3F2FA

Crystal structure of the mercury-bound form of merb, the organomercurial lyase involved in a bacterial mercury resistance system
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
208
structure length
208
Chain Sequence
MKLAPYILELLTSVNRTNGTADLLVPLLRELAKGRPVSRTTLAGILDWPAERVAAVLEQATSTEYDKDGNIIGYGLTLRETSYVFEIDDRRLYAWCALDTLIFPALIGRTARVSSHCAATGAPVSLTVSPSEIQAVEPAGMAVSLVLPQEAADVRQSFCCHVHFFASVPTAEDWASKHQGLEGLAIVSVHEAFGLGQEFNRHLLQTMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alkylmercury lyase
publication title Crystal Structures of the Organomercurial Lyase MerB in Its Free and Mercury-bound Forms: INSIGHTS INTO THE MECHANISM OF METHYLMERCURY DEGRADATION
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 61
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 4.99.1.2: Alkylmercury lyase.
pdb deposition date 2008-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03243 MerB Alkylmercury lyase
A PF12324 HTH_15 Helix-turn-helix domain of alkylmercury lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.490 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3f2fA00
3F2GA 3F2FA 3F0OA 3F0PA 3FN8A 5C17A 5DSFA 5C0UA 5C0TA 3F2HA
chains in the Genus database with same CATH superfamily
1D6RA 2TRMA 2GMTB 3TNTA 2ZTZA 1KXDA 2VIWA 2O8MA 1ARCA 2ESTE 1D6WA 4ISIH 3H5CB 3DSOA 1PYTD 4Z1MD 1QJ7B 2FODA 1VJAU 2AEIH 3QLPH 3HGPA 1F5RA 3U9AH 3PMJA 3MTYA 5FPYA 2KCPA 2Z6BD 4J1YA 2ZFSA 4R0IA 4Y11E 1YM0A 3URCA 1E1RD 2BYAX 1UK2A 1FAKH 1BMNH 4GHTA 1GJDB 4I32A 2FOFA 2WUBA 4X8SH 5HMAA 3FVFB 2FTLE 1Z6JH 2VBCA 1S5SA 1F7ZA 3Q3XA 8GCHG 1HAOH 3HK6B 1LPGB 1DSTA 5I46H 1GBIA 2GT8A 4X1NU 1OP0A 3AAUA 4AZ2B 4F48B 2B0FA 2PV9B 4GCHF 1ORFA 1UVSH 5DP5A 1SGQE 3ZZ5A 4Y79A 3QK1A 1OYQA 3RXOA 1X7AC 3DSPA 3ZVFA 4XBDA 3LGWA 1TOCB 1ZHRA 2ZHWH 1O32A 1P04A 4MNXA 3RMLH 2H9TH 2M5TA 2SNVA 2BDBA 3MO3A 6GCHG 1W0JD 2KR7A 1Y3WA 2GMTC 1QL7A 3OE7D 2O9QA 1HAVB 2ODQA 2VIPA 3QGJA 2BDIA 1CA8B 2PWXA 4NA8A 2FYRA 1P09A 1UHBA 1HRTH 2ZFPH 3Q3YA 3SQHE 2FLBH 2FOEA 3SGQE 1MQ6A 5FL7D 1DVAH 1NFXA 1GL0E 3EGKH 4ZXXH 3OY5U 2B5TB 5JPMH 3I29A 1SVPA 1OWIA 1SLUB 4KKDA 1O2KA 5IYTA 1LQDB 2VIQA 3W94A 1ZPZA 4WWYA 1KXEA 4Z0KA 4JZFH 4ABBA 1UO6A 1HUTH 1PQ7A 1DWBH 1V2TT 2VVCA 3LONA 5A2MH 1S6HA 1CE5A 4DT7B 1BTHH 1UTMA 1ZGIA 1YCPM 1Z6EA 1Z1IA 4D76A 1TPAE 2HPQH 1HAZB 2ZDKA 5A8ZA 4B1TA 1V2ST 3SBKA 1TX8A 3SU3A 4DIHH 1G3DA 1WUNH 4AG1A 1D3DB 2WPLS 1CO7E 1FY3A 2GD4B 1MCTA 1EX3A 1T8MA 3RP2A 1W13U 3S9BA 1GHXH 3B23B 3L3TA 5PTPA 4KGAA 3A7YA 5EG4A 3MH7A 3ZZDA 2BY7X 3URDA 4ASUD 1LKAA 1HAHH 1SBWA 1ZR0A 2KCOA 4X6MA 5TCCA 2F9UA 2OINA 3MU8A 1IQNA 2DE9A 1OWJA 2OK5A 1P12E 1A3EH 1ZTLA 1UVOA 4A1TA 5DN6D 5EQSA 2VWNA 2AYWA 2F91A 4B2CA 4NSVA 2P95A 1GBLA 3PLPA 2OP9A 1G3BA 2PP6A 3RXHA 1DPOA 3GY6A 1P2JA 3SU0A 1O2LA 2QY0B 1GJ9B 2XCFA 1O5EH 1ZSKA 1ZOMA 2I6QA 3RMNH 4MVNA 4ACBA 4JZEH 5GCHG 5EU8A 3ATWA 1MAYA 1OWDA 3WW7A 2HLDD 1F5KU 1YGCH 3BTKE 1BIOA 4I31A 3SNAA 2OQ5A 4Y8ZA 2OXSA 1NRPH 4BANB 3A7TA 1BMAA 5JB8S 2FO9A 1V2JT 3F1SB 3LPRA 5F8ZA 2ANWA 4JYTA 4CRGA 3SO3A 1IHSH 1NN6A 3LC3A 5CDFE 1V2VT 3SJ9A 3PMBB 3RXSA 3NKKA 2ZNKH 3C27B 1INCA 1VITG 2JH5D 3F0OA 1TMTH 1O2OA 4B76A 2GJGA 4FUHA 4I8HA 1EFRD 3IWMA 4ZH8A 1BOQA 3M3SA 3UUZA 3UPEA 1HFDA 2GT7A 1SGDE 1ELVA 3LOXA 2BD7A 3NRLA 5F6MA 3QZRA 3S7HB 1SHHB 2G4UA 5EOKA 1H8IH 1RS0A 3RLYH 4F55A 2FLRH 5ETXA 4BAQB 1O2GH 1QBVH 2ZCLP 3UTUH 1AZ8A 1AU8A 2FI3E 5C20A 2NU1E 3RXMA 2BDGA 2TGPZ 1IQFA 2ZU4A 4UONA 1K21H 1T8LA 4CH8B 2SGPE 1PPFE 1G2LA 1ZGVA 3WY8A 4YO9A 2RCEA 1Y8TA 2PHBA 1ESAA 3A87A 2A45B 3SW2B 4OS1A 4Z6AH 1ZPBA 3F9HA 1MCVA 1SGIB 2K0QA 2CGAA 1HAIH 1NY22 2QC2A 4DURA 5A0BA 5A8YA 4Y7AA 2M2AA 3BTFE 5EJZA 4FUGA 2GV6A 2PR3A 2EQNA 2R0LA 2ZTYA 3BEFB 3H7TA 5ABWA 3RU4E 3D49H 4AORA 1SGYE 2F43B 1COWD 1QJ1B 5EPNA 3E90B 4LOYH 2A7JA 1NZQH 2RG3A 2C90B 1O3EA 2ILNA 4K2YA 1RFNA 1WDIA 1AY6H 3N7EA 1QJ6B 1O39A 3PV2A 6CHAB 3KEEA 4JZIA 4NIYA 2ZU3A 3OTPA 3K9XB 2J38A 2HPPH 1IQKA 2Z94A 1T8NA 5HIYA 4GVUA 2LPRA 1MBMA 1SOZA 1CGHA 1HJ9A 3U28C 2W6ID 1BTXA 4FXGH 2WPDD 1VKYA 2F9PA 2HVYB 1A0HB 3TJVA 5BPEA 1EAXA 3NCLA 4ESTE 3M5NA 5AHGH 1QURH 1UTJA 2H9HA 2O8LA 2ZI2H 1RTFB 4TY7A 2YMSB 4X2VA 1ESBA 2SGQE 3CS7A 1BTZA 2IJD1 3D65E 4XSKU 2BVRH 2KAIA 3MU1A 4XE4A 4FU9A 1K1MA 2PUXB 3ZZAA 4I8JA 2ZEBA 2AIQA 3MH5A 3TK9A 3PLKA 5JB9S 1O5FH 2ZKSA 4AB9A 5E0JA 3B9FH 4TT3D 1EUFA 3EA9A 5A09A 2Q6DA 1C5ZB 2HWLB 1P10A 1F5LA 4K8BA 5L2YH 5K7RA 3VB5A 1NS3A 3I77A 1IQJA 1SG8B 1T8OA 2GZ7A 1V2WT 5KEDA 5DJ7A 1DE7H 1P02A 1GHVH 2BDCA 3SV8A 7GCHF 3VXFH 6CHAC 2YOLA 4IN2A 1L4ZA 3VEQB 3QN7A 1XUFA 2J94A 1QA7A 1K1LA 1Z1JA 2Y5HA 5FCKA 1YPMH 2GZ8A 4AX9H 4ABDA 2Y7ZA 1V2QT 1QBNA 1EZXC 2PKSB 2OC7A 4XBCA 2A4OA 2H6MA 1C2JA 1FZZA 1V3XA 1Y3YA 2D26C 3OSYA 4WF8A 1JRTA 3U1IB 9LPRA 1MTUA 2BVSH 1GCTB 1J17T 2XNIA 4NFEA 2ZA5A 2ZHDA 2KCAA 1C4Y2 2YMSC 2J95A 1H4WA 2OD3B 3A81A 4E05H 4GPGA 2VIOA 1ELAA 2JH6D 1WSSH 2A7HA 1O3AA 2KZ4A 5T6FA 1GBCA 1O3LA 4K1TA 5BRRE 2BTCE 1EZQA 1EZUC 1YBWA 2KX4A 1TMBH 3ENSB 1FPCH 1MQ5A 3RXEA 1TNLA 1GVZA 1QRXA 2C3SA 1T4UH 1GHAF 3ZVGA 1SB1H 1P01A 2AS9A 3PRBA 1BTUA 2WV5A 2ZFRH 3FZZA 2GX4A 3MH4A 4F49A 4OGYA 1RJXB 5CMXH 1BMMH 3P92A 3FO8D 1XUHA 1DANH 1F0TA 3RXFA 3F2HA 1PPCE 1NPMA 2F9BH 4GSOA 1W7XH 3RXVA 2PKSC 1D9IA 2GP9B 2BHGA 5C94A 3UQOA 4K60A 1FNIA 5E0HA 3OFND 1SMFE 3MMGA 1GCTC 2WINI 1N1LA 2ZTXA 3TH3H 1F0RA 1B0FA 1SGTA 2OTVA 3PTNA 3SU6A 5FBIA 1O2RA 1C2HA 4Y10E 2PUQH 1O5BB 3AW0A 4YTAA 1SLXB 3IG6B 1TGBA 1AUTC 3KIDU 3P8FA 2EI6A 1V6DA 1WYKA 4BTIB 1EJNA 3KGPA 4Y8XA 3MU0A 5DPAA 4K3JA 2ZQ1A 1EPTB 1TBZH 2BX4A 1ZMNA 4MDSA 2R2WU 3BIUH 1GHBF 2SNWA 4AFZA 1OWEA 3M5OA 3A7WA 4Q2KA 4ZUHA 1GMDG 4A5TS 2P3TB 3RUOA 4CRFA 4JYVH 5EXMA 5A0CA 3OX7U 4ABHA 1JBUH 1FY1A 2LELA 3MH6A 3JZ2B 2WSSD 4OS7A 1GDQA 3WWBA 1BBRK 1BUIA 1O5DH 2RDEA 4YLUA 1TPSA 3KF2A 1KYNA 1W7GH 2ANKH 5DP9A 3GY2A 5L2ZH 1O3CA 1LHGH 2OUAA 1GDUA 4ZMAH 1YKTA 3AVZA 1O37A 3M5MA 3ESTA 3LJJA 1BZXE 