3F2FA

Crystal structure of the mercury-bound form of merb, the organomercurial lyase involved in a bacterial mercury resistance system
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
208
structure length
208
Chain Sequence
MKLAPYILELLTSVNRTNGTADLLVPLLRELAKGRPVSRTTLAGILDWPAERVAAVLEQATSTEYDKDGNIIGYGLTLRETSYVFEIDDRRLYAWCALDTLIFPALIGRTARVSSHCAATGAPVSLTVSPSEIQAVEPAGMAVSLVLPQEAADVRQSFCCHVHFFASVPTAEDWASKHQGLEGLAIVSVHEAFGLGQEFNRHLLQTMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the Organomercurial Lyase MerB in Its Free and Mercury-bound Forms: INSIGHTS INTO THE MECHANISM OF METHYLMERCURY DEGRADATION
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Alkylmercury lyase
total genus 61
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 4.99.1.2: Alkylmercury lyase.
pdb deposition date 2008-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03243 MerB Alkylmercury lyase
A PF12324 HTH_15 Helix-turn-helix domain of alkylmercury lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.490 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3f2fA00
5C17A 3F0OA 3F2FA 3F0PA 3F2HA 3FN8A 5C0TA 3F2GA 5C0UA 5DSFA
chains in the Genus database with same CATH superfamily
4PROA 4I8JA 1ETTH 1ZHPA 4DGJA 4CRDA 4O97A 2HNTC 1C2IA 1NFYA 5FX6A 1FUJA 2PFEA 1C1MA 2WPLS 1FMGA 2KX4A 1CBWB 3KHVA 3RXHA 3RXKA 5A09A 1GI8B 1EB1H 3SUDA 1HJAC 1TGSZ 5C0TA 1FAXA 4UD9H 1UJ1A 1UTJA 4FUEA 5G4BA 1GBMA 1XKAC 2KM0A 3AASA 1GMDF 2AS9A 3RXDA 3UOUA 2A32A 2ZG0H 1H9IE 2ZFPH 3DSOA 3M3SA 1MU8B 3PMBB 1NU9A 4KTSA 3SNEA 4DOQA 3RXRA 2R2MB 1AWHB 4Y10E 1OP8A 2P8OC 3DHKH 4ISOA 4B73A 5KECA 3MH4A 1ZSLA 1VITF 2UWLA 2AFQB 4X2WA 4I33A 5K0HA 1B0EA 2F9UA 1SG8B 1O5EH 1IQLA 3EAJA 2GCHF 1TA2A 3KN2A 4RI0A 4Y0ZE 1O3EA 1O2YA 1O2SA 2VNTA 1NRNH 1Y3WA 1TX8A 2VIPA 4Y8YA 1AKSB 1HBTH 1YPHE 3SU4A 3PM3A 2BLVA 1MD8A 1K1NA 2H2ZA 4FVDA 1GI4A 1QJ7B 3LOXA 4WVPE 3NRLA 5JBCS 1CU1A 1A0HB 2IN2A 3PV5A 2DUCA 3P92A 2PKAB 1YC0A 1YKTA 2QXIA 2A0QB 5C67A 1MTVA 1K1LA 1C5VA 1ID5H 3M37A 2ZQ2A 1S82A 1W0JD 2Y7ZA 5AF9H 3U28C 2FWWA 3U8OH 2OINA 1BBRE 3GY3A 2H5DA 1O2KA 2XWBI 2XTTB 3DFJA 3SU0A 2FTMA 1QY6A 1H8HD 2ZGXH 4Y8XA 4R0IA 3PYHA 1HDTH 1SGFA 1F0SA 1HAOH 2WHXA 3P70B 2WPJS 1CT2E 2ZHQH 2QC2A 4Y11E 1RRKA 4CREA 1DFPA 4K3JA 3RXMA 3SO3A 1SQRA 5GPIB 1E1RD 4KGAA 3RUOA 3TVJB 2VWLA 3ZZ6A 1N6YA 3RXTA 1OWEA 3FVFB 3PV2A 3K2UA 4X8VH 1PPZA 5DO4H 1EUFA 3SV8A 4F49A 1BMFD 5CE1A 2EI6A 2LP6A 3LGWA 4NFEA 4UDWH 3FKSD 1NRQH 4B2CA 3M7TA 5ESTE 1EQ9A 1TONA 1VITG 1T4VH 9ESTA 1SOTA 2O8UA 5EJZA 1S84A 3HKJB 3VFEA 1UK3A 3S9CA 4ZKSU 3AW0A 3BN9A 1ESAA 3BTWE 3SJKA 2O8WA 3P17H 1AE5A 3MO6A 1O2MA 2GVFA 1UHBB 4AGJA 1DX5M 4WMDA 4RT1A 1IQGA 3BIUH 1G36A 4D8NA 1SFQB 2BMGB 3KGPA 3SGQE 1W7GH 2RG3A 3KEEA 1A1RA 1UTNA 1G37A 4MVNA 3RP2A 2PWXA 3C27B 2CK3D 4FU9A 4FU7A 2A31A 1E0FD 3SV7A 3L33A 5JB8S 4GSOA 5DG6A 1THRH 3WY8A 1DSUA 2ZFSA 4X8TH 4YLUA 3UB0A 5F8XA 1VJ9U 1LHGH 3E0NB 1SGCA 1UVSH 2O8MA 4BAQB 2O8LA 2R3UA 1TX6A 3OY6U 1VCPA 1BT7A 1H1BA 3JZ2B 1RTLA 2XC4A 8LPRA 4X8SH 2WPKS 4CR5A 1W13U 3EYDA 3O8DA 4KELA 3HPTB 4ZHLU 3FAOA 3SJOA 1EOJA 1CE5A 1CSOE 3AAVA 2GZ9A 1MKWK 1YF4A 1P06A 1RIWB 4ABDA 2W6ID 2XNDD 1O39A 4ZAEA 3SQEE 2ZWLH 1GJCB 1L1NA 1LMWB 1NN6A 4Q2KA 5ABWA 3R0FA 1QB9A 4B76A 3SBKA 5FAHA 1YLCA 2BDAA 4AB8A 2C8WB 2A5KA 1PYTD 3DSPA 2A5AA 1WAYB 1EXFA 1BJVA 4Y76A 4ZHAA 1C2DA 4DW2U 2XBXA 1LQDB 5EPYA 1GDNA 3MU5A 4E7NA 1NROH 1KTTB 5GXPA 1YPGH 3KQBA 1QL8A 2QXHA 3SZNA 