9OA 2SGQE 3BF6H 1SGQE 3DT0H 2QYIA 4MDSA 5H4IB 1GPZA 1MTSA 1KYNA 1DXWA 1ZPBA 4MPVA 1XUHA 3RU4D 2BD4A 1O3CA 2AMQA 1PQ5A 4YT6H 3A7ZA 1YM0A 3RXVA 2ZDVH 3RXRA 3MU1A 3F9EA 3MO6A 2G8TA 1C1UH 4FUGA 4CHAB 4WH6A 1BTHH 3M37A 4XBDA 5HM2A 2Q6GA 3H7TA 3ZZCA 4NFEA 1YPHC 3S69A 3ZYDA 5FAHA 1ETTH 1D6WA 4XSKU 5EOKA 4X8TH 1MU8B 5EGMA 1HIAA 1BRBE 1ZRKA 2R3YA 3BTQE 3GY7A 3VB6A 3S7HB 1LMWB 1F0SA 1S83A 2PKSC 4OS7A 1DE7H 3P17H 1EJNA 4ABJA 1AUJA 3O8CA 4ABFA 3RXQA 1MKXK 4D7FA 5CHAB 3SV9A 3T29A 2FZZA 1TABE 2Z3EA 4K5ZA 3DD2H 2OP9A 1FMGA 1UK2A 1A7SA 2R0LA 3QUMP 1QQ4A 1QJ7B 1YLDA 4FVBA 2BY7X 1RJXB 4NSVA 4X6NA 1GHWH 3PTNA 3LGTA 4JZDH 2ZO3H 1C1RA 2PTNA 1Y59T 4I32A 1SMFE 2ZU3A 4F49A 2EI8A 4INKA 1W0ZU 1N1LA 4ABEA 2LPRA 3KQCA 1ELVA 3A8DA 2TGAA 3SNDA 1M9UA 4X2YA 1GJCB 4Y0ZE 1NY22 1QR3E 3E6PH 2CMYA 2ZKSA 4AB9A 2ZEBA 1IQKA 3OU0A 2FS8A 4Q7YA 1TQ0B 1P03A 1C5LH 1HCGA 1THPB 1YPLH 1O3KA 3SU0A 4Y10E 2XRCA 1BCUH 5ESBA 2BHGA 2FOGA 1PQAA 4F4OC 3H7OA 3LOXA 4CRAA 1BOQA 1W13U 2JH5D 1GBKA 3M5MA 3NKKA 1CGJE 1OP8A 3TJNA 3F68H 1GGDC 1P2NA 1GL1A 4H42U 2D2DA 2OINA 3C1KA 1GI3A 4X8UH 1A5GH 4LZ4B 1PPCE 1AB9B 3ESTA 4I8GA 1ZJDA 1V2LT 1SVPA 1C5VA 2JETB 1VGCB 4MG3A 1CA0B 1D3DB 1EJMA 2BVRH 5DPAA 4X2XA 3V12A 2HNTF 5FPYA 5DP8A 4YESB 1QGFA 1O3LA 2BD9A 3M35A 3TNTA 2ALPA 3HKJB 4E05H 2PKAB 2ZHEH 1LKBA 4TY7A 4DVAU 3Q76A 1C5OH 1O36A 3SBKA 4WXIA 2NU3E 1DOJA 1SLVB 1KXAA 1TBZH 3QZRA 2GZ9A 4HI3A 4I8JA 2AFQB 5JPMH 1MKXH 3GYLB 1H8DH 2OC7A 1C2IA 1JXPA 4D7GA 4MQAA 4XBCA 1AU8A 5C5OA 4RKOB 1TE0A 5EPYA 1GHVH 2D26C 3TK9A 1GBDA 1GBBA 2CGAA 2IOTA 4AFZA 1O5BB 4NCYA 1CBWC 1EXFA 1TNLA 2ZECA 1TBRH 1RTFB 3HPTB 2ZDKA 3JZ1B 3IITA 4CBOA 2R3UA 1ANEA 2I6SA 1SOTA 2AS9A 4KGAA 4GVUA 3A7XA 4ABBA 1TMBH 1LDTT 1C5WB 5A2MH 1K2I1 4X1PU 3SGBE 9LPRA 2W3KA 1P3EA 1N6XA 2H5DA 1UCYH 1HAVB 1KY9A 1S5SA 1NRRH 1XM1A 1O30A 4NWLA 1C5UA 1C9TA 1W10U 1KLJH 2C90B 3LJOA 3M5LA 4JYTA 1O33A 1QRZA 3OSYA 1FLEE 1Q3XA 5FX6A 4ZMAH 2GMTB 2WPHS 3UIRA 1TGCA 1O37A 1F0TA 1EB2A 1GVLA 1V3XA 4AFQA 1NRQH 1OWEA 3PWBA 4IN2A 2F91A 3M36A 4ABDA 4QT8C 1DSUA 1N8OC 1ELCA 1HJ9A 3E1XB 2Z6BD 1FAXA 1W7XH 1K1JA 1MU6B 2ASUB 4I33A 1O5GH 1ZSLA 1LHCH 5AF9H 3RXUA 6LPRA 4WY3A 4WXVA 2WINI 5HM9A 3TIUA 2ZGCA 1O3FA 1GCTB 2Z9GA 1SGFG 1V6DA 2F9UA 5LH8A 1GVKB 4DY7B 3BTDE 2ZPRA 4DW2U 4CH2B 3P8GA 3RXMA 1EASA 2ZQ1A 1Y8TA 1GHXH 1O5CB 1O3IA 4Q80A 1JBUH 1FV9A 1W0YH 2A2QH 3RXAA 2B5TB 1YPEH 4WMFA 4Q2KA 4VGCB 4ZUHA 2VGCB 1ZJKA 2A5KA 3PO1C 2FOFA 2K1QA 3SNAA 3RXDA 1ORFA 4ISHH 4YZUA 1XKAC 4JCNA 2PKAA 2ZU2A 1NTPA 3EE0B 1X7AC 1OS8A 1F5RA 1V2TT 1MAXA 4H6TA 4AZ2B 2G5NA 2WPIS 1C2DA 2M5TA 1GL0E 1HAOH 2VB0A 1AO5A 1TMTH 1PPFE 2GCTB 1BMAA 1WOFA 3D49H 3BG4B 4Y8XA 5EQRA 3TH4H 4LOYH 3MH6A 2V35A 2ZCKP 1Z71A 2ALVA 2VIPA 4A1TA 2OXSA 1C1QA 4FVDA 2C8XB 3TGJE 4U30A 1LKAA 2HWLB 1WYKA 2ESTE 4I8KA 5JB8S 1KSNA 2V0BA 3PMAB 3MNSA 2YOLA 3A8AA 1A46H 2WYGA 2FESH 4JZIA 3VPKA 1O2NA 2AMDA 2VIQA 5FCKA 1H9HE 1HAVA 5E2PA 2ZDAH 1IQJA 1DT2A 1CO7E 2VIVA 1IQEA 1NROH 3HATH 3HKIB 1GJBB 4ISOA 2FMJA 5EW1H 1FDPA 1GG6C 1NU7B 1E38B 1A61H 4X6PA 3MI4A 4FUJA 2PUXB 1SGTA 3BTGE 1SFQB 4B73A 3ZYEA 1IQMA 2FOBA 2ZU4A 2QGRA 3R0FA 3CENA 3VGCC 1TX7A 2ZFPH 1S82A 3BEIB 1O3EA 5HYOA 1HAPH 2BD3A 1HAXB 1J15A 1LVYA 3ZZDA 1P05A 2ILNA 2SFAA 4K69A 1JRTA 2BD7A 1XX9A 1W11U 1UTKA 1O2MA 2ZHDA 2W7SA 4O03A 1TGNA 1Y3VA 2A4QA 1P01A 3LC3A 1TRMA 4THNH 1SHYA 1CQQA 2A7JA 4YO9A 4Y8YA 4KKDA 3SUFA 2Y7XA 1LPGB 3Q77A 1D3TB 1SGIB 4X1NU 5EQQA 1W3CA 3ODDA 1C4Y2 1MTWA 5C3NA 1KIGH 3LU9B 1EAXA 2BDYA 1TMUH 5LPRA 4BAMB 3I77A 1HJ8A 1QNJA 2FTMA 1WTGH 2EA3A 1LVOA 2Z3CA 5C67A 5DP6A 5DO4H 1VCQA 1EZUC 2Z9LA 1IHTH 2FYQA 4U01A 1AE5A 1O31A 1G37A 1UMAH 1AD8H 1TPPA 2ZFTA 4X8VH 1YPKH 4HGCA 1BTWA 2TIOA 3U69H 3ZZ8A 1ELGA 3B23B 3MOCA 5JBCS 3BTFE 4X1RU 1BZXE 3DUXH 4IC5A 3ZZ4A 5CMXH 2VWOA 1O3HA 1DY8A 4X6MA 3UQVA 3EYDA 1MZAA 3Q00A 2P3TB 4WMDA 3QGJA 1CT2E 1TLDA 1O2YA 1GBEA 1NM6A 1S0RA 4OGYA 5F6MA 3PV4A 4DCDA 1YCPK 1S0QA 3GDSA 2IPHA 1SG8B 1AN1E 2OD3B 