3F2FA

Crystal structure of the mercury-bound form of merb, the organomercurial lyase involved in a bacterial mercury resistance system
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
208
structure length
208
Chain Sequence
b'MKLAPYILELLTSVNRTNGTADLLVPLLRELAKGRPVSRTTLAGILDWPAERVAAVLEQATSTEYDKDGNIIGYGLTLRETSYVFEIDDRRLYAWCALDTLIFPALIGRTARVSSHCAATGAPVSLTVSPSEIQAVEPAGMAVSLVLPQEAADVRQSFCCHVHFFASVPTAEDWASKHQGLEGLAIVSVHEAFGLGQEFNRHLLQTMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alkylmercury lyase
publication title Crystal Structures of the Organomercurial Lyase MerB in Its Free and Mercury-bound Forms: INSIGHTS INTO THE MECHANISM OF METHYLMERCURY DEGRADATION
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 61
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 4.99.1.2: Alkylmercury lyase.
pdb deposition date 2008-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03243 MerB Alkylmercury lyase
A PF12324 HTH_15 Helix-turn-helix domain of alkylmercury lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.490 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3f2fA00
3F2GA 3F0PA 3F2HA 5C0UA 5C17A 5C0TA 3FN8A 3F2FA 3F0OA 5DSFA
chains in the Genus database with same CATH superfamily
2AGIX 1ZRKA 1GBFA 2WPLS 1ESTA 1PPCE 3W94A 1FIZA 2YMSB 1O2RA 2ZU5A 3TITA 3F3BA 1AFQB 1ARBA 3L3TA 1C2KA 1HJ8A 1C2FA 4XBBA 1ELBA 1TPSA 1AMHA 2QC2A 4ZUHA 5E2OA 3LU9B 1SQTA 3SI3H 1DWEH 5GXPA 1V6DA 2C8XB 2G4TA 4CRFA 2QGRA 1Y3WA 2VIPA 1ZTJA 3K6ZA 1UK2A 3GY7A 1ZR0A 4I8HA 2XTTB 1HCGA 2STAE 5E2PA 3PWBA 6ESTA 3M7QA 4UFGH 2BB4A 3CENA 3N99A 4DG4A 4ABJA 1TPOA 1U6QA 1AZ8A 4I86A 3RUOA 3T2NA 4GHTA 3TLOA 5KEDA 2SNWA 4LZ1H 3A86A 5EW2H 1GJ6A 1A4WH 2F43B 4GSOA 2BQ6B 2GV7A 3SV7A 3SU4A 1XUKA 2A1DB 3CS7A 1GHYH 5T6DA 2ANKH 1FY5A 1UTKA 7GCHF 1H4WA 5AF9H 2FZZA 3P92A 1LHEH 2A2QH 4MQAA 1GL1A 3RXJA 1Y3YA 5C5OA 1GDQA 1GBTA 1KXEA 1PPZA 2XNDD 2BY6X 2R3YA 3UNQA 2K0QA 1GHAG 3F2GA 1O2HA 2XC4A 2OQUA 4O9VA 1O3PB 2OLGA 3ZVCA 3H5CB 2ZPQA 4TPIZ 1ESAA 3SN8A 3BEFB 3RLWH 1PFXC 5EOKA 1K1PA 2VGCB 1GHZA 2ZFPH 1CE5A 1FXYA 4B6EA 2LNCA 2CHAC 1RGQA 4VGCC 3SNCA 5GPIB 4E06H 2H9TH 2Z3EA 3GDUA 5F8XA 1UVOA 1D4PB 2O8TA 5F8ZA 2TPIZ 3SU6A 4CH8B 5FCKA 3GCNA 3ATLA 2ODQA 1PPFE 4Y6DA 1OWEA 3E16B 3TNSA 1C1RA 4WXVA 1N6XA 6LPRA 2BOHB 1DY8A 2C8WB 2C90B 1PJPA 4E7RG 2A5AA 3ELAH 3U98H 1F0SA 4I33A 2BVRH 1CU1A 2O8MA 3FP7E 1C5UA 2A4OA 2FOHA 1SR5C 4X1NU 1YPHE 1BTPA 2ZFTA 1TPPA 1RD3B 1UJ1A 1E79D 2G00A 2HRVA 3LGWA 1QBVH 3O8CA 1MKXK 3KCGH 3TJNA 4D76A 3OE7D 2ZC9H 1QL8A 2O8LA 2J97A 2VNTA 3MNBA 1XUJA 4KGAA 5I25A 3SU5A 1LTOA 1FY1A 3BEUA 1GBLA 4LOYH 1O5FH 1MCTA 3KL6A 1QZ8A 2H5CA 3A7TA 1O2ZA 1G2LA 4THNH 4A92A 4YXWD 5T3HA 3C27B 2F4LA 2OQ5A 2YMSC 1UO6A 3A80A 2QE7D 2ZHQH 1AFQC 4B75A 1QTFA 3PROA 3OTPA 4SGAE 3V13A 1HAYB 5DJ7A 1TX6A 1MTWA 4WXIA 1O35A 2FM2A 1IQFA 3MYWA 3RM2H 1LHGH 2ZHDA 5JB8S 2D8WA 3S7HB 1C2LA 3LH1A 3SZEA 2XWAA 4DCDA 1A3BH 1LQEA 1GMCG 3QWCH 4DIHH 2Y7ZA 1AY6H 1DX5M 2BLOA 9ESTA 2ZDNA 1O5CB 4Y10E 3A7WA 3RMLH 4O97A 1SLWB 1ZTKA 3MNCA 3P8OA 1BRBE 1LVYA 1S5SA 2ZTYA 1L1GA 2B0FA 3F9FA 5C17A 1WTGH 3P8GA 2NU3E 2ZFSA 3RP2A 1YBWA 5AHGH 2XC5A 4JZDH 1C5SA 3VB4A 4FUCA 1AGJA 3WY8A 2KAIA 1AE8H 1QY6A 1LMWB 4PROA 2OD3B 4XE4A 1UCYH 1SB1H 2P3TB 3A7XA 3SUDA 5A0CA 4ZHAA 1ELFA 1O2JA 1DWBH 1KXAA 1O3KA 2GVFA 1CQQA 4H6TA 3BF6H 1HDTH 4OS7A 2AEIH 2UUFB 1N6YA 1F5LA 5HMAA 1O33A 3GICB 4YOIA 3KN2A 2JH0D 8LPRA 1D3TB 3LC3A 2C93B 3M61U 1FMGA 5SGAE 1EAIA 4F4OC 1DLKB 2WYJA 1TMTH 2Y5FA 5EPYA 3URDA 1W13U 1C1OA 1HBTH 5EXLA 4GCHF 3MTYA 1SGYE 2VGCC 3PTBA 1RTLA 2HOBA 5JBTA 2KAIB 4O3UA 3GY4A 1BMLA 1SGEE 2BD4A 1RS0A 1CT2E 3PMBB 1GBDA 1RRKA 3B9FH 4ACAA 3S9AA 1L0ZA 3RXLA 2CXVA 1BJUA 1EKBB 5GIBA 3LJJA 1W3CA 2P8OB 2AFQB 3MO3A 3A87A 1BBRK 1P05A 1HAXB 1K1OA 1Q31A 3PRDA 3MI4A 1BTYA 4AORA 3LKWA 2GD4B 2FOGA 1TX7A 4TSFD 3LGIA 3STIA 1JBUH 1XVMA 1T8OA 2G8TA 2Z9GA 4BAKB 3SI4H 3PLPA 5F03A 2J34A 2Q1JA 3UQVA 3TPIZ 1D3DB 3UQOA 3U1JB 4Q7YA 1T7CA 4AFSA 3RXSA 2KFWA 1W0YH 3BTKE 5HM9A 1BMFD 1LVOA 2ZU1A 2W7SA 1VITH 1LPGB 1QURH 2WUBA 2I6SA 1ELTA 3IITA 3GYMA 1UCYE 3DHKH 1XUHA 5HYOA 5EGMA 1GI7B 3F0OA 1EXFA 1O3GA 2BDIA 4WJG2 2M2AA 1G3EA 2OXSA 2ZHFH 4ZCNA 1UMAH 1DITH 2A5KA 1HUTH 1WTHD 4CHAC 2PLXA 4Z1MD 4JK5A 3FAOA 1P2QA 9LPRA 3SW2B 2H1UA 4K1TA 1K1NA 2GDDA 3CS0A 1ZGIA 1THSH 2GTBA 2QXJA 4IMZA 1V2WT 1CT0E 1V3XA 1EOJA 2UUJB 1SGRE 2AH4X 3FANA 1KMHB 1K1IA 5CE1A 2J2UA 2Z6BD 3L33A 1W7GH 2BQWB 3EA8A 1VZQH 2CGAA 3RXDA 3VPKA 1NRPH 2YMSD 4RKOB 5DP8A 4OS4A 4XBDA 1RXPA 2XC0A 5E0JA 3RXQA 3UWJH 1MTSA 4P00A 5JB9S 2OBQA 1EJMA 3E90B 1XX9A 3GY3A 3KYGA 2F9PA 2R3UA 3IWMA 1ABIH 1TOCB 4B76A 4NIYA 1UK3A 3L6PA 1DICA 3OEED 2FLBH 2QN5T 3KQCA 6GCHF 1OS8A 2GCHG 5C3NA 5DP4A 1FY8E 3PV2A 3SV6A 1TA6A 2VIDA 1Z8GA 5I46H 3OAAD 1G2MA 1MTNC 1IQIA 2EI8A 5B6OA 2QXHA 5GWZA 3NPSA 1SGDE 1UK4A 5GNDA 1BMAA 2WPJS 3RXOA 1H9IE 4UEHH 4WH8A 3LJOA 1QA0A 2Q6FA 1SFQB 2ZFFH 3ZVGA 3F2FA 1UVPA 4CR5A 4Y7AA 1C2GA 4TY7A 1N1LA 1S83A 5E8EH 1ELGA 3QO6A 1NROH 2J94A 3SUEA 3BV9B 2ZECA 4MNXA 1F0TA 3AW1A 2A31A 3ATIA 3QN7A 4CREA 1D6RA 1Y3UA 1CT4E 3ZV9A 1DLEA 4UD9H 1AE5A 5C0UA 2ZHWH 4MPUA 2P8OC 1YLCA 3M3VA 4X1SU 2ANYA 4X2VA 4YT7H 3EE7A 2WPDD 2H9EH 1V2KT 3HGNA 1T4UH 1TE0A 1B7XB 1DSUA 1TMBH 1F7ZA 1P3EA 4IGDA 4O03A 1GHWH 2PSXA 1P11E 1KYNA 3M36A 1JIRA 1SGIB 5FPSA 4FUGA 4U01A 3ESTA 4IW4E 1C5QA 3QTOH 2ANWA 1NC6A 5EJ1A 4GUXA 2NWNA 1H8IH 1Z1JA 3RMMH 1XXFA 4TWWA 2FS8A 3F68H 3SU3A 1LKAA 3F1SB 4CRDA 1BDAA 1SGCA 3TK5A 3MWIU 1DWDH 3I77A 4NSVA 4ABEA 5FX5A 3Q3XA 1UW7A 1IQKA 1BZXE 1J16A 2JETB 1YP9A 3DFJA 1NRSH 4DW2U 4XSKU 1AHTH 1C1WH 3STJA 2QCYA 1T32A 3TJVA 3N7OA 1XUIA 1TMUH 2FO9A 1GJAB 1X7AC 1TRYA 3TH3H 4Y8XA 1TB6H 1FQ3A 2BLVA 2ZHEH 1G36A 2VBCA 1O5DH 1GHAF 5A8ZA 1C2DA 3GY2A 4NIVA 1THPB 1BMMH 4XBCA 2WV5A 3SORA 1NM6A 2Y5HA 2PHBA 1FLEE 1MCVA 4AFQA 1LCYA 3GCOA 4IC5A 3NK8A 1Y59T 4H4FA 1PPBH 2AGGX 2W6ID 3FVFB 4Q80A 1TABE 3BTFE 