1GJ8B 4YTAA 5EU8A 3NXPA 1OWDA 3N99A 3PTBA 2F43B 1P01A 4MNVA 1AMHA 3GS9A 1QBVH 2TRMA 3P95A 1UK2A 1WTGH 1ZRKA 2A2XH 2KAIB 2OLGA 2G5VA 3UTUH 1UW7A 1LHDH 1NS3A 1GBJA 2F83A 1AZ8A 5PTPA 3F2GA 3STIA 4RKJB 1QA7A 1GHXH 1QL7A 2BD7A 3UPEA 1FQ3A 2O8TA 3OE7D 1AQ7A 1MAXA 3EGKH 2ZFQH 5EXLA 3VEQB 4UFDH 1D9IA 1TOMH 1ZTKA 1C5SA 4LZ4B 1K28D 1KDQB 2P3FH 1YCPH 4JZEH 2BQWB 1PPEE 3ATMA 3FN8A 1ZMJA 1GBKA 2FOAA 6GCHG 3V12A 1KTSB 1P2KA 5HIZA 2H9TH 1SGNE 2BLQA 1C5TA 1GBLA 2JJ1D 1CQQA 1ZMNA 4BTIB 1LVYA 2PKAA 5EPNA 1PFXC 1A46H 1O0DH 4TWYA 5A8YA 1AIXH 5I46H 1OX1A 1TRNA 4B2BA 5K7RA 2ZFFH 1EFRD 1AVWA 3FP8E 2ZDVH 1MKXH 1QGFA 1F0RA 1DPOA 1WBGB 2V35A 5F8ZA 2PKSB 4HI3A 1IHTH 1RTKA 2FYQA 4MPWA 5GCHG 3VB3A 1O3CA 1XXDA 1O2XA 4O3TA 1Q31A 4XBBA 2SGDE 2WUBA 2ZGHA 1DS2E 2VWMA 1JOUB 3SJ9A 2J34A 1SQAA 1O2ZA 4D76A 1ZYOA 5EQRA 1IQHA 4ZH8A 1DWDH 3ZVAA 1WV7H 4MPVA 1J15A 1BOQA 4NA7A 3K65B 1Z8JB 4FUIA 2GDDA 3NK8A 3MH5A 3A7ZA 3HGNA 6LPRA 4JYTA 1HIAB 1FN8A 1O3FA 4ZXYH 1SLUB 2VVVA 5TCCA 1W8BH 1AFEH 3GOVB 2VIQA 5EXMA 3E8LA 4LXBH 3E91A 2YMSB 3UR6A 2Z6BD 2PSYA 1ELFA 1EAWA 3P8OA 3ZZBA 1RJXB 3WW7A 2DE9A 1GJ9B 4HG6A 1XUIA 2VIOA 2ZF0H 5C5OA 1O3GA 3FZDA 3MFJA 2O9QA 4AORA 1ELAA 3SV2H 1LDTT 2BZAA 3ZYDA 4BAKB 4NA8A 1UTMA 4AFUA 5A0CA 2NU0E 1YPKH 2OQUA 1O3PB 2BLOA 1GI7B 7GCHF 1TNGA 3U8TH 1UCYH 1DVAH 3BTGE 3RMMH 2P93A 1ZPZA 1AUTC 5E0HA 4TT3D 3MMGA 5EW2H 3L6PA 2AMPA 3TJNA 4TYDA 5DP9A 4MPUA 5HKKD 1GWAA 1P05A 2ZU5A 1C5OH 3FP7E 1C2JA 3PTNA 1KLTA 4CRFA 2OC8A 4DJZB 2QA9E 2TBSA 1UMAH 1EPTB 2PW8H 2OTVA 1EJNA 3VGCB 1AB9C 1V2PT 3RXQA 1YP9A 2R0LA 3ZZ4A 1C5NH 3LGYA 3ZZ3A 3ZZAA 1FJSA 4XFQA 3EA9A 2R3YA 1DDJA 2ZDLA 5L6NH 1C2LA 3OY5U 2AH4X 5E0JA 4X1QU 1OWHA 1ZHRA 3WWFA 3U1JB 1A0LA 2BDYA 2HVXA 2OBQA 1ZGVA 3LJJA 1KLJH 4ABBA 3T25A 1LVOA 1P0SH 3S9BA 1ZSJA 3EE0B 1AE8H 5GJ4B 1NESE 2OXSA 1O30A 3MO9A 1LKAA 3ATLA 4XBCA 1C2EA 1PPFE 1C1PA 4MDSA 2HNTF 4K1EA 1COWD 1K1IA 3QX5H 5C1UA 1XUGA 4B6FA 1OYQA 1CHOG 3SUFA 3JZ1B 3BTME 1QR3E 4F55A 4CH8B 5DP4A 3F2HA 1VITH 5EOKA 1BRCE 1O38A 2FODA 1LCYA 2XOKD 4B74A 2K0QA 1G30B 1QRXA 3BTTE 1P2OA 1TPSA 1TLDA 2WYJA 2D1JA 4IW4E 4WJG2 4H6SB 3QK1A 3SUEA 4KTUA 1UCYE 1W2KH 1Z8RA 4NFFA 3A87A 3PMAB 5JDUB 3FFGA 2RDLA 3RXFA 1PQAA 4XBDA 1FY1A 1SC8U 1WYKA 4A1TA 3S7HB 1WOFA 4JK5A 2JETB 4Y71A 1ZZZA 2ZU3A 2ODPA 2WV5A 4AGKA 2FOFA 4OGXA 2A4RA 3N7OA 3PLPA 4Z1MD 1SQOA 1GCTB 5GNDA 1QFKH 3BIVH 2EI7A 2QF5A 1MTWA 4A1XA 2YMSC 1BZXE 3GYMA 5HM9A 3QTVH 3EA7A 1Z1IA 1GBBA 3ZVFA 4ISLA 3OYPA 1SGEE 1P12E 1FY4A 1THPB 7KMEH 2G51A 2YOLA 2Z9LA 4AFZA 1S6LA 1GHYH 3Q00A 2KCYA 4LK4A 3NZIA 1TNIA 1VZQH 1J16A 3LJOA 4AB9A 2R0KA 3KCGH 3LH3A 5JB9S 7LPRA 4B6EA 4R8TB 3LGUA 1A61H 1TB6H 1MBQA 5HXFA 2BY7X 1YYY1 1DY8A 2AHME 2WYGA 3PB1E 1XX9A 1FN6A 2ANYA 2BZ6H 2GGVB 1P2IA 3GCOA 1K2I1 4QT8C 2BQ6B 1DUEA 1MABB 3MNCA 3PWBA 2Y7XA 4ABGA 4ZCNA 2V0BA 1QIXB 2V6NA 3T5FH 1GI6A 3T2NA 2H1UA 4F48B 1SGTA 1GI5A 4Y7AA 1HAXB 3FP6E 4FUJA 2J38A 3PLKA 4E05H 3BTQE 3CS7A 4YT7H 2J4IA 1O2LA 3FZZA 2ZZUH 4MNXA 2IJOB 2XRCA 2JJ2D 1AVGH 3UOPA 3PLBA 2STAE 1CVWH 2Z3DA 1TYNA 1BIOA 4INLA 1C2GA 1J9CH 2QV1A 1EKBB 3C1KA 1HYLA 5DP7A 1MCTA 2FO9A 5IK2D 2RCEA 1G9IE 3BSQA 1V2LT 3NCLA 4ABHA 3MNBA 1LPGB 3SJIA 3SQHE 1ETSH 1SKYE 4GAWA 1P09A 8KME2 4NIVA 1O3OA 2GMTC 5EODA 2IOTA 2HLCA 2PTNA 4RT0A 2ESTE 2I6QA 1TNHA 1OXGA 2WV4A 1C5PA 1XVMA 1NY22 3SGAE 1SFIA 4NWKA 3MQKC 1FX0B 1BITA 4ASUD 8GCHF 2HPQH 1FDPA 8ESTE 4WH8A 3A7VA 3A7XA 2Y5HA 2BVXH 3UR9A 2ZHDA 1BDAA 3GDVA 3VXFH 3Q3KA 4OS1A 