1MKXK 3O8DA 1J15A 4DT4A 2K8IA 3IITA 5E0GA 2H1UA 1YCPK 2VVUA 1ZPCA 1U6QA 1TQ7B 2A5AA 2WYGA 1O3PB 1RIWB 1W0YH 3SUEA 2BD5A 1O3NA 1OX1A 3FN8A 3ATMA 1HAGE 3LJOA 1DS2E 1SGNE 2RFKC 4DG4A 4UFDH 4ZROA 5HM2A 1V2NT 3CNRA 1DOJA 2CXVA 2ZPQA 5EQRA 1BA8B 3NZIA 1B7XB 1AVWA 1BMFD 1C4V2 2W6JD 4FUDA 4B73A 1NRSH 1G36A 1E1QD 1EPTC 3UOPA 1GI6A 1UTKA 2RA0A 3GY5A 2FI5E 1SPJA 3E3TA 1O2VA 2A7CA 2DE8A 4X1SU 5FPSA 1KTTB 1BRCE 2B8OH 4BAHB 1GI3A 2C4FH 2BMGB 2A4GA 1AFEH 4WXIA 4DGJA 1UVTH 2G55A 4XFQA 5DO4H 2PSYA 1HIAB 1NRQH 1UTQA 3F0PA 2CV3A 1UW7A 2GTBA 1O3KA 3TGKE 1UVUH 1NBMD 1TPOA 2UUKB 1YP9A 3CP7A 3EDXB 2Z9KA 1P3EA 1KLTA 4WH6A 5L30H 1ZMLA 3N7OA 1RIWC 1LDTT 2P94A 3P70B 4B75A 1FLEE 2XBWA 5F8XA 1GJCB 1HAYB 2EY4C 1FUJA 4Y0ZE 4ZKSU 3NWUA 1BDAA 3MFJA 3KQEA 4O03A 1CHOF 3M36A 3SHAH 1ID5H 1GJ7B 4FUCA 3RM0H 5A8XA 1TALA 3NUMA 2Y6TA 1A5GH 5J4SA 3KYFA 1V2MT 1ARBA 1VITH 3GY4A 5FPTA 4TSFD 2G52A 4BAMB 1GG6B 3RDZA 1QB1A 3ZVCA 1AWFH 1P11E 5A0AE 5IK2D 2OC8A 1GHYH 5EW1H 2XTTB 1GL1A 1C5XB 1H8ED 4M7GA 3TH2H 3F9FA 5AFZH 1SQOA 1WXRA 2SFAA 1TNIA 4ABAA 2FDAA 2FI4E 4JYUH 1SGFA 1C5RA 1O2QA 1Q3XA 1MU8B 3QUMP 1C2FA 2IPHA 1PPBH 1UTLM 3QTOH 2BB4A 1E37B 5JBTA 1G30B 2O8TA 2QN5T 1SC8U 3HATH 4P00A 1D4PB 4YXWD 1DX5M 4AFSA 1EXFA 1FN6A 1P03A 1Y59T 1EPTA 2ULLA 1ZTJA 4WXVA 1QRWA 3UNRA 3F68H 3G01A 3ZVAA 2ZCKP 3SUFA 1FN8A 4X8UH 3VGCB 1DWCH 4Q7YA 1O30A 2G5NA 2ZHQH 3LIWA 2FPZA 1UJ1A 4HZHA 2NU2E 3LGVA 2AMPA 3M35A 4OS2A 1S85A 1TRMA 2P16A 2ZO3H 5JBAS 1GG6C 2WHXA 5C3NA 5KECA 4E06H 4NWLA 3A88A 1SHYA 4XD7D 4O3UA 1TX7A 2XBYA 1P05A 2A1DB 4AB8A 3PV4A 2CMYA 2VWOA 1EJAA 4CRAA 4DVAU 1XXFA 1HAXB 4IW4E 1G9IE 2ZDAH 3UFAA 4A92A 3SNEA 3FP7E 1HB0B 2ZC9H 1O3IA 5IDKA 1C1OA 2BX3A 1W0KD 2ASUB 1MD7A 2ZDVH 3BF6H 1BTPA 2J34A 2XRCA 2GCTB 1P9SA 1XX9A 1TRYA 1C5MD 2WPIS 3RU4T 5EGMA 3BV9B 1YLCA 5J4QA 4MQAA 1MZDA 2VWLA 5E8EH 3ELAH 2YNBA 1O5GH 3TJOA 4CRCA 2ZDMA 4FU8A 1ZHPA 1F2SE 3Q3KA 4RT0A 1GBEA 1P9UA 2ZHEH 5F8TA 2XC5A 4MLFB 3A83A 4X0WU 1FXYA 3SUGA 2HGTH 2BY8X 2OC0A 3VGCC 4MPWA 2Z9LA 1GMHF 3KL6A 3OY6U 1H9HE 2KAIB 3A86A 5T6GA 2G5VA 1CHGA 4H6SB 1SQTA 2THFB 5EIYA 1Y3XA 2QA9E 1A3BH 2Q1JA 2V0BA 5HM9A 1HIAA 1TFXA 2VWMA 1TAWA 2IJOB 3SU5A 3C1KA 1AFQB 4MG3A 4X6PA 1LTOA 1IQIA 4INKA 2PKAA 5DGJA 1O2MA 3AASA 3RC6A 3R0FA 1O2UA 1NRRH 5JDUB 4THNH 2HOBA 4H6TA 1YF4A 1DUEA 1LHFH 3KQCA 3TITA 1HAPH 1GHAG 2QF5A 3TK6A 2UUFB 1ZSLA 3GISB 5EJLA 4JMYA 2GCTC 1CT4E 4B6FA 5FX6A 1QB9A 5H4IB 1A5IA 2D2DA 2D8WA 3PRDA 1RXPA 4JK6A 1C1RA 1ZZZA 9ESTA 1CGJE 4ASHA 1C2MA 1E0FD 2FOGA 4I86A 2ZIQH 3A8AA 1ANCA 3VXEH 3SHCH 1GI0A 2EI7A 1GJ8B 1O2NA 1TNJA 3BG4B 7LPRA 2VVVA 3KCGH 2ZCHP 5DP4A 3A82A 3MWIU 1FV9A 1FMGA 3GDUA 1ZRKA 1T32A 2GZ9A 1DITH 2KM0A 1EAUA 3RXUA 3ZVDA 1AFQC 3OEHD 2QCYA 5JBCS 1DXPA 1VGCB 2FS9A 4OM9A 1W11U 1A2CH 5B6OA 1HXEH 4NZLA 1P2IA 1C1TA 1AGJA 3OTJE 2QF0A 1EJMA 1O2TA 3OYPA 5HGGA 3B8JA 1GHBG 1YPEH 3N7DA 4OS6A 4HTCH 4SGAE 1C5LH 1EB2A 3T62A 1HLTH 1BBRE 1DY9A 1S82A 2A5IA 3DUXH 1PQ8A 1QQUA 1SQRA 2GDDA 4FUIA 5HYOA 3GOVB 2JDID 3MHWU 2QXIA 1AHTH 1F0UA 1SLVB 4NWKA 5T3HA 3PWBA 1Y3VA 2EA3A 1LQEA 4MNVA 3VPKA 1UCYK 2TGDA 4Y71A 2FOCA 1Z71A 3BG4C 1DUAA 3S69A 4AYVB 1MTSA 4KP0A 3RXKA 2AMDA 2FS8A 1HCGA 1LPZB 2Z7FE 3Q76A 4GHQA 1T4VH 2FWWA 4O3TA 3K2UA 1H8DH 1THRH 3M5LA 2STBE 3SU4A 2XWAA 2WYJA 1C1MA 3U8RH 3ZIAD 3GCTG 1O31A 1VGCC 1ELFA 2ANYA 2C93B 4CREA 4FUJA 4MNYA 1GPZA 1O5CB 1ABIH 5F53A 1C1QA 2Z9JA 8GCHF 1ELBA 2BXUH 3LKWA 1NU7B 1YWUA 3QO6A 1XVOA 1QL8A 1P0SH 2ZDLA 1KMHB 4TPIZ 4ISOA 5FX5A 1OHHD 1JWTA 2STAE 1BCUH 1DXWA 2H5CA 1UTOA 1RGQA 3A8BA 2AIPA 5F03A 3A8CA 3FP8E 1BBRH 4Y0YE 5EXLA 1MD8A 2W26A 1C4U2 4CH2B 2ZGHA 6GCHF 4IMQA 1GJBB 4YLQH 3UQVA 4PROA 5EPYA 3V3MA 5HKKD 3SGBE 1MKXH 3T5FH 2BLWA 5TCAA 5EQQA 5AVDA 1QQ4A 1YCPH 1DLEA 1GI2A 1L1JA 2ZG0H 3ITIA 2ZGXH 1L1GA 2A31A 2NU3E 4YESB 1HYLA 1S0QA 4VGCB 1KXAA 4MPXA 4X1PU 1TB6H 1TNHA 2BD9A 4IMZA 4ABFA 2UUYA 2UWPA 3SJOA 1BRBE 4GUXA 5T6DA 2FOAA 3QGNB 1C1WH 4DY7B 1GI4A 1GGDB 1V2UT 1C5OH 3T26A 2P3UB 1FPHH 1CHOG 1TQ0B 1O3OA 1A0JA 3RXTA 4U30A 1F92A 2P59A 3SZEA 1JMOH 2BDAA 2ZU1A 3UNSA 2UWLA 2ZHFH 1BT7A 1BQYA 4OS5A 1DFPA 1EOJA 2FEQH 1VCPA 2XC4A 1CT0E 1WU1A 3T28A 5DP6A 1FI8A 2HNTF 1D3TB 2OC1A 3MOCA 3PO1B 5SGAE 3PMHB 3VG8A 1QB6A 5DSFA 3F6UH 2A2XH 2XBXA 4DJZB 3T27A 1BRAA 2I6SA 1C5VA 2FMJA 1AD8H 1ETSH 5KGOA 3CS0A 1ELDE 1ELGA 1NO9H 3LGYA 4CRDA 3RMOH 3M7QA 3EA7A 4FVBA 1L4DA 3MU4A 3RXLA 2PGBB 1TPPA 3U98H 3GY3A 4UD9H 3A89A 2TBSA 1GJ5H 4GCHG 2V3MA 2UUJB 2OBOA 1JIMA 4VGCC 4U01A 3UNQA 5LGOA 2XC0A 1BHXB 1TLDA 4ISNA 1BHXF 3VB4A 1WQVH 1G2MA 1GWAA 1G3CA 1PYTC 2P8OB 1GGDC 2QYIA 2SGDE 3ZZ4A 2BY9X 3S9CA 3UREA 1BRUP 3GY8A 2ZGBH 4OS4A 4MPVA 1SI5H 3SJ8A 4A6LA 2BVXH 1WBGB 2FOHA 4LXBH 5LPFA 1KY9A 1O2XA 1V2OT 4KTCA 1H9LB 1P2KA 3T25A 1HPGA 2HNTC 5CHBA 3PO1C 3MNSA 3KQDA 3PROA 1QFKH 1XUGA 2VU8E 1ANEA 7KMEH 1EASA 1LVMA 5GIBA 4NIWA 2CHAC 5CHAB 3UOUA 4X6NA 4XRNA 1ABJH 1ELEE 3RXCA 1WQSA 2W5EA 2PFEA 2C8WB 4BOHA 2P93A 1SSXA 2ZGCA 2BOKA 2ODYB 1E79D 4ZKRU 2HNTE 1LHDH 5LPRA 1Z7KA 3KN2A 4RKJB 1QCPA 1A1RA 2IN2A 1AIXH 5FXLA 2AERH 1SQAA 1P06A 4R8TB 1UTPA 1TE0A 2ZECA 1SR5C 3BTDE 1OOKB 3F9GA 3EA8A 1P2MA 3TK5A 4BTUB 2A4RA 3FAOA 4Y76A 4ABGA 2L6OA 1FY5A 2P8OC 2Q6FA 3K65B 2V35A 4MNWA 5ESBA 1A0LA 2ZFFH 5HIZA 2J92A 2ZDNA 1GMHG 1JRSA 2QGRA 2VIDA 2XW9A 1KXCA 2Z9IA 3GY7A 1GI5A 3SI4H 1C5SA 3OU0A 2C8ZB 3LGTA 1C2KA 3FANA 3U1JB 1GBFA 3SNCA 4CHAB 3F3BA 3BIVH 4HFPB 3T29A 1O33A 1DWDH 1O2HA 1CVWH 5B6LA 8ESTE 2HLCA 1TX6A 3SJIA 3HGNA 3ZVBA 2SGFE 3M7TA 4AGKA 1G32B 4RT1A 1H9IE 3ODFA 1EZSC 5CHAC 1A7SA 3SORA 1C1SA 3LH3A 2FP7B 1NFYA 2Y5GA 5HXFA 2XNDD 4K69A 3S0NA 3BG8A 3DT0H 1Q2WA 4IC6A 2PSXA 4Q4LA 2G8TA 1MKWK 5FBEA 1P2QA 2VINA 4F4OC 1MU6B 2ZU2A 5C1UA 4AFUA 3EAJA 1MTVA 5E2OA 1FQ3A 3I78A 4Y6DA 4YM9A 4FU7A 1C2EA 4Y8YA 5C1YA 1SGRE 3RXBA 2HVXA 2FTMA 3DSGA 1CGIE 2WZQA 3BTME 3A85A 1K1PA 2ODPA 1WTHD 1O2WA 2PGQB 2F9OA 4UFGH 3BTHE 2J98B 1P57B 1MZAA 2WPHS 1QHRB 5GJ4B 5JBBS 2YNAA 2GDEH 