1VJAU 1FPHH 1CGHA 1DM4B 2GDEH 5C94A 1O2WA 5F8TA 3RMOH 4JZFH 2IPQX 1HAZB 2D1JA 1DDJA 1EFRD 4X2XA 4ABAA 1ELEE 3A7VA 4ISOA 3W95A 2VIOA 4U30A 1TNLA 2ZPRA 3LGTA 4XD7D 3BTHE 1FUJA 1FNIA 4YO9A 2BD3A 3T25A 1ZSJA 5L6NH 4WF8A 1SOZA 5HXFA 1CA0C 3V0XA 1G3DA 5C1UA 1BTUA 3UUZA 1O36A 2FDAA 1O3JA 1A2CH 4NZLA 1O5EH 4UONA 1O5AB 2ZDKA 1QRZA 3Q3KA 5IK2D 1A0JA 1TOMH 1Z6JH 3PO1B 1FY4A 3ZVBA 1WDIA 7KMEH 3M37A 3V12A 1QRXA 2HLDD 3GDVA 2Z9JA 3RXBA 1ZPZA 4ABGA 3NKKA 1RTKA 1O2XA 1K1MA 5L2ZH 1AVWA 4MNWA 1EATA 1VCPA 1NESE 3ZIAD 2PGQB 2AYWA 1B0EA 1Z1IA 2CF8H 3TVJB 1C5NH 2RA3A 2ZGBH 5EW1H 2SGQE 1O2IA 6GCHG 1GG6B 1QFKH 2FODA 3F9EA 3MH7A 1CO7E 3D62A 2BD5A 4TT3D 4H42U 3CNRA 3Q76A 1CBWB 1GJ4H 2QF3A 1EZQA 2HPPH 1S85A 1YPLH 5A0AE 2PUXB 1GMCF 2VU8E 2HNTC 1O2QA 4X6OA 2UWPA 1BHXB 1HXEH 3BG8A 1MU6B 1GBMA 1W10U 4YESB 1SPJA 1HJAC 3EQ0H 2AIPA 1H9LB 1QJ6B 2Z94A 3ZVDA 1OYQA 1D3QB 1AFEH 2VB0A 3OSYA 4ASHA 1W0JD 1FJSA 1H8HD 2GZ8A 1MABB 2JETC 2WSSD 2VWMA 2BDBA 1HAPH 3T26A 4X6MA 1ZMJA 3OTJE 2BD2A 3LGYA 2F3CE 1NFUA 3VB6A 3SGBE 3EAJA 1ZJKA 1BTZA 2IN2A 1J17T 4F49A 1QB1A 8ESTE 2OINA 2HVYB 5TJXA 3KQBA 4ACBA 1Z7KA 1K21H 1AB9B 2G4UA 3NRLA 1WBGB 1YF4A 2R2MB 1QL9A 1E0FD 2SGPE 3DCLA 1NT1A 1V2QT 1XKAC 2BD9A 2GJGA 2HGTH 3RXPA 3U8RH 3A85A 4M9FA 4JYUH 2BDAA 1C5ZB 2GV6A 1DUEA 2A32A 1QJ1B 2AMPA 3QUMP 3ZVFA 1GI1A 1HIAA 2HNTE 4UFEH 3M5MA 2XBVA 5HKKD 1QR3E 1OHHD 3GY6A 1GBHA 2AMQA 1SGFG 4I8KA 1AUJA 3LT3A 3RXEA 2A2XH 2O8WA 1MKWK 3AAUA 2PV9B 3M3SA 4ABDA 3TH2H 1YWUA 4KP0A 4UDWH 3ZZCA 3DSOA 3BTWE 1MKXH 4AOQA 1DE7H 2P95A 5DGJA 1TGNA 1O31A 3K9XB 1IHSH 2OC7A 1KXCA 2BX3A 1GMHG 1C1PA 2GCTB 2AMDA 2XNIA 1C5XB 4Y79A 1OYTH 4BTUB 3PO1C 5FX6A 1HIAB 1GHXH 4KTUA 1J14A 1WOFA 2ZI2H 1AZZA 1QBOA 1GDNA 1YCPM 2HALA 5FBEA 1A0HB 1T4VH 3SGQE 1TIOA 1EPTC 1UTPA 3RXCA 1KLTA 1QB6A 3W1EA 4AGJA 4MG3A 3H7TA 2BTCE 4MDSA 5GCHG 2IOTA 3QDZB 3HGPA 4ZAEA 1O2NA 2CJIA 2PKSB 3T29A 2GZ9A 4FU8A 2BDGA 1K1LA 5LPRA 1OKXA 2EA3A 4M7GA 2W3KA 3KGPA 2WPHS 4I8GA 4MVNA 1GG6C 4K69A 3E3TA 1WYKA 1W0KD 5DG6A 5EJZA 1L2EA 1CHOG 2QF5A 1Y8TA 3F9HA 1GL0E 1SLUB 1CBWC 4YTAA 1W7XH 4ZH8A 1ESBA 2XXLA 1O3NA 5HIZA 3TJUA 3QLPH 3UAIC 4DT4A 2HLCA 1AWHB 2UUYA 1EAXA 4OS6A 3UIRA 1C5MD 1ANDA 2ZFRH 1GCTB 4YT6H 4X6PA 4AG2A 4CRBA 5C2ZA 1WSSH 3FOAA 4ZMAH 2EY4C 3IG6B 3T27A 3TIUA 4Z0KA 1E1RD 3MO9A 1MTUA 5F6MA 1KLIH 1TLDA 2ZQ1A 3UOUA 1K9OE 1PPGE 1KDQA 2ZP0H 2GCHF 3A81A 3SNDA 2WV4A 3BTGE 4AGKA 3VB7A 1Y3XA 1UTJA 5C67A 4KELA 1PQAA 3M7UA 1O2KA 1P2JA 2QF4A 3O8BA 1ETRH 1FV9A 1O0DH 2XRCA 2C3SA 5A09A 1AB9C 1AVGH 2FOMB 3E6PH 1PYTC 1P2NA 3N7EA 1HGTH 1J8AA 3WWFA 2D26C 2V0BA 3MHWU 2THFB 3D23A 3UY9A 5FBIA 3H09A 4NSYA 1HXFH 4FU9A 1DUAA 1ZSLA 1BBRH 1QGFA 3RXAA 4BOHA 2FPZA 1J9CH 1F0RA 1O2OA 2BD7A 1KDQB 3RMNH 1S82A 3KF2A 3VGCB 4ISNA 3ZZ9A 4ABFA 3PRBA 3OX7U 1C2MA 2WPIS 1ABJH 4HTCH 1P09A 2ZCKP 3O8RA 2BHGA 2B8OH 3U69H 1O34A 2PFEA 4J2YB 5G4BA 3TU7H 2C8ZB 2YOLA 3NCLA 1C1UH 1GBEA 1P2KA 1SC8U 3WW7A 3PLBA 1K0HA 2GCTC 4D9QA 4INKA 5FPTA 1ZJDA 4B2CA 1EP6A 2FOCA 1SBWA 1FI8A 3UNSA 1S6LA 1NRNH 1VCWA 3HPTB 3T28A 4CBOA 1DSTA 3F2HA 3S69A 1QIXB 4KTSA 4X8UH 3EYDA 2PWXA 3PWCA 3RXTA 2Z3DA 3A82A 3UREA 3NWUA 2BXTH 2KM0A 1SQAA 2GMTB 3C1KA 4FXGH 1IQJA 4KKDA 2RG3A 2XW9A 2LP6A 2B5TB 2QXIA 3RC4A 3AAVA 2TGDA 1C5OH 2Z9LA 2G51A 4NIXA 1XUFA 1BBRE 3S9BA 4ZHLU 2KX4A 1O3LA 2F9NA 1W11U 1O3HA 1UTLM 2Y7XA 4MNYA 1VITG 1GI4A 3NUMA 1THRH 2FYQA 3UTUH 3DA9B 4FUEA 3SU1A 5DP6A 4BAHB 4FUHA 3Q77A 1YKTA 8KME2 3SHCH 1UTQA 1O3DA 1P02A 1TWXB 1GCTC 4ABIA 1UVUH 6CHAB 3FP8E 1GI0A 1JRSA 1BRCE 2KCAA 2TGPZ 3UWIA 3ATWA 4YOGA 1ZHPA 1Y5BT 5EPNA 1YM0A 3VEQB 1GI9B 4X8VH 1GHVH 1XVOA 1EZXC 3UR9A 4NFFA 1EB1H 1Z8JB 1P0SH 2FTLE 2G52A 1SOTA 1TNIA 3MU8A 4AN7A 3SJOA 1TPAE 3BSQA 1HNEE 1C1QA 4XRNA 3PMHB 1FPCH 1TQ0B 1SHHB 2UUKB 1KSNA 1YCPK 2BXUH 1UVSH 5A8YA 5C5NA 4Y7BA 2A5IA 3JZ2B 1P9UA 2QF0A 5DP5A 4ZKOU 2JH5D 3FZDA 1AVXA 1HJ9A 1C5YB 4JZ1A 4FUIA 1YY3A 2GP9B 2SGEE 4U2WA 4A6LA 2J4IA 2PP6A 3SV9A 1KTSB 1SFIA 1NFXA 3LGUA 4JK6A 2D2DA 3PMAB 4Y0YE 2ALVA 3RM0H 1ZMNA 2STBE 3VGCC 3KQ5A 3RU4D 2ZF0H 1NN6A 4RSPA 3ZVAA 2KZ4A 1V2RT 4YOJA 1FIWA 3SQHE 1PYTD 3LDXH 1XKBC 1Q3XA 4ZXXH 2WYGA 1TQ7B 3SUGA 4D9RA 2CV3A 5EIYA 4AX9H 2BY7X 3GCTG 3QZRA 5JBCS 2ZZUH 3SNAA 3OYPA 1P04A 2K1QA 4O3TA 1G9IE 3LIWA 3VFEA 1O38A 4ESTE 2ZDAH 2BLWA 3ZZAA 1KXFA 1A5GH 1O3EA 1SHYA 3E0NB 3K6YA 2ODYB 4Q63A 5EQSA 2ZU3A 2CMYA 1IQLA 1C5WB 1H1BA 4AC9A 4IS5A 1A46H 1XMNB 1QQUA 2Z9KA 4BNRA 2F9UA 4HI3A 1BCUH 2WUCA 4MNVA 4AFUA 1QA7A 1BT7A 4R8TB 2AIQA 1MAYA 4JCNA 1C4Y2 4WY3A 1TNJA 2UWOA 3AASA 1NBMD 3M35A 3MO6A 4WMDA 2B9LA 1V2OT 1P2OA 2BQ7B 2SGAA 2W7UA 1BTHH 1ZPBA 1NO9H 3MMGA 5F53A 2F9BH 2FOFA 2H2ZA 3FKSD 1JXPA 3M5LA 2A7HA 2EEKA 4DY7B 4BXSA 3VB5A 1KXDA 4CRAA 1DT2A 2FS9A 2NU1E 2VWLA 2WINI 2FLRH 4ZROA 3A8DA 4UFDH 1GVKB 1OWHA 3ZZ4A 2A4GA 2V3MA 3U8OH 6CHAC 1MUEB 2FI5E 1TONA 4MPXA 4X0WU 4Y71A 3AK5A 1IQGA 1L4DA 5C1YA 4JZEH 3F6UH 1A5HA 5JYIA 1Y5UT 2ZFQH 2RDEA 1GGDB 2Z9IA 4IN1A 4OS5A 4X2WA 5JBAS 3UFAA 4DOQA 1KLJH 1P57B 1EJAA 1ELAA 4ISLA 3LGVA 3P95A 1Z6EA 1MZDA 2F9OA 4I7YH 4DJZB 1GCDA 1BJVA 1P03A 3RC5A 1C5RA 1LHDH 1TGTA 1HRTH 3LH3A 1QHRB 1RIWB 3DFLA 3MNSA 1GI8B 2FXRA 2SFAA 1GMHF 2ZCHP 2XCFA 3ZV8A 1K1JA 5JBBS 4NFEA 3T5FH 4X1QU 3ZZDA 1O3MA 1ZYOA 2J9NA 1CSOE 3P70B 1KTTB 1A3EH 2ANMH 4GVUA 2WV9A 5DN6D 1D6WA 1AKSA 2HPQH 3BIVH 2V35A 2DUCA 2ILNA 1GBAA 2XBXA 1SSXA 1MBQA 5GCHF 3PV5A 2SGFE 1K28D 1O3FA 3A88A 1SMFE 4OM9A 5ESTE 1GI6A 3FN8A 1NZQH 1FAKH 1ORFA 1S0RA 2FI4E 1GVZA 2FIRH 3BEIB 1B5GH 3E91A 5LPFA 1T8MA 2BZ6H 4CRGA 1Z71A 5ESBA 1XXDA 3UOPA 4JMYA 4XOJA 2H9HA 1CHOF 1O3AA 1ANEA 1V2JT 2VVUA 2CN0H 2W5EA 3D65E 4X8SH 4RT0A 1O30A 1KIGH 1GJ7B 4X1PU 4YLUA 1EZUC 1QL7A 2FTMA 1TGBA 1RTFB 4K5ZA 1AKSB 1YLNA 1SGTA 3HKJB 3U1IB 1AQ7A 3SJ9A 1ZLRA 3A8AA 4K1SA 2ESTE 3EA7A 1SGFA 3R0FA 1MQ5A 5DP7A 4ZXYH 1S6FA 1GBBA 1S6HA 1CGJE 3V3MA 2VH0A 1ZGVA 1OP8A 3TK6A 1YGCH 2VIVA 1ZPCA 4K60A 5L30H 1OWDA 2ZNKH 1E35B 2OUAA 1CA8B 4MLFB 4BAOB 