1QTFA 1WQVH 2VIDA 4IC6A 2QXIA 1BMNH 5C2ZA 1UHBB 3ZVAA 1DXPA 4LZ1H 5PTPA 4NG9H 2PTCE 3K65B 4GUXA 3SV8A 6GCHG 3SNEA 1AWHB 1W14U 1O32A 1C5QA 1GI5A 2QN5T 2ZHQH 3KEEA 1SQAA 2XBXA 2GV7A 1LVMA 2GDDA 1QB9A 3UTUH 5G4BA 1GBMA 2QC2A 3U8OH 1F0UA 4OS5A 1P04A 1XXFA 2PHBA 4YTAA 2STBE 2A0QB 4AGKA 4B75A 4O3UA 1HNEE 1LPZB 1RRKA 1O2JA 3LIWA 4CBNA 1ZR0A 1P06A 1XUJA 2OBOA 2Z3DA 3OY5U 3TH3H 3T62A 2ZF0H 3TNSA 4MNXA 4Y7AA 1MBMA 2BZAA 7GCHF 2STAE 3TK5A 1FY8E 1PFXC 5F8XA 5FHTA 1LQDB 4NA9H 2IJOB 5DP5A 1WV7H 1UVPA 1KXFA 4A6LA 4H6SB 5B6OA 4IS5A 1O3GA 2PWXA 3PYHA 1G30B 1LHDH 1BTZA 1C2MA 1ZHRA 4KP0A 4MNWA 4NIYA 3STJA 1Z8GA 4K8BA 1MTUA 1P2KA 2GCHG 5C20A 6GCHF 3SI3H 3TU7H 1QIXB 2CXVA 3M3SA 4ASHA 1ZZZA 2BVSH 1PPGE 2HALA 2I6QA 2FOCA 2ZFFH 3NK8A 4R8TB 4NA8A 1V2WT 1OPHB 1GI7B 1C2KA 3MMGA 4K1TA 1GHZA 3RXOA 1TQ7B 2FP7B 3MTYA 2QF0A 1BA8B 1OP2A 1QURH 2XC5A 1GCDA 1QJ1B 1Q2WA 1K1PA 4UFGH 1TA2A 2ZFRH 3MU8A 4AOQA 4ZHLU 4UE7H 2BMGB 3RUOA 3GCNA 1YCPH 5L2YH 4AB8A 2ODQA 1FI8A 4ZXYH 3RXKA 5BPEA 3LGVA 1VR1H 1L4DA 2Y5HA 1QY6A 1SOZA 4OS6A 1TFXA 2QA9E 3BV9B 3MWIU 1QRXA 4MPWA 1G2LA 1D6RA 4X2VA 1K28D 1O2RA 2ZP0H 1O2SA 5E0HA 2XC4A 1NT1A 2WUBA 1TX6A 2GCHF 3D62A 1P3CA 2FPZA 3RC5A 1UHBA 1O34A 1HJAB 1SGCA 2AGGX 8GCHG 4IBLH 3SN8A 2FI3E 1QBVH 5E2OA 1QA0A 4FXGH 1CA8B 2H1UA 2VNTA 2VIWA 1FN6A 2H9EH 1DWBH 3ODFA 1LHGH 1SQTA 1FQ3A 4FU8A 2P95A 4YT7H 4IGDA 4KTSA 4ZKSU 1V2OT 1AHTH 1GBTA 3LKWA 2B9LA 1GVZA 1GHYH 1B0FA 3O8DA 4B2BA 5A0BA 4H4FA 1CHOF 1GJ5H 1E0FD 3GY8A 3QX5H 1J17T 3QTVH 5FBEA 1EUFA 1TIOA 2EC9H 3ZVEA 1QB6A 4BAHB 5EXNA 2ZA5A 2AGIX 3EGKH 2ZFSA 1HGTH 3URCA 1VJAU 2C8ZB 1GBFA 1AWFH 4NSYA 4CR9A 3RMNH 3GCHC 2CF9H 2A31A 1TNGA 4Q7XA 3M3TA 2SNWA 3UFAA 4JZEH 1K22H 1A2CH 4LXBH 8GCHF 2G4UA 4X0WU 3V13A 1EOLA 2R9PA 3E91A 2OQ5A 2VINA 4J2YB 2UUYA 1YLCA 2O8WA 3A7VA 2PKSB 1SGFA 2GDEH 3T25A 2SGFE 4I8LA 3PWCA 3MH5A 2R0KA 2EI6A 1C2HA 1IQGA 2QY0B 1O5DH 2J38A 1TWXB 5EXLA 3KF2A 1GDNA 5JYIA 2P59A 2ZTYA 3QTOH 1O2XA 4OS1A 4MPXA 4K2YA 1KDQB 2Q6DA 2UWOA 3A7YA 2RG3A 1SL3A 4GHQA 1GJ8B 2BM2A 3E90B 5CHAC 2BDIA 3U8TH 2SGAA 4YLQH 2O8MA 3SI4H 3E8LA 3TJVA 3RXSA 3TGIE 1EATA 2A2XH 3BIUH 1KXCA 3ENSB 1J14A 3B8JA 5E8EH 2BDGA 1V2JT 5C1YA 3LGWA 1B0EA 2ZTZA 1L1NA 4DJZB 1HPGA 2Y81A 4FU7A 3KQBA 3SJIA 3V7TA 1VJ9U 3W95A 1RIWC 8LPRA 1P02A 1XUIA 1BTUA 1UCYK 2TGPZ 1B5GH 1FY5A 1ZPCA 4NFFA 2NU4E 3LH3A 5EW2H 1YPMH 1NFUA 3UNSA 2J2UA 1ELAA 3AW1A 2Z7FE 1ABJH 3Q3XA 3MH7A 5FPSA 1W7GH 4DG4A 1WU1A 4GHTA 7LPRA 3SV6A 2GT8A 1XMNB 2NU0E 3NWUA 1B7XB 2XCNA 3ZZ9A 3KQDA 1T4UH 1ZGIA 5FXLA 1GGDB 2FI4E 1TNJA 2O8TA 3KNXA 2ZHFH 2CHAC 4X2WA 2PR3A 2PUQH 3T28A 3RDZA 1FONA 1ZTJA 3ZZBA 1LO6A 1DX5M 3RC4A 1PYTC 2A5AA 1AI8H 2OQUA 1HAIH 3QWCH 3TJUA 2FLBH 1BBRK 3GY2A 1O3BA 1MQ5A 2VVVA 3AASA 1K1MA 2SGDE 1O3DA 4Y71A 1XKBC 2FTLE 1O3PB 1O5EH 2VIOA 3TPIZ 4BTTB 3ZZ6A 3ATMA 1A5HA 1ANDA 4TPYA 1Y3UA 4O3TA 2GD4B 1C5XB 5F8TA 3MO9A 5JBAS 1YYY1 3V0XA 1E34B 2BY8X 1Z6JH 3SU2A 2UUJB 2W7UA 2EEKA 1CBWB 5ABWA 5DP9A
chains in the Genus database with same CATH superfamily
1DVAH 1W0KD 1ZLRA 1VZQH 1P09A 2ZDNA 3FAOA 5DK1A 1DUEA 1SLUB 4I31A 3VEQB 3F9GA 1AVXA 1FAKH 1NC6A 1KDQA 4Q63A 2XWBI 2G00A 1Z1JA 1FPHH 1KLIH 1G3DA 5EQSA 4UD9H 3BG8A 1NS3A 2XBYA 2XNDD 1NFXA 1LCYA 3EA7A 1BJUA 3VG8A 3RXIA 2KFWA 2W3IA 4K60A 1MCVA 3BSQA 3PB1E 1XUKA 3E3TA 2ZPSA 3SJ9A 2BQ7B 4JK5A 1MD8A 4JK6A 4XDEA 3OE7D 4RKJB 1PQ8A 1TB6H 2BDBA 2ANKH 3CNRA 3WY8A 1Y5UT 2C8WB 3LPRA 3Q3YA 1BMFD 4ABGA 3K2UA 1A3EH 2O8LA 1EB1H 5J4QA 3QDZB 5IK2D 1F0RA 3UY9A 4X1QU 2VWMA 1V2KT 5C17A 5AFYH 3RXJA 3L6PA 4BOHA 3NZIA 1N8OB 1PQ7A 3W94A 5SGAE 3FP8E 4GLYA 2QXJA 1HDTH 1GBAA 3PMJA 1JRSA 2P8OC 4FUCA 2B0FA 2BB4A 4D8NA 1BMLA 4INLA 1H8IH 2G55A 1O2HA 4WH8A 3F2FA 1HLTH 1FIZA 2ULLA 1JWTA 2V6NA 3V3MA 1BBRH 2IN2A 5LGOA 2OC8A 2VWNA 1OWKA 4B74A 1C1MA 1GI9B 3HGNA 1MUEB 1O38A 3RM2H 3HGPA 2QXGA 1G2MA 2GT7A 2ZU5A 5DJ7A 1TPSA 2BOKA 2BLWA 1BRCE 2D8WA 2G81E 3PO1B 2A7HA 1DY9A 1SC8U 4D9QA 1CT4E 1EP6A 1A1RA 1DSTA 1J16A 