1OWHA

Substituted 2-naphthamidine inhibitors of urokinase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
245
structure length
245
Chain Sequence
b'IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Identification of Novel Binding Interactions in the Development of Potent, Selective 2-Naphthamidine Inhibitors of Urokinase. Synthesis, Structural Analysis, and SAR of N-Phenyl Amide 6-Substitution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 60
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1owhA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1owhA01
1TBZH 3SGBE 1QL7A 2ZU2A 4MNYA 4INKA 1P04A 1SVPA 2V0BA 3QTVH 4DOQA 1AFQB 2CHAB 1C2EA 1ZMJA 3RXGA 3MNSA 4AGKA 1NRRH 1RS0A 1TLDA 1UTNA 2NU3E 8ESTE 1SGTA 3SU4A 5LPFA 1TALA 2PV9B 3SOSA 1HBTH 3TK5A 1UMAH 5EODA 1NO9H 4CRFA 1GMCG 2P94A 2V35A 4NWLA 5T6GA 4Y10E 4CBNA 2CF9H 1P9UA 3PO1B 2ZZUH 1QB1A 3T29A 3S0NA 2PLXA 1AMHA 3ENSB 2VWLA 2VNTA 2PTNA 3QX5H 3RXIA 1DXWA 2EI8A 1A3BH 7ESTE 2YNAA 3A7VA 4OGXA 1O35A 3U8TH 3RXLA 1OWKA 4OS6A 1DX5M 2J92A 3QGJA 4MPWA 1QJ1B 1G9IE 1KY9A 3D49H 4NFEA 4X1NU 1RTFB 1DITH 1VZQH 3CS7A 1IHTH 4NWKA 2UUJB 3ATKA 5C1UA 2OXSA 1OOKB 1PQ7A 1HYLA 4D8NA 1YPKH 2FX6A 4NZLA 3RXHA 3MU1A 4UD9H 5GCHG 3K65B 1AVXA 2GKVE 1TIOA 1IQNA 1GMCF 4NIXA 1HAXB 1UTQA 3KGPA 4JMYA 1C1RA 1ARBA 1ZPCA 1LVOA 3W95A 2FI3E 1MMJN 1SMFE 3UNRA 1AUJA 1DWBH 1MH0A 1W3CA 2WUCA 1P0SH 4ISIH 3I77A 3SJIA 2FOFA 1TNLA 4K1EA 1EJAA 1TABE 3A80A 2J34A 1KLJH 1G3DA 1Y59T 3UR6A 3ZVFA 1AVGH 4KKDA 1OYTH 2FOAA 4GCHG 2ZTYA 1EPTA 4AGJA 5A09A 1BUIA 2OLGA 2Z9IA 3E3TA 1ELCA 4DVAU 1O34A 1S5SA 1A5HA 4FU7A 3M7TA 1P2QA 3LC3A 1C1MA 1IQEA 3F9HA 1T4VH 3BTKE 4XSKU 1LMWB 1MBMA 3KEEA 1MKWH 4U01A 1NPMA 2O8LA 4WWYA 3K6ZA 3MO6A 1OWJA 2FS9A 2GCTC 1A46H 1EB1H 4KELA 3RXEA 3OTJE 1X7AC 2ZFTA 2Z94A 1DS2E 1AE5A 1LCYA 2G5VA 4IC5A 1A7SA 1KTTB 1BRUP 3SO3A 3IITA 1SGQE 3UWIA 1VGCB 3OU0A 4X6PA 1QRXA 3I29A 1NU7B 1T4UH 4K2YA 1MZAA 2QGRA 2BVRH 3A81A 5B6OA 3F9EA 1OP8A 3JZ2B 1P06A 4I8JA 5E0GA 4ZUHA 2FPZA 1GHAG 3F9GA 4JK5A 2SFAA 3GCTG 1G32B 4I8KA 4JZEH 1V2MT 1EAXA 4DCDA 1XMNB 1KLTA 5A0AE 1SLWB 3GY6A 5C5OA 2PW8H 2FOCA 2QYIA 1Q2WA 1YYY1 4ASHA 3A8BA 1TGBA 3TITA 1DVAH 1UTLM 1V3XA 3LGYA 1O3JA 3D65E 1OX1A 5EPYA 2AERH 1UVSH 2OCVB 3K6YA 2GV6A 1TPSA 3I78A 1Y5AT 2AIPA 4YLUA 5FAHA 3GYMA 1K1MA 5F8XA 4JK6A 1ZHRA 2VJ1A 4XE4A 2AEIH 1C2JA 2ZFFH 3KN2A 1GI0A 1NFWA 2BXUH 1KXEA 1WTGH 4DIHH 3HKJB 1K28D 3H5CB 3M5LA 1FY1A 1ANCA 2M5TA 4ZKRU 1GJ9B 3DUXH 3GCTF 3U8RH 1SGYE 1TRNA 3KNXA 1GJ7B 4I8HA 2WPLS 2FXRA 1ACBE 2KAIA 3C27B 3MNCA 4ISOA 3M35A 3SW2B 1WAYB 4X2XA 4NCYA 1AY6H 1DLEA 2F83A 1GHBG 2Z3EA 3NXPA 2J38A 1INCA 1GJCB 1RTKA 1SHHB 3EYDA 2G00A 4TPIZ 1DPOA 5HXFA 3NK8A 1NRNH 1G3BA 2FM2A 2VH6A 3SU0A 1C5XB 1C5UA 2BD8A 5FCKA 2FI5E 1BTXA 4E05H 1K1IA 2QN5T 1E34B 1O3MA 1GCDA 3UUZA 1C2FA 3RC5A 1RFNA 4CRGA 3FAOA 1KDQA 2F9OA 1Q31A 4BTIB 1QCPA 2QIQA 2BD2A 2YOLA 3GCNA 1DY8A 2QXIA 1TRMA 2W5EA 1NFYA 1V2KT 3UOUA 1BTYA 5LGOA 2C93B 1P05A 3ZYDA 3S7HB 1XVOA 2PKAA 1L4ZA 1GHBF 1G37A 5PTPA 5L2ZH 1UVUH 9ESTA 4YT7H 3UWJH 5HM9A 2G81E 2CV3A 4CBOA 1EZUC 2G5NA 1C2DA 4B1TA 6ESTA 5DO4H 5JPMH 2Q6FA 2TPIZ 2FOEA 2SGAA 3JZ1B 3NCLA 3V3MA 4AFZA 2Y5FA 2FO9A 2A7CA 2CF8H 4MQAA 6CHAC 1S6FA 2ANYA 3BEIB 2CGAA 1EUFA 1NFXA 5SGAE 1C1VH 1GI6A 2AGEX 2XWAA 1C5QA 2G8TA 1ESTA 2H2ZA 4IS5A 4Y76A 2DUCA 1H4WA 2ZWLH 4Y7BA 1CHOG 3L3TA 1Q3XA 4FUIA 1C1OA 3MU5A 3UR9A 3ZVAA 1SC8U 1ZHPA 3F68H 8GCHF 3A84A 2VIWA 2ZU5A 1H9IE 3P8FA 2GCTB 3KQDA 2Z9JA 2VIDA 1H9HE 2D1JA 5A8ZA 3PLPA 1C5RA 2NU1E 1JWTA 5JB9S 4WXVA 1HV7A 3A7TA 2PKSC 3S69A 3M37A 1K21H 4YOGA 4FVDA 4X1QU 5BRRE 2VH0A 1S81A 1GHWH 1C1SA 2QY0B 1DDJA 4RSPA 4BXSA 1ABIH 2BDCA 4BNRA 1MZDA 1VCWA 1BOQA 1HIAB 4O3TA 1P09A 1GBKA 5JBAS 3RLYH 1QB6A 3U69H 2JH5D 1CA0C 3FANA 1C2IA 3AAUA 4UDWH 3VXFH 3QWCH 1T8OA 2STAE 4A1XA 1HJ8A 3SJOA 3SGAE 1O2LA 1O2QA 4ZHLU 1O3HA 4HGCA 1ELBA 1V2TT 3L33A 3O8DA 3FVFB 3GY3A 3R3GB 1FIZA 2BYAX 1LHFH 4X8UH 4AORA 5JB8S 3HATH 2K1QA 2F9VA 4U2WA 1Z7KA 3A8AA 2OC0A 3U8OH 3HKIB 2XCFA 2Q6DA 3TH4H 1YCPM 2XWBI 1O5GH 1C2KA 2ZGHA 1BITA 2AMDA 1HB0B 2EA3A 5LPEA 1BDAA 2WPKS 4MLFB 2A45B 4ISLA 4MNWA 2FYQA 2CJIA 4XDEA 3BN9A 1SQOA 1AUTC 1KYNA 5GDSH 3SUFA 4O3UA 3D62A 2BQ6B 3ZZ5A 1V2OT 4AN7A 2TGAA 1O2SA 1KDQB 3O8BA 2XYAA 1MKXH 1IQFA 1JIMA 1DICA 1HNEE 1TNKA 4X1PU 9LPRA 2G4TA 3RXFA 2QA9E 2ZU4A 4AG1A 3BTEE 1L2EA 4Y7AA 5BPEA 3SN8A 1BMMH 3A8DA 1K1OA 1Z8GA 3BSQA 2J94A 1ZRBA 5DGJA 1ETRH 3BTME 1BRCE 5GJ4B 2AGGX 1GDQA 1S6HA 1DUAA 3HGNA 3GY4A 1WU1A 3QN7A 1A0JA 2BM2A 1MBQA 2HWLB 1V2LT 4X1RU 3SU1A 3LU9B 4CREA 1VJ9U 4MVNA 5EQSA 3ZVBA 3H7OA 1GMDG 2J9NA 3BTHE 1CGJE 4BXWA 2C8WB 2ZCHP 1ZGIA 1BZXE 1O2OA 4WF8A 5C2ZA 3UNQA 1O0DH 2OBOA 5G4BA 2TBSA 4ISHH 4YO9A 4INLA 1O2MA 1P3CA 4XOJA 1P8VC 1E38B 1NT1A 2DE9A 3BTGE 1O5CB 2JH0D 1EZSC 2DE8A 2Y82A 2WUBA 3RUOA 5HYOA 5EW1H 3F1SB 4VGCC 3EQ0H 1TB6H 1GI7B 2OTVA 2ODYB 1SGRE 1O3CA 3NPSA 1TBRH 2BOKA 2FI4E 1HAHH 1OKXA 2OC8A 1U6QA 2NU0E 4TWYA 1BTZA 1JXPA 1AN1E 3SNDA 4ABBA 3C1KA 1JRTA 1QBNA 1RTLA 1TRYA 3A7ZA 2OC1A 5DP3A 4ABGA 1RD3B 2GT7A 1O38A 2BZAA 2GZ9A 3ZZ6A 5E2OA 3BTFE 3TK6A 