1K2I1 1UTMA 4NA9H 2FOAA 3FFGA 3DUXH 3A8CA 3G01A 4AB9A 1C1TA 2BDCA 3OY5U 1HAGE 1MD8A 1FONA 1ZOMA 4FUDA 2BDYA 5HIYA 4BAQB 2EI6A 1C5LH 2O9QA 2Q6GA 5EODA 5DP3A 1SKYE 5T1VA 3ATKA 1D3PB 3RDZA 3TGJE 1ACBE 1JMOH 4UFFH 1MKWH 2G5NA 2R9PA 4B1TA 4VGCB 2QY0B 2VVCA 2ZPSA 3TH4H 1HAVA 2GX4A 4WMFA 2UWLA 3SNEA 4RKJB 1O2SA 1GGDC 2J98A 1P9SA 4F48B 1LVBA 1ZHMA 1OP0A 1BA8B 2Z7FE 4KTCA 2P3UB 2XOKD 1FN8A 1ZMLA 1DXWA 4B74A 2WPMS 5EU8A 1L1JA 4NZQA 3RXVA 3UB0A 1TBZH 5A8XA 1NRRH 1C1MA 2FWWA 4OGYA 2ZDVH 2A7CA 2G55A 3CP7A 4X8TH 5PTPA 2BY5X 1BITA 1V2UT 3A8BA 2ZGXH 1IHTH 1C9PA 4RN6A 3M7TA 4B2AA 3P6ZB 1GBKA 2ZKSA 2VWOA 1OWIA 1UTNA 1EJNA 2ZCLP 1L4ZA 3ZZ5A 1ETTH 2P3FH 1V2PT 1JRTA 2YNBA 2VJ1A 4LK4A 3P8NA 1NPMA 2A0QB 2CK3D 1HAVB 4MTBA 3SV2H 3GYLB 4A1VA 4FOUC 5T6FA 1ETSH 3GDSA 1SL3A 1CGIE 4HGCA 3NZIA 2J98B 1MMJN 2BZAA 5TCAA 2W3IA 1N8OB 4ZKNU 4R0IA 3RLYH 1TBQH 1C9TA 5BRRE 1HLTH 1FX0B 2OBOA 4Q4LA 1HV7A 3GY8A 1O3OA 1TGSZ 1P2MA 5E0GA 3GOVB 4GAWA 5C0TA 3K2UA 1EAWA 3BTEE 3BTTE 1S81A 4IMQA 3VXFH 4NIWA 2ZDLA 4Q7ZA 2ZWLH 3V7TA 2M5TA 1GJBB 1UTOA 2JIZD 4Y8YA 3BG4B 1YPGH 5LPEA 1BIOA 1AI8H 1GMDG 4FUBA 1VITF 3ZYEA 1F0UA 5EJLA 1O32A 2Y5GA 4DGJA 1YPKH 4ZKRU 2C8YB 3SHAH 3K65B 1TRMA 3PM3A 2VVVA 5ETXA 4DT7B 4CR9A 1PQ8A 2BVXH 2JJ1D 1EZSC 1E37B 1AWFH 1CVWH 1GDUA 3E8LA 1T8LA 2NU0E 1ELVA 1LO6A 2CF9H 2OC0A 4ISIH 1TX8A 2QA9E 2FP7B 2I6QA 2QYIA 3TJOA 1V2MT 4E7NA 5FHTA 2H6MA 4X2YA 3U28C 3BIUH 2QIQA 1YPHC 2R0KA 1PQ7A 4Y76A 1MQ6A 4MPWA 5BPEA 3ZZ6A 1WU1A 4D7GA 1V2NT 3MFJA 5CHAB 3LPRA 2GT7A 3LC5A 5AFZH 4BANB 2ZTZA 4B71A 1EP5A 1GI2A 1Y5AT 1ZRBA 1LKBA 5FAHA 3U9AH 2PW8H 5TCCA 4AB8A 1EASA 3SUFA 1YLDA 1K22H 2TGAA 1S84A 1TA2A 2BDHA 1C2EA 3A89A 1VGCB 2SGDE 2ZU4A 4WMEA 4FETA 4TPYA 5EXNA 8GCHG 1LPKB 2JDID 2OCVB 3ENSB 1DOJA 4I8JA 1FN6A 3T62A 2BYAX 1O3IA 1C2HA 4NA7A 3EGKH 3AVZA 1IQHA 2DE8A 1ANBA 1DY9A 2J38A 1BOQA 1O2YA 3PLKA 5LGOA 3GCTF 3RXHA 1ELCA 3GY5A 2YNAA 3MH4A 1T8NA 4OS2A 2JH6D 4WH6A 1OX1A 5E0HA 1WQVH 3I78A 2GKVE 1P01A 2VIQA 4CH2B 3OFND 3VB3A 1EQ9A 1SQRA 3HATH 4DVAU 1ZZZA 5FCRA 2A45B 2TIOA 5DO4H 2ZDMA 1TNKA 2BMGB 2OC8A 3B23B 4I31A 1OPHB 4ZHMU 3OY6U 3I29A 5DP9A 1WAYB 2RA0A 1O2VA 2P16A 1N8OC 1ANCA 4JYTA 1GJDB 1MU8B 3ODFA 5EQQA 4CHAB 2XCNA 1E34B 4DURA 1G37A 4CRCA 2WZQA 1NTPA 5GDSH 1BB0B 5J4QA 4HZHA 1BMNH 3MH5A 4D8NA 4FUFA 2J95A 4K2YA 1XUGA 7LPRA 4GHQA 4I32A 1G3BA 1H9HE 3ZVEA 2RDLA 5ABWA 3FZZA 3QZQA 5GJ4B 3HK6B 3HKIB 1NFWA 1GPZA 1V2TT 1OSSA 4Y8ZA 1FY3A 1TNHA 3BTQE 3GCHB 3OEHD 3H7OA 3BG4C 2PGBB 5A2MH 2Z3CA 3M3TA 1PQ5A 1GHBF 1OP2A 2L6OA 1AIXH 2K8IA 3KHVA 1G3CA 5A0BA 1GJ8B 1SGPE 2VINA 3LOXA 3RU4E 2ZEBA 2AERH 2KCYA 1F92A 1LVMA 1A7SA 1GBCA 3MU0A 1F5KU 3SZNA 1C1NA 1OOKB 3N7DA 3A7ZA 1GJ5H 3RXUA 2VH6A 3SJKA 1IQNA 1YCPH 1YPEH 3EE0B 3ATMA 5CHBA 4B2BA 2BY8X 1L1NA 2XBYA 4RT1A 1MTNB 3SJIA 3SYJA 1VCQA 1A1RA 5T6GA 2G81E 4LXBH 2PKSC 1TBRH 2LPRA 3RXKA 2OC1A 4HFPB 4OS1A 1AUTC 2TRMA 5CHAC 2Q6DA 1QBNA 3SOSA 1C2IA 4J1YA 4DIIH 1WQSA 2Y6TA 3SV8A 2XWBI 4AFZA 1HAIH 1GWAA 4AZ2B 3GS9A 2XYAA 2FYRA 4NA8A 1P06A 1TAWA 3KYFA 3PYHA 1E36B 3TNTA 1OWJA 1NU7B 3SU0A 4BXWA 2W6JD 1VGCC 3A83A 1KY9A 1WXRA 1NBME 1O3BA 3RXRA 5JDUB 4X6NA 3EA9A 1O2UA 2QAAA 3HK3B 4F55A 1C1VH 3MU1A 4I8LA 3RXGA 2JKHA 4YLQH 5CMXH 1VJ9U 1EB2A 1V2ST 2KCOA 5EQRA 2FEQH 2PSYA 1IQMA 1QCPA 1XM1A 1P10A 2L74A 5B6LA 1E38B 3QTVH 3M5NA 1TNGA 3MU5A 4SGBE 5EG4A 7GCHG 1HAOH 2NU2E 1SLXB 1G32B 1RJXB 3E1XB 3QK1A 4UE7H 2WHXA 1BRAA 2F83A 2ZTXA 4NWKA 1W14U 1QB9A 2P59A 2ZG0H 5K7RA 3GISB 3F0PA 1QNJA 2FESH 1C5TA 4K8YA 2PKAA 1NS3A 5KGOA 1SGNE 1F5RA 1UCYK 2P94A 4H6SB 3F9GA 1O5BB 1ID5H 1O37A 1EOLA 1FAXA 2ODPA 3RU4T 4IBLH 2SNVA 1E1QD 4HG6A 3SNBA 2TBSA 2HNTF 3FP6E 3P17H 1C5PA 3AW0A 1A61H 2BD8A 1KXBA 2BX4A 4E05H 3QGNB 1HPGA 1W2KH 4Z6AH 3Q00A 4WVPE 3OU0A 1ELDE 1ZSKA 2Y82A 2GZ7A 1RFNA 2TGTA 4ABHA 4ISHH 4YZUA 3M5OA 4IN2A 3A84A 4FU7A 4MPVA 3TK9A 1O2GH 4NCYA 3QX5H 1QQ4A 1QRWA 1GJCB 2BLQA 3ZZBA 1P12E 2PKAB 2XBWA 5FXLA 1H8DH 1W8BH 2OK5A 3ZZ3A 3A7YA 1P8VC 3GCHC 1C2JA 5LH8A 1GBJA 2ULLA 3D49H 1O2TA 2A7JA 1INCA 1AO5A 2GT8A 7ESTE 4P02A 3PTNA 2GGVB 4NG9H 4JYVH 2ZU2A 2AGEX 1NFYA 2FI3E 2V3OH 1DFPA 2AS9A 4NGAH 1Z8RA 3DSGA 4TY6A 2PTNA 1LPZB 1PPHE 1WUNH 4NWLA 4RI0A 2C4FH 1O2PA 3FO8D 2ZGCA 3MNXA 2J5UA 1C4U2 4K3JA 1CA0B 2Y81A 1JIMA 3MH6A 2GMTC 3S9CA 1SVPA 2EQNA 3BTME 3WWBA 1BTWA 3MU4A 4GLYA 1DWCH 5HGGA 4B6FA 2OTVA 2W26A 3SU2A 4INLA 4QT8C 2ALPA 4OGXA 3MQKC 1C4V2 2BVSH 1QJ7B 1TGCA 3RXIA 1SLVB 2KCPA 3KQDA 1SGQE 2A4RA 4TYDA 1DS2E 1ZHRA 1ARCA 1W0ZU 1P3CA 1NU9A 1GHBG 3S0NA 1SI5H 1DANH 3BTDE 1LQDB 2G5VA 2HWLB 2EC9H 1VKYA 2IJD1 1BTXA 1CHGA 1O3CA 5K0HA 3E0PB 1JOUB 5L2YH 5FL7D 4ASUD 1LHCH 1DVAH 2R0LA 3KQEA 2Y80A 2O8UA 5DSFA 2FMJA 1W12U 4AYVB 4FVBA 3U8TH 5EXMA 2V3HH 1MD7A 4X1RU 1YPMH 3S7KB 3ZYDA 3UNRA 4TWYA 2FOBA 4B73A 5AFYH 1G30B 1MBMA 1GMDF 5DK1A 3RXFA 3NXPA 1UVTH 1GJ9B 1HJAB 1P2IA 3DD2H 3MOCA 1O2LA 2V6NA 3BN9A 2RFKC 4GCHG 2FOEA 2ZQ2A 4INHA 1TFXA 2PUQH 1WCZA 2ZGHA 1B0FA 1YPJH 3RXMA 3URCA 1IQEA 3ZZ8A 1BHXF 2OP9A 4GPGA 1TALA 5C1XA 1AU8A 2ZGJA 3UR6A 1JWTA 2FX6A 3SO3A 2A4QA 1UHBA 2P93A 2BY9X 3SGAE 2FX4A 2PR3A 3VG8A 1YYY1 5IDKA 2F9VA 1MH0A 5CDFE 1MAXA 3SBKA 1SG8B 1BRUP 1C5VA 1J15A 3DSPA 2BOKA 1EUFA 1HYLA 5KECA 1GBIA 1V2LT 1BUIA 2J92A 1S0QA 1GI5A 4K1EA 4IC6A 1O2MA 4Y0ZE 1FDPA 2ZO3H 3VXEH 1EX3A 1NRQH 3PV4A 1ZTLA 2V7QD 2ZIQH 4YM9A 3UPEA 1EPTA 1IAUA 4BTIB 4ZKSU 1PPEE 3PB1E 3ITIA 1UHBB 1OWKA 3ZZ7A 8GCHF 1GI3A 5DPAA 3KNXA 1O5GH 3EDXB 4A1TA 2VWNA 4WWYA 1HB0B 1Q2WA 2HVXA 4AG1A 1DXPA 3R3GB 4A7IB 1F2SE 4ABBA 3KEEA 4U32A 1VR1H 1WV7H 1C1SA 1O39A 4K8BA 3RC6A 1A0LA 1AD8H 2H5DA 4XFQA 1TRNA 1Z8IB 1Y3VA 4A5TS 2LELA 2RCEA 3ODDA 4Y11E 2EI7A 4D7FA 4FUJA 5H4IB 4A1XA 3TGIE 2F91A 5JPMH 1T31A 1EPTB 1MZAA 1H8ED 3TGKE 1DPOA 2QXGA 5AVDA 1GVLA 5IYTA 1NY22 1D9IA 3O8DA 1AN1E 1IOEA 4BTTB 3B8JA 5HM2A 2QV1A 4Q2KA 1BQYA 2CHAB 3PMJA 1EAUA 3Q3YA 2AHME 4XDEA 1LHFH 3JZ1B 3QGJA 5J4SA 4JZIA 2R2WU 2BM2A 4CBNA 1YC0A 2DE9A 1HFDA 5FPYA 3SJ8A 1HAHH 1V2VT 1COWD 4LZ4B 1MTVA 3DT0H 1SQOA 2ASUB 2NU4E 2ZA5A 1A5IA 4FVDA 2JJ2D 1FZZA 5DKMA 1OXGA 2VIWA 2B7DH 4AYYB 2KR7A 4BAMB 2WPKS 1RIWC 1TYNA 2IJOB 2PTCE 3P8FA 1LDTT 3KIDU 3LONA 2IPHA 1M9UA 5C20A 3SQEE 4Q7XA