1GJBB 3DSGA 1V3XA 1OSSA 1BMNH 2Z9GA 3HK6B 2ZC9H 2KFWA 2LPRA 1C5QA 2P16A 1O3MA 3HATH 4DCDA 4INKA 2VU8E 4FU8A 1GBDA 3OFND 4WMFA 1TNKA 1UTLM 2V7QD 3QN7A 3A8AA 1RGQA 2KAIA 1CA0C 2D8WA 3A86A 1FONA 1FAKH 2ZTXA 2ZU2A 1C2FA 3NWUA 1PPCE 3V13A 1HNEE 2A5IA 1XVOA 3OU0A 1V2VT 5E2OA 1B0FA 1G3BA 1QURH 1NFXA 1BBRH 1WXRA 2CF9H 2GT7A 1B7XB 1ANCA 1GJ7B 7ESTE 1IHSH 2SGFE 2G5NA 2C90B 3Q3XA 1GCTC 1VR1H 1ZLRA 3D62A 1GI3A 1P04A 3BTDE 2AEIH 1EB2A 2VWOA 2VVUA 1T4UH 2VH0A 3SHAH 2QE7D 2Y81A 4CH2B 2GP9B 1HB0B 2PGBB 3GY6A 3U1IB 3ZVCA 5C1XA 2RFKC 4K69A 2UUYA 2NU2E 1O2VA 2ODQA 3A84A 5DP8A 4AN7A 2H6MA 1P2MA 5E8EH 2FOBA 3G01A 2VWNA 3QZRA 4P02A 2XYAA 1G3EA 1WQSA 3BEUA 3BTHE 1O2NA 1SQTA 1C1QA 5F53A 1MKWH 1S0QA 3CP7A 3DA9B 2FM2A 4HFPB 3EDXB 3SYJA 1F5RA 1MH0A 1ELVA 2QCYA 2WPIS 3PO1C 1GHWH 3VPKA 1SR5C 2PLXA 2G4UA 2HOBA 4Y0YE 2G81E 4AFSA 4ZXXH 5FPYA 1RXPA 2ZA5A 4DT4A 3LDXH 5TJXA 3TLOA 3UNSA 4DG4A 3T26A 4A6LA 1AUJA 2ZTZA 3D65E 1EP6A 2IPQX 5E0GA 3GY8A 3LH1A 2FOGA 3GY5A 2IPHA 1Z6EA 1O36A 3F9FA 1D4PB 3SNCA 4ASHA 2BOKA 1C1TA 4MNYA 3BF6H 3MU1A 5HGGA 1QZ8A 2A45B 2HRVA 1K1JA 1JRTA 1XM1A 1XMNB 3S0NA 1IQFA 1NFWA 2H9EH 3OEED 1GBIA 1T8MA 2B9LA 4NWLA 1JXPA 1ZTLA 1BTUA 3KL6A 3M5OA 4XRNA 1CBWC 9LPRA 2CJIA 1TX7A 1Z6JH 1V2UT 1HAGE 3F9HA 3SJ8A 2F9PA 2W6JD 4MG3A 1FZZA 1W0YH 3BG8A 2ZKSA 1QHRB 3A85A 1CA0B 4UEHH 3SGBE 1TWXB 4X1NU 4B75A 4YZUA 1O5BB 1TGCA 1YPJH 1O5DH 1A5IA 1OP0A 5LGOA 3M7UA 4NIYA 5DP5A 1P2NA 2P3TB 1T31A 4IBLH 1BTZA 1G2LA 3ZIAD 1HAVB 3ZZ9A 4MPXA 1A0JA 2C8XB 2Y5GA 1WCZA 3RM0H 1O3JA 3MYWA 1GHAG 4JYUH 1EJMA 1MTUA 3U9AH 1MQ6A 1ARBA 1FNIA 4K8YA 2VIVA 1O35A 1EZUC 3A80A 2Q6FA 3EQ0H 2V3OH 1GMCF 1YPEH 4BXSA 4E7RG 5GDSH 1QJ1B 1QTFA 2ASUB 1AD8H 2VINA 3SU1A 4AZ2B 4X0WU 2FTLE 4ZMAH 5LH8A 1H8IH 4ZKOU 2WPMS 3RMOH 1SI5H 1GHBG 1P11E 5C94A 1BTXA 4TY7A 1BMAA 1VGCB 3RXJA 1O31A 3GYLB 1Z71A 1EPTA 1O3NA 1ESBA 1SBWA 2BD4A 1INCA 1SHYA 1GHZA 1ZHMA 1S0RA 1MTNC 3H7TA 1OYTH 3R3GB 4J1YA 2F9NA 2RDEA 5CHAC 2JETC 4OS5A 1KXBA 4I31A 2M5TA 3I78A 1DT2A 1OKXA 1V2TT 4WWYA 2FLRH 2BY8X 1LHEH 3RXGA 2CGAA 3SU2A 1F5LA 4NIXA 4XSKU 3UUZA 1F0UA 3NUMA 2WINI 1E35B 1ZPCA 2DE8A 2PUQH 1AI8H 3ZZCA 2ZGJA 3SORA 2AIQA 4IGDA 1GBTA 1AKSA 3OTJE 3KF2A 2FIRH 1HUTH 2C8YB 1F92A 4JZ1A 4O9VA 3ZZ5A 3OAAD 2W26A 3A7WA 4K8BA 5IYTA 3ATKA 3P8FA 3SV9A 1MU6B 3GY4A 2BDHA 1G32B 1K9OE 3SU6A 5T3HA 4ISIH 2GTBA 3PMJA 4H42U 4RSPA 3EA8A 1O2WA 2FZZA 3SI4H 2ZPRA 1TFXA 1O3IA 3ZZDA 6CHAC 1AGJA 4RKOB 4TPYA 1QA0A 2HNTE 4ISNA 4YM9A 2K8IA 4JCNA 3Q76A 3M3TA 3VB4A 1PJPA 1C5ZB 1P02A 1ZPBA 3H09A 3FO8D 4IC5A 2WV9A 1KXCA 1RTFB 2FS8A 3VG8A 1J17T 1GMHG 4X8UH 1AVXA 1FY3A 1JRSA 1K1PA 2VBCA 3ATIA 1UTPA 1YPLH 4GHQA 4FETA 1BA8B 4ABFA 3RU4D 2ULLA 2JH0D 4X6MA 2Z7FE 5HIYA 1C9PA 2BVRH 4JYVH 2AMQA 1TPPA 2W3KA 1A3EH 2PKSC 4ZKRU 3AK5A 1ETRH 1SGQE 4FVBA 3F9EA 1MTNB 2BHGA 2IJD1 2F4LA 1SSXA 2BD3A 3GCTG 3W94A 2YMSD 1GJAB 5L2YH 4MQAA 1OWIA 1ZMLA 2KCAA 2HALA 1ANBA 2TIOA 1IQNA 1GHAF 1YCPK 4UFGH 4NG9H 1HAZB 4DIIH 4I8KA 1NBMD 1CGJE 1NFUA 1D6WA 5EJ1A 3TNSA 5C2ZA 5JPMH 2Z9KA 2A1DB 3UWIA 2J2UA 1WQVH 4I8LA 3BG4C 1KIGH 1BTPA 1GGDC 1V2ST 2ZEBA 3FANA 1WUNH 1UVOA 1VJAU 1EATA 2G00A 4P00A 1JIRA 1LVMA 1THSH 3M5MA 2YNAA 3S9AA 2SGEE 3A8DA 4AYVB 1V2WT 1ELBA 3GDUA 3K6ZA 5GCHF 4BTUB 1W0ZU 1L1JA 3TH4H 2AIPA 2XNIA 2Z94A 1TGTA 2PTCE 3QUMP 3ZVEA 4XE4A 3A82A 4U30A 1GDQA 1N8OC 5ESBA 3SNBA 3ZVDA 1Z8GA 2FX6A 1FLEE 5I25A 2EY4C 1UCYK 3GISB 2CN0H 1UVUH 4BAMB 4ABEA 3CENA 3S69A 2XW9A 4RN6A 1S85A 4IMZA 1OPHB 1PYTC 