4FUFA 2NU2E 4A1VA 1RS0A 2QIQA 5T3HA 4DIHH 1PPEE 4BNRA 5L2ZH 1YPGH 2VJ1A 2XXLA 4Y11E 1XVMA 1DWCH 3PTBA 3SUDA 1FPCH 1MTNC 4Z1MD 1T8OA 2BD2A 3Q3KA 4X1SU 3ZVBA 3KQEA 3M3VA 4SGBE 2OUAA 2VU8E 3P70B 1FIWA 2PFEA 5T6FA 5EG4A 3BN9A 1P2MA 3P8NA 1C4V2 5DP3A 2ZCHP 4ZKOU 3N99A 1C2GA 1SFIA 3SGQE 1E36B 3CP7A 1F92A 1TNHA 3A8BA 3UB0A 4O9VA 1P57B 1GDQA 3LH1A 2EI7A 3RXHA 2SGEE 3RLWH 2BX4A 1PJPA 2BDCA 1LTOA 1AZZA 3A83A 2OCVB 2KCYA 4BXWA 1NZQH 3UWIA 2NWNA 5AVDA 5CHBA 2FLRH 5A0AE 3OFND 1A4WH 1ZHMA 1GG6B 3FP7E 3U1JB 1CE5A 1IQNA 1MCTA 5C1UA 1DICA 1HXFH 1SGDE 1DLKB 2Y82A 2Y5GA 3RXGA 1TGBA 3KQ5A 3UNQA 1H1BA 4GAWA 5AFZH 2RA0A 3VGCB 1C1NA 3PM3A 1BB0B 2H9TH 4NZQA 2VVCA 2Z94A 2A32A 4TY6A 5F8ZA 3PLKA 4INHA 1V2NT 4DIIH 4ASUD 1ZGVA 3U8RH 1ZTKA 1O2KA 3A82A 2O8UA 1DFPA 1C2LA 2F83A 3UOUA 1CU1A 1KTSB 1O0DH 1MH0A 4JMYA 2GKVE 3VB4A 5IDKA 2F9PA 3KYGA 1T32A 1YBWA 5LPEA 1YCPM 1O2GH 1SGNE 2BYAX 3OX7U 4YM9A 3QN7A 2IJD1 4IMQA 1OOKB 5DP4A 1IQLA 1NU9A 3OY6U 3M5NA 1LVBA 1PPHE 3QGNB 3VFEA 4HZHA 3VXFH 4I7YH 1T8NA 1PYTD 1AQ7A 4B1TA 1T8MA 4YLUA 3SHCH 1MKWK 2R2MB 1C1PA 1EPTC 1RTKA 3KHVA 2ODPA 1AMHA 1EAUA 4KELA 4CH8B 4DOQA 1F5LA 1OP0A 1AFQC 4UFFH 1Y5BT 2FX4A 1VCPA 1GBCA 3GY6A 1A3BH 2ZPQA 1HAYB 2FX6A 2FS9A 1KXDA 2B8OH 2KAIB 4B2AA 1FY1A 1EAWA 3TH2H 1WQSA 2FOHA 3DFJA 2A45B 1AFEH 3L3TA 1C2JA 1GBHA 1ID5H 4TSFD 4ABIA 1AIXH 3UOPA 3GICB 1G32B 4E7NA 4ZKNU 1KLTA 3RP2A 4X8SH 1BMMH 2BVXH 4CR5A 5FBIA 1GJ9B 4KTUA 1W12U 3FP6E 2ZDLA 4HTCH 2J9NA 4B71A 3EA9A 1H9IE 4BXSA 1QA7A 1C2FA 1C9PA 1L0ZA 5A8ZA 3S0NA 1IQIA 1OWHA 3RU4T 1GHBG 3N7OA 1GBIA 1OHHD 5JBTA 3QLPH 2L74A 1ESTA 1W8BH 2HPPH 1BTYA 1TRYA 3CS0A 1KXEA 2F9NA 4AN7A 1RTLA 2Y7ZA 1BT7A 1TOMH 4A7IB 1LHEH 1P9SA 1MZDA 2H9HA 1NRNH 1ANCA 2ANMH 1FJSA 2WYJA 5GJ4B 1C1VH 1XVOA 4OM9A 2AYWA 4Q7ZA 1SSXA 1QL9A 1VITH 4MNYA 1GI0A 2K0QA 2TPIZ 1O2OA 2QV1A 2HPQH 1K9OE 2G51A 3BEFB 3FOAA 1Y3WA 1O39A 1ABIH 3S9BA 1ELFA 4CRGA 1K1OA 1D4PB 1ELBA 1O5FH 4MLFB 2H5CA 3FFGA 4O97A 1MKWH 4OGXA 1UK3A 3TGKE 3RXBA 3P8FA 1DANH 1GI6A 4ZXXH 1C1WH 1FZZA 2A1DB 3P8OA 1GHBF 3RU4E 4E7RG 2WPJS 1ZPZA 2HNTE 3F2GA 3LT3A 4RT0A 2P93A 3FVFB 3ZZAA 1Y5AT 1QHRB 2FI5E 2O9QA 5DG6A 2DUCA 4XBBA 4NZLA 1O2TA 3KGPA 1C5PA 4CRBA 1IQFA 2SNVA 1GBLA 1EKBB 2YMSC 3IWMA 5T6DA 1DM4B 1GMHG 3FKSD 4AGJA 1C5RA 1C5ZB 1ELDE 2TRMA 5HIZA 3A8CA 4BANB 1OKXA 1O2LA 2KAIA 2FDAA 4AG2A 2YNAA 3MU4A 4K1EA 4UDWH 2F9BH 3VXEH 4RSPA 1ETRH 5KGOA 3KYFA 1Q31A 1ZSJA 2DE9A 1DITH 5LPFA 3T2NA 1O2VA 4YOGA 5EODA 1ZYOA 1A5IA 1RD3B 2P16A 1O3MA 3P92A 1GJ4H 1VITG 2ANYA 1BHXB 3F9FA 3GCTG 2OBQA 3RXEA 1THSH 3F2HA 2WHXA 1ELTA 3LDXH 4XFQA 4UFEH 2J4IA 1NRPH 1T31A 2P3FH 2VWLA 3I29A 2BY9X 2KCOA 1UK4A 4MPUA 3FANA 3C27B 3MHWU 1C5TA 1DS2E 2PSXA 1UTLM 1L1GA 6CHAB 2ZHWH 3L33A 2A4OA 2AIQA 1NPMA 1XXDA 1GMHF 2W6ID 1QJ6B 3JZ2B 2RDLA 2KZ4A 2AH4X 4GSOA 1HAZB 4FUEA 1QB1A 4P00A 1CGIE 3ZVCA 3PLBA 1C5MD 1UVUH 4NIXA 3RC6A 2HOBA 3SU5A 1JIMA 1SQOA 3M7QA 3LGIA 1V2MT 2G52A 1V2RT 3IG6B 1P2JA 1O3NA 3SJOA 1SGRE 1Z6EA 4Y79A 1OYQA 1O2ZA 1NFYA 2XCFA 1AUTC 4HFPB 3UNRA 2AEIH 1EAIA 3GCHB 6ESTA 3GCTF 3GOVB 2Y5FA 4ZKRU 2OTVA 1DPOA 2BZ6H 1D3PB 1UW7A 5J4SA 1NO9H 2AIPA 1EZQA 1HAHH 4FUDA 3KN2A 2C8YB 3D65E 1G3BA 2QF4A 2V3MA 3SU3A 2BXUH 3QZQA 1G36A 1V2PT 2HGTH 7KMEH 1C5YB 2V3OH 1S85A 4CHAC 4Y6DA 5A09A 3A81A 3UUZA 3ZVDA 2BLOA 1HUTH 2ZGXH 3RXTA 2VH6A 1O2UA 1GBJA 2Q6FA 2PV9B 1YP9A 1P12E 2HRVA 1MAYA 1OWDA 4CREA 3ZZ5A 2FOEA 3DA9B 5K7RA 2OLGA 1ETSH 1C1SA 4UFDH 4NIWA 3K6YA 3S7KB 2ZG0H 5HXFA 4CRDA 1HAGE 1SLWB 3MNBA 1V2QT 5GWZA 2H6MA 1ESAA 1TYNA 4OS2A 1DLEA 2BDAA 5GDSH 2GZ7A 4B76A 2AHME 1A0HB 1QRWA 2H2ZA 3UPEA 1OX1A 1TNIA 4CRFA 1T4VH 5GIBA 2ZGHA 3M61U 2A7CA 1TX8A 1IAUA 1JIRA 1WBGB 5FPTA 4AORA 4K1SA 4BTUB 1RIWB 4A92A 4NIVA 3A87A 5KEDA 1WUNH 4U2WA 1WSSH 1FY4A 2JKHA 1BJVA 5E0GA 3UWJH 1D9IA 4ZHAA 1UCYE 3GDVA 1GWAA 1RXPA 3RM0H 1ZOMA 3MU5A 1OYTH 1Z8RA 1E37B 1ANBA 1UVSH 1THRH 2XTTB 3SNBA 2F9VA 3DHKH 4ISIH 1BDAA 4ABAA 3ELAH 1ZRBA 1BTPA 5GPIB 1FXYA 5I46H 