chains in the Genus database with same CATH topology
2KCOA 5EQRA 2A4GA 2OC8A 3W1EA 5EPYA 4B76A 3L6PA 4I31A 3AK5A 3WWBA 2V7QD 2YMSB 3O8RA 5B6LA 2JIZD 3OEED 4I33A 3M5NA 3F3BA 4B6FA 3SU2A 1CU1A 2O8MA 2YOLA 5EQQA 1RTLA 2XCNA 2WHXA 2VBCA 3PV2A 4NWKA 2KCPA 3SV6A 3SV9A 2WZQA 1W0JD 2A4RA 3KNXA 4TYDA 1H8HD 1E79D 2P59A 3OAAD 3WW7A 5ETXA 4A1TA 3F0PA 1MABB 5FPTA 3O8CA 2WSSD 1SKYE 2JJ1D 5T1VA 1NS3A 1W3CA 3OE7D 1W0KD 3RC5A 4I32A 1DXPA 3SU5A 5GNDA 2KZ4A 2QF5A 2OC0A 1S6LA 2IJD1 2W6ID 3KEEA 3PRDA 2FP7B 5GJ4B 4K8BA 4WH8A 3LKWA 3RC6A 4A92A 2XCFA 3F2HA 4YXWD 1E1QD 2F4LA 3SUGA 4TSFD 2YMSC 5FL7D 3F2FA 3OEHD 4ASUD 2LELA 2OINA 3EYDA 3N99A 2QE7D 1EFRD 4B75A 1N1LA 2L6OA 3OYPA 2K8IA 4KTCA 5H4IB 3OTPA 2KM0A 4A1XA 2XOKD 2WV9A 3LOXA 5DSFA 2K1QA 3SUEA 3NRLA 5DN6D 2KCYA 3FOAA 4XD7D 4B74A 1DXWA 1H8ED 2FM2A 4B71A 3UB0A 1E1RD 3DCLA 3U1JB 2F43B 2KFWA 3M5OA 3N7DA 4Q63A 4WF8A 3SU4A 4M9FA 3SV7A 5EQSA 3RC4A 3SZEA 3O8DA 4B73A 5C0UA 1BMFD 3SUFA 3PV5A 2QV1A 2WPDD 4OM9A 5CHBA 3M5MA 5IK2D 3FN8A 2AHME 5HKKD 4FETA 3F0OA 1OHHD 2OK5A 3SYJA 2QF4A 3O8BA 2F9UA 1A1RA 2M2AA 1BT7A 3SU1A 2XNDD 4R8TB 5ESBA 4ZCNA 2HLDD 3P8NA 3P8OA 2CK3D 5FPSA 2K0QA 3F2GA 2JDID 5FPYA 2OC1A 4JMYA 4Z1MD 4U01A 1COWD 4A1VA 5C17A 1NBMD 2FOMB 2KCAA 3N7EA 2GGVB 3WWFA 2A4QA 1DY9A 5EPNA 3DSOA 2JJ2D 3ZIAD 3SV8A 3VG8A 3H09A 5F53A 5IDKA 2KR7A 2F9VA 3SU3A 3M5LA 3FKSD 1JXPA 3GS9A 3U1IB 1FX0B 2OBOA 2OC7A 4Q4LA 1KMHB 3SUDA 2IJOB 5CDFE 4B6EA 2GVFA 1RGQA 2XNIA 4NWLA 3DSPA 4RI0A 5GPIB 3SU0A 2W6JD 4WH6A 3SU6A 3FO8D 3LONA 5C0TA 3KF2A 1WXRA 1NBME 3OFND 2YMSD 4TT3D 3KN2A 2J5UA 3PRBA 4F55A 2OBQA 4DT4A 3E90B 1DY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F2G A;  3F0P A;  3F2H A;  5C0U A;  5C17 A;  5C0T A;  3FN8 A;  3F2F A;  3F0O A;  5DSF A; 
#chains in the Genus database with same CATH topology
 2AGI X;  1ZRK A;  1GBF A;  2WPL S;  1EST A;  1PPC E;  3W94 A;  1FIZ A;  2YMS B;  1O2R A;  2ZU5 A;  3TIT A;  3F3B A;  1AFQ B;  1ARB A;  3L3T A;  1C2K A;  1HJ8 A;  1C2F A;  4XBB A;  1ELB A;  1TPS A;  1AMH A;  2QC2 A;  4ZUH A;  5E2O A;  3LU9 B;  1SQT A;  3SI3 H;  1DWE H;  5GXP A;  1V6D A;  2C8X B;  2G4T A;  4CRF A;  2QGR A;  1Y3W A;  2VIP A;  1ZTJ A;  3K6Z A;  1UK2 A;  3GY7 A;  1ZR0 A;  4I8H A;  2XTT B;  1HCG A;  2STA E;  5E2P A;  3PWB A;  6EST A;  3M7Q A;  4UFG H;  2BB4 A;  3CEN A;  3N99 A;  4DG4 A;  4ABJ A;  1TPO A;  1U6Q A;  1AZ8 A;  4I86 A;  3RUO A;  3T2N A;  4GHT A;  3TLO A;  5KED A;  2SNW A;  4LZ1 H;  3A86 A;  5EW2 H;  1GJ6 A;  1A4W H;  2F43 B;  4GSO A;  2BQ6 B;  2GV7 A;  3SV7 A;  3SU4 A;  1XUK A;  2A1D B;  3CS7 A;  1GHY H;  5T6D A;  2ANK H;  1FY5 A;  1UTK A;  7GCH F;  1H4W A;  5AF9 H;  2FZZ A;  3P92 A;  1LHE H;  2A2Q H;  4MQA A;  1GL1 A;  3RXJ A;  1Y3Y A;  5C5O A;  1GDQ A;  1GBT A;  1KXE A;  1PPZ A;  2XND D;  2BY6 X;  2R3Y A;  3UNQ A;  2K0Q A;  1GHA G;  3F2G A;  1O2H A;  2XC4 A;  2OQU A;  4O9V A;  1O3P B;  2OLG A;  3ZVC A;  3H5C B;  2ZPQ A;  4TPI Z;  1ESA A;  3SN8 A;  3BEF B;  3RLW H;  1PFX C;  5EOK A;  1K1P A;  2VGC B;  1GHZ A;  2ZFP H;  1CE5 A;  1FXY A;  4B6E A;  2LNC A;  2CHA C;  1RGQ A;  4VGC C;  3SNC A;  5GPI B;  4E06 H;  2H9T H;  2Z3E A;  3GDU A;  5F8X A;  1UVO A;  1D4P B;  2O8T A;  5F8Z A;  2TPI Z;  3SU6 A;  4CH8 B;  5FCK A;  3GCN A;  3ATL A;  2ODQ A;  1PPF E;  4Y6D A;  1OWE A;  3E16 B;  3TNS A;  1C1R A;  4WXV A;  1N6X A;  6LPR A;  2BOH B;  1DY8 A;  2C8W B;  2C90 B;  1PJP A;  4E7R G;  2A5A A;  3ELA H;  3U98 H;  1F0S A;  4I33 A;  2BVR H;  1CU1 A;  2O8M A;  3FP7 E;  1C5U A;  2A4O A;  2FOH A;  1SR5 C;  4X1N U;  1YPH E;  1BTP A;  2ZFT A;  1TPP A;  1RD3 B;  1UJ1 A;  1E79 D;  2G00 A;  2HRV A;  3LGW A;  1QBV H;  3O8C A;  1MKX K;  3KCG H;  3TJN A;  4D76 A;  3OE7 D;  2ZC9 H;  1QL8 A;  2O8L A;  2J97 A;  2VNT A;  3MNB A;  1XUJ A;  4KGA A;  5I25 A;  3SU5 A;  1LTO A;  1FY1 A;  3BEU A;  1GBL A;  4LOY H;  1O5F H;  1MCT A;  3KL6 A;  1QZ8 A;  2H5C A;  3A7T A;  1O2Z A;  1G2L A;  4THN H;  4A92 A;  4YXW D;  5T3H A;  3C27 B;  2F4L A;  2OQ5 A;  2YMS C;  1UO6 A;  3A80 A;  2QE7 D;  2ZHQ H;  1AFQ C;  4B75 A;  1QTF A;  3PRO A;  3OTP A;  4SGA E;  3V13 A;  1HAY B;  5DJ7 A;  1TX6 A;  1MTW A;  4WXI A;  1O35 A;  2FM2 A;  1IQF A;  3MYW A;  3RM2 H;  1LHG H;  2ZHD A;  5JB8 S;  2D8W A;  3S7H B;  1C2L A;  3LH1 A;  3SZE A;  2XWA A;  4DCD A;  1A3B H;  1LQE A;  1GMC G;  3QWC H;  4DIH H;  2Y7Z A;  1AY6 H;  1DX5 M;  2BLO A;  9EST A;  2ZDN A;  1O5C B;  4Y10 E;  3A7W A;  3RML H;  4O97 A;  1SLW B;  1ZTK A;  3MNC A;  3P8O A;  1BRB E;  1LVY A;  1S5S A;  2ZTY A;  1L1G A;  2B0F A;  3F9F A;  5C17 A;  1WTG H;  3P8G A;  2NU3 E;  2ZFS A;  3RP2 A;  1YBW A;  5AHG H;  2XC5 A;  4JZD H;  1C5S A;  3VB4 A;  4FUC A;  1AGJ A;  3WY8 A;  2KAI A;  1AE8 H;  1QY6 A;  1LMW B;  4PRO A;  2OD3 B;  4XE4 A;  1UCY H;  1SB1 H;  2P3T B;  3A7X A;  3SUD A;  5A0C A;  4ZHA A;  1ELF A;  1O2J A;  1DWB H;  1KXA A;  1O3K A;  2GVF A;  1CQQ A;  4H6T A;  3BF6 H;  1HDT H;  4OS7 A;  2AEI H;  2UUF B;  1N6Y A;  1F5L A;  5HMA A;  1O33 A;  3GIC B;  4YOI A;  3KN2 A;  2JH0 D;  8LPR A;  1D3T B;  3LC3 A;  2C93 B;  3M61 U;  1FMG A;  5SGA E;  1EAI A;  4F4O C;  1DLK B;  2WYJ A;  1TMT H;  2Y5F A;  5EPY A;  3URD A;  1W13 U;  1C1O A;  1HBT H;  5EXL A;  4GCH F;  3MTY A;  1SGY E;  2VGC C;  3PTB A;  1RTL A;  2HOB A;  5JBT A;  2KAI B;  4O3U A;  3GY4 A;  1BML A;  1SGE E;  2BD4 A;  1RS0 A;  1CT2 E;  3PMB B;  1GBD A;  1RRK A;  3B9F H;  4ACA A;  3S9A A;  1L0Z A;  3RXL A;  2CXV A;  1BJU A;  1EKB B;  5GIB A;  3LJJ A;  1W3C A;  2P8O B;  2AFQ B;  3MO3 A;  3A87 A;  1BBR K;  1P05 A;  1HAX B;  1K1O A;  1Q31 A;  3PRD A;  3MI4 A;  1BTY A;  4AOR A;  3LKW A;  2GD4 B;  2FOG A;  