1NC6A 2FDAA 3ENSB 4ZUHA 4BTTB 4WXIA 1BMLA 1Y3YA 3LU9B 1GMHF 3B8JA 1LVBA 4NGAH 3TNTA 3SNAA 3MWIU 4X2XA 2B8OH 5KEDA 5AFYH 3TJUA 5DN6D 2QXJA 4YXWD 3SU3A 3MOCA 2WSSD 1K1MA 1T8NA 2V3HH 3SHCH 1C5WB 4X1RU 4LZ1H 2P59A 3VB7A 4B71A 3TH3H 2Y82A 5B6LA 1HAVA 2HLDD 1ELCA 1P57B 4BXWA 4FUFA 5AHGH 1GJ6A 2RA0A 3SZEA 1EPTC 1SGDE 1D3PB 3RXBA 1ARCA 3U69H 5DP3A 1D3DB 1Y5BT 1WDIA 2XBVA 3U98H 4OM9A 1C2MA 1OWKA 1ZRBA 2C8ZB 2BY5X 1HRTH 4GPGA 1W14U 1GVLA 1A7SA 3A81A 5FCRA 5CMXH 2L74A 3I29A 1CHGA 2TGAA 3ATWA 2GMTB 4AG1A 1TGBA 1Y59T 3PRBA 1TAWA 4ZHMU 1PPGE 3RLYH 2NWNA 1HGTH 1L4ZA 4UE7H 4IS5A 5AVDA 2I6SA 1TNLA 4K2YA 2GV6A 1JWTA 4OS2A 3UY9A 1TMUH 3UQVA 2QXGA 1Q2WA 1ABIH 4AG2A 1H9LB 4ABAA 3LONA 1AWFH 3RU4T 3ZVGA 4YOIA 1DWEH 2HGTH 1LKBA 4YESB 4YOJA 4FUBA 1C5YB 2J97A 1C1RA 1V6DA 2UWPA 3A7YA 3K9XB 2FPZA 1SLVB 5FBEA 5DJ7A 2FOMB 1LO6A 1EASA 5F6MA 2OBOA 2FESH 1E34B 1HPGA 1A5GH 1Y3XA 2XCFA 7GCHG 1GGDB 1O5AB 1G2MA 1FI8A 3KNXA 1W7XH 2VIDA 2QIQA 3TK5A 3RXAA 1FY8E 3IG6B 1GJ5H 1P03A 3ZZ7A 2LELA 2J9NA 3GDSA 3TH2H 4B2AA 1TA6A 1AU8A 2J95A 3RXSA 1C5XB 3SW2B 5HM2A 1FIWA 2UUFB 3GCNA 1DWBH 1QBNA 4DVAU 1GDUA 3GCTF 4CRAA 2Y80A 2B0FA 2W7UA 1UTOA 4ZKNU 2NU4E 2UWOA 1E79D 2P3UB 2P94A 5EIYA 3RXOA 2G8TA 4TSFD 2W3IA 2FI4E 2JKHA 3Q3YA 1G3CA 2OD3B 3SV6A 4SGAE 3A88A 3UQOA 1U6QA 1DXWA 2CHAC 4MTBA 3ZV9A 1HIAA 1TALA 2VGCB 2FLBH 3WWBA 1NPMA 4A92A 4GUXA 2R2WU 5BPEA 3SI3H 4FOUC 1KDQA 3E1XB 4H6TA 1BCUH 4IMQA 1QQUA 1LTOA 4CBOA 1SGYE 2XXLA 4YO9A 3PV4A 1BB0B 3N7DA 2BYAX 2WPDD 3VB5A 3F6UH 3M3VA 1C5UA 2GZ8A 4ZROA 4Y79A 2Z9JA 5EQQA 1YPHC 4HTCH 2G52A 4D7FA 3M7QA 4GHTA 1HAYB 2A7HA 4GCHG 1VKYA 1S6FA 3V0XA 1EZSC 3T27A 3M35A 1E1QD 2SNWA 4OGYA 1TRMA 1O2HA 2QF0A 3RMLH 2FI3E 1QB6A 4UFFH 4WXVA 1FPCH 1J8AA 6GCHF 1HAHH 1BHXF 3RC5A 3BTKE 2BD8A 3E6PH 3HGPA 4A5TS 2BB4A 2F9BH 2BDIA 3KYGA 3LPRA 4U2WA 2A4QA 1J14A 4IN2A 2TPIZ 2HWLB 1GMCG 1XXFA 2C93B 1FXYA 5EGMA 3A83A 3ODFA 1O32A 3VGCC 1EAUA 2PUXB 1C1SA 5EJLA 2ZGCA 2Q6GA 5CHAB 1GPZA 1T8LA 1GI0A 1C1OA 2GZ7A 1D3TB 3B9FH 4NSVA 2TGPZ 1YBWA 1YPMH 2FOHA 2XCNA 3IITA 3P6ZB 2PV9B 1TOCB 5A0AE 1T8OA 4TWWA 3LGTA 1QB1A 3MU4A 1V2OT 3MH7A 4FUHA 1FPHH 1KSNA 8GCHG 2Z3CA 5EG4A 2UUKB 4AX9H 5J4SA 3F1SB 3RXIA 2A4OA 5T6GA 4O03A 2BY6X 1OWJA 4Y6DA 2OC1A 5C17A 1S83A 2XBWA 5LPFA 4X1SU 1IQIA 2BM2A 1QCPA 3TJOA 3LT3A 5C5NA 1HXEH 5GWZA 2FYRA 2ZCHP 3RXUA 1S5SA 3BV9B 1Z7KA 4ABJA 2ZU4A 2GT8A 2BVSH 2ANKH 2WZQA 3GY7A 1T32A 1NRRH 2A4GA 3DFLA 3QGJA 2VB0A 4YOGA 2J5UA 4HZHA 2OP9A 3TGJE 1ELDE 2BD5A 1XUHA 4GLYA 1AY6H 2ZDNA 5JYIA 2VIWA 1C4Y2 4ISHH 3T62A 3OX7U 4X2YA 5LPRA 3A7TA 1C5MD 1MMJN 3AVZA 3E0PB 1QL9A 2C3SA 1JIMA 3P8NA 1C5RA 4Z0KA 1PPHE 5AFZH 2CV3A 3ITIA 2F3CE 5SGAE 1ESTA 4KKDA 4WY3A 3PO1B 5CDFE 3TITA 1CHOF 1GJDB 1TRYA 1MD7A 2JH5D 4THNH 1AN1E 1V2QT 2M2AA 2ODYB 2ZU1A 2OCVB 1YWUA 1NU7B 1E37B 3MU0A 1O3LA 1VCQA 2G4TA 1CT0E 1DSTA 1QBOA 5F03A 1DM4B 4K60A 1E36B 2QN5T 1IQEA 3UREA 3V7TA 4M9FA 4K1SA 3RU4E 3A8CA 2YNBA 3UWJH 1SGFG 4CHAC 4NZQA 5DPAA 3V3MA 1HAIH 2XWAA 3BEIB 1WSSH 1L0ZA 3F3BA 3MHWU 1RFNA 4K5ZA 1NM6A 1UTQA 2G55A 3H7OA 2ANMH 3Q77A 2ZFTA 1N1LA 1TGNA 1ZR0A 1BMMH 2ZQ1A 2ZI2H 5L30H 2JDID 2VGCC 5ETXA 5DK1A 4H4FA 3URCA 1SGIB 3A8BA 2AGIX 1P2JA 1O2TA 2UUJB 1XUKA 1YCPM 1CO7E 3PMHB 2ILNA 3TGKE 2BD2A 2JIZD 1TPAE 4AOQA 5FBIA 1N6XA 1ZTJA 5A2MH 1P3EA 4FUDA 2GJGA 2Y5FA 2AMDA 1L4DA 3ZVBA 4VGCC 3GCHC 4LOYH 1EAXA 2W7SA 1IQMA 5TCAA 1GHBF 3TK6A 1IQKA 2QYIA 1BTHH 3CS0A 2H5CA 1P2QA 4UFEH 4B1TA 5A8XA 1C1NA 3RC6A 3A89A 