1TIOA 1YPHC 3MO6A 2Q6GA 1FIWA 1OKXA 3BEIB 1MABB 1HJAB 4BAKB 2BZAA 2CF9H 4XBBA 1S0RA 1CSOE 1P8VC 4CHAC 1NM6A 1XXDA 2PKAB 2VH0A 4Q80A 5CE1A 1YPJH 3PTBA 1O3BA 1KXBA 8LPRA 1NC6A 5GWZA 2H9EH 4A7IB 3MNBA 1GDNA 3RXRA 2YMSD 2CJIA 1OS8A 4DW2U 2B9LA 3GICB 3K6YA 1YPHE 1DDJA 4KTUA 4ACAA 1D3QB 2IOTA 2WV9A 3SOSA 1G3EA 4YT7H 1QRZA 1Z8RA 4DCDA 1AQ7A 4CRBA 1PPHE 2Y7XA 1SGEE 4NIXA 3AW1A 3HKJB 2F3CE 3PLBA 1TGTA 4TYDA 3U69H 1P2OA 1XUJA 1DT2A 4YOIA 2V7QD 1TNGA 4ZHAA 3T2NA 1UCYE 2BLVA 3BSQA 3A8DA 2WV4A 1O3DA 3BN9A 2OCVB 1DICA 3M3TA 4B6EA 4WMFA 3SJKA 1JOUB 1LPKB 1Y5BT 3AAVA 1NU9A 5C0UA 1MTNB 3V0XA 4MTBA 3VB6A 1E35B 1SL3A 1C1NA 2BLQA 1LHCH 3ATLA 4YZUA 2TGTA 4ABEA 2XBVA 3SV9A 1CU1A 3GCHB 1AWHB 3GYMA 1O2JA 1HJAC 2EEKA 3N99A 5GXPA 3FKSD 3UAIC 4BXWA 4NSYA 1B0EA 2BD8A 1BJVA 2VB0A 2CF8H 1PQAA 1QTFA 2L74A 3EQ0H 2JETB 1EP5A 5LH8A 2NU4E 1TGNA 3NPSA 3UIRA 2G00A 4K8YA 4NCYA 1BTYA 4D9QA 4D9RA 4I8GA 1W12U 2QXJA 4INHA 1K1NA 1DLKB 4TY6A 2BD3A 1Q31A 2EC9H 3LGUA 3GDSA 2ZP0H 2LNCA 4UDWH 1H1BA 4BNRA 3HKIB 3GCOA 3MNCA 1W14U 1XM1A 1IOEA 1S6FA 1A5HA 2V3OH 3LC5A 3BTQE 1Z8JB 1CA0B 1VR1H 1YPKH 2Z3CA 1NFUA 1TA2A 2TGAA 3DFLA 4JCNA 1N6XA 2J9NA 3LGIA 1MTNC 1UCYH 1IQEA 2J4IA 4AN7A 4CBOA 2HRVA 4P02A 1PJPA 6ESTA 1LCYA 4KTSA 1O34A 3BTWE 4QT8C 4FVDA 4ZKOU 4O97A 1VJ9U 3GCHC 1P3CA 2HALA 1CQQA 3P17H 1THSH 2AGIX 1XUKA 2ZGJA 3ZZ9A 1TGCA 7GCHG 4FUFA 1GCDA 2PTCE 5L6NH 4RSPA 2QF3A 3MQKC 1LMWB 3UR9A 2AMQA 7ESTE 3BTEE 3TJNA 1O2PA 2XCNA 3E0NB 2NU0E 4X2YA 1Z8GA 4IS5A 2JETC 1EOLA 4WVPE 1ZJKA 3H7OA 1QA0A 4NG9H 1NROH 3SI3H 5AF9H 5C0TA 4ZHMU 1GVLA 2FX6A 2J97A 1VCQA 2FM2A 1GBDA 3EYDA 3NK8A 4WMEA 2J98A 1EKBB 3V7TA 4GAWA 2W3IA 1OWKA 2FOBA 4X2XA 5C5OA 1GMDF 1OP2A 4B71A 2B7DH 2JIZD 1IQMA 1C9TA 2F83A 3NXPA 4J2YB 3SNDA 2FXRA 2ALVA 2FOMB 3RXQA 1ZJDA 2QXGA 1THPB 2Z3EA 1CA0C 1ZSJA 1QY6A 3E1XB 1WTGH 1K9OE 4WJG2 4MPUA 1ANBA 1GMCF 1ZHMA 5FHTA 1FAXA 4UFFH 5JYIA 3K6ZA 4ZXYH 1KDQA 2AH4X 2BM2A 3LU9B 2W7SA 1YYY1 4WY3A 1MAXA 3W95A 1O3HA 1SGCA 2VIVA 1IQGA 4IC5A 1VCWA 3FOAA 2Y82A 3TJUA 1TNKA 3AK5A 4D7FA 4DIIH 1DY8A 4NZQA 1HJ8A 3TGJE 1FJSA 1YPLH 3Q77A 2WUCA 1UK3A 3SN8A 1YPGH 4AOQA 4HGCA 4ZCNA 5C1XA 2GGVB 3MYWA 1FIZA 2TPIZ 1EP6A 2C8YB 4CR5A 1BB0B 1BITA 1YLNA 1QR3E 1NT1A 1NFWA 1S83A 2Z9GA 2GCHF 4A1VA 2W3KA 3SGAE 3U8TH 2QV1A 1O35A 2BLOA 1V2KT 2JH0D 1ELTA 4Y7BA 4NA7A 3A7ZA 1AB9B 1RTLA 4GLYA 4O9VA 3VFEA 1SGFG 4AG2A 2BXTH 1C2LA 2ZU5A 4YT6H 3TU7H 3P95A 3M3VA 1S6LA 3ZYEA 1SGPE 1FONA 1O2SA 3E8LA 5DP7A 1QBOA 1C5TA 3DFJA 1E34B 2BDYA 1GHWH 1ETRH 1XKBC 2ZPSA 1AMHA 1W8BH 1GJAB 4YOGA 5LPEA 1MTWA 2P3FH 1G37A 2QF4A 2RDLA 3MO9A 1E36B 3QZQA 2OQUA 4KELA 3QDZB 4ZAEA 2QXHA 1LVBA 3PWCA 1KLJH 4H42U 1YLDA 3RXPA 2H2ZA 5AFYH 3PYHA 1GBMA 4K1EA 4LK4A 2ALPA 3A7VA 1GI9B 1UVPA 1PQ5A 2BY6X 3LH1A 1BMLA 1V2PT 4K1SA 2XOKD 1J8AA 5K0HA 1C5NH 3S7KB 4ABIA 1O3MA 4UFEH 2W7UA 1AN1E 3SZNA 5E2PA 1HV7A 5C67A 2PLXA 1KLIH 4HG6A 3F2GA 1C1UH 1TONA 1XVMA 4X2WA 3OAAD 4AC9A 1FDPA 1HAVA 2TIOA 1Z8IB 4I8LA 1GVKB 1T31A 1XUIA 3SU2A 3OEED 2OLGA 2PTNA 3HPTB 1AB9C 1NRNH 1QIXB 3QX5H 1JIRA 2ZFTA 1WOFA 1FY8E 1A46H 2ZWLH 1LVYA 3KNXA 1AI8H 2NWNA 1GI7B 3RXAA 3SU1A 1UK4A 2BOHB 4I8KA 2AFQB 3UY9A 1C5PA 4ZHLU 3PV5A 1J16A 4ABJA 1S81A 1ZLRA 4K5ZA 1Y3UA 3GYLB 1JXPA 4ISLA 3RXDA 1K28D 1TRNA 2AHME 3KYGA 4B2AA 1SLWB 3D23A 1TBQH 1V2LT 2JJ1D 2R3YA 4TWWA 1T7CA 1Y5UT 3FP6E 4H4FA 4TPYA 4Q7XA 3FZDA 1O38A 2FX4A 2Y80A 1C5QA 1EAWA 1OXGA 4U32A 2A4QA 1EB1H 4HI3A 6LPRA 1K0HA 3JZ1B 1KIGH 4E7RG 2A32A 2ANMH 1E38B 2ZQ2A 2F9VA 1QGFA 1K1IA 3STIA 4AFQA 2D1JA 3WWFA 3E16B 5C5NA 1O0DH 2BZ6H 1DWEH 1CT2E 4FOUC 2G51A 3LDXH 4IN1A 1F0SA 1QZ8A 4U2WA 2OBQA 1HXFH 3F9EA 3QTVH 1LHEH 1MBQA 1O3FA 1XMNB 2BQ7B 2G4TA 1GJ4H 1GI1A 2LP6A 1ELCA 2AGGX 1N8OB 2R3UA 3F2FA 5C2ZA 1GBJA 1K2I1 1ZYOA 1OWHA 2WPKS 1HDTH 1SFIA 4E7NA 5FAHA 3L33A 1W10U 3ZV9A 1TBRH 4DOQA 1AE8H 1K1OA 3RXJA 1UMAH 2XWBI 4FUBA 4TWYA 1MKWH 4XOJA 2XYAA 1AKSB 3EE0B 1TA6A 2VNTA 4XDEA 3SV6A 3M37A 3VB7A 3SYJA 3VB3A 4SGBE 3BTGE 1KTSB 2A0QB 5DKMA 3SV2H 3P8OA 3LT3A 1N6YA 1J9CH 2JKHA 3GS9A 1L0ZA 3TLOA 2GKVE 3BEUA 1MUEB 1YC0A 3KHVA 5ESTE 5EODA 5DP8A 1YY3A 1C9PA 1P2NA 3DD2H 3O8RA 2SGEE 1GI8B 4B2BA 1TOMH 4BXSA 2CHAB 2Y5FA 3RXIA 3DHKH 1VZQH 1ZMJA 2BD2A 2WPMS 1NESE 4BAOB 4CR9A 1M9UA 3M7UA 1OYTH 1TMUH 1C2GA 4BTTB 1A4WH 1IQLA 1C5WB 4RI0A 4I7YH 1ANDA 1BJUA 1C1VH 3UB0A 1O3GA 1TGSZ 4AYYB 2V3HH 4NA9H 1KSNA 3UWIA 1OP8A 3GCNA 2QIQA 2O8WA 3PMAB 1N8OC 5GPIB 3DCLA 2KFWA 4X8VH 1NBME 5GNDA 2KCYA 1J14A 3V13A 2G81E 3CENA 2C8XB 1XKAC 2BQWB 4NGAH 1D3PB 1GHZA 3W1EA 2R9PA 1OPHB 1CBWB 3BTTE 3S9AA 5GCHF 2R2MB 2CK3D 4X8TH 3P8GA 3ZVEA 2VGCB 1BTWA 3RM2H 4JZDH 3UR6A 3FFGA 1AVXA 3ODDA 4B74A 5EJ1A 1NTPA 2FIRH 1W0ZU 1TWXB 3V12A 2ZF0H 1QL9A 1QNJA 3RU4D 1ZRBA 5G4BA 5GDSH 2QAAA 2EI8A 2IPQX 1HGTH 3P8NA 3PM3A 4AGJA 1WAYB 4WMDA 3KQ5A 3ZZ8A 1W2KH 3ATIA 3ZZCA 1AVGH 4ISHH 5DP3A 3ZZ3A 3TPIZ 5DG6A 4M9FA 2BDHA 1VITF 1RTKA 3R3GB 2UWOA 1TYNA 1V2RT 1MMJN 1MH0A 1O3JA 2VH6A 2VJ1A 1HNEE 1KXFA 2K1QA 3DA9B 4YOJA 3ATKA 2BD4A 4UEHH 1PPGE 1LO6A 4FUEA 4INLA 4UE7H 2J5UA 4IBLH 2FYQA 3RC5A 3SNBA 2CN0H 5C17A 1AZZA 4Q63A 1K1JA 1EAIA 8KME2 3KQBA 4Q7ZA 1CBWC 1L2EA 3E6PH 1RRKA 2R0KA 3O8CA 2GVFA 1C2DA 1PPEE 1IHTH 2VGCC 3E91A 3RXGA 2V6NA 3L6PA 4NIVA 1AE5A 1OSSA 1HBTH 1GJ6A 2Z3DA 3SV7A 3A84A 4NFFA 4JK5A 5TJXA 4A1XA 2F4LA 1SFQB 1ZTKA 3ZZBA 1C5UA 1K22H 2AGEX 1O2ZA 1C5YB 1Y5AT 4CBNA 1GBKA 1IQHA 1GMCG 1PFXC 1UHBB 1WV7H 3ZZ7A 3EE7A 3TGIE 2FZZA 3H09A 5T1VA 3MNXA 2RA3A 2O8UA 4OGXA 4D8NA 3ZV8A 2A2QH 2A5KA 3O8BA 1A61H 1PPZA 1WCZA 4LZ1H 3MU5A 1C1PA 4D7GA 2ZPRA 3PB1E 1DSUA 2SGAA 4X1QU 2WPJS 4I33A 3HK3B 4LZ4B 4X1RU 2PW8H 3QWCH 3A7XA 2DUCA 1H8HD 1C2IA 1W3CA 3RLWH 3TIUA 1AKSA 3MI4A 4WH8A 1O2YA 1LKBA 1SOTA 2H5DA 2GV7A 1UTNA 3GCTF 5EW2H 1ESTA 1GBBA 3SUDA 3A80A 1FX0B 1AO5A 1EQ9A 3ZYDA 2QE7D 3GDVA 5DK1A 2GCHG 1GBAA 4ZKNU 1ACBE 2BQ6B 3ZZ6A 1B5GH 1LVOA 5EXNA 1O36A 2JJ2D 3RMMH 3UWJH 4X6OA 3TH4H 1GBTA 1S84A 4FETA 1EATA 1KDQB 1GBHA 4RKOB 4JZ1A 1IAUA 5I25A 4IGDA 3E0PB 1AUJA 3Q00A 2J2UA 1DM4B 3M61U 2Y81A 2BY5X 1TABE 3STJA 3P6ZB 3TNSA 1RD3B 1L1NA 3SQEE 3U8OH 1SKYE 2XXLA 2FESH 2F9NA 1O2IA 1FY4A 1O5AB 2ZFQH 5FCRA 2ZZUH 3D62A 3RC4A 3TVJB 4RN6A 1ETTH