1TX7 A;  4TSF D;  3LGI A;  3STI A;  1JBU H;  1XVM A;  1T8O A;  2G8T A;  2Z9G A;  4BAK B;  3SI4 H;  3PLP A;  5F03 A;  2J34 A;  2Q1J A;  3UQV A;  3TPI Z;  1D3D B;  3UQO A;  3U1J B;  4Q7Y A;  1T7C A;  4AFS A;  3RXS A;  2KFW A;  1W0Y H;  3BTK E;  5HM9 A;  1BMF D;  1LVO A;  2ZU1 A;  2W7S A;  1VIT H;  1LPG B;  1QUR H;  2WUB A;  2I6S A;  1ELT A;  3IIT A;  3GYM A;  1UCY E;  3DHK H;  1XUH A;  5HYO A;  5EGM A;  1GI7 B;  3F0O A;  1EXF A;  1O3G A;  2BDI A;  4WJG 2;  2M2A A;  1G3E A;  2OXS A;  2ZHF H;  4ZCN A;  1UMA H;  1DIT H;  2A5K A;  1HUT H;  1WTH D;  4CHA C;  2PLX A;  4Z1M D;  4JK5 A;  3FAO A;  1P2Q A;  9LPR A;  3SW2 B;  2H1U A;  4K1T A;  1K1N A;  2GDD A;  3CS0 A;  1ZGI A;  1THS H;  2GTB A;  2QXJ A;  4IMZ A;  1V2W T;  1CT0 E;  1V3X A;  1EOJ A;  2UUJ B;  1SGR E;  2AH4 X;  3FAN A;  1KMH B;  1K1I A;  5CE1 A;  2J2U A;  2Z6B D;  3L33 A;  1W7G H;  2BQW B;  3EA8 A;  1VZQ H;  2CGA A;  3RXD A;  3VPK A;  1NRP H;  2YMS D;  4RKO B;  5DP8 A;  4OS4 A;  4XBD A;  1RXP A;  2XC0 A;  5E0J A;  3RXQ A;  3UWJ H;  1MTS A;  4P00 A;  5JB9 S;  2OBQ A;  1EJM A;  3E90 B;  1XX9 A;  3GY3 A;  3KYG A;  2F9P A;  2R3U A;  3IWM A;  1ABI H;  1TOC B;  4B76 A;  4NIY A;  1UK3 A;  3L6P A;  1DIC A;  3OEE D;  2FLB H;  2QN5 T;  3KQC A;  6GCH F;  1OS8 A;  2GCH G;  5C3N A;  5DP4 A;  1FY8 E;  3PV2 A;  3SV6 A;  1TA6 A;  2VID A;  1Z8G A;  5I46 H;  3OAA D;  1G2M A;  1MTN C;  1IQI A;  2EI8 A;  5B6O A;  2QXH A;  5GWZ A;  3NPS A;  1SGD E;  1UK4 A;  5GND A;  1BMA A;  2WPJ S;  3RXO A;  1H9I E;  4UEH H;  4WH8 A;  3LJO A;  1QA0 A;  2Q6F A;  1SFQ B;  2ZFF H;  3ZVG A;  3F2F A;  1UVP A;  4CR5 A;  4Y7A A;  1C2G A;  4TY7 A;  1N1L A;  1S83 A;  5E8E H;  1ELG A;  3QO6 A;  1NRO H;  2J94 A;  3SUE A;  3BV9 B;  2ZEC A;  4MNX A;  1F0T A;  3AW1 A;  2A31 A;  3ATI A;  3QN7 A;  4CRE A;  1D6R A;  1Y3U A;  1CT4 E;  3ZV9 A;  1DLE A;  4UD9 H;  1AE5 A;  5C0U A;  2ZHW H;  4MPU A;  2P8O C;  1YLC A;  3M3V A;  4X1S U;  2ANY A;  4X2V A;  4YT7 H;  3EE7 A;  2WPD D;  2H9E H;  1V2K T;  3HGN A;  1T4U H;  1TE0 A;  1B7X B;  1DSU A;  1TMB H;  1F7Z A;  1P3E A;  4IGD A;  4O03 A;  1GHW H;  2PSX A;  1P11 E;  1KYN A;  3M36 A;  1JIR A;  1SGI B;  5FPS A;  4FUG A;  4U01 A;  3EST A;  4IW4 E;  1C5Q A;  3QTO H;  2ANW A;  1NC6 A;  5EJ1 A;  4GUX A;  2NWN A;  1H8I H;  1Z1J A;  3RMM H;  1XXF A;  4TWW A;  2FS8 A;  3F68 H;  3SU3 A;  1LKA A;  3F1S B;  4CRD A;  1BDA A;  1SGC A;  3TK5 A;  3MWI U;  1DWD H;  3I77 A;  4NSV A;  4ABE A;  5FX5 A;  3Q3X A;  1UW7 A;  1IQK A;  1BZX E;  1J16 A;  2JET B;  1YP9 A;  3DFJ A;  1NRS H;  4DW2 U;  4XSK U;  1AHT H;  1C1W H;  3STJ A;  2QCY A;  1T32 A;  3TJV A;  3N7O A;  1XUI A;  1TMU H;  2FO9 A;  1GJA B;  1X7A C;  1TRY A;  3TH3 H;  4Y8X A;  1TB6 H;  1FQ3 A;  2BLV A;  2ZHE H;  1G36 A;  2VBC A;  1O5D H;  1GHA F;  5A8Z A;  1C2D A;  3GY2 A;  4NIV A;  1THP B;  1BMM H;  4XBC A;  2WV5 A;  3SOR A;  1NM6 A;  2Y5H A;  2PHB A;  1FLE E;  1MCV A;  4AFQ A;  1LCY A;  3GCO A;  4IC5 A;  3NK8 A;  1Y59 T;  4H4F A;  1PPB H;  2AGG X;  2W6I D;  3FVF B;  4Q80 A;  1TAB E;  3BTF E;  1VJA U;  1FPH H;  1CGH A;  1DM4 B;  2GDE H;  5C94 A;  1O2W A;  5F8T A;  3RMO H;  4JZF H;  2IPQ X;  1HAZ B;  2D1J A;  1DDJ A;  1EFR D;  4X2X A;  4ABA A;  1ELE E;  3A7V A;  4ISO A;  3W95 A;  2VIO A;  4U30 A;  1TNL A;  2ZPR A;  3LGT A;  4XD7 D;  3BTH E;  1FUJ A;  1FNI A;  4YO9 A;  2BD3 A;  3T25 A;  1ZSJ A;  5L6N H;  4WF8 A;  1SOZ A;  5HXF A;  1CA0 C;  3V0X A;  1G3D A;  5C1U A;  1BTU A;  3UUZ A;  1O36 A;  2FDA A;  1O3J A;  1A2C H;  4NZL A;  1O5E H;  4UON A;  1O5A B;  2ZDK A;  1QRZ A;  3Q3K A;  5IK2 D;  1A0J A;  1TOM H;  1Z6J H;  3PO1 B;  1FY4 A;  3ZVB A;  1WDI A;  7KME H;  3M37 A;  3V12 A;  1QRX A;  2HLD D;  3GDV A;  2Z9J A;  3RXB A;  1ZPZ A;  4ABG A;  3NKK A;  1RTK A;  1O2X A;  1K1M A;  5L2Z H;  1AVW A;  4MNW A;  1EAT A;  1VCP A;  1NES E;  3ZIA D;  2PGQ B;  2AYW A;  1B0E A;  1Z1I A;  2CF8 H;  3TVJ B;  1C5N H;  2RA3 A;  2ZGB H;  5EW1 H;  2SGQ E;  1O2I A;  6GCH G;  1GG6 B;  1QFK H;  2FOD A;  3F9E A;  3MH7 A;  1CO7 E;  3D62 A;  2BD5 A;  4TT3 D;  4H42 U;  3CNR A;  3Q76 A;  1CBW B;  1GJ4 H;  2QF3 A;  1EZQ A;  2HPP H;  1S85 A;  1YPL H;  5A0A E;  2PUX B;  1GMC F;  2VU8 E;  2HNT C;  1O2Q A;  4X6O A;  2UWP A;  1BHX B;  1HXE H;  3BG8 A;  1MU6 B;  1GBM A;  1W10 U;  4YES B;  1SPJ A;  1HJA C;  3EQ0 H;  2AIP A;  1H9L B;  1QJ6 B;  2Z94 A;  3ZVD A;  1OYQ A;  1D3Q B;  1AFE H;  2VB0 A;  3OSY A;  4ASH A;  1W0J D;  1FJS A;  1H8H D;  2GZ8 A;  1MAB B;  2JET C;  2WSS D;  2VWM A;  2BDB A;  1HAP H;  3T26 A;  4X6M A;  1ZMJ A;  3OTJ E;  2BD2 A;  3LGY A;  2F3C E;  1NFU A;  3VB6 A;  3SGB E;  3EAJ A;  1ZJK A;  1BTZ A;  2IN2 A;  1J17 T;  4F49 A;  1QB1 A;  8EST E;  2OIN A;  2HVY B;  5TJX A;  3KQB A;  4ACB A;  1Z7K A;  1K21 H;  1AB9 B;  2G4U A;  3NRL A;  1WBG B;  1YF4 A;  2R2M B;  1QL9 A;  1E0F D;  2SGP E;  3DCL A;  1NT1 A;  1V2Q T;  1XKA C;  2BD9 A;  2GJG A;  2HGT H;  3RXP A;  3U8R H;  3A85 A;  4M9F A;  4JYU H;  2BDA A;  1C5Z B;  2GV6 A;  1DUE A;  2A32 A;  1QJ1 B;  2AMP A;  3QUM P;  3ZVF A;  1GI1 A;  1HIA A;  2HNT E;  4UFE H;  3M5M A;  2XBV A;  5HKK D;  1QR3 E;  1OHH D;  3GY6 A;  1GBH A;  2AMQ A;  1SGF G;  4I8K A;  1AUJ A;  3LT3 A;  3RXE A;  2A2X H;  2O8W A;  1MKW K;  3AAU A;  2PV9 B;  3M3S A;  4ABD A;  3TH2 H;  1YWU A;  4KP0 A;  4UDW H;  3ZZC A;  3DSO A;  3BTW E;  1MKX H;  4AOQ A;  1DE7 H;  2P95 A;  5DGJ A;  1TGN A;  1O31 A;  3K9X B;  1IHS H;  2OC7 A;  1KXC A;  2BX3 A;  1GMH G;  1C1P A;  2GCT B;  2AMD A;  2XNI A;  1C5X B;  4Y79 A;  1OYT H;  4BTU B;  3PO1 C;  5FX6 A;  1HIA B;  1GHX H;  4KTU A;  1J14 A;  1WOF A;  2ZI2 H;  1AZZ A;  1QBO A;  1GDN A;  1YCP M;  2HAL A;  5FBE A;  1A0H B;  1T4V H;  3SGQ E;  1TIO A;  1EPT C;  1UTP A;  3RXC A;  1KLT A;  1QB6 A;  3W1E A;  4AGJ A;  4MG3 A;  3H7T A;  2BTC E;  4MDS A;  5GCH G;  2IOT A;  3QDZ B;  3HGP A;  4ZAE A;  