4DURA 1LPZB 1BUIA 3QWCH 5FL7D 3S7KB 2BX3A 2J92A 1ACBE 1UTKA 1PQ5A 4I8HA 1P10A 1W3CA 2KCPA 5HMAA 4BANB 1ELGA 4U01A 2P95A 3RM2H 4BAHB 5T6DA 3ZYEA 2J98B 3MO3A 4JZDH 2PR3A 1IQJA 1C5LH 3BTEE 3UNRA 1GJ4H 1O5FH 1BTWA 3F0OA 4ACAA 2OC7A 2BDCA 1GVZA 2CXVA 4I8GA 4X2VA 1K22H 2W5EA 5DP6A 2XBYA 3PRDA 2A7JA 3B23B 2ZTYA 1TBRH 2J94A 1LHCH 2BDGA 1DITH 2GKVE 1ANEA 2QAAA 4NZLA 1O5GH 1O33A 2ZGBH 2ZECA 1AB9B 3RXCA 2Q6DA 3T29A 3UNQA 3GY2A 1TQ0B 2GCTC 1TABE 4Y8ZA 1LHFH 1ANDA 2Q1JA 4TY6A 3RDZA 4D7GA 3BG4B 3STJA 4JZFH 1DOJA 1C4U2 1A3BH 1UVTH 2PGQB 2L6OA 4GVUA 3O8RA 4X6PA 5C0UA 1KXDA 1HLTH 2ALVA 1GBAA 1QRZA 2J98A 1DE7H 1E38B 1HJ9A 1O2GH 5FCKA 3E90B 1N8OB 3BTFE 2FS9A 4NIWA 2SGPE 3VXEH 2BXTH 4NA9H 4Y7BA 3QTOH 1SMFE 1TBQH 1GL0E 4X6NA 3H5CB 2FEQH 3TIUA 2Z9IA 3F9GA 1B5GH 1F7ZA 4A1VA 4UONA 1ZOMA 1ZSKA 3FOAA 5DGJA 1KXFA 2ZHFH 3TU7H 1FV9A 4CBNA 2SGAA 1AFQB 2B7DH 1KYNA 3SOSA 4INHA 1TMTH 1C2HA 1RIWC 1RS0A 2ZO3H 2BY9X 1ZJDA 5JBBS 2ZDKA 2ALPA 2ZHWH 1BHXB 1JMOH 5J4QA 2JH6D 4GCHF 3HKIB 1SLXB 2V3MA 1O2IA 4ACBA 1IOEA 3D23A 2QF4A 3M5LA 2CMYA 3HK3B 5H4IB 2FOEA 1L1GA 4XDEA 3M5NA 3UAIC 1O3HA 2QF3A 3OEHD 2GCTB 1GG6C 4OS4A 2EA3A 1F5KU 1WTHD 1UO6A 1EX3A 5T1VA 1SPJA 5EQSA 3MNSA 1S81A 1PQ7A 2SFAA 1MUEB 1A4WH 2GV7A 3CNRA 3QDZB 3RXVA 2RA3A 2K1QA 1O3DA 1XUJA 2R9PA 1GG6B 1ORFA 1Y5UT 2PP6A 3TK9A 2ZCKP 5DKMA 4I86A 1TBZH 1YLDA 1YM0A 4NCYA 3SN8A 2SGQE 3O8BA 3W1EA 1C1VH 2AERH 4IC6A 4M7GA 4K1TA 1CGIE 1SGPE 2ZCLP 1AZZA 4ESTE 3QO6A 4FXGH 1MCVA 1D6RA 1NT1A 1K0HA 2EQNA 1C2KA 3T28A 2ZDAH 1W0KD 4HGCA 1GBFA 3SU5A 1MZDA 4Q7XA 4OS6A 1AFQC 2ZIQH 5C20A 1SHHB 3LGIA 1KY9A 4YLQH 1K21H 2OC0A 2FI5E 3F2FA 1M9UA 1Y5AT 1GVKB 1W10U 1YGCH 1Z1JA 5A0BA 1VCWA 1P3CA 5HYOA 2FXRA 2WPHS 2AGEX 2GCHG 4CRBA 5C3NA 1W11U 3L3TA 1H9HE 1PQ8A 5FXLA 3MNXA 1KXAA 3MTYA 1G3DA 4Q63A 4AC9A 4O3UA 1EZQA 5B6OA 1Z8IB 4ABIA 2ZPSA 1FY5A 1GBHA 1NBME 1O2UA 2BX4A 2HPPH 3LGVA 4A7IB 2BD9A 3OSYA 1L2EA 2ZDMA 1NO9H 3PWCA 1ZJKA 1O2RA 4KTCA 2H9HA 3DCLA 1SL3A 3DT0H 2EI8A 3AW1A 2CF8H 1F2SE 3QZQA 1V2KT 2D26C 1GL1A 2D2DA 3SUGA 4J2YB 5L2ZH 1S6HA 3E16B 1C9TA 2Y6TA 4DT7B 4Z6AH 2ZP0H 2EC9H 1C1UH 3KQEA 1HV7A 1A2CH 5C1YA 1SLWB 4FUGA 1YLNA 1O34A 3DUXH 6ESTA 4XD7D 3URDA 1DLEA 1LQEA 1OHHD 1IAUA 3SNDA 2XC5A 4CRCA 3KYFA 4WMEA 1MQ5A 2GDEH 2TGTA 3U8RH 1Q3XA 1O2OA 5EXNA 1BRAA 1CGHA 1TE0A 3D49H 5KGOA 4CRGA 1HFDA 1ELTA 1D3QB 1H4WA 4OS7A 3MH6A 4D9RA 3UFAA 2ZHEH 1Y8TA 3F68H 3NPSA 4BOHA 4F4OC 1EJAA 1MTSA 2FP7B 4I7YH 1BBRK 3LKWA 2VJ1A 1HCGA 3EE7A 1PPBH 3LC3A 1GI2A 3F0PA 1O3KA 3LIWA 1T7CA 1HJAB 4D9QA 1GBEA 1P9UA 1VGCC 2ZFRH 1DLKB 3N7EA 1GI9B 4NSYA 1DUAA 1NRPH 5BRRE 1ELEE 5LPEA 2NU1E 3TGIE 1DXPA 5GIBA 4DY7B 1ABJH 3OTPA 1QRWA 1JBUH 4IN1A 1O3AA 2FMJA 4JMYA 1TQ7B 4Q4LA 4BNRA 1O37A 2BLWA 3PROA 5FPTA 5E2PA 1KXEA 4KP0A 4WH6A 3TJVA 5FX5A 2GX4A 4CR9A 2F9VA 1QJ6B 1QQ4A 2OK5A 2WUCA 4X1PU 2GD4B 1F0TA 1A5HA 3W95A 3TPIZ 3I77A 1OS8A 2BOHB 2KR7A 1BTYA 1DY9A 1UHBA 1P8VC 6CHAB 3ZZ8A 2FOCA 2FX4A 1LPKB 1WU1A 5T6FA 3ELAH 1O5CB 3M36A 1KMHB 2OUAA 1KLIH 3MI4A 4WF8A 4CHAB 4Q7YA 1SOZA 3RC4A 3VB6A 1CT4E 1NTPA 1NZQH 1TIOA 4Q7ZA 2C4FH 1AHTH 1H8DH 3RXLA 2BDBA 2PHBA 4E06H 2VH6A 3GCHB 1EZXC 1GHVH 3RXPA 1XUFA 4AYYB 1HAPH 1MAYA 4SGBE 1EP5A 2A2QH 2EEKA 4FUCA 1BJUA 2P8OB 1RD3B 1GCDA 3NKKA 1O2PA 2QGRA 4I32A 1V2NT 2ZNKH 2KZ4A 2VVCA 1V2MT 1UK4A 2HVYB 1XKBC 2XC0A 4MLFB 3KQ5A 2BTCE 1MZAA 1MKXK 1OP2A 2AGGX 1NRSH 3RLWH 5F8TA 4JZIA 1O2JA 1C1WH 1CA8B 4MNWA 1DWCH 1DICA 4JK6A 3KQDA 3E3TA 2CHAB 4TPIZ 1SB1H 3UIRA 