4XRNA 3AVZA 7ESTE 4ZHMU 3S9CA 2P94A 1K0HA 4FOUC 1Y3YA 2CHAB 1DWDH 1MMJN 4Z0KA 2TGDA 2J97A 4TPIZ 4A1XA 1OSSA 3PLPA 4KTCA 1ZTLA 2Y80A 2Z9JA 2VBCA 3MH4A 3GCOA 1YY3A 1IOEA 5GCHG 1TA6A 1HYLA 1AB9C 1TGSZ 1EX3A 5A8YA 3SQEE 2JETC 1VGCC 2UUKB 4AYYB 1CA0C 1BBRE 2DE8A 2ZGBH 3ATKA 3E16B 3MNXA 1LPKB 4AFSA 1N6YA 4CRCA 2ZFQH 3SU4A 2PW8H 4ABHA 1PPBH 1SQRA 3A80A 3PROA 3SZNA 3GDUA 1AVWA 2PLXA 2XC0A 1C2EA 1NBME 3OEHD 5TCAA 4P02A 1P2OA 2FYRA 4I8HA 1SHHB 3RMMH 3P6ZB 1S6FA 3LGYA 2VVUA 1YPHE 2YMSD 1Y3XA 5JBBS 3EA8A 1SPJA 1IQHA 4WJG2 5EJ1A 4DT7B 4ZAEA 2J92A 4ESTE 3RXFA 5GCHF 3WW7A 5B6LA 2FXRA 3G01A 2AMPA 1TPAE 2PSYA 2FO9A 2ZTXA 2PGBB 4FU9A 3SUGA 5ESTE 4D9RA 4JZFH 5A8XA 1CHGA 5E0JA 2W26A 1J8AA 2RFKC 1WXRA 1ELEE 4WVPE 2BOHB 3QO6A 4U32A 3T27A 4GCHG 4XE4A 1F5KU 2WV4A 3A89A 1D3QB 1MQ6A 1QFKH 5F03A 1S81A 3D23A 1GMDG 1H4WA 2Z9KA 4FUHA 4IMZA 4JYUH 2V7QD 2GMTC 2RA3A 4Y76A 1ZSKA 3K9XB 3SJ8A 2Z9IA 5T6GA 3VB3A 1AY6H 1TPOA 2P8OB 2G4TA 1ARCA 1O2QA 3A7WA 3U1IB 2D1JA 3PMBB 1EZSC 3NPSA 1ESBA 2JH6D 2XOKD 4FETA 1P0SH 1EOJA 4Y8ZA 4DT4A 5GNDA 3SW2B 1JOUB 3GY5A 3F0PA 3LJJA 4NGAH 5L6NH 3AAUA 2BTCE 1C1TA 4HG6A 4MTBA 1GCTC 2XBVA 2ZCLP 1TOCB 4ISNA 1JMOH 3H5CB 4AYVB 1SB1H 2NU1E 1BRUP 3SHAH 4NWKA 3ZV8A 1NESE 5AHGH 1SGYE 1ZMLA 1XUFA 1Z1IA 4ACBA 2ZC9H 5DGJA 3NXPA 1UTJA 1YPJH 2VH0A 3BIVH 1W2KH 2A4GA 3SV2H 2R2WU 4VGCC 1Z8JB 1BIOA 4GCHF 2VGCC 4PROA 1O2IA 3ZVFA 4BAOB 4Y7BA 1EFRD 1GJ6A 1H8ED 4TWYA 1WTHD 1UTOA 1GMDF 2WV5A 4IW4E 1GI8B 2GTBA 2GX4A 2UWLA 1GJDB 1MTNB 3B9FH 1NBMD 2BY6X 3LGUA 5L30H 2GV6A 1O3OA 2W5EA 1YC0A 4ZCNA 1L2EA 3KIDU 1SGEE 1FNIA 3CS7A 1QL8A 2TBSA 2GCTC 4UEHH 3ZV9A 5ETXA 3AAVA 2P3UB 3BG4C 1G9IE 1UVOA 2UWPA 2WZQA 5EU8A 1GJ7B 4OS4A 1HXEH 3A85A 3ATLA 1MTVA 1UTPA 1G3EA 2GVFA 4RN6A 1OXGA 1P10A 1ZHPA 4JZ1A 1HV7A 3WWFA 1C1OA 2J34A 3OTJE 4Y0YE 4LK4A 2A4RA 3BTEE 1QBOA 1TRNA 3SJKA 4A5TS 1YKTA 4GPGA 2F43B 1P2IA 3MO3A 1BHXF 5C94A 2JH0D 2QXHA 5FX5A 2OC1A 3FZDA 5TCCA 2XYAA 4ZH8A 1DUAA 1EZXC 2HLDD 1FX0B 1T8LA 4FUIA 2QE7D 3O8BA 2A5IA 5GXPA 2BLVA 2HLCA 1TBQH 2AERH 3UR6A 3SORA 4WF8A 3ZZ7A 5EPNA 2THFB 3A7TA 3TITA 4MNVA 2J95A 1K21H 5EXMA 1EP5A 4AFUA 3MYWA 1QCPA 1O3JA 1UTQA 4BTIB 4DGJA 2HNTC 5JB9S 1AZ8A 5I25A 1GI2A 1ZMNA 3GY3A 3PV5A 2L6OA 3M7UA 1HRTH 1F2SE 3QK1A 1TGTA 1FN8A 2BD8A 3NCLA 2FEQH 5C5NA 2BQ6B 2V3HH 1XUGA 3P95A 3F9HA 1AKSB 2EQNA 2ZIQH 3GY4A 3T26A 2BXTH 2BLQA 1QL7A 2CV3A 1EPTB 1INCA 4WMEA 1ACBE 3TVJB 2ZGJA 2CF8H 1BRAA 2Y6TA 1AFQB 4IN1A 1E35B 2ZU1A 1NN6A 1WAYB 1UTMA 1BITA 1C4U2 3A88A 3LC5A 1EQ9A 1YGCH 3MU0A 2KCPA 4AG1A 3BEUA 4K8YA 2F4LA 4NA7A 1TAWA 3U98H 1EJAA 4R0IA 5FL7D 3LONA 1H8HD 3BTME 1P11E 1F7ZA 4BAQB 1VCWA 8ESTE 1CVWH 3ATIA 1J9CH 4YOJA 1HB0B 2XW9A 2LNCA 2YNBA 4J1YA 1UVTH 3T5FH 3URDA 1NRSH 2ANWA 2JJ1D 2ZDMA 9ESTA 1L1JA 1UJ1A 3SU1A 2PGQB 4BAKB 3ZVGA 3OYPA 2RCEA 3EAJA 1RGQA 7GCHG 1MD7A 1TALA 3RXPA 1BQYA 1S84A 5IYTA 2JJ2D 4TWWA 1AGJA 2C3SA 2ZI2H 2HVXA 1O35A 3O8RA 3I78A 2WPLS 1V2ST 4X6OA 2GP9B 2QAAA 3AW0A 3ZZ3A 4JYVH 3HK6B 5FCRA 2FOMB 1A0LA 1O3AA 4AC9A 5HMAA 3PMHB 2TGTA 1OWJA 4ZROA 5BRRE 3GISB 1L4ZA 1YF4A 3E0PB 3F6UH 1GI4A 1SBWA 1GJAB 4FUBA 1NFWA 2FIRH 1HFDA 1SGPE 1AE8H 1HBTH 1PPZA 1CT0E 1UO6A 1OWIA 5JDUB 1QBNA 3BTKE 3BTTE 2BD5A 1LHFH 1K1IA 2BY5X 2FM2A 2XBWA 2ZQ2A 2GZ8A 1G3CA 1ZMJA 3EQ0H 2WPMS 3BTHE 1V2UT 5EJLA 2J94A 3RLYH 1O2WA 4M7GA 1T7CA 3BTWE 3DSPA 1K1NA 8KME2 3FZZA 3KCGH 3NUMA 1H9LB 1AKSA 1FY3A 1P2QA 1GMCG 1K1LA 2ZZUH 5HKKD 5CDFE 4B6FA 1EPTA 3S9AA 1KXBA 1HIAB 2YMSB 3U9AH 3DSGA 3STIA 2QCYA 3M7TA 1S6HA 1C5NH 1DWEH 1UTNA 3RMLH 1P9UA 4DURA 1TONA 1AVGH 1E1RD 1A0JA 1C5SA 1ARBA 4UONA 3KL6A 4XOJA 1GDUA 4E06H 1RFNA 1W0JD 1Z7KA 1TNKA 1GHAG 3R3GB 1O2PA 2JDID 2CJIA 2WUCA 4MVNA 5CE1A 5KECA 3SNCA 3UR9A 2ODYB 3DSOA 2BX3A 1FUJA 2C93B 2SGPE 3ITIA 3UQOA 1O5AB 5HGGA 3MFJA 3TLOA 1CHOG 3SV7A 1SR5C 4ISLA 2GGVB 4XD7D 2FODA 3MNCA 3E0NB 2Q1JA 2FWWA 2AGEX 2BQWB 3EDXB 1CGHA 3SU6A 2F3CE 3PRBA 3SUEA 2ZNKH 1LQEA 2FOAA 4AX9H 2QF3A 4D76A 1IHSH 2B7DH 