2HNTE 1UCYE 1KSNA 2CXVA 1A4WH 1FY4A 1Y5BT 3QO6A 4NIYA 3SQHE 2PKSB 5A8XA 1FAXA 3T28A 4DW2U 1CT0E 4AYVB 4JZIA 3BG8A 3RXVA 4D76A 5LPRA 1HPGA 1KXFA 3O8CA 1SI5H 2CN0H 3NUMA 1E36B 1YBWA 4FUBA 4IW4E 1CA0B 2P95A 3QZRA 2VWOA 1A1RA 1OWHA 4NSVA 1C5NH 1LKBA 1KXBA 4I7YH 2ZPRA 2Y7XA 4MDSA 2A5KA 1AVWA 1O2XA 1HAPH 2BDYA 2F9NA 2ANKH 1HJ9A 2F9PA 4Z6AH 1HXFH 1GG6C 2XC4A 3ATMA 5L6NH 4DT7B 1UTKA 3EE0B 1T8MA 1OP2A 1XUIA 3W94A 4IMQA 1EP6A 5EGMA 1T8LA 7LPRA 5J4SA 1O3LA 2BDBA 3BG4C 3P8OA 4UONA 1QR3E 4ZHMU 4K1TA 4M7GA 3ZZ3A 1UVPA 2PGBB 3PWCA 5AVDA 2P16A 3AVZA 1JIRA 1BMLA 2PUXB 1KIGH 2XXLA 3UFAA 1CO7E 2VGCC 3A7WA 3VFEA 3PYHA 3LH3A 1QURH 4Z0KA 1FN8A 1Z8RA 1MKXK 4JZ1A 1C5ZB 4X8SH 1F5LA 2WPIS 1GMHG 1Y5UT 1CE5A 1IQJA 3EA7A 1HFDA 3SBKA 2ZGXH 2Y7ZA 2ZP0H 1MTUA 3KL6A 1IQMA 3EAJA 3ZZ4A 2B7DH 5CHAC 1V2QT 2GGVB 4GHTA 2WPMS 4TPYA 1ELGA 5C1XA 2ZU3A 1MQ6A 3BTWE 4KP0A 3M7QA 3TU7H 4GSOA 4WJG2 4K69A 3QK1A 2SNWA 2P3FH 1DWEH 2BX4A 1M9UA 5EQQA 1GI1A 3O8RA 1LHDH 3KQCA 1FUJA 3BIVH 1O2IA 1GJAB 2FIRH 1AFEH 4CH8B 1Z8IB 2ZO3H 2BOHB 4AFQA 1BRBE 2TRMA 4ABDA 4Q7YA 3ZVCA 3QGNB 5H4IB 1G36A 1MAYA 1S83A 1EXFA 2AYWA 3BIUH 4ISNA 1FDPA 1AQ7A 3SI3H 1TGNA 4RKJB 1W7XH 3HK6B 5HM2A 1PPEE 1QL9A 2ZHFH 3TH2H 1A5IA 3ZYEA 1GBCA 4IMZA 3RU4T 5CMXH 4BAKB 5J4QA 1GBMA 1C1TA 4K3JA 4ZHAA 3MNBA 3U9AH 1PFXC 5JBCS 1ZTLA 2BY6X 1V2ST 3BTQE 3PMBB 4NZQA 1UCYH 1ZTKA 2A4GA 2ZIQH 4VGCB 4R0IA 3EDXB 5GCHF 1FY5A 4IN2A 3RP2A 2BHGA 1K1PA 4FUFA 1CGIE 1CSOE 3SU3A 1ZOMA 3TH3H 2VVVA 1YLDA 4KTCA 3RC4A 1F5RA 3SU5A 3SNCA 4I32A 2ODPA 3LGVA 2A2QH 5T6DA 4WH8A 2SGPE 4JYUH 4A7IB 1C2GA 1EJNA 4OS1A 2Y81A 2ZQ1A 3TNSA 3RU4D 1UK2A 4JZFH 3E0NB 3T26A 1NS3A 1EB2A 4ABEA 2C8YB 1GHXH 1GI8B 4NA8A 1BJUA 1UVOA 1T32A 5F8ZA 5C20A 1IQKA 1AZ8A 1AI8H 1YPEH 2IOTA 4GCHF 3EA9A 2Z3DA 1TNIA 4NGAH 1PPGE 2W26A 4CRCA 5A0CA 2FOBA 1OWDA 1N8OC 2BTCE 3A89A 2A32A 1QJ7B 4FU8A 1YPJH 3B23B 5I46H 1C5PA 1O3PB 3ESTA 2ZA5A 3MNXA 3A7YA 1V2NT 3RXTA 1WYKA 4I33A 2ZHEH 3OY5U 2Z9KA 1GBTA 1V6DA 1O2GH 3SI4H 1GBEA 3SV8A 1T8NA 5JBTA 2BDIA 3A86A 5DP4A 1ANDA 1SGDE 4B2BA 2SGFE 4OS4A 1MU8B 2GZ7A 1V2VT 4DY7B 3Q3XA 3ZZCA 3AW0A 1GG6B 1HJAC 2GZ8A 4YM9A 3CENA 5K0HA 1GVKB 4SGBE 4X0WU 2V6NA 1VCPA 3RXUA 2WYJA 1V2JT 2H5DA 2ZCLP 1GI3A 1HIAA 3KCGH 3RLWH 3BG4B 1O5DH 5EW2H 4X6NA 2AFQB 1L1GA 1LVBA 1BBRE 1TQ0B 3FFGA 3ZVEA 1OWEA 1YCPH 1JOUB 1HAZB 1XKBC 1O33A 1C5MD 1O2UA 2THFB 1GHAF 2VGCB 2SNVA 3G01A 1KTSB 5FCRA 3UY9A 4IC6A 1S82A 3GY8A 2BB4A 2BD7A 1HDTH 3MU8A 1EAWA 1HGTH 2O8WA 2RCEA 2GVFA 1NROH 4CRBA 1PYTC 3M7UA 3MMGA 5JDUB 1E0FD 1EX3A 1A3EH 1DUEA 1E35B 3QTOH 4U32A 2H9EH 1C1NA 3ATIA 1LQEA 2SGEE 4B2CA 1ZPZA 4AFUA 1GJ6A 2Y5GA 2G4UA 2ZCKP 1J17T 1NRSH 3ODDA 1VITG 5FXLA 5T3HA 5CHAB 1B7XB 2ZDNA 1BRAA 1UVTH 2GCHG 1ZLRA 1D9IA 2ZGBH 1HCGA 1MCTA 4H42U 1GGDC 3RMMH 3WY8A 1ZSJA 4CH2B 1LDTT 1GVZA 1MCVA 1TMTH 3P70B 2FOHA 5DG6A 1CT2E 2FOGA 2ZDLA 3MTYA 1VITH 2FMJA 3TGKE 1UHBB 2ZFQH 4B2AA 4A92A 3MO9A 2VIQA 1C5OH 4Q7ZA 4E7NA 1QGFA 1FV9A 2FODA 4HZHA 1C1WH 2Q1JA 1YLCA 1XX9A 2QF3A 1SFQB 3PV4A 1GHYH 4ZMAH 1TGTA 2NU4E 3OSYA 1NC6A 3DT0H 4NG9H 1AIXH 2JKHA 3TNTA 1BB0B 3PMHB 1GWAA 3UQOA 2HPQH 5FBEA 1GDNA 1O2ZA 1O2RA 1TOCB 1UJ1A 1TNGA 4ESTE 4XBDA 1FPCH 3Q77A 3M61U 1ARCA 3LGTA 1SSXA 2ZTZA 1WTHD 3ZZ9A 3GISB 3ODFA 3S9AA 1YPHE 4O97A 1AB9C 1MKWK 2R2WU 1P57B 1BQYA 2OUAA 1ZPBA 3RXBA 2I6SA 5AHGH 2A4QA 1NM6A 3DA9B 4MG3A 2YNBA 1C2HA 3M36A 4MPVA 3D23A 3K9XB 3VEQB 4A1TA 2P8OC 3VB3A 2HALA 1F92A 1TBQH 4O03A 1P02A 4ZAEA 4JCNA 4Q2KA 1ZMLA 4AOQA 2P59A 7KMEH 1P11E 3NZIA 4FUGA 1LPGB 3P8GA 1O2TA 4JYTA 1P03A 4UEHH 3SNEA 2TIOA 4HTCH 4XFQA 4I8GA 3MI4A 2F91A 3PB1E 3T62A 1ZTJA 1F0SA 2HGTH 1P2OA 1N8OB 1P2NA 2ASUB 1SLUB 3GDSA 1NZQH 3KIDU 4X2YA 3MH4A 1CHOF 1S0RA 1NTPA 1AD8H 1RIWC 3PTNA 2I6QA 2OC7A 1DSTA 1BBRH 3AW1A 1D3QB 1TX6A 4RN6A 1EZXC 8LPRA 1TA2A 4NIVA 5L2YH 3KF2A 5EG4A 4CRAA 1D3PB 1OYQA 4GUXA 3RXQA 1ORFA 1O3NA 1ELFA 5JYIA 4JZDH 1TNHA 1GCTC 3MHWU 2Q6GA 4ABIA 2O8MA 2XC0A 1NRQH 3RMNH 1D6WA 2BY8X 1HJAB 4FXGH 1VJAU 1W0ZU 1DT2A 1AU8A 1SGEE 4BAHB 1BCUH 4Q80A 7GCHG 2UWLA 2A2XH 4E06H 1W7GH 1SB1H 1ID5H 2SGDE 4O9VA 2QAAA 1C1UH 2ZQ2A 3RMOH 3ZVGA 4BAOB 1DM4B 1C5TA 2A4RA 1YPMH 4QT8C 2BDGA 1XUFA 3GICB 3LGUA 2FOMB 1DFPA 2AS9A 1OS8A 1G30B 1SFIA 4X2WA 3LONA 5FX6A 3F6UH 2VVCA 3KQEA 1Z6EA 2GX4A 2C90B 4D7GA 1SQTA 5A0BA 1DANH 1THRH 3GYLB 4UFEH 2TGTA 2ZFSA 2GMTC 2O8UA 2QXGA 3CS0A 4DGJA 4WMEA 3PWBA 4LOYH 1GHZA 1Z71A 2ZC9H 3ZZBA 2P3TB 1SOTA 2ZEBA 4B73A 1YP9A 4Y8YA 4YT6H 1MQ5A 1GI9B 1QRWA 4F4OC 1ELTA 1TX8A 1C9PA 4I8LA 5T6FA 4AB9A 1GBLA 2A1DB 3PMJA 1GGDB 1TFXA 1S85A 1ELEE 1BIOA 2OINA 2Y5HA 4A5TS 4DIIH 1H8IH 1WUNH 3VPKA 2UUYA 3TJOA 1Y3YA 1QBVH 3OYPA 3UPEA 2IPHA 5E0JA 1G3EA 1J8AA 1V2WT 4CHAC 4LXBH 3UNSA 1W11U 1O3AA 2OQUA 3DHKH 3LJJA 2HPPH 3S9CA 2BZ6H 2C4FH 5GWZA 4RKOB 1P2IA 1F0TA 2WV5A 3H7TA 2B0FA 2ZF0H 1QY6A 2ESTE 2PR3A 1O3IA 1FAKH 4NA7A 2ZKSA 1IAUA 2ZPSA 1IQGA 1SGPE 3R0FA 3RXCA 1P12E 2Z6BD 1PPHE 1SG8B 3BV9B 3URDA 1MTWA 4H6TA 1FN6A 2H9HA 3SHAH 1QFKH 3M5NA 3MWIU 3SGQE 1FQ3A 2HNTC 5HGGA 1O2KA 1EAUA 1S84A 3VB7A 1LO6A 2OBQA 1GJ8B 2R2MB 4YOIA 2A7HA 3L6PA 1O5BB 1BT7A 2ZPQA 4OS5A 1GMDF 2PTCE 2VVUA 