1P9SA 3O8CA 1TNJA 1EAIA 1SGRE 3KQCA 1TPOA 2THFB 2OQ5A 1QNJA 1V2RT 2BQ7B 1FIZA 2AYWA 3IWMA 4YT6H 1GBCA 1OOKB 1SVPA 3QGNB 4U32A 2A7CA 2F91A 1DANH 2PSXA 1O3BA 5FHTA 1AO5A 1X7AC 1TMBH 2F9OA 2ANWA 5A8ZA 2TGDA 4Q80A 4XOJA 1W12U 3ZV8A 2NU3E 1Y3VA 2BXUH 3LC5A 5FPSA 5EW1H 3DD2H 1V2JT 1HXFH 1UVPA 5DSFA 1MBMA 2QY0B 3MU8A 3RMNH 2Z3EA 2SNVA 1GMDG 5IDKA 5CHBA 1BRUP 1HJ8A 3ODDA 3P8GA 2KCOA 1C4V2 3AAUA 4DIHH 3GICB 3QLPH 2B5TB 2ZPQA 1Y3UA 2LNCA 4VGCB 1ZGIA 4X6OA 1K1OA 5JBAS 1YY3A 3BEFB 1EOLA 1O2QA 4BAOB 3M61U 1GI1A 3RXEA 3KIDU 1H8ED 2STBE 3ESTA 4AFQA 5JBTA 3K6YA 1BQYA 1BRBE
chains in the Genus database with same CATH topology
3SUFA 1E79D 2IJOB 2JJ2D 2QF4A 2WSSD 3M5LA 3PV2A 4TSFD 4F55A 2YMSB 3F2HA 3SV8A 3ZIAD 1BMFD 5H4IB 2K8IA 2XOKD 4B74A 2K0QA 2QE7D 3M5NA 3SV6A 2P59A 3P8OA 3FKSD 3RC6A 3OEHD 2QV1A 3U1IB 3N99A 3H09A 3WW7A 2F43B 3FO8D 4XD7D 4B71A 1DXWA 2WZQA 5B6LA 2HLDD 2WV9A 1OHHD 2A4GA 5FL7D 3SUEA 3VG8A 3WWBA 3GS9A 4A92A 3SUDA 2J5UA 5C0TA 5T1VA 3SZEA 1W3CA 2KCPA 5IK2D 5EQSA 2VBCA 4I32A 2KM0A 4U01A 2KZ4A 1NS3A 3DSOA 2K1QA 4A1TA 3N7DA 2WPDD 1SKYE 4FETA 4OM9A 3F2GA 3F0OA 3P8NA 2GVFA 5EQQA 2OC7A 3SU1A 4B73A 3OE7D 2A4RA 3O8BA 4Z1MD 3W1EA 3PRDA 5GNDA 5F53A 4TT3D 2QF5A 4I33A 3L6PA 4A1XA 3PRBA 2YMSC 3AK5A 2F9UA 1E1QD 5CDFE 4TYDA 3KEEA 2FM2A 3SYJA 5HKKD 1A1RA 2IJD1 2F4LA 2FP7B 3FN8A 4NWKA 1FX0B 2M2AA 3LKWA 2YMSD 3OYPA 3KN2A 2CK3D 4ASUD 4RI0A 2KCAA 3O8CA 1W0KD 2OC8A 3F0PA 3SU5A 3SV7A 2YOLA 1NBMD 4WH8A 1S6LA 5FPYA 3RC5A 3SU4A 2KCYA 2JJ1D 3LONA 4DT4A 3UB0A 3N7EA 2L6OA 2OC0A 3O8RA 3LOXA 5EPNA 3NRLA 3F2FA 4M9FA 5C0UA 1CU1A 2A4QA 2O8MA 3PV5A 1DXPA 4I31A 3OTPA 1BT7A 1EFRD 1RTLA 4B6EA 2KFWA 4JMYA 4R8TB 3M5MA 3E90B 2FOMB 3SU2A 4Q4LA 2OBOA 5FPSA 3F3BA 5DSFA 2XCFA 3EYDA 5FPTA 3O8DA 4Q63A 1W0JD 1DY8A 2AHME 3WWFA 3U1JB 2XNIA 3KNXA 3OFND 1N1LA 2OINA 2V7QD 5CHBA 2GGVB 5IDKA 3OEED 2XCNA 2OBQA 4WH6A 4NWLA 1JXPA 1RGQA 5ESBA 4A1VA 2JDID 3M5OA 3FOAA 2KCOA 5ETXA 2F9VA 3SU0A 1NBME 1MABB 2W6ID 2XNDD 1H8HD 2LELA 3KF2A 2OK5A 4ZCNA 3OAAD 5EQRA 4K8BA 2WHXA 2W6JD 5GJ4B 3SV9A 2JIZD 2KR7A 4KTCA 1DY9A 3DCLA 4B76A 4B75A 1WXRA 3SU6A 3DSPA 1KMHB 4WF8A 2OC1A 5GPIB 1E1RD 3RC4A 5C17A 1COWD 1H8ED 3SUGA 5EPYA 5DN6D 4YXWD 4B6FA 3SU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C17 A;  3F0O A;  3F2F A;  3F0P A;  3F2H A;  3FN8 A;  5C0T A;  3F2G A;  5C0U A;  5DSF A; 
#chains in the Genus database with same CATH topology
 4PRO A;  4I8J A;  1ETT H;  1ZHP A;  4DGJ A;  4CRD A;  4O97 A;  2HNT C;  1C2I A;  1NFY A;  5FX6 A;  1FUJ A;  2PFE A;  1C1M A;  2WPL S;  1FMG A;  2KX4 A;  1CBW B;  3KHV A;  3RXH A;  3RXK A;  5A09 A;  1GI8 B;  1EB1 H;  3SUD A;  1HJA C;  1TGS Z;  5C0T A;  1FAX A;  4UD9 H;  1UJ1 A;  1UTJ A;  4FUE A;  5G4B A;  1GBM A;  1XKA C;  2KM0 A;  3AAS A;  1GMD F;  2AS9 A;  3RXD A;  3UOU A;  2A32 A;  2ZG0 H;  1H9I E;  2ZFP H;  3DSO A;  3M3S A;  1MU8 B;  3PMB B;  1NU9 A;  4KTS A;  3SNE A;  4DOQ A;  3RXR A;  2R2M B;  1AWH B;  4Y10 E;  1OP8 A;  2P8O C;  3DHK H;  4ISO A;  4B73 A;  5KEC A;  3MH4 A;  1ZSL A;  1VIT F;  2UWL A;  2AFQ B;  4X2W A;  4I33 A;  5K0H A;  1B0E A;  2F9U A;  1SG8 B;  1O5E H;  1IQL A;  3EAJ A;  2GCH F;  1TA2 A;  3KN2 A;  4RI0 A;  4Y0Z E;  1O3E A;  1O2Y A;  1O2S A;  2VNT A;  1NRN H;  1Y3W A;  1TX8 A;  2VIP A;  4Y8Y A;  1AKS B;  1HBT H;  1YPH E;  3SU4 A;  3PM3 A;  2BLV A;  1MD8 A;  1K1N A;  2H2Z A;  4FVD A;  1GI4 A;  1QJ7 B;  3LOX A;  4WVP E;  3NRL A;  5JBC S;  1CU1 A;  