chains in the Genus database with same CATH topology
3LOXA 4Q4LA 4TT3D 3SU2A 3L6PA 3F0PA 3NRLA 3OEED 3SU6A 1KMHB 2WHXA 3LONA 1OHHD 2O8MA 3SV7A 4NWLA 4A1XA 1DXWA 4K8BA 4XD7D 1NS3A 2F4LA 4F55A 1RGQA 4RI0A 3KNXA 5ETXA 3DSOA 1NBMD 4Z1MD 3FOAA 3UB0A 3SU1A 3SV8A 3AK5A 2YOLA 1DY8A 3PV5A 4KTCA 3SU3A 4WH6A 5FPYA 4A92A 2WZQA 2KCPA 3H09A 5T1VA 5EPYA 5IDKA 5CHBA 4B75A 1JXPA 1W0KD 1E1RD 3O8BA 5HKKD 2AHME 5GPIB 2KM0A 2KFWA 3DCLA 4ZCNA 5EQQA 2JJ1D 3M5OA 1NBME 5GJ4B 5GNDA 2KCYA 2OC7A 3OEHD 2GGVB 1DXPA 4I33A 4I32A 4OM9A 2K0QA 3W1EA 1MABB 4WF8A 1H8HD 2LELA 3U1IB 1W3CA 4ASUD 4A1VA 2KCOA 2A4QA 2XNIA 2WSSD 2F9UA 2M2AA 2OINA 2QV1A 3WWBA 2VBCA 4WH8A 2CK3D 2KCAA 3KF2A 2YMSC 3OYPA 2OK5A 2F9VA 4TSFD 2F43B 1E79D 5FPTA 4A1TA 5DN6D 1COWD 3N7DA 5EQSA 5EPNA 3E90B 4B74A 3WWFA 1RTLA 3M5MA 1DY9A 2YMSD 3SUDA 5IK2D 2OC8A 3KN2A 1FX0B 3SUGA 2OC0A 3O8DA 3SU0A 4DT4A 2K8IA 2P59A 1A1RA 1S6LA 2QE7D 2XCFA 3SZEA 3DSPA 1BT7A 1H8ED 2KZ4A 3N7EA 2OBQA 3P8NA 3PV2A 2JDID 3KEEA 2WV9A 1WXRA 4R8TB 3WW7A 3OTPA 2HLDD 4NWKA 3SUEA 2JJ2D 1W0JD 2KR7A 2OC1A 4M9FA 2A4RA 2IJOB 2QF4A 3F2FA 2XCNA 2L6OA 3OE7D 4I31A 3FN8A 2W6ID 3SU5A 3VG8A 5DSFA 5ESBA 2WPDD 3PRBA 4TYDA 4FETA 3RC6A 2V7QD 5C0TA 5EQRA 3M5NA 2K1QA 1BMFD 5CDFE 2W6JD 4YXWD 5FL7D 2FM2A 3U1JB 4B73A 2XOKD 3F3BA 3FO8D 4B6EA 5C0UA 3SV6A 2YMSB 3F2HA 3EYDA 1E1QD 3SYJA 5B6LA 2QF5A 2IJD1 3F0OA 3P8OA 3M5LA 2J5UA 3SU4A 3SUFA 4JMYA 4B71A 3GS9A 3ZIAD 4B6FA 4B76A 3F2GA 2JIZD 3RC5A 3SV9A 5FPSA 1CU1A 5H4IB 3PRDA 1EFRD 2OBOA 4Q63A 1SKYE 5C17A 2FOMB 3OFND 4U01A 2A4GA 3N99A 3O8RA 3OAAD 3FKSD 2FP7B 5F53A 3RC4A 2XNDD 3O8CA 1N1LA 2GVFA 3LKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F2G A;  3F2F A;  3F0O A;  3F0P A;  3FN8 A;  5C17 A;  5DSF A;  5C0U A;  5C0T A;  3F2H A; 
#chains in the Genus database with same CATH topology
 1D6R A;  2TRM A;  2GMT B;  3TNT A;  2ZTZ A;  1KXD A;  2VIW A;  2O8M A;  1ARC A;  2EST E;  1D6W A;  4ISI H;  3H5C B;  3DSO A;  1PYT D;  4Z1M D;  1QJ7 B;  2FOD A;  1VJA U;  2AEI H;  3QLP H;  3HGP A;  1F5R A;  3U9A H;  3PMJ A;  3MTY A;  5FPY A;  2KCP A;  2Z6B D;  4J1Y A;  2ZFS A;  4R0I A;  4Y11 E;  1YM0 A;  3URC A;  1E1R D;  2BYA X;  1UK2 A;  1FAK H;  1BMN H;  4GHT A;  1GJD B;  4I32 A;  2FOF A;  2WUB A;  4X8S H;  5HMA A;  3FVF B;  2FTL E;  1Z6J H;  2VBC A;  1S5S A;  1F7Z A;  3Q3X A;  8GCH G;  1HAO H;  3HK6 B;  1LPG B;  1DST A;  5I46 H;  1GBI A;  2GT8 A;  4X1N U;  1OP0 A;  3AAU A;  4AZ2 B;  4F48 B;  2B0F A;  2PV9 B;  4GCH F;  1ORF A;  1UVS H;  5DP5 A;  1SGQ E;  3ZZ5 A;  4Y79 A;  3QK1 A;  1OYQ A;  3RXO A;  1X7A C;  3DSP A;  3ZVF A;  4XBD A;  3LGW A;  1TOC B;  1ZHR A;  2ZHW H;  1O32 A;  1P04 A;  4MNX A;  3RML H;  2H9T H;  2M5T A;  2SNV A;  2BDB A;  3MO3 A;  6GCH G;  1W0J D;  2KR7 A;  1Y3W A;  2GMT C;  1QL7 A;  3OE7 D;  2O9Q A;  1HAV B;  2ODQ A;  2VIP A;  3QGJ A;  2BDI A;  1CA8 B;  2PWX A;  4NA8 A;  2FYR A;  1P09 A;  1UHB A;  1HRT H;  2ZFP H;  3Q3Y A;  3SQH E;  2FLB H;  2FOE A;  3SGQ E;  1MQ6 A;  5FL7 D;  1DVA H;  1NFX A;  1GL0 E;  3EGK H;  4ZXX H;  3OY5 U;  2B5T B;  5JPM H;  3I29 A;  1SVP A;  1OWI A;  1SLU B;  4KKD A;  1O2K A;  5IYT A;  1LQD B;  2VIQ A;  3W94 A;  1ZPZ A;  4WWY A;  1KXE A;  4Z0K A;  4JZF H;  4ABB A;  1UO6 A;  1HUT H;  1PQ7 A;  1DWB H;  1V2T T;  2VVC A;  3LON A;  5A2M H;  1S6H A;  1CE5 A;  4DT7 B;  1BTH H;  1UTM A;  1ZGI A;  1YCP M;  1Z6E A;  1Z1I A;  4D76 A;  1TPA E;  2HPQ H;  1HAZ B;  2ZDK A;  5A8Z A;  4B1T A;  1V2S T;  3SBK A;  1TX8 A;  3SU3 A;  4DIH H;  1G3D A;  1WUN H;  4AG1 A;  1D3D B;  2WPL S;  1CO7 E;  1FY3 A;  2GD4 B;  1MCT A;  1EX3 A;  1T8M A;  3RP2 A;  1W13 U;  3S9B A;  1GHX H;  3B23 B;  3L3T A;  5PTP A;  4KGA A;  3A7Y A;  5EG4 A;  3MH7 A;  3ZZD A;  2BY7 X;  3URD A;  4ASU D;  1LKA A;  1HAH H;  1SBW A;  1ZR0 A;  2KCO A;  4X6M A;  5TCC A;  2F9U A;  2OIN A;  3MU8 A;  1IQN A;  2DE9 A;  1OWJ A;  2OK5 A;  1P12 E;  1A3E H;  1ZTL A;  1UVO A;  4A1T A;  5DN6 D;  5EQS A;  2VWN A;  2AYW A;  2F91 A;  4B2C A;  4NSV A;  2P95 A;  1GBL A;  3PLP A;  2OP9 A;  1G3B A;  2PP6 A;  3RXH A;  1DPO A;  3GY6 A;  1P2J A;  3SU0 A;  1O2L A;  2QY0 B;  1GJ9 B;  2XCF A;  1O5E H;  1ZSK A;  1ZOM A;  2I6Q A;  3RMN H;  4MVN A;  4ACB A;  4JZE H;  5GCH G;  5EU8 A;  3ATW A;  1MAY A;  1OWD A;  3WW7 A;  2HLD D;  1F5K U;  1YGC H;  3BTK E;  1BIO A;  4I31 A;  3SNA A;  2OQ5 A;  4Y8Z A;  2OXS A;  1NRP H;  4BAN B;  3A7T A;  1BMA A;  5JB8 S;  2FO9 A;  1V2J T;  3F1S B;  3LPR A;  5F8Z A;  2ANW A;  4JYT A;  4CRG A;  3SO3 A;  1IHS H;  1NN6 A;  3LC3 A;  5CDF E;  1V2V T;  3SJ9 A;  3PMB B;  3RXS A;  3NKK A;  2ZNK H;  3C27 B;  1INC A;  1VIT G;  2JH5 D;  3F0O A;  1TMT H;  1O2O A;  4B76 A;  2GJG A;  4FUH A;  4I8H A;  1EFR D;  3IWM A;  4ZH8 A;  1BOQ A;  3M3S A;  3UUZ A;  3UPE A;  1HFD A;  2GT7 A;  1SGD E;  1ELV A;  3LOX A;  2BD7 A;  3NRL A;  5F6M A;  3QZR A;  3S7H B;  1SHH B;  2G4U A;  5EOK A;  1H8I H;  1RS0 A;  3RLY H;  4F55 A;  2FLR H;  5ETX A;  4BAQ B;  1O2G H;  1QBV H;  2ZCL P;  3UTU H;  1AZ8 A;  1AU8 A;  2FI3 E;  5C20 A;  2NU1 E;  3RXM A;  2BDG A;  2TGP Z;  1IQF A;  2ZU4 A;  4UON A;  1K21 H;  1T8L A;  4CH8 B;  2SGP E;  1PPF E;  1G2L A;  1ZGV A;  3WY8 A;  4YO9 A;  2RCE A;  1Y8T A;  2PHB A;  1ESA A;  3A87 A;  2A45 B;  3SW2 B;  4OS1 A;  4Z6A H;  1ZPB A;  3F9H A;  1MCV A;  1SGI B;  2K0Q A;  2CGA A;  1HAI H;  1NY2 2;  2QC2 A;  4DUR A;  5A0B A;  5A8Y A;  4Y7A A;  2M2A A;  3BTF E;  5EJZ A;  4FUG A;  2GV6 A;  2PR3 A;  2EQN A;  2R0L A;  2ZTY A;  3BEF B;  3H7T A;  5ABW A;  3RU4 E;  3D49 H;  4AOR A;  1SGY E;  2F43 B;  1COW D;  1QJ1 B;  5EPN A;  3E90 B;  4LOY H;  2A7J A;  1NZQ H;  2RG3 A;  2C90 B;  1O3E A;  2ILN A;  