1AB9B 3VXEH 2H1UA 1TA6A 3SU2A 1DY9A 1KXCA 1OXGA 2Z9GA 3LJOA 5IYTA 3K2UA 4UFGH 3BTTE 1HUTH 4MPUA 5E8EH 3FZZA 1D6RA 3AASA 1MTNC 1QTFA 1EKBB 2BLQA 4ABHA 3FP6E 4KTSA 1UTJA 2F9BH 2ZHDA 5DPAA 1O3EA 2P8OB 2FYRA 1F5KU 1DOJA 1UK4A 1QB9A 3PLKA 1SLXB 2TGDA 1PJPA 1O37A 2Z9LA 3TJNA 1PPZA 2C8XB 1C1QA 2IN2A 3BEUA 1C4Y2 1ZJDA 1LHCH 3RXRA 1E37B 2Y6TA 2R0LA 1O3OA 2QF0A 2XCNA 5ABWA 1WBGB 1PQ8A 1ZHMA 1RIWB 1TYNA 1QNJA 2PHBA 1NY22 3E6PH 1V2PT 6GCHG 2PSXA 4YTAA 2ZGCA 2BMGB 3SZNA 4Y6DA 1CHGA 2FS8A 3ITIA 3SV6A 5ESTE 3RU4E 1XUGA 4H6SB 1A0LA 3T25A 5LH8A 2ZFRH 3FP7E 3VGCC 4D7FA 1GCTB 3QZQA 3V12A 4ZXYH 2B8OH 3DFJA 1XXFA 2ZTXA 2ZDKA 3PM3A 1A5GH 4WVPE 2GV7A 2ZHWH 1EJMA 1J14A 3ATWA 1GI2A 4UFFH 3STIA 1GBJA 1ZMNA 3RXKA 3ZZ7A 2WPJS 4X1SU 5EXLA 5AF9H 6LPRA 1H1BA 3TJUA 3SV2H 2G55A 1B0FA 1GBFA 6GCHF 2BD5A 2VWNA 2HRVA 2BVSH 1ELDE 2ZI2H 3E90B 1W14U 3HK3B 1C2LA 1WV7H 2BLVA 2V3OH 3A85A 1QA7A 2QC2A 5F6MA 1LPKB 1AHTH 1F0RA 1O2VA 2A4OA 2A0QB 4XBBA 1XKAC 2EI6A 1ZR0A 2A7JA 1AO5A 2GMTB 1FJSA 3M3SA 1ANEA 4D9QA 3LIWA 1RRKA 2BY7X 2FWWA 5A8YA 1O36A 2UUFB 2FLRH 2XW9A 2W7SA 1JMOH 1Z1JA 3RMLH 1ZGVA 3RXJA 2J95A 1OP0A 2O8TA 2GP9B 3A88A 1HAVB 2PWXA 1B5GH 1DWCH 3GY5A 3SJKA 5C1YA 3IG6B 4AYYB 5C5NA 4FVBA 2Z7FE 5DP5A 2ALVA 1HAOH 1LHGH 3F9FA 3NWUA 1NFUA 1ZZZA 5ETXA 1GJDB 3TVJB 1GMHF 1EASA 3P6ZB 4X8TH 5EU8A 4CHAB 2ANMH 1EAIA 2V3HH 4YZUA 1TNJA 1BTHH 1Z8JB 2NWNA 4ZROA 1Y3UA 2FZZA 2EC9H 4GVUA 1EPTC 2XBVA 3GOVB 4BOHA 1G2MA 1DE7H 4X6MA 1MTSA 2ZNKH 1PPBH 3U98H 4ABFA 1SQAA 1BTPA 2R9PA 2BQWB 2D8WA 1QRZA 1MU6B 1HRTH 3UQVA 5DK1A 3SUEA 1LTOA 3HGPA 1K2I1 1L1JA 1UHBA 2FTLE 5E0HA 5EOKA 1AZZA 3P17H 5JBBS 2FP7B 4A1VA 1AGJA 4X8VH 1EOLA 4MNVA 1KXAA 1BTWA 2PGQB 1MUEB 2A5IA 5FPYA 4PROA 1GDUA 3SV7A 4BTUB 3UIRA 2EEKA 1T31A 2ZECA 1A2CH 3EA8A 3RC6A 2HNTF 1QL8A 1XXDA 2XNIA 1BJVA 4BTTB 4OS7A 1H8DH 1MTNB 4XBCA 1F7ZA 2ZGJA 2AH4X 1WSSH 1SGFG 1O3GA 1CBWC 3GDVA 1GHVH 1C4U2 5DP6A 4AG2A 3LPRA 3M5OA 1RJXB 1WQVH 1FZZA 1TGSZ 4GAWA 5AFYH 1D3DB 1TE0A 1FXYA 1TWXB 2UWPA 1XUJA 3BTDE 4SGAE 3Q3YA 4WMDA 1UTMA 1IQHA 1JRSA 1YPGH 4KTUA 3U1JB 2AGIX 1FIWA 2TGPZ 3SUDA 5GIBA 1W10U 3IWMA 2RA3A 1EATA 1D3TB 1QQUA 2W3KA 2Y80A 1ETTH 1V2RT 1YF4A 1ZJKA 4LZ1H 1QJ6B 2R3UA 3VGCB 3DD2H 1O3DA 5TCAA 1YM0A 3PTBA 4TY6A 3RDZA 3A87A 1Y3XA 3E16B 2QV1A 2VIPA 3A8CA 3V0XA 4A6LA 2VIOA 2NU2E 1TQ7B 1O5FH 4Y0ZE 1EP5A 1W0YH 5EXMA 3ZVDA 4NA9H 2G51A 2QXJA 1CGHA 4WY3A 2STBE 5FBIA 1OSSA 3RM2H 3GCHC 1MTVA 1O2WA 1C5VA 1O30A 3RXDA 1XUKA 1O2HA 2W3IA 4Y71A 1KLIH 2P3UB 3SNAA 4YLQH 1BTUA 1EZQA 4Y79A 1P9SA 1LPZB 4MPXA 1O2YA 5FHTA 3ZV8A 1GL0E 3SQEE 2RDLA 3UOPA 4WH6A 1C9TA 4K5ZA 3Q76A 3TJVA 1FI8A 3LC5A 3SU6A 2SGQE 1RGQA 1P3EA 3T27A 1UTOA 4HI3A 2XC5A 2PFEA 1TX7A 3BF6H 1W2KH 4CRDA 1NN6A 4OS2A 5FPSA 1SBWA 4D9RA 4NFFA 3P92A 3RXSA 1BMNH 3ZZAA 1OWIA 2XRCA 4Y8XA 4WMFA 3GCOA 2PSYA 3UREA 4LZ4B 1O5EH 3LGWA 1LKAA 1SR5C 2FEQH 2VINA 1FPHH 3MOCA 2UUKB 1ETSH 2CMYA 3MH5A 2JH6D 4OGYA 1HLTH 2OQ5A 2UWOA 3EGKH 1NRPH 1MAXA 1GBIA 2C8ZB 1CA8B 1YPHC 8KME2 1A61H 2F3CE 2ANWA 2H6MA 1AE8H 5C67A 3E91A 4KGAA 1TONA 1N6XA 1EPTB 5ESBA 1P2JA 1VITF 3DFLA 3ELAH 3ZZ8A 1LHEH 4LK4A 4YOJA 5F03A 5TCCA 2GCHF 2AIQA 1ANBA 4GLYA 1SHYA 1C5WB 8GCHG 1UCYK 2BDHA 4J1YA 3MH6A 1TPOA 4BANB 5DKMA 4ZKOU 5I25A 2BY5X 1YGCH 5C3NA 3U1IB 3RXAA 4YESB 4K8BA 1GBAA 1IHSH 1C5SA 2ALPA 4B74A 2HOBA 1L1NA 4FU9A 1TPAE 1TMUH 2GDDA 1K1NA 2XBXA 2WYGA 4DJZB 3TK9A 3TIUA 3SORA 4WXIA 2C3SA 4Y0YE 2ZDAH 3M3TA 1CBWB 2AMPA 3S7KB 1PQAA 5DP7A 3LGIA 3FP8E 2O9QA 1GJ5H 1B0EA 1ESBA 2BQ7B 2P93A 4TY7A 2ILNA 1P01A 4B76A 3TLOA 3GY2A 1C2MA 2VU8E 3QLPH 1QBOA 1ELVA 1ELAA 2BD4A 1GI4A 3N7OA 1UK3A 3A82A 3LT3A 1SPJA 2A5AA 2AMQA 4B75A 2EI7A 1A0HB 5GXPA 4TYDA 1N1LA 3PROA 3QDZB 1QQ4A 3V13A 1W8BH 4R8TB 2HLCA 2ODQA 4UFDH 4H4FA 4TWWA 3SUGA 2FLBH 4JYVH 4GHQA 1IQLA 1THPB 1GPZA 3P95A 1HAYB 1TAWA 1O2JA 2BD9A 3SHCH 3RXPA 1T7CA 5EQRA 3ZV9A 1C5YB 1PPCE 1O2NA 2ULLA 4ZKSU 3V7TA 1SL3A 2ZDMA 4NIWA 3SJ9A 1UO6A 1QA0A 2XTTB 1HAIH 4Y8ZA 2W7UA 4E7RG 1AWHB 1YCPK 1H9LB 2VWMA 2QXHA 1O3KA 1JBUH 4AFSA 2JETC 2KAIB 1FONA 2RA0A 2BD3A 3AAVA 4ABAA 3GCHB 3MH7A 4BAQB 5AFZH 1QHRB 2WV4A 1W13U 3S9BA 1FNIA 1D4PB 2WPHS 5HMAA 1FY8E 1RXPA 1C4V2 4FUEA 1J16A 1O3FA 1GJ4H 1AFQC 1ZSKA 1WOFA 2CHAC 5FX5A 1ABJH 2IJOB 1GBHA 1FMGA 1IOEA 1TMBH 3HPTB 5DJ7A 1AWFH 1J15A 3MFJA 5FPTA 3UTUH 7GCHF 1PYTD 3PLBA 5DP8A 1K22H 4IGDA 2ZHQH 2BXTH 4AZ2B 3P8NA 4MNXA 1BA8B 3PO1C 2FDAA 1VCQA 1CT4E 3T5FH 4J2YB 3URCA 1NU9A 1AKSA 5DP9A 1O39A 3Q00A 1UTPA 2G52A 1TPPA 4AX9H 2A31A 1TOMH 1L4DA 1O2PA 1DXPA 1CQQA 2PKAB 2ZU1A 1Y8TA 1VR1H 3MU0A 1Y3WA 2BDAA 4IBLH 4INHA 3ZZDA 3M5MA 4X6OA 1P10A 2ZFPH 4GPGA 3A83A 3E8LA 1SOZA 3M3VA 5F8TA 1FY3A 1PPFE 4FUJA 1Z6JH 1BHXB 3OY6U 1YPLH 1DWDH 1ZSLA 2D26C 1N6YA 3PMAB 4I31A 3TGIE 4Q7XA 5CE1A 3QUMP 2BX3A 1ESAA 1HAVA 1QIXB 3E1XB 1SGCA 1XUHA 1O3BA 1YC0A 1G2LA 4FUDA 1SGIB 4B71A 4Y11E 4K60A 1L0ZA 2HVXA 3A7XA 4ABJA 1BHXF 1ZYOA 2F9UA 4AB8A 1XVMA 1J9CH 3RXMA 2ZG0H 3MYWA 1K9OE 4X2VA 2Z3CA 4UE7H 1ZRKA 2FESH 2FTMA 2OP9A 5EPNA 3CP7A 1C5LH 1KXDA 2XBYA 2WINI 3RXOA 2QCYA 1EQ9A 1F2SE 5E2PA 6CHAB 2ZDVH 1CU1A 1MD7A 1OPHB 4FUHA 1W12U 3MO3A 4K1SA 