3A84A 1Z8IB 2CN0H 1CSOE 3RMOH 3SOSA 3UREA 2G5VA 1BUIA 1GMCF 4K3JA 5C1XA 1SI5H 1P8VC 1MBQA 1KTTB 2XWAA 2C4FH 3ATWA 3K6ZA 3SGAE 2OC0A 1HJAC 3RXCA 1V2VT 2XNIA 2UUFB 3F1SB 3VB5A 4B2CA 3HK3B 3M5OA 4TYDA 5T1VA 3RXLA 3SO3A 4WWYA 1WCZA 6CHAC 2ZWLH 1GHAF 4SGAE 1U6QA 3TK6A 3DFLA 3GYMA 1DDJA 2BDHA 1QQUA 4YOIA 5HIYA 1SLXB 1BTXA 3TJOA 2WPKS 5A0CA 3VB7A 1GI1A 3FN8A 2HVYB 5DP7A 3SQHE 4Z6AH 1VITF 5K0HA 5TJXA 5DKMA 3A86A 2F9OA 2SGQE 4RT1A 3BF6H 1SGQE 3DT0H 2QYIA 4MDSA 5H4IB 1GPZA 1MTSA 1KYNA 1DXWA 1ZPBA 4MPVA 1XUHA 3RU4D 2BD4A 1O3CA 2AMQA 1PQ5A 4YT6H 3A7ZA 1YM0A 3RXVA 2ZDVH 3RXRA 3MU1A 3F9EA 3MO6A 2G8TA 4F48B 1C1UH 4FUGA 4CHAB 4WH6A 1BTHH 3M37A 4XBDA 5HM2A 2Q6GA 3H7TA 3ZZCA 4NFEA 1YPHC 3S69A 3ZYDA 5FAHA 1ETTH 1D6WA 4XSKU 5EOKA 3SZEA 4X8TH 1MU8B 5EGMA 1HIAA 1BRBE 1ZRKA 2R3YA 3BTQE 3GY7A 3VB6A 4B6EA 3S7HB 1LMWB 1F0SA 1S83A 2PKSC 4OS7A 1DE7H 3P17H 1EJNA 4ABJA 1AUJA 3O8CA 4ABFA 3RXQA 1MKXK 4D7FA 5CHAB 5DN6D 3T29A 2FZZA 1TABE 2Z3EA 3SV9A 4K5ZA 3DD2H 2OP9A 1FMGA 1UK2A 1A7SA 2R0LA 3QUMP 1QQ4A 3F3BA 1QJ7B 1YLDA 4FVBA 2BY7X 1RJXB 4TT3D 4NSVA 4X6NA 1GHWH 3PTNA 3LGTA 4JZDH 2ZO3H 1C1RA 2PTNA 1Y59T 2OK5A 4I32A 1SMFE 2ZU3A 4F49A 2EI8A 4INKA 1W0ZU 1N1LA 4ABEA 2LPRA 3KQCA 1ELVA 3A8DA 2TGAA 3SNDA 1M9UA 4X2YA 1GJCB 4Y0ZE 1NY22 1QR3E 3E6PH 2CMYA 2ZKSA 4AB9A 2ZEBA 1IQKA 3OU0A 2FS8A 4Q7YA 1TQ0B 1P03A 1C5LH 1S6LA 1HCGA 1THPB 1YPLH 1O3KA 3SU0A 4Y10E 2XRCA 1BCUH 5ESBA 2BHGA 2FOGA 1PQAA 4F4OC 3H7OA 3LOXA 4CRAA 1BOQA 1W13U 4YXWD 2JH5D 1GBKA 1SKYE 3M5MA 3NKKA 1CGJE 1OP8A 3TJNA 3F68H 1GGDC 1P2NA 1GL1A 4H42U 3W1EA 2D2DA 2OINA 3C1KA 1GI3A 4X8UH 1A5GH 4LZ4B 1PPCE 1AB9B 3ESTA 4I8GA 1ZJDA 1V2LT 1SVPA 1C5VA 2JETB 1VGCB 4MG3A 1CA0B 1D3DB 1EJMA 2BVRH 5DPAA 4X2XA 3V12A 2HNTF 5FPYA 5DP8A 4YESB 1QGFA 1O3LA 2BD9A 3M35A 3TNTA 2ALPA 5F53A 3HKJB 4E05H 2PKAB 2ZHEH 1LKBA 4TY7A 2GJGA 4DVAU 3Q76A 1C5OH 1O36A 3SBKA 4WXIA 2NU3E 1DOJA 1SLVB 1KXAA 1TBZH 3QZRA 2GZ9A 4HI3A 4I8JA 2AFQB 5JPMH 1MKXH 3GYLB 1H8DH 2OC7A 1C2IA 1JXPA 4D7GA 4MQAA 4XBCA 1AU8A 3OTPA 5C5OA 4RKOB 1TE0A 2KCAA 5EPYA 1GHVH 2D26C 3TK9A 1GBDA 1GBBA 2CGAA 2IOTA 4AFZA 1O5BB 4NCYA 1CBWC 1EXFA 1TNLA 2ZECA 1TBRH 1RTFB 2J98B 3HPTB 2ZDKA 3JZ1B 3IITA 1WDIA 4CBOA 2R3UA 1ANEA 2I6SA 1SOTA 2AS9A 4KGAA 4GVUA 3A7XA 4ABBA 1TMBH 1LDTT 1C5WB 5A2MH 1K2I1 4X1PU 3SGBE 9LPRA 2W3KA 1P3EA 1N6XA 2H5DA 1UCYH 1HAVB 1KY9A 1S5SA 1NRRH 1XM1A 1O30A 4NWLA 1C5UA 1C9TA 5C0TA 1W10U 1KLJH 2C90B 3LJOA 3M5LA 4JYTA 3F0OA 1O33A 1QRZA 3OSYA 1FLEE 1Q3XA 5FX6A 4ZMAH 2GMTB 2WPHS 3UIRA 3H09A 3ZIAD 1TGCA 1O37A 1F0TA 1EB2A 1GVLA 1V3XA 4AFQA 1NRQH 1OWEA 3PWBA 4IN2A 2F91A 3M36A 4ABDA 4QT8C 1DSUA 1N8OC 1ELCA 1HJ9A 3E1XB 5EIYA 2Z6BD 1FAXA 1W7XH 1K1JA 1MU6B 2ASUB 4I33A 1O5GH 1ZSLA 1LHCH 5AF9H 3RXUA 6LPRA 4WY3A 4WXVA 2WINI 5HM9A 3TIUA 2ZGCA 1O3FA 1GCTB 2Z9GA 1SGFG 1V6DA 2F9UA 5LH8A 5C0UA 1GVKB 4DY7B 3BTDE 2ZPRA 4DW2U 4CH2B 2WPDD 3P8GA 3RXMA 1EASA 2ZQ1A 1Y8TA 1GHXH 1O5CB 1O3IA 4Q80A 1JBUH 1FV9A 1W0YH 2A2QH 3RXAA 2B5TB 1YPEH 4WMFA 4Q2KA 2W6JD 4VGCB 4ZUHA 2VGCB 1ZJKA 2A5KA 3PO1C 2FOFA 2K1QA 3SNAA 3RXDA 1ORFA 4ISHH 4YZUA 1XKAC 4JCNA 2PP6A 2PKAA 2ZU2A 1NTPA 2CK3D 3EE0B 1X7AC 1OS8A 1F5RA 1V2TT 1MAXA 4H6TA 4AZ2B 2G5NA 2WPIS 1C2DA 2M5TA 1GL0E 1HAOH 2VB0A 1AO5A 1TMTH 1PPFE 2GCTB 1BMAA 1WOFA 3D49H 3BG4B 4Y8XA 2JIZD 5EQRA 3TH4H 4LOYH 3MH6A 2V35A 2ZCKP 1Z71A 2ALVA 2VIPA 4A1TA 3U28C 2OXSA 1C1QA 4FVDA 3NRLA 2C8XB 3TGJE 4U30A 1LKAA 2HWLB 1WYKA 2ESTE 2J98A 4I8KA 1KSNA 2V0BA 5JB8S 3PMAB 2IPQX 3MNSA 2YOLA 3A8AA 1A46H 2WYGA 2FESH 4JZIA 3VPKA 1O2NA 3N7EA 3EE7A 2AMDA 2VIQA 5FCKA 1H9HE 1HAVA 5E2PA 2ZDAH 1IQJA 1DT2A 1CO7E 2VIVA 1IQEA 1NROH 3HATH 3HKIB 1GJBB 4ISOA 2FMJA 5EW1H 1FDPA 1GG6C 1NU7B 1E38B 1A61H 4X6PA 3MI4A 4FUJA 2PUXB 1SGTA 3BTGE 1SFQB 4B73A 3ZYEA 1IQMA 2FOBA 2ZU4A 2QGRA 3R0FA 3CENA 3VGCC 1TX7A 2ZFPH 1S82A 3BEIB 1O3EA 5HYOA 1HAPH 2BD3A 4ACAA 1HAXB 1J15A 2EY4C 3WWBA 1LVYA 3ZZDA 1P05A 2ILNA 2SFAA 4K69A 1JRTA 2BD7A 1XX9A 4Q4LA 1W11U 1UTKA 1O2MA 