4K2Y A;  1RFN A;  1WDI A;  1AY6 H;  3N7E A;  1QJ6 B;  1O39 A;  3PV2 A;  6CHA B;  3KEE A;  4JZI A;  4NIY A;  2ZU3 A;  3OTP A;  3K9X B;  2J38 A;  2HPP H;  1IQK A;  2Z94 A;  1T8N A;  5HIY A;  4GVU A;  2LPR A;  1MBM A;  1SOZ A;  1CGH A;  1HJ9 A;  3U28 C;  2W6I D;  1BTX A;  4FXG H;  2WPD D;  1VKY A;  2F9P A;  2HVY B;  1A0H B;  3TJV A;  5BPE A;  1EAX A;  3NCL A;  4EST E;  3M5N A;  5AHG H;  1QUR H;  1UTJ A;  2H9H A;  2O8L A;  2ZI2 H;  1RTF B;  4TY7 A;  2YMS B;  4X2V A;  1ESB A;  2SGQ E;  3CS7 A;  1BTZ A;  2IJD 1;  3D65 E;  4XSK U;  2BVR H;  2KAI A;  3MU1 A;  4XE4 A;  4FU9 A;  1K1M A;  2PUX B;  3ZZA A;  4I8J A;  2ZEB A;  2AIQ A;  3MH5 A;  3TK9 A;  3PLK A;  5JB9 S;  1O5F H;  2ZKS A;  4AB9 A;  5E0J A;  3B9F H;  4TT3 D;  1EUF A;  3EA9 A;  5A09 A;  2Q6D A;  1C5Z B;  2HWL B;  1P10 A;  1F5L A;  4K8B A;  5L2Y H;  5K7R A;  3VB5 A;  1NS3 A;  3I77 A;  1IQJ A;  1SG8 B;  1T8O A;  2GZ7 A;  1V2W T;  5KED A;  5DJ7 A;  1DE7 H;  1P02 A;  1GHV H;  2BDC A;  3SV8 A;  7GCH F;  3VXF H;  6CHA C;  2YOL A;  4IN2 A;  1L4Z A;  3VEQ B;  3QN7 A;  1XUF A;  2J94 A;  1QA7 A;  1K1L A;  1Z1J A;  2Y5H A;  5FCK A;  1YPM H;  2GZ8 A;  4AX9 H;  4ABD A;  2Y7Z A;  1V2Q T;  1QBN A;  1EZX C;  2PKS B;  2OC7 A;  4XBC A;  2A4O A;  2H6M A;  1C2J A;  1FZZ A;  1V3X A;  1Y3Y A;  2D26 C;  3OSY A;  4WF8 A;  1JRT A;  3U1I B;  9LPR A;  1MTU A;  2BVS H;  1GCT B;  1J17 T;  2XNI A;  4NFE A;  2ZA5 A;  2ZHD A;  2KCA A;  1C4Y 2;  2YMS C;  2J95 A;  1H4W A;  2OD3 B;  3A81 A;  4E05 H;  4GPG A;  2VIO A;  1ELA A;  2JH6 D;  1WSS H;  2A7H A;  1O3A A;  2KZ4 A;  5T6F A;  1GBC A;  1O3L A;  4K1T A;  5BRR E;  2BTC E;  1EZQ A;  1EZU C;  1YBW A;  2KX4 A;  1TMB H;  3ENS B;  1FPC H;  1MQ5 A;  3RXE A;  1TNL A;  1GVZ A;  1QRX A;  2C3S A;  1T4U H;  1GHA F;  3ZVG A;  1SB1 H;  1P01 A;  2AS9 A;  3PRB A;  1BTU A;  2WV5 A;  2ZFR H;  3FZZ A;  2GX4 A;  3MH4 A;  4F49 A;  4OGY A;  1RJX B;  5CMX H;  1BMM H;  3P92 A;  3FO8 D;  1XUH A;  1DAN H;  1F0T A;  3RXF A;  3F2H A;  1PPC E;  1NPM A;  2F9B H;  4GSO A;  1W7X H;  3RXV A;  2PKS C;  1D9I A;  2GP9 B;  2BHG A;  5C94 A;  3UQO A;  4K60 A;  1FNI A;  5E0H A;  3OFN D;  1SMF E;  3MMG A;  1GCT C;  2WIN I;  1N1L A;  2ZTX A;  3TH3 H;  1F0R A;  1B0F A;  1SGT A;  2OTV A;  3PTN A;  3SU6 A;  5FBI A;  1O2R A;  1C2H A;  4Y10 E;  2PUQ H;  1O5B B;  3AW0 A;  4YTA A;  1SLX B;  3IG6 B;  1TGB A;  1AUT C;  3KID U;  3P8F A;  2EI6 A;  1V6D A;  1WYK A;  4BTI B;  1EJN A;  3KGP A;  4Y8X A;  3MU0 A;  5DPA A;  4K3J A;  2ZQ1 A;  1EPT B;  1TBZ H;  2BX4 A;  1ZMN A;  4MDS A;  2R2W U;  3BIU H;  1GHB F;  2SNW A;  4AFZ A;  1OWE A;  3M5O A;  3A7W A;  4Q2K A;  4ZUH A;  1GMD G;  4A5T S;  2P3T B;  3RUO A;  4CRF A;  4JYV H;  5EXM A;  5A0C A;  3OX7 U;  4ABH A;  1JBU H;  1FY1 A;  2LEL A;  3MH6 A;  3JZ2 B;  2WSS D;  4OS7 A;  1GDQ A;  3WWB A;  1BBR K;  1BUI A;  1O5D H;  2RDE A;  4YLU A;  1TPS A;  3KF2 A;  1KYN A;  1W7G H;  2ANK H;  5DP9 A;  3GY2 A;  5L2Z H;  1O3C A;  1LHG H;  2OUA A;  1GDU A;  4ZMA H;  1YKT A;  3AVZ A;  1O37 A;  3M5M A;  3EST A;  3LJJ A;  1BZX E;  1MKX K;  3O8D A;  1J15 A;  4DT4 A;  2K8I A;  3IIT A;  5E0G A;  2H1U A;  1YCP K;  2VVU A;  1ZPC A;  1U6Q A;  1TQ7 B;  2A5A A;  2WYG A;  1O3P B;  1RIW B;  1W0Y H;  3SUE A;  2BD5 A;  1O3N A;  1OX1 A;  3FN8 A;  3ATM A;  1HAG E;  3LJO A;  1DS2 E;  1SGN E;  2RFK C;  4DG4 A;  4UFD H;  4ZRO A;  5HM2 A;  1V2N T;  3CNR A;  1DOJ A;  2CXV A;  2ZPQ A;  5EQR A;  1BA8 B;  3NZI A;  1B7X B;  1AVW A;  1BMF D;  1C4V 2;  2W6J D;  4FUD A;  4B73 A;  1NRS H;  1G36 A;  1E1Q D;  1EPT C;  3UOP A;  1GI6 A;  1UTK A;  2RA0 A;  3GY5 A;  2FI5 E;  1SPJ A;  3E3T A;  1O2V A;  2A7C A;  2DE8 A;  4X1S U;  5FPS A;  1KTT B;  1BRC E;  2B8O H;  4BAH B;  1GI3 A;  2C4F H;  2BMG B;  2A4G A;  1AFE H;  4WXI A;  4DGJ A;  1UVT H;  2G55 A;  4XFQ A;  5DO4 H;  2PSY A;  1HIA B;  1NRQ H;  1UTQ A;  3F0P A;  2CV3 A;  1UW7 A;  2GTB A;  1O3K A;  3TGK E;  1UVU H;  1NBM D;  1TPO A;  2UUK B;  1YP9 A;  3CP7 A;  3EDX B;  2Z9K A;  1P3E A;  1KLT A;  4WH6 A;  5L30 H;  1ZML A;  3N7O A;  1RIW C;  1LDT T;  2P94 A;  3P70 B;  4B75 A;  1FLE E;  2XBW A;  5F8X A;  1GJC B;  1HAY B;  2EY4 C;  1FUJ A;  4Y0Z E;  4ZKS U;  3NWU A;  1BDA A;  3MFJ A;  3KQE A;  4O03 A;  1CHO F;  3M36 A;  3SHA H;  1ID5 H;  1GJ7 B;  4FUC A;  3RM0 H;  5A8X A;  1TAL A;  3NUM A;  2Y6T A;  1A5G H;  5J4S A;  3KYF A;  1V2M T;  1ARB A;  1VIT H;  3GY4 A;  5FPT A;  4TSF D;  2G52 A;  4BAM B;  1GG6 B;  3RDZ A;  1QB1 A;  3ZVC A;  1AWF H;  1P11 E;  5A0A E;  5IK2 D;  2OC8 A;  1GHY H;  5EW1 H;  2XTT B;  1GL1 A;  1C5X B;  1H8E D;  4M7G A;  3TH2 H;  3F9F A;  5AFZ H;  1SQO A;  1WXR A;  2SFA A;  1TNI A;  4ABA A;  2FDA A;  2FI4 E;  4JYU H;  1SGF A;  1C5R A;  1O2Q A;  1Q3X A;  1MU8 B;  3QUM P;  1C2F A;  2IPH A;  1PPB H;  1UTL M;  3QTO H;  2BB4 A;  1E37 B;  5JBT A;  1G30 B;  2O8T A;  2QN5 T;  1SC8 U;  3HAT H;  4P00 A;  1D4P B;  4YXW D;  1DX5 M;  4AFS A;  1EXF A;  1FN6 A;  1P03 A;  1Y59 T;  1EPT A;  2ULL A;  1ZTJ A;  4WXV A;  1QRW A;  3UNR A;  3F68 H;  3G01 A;  3ZVA A;  2ZCK P;  3SUF A;  1FN8 A;  4X8U H;  3VGC B;  1DWC H;  4Q7Y A;  1O30 A;  2G5N A;  2ZHQ H;  3LIW A;  2FPZ A;  1UJ1 A;  4HZH A;  2NU2 E;  3LGV A;  2AMP A;  3M35 A;  4OS2 A;  1S85 A;  1TRM A;  2P16 A;  2ZO3 H;  5JBA S;  1GG6 C;  2WHX A;  5C3N A;  5KEC A;  4E06 H;  4NWL A;  3A88 A;  1SHY A;  4XD7 D;  4O3U A;  1TX7 A;  2XBY A;  1P05 A;  2A1D B;  4AB8 A;  3PV4 A;  2CMY A;  2VWO A;  1EJA A;  4CRA A;  4DVA U;  1XXF A;  1HAX B;  4IW4 E;  1G9I E;  2ZDA H;  3UFA A;  4A92 A;  3SNE A;  3FP7 E;  1HB0 B;  2ZC9 H;  1O3I A;  5IDK A;  1C1O A;  2BX3 A;  1W0K D;  2ASU B;  1MD7 A;  2ZDV H;  3BF6 H;  1BTP A;  2J34 A;  2XRC A;  2GCT B;  1P9S A;  1XX9 A;  1TRY A;  1C5M D;  2WPI S;  3RU4 T;  5EGM A;  3BV9 B;  1YLC A;  5J4Q A;  4MQA A;  1MZD A;  2VWL A;  5E8E H;  3ELA H;  2YNB A;  1O5G H;  3TJO A;  