3STJA 1TGCA 4THNH 3OX7U 5IDKA 2BY9X 3MU4A 2D2DA 2BVXH 4ZXXH 2GT8A 2GDEH 4NSYA 3LH1A 1Z1IA 5K7RA 1THSH 2PUQH 1GVLA 3E0PB 3LOXA 1P2MA 4DURA 3RM0H 5TJXA 3VB6A 3LDXH 4IN1A 2LNCA 3TGJE 1WQSA 3Q3KA 2OD3B 1LVYA 1PQ5A 5L30H 2H5CA 3VB4A 1G3CA 2XBWA 4HFPB 1O32A 4CR9A 3SV9A 1BMAA 1LVMA 3SJ8A 2LPRA 1HXEH 1O5AB 1Y3VA 3KHVA 4U30A 3VB5A 1BBRK 4F49A 2RG3A 1WCZA 1V2UT 2J2UA 1K1JA 1VGCC 2R3YA 3KQBA 2BLOA 1SLVB 5EXNA 4MTBA 2B9LA 4K8YA 1GL1A 2GTBA 3BEFB 2VB0A 2J4IA 1DSUA 4BAMB 1GJBB 2BLWA 3B8JA 2VIVA 3GY7A 1MD8A 4CR5A 3TPIZ 2B5TB 1GI5A 5GPIB 1SGNE 4ZH8A 3ATLA 1O31A 1EOJA 1GBBA 4FUCA 1SGFA 1NESE 1F0UA 1HAGE 1P2KA 3NKKA 2GD4B 1IQIA 5A2MH 3SNBA 3LKWA 2FX4A 3B9FH 3GDUA 1K1LA 4DG4A 1YKTA 2JETB 1DLKB 1XM1A 1CVWH 1S0QA 1C1PA 1AKSB 1LQDB 4ZKNU 1FLEE 2H9TH 3FZDA 1GBDA 3T2NA 2R0KA
chains in the Genus database with same CATH superfamily
1TBZH 3SGBE 1QL7A 2ZU2A 4MNYA 4INKA 1P04A 1SVPA 2V0BA 3QTVH 4DOQA 1AFQB 2CHAB 1C2EA 1ZMJA 3RXGA 3MNSA 4AGKA 1NRRH 1RS0A 1TLDA 1UTNA 2NU3E 8ESTE 1SGTA 3SU4A 5LPFA 1TALA 2PV9B 3SOSA 5KECA 1HBTH 3TK5A 1UMAH 5EODA 1NO9H 4CRFA 1GMCG 2P94A 2V35A 4NWLA 5T6GA 4Y10E 4CBNA 2CF9H 1P9UA 3PO1B 2ZZUH 1QB1A 3T29A 3S0NA 2PLXA 3OEHD 1AMHA 3ENSB 2VWLA 2VNTA 2PTNA 3QX5H 3RXIA 1DXWA 2EI8A 1A3BH 1BMFD 7ESTE 2YNAA 3A7VA 4OGXA 1O35A 3U8TH 3RXLA 1OWKA 4OS6A 1DX5M 2J92A 3QGJA 4MPWA 1QJ1B 1G9IE 1KY9A 3D49H 4NFEA 4X1NU 1RTFB 1DITH 1VZQH 3CS7A 1IHTH 4NWKA 2UUJB 3ATKA 5C1UA 2OXSA 1OOKB 1PQ7A 1YY3A 1HYLA 4D8NA 2QF4A 1YPKH 2FX6A 4NZLA 3RXHA 3MU1A 4UD9H 5GCHG 3K65B 1AVXA 2KCPA 2GKVE 1TIOA 1IQNA 1GMCF 4NIXA 1HAXB 1UTQA 3KGPA 4JMYA 1C1RA 1ARBA 1ZPCA 1LVOA 3W95A 2FI3E 1MMJN 1SMFE 3UNRA 1AUJA 1DWBH 1MH0A 1W3CA 2WUCA 1P0SH 4ISIH 3I77A 3SJIA 2FOFA 1TNLA 4K1EA 1EJAA 1TABE 3A80A 2J34A 1KLJH 1G3DA 1Y59T 2J5UA 3UR6A 3ZVFA 1AVGH 4KKDA 1OYTH 2FOAA 4GCHG 2ZTYA 1EPTA 4AGJA 5A09A 1BUIA 2OLGA 2Z9IA 3E3TA 1ELCA 4DVAU 1O34A 1S5SA 1A5HA 4FU7A 3M7TA 1P2QA 3LC3A 1C1MA 1IQEA 3F9HA 1T4VH 3BTKE 4XSKU 1LMWB 1MBMA 3KEEA 1MKWH 4U01A 1NPMA 2O8LA 4WWYA 3K6ZA 3MO6A 1OWJA 2FS9A 2GCTC 1A46H 1EB1H 4KELA 3RXEA 3OTJE 3KQ5A 1X7AC 2ZFTA 2Z94A 1DS2E 1AE5A 1LCYA 2G5VA 4IC5A 1A7SA 1KTTB 1BRUP 2KX4A 3SO3A 3IITA 1SGQE 3UWIA 1VGCB 3OU0A 4X6PA 1QRXA 3I29A 1NU7B 1T4UH 4K2YA 1MZAA 2QGRA 2BVRH 3A81A 5B6OA 3F9EA 1OP8A 3JZ2B 1P06A 4I8JA 5E0GA 4ZUHA 2FPZA 1GHAG 3F9GA 4JK5A 2YMSC 2SFAA 3GCTG 1G32B 4I8KA 4I86A 4JZEH 1V2MT 1EAXA 4DCDA 1XMNB 1KLTA 5A0AE 1SLWB 3GY6A 2EY4C 5C5OA 2PW8H 2FOCA 2QYIA 1Q2WA 1YYY1 4ASHA 3A8BA 1TGBA 3TITA 1DVAH 1UTLM 1V3XA 3LGYA 1O3JA 3D65E 1OX1A 5EPYA 2AERH 3OAAD 1UVSH 2OCVB 3K6YA 2GV6A 1TPSA 3I78A 1Y5AT 2AIPA 4M9FA 4YLUA 4F55A 5FAHA 3GYMA 1K1MA 5F8XA 4JK6A 1ZHRA 2VJ1A 4XE4A 2AEIH 1C2JA 2ZFFH 3KN2A 1GI0A 1NFWA 2BXUH 1KXEA 1WTGH 4DIHH 1FX0B 3HKJB 1K28D 3H5CB 3M5LA 1FY1A 1ANCA 2M5TA 4ZKRU 1GJ9B 3DUXH 3GCTF 3U8RH 1SGYE 1TRNA 3KNXA 1GJ7B 4I8HA 2WPLS 2FXRA 1ACBE 2KAIA 3C27B 2W6JD 3MNCA 4ISOA 3W1EA 3M35A 3SW2B 1WAYB 4X2XA 4NCYA 1AY6H 1DLEA 2F83A 1GHBG 2Z3EA 3NXPA 2J38A 1INCA 1GJCB 1RTKA 4RT1A 1SHHB 3EYDA 2G00A 4TPIZ 1DPOA 5HXFA 3NK8A 1NRNH 1G3BA 2FM2A 2VH6A 3SU0A 3DSGA 1C5XB 1C5UA 2BD8A 5FCKA 2FI5E 1BTXA 4E05H 1K1IA 2QN5T 1E34B 1O3MA 1GCDA 3UUZA 1C2FA 3RC5A 1RFNA 4CRGA 3FAOA 1KDQA 2F9OA 1Q31A 4BTIB 1QCPA 2QIQA 4TT3D 5C94A 2BD2A 1MABB 2YOLA 3GCNA 1DY8A 2QXIA 1TRMA 2W5EA 1NFYA 1V2KT 5FL7D 3UOUA 1BTYA 5LGOA 2C93B 1P05A 3ZYDA 2WSSD 3S7HB 1XVOA 2PKAA 1L4ZA 1GHBF 1G37A 5PTPA 4B6EA 5L2ZH 1UVUH 9ESTA 4YT7H 3UWJH 5HM9A 2G81E 2CV3A 4CBOA 1EZUC 2G5NA 1C2DA 4B1TA 6ESTA 5DO4H 5JPMH 2Q6FA 2TPIZ 2FOEA 2SGAA 3JZ1B 3NCLA 3V3MA 4AFZA 2Y5FA 2FO9A 2A7CA 5EIYA 2CF8H 4MQAA 6CHAC 1S6FA 2ANYA 3BEIB 5C0TA 2CGAA 1EUFA 1NFXA 5SGAE 1C1VH 1GI6A 2AGEX 2XWAA 1C5QA 2G8TA 1ESTA 2H2ZA 4IS5A 4Y76A 2DUCA 1H4WA 2ZWLH 4Y7BA 1CHOG 3L3TA 1Q3XA 4FUIA 1C1OA 3MU5A 1W0KD 3UR9A 3ZVAA 1SC8U 1ZHPA 3F68H 8GCHF 3A84A 2VIWA 2ZU5A 1H9IE 3P8FA 2GCTB 3KQDA 2Z9JA 2VIDA 1H9HE 2D1JA 3PRDA 5A8ZA 3PLPA 3VG8A 1W0JD 1C5RA 2NU1E 1JWTA 5JB9S 4WXVA 1HV7A 3A7TA 2PKSC 3S69A 3M37A 1K21H 4YOGA 4FVDA 4X1QU 5BRRE 2VH0A 1S81A 1GHWH 1C1SA 2QY0B 1DDJA 4RSPA 5KEDA 4BXSA 1ABIH 2BDCA 4BNRA 1MZDA 1VCWA 1BOQA 1HIAB 4O3TA 1P09A 1GBKA 2JDID 3RLYH 1QB6A 5JBAS 3PRBA 3U69H 2JH5D 4RT0A 1CA0C 3FANA 1C2IA 3AAUA 4AC9A 4UDWH 3VXFH 3QWCH 1T8OA 2STAE 4A1XA 1HJ8A 2YMSB 3SJOA 5F53A 3SGAE 1O2LA 1O2QA 4ZHLU 1O3HA 4HGCA 1ELBA 2F4LA 1V2TT 3L33A 3O8DA 3FVFB 3GY3A 3GS9A 3R3GB 1YWUA 1FIZA 2BYAX 1LHFH 4X8UH 4AORA 5JB8S 3HATH 2K1QA 2F9VA 4U2WA 1Z7KA 3A8AA 2OC0A 3U8OH 3HKIB 2XCFA 2Q6DA 3PV2A 3TH4H 1YCPM 4F48B 2XWBI 5DN6D 1O5GH 1C2KA 2ZGHA 1BITA 2AMDA 1HB0B 2EA3A 5LPEA 1BDAA 2WPKS 4MLFB 2A45B 4ISLA 2AHME 4MNWA 2FYQA 2CJIA 4XDEA 3BN9A 1SQOA 1AUTC 1KYNA 5GDSH 3SUFA 4O3UA 3D62A 2BQ6B 3ZZ5A 1V2OT 4AN7A 2TGAA 1O2SA 1KDQB 3O8BA 2XYAA 1MKXH 1IQFA 1JIMA 1DICA 1HNEE 1TNKA 4X1PU 9LPRA 3FOAA 2G4TA 3RXFA 2QA9E 2ZU4A 4AG1A 3BTEE 1L2EA 4Y7AA 5BPEA 3SN8A 1BMMH 3A8DA 1K1OA 2EQNA 1Z8GA 3BSQA 2J94A 1ZRBA 5DGJA 4XBBA 1ETRH 3BTME 1BRCE 5GJ4B 2AGGX 1GDQA 1S6HA 1DUAA 3HGNA 3GY4A 1WU1A 3QN7A 1A0JA 2BM2A 1MBQA 2HWLB 1V2LT 