2ZHDA 2W7SA 4O03A 1TGNA 1Y3VA 2A4QA 1P01A 3LC3A 1TRMA 4THNH 1SHYA 1VKYA 1CQQA 1E79D 2A7JA 4YO9A 4Y8YA 4KKDA 3SUFA 2Y7XA 1LPGB 3Q77A 1D3TB 1SGIB 4X1NU 5EQQA 1W3CA 3ODDA 1C4Y2 1MTWA 5C3NA 1KIGH 3LU9B 1EAXA 2BDYA 1TMUH 4RI0A 4BAMB 5LPRA 3I77A 1HJ8A 1QNJA 2FTMA 1WTGH 2EA3A 1LVOA 2Z3CA 1YWUA 5C67A 5DP6A 5DO4H 1VCQA 1EZUC 2Z9LA 1IHTH 2FYQA 4U01A 1AE5A 1O31A 1G37A 1UMAH 1AD8H 1TPPA 2ZFTA 4X8VH 1YPKH 4HGCA 1BTWA 2TIOA 2M2AA 3U69H 3ZZ8A 1ELGA 3B23B 3MOCA 5JBCS 3BTFE 4X1RU 1BZXE 3DUXH 4IC5A 3ZZ4A 5CMXH 2VWOA 1O3HA 1DY8A 4X6MA 3UQVA 3EYDA 1MZAA 3Q00A 2P3TB 4WMDA 3QGJA 1CT2E 1TLDA 1O2YA 1GBEA 1NM6A 1S0RA 4OGYA 5F6MA 3PV4A 4DCDA 1YCPK 1S0QA 3GDSA 2IPHA 1SG8B 1AN1E 2OD3B 1QTFA 1WQVH 2VIDA 4IC6A 4I86A 2QXIA 1BMNH 5C2ZA 1UHBB 3ZVAA 1DXPA 4LZ1H 5PTPA 4NG9H 2PTCE 3K65B 4GUXA 3SV8A 6GCHG 3SNEA 1AWHB 1W14U 3UAIC 1O32A 1C5QA 1GI5A 2QN5T 2ZHQH 3KEEA 1SQAA 2XBXA 2GV7A 1LVMA 2GDDA 1QB9A 3UTUH 5G4BA 3FO8D 1GBMA 2QC2A 3U8OH 1F0UA 4OS5A 1P04A 1XXFA 2PHBA 4YTAA 2STBE 2A0QB 4AGKA 4B75A 4O3UA 1HNEE 1LPZB 5DSFA 1RRKA 1O2JA 3LIWA 4CBNA 1ZR0A 1P06A 1XUJA 2OBOA 2Z3DA 3OY5U 3TH3H 3T62A 2ZF0H 3TNSA 4MNXA 4Y7AA 1MBMA 2BZAA 7GCHF 2STAE 3MQKC 3TK5A 1FY8E 1PFXC 5F8XA 5FHTA 1LQDB 4NA9H 2IJOB 5DP5A 1WV7H 1UVPA 5EJZA 1KXFA 4A6LA 4H6SB 5B6OA 4IS5A 1O3GA 2PWXA 3PYHA 1G30B 1LHDH 1BTZA 1C2MA 1ZHRA 1MABB 4KP0A 4MNWA 4NIYA 3STJA 1Z8GA 4K8BA 1MTUA 1P2KA 2GCHG 5C20A 6GCHF 4M9FA 3SI3H 3TU7H 1QIXB 2CXVA 3M3SA 4ASHA 1ZZZA 2BVSH 1PPGE 3AK5A 2HALA 2I6QA 2FOCA 2ZFFH 3NK8A 4R8TB 4NA8A 1V2WT 1OPHB 1GI7B 1C2KA 3MMGA 4K1TA 1GHZA 3RXOA 1TQ7B 2FP7B 3MTYA 2QF0A 1BA8B 1OP2A 1QURH 2XC5A 1GCDA 1QJ1B 1Q2WA 1K1PA 2LELA 4UFGH 1TA2A 2ZFRH 3MU8A 4AOQA 4ZHLU 4UE7H 2BMGB 3RUOA 3GCNA 1YCPH 5L2YH 4AB8A 2ODQA 1FI8A 4ZXYH 3RXKA 1KMHB 5BPEA 3LGVA 1VR1H 1L4DA 2Y5HA 1QY6A 1SOZA 4OS6A 1TFXA 2QA9E 3BV9B 3MWIU 1QRXA 4MPWA 1G2LA 1D6RA 4X2VA 1K28D 1O2RA 2ZP0H 1O2SA 5E0HA 2XC4A 1NT1A 2WUBA 1TX6A 2GCHF 3D62A 1P3CA 2FPZA 3RC5A 2J5UA 1UHBA 1O34A 1HJAB 1SGCA 2AGGX 8GCHG 4IBLH 3SN8A 2FI3E 1QBVH 3DCLA 5E2OA 1QA0A 4FXGH 1CA8B 2H1UA 2VNTA 2VIWA 1FN6A 2H9EH 1DWBH 3ODFA 4F55A 1LHGH 1SQTA 1FQ3A 4FU8A 2P95A 4YT7H 4IGDA 4KTSA 4ZKSU 1V2OT 1AHTH 1GBTA 3LKWA 2B9LA 1GVZA 3PRDA 1GHYH 1B0FA 3O8DA 4B2BA 5A0BA 4H4FA 1CHOF 1GJ5H 1E0FD 3GY8A 2WV9A 3QX5H 1J17T 3QTVH 5FBEA 1EUFA 1TIOA 2EC9H 3ZVEA 1QB6A 4BAHB 5EXNA 2ZA5A 2AGIX 3EGKH 2ZFSA 1HGTH 3URCA 1VJAU 2C8ZB 1GBFA 1AWFH 4NSYA 4CR9A 3RMNH 3GCHC 2CF9H 2A31A 1TNGA 4Q7XA 2KM0A 2SNWA 3M3TA 3UFAA 4JZEH 1K22H 1A2CH 3GS9A 4LXBH 8GCHF 2G4UA 4X0WU 1E1QD 3V13A 1EOLA 2R9PA 3E91A 2OQ5A 2VINA 2WSSD 4J2YB 2UUYA 1YLCA 2O8WA 3A7VA 2PKSB 1SGFA 2GDEH 3T25A 2SGFE 4I8LA 3PWCA 3MH5A 2R0KA 2EI6A 1C2HA 1IQGA 2QY0B 1O5DH 2J38A 1TWXB 5EXLA 3KF2A 1GDNA 5JYIA 2KX4A 2P59A 2ZTYA 2RDEA 1O2XA 3QTOH 4OS1A 4MPXA 4K2YA 1KDQB 2Q6DA 2UWOA 3A7YA 2RG3A 1SL3A 4GHQA 1GJ8B 2BM2A 3E90B 5CHAC 2BDIA 3U8TH 2SGAA 4YLQH 2O8MA 3SI4H 3E8LA 3TJVA 3RXSA 3TGIE 1EATA 2A2XH 3BIUH 1KXCA 3ENSB 1J14A 3B8JA 5E8EH 2BDGA 1V2JT 5C1YA 3OEED 3LGWA 1B0EA 2ZTZA 1L1NA 4DJZB 1HPGA 2Y81A 4FU7A 3KQBA 3SJIA 3V7TA 1VJ9U 3W95A 1RIWC 8LPRA 1P02A 1XUIA 1BTUA 1UCYK 2TGPZ 1B5GH 1FY5A 1ZPCA 4NFFA 2NU4E 3LH3A 5EW2H 1YPMH 1NFUA 3UNSA 2J2UA 1ELAA 3AW1A 2Z7FE 1ABJH 3Q3XA 3MH7A 5FPSA 1W7GH 4DG4A 1WU1A 4GHTA 7LPRA 3OAAD 3SV6A 2GT8A 1XMNB 2NU0E 3NWUA 3SYJA 1B7XB 2XCNA 3ZZ9A 3KQDA 2KR7A 1T4UH 1ZGIA 5FXLA 1GGDB 2FI4E 1TNJA 2O8TA 3KNXA 2ZHFH 2CHAC 4X2WA 2PR3A 2PUQH 3T28A 3RDZA 1FONA 1ZTJA 3ZZBA 1LO6A 1DX5M 3RC4A 1PYTC 2A5AA 1AI8H 2OQUA 2K8IA 1HAIH 3QWCH 3TJUA 2FLBH 1COWD 1BBRK 3PV2A 3GY2A 1O3BA 1MQ5A 2VVVA 3AASA 1K1MA 1QZ8A 2SGDE 1O3DA 4Y71A 1XKBC 2FTLE 1O3PB 1O5EH 2VIOA 3TPIZ 4BTTB 3N7DA 3ZZ6A 3ATMA 1A5HA 1ANDA 4TPYA 1Y3UA 4O3TA 2GD4B 1C5XB 5F8TA 2LP6A 3MO9A 5JBAS 1YYY1 3V0XA 1E34B 2BY8X 1Z6JH 3SU2A 2UUJB 2W7UA 2EEKA 2QF5A 1YLNA 1CBWB 5ABWA 5DP9A
chains in the Genus database with same CATH topology