1A0H B;  2IN2 A;  3PV5 A;  2DUC A;  3P92 A;  2PKA B;  1YC0 A;  1YKT A;  2QXI A;  2A0Q B;  5C67 A;  1MTV A;  1K1L A;  1C5V A;  1ID5 H;  3M37 A;  2ZQ2 A;  1S82 A;  1W0J D;  2Y7Z A;  5AF9 H;  3U28 C;  2FWW A;  3U8O H;  2OIN A;  1BBR E;  3GY3 A;  2H5D A;  1O2K A;  2XWB I;  2XTT B;  3DFJ A;  3SU0 A;  2FTM A;  1QY6 A;  1H8H D;  2ZGX H;  4Y8X A;  4R0I A;  3PYH A;  1HDT H;  1SGF A;  1F0S A;  1HAO H;  2WHX A;  3P70 B;  2WPJ S;  1CT2 E;  2ZHQ H;  2QC2 A;  4Y11 E;  1RRK A;  4CRE A;  1DFP A;  4K3J A;  3RXM A;  3SO3 A;  1SQR A;  5GPI B;  1E1R D;  4KGA A;  3RUO A;  3TVJ B;  2VWL A;  3ZZ6 A;  1N6Y A;  3RXT A;  1OWE A;  3FVF B;  3PV2 A;  3K2U A;  4X8V H;  1PPZ A;  5DO4 H;  1EUF A;  3SV8 A;  4F49 A;  1BMF D;  5CE1 A;  2EI6 A;  2LP6 A;  3LGW A;  4NFE A;  4UDW H;  3FKS D;  1NRQ H;  4B2C A;  3M7T A;  5EST E;  1EQ9 A;  1TON A;  1VIT G;  1T4V H;  9EST A;  1SOT A;  2O8U A;  5EJZ A;  1S84 A;  3HKJ B;  3VFE A;  1UK3 A;  3S9C A;  4ZKS U;  3AW0 A;  3BN9 A;  1ESA A;  3BTW E;  3SJK A;  2O8W A;  3P17 H;  1AE5 A;  3MO6 A;  1O2M A;  2GVF A;  1UHB B;  4AGJ A;  1DX5 M;  4WMD A;  4RT1 A;  1IQG A;  3BIU H;  1G36 A;  4D8N A;  1SFQ B;  2BMG B;  3KGP A;  3SGQ E;  1W7G H;  2RG3 A;  3KEE A;  1A1R A;  1UTN A;  1G37 A;  4MVN A;  3RP2 A;  2PWX A;  3C27 B;  2CK3 D;  4FU9 A;  4FU7 A;  2A31 A;  1E0F D;  3SV7 A;  3L33 A;  5JB8 S;  4GSO A;  5DG6 A;  1THR H;  3WY8 A;  1DSU A;  2ZFS A;  4X8T H;  4YLU A;  3UB0 A;  5F8X A;  1VJ9 U;  1LHG H;  3E0N B;  1SGC A;  1UVS H;  2O8M A;  4BAQ B;  2O8L A;  2R3U A;  1TX6 A;  3OY6 U;  1VCP A;  1BT7 A;  1H1B A;  3JZ2 B;  1RTL A;  2XC4 A;  8LPR A;  4X8S H;  2WPK S;  4CR5 A;  1W13 U;  3EYD A;  3O8D A;  4KEL A;  3HPT B;  4ZHL U;  3FAO A;  3SJO A;  1EOJ A;  1CE5 A;  1CSO E;  3AAV A;  2GZ9 A;  1MKW K;  1YF4 A;  1P06 A;  1RIW B;  4ABD A;  2W6I D;  2XND D;  1O39 A;  4ZAE A;  3SQE E;  2ZWL H;  1GJC B;  1L1N A;  1LMW B;  1NN6 A;  4Q2K A;  5ABW A;  3R0F A;  1QB9 A;  4B76 A;  3SBK A;  5FAH A;  1YLC A;  2BDA A;  4AB8 A;  2C8W B;  2A5K A;  1PYT D;  3DSP A;  2A5A A;  1WAY B;  1EXF A;  1BJV A;  4Y76 A;  4ZHA A;  1C2D A;  4DW2 U;  2XBX A;  1LQD B;  5EPY A;  1GDN A;  3MU5 A;  4E7N A;  1NRO H;  1KTT B;  5GXP A;  1YPG H;  3KQB A;  1QL8 A;  2QXH A;  3SZN A;  1GJ8 B;  4YTA A;  5EU8 A;  3NXP A;  1OWD A;  3N99 A;  3PTB A;  2F43 B;  1P01 A;  4MNV A;  1AMH A;  3GS9 A;  1QBV H;  2TRM A;  3P95 A;  1UK2 A;  1WTG H;  1ZRK A;  2A2X H;  2KAI B;  2OLG A;  2G5V A;  3UTU H;  1UW7 A;  1LHD H;  1NS3 A;  1GBJ A;  2F83 A;  1AZ8 A;  5PTP A;  3F2G A;  3STI A;  4RKJ B;  1QA7 A;  1GHX H;  1QL7 A;  2BD7 A;  3UPE A;  1FQ3 A;  2O8T A;  3OE7 D;  1AQ7 A;  1MAX A;  3EGK H;  2ZFQ H;  5EXL A;  3VEQ B;  4UFD H;  1D9I A;  1TOM H;  1ZTK A;  1C5S A;  4LZ4 B;  1K28 D;  1KDQ B;  2P3F H;  1YCP H;  4JZE H;  2BQW B;  1PPE E;  3ATM A;  3FN8 A;  1ZMJ A;  1GBK A;  2FOA A;  6GCH G;  3V12 A;  1KTS B;  1P2K A;  5HIZ A;  2H9T H;  1SGN E;  2BLQ A;  1C5T A;  1GBL A;  2JJ1 D;  1CQQ A;  1ZMN A;  4BTI B;  1LVY A;  2PKA A;  5EPN A;  1PFX C;  1A46 H;  1O0D H;  4TWY A;  5A8Y A;  1AIX H;  5I46 H;  1OX1 A;  1TRN A;  4B2B A;  5K7R A;  2ZFF H;  1EFR D;  1AVW A;  3FP8 E;  2ZDV H;  1MKX H;  1QGF A;  1F0R A;  1DPO A;  1WBG B;  2V35 A;  5F8Z A;  2PKS B;  4HI3 A;  1IHT H;  1RTK A;  2FYQ A;  4MPW A;  5GCH G;  3VB3 A;  1O3C A;  1XXD A;  1O2X A;  4O3T A;  1Q31 A;  4XBB A;  2SGD E;  2WUB A;  2ZGH A;  1DS2 E;  2VWM A;  