4X1RU 3SU1A 3LU9B 4CREA 1VJ9U 4MVNA 5EQSA 3ZVBA 3H7OA 2KCAA 2LP6A 1GMDG 3F2GA 2J9NA 3BTHE 1CGJE 4BXWA 3KYGA 2C8WB 2ZCHP 1ZGIA 1BZXE 1O2OA 4WF8A 5C2ZA 3UNQA 1O0DH 2OBOA 5G4BA 2TBSA 4ISHH 4YO9A 4INLA 1O2MA 1P3CA 4XOJA 3EE7A 1P8VC 1E38B 1NT1A 2DE9A 3BTGE 1O5CB 2JH0D 1EZSC 2DE8A 2Y82A 2WUBA 3RUOA 5HYOA 5EW1H 3F1SB 3KYFA 4VGCC 3EQ0H 1TB6H 1S6LA 1GI7B 2ODYB 2OTVA 1SGRE 1O3CA 3NPSA 1TBRH 2BOKA 2FI4E 1HAHH 1OKXA 3SZEA 2OC8A 1U6QA 2J98B 2NU0E 4TWYA 1BTZA 1JXPA 1AN1E 3SNDA 4ABBA 2HVYB 3C1KA 1JRTA 1QBNA 1RTLA 1TRYA 3A7ZA 2OC1A 5DP3A 3FO8D 4ABGA 1RD3B 2GT7A 1O38A 2BZAA 2GZ9A 3ZZ6A 5E2OA 3BTFE 3TK6A 2HNTE 1UCYE 1WDIA 1KSNA 2CXVA 1A4WH 1FY4A 1Y5BT 3QO6A 4NIYA 3SQHE 2PKSB 5A8XA 1FAXA 3T28A 4DW2U 1CT0E 4AYVB 4JZIA 3BG8A 3RXVA 4D76A 5LPRA 1HPGA 1KXFA 3PV5A 3O8CA 1SI5H 2CN0H 3NUMA 1E36B 1YBWA 4FUBA 4IW4E 1CA0B 2P95A 3QZRA 2VWOA 1A1RA 1OWHA 4NSVA 1KMHB 1C5NH 1LKBA 1KXBA 4I7YH 2ZPRA 2Y7XA 4MDSA 2A5KA 1AVWA 1O2XA 1HAPH 2BDYA 2F9NA 2ANKH 1HJ9A 2F9PA 4Z6AH 1HXFH 1GG6C 2XC4A 3ATMA 5L6NH 4DT7B 1UTKA 3EE0B 1T8MA 1OP2A 1XUIA 3W94A 4IMQA 1EP6A 5EGMA 1T8LA 7LPRA 3N7EA 5J4SA 1O3LA 2BDBA 3BG4C 3P8OA 4UONA 1QR3E 4ZHMU 1EFRD 4K1TA 4M7GA 3ZZ3A 5C0UA 1UVPA 2PGBB 3PWCA 5AVDA 2LELA 2P16A 3AVZA 1JIRA 3CNRA 1BMLA 2PUXB 1KIGH 2XXLA 3UFAA 1CO7E 2VGCC 3A7WA 3VFEA 4DT4A 3PYHA 3LH3A 1QURH 4Z0KA 1FN8A 2QE7D 1Z8RA 3H09A 3N7DA 1MKXK 4JZ1A 1C5ZB 4X8SH 1F5LA 2WPIS 1GMHG 1Y5UT 1CE5A 2V3MA 1IQJA 1NBMD 3EA7A 1HFDA 3SBKA 2ZGXH 2Y7ZA 2ZP0H 1MTUA 3KL6A 1IQMA 3EAJA 3ZZ4A 2B7DH 5CHAC 1V2QT 2GGVB 4GHTA 2WPMS 4TPYA 1ELGA 5C1XA 2ZU3A 1MQ6A 3BTWE 4KP0A 3M7QA 3TU7H 4GSOA 4WJG2 4K69A 4Z1MD 3QK1A 2SNWA 1DWEH 2P3FH 2BX4A 1M9UA 5EQQA 1GI1A 3O8RA 1LHDH 3KQCA 1FUJA 3BIVH 1O2IA 1GJAB 2FIRH 1AFEH 4CH8B 1Z8IB 2ZO3H 2BOHB 4AFQA 1BRBE 2TRMA 4ABDA 4Q7YA 3ZVCA 3QGNB 5H4IB 1G36A 1MAYA 1S83A 1E1RD 1EXFA 2AYWA 3BIUH 4ISNA 1FDPA 1AQ7A 3SI3H 1TGNA 2F43B 4RKJB 1W7XH 3HK6B 5HM2A 1PPEE 1QL9A 2ZHFH 3TH2H 1A5IA 3ZYEA 4XRNA 1GBCA 4IMZA 3RU4T 5CMXH 4BAKB 5J4QA 1GBMA 1C1TA 4K3JA 4ZHAA 3MNBA 3U9AH 1PFXC 5JBCS 2HLDD 1ZTLA 2BY6X 1V2ST 3BTQE 3PMBB 4NZQA 1UCYH 1ZTKA 2A4GA 2ZIQH 4VGCB 2GJGA 4R0IA 3EDXB 5GCHF 1FY5A 4IN2A 3RP2A 2BHGA 1K1PA 4FUFA 1CGIE 1CSOE 3SU3A 1ZOMA 3TH3H 2VVVA 1YLDA 4KTCA 3RC4A 1F5RA 3SU5A 3SNCA 4I32A 2ODPA 3LGVA 2A2QH 5T6DA 4TSFD 4WH8A 2SGPE 4JYUH 4A7IB 1C2GA 1EJNA 4OS1A 2Y81A 2ZQ1A 3TNSA 3RU4D 1UK2A 4JZFH 3E0NB 3T26A 1NS3A 1EB2A 4ABEA 2C8YB 1GHXH 1GI8B 4NA8A 1BJUA 1UVOA 1T32A 5F8ZA 5C20A 1IQKA 1AZ8A 1AI8H 1YPEH 2IOTA 4GCHF 3EA9A 2Z3DA 1TNIA 4NGAH 1PPGE 5EJ1A 2W26A 4CRCA 5A0CA 1YLNA 1OWDA 2FOBA 1N8OC 2BTCE 3A89A 2A32A 1QJ7B 4FU8A 1YPJH 3NRLA 3B23B 5I46H 1C5PA 1O3PB 3ESTA 2ZA5A 3MNXA 3A7YA 1V2NT 3RXTA 1WYKA 4I33A 2ZHEH 3OY5U 2Z9KA 1GBTA 1V6DA 1O2GH 3SI4H 1GBEA 3SV8A 1T8NA 5JBTA 2BDIA 3A86A 5DP4A 1ANDA 1SGDE 4B2BA 2SGFE 4OS4A 1MU8B 2GZ7A 1V2VT 4DY7B 3Q3XA 3ZZCA 3AW0A 1GG6B 1HJAC 2GZ8A 4YM9A 3CENA 5K0HA 1GVKB 4SGBE 4X0WU 2V6NA 1VCPA 3RXUA 2WYJA 1V2JT 2H5DA 3WWBA 2ZCLP 1GI3A 1HIAA 3KCGH 3RLWH 3BG4B 1O5DH 5EW2H 4X6NA 3UAIC 2AFQB 1L1GA 1LVBA 1BBRE 1TQ0B 3FFGA 3ZVEA 1OWEA 1YCPH 1JOUB 1HAZB 3F0OA 1XKBC 1O33A 4P02A 3OTPA 1C5MD 1O2UA 2THFB 1GHAF 2VGCB 2SNVA 3G01A 1KTSB 5FCRA 3UY9A 4IC6A 1S82A 3GY8A 2BB4A 2BD7A 1HDTH 3MU8A 1EAWA 1HGTH 2O8WA 2RCEA 2GVFA 1NROH 4CRBA 1PYTC 3M7UA 3MMGA 5JDUB 1E0FD 1EX3A 1A3EH 1DUEA 1E35B 3QTOH 3F2HA 2H9EH 4U32A 1C1NA 3ATIA 1LQEA 2SGEE 4B2CA 1ZPZA 4AFUA 1GJ6A 2Y5GA 2G4UA 1E79D 2ZCKP 1J17T 1NRSH 3ODDA 1VITG 5FXLA 5T3HA 5CHAB 1B7XB 2ZDNA 1BRAA 1UVTH 2GCHG 1ZLRA 1D9IA 2ZGBH 1HCGA 1MCTA 4H42U 1GGDC 3RMMH 3WY8A 1ZSJA 4CH2B 1LDTT 1GVZA 1MCVA 1TMTH 3P70B 2FOHA 5DG6A 1CT2E 2FOGA 2ZDLA 3MTYA 1COWD 1VITH 2FMJA 3TGKE 1UHBB 2ZFQH 4B2AA 4A92A 3MO9A 2VIQA 1C5OH 4Q7ZA 4E7NA 3ZIAD 1QGFA 1FV9A 2FODA 4HZHA 1C1WH 2Q1JA 1YLCA 1XX9A 2QF3A 1SFQB 3PV4A 1GHYH 4ZMAH 1TGTA 2NU4E 3OSYA 1NC6A 3DT0H 4NG9H 1AIXH 2JKHA 3TNTA 1BB0B 3PMHB 1GWAA 3UQOA 2HPQH 5FBEA 1GDNA 1O2ZA 1O2RA 1TOCB 1UJ1A 1TNGA 4ESTE 4XBDA 1FPCH 3Q77A 3M61U 3OFND 1ARCA 4RI0A 3LGTA 3N99A 1SSXA 2ZTZA 1WTHD 3ZZ9A 3GISB 1K0HA 3ODFA 3S9AA 1YPHE 4O97A 1AB9C 1MKWK 2R2WU 1P57B 1BQYA 2OUAA 1ZPBA 3RXBA 2I6SA 5AHGH 2A4QA 1NM6A 3DA9B 4MG3A 2YNBA 1C2HA 3M36A 4MPVA 3D23A 3K9XB 3VEQB 4A1TA 2P8OC 3VB3A 4YXWD 2HALA 1F92A 1TBQH 4O03A 1P02A 4ZAEA 4JCNA 4Q2KA 1ZMLA 4AOQA 2P59A 7KMEH 1P11E 3NZIA 4FUGA 1LPGB 3P8GA 1O2TA 4JYTA 1P03A 4UEHH 3SNEA 2TIOA 4HTCH 4XFQA 4I8GA 3MI4A 2F91A 3PB1E 5EJZA 3T62A 1ZTJA 1F0SA 2HGTH 1P2OA 1N8OB 1P2NA 2ASUB 1SLUB 2J98A 3GDSA 2RDEA 1NZQH 3KIDU 4X2YA 3MH4A 1CHOF 1S0RA 1NTPA 1AD8H 1RIWC 3PTNA 5DSFA 2I6QA 2OC7A 1DSTA 1BBRH 3AW1A 1D3QB 1TX6A 4RN6A 1EZXC 8LPRA 1TA2A 4NIVA 5L2YH 3KF2A 5EG4A 4FETA 4CRAA 1D3PB 4ZCNA 1OYQA 4GUXA 3RXQA 1ORFA 1O3NA 1ELFA 5JYIA 4JZDH 1TNHA 1GCTC 3MHWU 1H8ED 2Q6GA 4ABIA 2O8MA 2XC0A 1NRQH 2YMSD 3RMNH 1D6WA 2BY8X 1HJAB 4FXGH 1VJAU 1W0ZU 1DT2A 1AU8A 1SGEE 4BAHB 1BCUH 4Q80A 7GCHG 2UWLA 3F3BA 2A2XH 4E06H 1W7GH 1SB1H 1ID5H 2SGDE 4O9VA 2QAAA 1C1UH 2ZQ2A 3RMOH 3ZVGA 4BAOB 1DM4B 1C5TA 2A4RA 1YPMH 4QT8C 2BDGA 1XUFA 3GICB 3LGUA 2FOMB 1DFPA 