1O2N A;  2CJI A;  2PKS B;  3T29 A;  2GZ9 A;  4FU8 A;  2BDG A;  1K1L A;  5LPR A;  1OKX A;  2EA3 A;  4M7G A;  2W3K A;  3KGP A;  2WPH S;  4I8G A;  4MVN A;  1GG6 C;  4K69 A;  3E3T A;  1WYK A;  1W0K D;  5DG6 A;  5EJZ A;  1L2E A;  1CHO G;  2QF5 A;  1Y8T A;  3F9H A;  1GL0 E;  1SLU B;  1CBW C;  4YTA A;  1W7X H;  4ZH8 A;  1ESB A;  2XXL A;  1O3N A;  5HIZ A;  3TJU A;  3QLP H;  3UAI C;  4DT4 A;  2HLC A;  1AWH B;  2UUY A;  1EAX A;  4OS6 A;  3UIR A;  1C5M D;  1AND A;  2ZFR H;  1GCT B;  4YT6 H;  4X6P A;  4AG2 A;  4CRB A;  5C2Z A;  1WSS H;  3FOA A;  4ZMA H;  2EY4 C;  3IG6 B;  3T27 A;  3TIU A;  4Z0K A;  1E1R D;  3MO9 A;  1MTU A;  5F6M A;  1KLI H;  1TLD A;  2ZQ1 A;  3UOU A;  1K9O E;  1PPG E;  1KDQ A;  2ZP0 H;  2GCH F;  3A81 A;  3SND A;  2WV4 A;  3BTG E;  4AGK A;  3VB7 A;  1Y3X A;  1UTJ A;  5C67 A;  4KEL A;  1PQA A;  3M7U A;  1O2K A;  1P2J A;  2QF4 A;  3O8B A;  1ETR H;  1FV9 A;  1O0D H;  2XRC A;  2C3S A;  5A09 A;  1AB9 C;  1AVG H;  2FOM B;  3E6P H;  1PYT C;  1P2N A;  3N7E A;  1HGT H;  1J8A A;  3WWF A;  2D26 C;  2V0B A;  3MHW U;  2THF B;  3D23 A;  3UY9 A;  5FBI A;  3H09 A;  4NSY A;  1HXF H;  4FU9 A;  1DUA A;  1ZSL A;  1BBR H;  1QGF A;  3RXA A;  4BOH A;  2FPZ A;  1J9C H;  1F0R A;  1O2O A;  2BD7 A;  1KDQ B;  3RMN H;  1S82 A;  3KF2 A;  3VGC B;  4ISN A;  3ZZ9 A;  4ABF A;  3PRB A;  3OX7 U;  1C2M A;  2WPI S;  1ABJ H;  4HTC H;  1P09 A;  2ZCK P;  3O8R A;  2BHG A;  2B8O H;  3U69 H;  1O34 A;  2PFE A;  4J2Y B;  5G4B A;  3TU7 H;  2C8Z B;  2YOL A;  3NCL A;  1C1U H;  1GBE A;  1P2K A;  1SC8 U;  3WW7 A;  3PLB A;  1K0H A;  2GCT C;  4D9Q A;  4INK A;  5FPT A;  1ZJD A;  4B2C A;  1EP6 A;  2FOC A;  1SBW A;  1FI8 A;  3UNS A;  1S6L A;  1NRN H;  1VCW A;  3HPT B;  3T28 A;  4CBO A;  1DST A;  3F2H A;  3S69 A;  1QIX B;  4KTS A;  4X8U H;  3EYD A;  2PWX A;  3PWC A;  3RXT A;  2Z3D A;  3A82 A;  3URE A;  3NWU A;  2BXT H;  2KM0 A;  1SQA A;  2GMT B;  3C1K A;  4FXG H;  1IQJ A;  4KKD A;  2RG3 A;  2XW9 A;  2LP6 A;  2B5T B;  2QXI A;  3RC4 A;  3AAV A;  2TGD A;  1C5O H;  2Z9L A;  2G51 A;  4NIX A;  1XUF A;  1BBR E;  3S9B A;  4ZHL U;  2KX4 A;  1O3L A;  2F9N A;  1W11 U;  1O3H A;  1UTL M;  2Y7X A;  4MNY A;  1VIT G;  1GI4 A;  3NUM A;  1THR H;  2FYQ A;  3UTU H;  3DA9 B;  4FUE A;  3SU1 A;  5DP6 A;  4BAH B;  4FUH A;  3Q77 A;  1YKT A;  8KME 2;  3SHC H;  1UTQ A;  1O3D A;  1P02 A;  1TWX B;  1GCT C;  4ABI A;  1UVU H;  6CHA B;  3FP8 E;  1GI0 A;  1JRS A;  1BRC E;  2KCA A;  2TGP Z;  3UWI A;  3ATW A;  4YOG A;  1ZHP A;  1Y5B T;  5EPN A;  1YM0 A;  3VEQ B;  1GI9 B;  4X8V H;  1GHV H;  1XVO A;  1EZX C;  3UR9 A;  4NFF A;  1EB1 H;  1Z8J B;  1P0S H;  2FTL E;  2G52 A;  1SOT A;  1TNI A;  3MU8 A;  4AN7 A;  3SJO A;  1TPA E;  3BSQ A;  1HNE E;  1C1Q A;  4XRN A;  3PMH B;  1FPC H;  1TQ0 B;  1SHH B;  2UUK B;  1KSN A;  1YCP K;  2BXU H;  1UVS H;  5A8Y A;  5C5N A;  4Y7B A;  2A5I A;  3JZ2 B;  1P9U A;  2QF0 A;  5DP5 A;  4ZKO U;  2JH5 D;  3FZD A;  1AVX A;  1HJ9 A;  1C5Y B;  4JZ1 A;  4FUI A;  1YY3 A;  2GP9 B;  2SGE E;  4U2W A;  4A6L A;  2J4I A;  2PP6 A;  3SV9 A;  1KTS B;  1SFI A;  1NFX A;  3LGU A;  4JK6 A;  2D2D A;  3PMA B;  4Y0Y E;  2ALV A;  3RM0 H;  1ZMN A;  2STB E;  3VGC C;  3KQ5 A;  3RU4 D;  2ZF0 H;  1NN6 A;  4RSP A;  3ZVA A;  2KZ4 A;  1V2R T;  4YOJ A;  1FIW A;  3SQH E;  1PYT D;  3LDX H;  1XKB C;  1Q3X A;  4ZXX H;  2WYG A;  1TQ7 B;  3SUG A;  4D9R A;  2CV3 A;  5EIY A;  4AX9 H;  2BY7 X;  3GCT G;  3QZR A;  5JBC S;  2ZZU H;  3SNA A;  3OYP A;  1P04 A;  2K1Q A;  4O3T A;  1G9I E;  3LIW A;  3VFE A;  1O38 A;  4EST E;  2ZDA H;  2BLW A;  3ZZA A;  1KXF A;  1A5G H;  1O3E A;  1SHY A;  3E0N B;  3K6Y A;  2ODY B;  4Q63 A;  5EQS A;  2ZU3 A;  2CMY A;  1IQL A;  1C5W B;  1H1B A;  4AC9 A;  4IS5 A;  1A46 H;  1XMN B;  1QQU A;  2Z9K A;  4BNR A;  2F9U A;  4HI3 A;  1BCU H;  2WUC A;  4MNV A;  4AFU A;  1QA7 A;  1BT7 A;  4R8T B;  2AIQ A;  1MAY A;  4JCN A;  1C4Y 2;  4WY3 A;  1TNJ A;  2UWO A;  3AAS A;  1NBM D;  3M35 A;  3MO6 A;  4WMD A;  2B9L A;  1V2O T;  1P2O A;  2BQ7 B;  2SGA A;  2W7U A;  1BTH H;  1ZPB A;  1NO9 H;  3MMG A;  5F53 A;  2F9B H;  2FOF A;  2H2Z A;  3FKS D;  1JXP A;  3M5L A;  2A7H A;  2EEK A;  4DY7 B;  4BXS A;  3VB5 A;  1KXD A;  4CRA A;  1DT2 A;  2FS9 A;  2NU1 E;  2VWL A;  2WIN I;  2FLR H;  4ZRO A;  3A8D A;  4UFD H;  1GVK B;  1OWH A;  3ZZ4 A;  2A4G A;  2V3M A;  3U8O H;  6CHA C;  1MUE B;  2FI5 E;  1TON A;  4MPX A;  4X0W U;  4Y71 A;  3AK5 A;  1IQG A;  1L4D A;  5C1Y A;  4JZE H;  3F6U H;  1A5H A;  5JYI A;  1Y5U T;  2ZFQ H;  2RDE A;  1GGD B;  2Z9I A;  4IN1 A;  4OS5 A;  4X2W A;  5JBA S;  3UFA A;  4DOQ A;  1KLJ H;  1P57 B;  1EJA A;  1ELA A;  4ISL A;  3LGV A;  3P95 A;  1Z6E A;  1MZD A;  2F9O A;  4I7Y H;  4DJZ B;  1GCD A;  1BJV A;  1P03 A;  3RC5 A;  1C5R A;  1LHD H;  1TGT A;  1HRT H;  3LH3 A;  1QHR B;  1RIW B;  3DFL A;  3MNS A;  1GI8 B;  2FXR A;  2SFA A;  1GMH F;  2ZCH P;  2XCF A;  3ZV8 A;  1K1J A;  5JBB S;  4NFE A;  3T5F H;  4X1Q U;  3ZZD A;  1O3M A;  1ZYO A;  2J9N A;  1CSO E;  3P70 B;  1KTT B;  1A3E H;  2ANM H;  4GVU A;  2WV9 A;  5DN6 D;  1D6W A;  1AKS A;  2HPQ H;  3BIV H;  2V35 A;  2DUC A;  2ILN A;  1GBA A;  2XBX A;  1SSX A;  1MBQ A;  5GCH F;  3PV5 A;  2SGF E;  1K28 D;  1O3F A;  3A88 A;  1SMF E;  4OM9 A;  5EST E;  1GI6 A;  3FN8 A;  1NZQ H;  1FAK H;  1ORF A;  1S0R A;  2FI4 E;  1GVZ A;  2FIR H;  3BEI B;  1B5G H;  3E91 A;  5LPF A;  1T8M A;  2BZ6 H;  4CRG A;  1Z71 A;  5ESB A;  1XXD A;  3UOP A;  4JMY A;  4XOJ A;  2H9H A;  1CHO F;  1O3A A;  1ANE A;  1V2J T;  2VVU A;  2CN0 H;  2W5E A;  3D65 E;  4X8S H;  4RT0 A;  1O30 A;  1KIG H;  1GJ7 B;  4X1P U;  4YLU A;  1EZU C;  1QL7 A;  2FTM A;  1TGB A;  1RTF B;  4K5Z A;  1AKS B;  1YLN A;  1SGT A;  3HKJ B;  3U1I B;  1AQ7 A;  3SJ9 A;  1ZLR A;  3A8A A;  4K1S A;  2EST E;  3EA7 A;  1SGF A;  3R0F A;  1MQ5 A;  5DP7 A;  4ZXY H;  1S6F A;  1GBB A;  1S6H A;  1CGJ E;  3V3M A;  2VH0 A;  1ZGV