4CRC A;  2ZDM A;  4FU8 A;  1ZHP A;  1F2S E;  3Q3K A;  4RT0 A;  1GBE A;  1P9U A;  2ZHE H;  5F8T A;  2XC5 A;  4MLF B;  3A83 A;  4X0W U;  1FXY A;  3SUG A;  2HGT H;  2BY8 X;  2OC0 A;  3VGC C;  4MPW A;  2Z9L A;  1GMH F;  3KL6 A;  3OY6 U;  1H9H E;  2KAI B;  3A86 A;  5T6G A;  2G5V A;  1CHG A;  4H6S B;  1SQT A;  2THF B;  5EIY A;  1Y3X A;  2QA9 E;  1A3B H;  2Q1J A;  2V0B A;  5HM9 A;  1HIA A;  1TFX A;  2VWM A;  1TAW A;  2IJO B;  3SU5 A;  3C1K A;  1AFQ B;  4MG3 A;  4X6P A;  1LTO A;  1IQI A;  4INK A;  2PKA A;  5DGJ A;  1O2M A;  3AAS A;  3RC6 A;  3R0F A;  1O2U A;  1NRR H;  5JDU B;  4THN H;  2HOB A;  4H6T A;  1YF4 A;  1DUE A;  1LHF H;  3KQC A;  3TIT A;  1HAP H;  1GHA G;  2QF5 A;  3TK6 A;  2UUF B;  1ZSL A;  3GIS B;  5EJL A;  4JMY A;  2GCT C;  1CT4 E;  4B6F A;  5FX6 A;  1QB9 A;  5H4I B;  1A5I A;  2D2D A;  2D8W A;  3PRD A;  1RXP A;  4JK6 A;  1C1R A;  1ZZZ A;  9EST A;  1CGJ E;  4ASH A;  1C2M A;  1E0F D;  2FOG A;  4I86 A;  2ZIQ H;  3A8A A;  1ANC A;  3VXE H;  3SHC H;  1GI0 A;  2EI7 A;  1GJ8 B;  1O2N A;  1TNJ A;  3BG4 B;  7LPR A;  2VVV A;  3KCG H;  2ZCH P;  5DP4 A;  3A82 A;  3MWI U;  1FV9 A;  1FMG A;  3GDU A;  1ZRK A;  1T32 A;  2GZ9 A;  1DIT H;  2KM0 A;  1EAU A;  3RXU A;  3ZVD A;  1AFQ C;  3OEH D;  2QCY A;  5JBC S;  1DXP A;  1VGC B;  2FS9 A;  4OM9 A;  1W11 U;  1A2C H;  5B6O A;  1HXE H;  4NZL A;  1P2I A;  1C1T A;  1AGJ A;  3OTJ E;  2QF0 A;  1EJM A;  1O2T A;  3OYP A;  5HGG A;  3B8J A;  1GHB G;  1YPE H;  3N7D A;  4OS6 A;  4HTC H;  4SGA E;  1C5L H;  1EB2 A;  3T62 A;  1HLT H;  1BBR E;  1DY9 A;  1S82 A;  2A5I A;  3DUX H;  1PQ8 A;  1QQU A;  1SQR A;  2GDD A;  4FUI A;  5HYO A;  3GOV B;  2JDI D;  3MHW U;  2QXI A;  1AHT H;  1F0U A;  1SLV B;  4NWK A;  5T3H A;  3PWB A;  1Y3V A;  2EA3 A;  1LQE A;  4MNV A;  3VPK A;  1UCY K;  2TGD A;  4Y71 A;  2FOC A;  1Z71 A;  3BG4 C;  1DUA A;  3S69 A;  4AYV B;  1MTS A;  4KP0 A;  3RXK A;  2AMD A;  2FS8 A;  1HCG A;  1LPZ B;  2Z7F E;  3Q76 A;  4GHQ A;  1T4V H;  2FWW A;  4O3T A;  3K2U A;  1H8D H;  1THR H;  3M5L A;  2STB E;  3SU4 A;  2XWA A;  2WYJ A;  1C1M A;  3U8R H;  3ZIA D;  3GCT G;  1O31 A;  1VGC C;  1ELF A;  2ANY A;  2C93 B;  4CRE A;  4FUJ A;  4MNY A;  1GPZ A;  1O5C B;  1ABI H;  5F53 A;  1C1Q A;  2Z9J A;  8GCH F;  1ELB A;  2BXU H;  3LKW A;  1NU7 B;  1YWU A;  3QO6 A;  1XVO A;  1QL8 A;  1P0S H;  2ZDL A;  1KMH B;  4TPI Z;  4ISO A;  5FX5 A;  1OHH D;  1JWT A;  2STA E;  1BCU H;  1DXW A;  2H5C A;  1UTO A;  1RGQ A;  3A8B A;  2AIP A;  5F03 A;  3A8C A;  3FP8 E;  1BBR H;  4Y0Y E;  5EXL A;  1MD8 A;  2W26 A;  1C4U 2;  4CH2 B;  2ZGH A;  6GCH F;  4IMQ A;  1GJB B;  4YLQ H;  3UQV A;  4PRO A;  5EPY A;  3V3M A;  5HKK D;  3SGB E;  1MKX H;  3T5F H;  2BLW A;  5TCA A;  5EQQ A;  5AVD A;  1QQ4 A;  1YCP H;  1DLE A;  1GI2 A;  1L1J A;  2ZG0 H;  3ITI A;  2ZGX H;  1L1G A;  2A31 A;  2NU3 E;  4YES B;  1HYL A;  1S0Q A;  4VGC B;  1KXA A;  4MPX A;  4X1P U;  1TB6 H;  1TNH A;  2BD9 A;  4IMZ A;  4ABF A;  2UUY A;  2UWP A;  3SJO A;  1BRB E;  4GUX A;  5T6D A;  2FOA A;  3QGN B;  1C1W H;  4DY7 B;  1GI4 A;  1GGD B;  1V2U T;  1C5O H;  3T26 A;  2P3U B;  1FPH H;  1CHO G;  1TQ0 B;  1O3O A;  1A0J A;  3RXT A;  4U30 A;  1F92 A;  2P59 A;  3SZE A;  1JMO H;  2BDA A;  2ZU1 A;  3UNS A;  2UWL A;  2ZHF H;  1BT7 A;  1BQY A;  4OS5 A;  1DFP A;  1EOJ A;  2FEQ H;  1VCP A;  2XC4 A;  1CT0 E;  1WU1 A;  3T28 A;  5DP6 A;  1FI8 A;  2HNT F;  1D3T B;  2OC1 A;  3MOC A;  3PO1 B;  5SGA E;  3PMH B;  3VG8 A;  1QB6 A;  5DSF A;  3F6U H;  2A2X H;  2XBX A;  4DJZ B;  3T27 A;  1BRA A;  2I6S A;  1C5V A;  2FMJ A;  1AD8 H;  1ETS H;  5KGO A;  3CS0 A;  1ELD E;  1ELG A;  1NO9 H;  3LGY A;  4CRD A;  3RMO H;  3M7Q A;  3EA7 A;  4FVB A;  1L4D A;  3MU4 A;  3RXL A;  2PGB B;  1TPP A;  3U98 H;  3GY3 A;  4UD9 H;  3A89 A;  2TBS A;  1GJ5 H;  4GCH G;  2V3M A;  2UUJ B;  2OBO A;  1JIM A;  4VGC C;  4U01 A;  3UNQ A;  5LGO A;  2XC0 A;  1BHX B;  1TLD A;  4ISN A;  1BHX F;  3VB4 A;  1WQV H;  1G2M A;  1GWA A;  1G3C A;  1PYT C;  2P8O B;  1GGD C;  2QYI A;  2SGD E;  3ZZ4 A;  2BY9 X;  3S9C A;  3URE A;  1BRU P;  3GY8 A;  2ZGB H;  4OS4 A;  4MPV A;  1SI5 H;  3SJ8 A;  4A6L A;  2BVX H;  1WBG B;  2FOH A;  4LXB H;  5LPF A;  1KY9 A;  1O2X A;  1V2O T;  4KTC A;  1H9L B;  1P2K A;  3T25 A;  1HPG A;  2HNT C;  5CHB A;  3PO1 C;  3MNS A;  3KQD A;  3PRO A;  1QFK H;  1XUG A;  2VU8 E;  1ANE A;  7KME H;  1EAS A;  1LVM A;  5GIB A;  4NIW A;  2CHA C;  5CHA B;  3UOU A;  4X6N A;  4XRN A;  1ABJ H;  1ELE E;  3RXC A;  1WQS A;  2W5E A;  2PFE A;  2C8W B;  4BOH A;  2P93 A;  1SSX A;  2ZGC A;  2BOK A;  2ODY B;  1E79 D;  4ZKR U;  2HNT E;  1LHD H;  5LPR A;  1Z7K A;  3KN2 A;  4RKJ B;  1QCP A;  1A1R A;  2IN2 A;  1AIX H;  5FXL A;  2AER H;  1SQA A;  1P06 A;  4R8T B;  1UTP A;  1TE0 A;  2ZEC A;  1SR5 C;  3BTD E;  1OOK B;  3F9G A;  3EA8 A;  1P2M A;  3TK5 A;  4BTU B;  2A4R A;  3FAO A;  4Y76 A;  4ABG A;  2L6O A;  1FY5 A;  2P8O C;  2Q6F A;  3K65 B;  2V35 A;  4MNW A;  5ESB A;  1A0L A;  2ZFF H;  5HIZ A;  2J92 A;  2ZDN A;  1GMH G;  1JRS A;  2QGR A;  2VID A;  2XW9 A;  1KXC A;  2Z9I A;  3GY7 A;  1GI5 A;  3SI4 H;  1C5S A;  3OU0 A;  2C8Z B;  3LGT A;  1C2K A;  3FAN A;  3U1J B;  1GBF A;  3SNC A;  4CHA B;  3F3B A;  3BIV H;  4HFP B;  3T29 A;  1O33 A;  1DWD H;  1O2H A;  1CVW H;  5B6L A;  8EST E;  2HLC A;  1TX6 A;  3SJI A;  3HGN A;  3ZVB A;  2SGF E;  3M7T A;  4AGK A;  1G32 B;  4RT1 A;  1H9I E;  3ODF A;  1EZS C;  5CHA C;  1A7S A;  3SOR A;  1C1S A;  3LH3 A;  2FP7 B;  1NFY A;  2Y5G A;  5HXF A;  2XND D;  4K69 A;  3S0N A;  3BG8 A;  3DT0 H;  1Q2W A;  4IC6 A;  2PSX A;  4Q4L A;  2G8T A;  1MKW K;  5FBE A;  1P2Q A;  2VIN A;  4F4O C;  1MU6 B;  2ZU2 A;  5C1U A;  4AFU A;  3EAJ A;  1MTV A;  5E2O A;  1FQ3 A;  3I78 A;  4Y6D A;  4YM9 A;  4FU7 A;  1C2E A;  4Y8Y A;  5C1Y A;  1SGR E;  3RXB A;  2HVX A;  2FTM A;  3DSG A;  1CGI E;  2WZQ A;  3BTM E;  3A85 A;  1K1P A;  2ODP A;  1WTH