2AS9A 1OS8A 1G30B 1SFIA 2K0QA 4X2WA 3LONA 5FX6A 2KM0A 3F6UH 2VVCA 3OE7D 3KQEA 1Z6EA 2GX4A 2C90B 4D7GA 1SQTA 5A0BA 1DANH 2WPDD 1THRH 3GYLB 5HIYA 4UFEH 5EJLA 2TGTA 2ZFSA 2GMTC 2O8UA 2QXGA 3CS0A 4DGJA 4WMEA 2KR7A 3PWBA 4LOYH 2JJ2D 1GHZA 1Z71A 2ZC9H 3ZZBA 2P3TB 1SOTA 2ZEBA 4B73A 1YP9A 4Y8YA 4YT6H 2IJD1 1MQ5A 1GI9B 1QRWA 4F4OC 1ELTA 4OM9A 1TX8A 1C9PA 4I8LA 5T6FA 4AB9A 1GBLA 2A1DB 3PMJA 1GGDB 1TFXA 1S85A 1ELEE 1BIOA 2OINA 2Y5HA 4A5TS 4DIIH 1H8IH 1WUNH 3VPKA 2UUYA 3TJOA 1Y3YA 1QBVH 3OYPA 3UPEA 2IPHA 5E0JA 1G3EA 1J8AA 1V2WT 4CHAC 4LXBH 3UNSA 1W11U 1O3AA 2OQUA 3DHKH 1NBME 3LJJA 2HPPH 3S9CA 2BZ6H 2C4FH 5GWZA 4RKOB 1P2IA 1F0TA 2WV5A 3H7TA 2B0FA 2ZF0H 1QY6A 2ESTE 2PR3A 1O3IA 1FAKH 4NA7A 2ZKSA 1IAUA 2ZPSA 1IQGA 1SGPE 3R0FA 3RXCA 1P12E 2Z6BD 1PPHE 1SG8B 3BV9B 3URDA 1MTWA 4H6TA 1FN6A 2H9HA 3SHAH 1QFKH 3M5NA 3MWIU 3SGQE 1FQ3A 2HNTC 5HGGA 1O2KA 1EAUA 1S84A 3VB7A 1LO6A 2OBQA 1GJ8B 2R2MB 4YOIA 2A7HA 3L6PA 1O5BB 1BT7A 2VBCA 2ZPQA 4OS5A 1GMDF 2PTCE 4HG6A 2VVUA 1AB9B 3VXEH 2H1UA 1TA6A 3SU2A 1DY9A 1KXCA 1OXGA 2Z9GA 2KCYA 3LJOA 5IYTA 3K2UA 4UFGH 3BTTE 1HUTH 4MPUA 5E8EH 3FZZA 1D6RA 3AASA 1MTNC 1QTFA 1EKBB 2BLQA 4ABHA 3FP6E 4KTSA 1UTJA 2F9BH 2ZHDA 5DPAA 1O3EA 2P8OB 2FYRA 1F5KU 1DOJA 1UK4A 1QB9A 3PLKA 1SLXB 2TGDA 1PJPA 1O37A 2Z9LA 3TJNA 1PPZA 2C8XB 1C1QA 2IN2A 3BEUA 1C4Y2 1ZJDA 1LHCH 3RXRA 1E37B 2Y6TA 2R0LA 1O3OA 2QF0A 2XCNA 1H8HD 5ABWA 1WBGB 1PQ8A 1ZHMA 1RIWB 1TYNA 1QNJA 2PHBA 1NY22 3E6PH 1V2PT 6GCHG 2PSXA 4YTAA 2ZGCA 2BMGB 3SZNA 2PP6A 4Y6DA 1CHGA 2FS8A 3ITIA 3SV6A 5ESTE 3RU4E 3DSOA 1XUGA 4H6SB 2IPQX 1A0LA 3T25A 5LH8A 2ZFRH 3FP7E 3VGCC 4D7FA 1GCTB 3QZQA 3V12A 4ZXYH 2B8OH 3DFJA 1XXFA 2ZTXA 2ZDKA 3PM3A 1QZ8A 1A5GH 4WVPE 2GV7A 2ZHWH 1EJMA 1J14A 3ATWA 1GI2A 4UFFH 3STIA 1GBJA 1ZMNA 3RXKA 3ZZ7A 2WPJS 4X1SU 5EXLA 5AF9H 6LPRA 1H1BA 2M2AA 3TJUA 3SV2H 2G55A 1B0FA 1GBFA 6GCHF 2BD5A 2VWNA 2HRVA 2BVSH 1ELDE 2ZI2H 3E90B 1W14U 3HK3B 1C2LA 1WV7H 2BLVA 2V3OH 3A85A 1QA7A 2QC2A 5F6MA 1LPKB 1AHTH 1F0RA 1O2VA 2A4OA 1E1QD 2A0QB 1XKAC 2EI6A 1ZR0A 2A7JA 1AO5A 2GMTB 1FJSA 3M3SA 1ANEA 4D9QA 3LIWA 1RRKA 2BY7X 2FWWA 5A8YA 1O36A 5CDFE 2UUFB 2FLRH 2XW9A 3OEED 2W7SA 1JMOH 1Z1JA 3RMLH 4XD7D 5GNDA 1ZGVA 3RXJA 2J95A 4ASUD 1OP0A 2O8TA 2GP9B 3A88A 1HAVB 2PWXA 1B5GH 1DWCH 3GY5A 3SJKA 5C1YA 3IG6B 4AYYB 5C5NA 1SQRA 4FVBA 2JIZD 2Z7FE 5DP5A 2ALVA 1HAOH 1LHGH 4Q4LA 3F9FA 3NWUA 1NFUA 1ZZZA 5ETXA 1GJDB 3TVJB 1GMHF 1EASA 3P6ZB 4X8TH 5EU8A 4CHAB 2ANMH 1EAIA 2V3HH 4YZUA 1TNJA 1BTHH 1Z8JB 2NWNA 4ZROA 1Y3UA 2FZZA 2EC9H 4GVUA 1EPTC 2XBVA 3GOVB 4BOHA 1G2MA 1DE7H 1VKYA 1MTSA 4X6MA 2ZNKH 1PPBH 3U98H 4ABFA 1SQAA 1BTPA 2R9PA 2BQWB 2D8WA 1QRZA 1MU6B 1HRTH 3UQVA 5DK1A 3SUEA 1LTOA 3HGPA 1K2I1 1L1JA 1UHBA 2FTLE 5E0HA 5EOKA 1AZZA 3P17H 5JBBS 2FP7B 4A1VA 1AGJA 4X8VH 1EOLA 4MNVA 1KXAA 1BTWA 2PGQB 1MUEB 2A5IA 5FPYA 4PROA 1GDUA 3SV7A 4BTUB 3UIRA 2EEKA 1T31A 2ZECA 1A2CH 3EA8A 3RC6A 2HNTF 1QL8A 1XXDA 2XNIA 1BJVA 4BTTB 4OS7A 1H8DH 1MTNB 4XBCA 1F7ZA 2ZGJA 2AH4X 1WSSH 1SGFG 1O3GA 1CBWC 3GDVA 1GHVH 1C4U2 5DP6A 3SYJA 4AG2A 3LPRA 3M5OA 1RJXB 1WQVH 1FZZA 1TGSZ 4GAWA 5AFYH 1D3DB 1TE0A 1FXYA 1TWXB 2UWPA 1XUJA 3BTDE 4SGAE 5B6LA 3Q3YA 4WMDA 1UTMA 1IQHA 2KFWA 1JRSA 1YPGH 4KTUA 3U1JB 5HIZA 2KCOA 2AGIX 1FIWA 2TGPZ 3SUDA 5GIBA 1W10U 3IWMA 2RA3A 1EATA 3FKSD 1D3TB 1QQUA 2W3KA 2Y80A 1ETTH 5CHBA 2L74A 1V2RT 1YF4A 1ZJKA 4LZ1H 1QJ6B 2R3UA 3VGCB 3DD2H 1O3DA 5TCAA 1YM0A 3PTBA 4TY6A 3RDZA 3A87A 1Y3XA 3E16B 2QV1A 2VIPA 3A8CA 3V0XA 4A6LA 2VIOA 5KGOA 2NU2E 1TQ7B 3WWFA 1O5FH 4Y0ZE 1EP5A 1W0YH 5EXMA 3ZVDA 2W6ID 4NA9H 2G51A 2QXJA 1CGHA 4WY3A 2STBE 5FBIA 2CK3D 1OSSA 3RM2H 3GCHC 1MTVA 1O2WA 1C5VA 1O30A 3RXDA 1XUKA 1O2HA 2W3IA 4Y71A 1KLIH 2P3UB 3SNAA 4YLQH 1BTUA 1EZQA 4Y79A 1P9SA 1LPZB 4MPXA 1O2YA 5FHTA 3ZV8A 1GL0E 3SQEE 2RDLA 3UOPA 4WH6A 1C9TA 4K5ZA 3Q76A 3TJVA 1FI8A 3LC5A 3SU6A 2SGQE 1RGQA 1P3EA 3T27A 1UTOA 4HI3A 2XC5A 2PFEA 1TX7A 3BF6H 1W2KH 4CRDA 1NN6A 4OS2A 5FPSA 1SBWA 4D9RA 4NFFA 3P92A 3RXSA 1BMNH 3ZZAA 1OWIA 2XRCA 3DCLA 4Y8XA 4WMFA 3GCOA 5T1VA 2PSYA 3UREA 4LZ4B 1O5EH 3LGWA 1LKAA 1SR5C 2FEQH 2VINA 1FPHH 3MOCA 2UUKB 1ETSH 2CMYA 3MH5A 2JH6D 4OGYA 2XOKD 1HLTH 2OQ5A 2K8IA 2UWOA 3EGKH 1NRPH 1MAXA 1GBIA 2C8ZB 1CA8B 1YPHC 8KME2 1A61H 2F3CE 2ANWA 2H6MA 1AE8H 5C67A 3E91A 4KGAA 1TONA 1N6XA 1EPTB 5ESBA 1P2JA 1VITF 3DFLA 3ELAH 3ZZ8A 1LHEH 4LK4A 4YOJA 5F03A 5TCCA 2GCHF 2AIQA 1ANBA 4GLYA 1SHYA 1C5WB 8GCHG 1UCYK 2BDHA 4J1YA 3MH6A 1TPOA 4BANB 5DKMA 4ZKOU 5I25A 4B6FA 2BY5X 1YGCH 5C3NA 2L6OA 3U1IB 3RXAA 4YESB 4K8BA 1GBAA 1IHSH 1C5SA 2ALPA 4B74A 2HOBA 1L1NA 4FU9A 1TPAE 1TMUH 2GDDA 1K1NA 2XBXA 2WYGA 4DJZB 3TK9A 3TIUA 3SORA 4WXIA 2C3SA 4Y0YE 2ZDAH 3M3TA 1CBWB 2AMPA 3S7KB 1PQAA 5DP7A 3LGIA 3FP8E 1OHHD 2O9QA 2WV9A 1GJ5H 1B0EA 1ESBA 2BQ7B 2P93A 4TY7A 2ILNA 1P01A 4B76A 3TLOA 3F0PA 1C2MA 3GY2A 2VU8E 3QLPH 1QBOA 1SKYE 1ELVA 1ELAA 2BD4A 1GI4A 3N7OA 1UK3A 3A82A 3LT3A 1SPJA 2A5AA 4ACBA 2AMQA 4B75A 2EI7A 1A0HB 5GXPA 4TYDA 1N1LA 3PROA 3QDZB 1QQ4A 3V13A 1W8BH 4R8TB 2HLCA 2ODQA 4UFDH 4H4FA 4TWWA 3SUGA 2FLBH 4JYVH 4GHQA 1IQLA 1THPB 1GPZA 2V7QD 1HAYB 1TAWA 1O2JA 2BD9A 3P95A 3SHCH 3RXPA 