A;  1OP8 A;  3TK6 A;  1YGC H;  2VIV A;  1ZPC A;  4K60 A;  5L30 H;  1OWD A;  2ZNK H;  1E35 B;  2OUA A;  1CA8 B;  4MLF B;  4BAO B;  1K2I 1;  1UTM A;  4NA9 H;  2FOA A;  3FFG A;  3DUX H;  3A8C A;  3G01 A;  4AB9 A;  1C1T A;  2BDC A;  3OY5 U;  1HAG E;  1MD8 A;  1FON A;  1ZOM A;  4FUD A;  2BDY A;  5HIY A;  4BAQ B;  2EI6 A;  1C5L H;  2O9Q A;  2Q6G A;  5EOD A;  5DP3 A;  1SKY E;  5T1V A;  3ATK A;  1D3P B;  3RDZ A;  3TGJ E;  1ACB E;  1JMO H;  4UFF H;  1MKW H;  2G5N A;  2R9P A;  4B1T A;  4VGC B;  2QY0 B;  2VVC A;  2ZPS A;  3TH4 H;  1HAV A;  2GX4 A;  4WMF A;  2UWL A;  3SNE A;  4RKJ B;  1O2S A;  1GGD C;  2J98 A;  1P9S A;  4F48 B;  1LVB A;  1ZHM A;  1OP0 A;  1BA8 B;  2Z7F E;  4KTC A;  2P3U B;  2XOK D;  1FN8 A;  1ZML A;  1DXW A;  4B74 A;  2WPM S;  5EU8 A;  1L1J A;  4NZQ A;  3RXV A;  3UB0 A;  1TBZ H;  5A8X A;  1NRR H;  1C1M A;  2FWW A;  4OGY A;  2ZDV H;  2A7C A;  2G55 A;  3CP7 A;  4X8T H;  5PTP A;  2BY5 X;  1BIT A;  1V2U T;  3A8B A;  2ZGX H;  1IHT H;  1C9P A;  4RN6 A;  3M7T A;  4B2A A;  3P6Z B;  1GBK A;  2ZKS A;  2VWO A;  1OWI A;  1UTN A;  1EJN A;  2ZCL P;  1L4Z A;  3ZZ5 A;  1ETT H;  2P3F H;  1V2P T;  1JRT A;  2YNB A;  2VJ1 A;  4LK4 A;  3P8N A;  1NPM A;  2A0Q B;  2CK3 D;  1HAV B;  4MTB A;  3SV2 H;  3GYL B;  4A1V A;  4FOU C;  5T6F A;  1ETS H;  3GDS A;  1SL3 A;  1CGI E;  4HGC A;  3NZI A;  2J98 B;  1MMJ N;  2BZA A;  5TCA A;  2W3I A;  1N8O B;  4ZKN U;  4R0I A;  3RLY H;  1TBQ H;  1C9T A;  5BRR E;  1HLT H;  1FX0 B;  2OBO A;  4Q4L A;  1HV7 A;  3GY8 A;  1O3O A;  1TGS Z;  1P2M A;  5E0G A;  3GOV B;  4GAW A;  5C0T A;  3K2U A;  1EAW A;  3BTE E;  3BTT E;  1S81 A;  4IMQ A;  3VXF H;  4NIW A;  2ZDL A;  4Q7Z A;  2ZWL H;  3V7T A;  2M5T A;  1GJB B;  1UTO A;  2JIZ D;  4Y8Y A;  3BG4 B;  1YPG H;  5LPE A;  1BIO A;  1AI8 H;  1GMD G;  4FUB A;  1VIT F;  3ZYE A;  1F0U A;  5EJL A;  1O32 A;  2Y5G A;  4DGJ A;  1YPK H;  4ZKR U;  2C8Y B;  3SHA H;  3K65 B;  1TRM A;  3PM3 A;  2VVV A;  5ETX A;  4DT7 B;  4CR9 A;  1PQ8 A;  2BVX H;  2JJ1 D;  1EZS C;  1E37 B;  1AWF H;  1CVW H;  1GDU A;  3E8L A;  1T8L A;  2NU0 E;  1ELV A;  1LO6 A;  2CF9 H;  2OC0 A;  4ISI H;  1TX8 A;  2QA9 E;  2FP7 B;  2I6Q A;  2QYI A;  3TJO A;  1V2M T;  4E7N A;  5FHT A;  2H6M A;  4X2Y A;  3U28 C;  3BIU H;  2QIQ A;  1YPH C;  2R0K A;  1PQ7 A;  4Y76 A;  1MQ6 A;  4MPW A;  5BPE A;  3ZZ6 A;  1WU1 A;  4D7G A;  1V2N T;  3MFJ A;  5CHA B;  3LPR A;  2GT7 A;  3LC5 A;  5AFZ H;  4BAN B;  2ZTZ A;  4B71 A;  1EP5 A;  1GI2 A;  1Y5A T;  1ZRB A;  1LKB A;  5FAH A;  3U9A H;  2PW8 H;  5TCC A;  4AB8 A;  1EAS A;  3SUF A;  1YLD A;  1K22 H;  2TGA A;  1S84 A;  1TA2 A;  2BDH A;  1C2E A;  3A89 A;  1VGC B;  2SGD E;  2ZU4 A;  4WME A;  4FET A;  4TPY A;  5EXN A;  8GCH G;  1LPK B;  2JDI D;  2OCV B;  3ENS B;  1DOJ A;  4I8J A;  1FN6 A;  3T62 A;  2BYA X;  1O3I A;  1C2H A;  4NA7 A;  3EGK H;  3AVZ A;  1IQH A;  2DE8 A;  1ANB A;  1DY9 A;  2J38 A;  1BOQ A;  1O2Y A;  3PLK A;  5LGO A;  3GCT F;  3RXH A;  1ELC A;  3GY5 A;  2YNA A;  3MH4 A;  1T8N A;  4OS2 A;  2JH6 D;  4WH6 A;  1OX1 A;  5E0H A;  1WQV H;  3I78 A;  2GKV E;  1P01 A;  2VIQ A;  4CH2 B;  3OFN D;  3VB3 A;  1EQ9 A;  1SQR A;  3HAT H;  4DVA U;  1ZZZ A;  5FCR A;  2A45 B;  2TIO A;  5DO4 H;  2ZDM A;  1TNK A;  2BMG B;  2OC8 A;  3B23 B;  4I31 A;  1OPH B;  4ZHM U;  3OY6 U;  3I29 A;  5DP9 A;  1WAY B;  2RA0 A;  1O2V A;  2P16 A;  1N8O C;  1ANC A;  4JYT A;  1GJD B;  1MU8 B;  3ODF A;  5EQQ A;  4CHA B;  2XCN A;  1E34 B;  4DUR A;  1G37 A;  4CRC A;  2WZQ A;  1NTP A;  5GDS H;  1BB0 B;  5J4Q A;  4HZH A;  1BMN H;  3MH5 A;  4D8N A;  4FUF A;  2J95 A;  4K2Y A;  1XUG A;  7LPR A;  4GHQ A;  4I32 A;  1G3B A;  1H9H E;  3ZVE A;  2RDL A;  5ABW A;  3FZZ A;  3QZQ A;  5GJ4 B;  3HK6 B;  3HKI B;  1NFW A;  1GPZ A;  1V2T T;  1OSS A;  4Y8Z A;  1FY3 A;  1TNH A;  3BTQ E;  3GCH B;  3OEH D;  3H7O A;  3BG4 C;  2PGB B;  5A2M H;  2Z3C A;  3M3T A;  1PQ5 A;  1GHB F;  1OP2 A;  2L6O A;  1AIX H;  2K8I A;  3KHV A;  1G3C A;  5A0B A;  1GJ8 B;  1SGP E;  2VIN A;  3LOX A;  3RU4 E;  2ZEB A;  2AER H;  2KCY A;  1F92 A;  1LVM A;  1A7S A;  1GBC A;  3MU0 A;  1F5K U;  3SZN A;  1C1N A;  1OOK B;  3N7D A;  3A7Z A;  1GJ5 H;  3RXU A;  2VH6 A;  3SJK A;  1IQN A;  1YCP H;  1YPE H;  3EE0 B;  3ATM A;  5CHB A;  4B2B A;  2BY8 X;  1L1N A;  2XBY A;  4RT1 A;  1MTN B;  3SJI A;  3SYJ A;  1VCQ A;  1A1R A;  5T6G A;  2G81 E;  4LXB H;  2PKS C;  1TBR H;  2LPR A;  3RXK A;  2OC1 A;  4HFP B;  4OS1 A;  1AUT C;  2TRM A;  5CHA C;  2Q6D A;  1QBN A;  3SOS A;  1C2I A;  4J1Y A;  4DII H;  1WQS A;  2Y6T A;  3SV8 A;  2XWB I;  4AFZ A;  1HAI H;  1GWA A;  4AZ2 B;  3GS9 A;  2XYA A;  2FYR A;  4NA8 A;  1P06 A;  1TAW A;  3KYF A;  3PYH A;  1E36 B;  3TNT A;  1OWJ A;  1NU7 B;  3SU0 A;  4BXW A;  2W6J D;  1VGC C;  3A83 A;  1KY9 A;  1WXR A;  1NBM E;  1O3B A;  3RXR A;  5JDU B;  4X6N A;  3EA9 A;  1O2U A;  2QAA A;  3HK3 B;  4F55 A;  1C1V H;  3MU1 A;  4I8L A;  3RXG A;  2JKH A;  4YLQ H;  5CMX H;  1VJ9 U;  1EB2 A;  1V2S T;  2KCO A;  5EQR A;  2FEQ H;  2PSY A;  1IQM A;  1QCP A;  1XM1 A;  1P10 A;  2L74 A;  5B6L A;  1E38 B;  3QTV H;  3M5N A;  1TNG A;  3MU5 A;  4SGB E;  5EG4 A;  7GCH G;  1HAO H;  2NU2 E;  1SLX B;  1G32 B;  1RJX B;  3E1X B;  3QK1 A;  4UE7 H;  2WHX A;  1BRA A;  2F83 A;  2ZTX A;  4NWK A;  1W14 U;  1QB9 A;  2P59 A;  2ZG0 H;  5K7R A;  3GIS B;  3F0P A;  1QNJ A;  2FES H;  1C5T A;  4K8Y A;  2PKA A;  1NS3 A;  5KGO A;  1SGN E;  1F5R A;  1UCY K;  2P94 A;  4H6S B;  3F9G A;  1O5B B;  1ID5 H;  1O37 A;  1EOL A;  1FAX A;  2ODP A;  3RU4 T;  4IBL H;  2SNV A;  1E1Q D;  4HG6 A;  3SNB A;  2TBS A;  2HNT F;  3FP6 E;  3P17 H;  1C5P A;  3AW0 A;  1A61 H;  2BD8 A;  1KXB A;  2BX4 A;  4E05 H;  3QGN B;  1HPG A;  1W2K H;  4Z6A H;  3Q00 A;  4WVP E;  3OU0 A;  1ELD E;  1ZSK A;  2Y82 A;  2GZ7 A;  1RFN A;  2TGT A;  4ABH A;  4ISH H;  4YZU A;  3M5O A;  4IN2 A;  3A84 A;  4FU7 A;  4MPV A;  3TK9 A;  1O2G