D;  1O2W A;  2PGQ B;  2F9O A;  4UFG H;  3BTH E;  2J98 B;  1P57 B;  1MZA A;  2WPH S;  1QHR B;  5GJ4 B;  5JBB S;  2YNA A;  2GDE H;  1TIO A;  1YPH C;  3MO6 A;  2Q6G A;  1FIW A;  1OKX A;  3BEI B;  1MAB B;  1HJA B;  4BAK B;  2BZA A;  2CF9 H;  4XBB A;  1S0R A;  1CSO E;  1P8V C;  4CHA C;  1NM6 A;  1XXD A;  2PKA B;  2VH0 A;  4Q80 A;  5CE1 A;  1YPJ H;  3PTB A;  1O3B A;  1KXB A;  8LPR A;  1NC6 A;  5GWZ A;  2H9E H;  4A7I B;  3MNB A;  1GDN A;  3RXR A;  2YMS D;  2CJI A;  1OS8 A;  4DW2 U;  2B9L A;  3GIC B;  3K6Y A;  1YPH E;  1DDJ A;  4KTU A;  4ACA A;  1D3Q B;  2IOT A;  2WV9 A;  3SOS A;  1G3E A;  4YT7 H;  1QRZ A;  1Z8R A;  4DCD A;  1AQ7 A;  4CRB A;  1PPH E;  2Y7X A;  1SGE E;  4NIX A;  3AW1 A;  3HKJ B;  2F3C E;  3PLB A;  1TGT A;  4TYD A;  3U69 H;  1P2O A;  1XUJ A;  1DT2 A;  4YOI A;  2V7Q D;  1TNG A;  4ZHA A;  3T2N A;  1UCY E;  2BLV A;  3BSQ A;  3A8D A;  2WV4 A;  1O3D A;  3BN9 A;  2OCV B;  1DIC A;  3M3T A;  4B6E A;  4WMF A;  3SJK A;  1JOU B;  1LPK B;  1Y5B T;  3AAV A;  1NU9 A;  5C0U A;  1MTN B;  3V0X A;  4MTB A;  3VB6 A;  1E35 B;  1SL3 A;  1C1N A;  2BLQ A;  1LHC H;  3ATL A;  4YZU A;  2TGT A;  4ABE A;  2XBV A;  3SV9 A;  1CU1 A;  3GCH B;  1AWH B;  3GYM A;  1O2J A;  1HJA C;  2EEK A;  3N99 A;  5GXP A;  3FKS D;  3UAI C;  4BXW A;  4NSY A;  1B0E A;  2BD8 A;  1BJV A;  2VB0 A;  2CF8 H;  1PQA A;  1QTF A;  2L74 A;  3EQ0 H;  2JET B;  1EP5 A;  5LH8 A;  2NU4 E;  1TGN A;  3NPS A;  3UIR A;  2G00 A;  4K8Y A;  4NCY A;  1BTY A;  4D9Q A;  4D9R A;  4I8G A;  1W12 U;  2QXJ A;  4INH A;  1K1N A;  1DLK B;  4TY6 A;  2BD3 A;  1Q31 A;  2EC9 H;  3LGU A;  3GDS A;  2ZP0 H;  2LNC A;  4UDW H;  1H1B A;  4BNR A;  3HKI B;  3GCO A;  3MNC A;  1W14 U;  1XM1 A;  1IOE A;  1S6F A;  1A5H A;  2V3O H;  3LC5 A;  3BTQ E;  1Z8J B;  1CA0 B;  1VR1 H;  1YPK H;  2Z3C A;  1NFU A;  1TA2 A;  2TGA A;  3DFL A;  4JCN A;  1N6X A;  2J9N A;  3LGI A;  1MTN C;  1UCY H;  1IQE A;  2J4I A;  4AN7 A;  4CBO A;  2HRV A;  4P02 A;  1PJP A;  6EST A;  1LCY A;  4KTS A;  1O34 A;  3BTW E;  4QT8 C;  4FVD A;  4ZKO U;  4O97 A;  1VJ9 U;  3GCH C;  1P3C A;  2HAL A;  1CQQ A;  3P17 H;  1THS H;  2AGI X;  1XUK A;  2ZGJ A;  3ZZ9 A;  1TGC A;  7GCH G;  4FUF A;  1GCD A;  2PTC E;  5L6N H;  4RSP A;  2QF3 A;  3MQK C;  1LMW B;  3UR9 A;  2AMQ A;  7EST E;  3BTE E;  3TJN A;  1O2P A;  2XCN A;  3E0N B;  2NU0 E;  4X2Y A;  1Z8G A;  4IS5 A;  2JET C;  1EOL A;  4WVP E;  1ZJK A;  3H7O A;  1QA0 A;  4NG9 H;  1NRO H;  3SI3 H;  5AF9 H;  5C0T A;  4ZHM U;  1GVL A;  2FX6 A;  2J97 A;  1VCQ A;  2FM2 A;  1GBD A;  3EYD A;  3NK8 A;  4WME A;  2J98 A;  1EKB B;  3V7T A;  4GAW A;  2W3I A;  1OWK A;  2FOB A;  4X2X A;  5C5O A;  1GMD F;  1OP2 A;  4B71 A;  2B7D H;  2JIZ D;  1IQM A;  1C9T A;  2F83 A;  3NXP A;  4J2Y B;  3SND A;  2FXR A;  2ALV A;  2FOM B;  3RXQ A;  1ZJD A;  2QXG A;  1THP B;  2Z3E A;  1CA0 C;  1ZSJ A;  1QY6 A;  3E1X B;  1WTG H;  1K9O E;  4WJG 2;  4MPU A;  1ANB A;  1GMC F;  1ZHM A;  5FHT A;  1FAX A;  4UFF H;  5JYI A;  3K6Z A;  4ZXY H;  1KDQ A;  2AH4 X;  2BM2 A;  3LU9 B;  2W7S A;  1YYY 1;  4WY3 A;  1MAX A;  3W95 A;  1O3H A;  1SGC A;  2VIV A;  1IQG A;  4IC5 A;  1VCW A;  3FOA A;  2Y82 A;  3TJU A;  1TNK A;  3AK5 A;  4D7F A;  4DII H;  1DY8 A;  4NZQ A;  1HJ8 A;  3TGJ E;  1FJS A;  1YPL H;  3Q77 A;  2WUC A;  1UK3 A;  3SN8 A;  1YPG H;  4AOQ A;  4HGC A;  4ZCN A;  5C1X A;  2GGV B;  3MYW A;  1FIZ A;  2TPI Z;  1EP6 A;  2C8Y B;  4CR5 A;  1BB0 B;  1BIT A;  1YLN A;  1QR3 E;  1NT1 A;  1NFW A;  1S83 A;  2Z9G A;  2GCH F;  4A1V A;  2W3K A;  3SGA E;  3U8T H;  2QV1 A;  1O35 A;  2BLO A;  1V2K T;  2JH0 D;  1ELT A;  4Y7B A;  4NA7 A;  3A7Z A;  1AB9 B;  1RTL A;  4GLY A;  4O9V A;  3VFE A;  1SGF G;  4AG2 A;  2BXT H;  1C2L A;  2ZU5 A;  4YT6 H;  3TU7 H;  3P95 A;  3M3V A;  1S6L A;  3ZYE A;  1SGP E;  1FON A;  1O2S A;  3E8L A;  5DP7 A;  1QBO A;  1C5T A;  3DFJ A;  1E34 B;  2BDY A;  1GHW H;  1ETR H;  1XKB C;  2ZPS A;  1AMH A;  1W8B H;  1GJA B;  4YOG A;  5LPE A;  1MTW A;  2P3F H;  1G37 A;  2QF4 A;  2RDL A;  3MO9 A;  1E36 B;  3QZQ A;  2OQU A;  4KEL A;  3QDZ B;  4ZAE A;  2QXH A;  1LVB A;  3PWC A;  1KLJ H;  4H42 U;  1YLD A;  3RXP A;  2H2Z A;  5AFY H;  3PYH A;  1GBM A;  4K1E A;  4LK4 A;  2ALP A;  3A7V A;  1GI9 B;  1UVP A;  1PQ5 A;  2BY6 X;  3LH1 A;  1BML A;  1V2P T;  4K1S A;  2XOK D;  1J8A A;  5K0H A;  1C5N H;  3S7K B;  4ABI A;  1O3M A;  4UFE H;  2W7U A;  1AN1 E;  3SZN A;  5E2P A;  1HV7 A;  5C67 A;  2PLX A;  1KLI H;  4HG6 A;  3F2G A;  1C1U H;  1TON A;  1XVM A;  4X2W A;  3OAA D;  4AC9 A;  1FDP A;  1HAV A;  2TIO A;  1Z8I B;  4I8L A;  1GVK B;  1T31 A;  1XUI A;  3SU2 A;  3OEE D;  2OLG A;  2PTN A;  3HPT B;  1AB9 C;  1NRN H;  1QIX B;  3QX5 H;  1JIR A;  2ZFT A;  1WOF A;  1FY8 E;  1A46 H;  2ZWL H;  1LVY A;  3KNX A;  1AI8 H;  2NWN A;  1GI7 B;  3RXA A;  3SU1 A;  1UK4 A;  2BOH B;  4I8K A;  2AFQ B;  3UY9 A;  1C5P A;  4ZHL U;  3PV5 A;  1J16 A;  4ABJ A;  1S81 A;  1ZLR A;  4K5Z A;  1Y3U A;  3GYL B;  1JXP A;  4ISL A;  3RXD A;  1K28 D;  1TRN A;  2AHM E;  3KYG A;  4B2A A;  1SLW B;  3D23 A;  1TBQ H;  1V2L T;  2JJ1 D;  2R3Y A;  4TWW A;  1T7C A;  1Y5U T;  3FP6 E;  4H4F A;  4TPY A;  4Q7X A;  3FZD A;  1O38 A;  2FX4 A;  2Y80 A;  1C5Q A;  1EAW A;  1OXG A;  4U32 A;  2A4Q A;  1EB1 H;  4HI3 A;  6LPR A;  1K0H A;  3JZ1 B;  1KIG H;  4E7R G;  2A32 A;  2ANM H;  1E38 B;  2ZQ2 A;  2F9V A;  1QGF A;  1K1I A;  3STI A;  4AFQ A;  2D1J A;  3WWF A;  3E16 B;  5C5N A;  1O0D H;  2BZ6 H;  1DWE H;  1CT2 E;  4FOU C;  2G51 A;  3LDX H;  4IN1 A;  1F0S A;  1QZ8 A;  4U2W A;  2OBQ A;  1HXF H;  3F9E A;  3QTV H;  1LHE H;  1MBQ A;  1O3F A;  1XMN B;  2BQ7 B;  2G4T A;  1GJ4 H;  1GI1 A;  2LP6 A;  1ELC A;  2AGG X;  1N8O B;  2R3U A;  3F2F A;  5C2Z A;  1GBJ A;  1K2I 1;  1ZYO A;  1OWH A;  2WPK S;  1HDT H;  1SFI A;  4E7N A;  5FAH A;  3L33 A;  1W10 U;  3ZV9 A;  1TBR H;  4DOQ A;  1AE8 H;  1K1O A;  3RXJ A;  1UMA H;  2XWB