1T7CA 5EQRA 3ZV9A 1C5YB 1PPCE 1O2NA 2ULLA 4ZKSU 3V7TA 1SL3A 2ZDMA 4NIWA 3SJ9A 1UO6A 1QA0A 2XTTB 1HAIH 4Y8ZA 2W7UA 4E7RG 1AWHB 1YCPK 1H9LB 2JJ1D 2VWMA 2QXHA 1O3KA 1JBUH 4AFSA 2JETC 2KAIB 1FONA 2RA0A 2BD3A 3AAVA 4ABAA 3GCHB 3MH7A 4BAQB 5AFZH 1QHRB 2WV4A 1W13U 3S9BA 1FNIA 1D4PB 2WPHS 5HMAA 1FY8E 1RXPA 1C4V2 4FUEA 1J16A 1O3FA 1GJ4H 1AFQC 1ZSKA 1WOFA 2CHAC 5FX5A 1ABJH 2IJOB 1GBHA 1FMGA 1IOEA 1TMBH 3HPTB 5DJ7A 1AWFH 1J15A 3MFJA 5FPTA 3UTUH 7GCHF 1PYTD 3PLBA 5DP8A 1K22H 4IGDA 2ZHQH 2J97A 2BXTH 4AZ2B 3P8NA 4MNXA 1BA8B 3PO1C 2FDAA 1VCQA 5IK2D 1CT4E 3T5FH 4J2YB 3URCA 1NU9A 1AKSA 5DP9A 1O39A 3Q00A 1UTPA 2G52A 1TPPA 4AX9H 2A31A 1TOMH 1L4DA 1O2PA 1DXPA 1CQQA 2PKAB 2ZU1A 3MQKC 1Y8TA 1VR1H 3MU0A 1Y3WA 2BDAA 2WHXA 4IBLH 4INHA 3ZZDA 3M5MA 4X6OA 1P10A 5C17A 2ZFPH 1WXRA 4GPGA 3A83A 3E8LA 1SOZA 3M3VA 5F8TA 1FY3A 1PPFE 4FUJA 1Z6JH 2XNDD 4P00A 1BHXB 3OY6U 1YPLH 1DWDH 1ZSLA 2D26C 4ACAA 1N6YA 3PMAB 4I31A 3TGIE 4Q7XA 5CE1A 3QUMP 2BX3A 1ESAA 1HAVA 1QIXB 3E1XB 1SGCA 1XUHA 1O3BA 1YC0A 1G2LA 4FUDA 1SGIB 4B71A 4Y11E 4K60A 1L0ZA 2HVXA 3A7XA 4ABJA 1BHXF 1ZYOA 2F9UA 3FN8A 4AB8A 1XVMA 1J9CH 3RXMA 2ZG0H 3MYWA 1K9OE 4X2VA 2Z3CA 4UE7H 1ZRKA 2FESH 2FTMA 2OP9A 5EPNA 3CP7A 1C5LH 1KXDA 2XBYA 2WINI 3RXOA 2QCYA 2KZ4A 1EQ9A 1UW7A 1F2SE 5E2PA 6CHAB 2ZDVH 1CU1A 1MD7A 1OPHB 2QF5A 4FUHA 1W12U 3MO3A 4K1SA 3STJA 2RFKC 1TGCA 4THNH 3OX7U 5IDKA 2BY9X 3MU4A 2D2DA 2BVXH 4ZXXH 2GT8A 2GDEH 4NSYA 3LH1A 1Z1IA 5K7RA 1THSH 2PUQH 1GVLA 3E0PB 3LOXA 1P2MA 4DURA 3RM0H 5TJXA 3U28C 3VB6A 3LDXH 4IN1A 2LNCA 3TGJE 1WQSA 3Q3KA 2OD3B 1LVYA 1PQ5A 5L30H 2H5CA 3VB4A 1G3CA 2XBWA 4HFPB 1O32A 4CR9A 3SV9A 3F2FA 1BMAA 1LVMA 3SJ8A 2LPRA 1HXEH 1O5AB 1Y3VA 3KHVA 4U30A 3VB5A 1BBRK 4F49A 2RG3A 1WCZA 1V2UT 2J2UA 1K1JA 1VGCC 2R3YA 3KQBA 2BLOA 1SLVB 3WW7A 5EXNA 4MTBA 3UB0A 2B9LA 4K8YA 1GL1A 2GTBA 3BEFB 2VB0A 2J4IA 1DSUA 4BAMB 1GJBB 2BLWA 3B8JA 2VIVA 3GY7A 1MD8A 4CR5A 3TPIZ 2B5TB 1GI5A 5GPIB 1SGNE 4ZH8A 3ATLA 1O31A 1EOJA 1GBBA 4FUCA 1SGFA 5HKKD 1NESE 1F0UA 1HAGE 1P2KA 3NKKA 2GD4B 1IQIA 5A2MH 3SNBA 2OK5A 4Q63A 2WZQA 4FOUC 3LKWA 2FX4A 3B9FH 3GDUA 1K1LA 4DG4A 1YKTA 2JETB 1DLKB 1XM1A 1CVWH 1S0QA 1C1PA 1AKSB 1LQDB 4ZKNU 1FLEE 3AK5A 2H9TH 3FZDA 1GBDA 3DSPA 3T2NA 2R0KA
chains in the Genus database with same CATH topology
1TBZH 3SGBE 1QL7A 2ZU2A 4MNYA 4INKA 1P04A 1SVPA 2V0BA 3QTVH 4DOQA 1AFQB 2CHAB 1C2EA 1ZMJA 3RXGA 3MNSA 4AGKA 1NRRH 1RS0A 1TLDA 1UTNA 2NU3E 8ESTE 1SGTA 3SU4A 5LPFA 1TALA 2PV9B 3SOSA 1HBTH 3TK5A 1UMAH 5EODA 1NO9H 4CRFA 1GMCG 2P94A 2V35A 4NWLA 5T6GA 4Y10E 4CBNA 2CF9H 1P9UA 3PO1B 2ZZUH 1QB1A 3T29A 3S0NA 2PLXA 1AMHA 3ENSB 2VWLA 2VNTA 2PTNA 3QX5H 3RXIA 1DXWA 2EI8A 1A3BH 7ESTE 2YNAA 3A7VA 4OGXA 1O35A 3U8TH 3RXLA 1OWKA 4OS6A 1DX5M 2J92A 3QGJA 4MPWA 1QJ1B 1G9IE 1KY9A 3D49H 4NFEA 4X1NU 1RTFB 1DITH 1VZQH 3CS7A 1IHTH 4NWKA 2UUJB 3ATKA 5C1UA 2OXSA 1OOKB 1PQ7A 1HYLA 4D8NA 1YPKH 2FX6A 4NZLA 3RXHA 3MU1A 4UD9H 5GCHG 3K65B 1AVXA 2GKVE 1TIOA 1IQNA 1GMCF 4NIXA 1HAXB 1UTQA 3KGPA 4JMYA 1C1RA 1ARBA 1ZPCA 1LVOA 3W95A 2FI3E 1MMJN 1SMFE 3UNRA 1AUJA 1DWBH 1MH0A 1W3CA 2WUCA 1P0SH 4ISIH 3I77A 3SJIA 2FOFA 1TNLA 4K1EA 1EJAA 1TABE 3A80A 2J34A 1KLJH 1G3DA 1Y59T 3UR6A 3ZVFA 1AVGH 4KKDA 1OYTH 2FOAA 4GCHG 2ZTYA 1EPTA 4AGJA 5A09A 1BUIA 2OLGA 2Z9IA 3E3TA 1ELCA 4DVAU 1O34A 1S5SA 1A5HA 4FU7A 3M7TA 1P2QA 3LC3A 1C1MA 1IQEA 3F9HA 1T4VH 3BTKE 4XSKU 1LMWB 1MBMA 3KEEA 1MKWH 4U01A 1NPMA 2O8LA 4WWYA 3K6ZA 3MO6A 1OWJA 2FS9A 2GCTC 1A46H 1EB1H 4KELA 3RXEA 3OTJE 1X7AC 2ZFTA 2Z94A 1DS2E 1AE5A 1LCYA 2G5VA 4IC5A 1A7SA 1KTTB 1BRUP 3SO3A 3IITA 1SGQE 3UWIA 1VGCB 3OU0A 4X6PA 1QRXA 3I29A 1NU7B 1T4UH 4K2YA 1MZAA 2QGRA 2BVRH 3A81A 5B6OA 3F9EA 1OP8A 3JZ2B 1P06A 4I8JA 5E0GA 4ZUHA 2FPZA 1GHAG 3F9GA 4JK5A 2SFAA 3GCTG 1G32B 4I8KA 4JZEH 1V2MT 1EAXA 4DCDA 1XMNB 1KLTA 5A0AE 1SLWB 3GY6A 5C5OA 2PW8H 2FOCA 2QYIA 1Q2WA 1YYY1 4ASHA 3A8BA 1TGBA 3TITA 1DVAH 1UTLM 1V3XA 3LGYA 1O3JA 3D65E 1OX1A 5EPYA 2AERH 1UVSH 2OCVB 3K6YA 2GV6A 1TPSA 3I78A 1Y5AT 2AIPA 4YLUA 5FAHA 3GYMA 1K1MA 5F8XA 4JK6A 1ZHRA 2VJ1A 4XE4A 2AEIH 1C2JA 2ZFFH 3KN2A 1GI0A 1NFWA 2BXUH 1KXEA 1WTGH 4DIHH 3HKJB 1K28D 3H5CB 3M5LA 1FY1A 1ANCA 2M5TA 4ZKRU 1GJ9B 3DUXH 3GCTF 3U8RH 1SGYE 1TRNA 3KNXA 1GJ7B 4I8HA 2WPLS 2FXRA 1ACBE 2KAIA 3C27B 3MNCA 4ISOA 3M35A 3SW2B 1WAYB 4X2XA 4NCYA 1AY6H 1DLEA 2F83A 1GHBG 2Z3EA 3NXPA 2J38A 1INCA 1GJCB 1RTKA 1SHHB 3EYDA 2G00A 4TPIZ 1DPOA 5HXFA 3NK8A 1NRNH 1G3BA 2FM2A 2VH6A 3SU0A 1C5XB 1C5UA 2BD8A 5FCKA 2FI5E 1BTXA 4E05H 1K1IA 2QN5T 1E34B 1O3MA 1GCDA 3UUZA 1C2FA 3RC5A 1RFNA 4CRGA 3FAOA 1KDQA 2F9OA 1Q31A 4BTIB 1QCPA 2QIQA 2BD2A 2YOLA 3GCNA 1DY8A 2QXIA 1TRMA 2W5EA 1NFYA 1V2KT 3UOUA 1BTYA 5LGOA 2C93B 1P05A 3ZYDA 3S7HB 1XVOA 2PKAA 1L4ZA 1GHBF 1G37A 5PTPA 5L2ZH 1UVUH 9ESTA 4YT7H 3UWJH 5HM9A 2G81E 2CV3A 4CBOA 1EZUC 2G5NA 1C2DA 4B1TA 6ESTA 5DO4H 5JPMH 2Q6FA 2TPIZ 2FOEA 2SGAA 3JZ1B 3NCLA 3V3MA 4AFZA 2Y5FA 2FO9A 2A7CA 2CF8H 4MQAA 6CHAC 1S6FA 2ANYA 3BEIB 2CGAA 1EUFA 1NFXA 5SGAE 1C1VH 1GI6A 2AGEX 2XWAA 1C5QA 2G8TA 1ESTA 2H2ZA 4IS5A 4Y76A 2DUCA 1H4WA 2ZWLH 4Y7BA 1CHOG 3L3TA 1Q3XA 4FUIA 1C1OA 3MU5A 3UR9A 3ZVAA 1SC8U 