1DVAH 1ZLRA 1VZQH 1P09A 2ZDNA 3FAOA 5DK1A 1DUEA 1SLUB 4I31A 3VEQB 3F9GA 1AVXA 1FAKH 1NC6A 1KDQA 2XWBI 2G00A 1Z1JA 1FPHH 1KLIH 1G3DA 5EQSA 4UD9H 3BG8A 1NS3A 2XBYA 1NFXA 1LCYA 3EA7A 1BJUA 3RXIA 2W3IA 4K60A 1MCVA 3BSQA 3PB1E 1XUKA 3E3TA 2ZPSA 3SJ9A 2BQ7B 4JK5A 1MD8A 4JK6A 4XDEA 4RKJB 1PQ8A 1TB6H 2BDBA 2ANKH 3WY8A 1Y5UT 2C8WB 3LPRA 3Q3YA 4ABGA 3K2UA 1A3EH 2O8LA 1EB1H 5J4QA 3QDZB 1F0RA 3UY9A 4X1QU 2VWMA 1V2KT 5AFYH 3RXJA 3L6PA 4BOHA 3NZIA 1N8OB 1PQ7A 3W94A 5SGAE 3FP8E 4GLYA 2QXJA 1HDTH 1GBAA 3PMJA 1JRSA 2P8OC 4FUCA 2B0FA 2BB4A 4D8NA 1BMLA 4INLA 1H8IH 2G55A 1O2HA 4WH8A 1HLTH 1FIZA 2ULLA 1JWTA 2V6NA 3V3MA 1BBRH 2IN2A 5LGOA 2OC8A 2VWNA 1OWKA 4B74A 1C1MA 1GI9B 3HGNA 1MUEB 1O38A 3RM2H 3HGPA 2QXGA 1G2MA 2GT7A 2ZU5A 5DJ7A 1TPSA 2BOKA 2BLWA 1BRCE 2D8WA 2G81E 3PO1B 2A7HA 1DY9A 1SC8U 4D9QA 1CT4E 1EP6A 1A1RA 1DSTA 1J16A 4FUFA 2NU2E 4A1VA 1RS0A 2QIQA 5T3HA 4DIHH 1PPEE 4BNRA 5L2ZH 1YPGH 2VJ1A 2XXLA 4Y11E 1XVMA 1DWCH 3PTBA 3SUDA 1FPCH 1MTNC 1T8OA 2BD2A 3Q3KA 4X1SU 3ZVBA 3KQEA 3M3VA 4SGBE 2OUAA 2VU8E 3P70B 1FIWA 2PFEA 5T6FA 5EG4A 3BN9A 1P2MA 3P8NA 1C4V2 5DP3A 2ZCHP 4ZKOU 1C2GA 1SFIA 3SGQE 1E36B 3CP7A 1F92A 1TNHA 3A8BA 4O9VA 1P57B 1GDQA 3LH1A 2EI7A 3RXHA 2SGEE 3RLWH 2BX4A 1PJPA 2BDCA 1LTOA 1AZZA 3A83A 2OCVB 4BXWA 1NZQH 3UWIA 2NWNA 5AVDA 2FLRH 5A0AE 1A4WH 1ZHMA 1GG6B 3FP7E 3U1JB 1CE5A 1IQNA 1MCTA 5C1UA 1DICA 1HXFH 1SGDE 1DLKB 2Y82A 2Y5GA 3RXGA 1TGBA 3UNQA 1H1BA 4GAWA 5AFZH 2RA0A 3VGCB 1C1NA 3PM3A 1BB0B 2H9TH 4NZQA 2VVCA 2Z94A 2A32A 4TY6A 5F8ZA 3PLKA 4INHA 1V2NT 4DIIH 1ZGVA 3U8RH 1ZTKA 1O2KA 3A82A 2O8UA 1DFPA 1C2LA 2F83A 3UOUA 1CU1A 1KTSB 1O0DH 1MH0A 4JMYA 2GKVE 3VB4A 5IDKA 2F9PA 1T32A 1YBWA 5LPEA 1YCPM 1O2GH 1SGNE 2BYAX 3OX7U 4YM9A 3QN7A 4IMQA 1OOKB 5DP4A 1IQLA 1NU9A 3OY6U 3M5NA 1LVBA 1PPHE 3QGNB 3VFEA 4HZHA 3VXFH 4I7YH 1T8NA 1PYTD 1AQ7A 4B1TA 1T8MA 4YLUA 3SHCH 1MKWK 2R2MB 1C1PA 1EPTC 1RTKA 3KHVA 2ODPA 1AMHA 1EAUA 4KELA 4CH8B 4DOQA 1F5LA 1OP0A 1AFQC 4UFFH 1Y5BT 2FX4A 1VCPA 1GBCA 3GY6A 1A3BH 2ZPQA 1HAYB 2FX6A 2FS9A 1KXDA 2B8OH 2KAIB 4B2AA 1FY1A 1EAWA 3TH2H 1WQSA 2FOHA 3DFJA 2A45B 1AFEH 3L3TA 1C2JA 1GBHA 1ID5H 4ABIA 1AIXH 3UOPA 3GICB 1G32B 4E7NA 4ZKNU 1KLTA 3RP2A 4X8SH 1BMMH 2BVXH 4CR5A 5FBIA 1GJ9B 4KTUA 1W12U 3FP6E 2ZDLA 4HTCH 2J9NA 4B71A 3EA9A 1H9IE 4BXSA 1QA7A 1C2FA 1C9PA 1L0ZA 5A8ZA 3S0NA 1IQIA 1OWHA 3RU4T 1GHBG 3N7OA 1GBIA 5JBTA 3QLPH 1ESTA 1W8BH 2HPPH 1BTYA 1TRYA 3CS0A 1KXEA 2F9NA 4AN7A 1RTLA 2Y7ZA 1BT7A 1TOMH 4A7IB 1LHEH 1P9SA 1MZDA 2H9HA 1NRNH 1ANCA 2ANMH 1FJSA 2WYJA 5GJ4B 1C1VH 1XVOA 2AYWA 4Q7ZA 1SSXA 1QL9A 1VITH 4MNYA 1GI0A 2TPIZ 1O2OA 2QV1A 2HPQH 1K9OE 2G51A 3BEFB 1Y3WA 1O39A 1ABIH 3S9BA 1ELFA 4CRGA 1K1OA 1D4PB 1ELBA 1O5FH 4MLFB 2H5CA 3FFGA 4O97A 1MKWH 4OGXA 1UK3A 3TGKE 3RXBA 3P8FA 1DANH 1GI6A 4ZXXH 1C1WH 1FZZA 2A1DB 3P8OA 1GHBF 3RU4E 4E7RG 2WPJS 1ZPZA 2HNTE 3LT3A 2P93A 3FVFB 3ZZAA 1Y5AT 1QHRB 2FI5E 2O9QA 5DG6A 2DUCA 4XBBA 4NZLA 1O2TA 3KGPA 1C5PA 4CRBA 1IQFA 2SNVA 1GBLA 1EKBB 3IWMA 5T6DA 1DM4B 1GMHG 4AGJA 1C5RA 1C5ZB 1ELDE 2TRMA 3A8CA 4BANB 1OKXA 1O2LA 2KAIA 2FDAA 4AG2A 2YNAA 3MU4A 4K1EA 4UDWH 2F9BH 3VXEH 4RSPA 1ETRH 1Q31A 1ZSJA 2DE9A 1DITH 5LPFA 3T2NA 1O2VA 4YOGA 5EODA 1ZYOA 1A5IA 1RD3B 2P16A 1O3MA 3P92A 1GJ4H 1VITG 2ANYA 1BHXB 3F9FA 3GCTG 2OBQA 3RXEA 1THSH 1ELTA 3LDXH 4XFQA 4UFEH 2J4IA 1NRPH 1T31A 2P3FH 2VWLA 3I29A 2BY9X 1UK4A 4MPUA 3FANA 3C27B 3MHWU 1C5TA 1DS2E 2PSXA 1UTLM 1L1GA 6CHAB 2ZHWH 3L33A 2A4OA 2AIQA 1NPMA 1XXDA 1GMHF 3JZ2B 1QJ6B 2RDLA 2AH4X 4GSOA 1HAZB 4FUEA 1QB1A 1CGIE 3ZVCA 3PLBA 1C5MD 1UVUH 4NIXA 3RC6A 2HOBA 3SU5A 1JIMA 1SQOA 3M7QA 3LGIA 1V2MT 2G52A 1V2RT 3IG6B 1P2JA 1O3NA 3SJOA 1SGRE 1Z6EA 4Y79A 1OYQA 1O2ZA 1NFYA 2XCFA 1AUTC 4HFPB 3UNRA 2AEIH 1EAIA 3GCHB 6ESTA 3GCTF 3GOVB 2Y5FA 4ZKRU 2OTVA 1DPOA 2BZ6H 1D3PB 5J4SA 1NO9H 2AIPA 1EZQA 1HAHH 4FUDA 3KN2A 2C8YB 3D65E 1G3BA 3SU3A 2BXUH 3QZQA 1G36A 1V2PT 2HGTH 7KMEH 1C5YB 2V3OH 1S85A 4CHAC 4Y6DA 5A09A 3A81A 3UUZA 3ZVDA 2BLOA 1HUTH 2ZGXH 