I;  4FUB A;  4TWY A;  1MKW H;  4XOJ A;  2XYA A;  1AKS B;  3EE0 B;  1TA6 A;  2VNT A;  4XDE A;  3SV6 A;  3M37 A;  3VB7 A;  3SYJ A;  3VB3 A;  4SGB E;  3BTG E;  1KTS B;  2A0Q B;  5DKM A;  3SV2 H;  3P8O A;  3LT3 A;  1N6Y A;  1J9C H;  2JKH A;  3GS9 A;  1L0Z A;  3TLO A;  2GKV E;  3BEU A;  1MUE B;  1YC0 A;  3KHV A;  5EST E;  5EOD A;  5DP8 A;  1YY3 A;  1C9P A;  1P2N A;  3DD2 H;  3O8R A;  2SGE E;  1GI8 B;  4B2B A;  1TOM H;  4BXS A;  2CHA B;  2Y5F A;  3RXI A;  3DHK H;  1VZQ H;  1ZMJ A;  2BD2 A;  2WPM S;  1NES E;  4BAO B;  4CR9 A;  1M9U A;  3M7U A;  1OYT H;  1TMU H;  1C2G A;  4BTT B;  1A4W H;  1IQL A;  1C5W B;  4RI0 A;  4I7Y H;  1AND A;  1BJU A;  1C1V H;  3UB0 A;  1O3G A;  1TGS Z;  4AYY B;  2V3H H;  4NA9 H;  1KSN A;  3UWI A;  1OP8 A;  3GCN A;  2QIQ A;  2O8W A;  3PMA B;  1N8O C;  5GPI B;  3DCL A;  2KFW A;  4X8V H;  1NBM E;  5GND A;  2KCY A;  1J14 A;  3V13 A;  2G81 E;  3CEN A;  2C8X B;  1XKA C;  2BQW B;  4NGA H;  1D3P B;  1GHZ A;  3W1E A;  2R9P A;  1OPH B;  1CBW B;  3BTT E;  3S9A A;  5GCH F;  2R2M B;  2CK3 D;  4X8T H;  3P8G A;  3ZVE A;  2VGC B;  1BTW A;  3RM2 H;  4JZD H;  3UR6 A;  3FFG A;  1AVX A;  3ODD A;  4B74 A;  5EJ1 A;  1NTP A;  2FIR H;  1W0Z U;  1TWX B;  3V12 A;  2ZF0 H;  1QL9 A;  1QNJ A;  3RU4 D;  1ZRB A;  5G4B A;  5GDS H;  2QAA A;  2EI8 A;  2IPQ X;  1HGT H;  3P8N A;  3PM3 A;  4AGJ A;  1WAY B;  4WMD A;  3KQ5 A;  3ZZ8 A;  1W2K H;  3ATI A;  3ZZC A;  1AVG H;  4ISH H;  5DP3 A;  3ZZ3 A;  3TPI Z;  5DG6 A;  4M9F A;  2BDH A;  1VIT F;  1RTK A;  3R3G B;  2UWO A;  1TYN A;  1V2R T;  1MMJ N;  1MH0 A;  1O3J A;  2VH6 A;  2VJ1 A;  1HNE E;  1KXF A;  2K1Q A;  3DA9 B;  4YOJ A;  3ATK A;  2BD4 A;  4UEH H;  1PPG E;  1LO6 A;  4FUE A;  4INL A;  4UE7 H;  2J5U A;  4IBL H;  2FYQ A;  3RC5 A;  3SNB A;  2CN0 H;  5C17 A;  1AZZ A;  4Q63 A;  1K1J A;  1EAI A;  8KME 2;  3KQB A;  4Q7Z A;  1CBW C;  1L2E A;  3E6P H;  1RRK A;  2R0K A;  3O8C A;  2GVF A;  1C2D A;  1PPE E;  1IHT H;  2VGC C;  3E91 A;  3RXG A;  2V6N A;  3L6P A;  4NIV A;  1AE5 A;  1OSS A;  1HBT H;  1GJ6 A;  2Z3D A;  3SV7 A;  3A84 A;  4NFF A;  4JK5 A;  5TJX A;  4A1X A;  2F4L A;  1SFQ B;  1ZTK A;  3ZZB A;  1C5U A;  1K22 H;  2AGE X;  1O2Z A;  1C5Y B;  1Y5A T;  4CBN A;  1GBK A;  1IQH A;  1GMC G;  1PFX C;  1UHB B;  1WV7 H;  3ZZ7 A;  3EE7 A;  3TGI E;  2FZZ A;  3H09 A;  5T1V A;  3MNX A;  2RA3 A;  2O8U A;  4OGX A;  4D8N A;  3ZV8 A;  2A2Q H;  2A5K A;  3O8B A;  1A61 H;  1PPZ A;  1WCZ A;  4LZ1 H;  3MU5 A;  1C1P A;  4D7G A;  2ZPR A;  3PB1 E;  1DSU A;  2SGA A;  4X1Q U;  2WPJ S;  4I33 A;  3HK3 B;  4LZ4 B;  4X1R U;  2PW8 H;  3QWC H;  3A7X A;  2DUC A;  1H8H D;  1C2I A;  1W3C A;  3RLW H;  3TIU A;  1AKS A;  3MI4 A;  4WH8 A;  1O2Y A;  1LKB A;  1SOT A;  2H5D A;  2GV7 A;  1UTN A;  3GCT F;  5EW2 H;  1EST A;  1GBB A;  3SUD A;  3A80 A;  1FX0 B;  1AO5 A;  1EQ9 A;  3ZYD A;  2QE7 D;  3GDV A;  5DK1 A;  2GCH G;  1GBA A;  4ZKN U;  1ACB E;  2BQ6 B;  3ZZ6 A;  1B5G H;  1LVO A;  5EXN A;  1O36 A;  2JJ2 D;  3RMM H;  3UWJ H;  4X6O A;  3TH4 H;  1GBT A;  1S84 A;  4FET A;  1EAT A;  1KDQ B;  1GBH A;  4RKO B;  4JZ1 A;  1IAU A;  5I25 A;  4IGD A;  3E0P B;  1AUJ A;  3Q00 A;  2J2U A;  1DM4 B;  3M61 U;  2Y81 A;  2BY5 X;  1TAB E;  3STJ A;  3P6Z B;  3TNS A;  1RD3 B;  1L1N A;  3SQE E;  3U8O H;  1SKY E;  2XXL A;  2FES H;  2F9N A;  1O2I A;  1FY4 A;  1O5A B;  2ZFQ H;  5FCR A;  2ZZU H;  3D62 A;  3RC4 A;  3TVJ B;  4RN6 A;  1ETT H; 
#chains in the Genus database with same CATH homology
 3LOX A;  4Q4L A;  4TT3 D;  3SU2 A;  3L6P A;  3F0P A;  3NRL A;  3OEE D;  3SU6 A;  1KMH B;  2WHX A;  3LON A;  1OHH D;  2O8M A;  3SV7 A;  4NWL A;  4A1X A;  1DXW A;  4K8B A;  4XD7 D;  1NS3 A;  2F4L A;  4F55 A;  1RGQ A;  4RI0 A;  3KNX A;  5ETX A;  3DSO A;  1NBM D;  4Z1M D;  3FOA A;  3UB0 A;  3SU1 A;  3SV8 A;  3AK5 A;  2YOL A;  1DY8 A;  3PV5 A;  4KTC A;  3SU3 A;  4WH6 A;  5FPY A;  4A92 A;  2WZQ A;  2KCP A;  3H09 A;  5T1V A;  5EPY A;  5IDK A;  5CHB A;  4B75 A;  1JXP A;  1W0K D;  1E1R D;  3O8B A;  5HKK D;  2AHM E;  5GPI B;  2KM0 A;  2KFW A;  3DCL A;  4ZCN A;  5EQQ A;  2JJ1 D;  3M5O A;  1NBM E;  5GJ4 B;  5GND A;  2KCY A;  2OC7 A;  3OEH D;  2GGV B;  1DXP A;  4I33 A;  4I32 A;  4OM9 A;  2K0Q A;  3W1E A;  1MAB B;  4WF8 A;  1H8H D;  2LEL A;  3U1I B;  1W3C A;  4ASU D;  4A1V A;  2KCO A;  2A4Q A;  2XNI A;  2WSS D;  2F9U A;  2M2A A;  2OIN A;  2QV1 A;  3WWB A;  2VBC A;  4WH8 A;  2CK3 D;  2KCA A;  3KF2 A;  2YMS C;  3OYP A;  2OK5 A;  2F9V A;  4TSF D;  2F43 B;  1E79 D;  5FPT A;  4A1T A;  5DN6 D;  1COW D;  3N7D A;  5EQS A;  5EPN A;  3E90 B;  4B74 A;  3WWF A;  1RTL A;  3M5M A;  1DY9 A;  2YMS D;  3SUD A;  5IK2 D;  2OC8 A;  3KN2 A;  1FX0 B;  3SUG A;  2OC0 A;  3O8D A;  3SU0 A;  4DT4 A;  2K8I A;  2P59 A;  1A1R A;  1S6L A;  2QE7 D;  2XCF A;  3SZE A;  3DSP A;  1BT7 A;  1H8E D;  2KZ4 A;  3N7E A;  2OBQ A;  3P8N A;  3PV2 A;  2JDI D;  3KEE A;  2WV9 A;  1WXR A;  4R8T B;  3WW7 A;  3OTP A;  2HLD D;  4NWK A;  3SUE A;  2JJ2 D;  1W0J D;  2KR7 A;  2OC1 A;  4M9F A;  2A4R A;  2IJO B;  2QF4 A;  3F2F A;  2XCN A;  2L6O A;  3OE7 D;  4I31 A;  3FN8 A;  2W6I D;  3SU5 A;  3VG8 A;  5DSF A;  5ESB A;  2WPD D;  3PRB A;  4TYD A;  4FET A;  3RC6 A;  2V7Q D;  5C0T A;  5EQR A;  3M5N A;  2K1Q A;  1BMF D;  5CDF E;  2W6J D;  4YXW D;  5FL7 D;  2FM2 A;  3U1J B;  4B73 A;  2XOK D;  3F3B A;  3FO8 D;  4B6E A;  5C0U A;  3SV6 A;  2YMS B;  3F2H A;  3EYD A;  1E1Q D;  3SYJ A;  5B6L A;  2QF5 A;  2IJD 1;  3F0O A;  3P8O A;  3M5L A;  2J5U A;  3SU4 A;  3SUF A;  4JMY A;  4B71 A;  3GS9 A;  3ZIA D;  4B6F A;  4B76 A;  3F2G A;  2JIZ D;  3RC5 A;  3SV9 A;  5FPS A;  1CU1 A;  5H4I B;  3PRD A;  1EFR D;  2OBO A;  4Q63 A;  1SKY E;  5C17 A;  2FOM B;  3OFN D;  4U01 A;  2A4G A;  3N99 A;  3O8R A;  3OAA D;  3FKS D;  2FP7 B;  5F53 A;  3RC4 A;  2XND D;  3O8C A;  1N1L A;  2GVF A;  3LKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...