H;  4NCY A;  3QX5 H;  1QQ4 A;  1QRW A;  1GJC B;  2BLQ A;  3ZZB A;  1P12 E;  2PKA B;  2XBW A;  5FXL A;  1H8D H;  1W8B H;  2OK5 A;  3ZZ3 A;  3A7Y A;  1P8V C;  3GCH C;  1C2J A;  5LH8 A;  1GBJ A;  2ULL A;  3D49 H;  1O2T A;  2A7J A;  1INC A;  1AO5 A;  2GT8 A;  7EST E;  4P02 A;  3PTN A;  2GGV B;  4NG9 H;  4JYV H;  2ZU2 A;  2AGE X;  1NFY A;  2FI3 E;  2V3O H;  1DFP A;  2AS9 A;  4NGA H;  1Z8R A;  3DSG A;  4TY6 A;  2PTN A;  1LPZ B;  1PPH E;  1WUN H;  4NWL A;  4RI0 A;  2C4F H;  1O2P A;  3FO8 D;  2ZGC A;  3MNX A;  2J5U A;  1C4U 2;  4K3J A;  1CA0 B;  2Y81 A;  1JIM A;  3MH6 A;  2GMT C;  3S9C A;  1SVP A;  2EQN A;  3BTM E;  3WWB A;  1BTW A;  3MU4 A;  4GLY A;  1DWC H;  5HGG A;  4B6F A;  2OTV A;  2W26 A;  3SU2 A;  4INL A;  4QT8 C;  2ALP A;  4OGX A;  3MQK C;  1C4V 2;  2BVS H;  1QJ7 B;  1TGC A;  3RXI A;  1SLV B;  2KCP A;  3KQD A;  1SGQ E;  2A4R A;  4TYD A;  1DS2 E;  1ZHR A;  1ARC A;  1W0Z U;  1P3C A;  1NU9 A;  1GHB G;  3S0N A;  1SI5 H;  1DAN H;  3BTD E;  1LQD B;  2G5V A;  2HWL B;  2EC9 H;  1VKY A;  2IJD 1;  1BTX A;  1CHG A;  1O3C A;  5K0H A;  3E0P B;  1JOU B;  5L2Y H;  5FL7 D;  4ASU D;  1LHC H;  1DVA H;  2R0L A;  3KQE A;  2Y80 A;  2O8U A;  5DSF A;  2FMJ A;  1W12 U;  4AYV B;  4FVB A;  3U8T H;  5EXM A;  2V3H H;  1MD7 A;  4X1R U;  1YPM H;  3S7K B;  3ZYD A;  3UNR A;  4TWY A;  2FOB A;  4B73 A;  5AFY H;  1G30 B;  1MBM A;  1GMD F;  5DK1 A;  3RXF A;  3NXP A;  1UVT H;  1GJ9 B;  1HJA B;  1P2I A;  3DD2 H;  3MOC A;  1O2L A;  2V6N A;  3BN9 A;  2RFK C;  4GCH G;  2FOE A;  2ZQ2 A;  4INH A;  1TFX A;  2PUQ H;  1WCZ A;  2ZGH A;  1B0F A;  1YPJ H;  3RXM A;  3URC A;  1IQE A;  3ZZ8 A;  1BHX F;  2OP9 A;  4GPG A;  1TAL A;  5C1X A;  1AU8 A;  2ZGJ A;  3UR6 A;  1JWT A;  2FX6 A;  3SO3 A;  2A4Q A;  1UHB A;  2P93 A;  2BY9 X;  3SGA E;  2FX4 A;  2PR3 A;  3VG8 A;  1YYY 1;  5IDK A;  2F9V A;  1MH0 A;  5CDF E;  1MAX A;  3SBK A;  1SG8 B;  1BRU P;  1C5V A;  1J15 A;  3DSP A;  2BOK A;  1EUF A;  1HYL A;  5KEC A;  1GBI A;  1V2L T;  1BUI A;  2J92 A;  1S0Q A;  1GI5 A;  4K1E A;  4IC6 A;  1O2M A;  4Y0Z E;  1FDP A;  2ZO3 H;  3VXE H;  1EX3 A;  1NRQ H;  3PV4 A;  1ZTL A;  2V7Q D;  2ZIQ H;  4YM9 A;  3UPE A;  1EPT A;  1IAU A;  4BTI B;  4ZKS U;  1PPE E;  3PB1 E;  3ITI A;  1UHB B;  1OWK A;  3ZZ7 A;  8GCH F;  1GI3 A;  5DPA A;  3KNX A;  1O5G H;  3EDX B;  4A1T A;  2VWN A;  4WWY A;  1HB0 B;  1Q2W A;  2HVX A;  4AG1 A;  1DXP A;  3R3G B;  4A7I B;  1F2S E;  4ABB A;  3KEE A;  4U32 A;  1VR1 H;  1WV7 H;  1C1S A;  1O39 A;  4K8B A;  3RC6 A;  1A0L A;  1AD8 H;  2H5D A;  4XFQ A;  1TRN A;  1Z8I B;  1Y3V A;  4A5T S;  2LEL A;  2RCE A;  3ODD A;  4Y11 E;  2EI7 A;  4D7F A;  4FUJ A;  5H4I B;  4A1X A;  3TGI E;  2F91 A;  5JPM H;  1T31 A;  1EPT B;  1MZA A;  1H8E D;  3TGK E;  1DPO A;  2QXG A;  5AVD A;  1GVL A;  5IYT A;  1NY2 2;  1D9I A;  3O8D A;  1AN1 E;  1IOE A;  4BTT B;  3B8J A;  5HM2 A;  2QV1 A;  4Q2K A;  1BQY A;  2CHA B;  3PMJ A;  1EAU A;  3Q3Y A;  2AHM E;  4XDE A;  1LHF H;  3JZ1 B;  3QGJ A;  5J4S A;  4JZI A;  2R2W U;  2BM2 A;  4CBN A;  1YC0 A;  2DE9 A;  1HFD A;  5FPY A;  3SJ8 A;  1HAH H;  1V2V T;  1COW D;  4LZ4 B;  1MTV A;  3DT0 H;  1SQO A;  2ASU B;  2NU4 E;  2ZA5 A;  1A5I A;  4FVD A;  2JJ2 D;  1FZZ A;  5DKM A;  1OXG A;  2VIW A;  2B7D H;  4AYY B;  2KR7 A;  4BAM B;  2WPK S;  1RIW C;  1TYN A;  2IJO B;  2PTC E;  3P8F A;  1LDT T;  3KID U;  3LON A;  2IPH A;  1M9U A;  5C20 A;  3SQE E;  4Q7X A; 
#chains in the Genus database with same CATH homology
 2KCO A;  5EQR A;  2A4G A;  2OC8 A;  3W1E A;  5EPY A;  4B76 A;  3L6P A;  4I31 A;  3AK5 A;  3WWB A;  2V7Q D;  2YMS B;  3O8R A;  5B6L A;  2JIZ D;  3OEE D;  4I33 A;  3M5N A;  3F3B A;  4B6F A;  3SU2 A;  1CU1 A;  2O8M A;  2YOL A;  5EQQ A;  1RTL A;  2XCN A;  2WHX A;  2VBC A;  3PV2 A;  4NWK A;  2KCP A;  3SV6 A;  3SV9 A;  2WZQ A;  1W0J D;  2A4R A;  3KNX A;  4TYD A;  1H8H D;  1E79 D;  2P59 A;  3OAA D;  3WW7 A;  5ETX A;  4A1T A;  3F0P A;  1MAB B;  5FPT A;  3O8C A;  2WSS D;  1SKY E;  2JJ1 D;  5T1V A;  1NS3 A;  1W3C A;  3OE7 D;  1W0K D;  3RC5 A;  4I32 A;  1DXP A;  3SU5 A;  5GND A;  2KZ4 A;  2QF5 A;  2OC0 A;  1S6L A;  2IJD 1;  2W6I D;  3KEE A;  3PRD A;  2FP7 B;  5GJ4 B;  4K8B A;  4WH8 A;  3LKW A;  3RC6 A;  4A92 A;  2XCF A;  3F2H A;  4YXW D;  1E1Q D;  2F4L A;  3SUG A;  4TSF D;  2YMS C;  5FL7 D;  3F2F A;  3OEH D;  4ASU D;  2LEL A;  2OIN A;  3EYD A;  3N99 A;  2QE7 D;  1EFR D;  4B75 A;  1N1L A;  2L6O A;  3OYP A;  2K8I A;  4KTC A;  5H4I B;  3OTP A;  2KM0 A;  4A1X A;  2XOK D;  2WV9 A;  3LOX A;  5DSF A;  2K1Q A;  3SUE A;  3NRL A;  5DN6 D;  2KCY A;  3FOA A;  4XD7 D;  4B74 A;  1DXW A;  1H8E D;  2FM2 A;  4B71 A;  3UB0 A;  1E1R D;  3DCL A;  3U1J B;  2F43 B;  2KFW A;  3M5O A;  3N7D A;  4Q63 A;  4WF8 A;  3SU4 A;  4M9F A;  3SV7 A;  5EQS A;  3RC4 A;  3SZE A;  3O8D A;  4B73 A;  5C0U A;  1BMF D;  3SUF A;  3PV5 A;  2QV1 A;  2WPD D;  4OM9 A;  5CHB A;  3M5M A;  5IK2 D;  3FN8 A;  2AHM E;  5HKK D;  4FET A;  3F0O A;  1OHH D;  2OK5 A;  3SYJ A;  2QF4 A;  3O8B A;  2F9U A;  1A1R A;  2M2A A;  1BT7 A;  3SU1 A;  2XND D;  4R8T B;  5ESB A;  4ZCN A;  2HLD D;  3P8N A;  3P8O A;  2CK3 D;  5FPS A;  2K0Q A;  3F2G A;  2JDI D;  5FPY A;  2OC1 A;  4JMY A;  4Z1M D;  4U01 A;  1COW D;  4A1V A;  5C17 A;  1NBM D;  2FOM B;  2KCA A;  3N7E A;  2GGV B;  3WWF A;  2A4Q A;  1DY9 A;  5EPN A;  3DSO A;  2JJ2 D;  3ZIA D;  3SV8 A;  3VG8 A;  3H09 A;  5F53 A;  5IDK A;  2KR7 A;  2F9V A;  3SU3 A;  3M5L A;  3FKS D;  1JXP A;  3GS9 A;  3U1I B;  1FX0 B;  2OBO A;  2OC7 A;  4Q4L A;  1KMH B;  3SUD A;  2IJO B;  5CDF E;  4B6E A;  2GVF A;  1RGQ A;  2XNI A;  4NWL A;  3DSP A;  4RI0 A;  5GPI B;  3SU0 A;  2W6J D;  4WH6 A;  3SU6 A;  3FO8 D;  3LON A;  5C0T A;  3KF2 A;  1WXR A;  1NBM E;  3OFN D;  2YMS D;  4TT3 D;  3KN2 A;  2J5U A;  3PRB A;  4F55 A;  2OBQ A;  4DT4 A;  3E90 B;  1DY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...