3RXTA 2VH6A 1O2UA 1GBJA 2Q6FA 2PV9B 1YP9A 1P12E 2HRVA 1MAYA 1OWDA 4CREA 3ZZ5A 2FOEA 3DA9B 5K7RA 2OLGA 1ETSH 1C1SA 4UFDH 4NIWA 3K6YA 3S7KB 2ZG0H 5HXFA 4CRDA 1HAGE 1SLWB 3MNBA 1V2QT 5GWZA 2H6MA 1ESAA 1TYNA 4OS2A 1DLEA 2BDAA 5GDSH 2GZ7A 4B76A 1A0HB 1QRWA 2H2ZA 3UPEA 1OX1A 1TNIA 4CRFA 1T4VH 5GIBA 2ZGHA 3M61U 2A7CA 1TX8A 1IAUA 1JIRA 1WBGB 5FPTA 4AORA 4K1SA 4BTUB 1RIWB 4A92A 4NIVA 3A87A 1WUNH 4U2WA 1WSSH 1FY4A 2JKHA 1BJVA 5E0GA 3UWJH 1D9IA 4ZHAA 1UCYE 3GDVA 1GWAA 1RXPA 3RM0H 1ZOMA 3MU5A 1OYTH 1Z8RA 1E37B 1ANBA 1UVSH 1THRH 2XTTB 3SNBA 2F9VA 3DHKH 4ISIH 1BDAA 4ABAA 3ELAH 1ZRBA 1BTPA 5GPIB 1FXYA 5I46H 3AVZA 7ESTE 4ZHMU 3S9CA 2P94A 1Y3YA 2CHAB 1DWDH 1MMJN 4Z0KA 2TGDA 4TPIZ 4A1XA 1OSSA 3PLPA 4KTCA 1ZTLA 2Y80A 2Z9JA 3MH4A 3GCOA 1IOEA 5GCHG 1TA6A 1HYLA 1AB9C 1TGSZ 1EX3A 5A8YA 3SQEE 2JETC 1VGCC 2UUKB 4AYYB 1CA0C 1BBRE 2DE8A 2ZGBH 3ATKA 3E16B 3MNXA 1LPKB 4AFSA 1N6YA 4CRCA 2ZFQH 3SU4A 2PW8H 4ABHA 1PPBH 3A80A 3PROA 3SZNA 3GDUA 1AVWA 2PLXA 2XC0A 1C2EA 5TCAA 1P2OA 2FYRA 4I8HA 1SHHB 3RMMH 3P6ZB 1S6FA 3LGYA 2VVUA 1YPHE 1Y3XA 5JBBS 3EA8A 1SPJA 1IQHA 4WJG2 4DT7B 4ZAEA 2J92A 4ESTE 3RXFA 5GCHF 2FXRA 3G01A 2AMPA 1TPAE 2PSYA 2FO9A 2ZTXA 2PGBB 4FU9A 3SUGA 5ESTE 4D9RA 4JZFH 5A8XA 1CHGA 5E0JA 2W26A 1J8AA 1ELEE 4WVPE 2BOHB 3QO6A 4U32A 3T27A 4GCHG 4XE4A 1F5KU 2WV4A 3A89A 1D3QB 1MQ6A 1QFKH 5F03A 1S81A 3D23A 1GMDG 1H4WA 2Z9KA 4FUHA 4IMZA 4JYUH 2GMTC 2RA3A 4Y76A 1ZSKA 3K9XB 3SJ8A 2Z9IA 5T6GA 3VB3A 1AY6H 1TPOA 2P8OB 2G4TA 1ARCA 1O2QA 3A7WA 3U1IB 2D1JA 3PMBB 1EZSC 3NPSA 1ESBA 2JH6D 1P0SH 1EOJA 4Y8ZA 3SW2B 1JOUB 3GY5A 3LJJA 4NGAH 5L6NH 3AAUA 2BTCE 1C1TA 4MTBA 1GCTC 2XBVA 2ZCLP 1TOCB 4ISNA 1JMOH 3H5CB 4AYVB 1SB1H 2NU1E 1BRUP 3SHAH 4NWKA 3ZV8A 1NESE 5AHGH 1SGYE 1ZMLA 1XUFA 1Z1IA 2ZC9H 5DGJA 3NXPA 1UTJA 1YPJH 2VH0A 3BIVH 1W2KH 2A4GA 3SV2H 2R2WU 4VGCC 1Z8JB 1BIOA 4GCHF 2VGCC 4PROA 1O2IA 3ZVFA 4BAOB 4Y7BA 1GJ6A 4TWYA 1WTHD 1UTOA 1GMDF 2WV5A 4IW4E 1GI8B 2GTBA 2GX4A 2UWLA 1GJDB 1MTNB 3B9FH 2BY6X 3LGUA 5L30H 2GV6A 1O3OA 2W5EA 1YC0A 1L2EA 3KIDU 1SGEE 1FNIA 3CS7A 1QL8A 2TBSA 2GCTC 4UEHH 3ZV9A 5ETXA 3AAVA 2P3UB 3BG4C 1G9IE 1UVOA 2UWPA 5EU8A 1GJ7B 4OS4A 1HXEH 3A85A 3ATLA 1MTVA 1UTPA 1G3EA 2GVFA 4RN6A 1OXGA 1P10A 1ZHPA 4JZ1A 1HV7A 1C1OA 2J34A 3OTJE 4Y0YE 4LK4A 2A4RA 3BTEE 1QBOA 1TRNA 3SJKA 4A5TS 1YKTA 4GPGA 1P2IA 3MO3A 1BHXF 2JH0D 2QXHA 5FX5A 2OC1A 3FZDA 5TCCA 2XYAA 4ZH8A 1DUAA 1EZXC 1T8LA 4FUIA 3O8BA 2A5IA 5GXPA 2BLVA 2HLCA 1TBQH 2AERH 3UR6A 3SORA 4WF8A 3ZZ7A 5EPNA 2THFB 3A7TA 3TITA 4MNVA 2J95A 1K21H 5EXMA 1EP5A 4AFUA 3MYWA 1QCPA 1O3JA 1UTQA 4BTIB 4DGJA 2HNTC 5JB9S 1AZ8A 5I25A 1GI2A 1ZMNA 3GY3A 3M7UA 1HRTH 1F2SE 3QK1A 1TGTA 1FN8A 2BD8A 3NCLA 2FEQH 5C5NA 2BQ6B 2V3HH 1XUGA 3P95A 3F9HA 1AKSB 2ZIQH 3GY4A 3T26A 2BXTH 2BLQA 1QL7A 2CV3A 1EPTB 1INCA 4WMEA 1ACBE 3TVJB 2ZGJA 2CF8H 1BRAA 2Y6TA 1AFQB 4IN1A 1E35B 2ZU1A 1NN6A 1WAYB 1UTMA 1BITA 1C4U2 3A88A 3LC5A 1EQ9A 1YGCH 3MU0A 4AG1A 3BEUA 4K8YA 4NA7A 1TAWA 3U98H 1EJAA 4R0IA 3LONA 3BTME 1P11E 1F7ZA 4BAQB 1VCWA 8ESTE 1CVWH 3ATIA 1J9CH 4YOJA 1HB0B 2XW9A 2LNCA 2YNBA 4J1YA 1UVTH 3T5FH 3URDA 1NRSH 2ANWA 2ZDMA 9ESTA 1L1JA 1UJ1A 3SU1A 2PGQB 4BAKB 3ZVGA 3OYPA 2RCEA 3EAJA 1RGQA 7GCHG 1MD7A 1TALA 3RXPA 1BQYA 1S84A 5IYTA 4TWWA 1AGJA 2C3SA 2ZI2H 2HVXA 1O35A 3O8RA 3I78A 2WPLS 1V2ST 4X6OA 2GP9B 2QAAA 3AW0A 3ZZ3A 4JYVH 3HK6B 5FCRA 2FOMB 1A0LA 1O3AA 5HMAA 3PMHB 2TGTA 1OWJA 4ZROA 5BRRE 3GISB 1L4ZA 1YF4A 3E0PB 3F6UH 1GI4A 1SBWA 1GJAB 4FUBA 1NFWA 2FIRH 1HFDA 1SGPE 1AE8H 1HBTH 1PPZA 1CT0E 1UO6A 1OWIA 5JDUB 1QBNA 3BTKE 3BTTE 2BD5A 1LHFH 1K1IA 2BY5X 2FM2A 2XBWA 2ZQ2A 2GZ8A 1G3CA 1ZMJA 3EQ0H 2WPMS 3BTHE 1V2UT 2J94A 3RLYH 1O2WA 4M7GA 1T7CA 3BTWE 1K1NA 8KME2 3FZZA 3KCGH 3NUMA 1H9LB 1AKSA 1FY3A 1P2QA 1GMCG 1K1LA 2ZZUH 1EPTA 3S9AA 1KXBA 1HIAB 3U9AH 3STIA 2QCYA 3M7TA 1S6HA 1C5NH 1DWEH 1UTNA 3RMLH 1P9UA 4DURA 1TONA 1AVGH 1A0JA 1C5SA 1ARBA 4UONA 3KL6A 4XOJA 1GDUA 4E06H 1RFNA 1Z7KA 1TNKA 1GHAG 3R3GB 1O2PA 2WUCA</