1ZHPA 3F68H 8GCHF 3A84A 2VIWA 2ZU5A 1H9IE 3P8FA 2GCTB 3KQDA 2Z9JA 2VIDA 1H9HE 2D1JA 5A8ZA 3PLPA 1C5RA 2NU1E 1JWTA 5JB9S 4WXVA 1HV7A 3A7TA 2PKSC 3S69A 3M37A 1K21H 4YOGA 4FVDA 4X1QU 5BRRE 2VH0A 1S81A 1GHWH 1C1SA 2QY0B 1DDJA 4RSPA 4BXSA 1ABIH 2BDCA 4BNRA 1MZDA 1VCWA 1BOQA 1HIAB 4O3TA 1P09A 1GBKA 5JBAS 3RLYH 1QB6A 3U69H 2JH5D 1CA0C 3FANA 1C2IA 3AAUA 4UDWH 3VXFH 3QWCH 1T8OA 2STAE 4A1XA 1HJ8A 3SJOA 3SGAE 1O2LA 1O2QA 4ZHLU 1O3HA 4HGCA 1ELBA 1V2TT 3L33A 3O8DA 3FVFB 3GY3A 3R3GB 1FIZA 2BYAX 1LHFH 4X8UH 4AORA 5JB8S 3HATH 2K1QA 2F9VA 4U2WA 1Z7KA 3A8AA 2OC0A 3U8OH 3HKIB 2XCFA 2Q6DA 3TH4H 1YCPM 2XWBI 1O5GH 1C2KA 2ZGHA 1BITA 2AMDA 1HB0B 2EA3A 5LPEA 1BDAA 2WPKS 4MLFB 2A45B 4ISLA 4MNWA 2FYQA 2CJIA 4XDEA 3BN9A 1SQOA 1AUTC 1KYNA 5GDSH 3SUFA 4O3UA 3D62A 2BQ6B 3ZZ5A 1V2OT 4AN7A 2TGAA 1O2SA 1KDQB 3O8BA 2XYAA 1MKXH 1IQFA 1JIMA 1DICA 1HNEE 1TNKA 4X1PU 9LPRA 2G4TA 3RXFA 2QA9E 2ZU4A 4AG1A 3BTEE 1L2EA 4Y7AA 5BPEA 3SN8A 1BMMH 3A8DA 1K1OA 1Z8GA 3BSQA 2J94A 1ZRBA 5DGJA 1ETRH 3BTME 1BRCE 5GJ4B 2AGGX 1GDQA 1S6HA 1DUAA 3HGNA 3GY4A 1WU1A 3QN7A 1A0JA 2BM2A 1MBQA 2HWLB 1V2LT 4X1RU 3SU1A 3LU9B 4CREA 1VJ9U 4MVNA 5EQSA 3ZVBA 3H7OA 1GMDG 2J9NA 3BTHE 1CGJE 4BXWA 2C8WB 2ZCHP 1ZGIA 1BZXE 1O2OA 4WF8A 5C2ZA 3UNQA 1O0DH 2OBOA 5G4BA 2TBSA 4ISHH 4YO9A 4INLA 1O2MA 1P3CA 4XOJA 1P8VC 1E38B 1NT1A 2DE9A 3BTGE 1O5CB 2JH0D 1EZSC 2DE8A 2Y82A 2WUBA 3RUOA 5HYOA 5EW1H 3F1SB 4VGCC 3EQ0H 1TB6H 1GI7B 2OTVA 2ODYB 1SGRE 1O3CA 3NPSA 1TBRH 2BOKA 2FI4E 1HAHH 1OKXA 2OC8A 1U6QA 2NU0E 4TWYA 1BTZA 1JXPA 1AN1E 3SNDA 4ABBA 3C1KA 1JRTA 1QBNA 1RTLA 1TRYA 3A7ZA 2OC1A 5DP3A 4ABGA 1RD3B 2GT7A 1O38A 2BZAA 2GZ9A 3ZZ6A 5E2OA 3BTFE 3TK6A 2HNTE 1UCYE 1KSNA 2CXVA 1A4WH 1FY4A 1Y5BT 3QO6A 4NIYA 3SQHE 2PKSB 5A8XA 1FAXA 3T28A 4DW2U 1CT0E 4AYVB 4JZIA 3BG8A 3RXVA 4D76A 5LPRA 1HPGA 1KXFA 3O8CA 1SI5H 2CN0H 3NUMA 1E36B 1YBWA 4FUBA 4IW4E 1CA0B 2P95A 3QZRA 2VWOA 1A1RA 1OWHA 4NSVA 1C5NH 1LKBA 1KXBA 4I7YH 2ZPRA 2Y7XA 4MDSA 2A5KA 1AVWA 1O2XA 1HAPH 2BDYA 2F9NA 2ANKH 1HJ9A 2F9PA 4Z6AH 1HXFH 1GG6C 2XC4A 3ATMA 5L6NH 4DT7B 1UTKA 3EE0B 1T8MA 1OP2A 1XUIA 3W94A 4IMQA 1EP6A 5EGMA 1T8LA 7LPRA 5J4SA 1O3LA 2BDBA 3BG4C 3P8OA 4UONA 1QR3E 4ZHMU 4K1TA 4M7GA 3ZZ3A 1UVPA 2PGBB 3PWCA 5AVDA 2P16A 3AVZA 1JIRA 1BMLA 2PUXB 1KIGH 2XXLA 3UFAA 1CO7E 2VGCC 3A7WA 3VFEA 3PYHA 3LH3A 1QURH 4Z0KA 1FN8A 1Z8RA 1MKXK 4JZ1A 1C5ZB 4X8SH 1F5LA 2WPIS 1GMHG 1Y5UT 1CE5A 1IQJA 3EA7A 1HFDA 3SBKA 2ZGXH 2Y7ZA 2ZP0H 1MTUA 3KL6A 1IQMA 3EAJA 3ZZ4A 2B7DH 5CHAC 1V2QT 2GGVB 4GHTA 2WPMS 4TPYA 1ELGA 5C1XA 2ZU3A 1MQ6A 3BTWE 4KP0A 3M7QA 3TU7H 4GSOA 4WJG2 4K69A 3QK1A 2SNWA 2P3FH 1DWEH 2BX4A 1M9UA 5EQQA 1GI1A 3O8RA 1LHDH 3KQCA 1FUJA 3BIVH 1O2IA 1GJAB 2FIRH 1AFEH 4CH8B 1Z8IB 2ZO3H 2BOHB 4AFQA 1BRBE 2TRMA 4ABDA 4Q7YA 3ZVCA 3QGNB 5H4IB 1G36A 1MAYA 1S83A 1EXFA 2AYWA 3BIUH 4ISNA 1FDPA 1AQ7A 3SI3H 1TGNA 4RKJB 1W7XH 3HK6B 5HM2A 1PPEE 1QL9A 2ZHFH 3TH2H 1A5IA 3ZYEA 1GBCA 4IMZA 3RU4T 5CMXH 4BAKB 5J4QA 1GBMA 1C1TA 4K3JA 4ZHAA 3MNBA 3U9AH 1PFXC 5JBCS 1ZTLA 2BY6X 1V2ST 3BTQE 3PMBB 4NZQA 1UCYH 1ZTKA 2A4GA 2ZIQH 4VGCB 4R0IA 3EDXB 5GCHF 1FY5A 4IN2A 3RP2A 2BHGA 1K1PA 4FUFA 1CGIE 1CSOE 3SU3A 1ZOMA 3TH3H 2VVVA 1YLDA 4KTCA 3RC4A 1F5RA 3SU5A 3SNCA 4I32A 2ODPA 3LGVA 2A2QH 5T6DA 4WH8A 2SGPE 4JYUH 4A7IB 1C2GA 1EJNA 4OS1A 2Y81A 2ZQ1A 3TNSA 3RU4D 1UK2A 4JZFH 3E0NB 3T26A 1NS3A 1EB2A 4ABEA 2C8YB 1GHXH 1GI8B 4NA8A 1BJUA 1UVOA 1T32A 5F8ZA 5C20A 1IQKA 1AZ8A 1AI8H 1YPEH 2IOTA 4GCHF 3EA9A 2Z3DA 1TNIA 4NGAH 1PPGE 2W26A 4CRCA 5A0CA 2FOBA 1OWDA 1N8OC 2BTCE 3A89A 2A32A 1QJ7B 4FU8A 1YPJH 3B23B 5I46H 1C5PA 1O3PB 3ESTA 2ZA5A 3MNXA 3A7YA 1V2NT 3RXTA 1WYKA 4I33A 2ZHEH 3OY5U 2Z9KA 1GBTA 1V6DA 1O2GH 3SI4H 1GBEA 3SV8A 1T8NA 5JBTA 2BDIA 3A86A 5DP4A 1ANDA 1SGDE 4B2BA 2SGFE 4OS4A 1MU8B 2GZ7A 1V2VT 4DY7B 3Q3XA 3ZZCA 3AW0A 1GG6B 1HJAC 2GZ8A 4YM9A 3CENA 5K0HA 1GVKB 4SGBE 4X0WU 2V6NA 1VCPA 3RXUA 2WYJA 1V2JT 2H5DA 2ZCLP 1GI3A 1HIAA 3KCGH 3RLWH 3BG4B 1O5DH 5EW2H 4X6NA 2AFQB 1L1GA 1LVBA 1BBRE 1TQ0B 3FFGA 3ZVEA 1OWEA 1YCPH 1JOUB 1HAZB 1XKBC 1O33A 1C5MD 1O2UA 2THFB 1GHAF 2VGCB 2SNVA 3G01A 1KTSB 5FCRA 3UY9A 4IC6A 1S82A 3GY8A 2BB4A 2BD7A 1HDTH 3MU8A 1EAWA 1HGTH 2O8WA 2RCEA 2GVFA 1NROH 4CRBA 1PYTC 3M7UA 3MMGA 5JDUB 1E0FD 1EX3A 1A3EH 1DUEA 1E35B 3QTOH 4U32A 2H9EH 1C1NA 3ATIA 1LQEA 2SGEE 4B2CA 1ZPZA 4AFUA 1GJ6A 2Y5GA 2G4UA 2ZCKP 1J17T 1NRSH 3ODDA 1VITG 5FXLA 5T3HA 5CHAB 1B7XB 2ZDNA 1BRAA 1UVTH 2GCHG 1ZLRA 1D9IA 2ZGBH 1HCGA 1MCTA 4H42U 1GGDC 3RMMH 3WY8A 1ZSJA 4CH2B 1LDTT 1GVZA 1MCVA 1TMTH 3P70B 2FOHA 5DG6A 1CT2E 2FOGA 2ZDLA 3MTYA 1VITH 2FMJA 3TGKE 1UHBB 2ZFQH 4B2AA 4A92A 3MO9A 2VIQA 1C5OH 4Q7ZA 4E7NA 1QGFA 1FV9A 2FODA 4HZHA 1C1WH 2Q1JA 1YLCA 1XX9A 2QF3A 1SFQB 3PV4A 1GHYH 4ZMAH 1TGTA 2NU4E 3OSYA 1NC6A 3DT0H 4NG9H 1AIXH 2JKHA 3TNTA 1BB0B 3PMHB 1GWAA 3UQOA 2HPQH 5FBEA 1GDNA 1O2ZA 1O2RA 1TOCB 1UJ1A 1TNGA 4ESTE 4XBDA 1FPCH 3Q77A 3M61U 1ARCA 3LGTA 1SSXA 2ZTZA 1WTHD 3ZZ9A 3GISB 3ODFA 3S9AA 1YPHE 4O97A 1AB9C 1MKWK 2R2WU 1P57B 1BQYA 2OUAA 1ZPBA 3RXBA 2I6SA 5AHGH 2A4QA 1NM6A 3DA9B 4MG3A 2YNBA 1C2HA 3M36A 4MPVA 3D23A 3K9XB 3VEQB 4A1TA 2P8OC 3VB3A 2HALA 1F92A 1TBQH