1JOU B;  3SJ9 A;  2J34 A;  1SQA A;  1O2Z A;  4D76 A;  1ZYO A;  5EQR A;  1IQH A;  4ZH8 A;  1DWD H;  3ZVA A;  1WV7 H;  4MPV A;  1J15 A;  1BOQ A;  4NA7 A;  3K65 B;  1Z8J B;  4FUI A;  2GDD A;  3NK8 A;  3MH5 A;  3A7Z A;  3HGN A;  6LPR A;  4JYT A;  1HIA B;  1FN8 A;  1O3F A;  4ZXY H;  1SLU B;  2VVV A;  5TCC A;  1W8B H;  1AFE H;  3GOV B;  2VIQ A;  5EXM A;  3E8L A;  4LXB H;  3E91 A;  2YMS B;  3UR6 A;  2Z6B D;  2PSY A;  1ELF A;  1EAW A;  3P8O A;  3ZZB A;  1RJX B;  3WW7 A;  2DE9 A;  1GJ9 B;  4HG6 A;  1XUI A;  2VIO A;  2ZF0 H;  5C5O A;  1O3G A;  3FZD A;  3MFJ A;  2O9Q A;  4AOR A;  1ELA A;  3SV2 H;  1LDT T;  2BZA A;  3ZYD A;  4BAK B;  4NA8 A;  1UTM A;  4AFU A;  5A0C A;  2NU0 E;  1YPK H;  2OQU A;  1O3P B;  2BLO A;  1GI7 B;  7GCH F;  1TNG A;  3U8T H;  1UCY H;  1DVA H;  3BTG E;  3RMM H;  2P93 A;  1ZPZ A;  1AUT C;  5E0H A;  4TT3 D;  3MMG A;  5EW2 H;  3L6P A;  2AMP A;  3TJN A;  4TYD A;  5DP9 A;  4MPU A;  5HKK D;  1GWA A;  1P05 A;  2ZU5 A;  1C5O H;  3FP7 E;  1C2J A;  3PTN A;  1KLT A;  4CRF A;  2OC8 A;  4DJZ B;  2QA9 E;  2TBS A;  1UMA H;  1EPT B;  2PW8 H;  2OTV A;  1EJN A;  3VGC B;  1AB9 C;  1V2P T;  3RXQ A;  1YP9 A;  2R0L A;  3ZZ4 A;  1C5N H;  3LGY A;  3ZZ3 A;  3ZZA A;  1FJS A;  4XFQ A;  3EA9 A;  2R3Y A;  1DDJ A;  2ZDL A;  5L6N H;  1C2L A;  3OY5 U;  2AH4 X;  5E0J A;  4X1Q U;  1OWH A;  1ZHR A;  3WWF A;  3U1J B;  1A0L A;  2BDY A;  2HVX A;  2OBQ A;  1ZGV A;  3LJJ A;  1KLJ H;  4ABB A;  3T25 A;  1LVO A;  1P0S H;  3S9B A;  1ZSJ A;  3EE0 B;  1AE8 H;  5GJ4 B;  1NES E;  2OXS A;  1O30 A;  3MO9 A;  1LKA A;  3ATL A;  4XBC A;  1C2E A;  1PPF E;  1C1P A;  4MDS A;  2HNT F;  4K1E A;  1COW D;  1K1I A;  3QX5 H;  5C1U A;  1XUG A;  4B6F A;  1OYQ A;  1CHO G;  3SUF A;  3JZ1 B;  3BTM E;  1QR3 E;  4F55 A;  4CH8 B;  5DP4 A;  3F2H A;  1VIT H;  5EOK A;  1BRC E;  1O38 A;  2FOD A;  1LCY A;  2XOK D;  4B74 A;  2K0Q A;  1G30 B;  1QRX A;  3BTT E;  1P2O A;  1TPS A;  1TLD A;  2WYJ A;  2D1J A;  4IW4 E;  4WJG 2;  4H6S B;  3QK1 A;  3SUE A;  4KTU A;  1UCY E;  1W2K H;  1Z8R A;  4NFF A;  3A87 A;  3PMA B;  5JDU B;  3FFG A;  2RDL A;  3RXF A;  1PQA A;  4XBD A;  1FY1 A;  1SC8 U;  1WYK A;  4A1T A;  3S7H B;  1WOF A;  4JK5 A;  2JET B;  4Y71 A;  1ZZZ A;  2ZU3 A;  2ODP A;  2WV5 A;  4AGK A;  2FOF A;  4OGX A;  2A4R A;  3N7O A;  3PLP A;  4Z1M D;  1SQO A;  1GCT B;  5GND A;  1QFK H;  3BIV H;  2EI7 A;  2QF5 A;  1MTW A;  4A1X A;  2YMS C;  1BZX E;  3GYM A;  5HM9 A;  3QTV H;  3EA7 A;  1Z1I A;  1GBB A;  3ZVF A;  4ISL A;  3OYP A;  1SGE E;  1P12 E;  1FY4 A;  1THP B;  7KME H;  2G51 A;  2YOL A;  2Z9L A;  4AFZ A;  1S6L A;  1GHY H;  3Q00 A;  2KCY A;  4LK4 A;  3NZI A;  1TNI A;  1VZQ H;  1J16 A;  3LJO A;  4AB9 A;  2R0K A;  3KCG H;  3LH3 A;  5JB9 S;  7LPR A;  4B6E A;  4R8T B;  3LGU A;  1A61 H;  1TB6 H;  1MBQ A;  5HXF A;  2BY7 X;  1YYY 1;  1DY8 A;  2AHM E;  2WYG A;  3PB1 E;  1XX9 A;  1FN6 A;  2ANY A;  2BZ6 H;  2GGV B;  1P2I A;  3GCO A;  1K2I 1;  4QT8 C;  2BQ6 B;  1DUE A;  1MAB B;  3MNC A;  3PWB A;  2Y7X A;  4ABG A;  4ZCN A;  2V0B A;  1QIX B;  2V6N A;  3T5F H;  1GI6 A;  3T2N A;  2H1U A;  4F48 B;  1SGT A;  1GI5 A;  4Y7A A;  1HAX B;  3FP6 E;  4FUJ A;  2J38 A;  3PLK A;  4E05 H;  3BTQ E;  3CS7 A;  4YT7 H;  2J4I A;  1O2L A;  3FZZ A;  2ZZU H;  4MNX A;  2IJO B;  2XRC A;  2JJ2 D;  1AVG H;  3UOP A;  3PLB A;  2STA E;  1CVW H;  2Z3D A;  1TYN A;  1BIO A;  4INL A;  1C2G A;  1J9C H;  2QV1 A;  1EKB B;  3C1K A;  1HYL A;  5DP7 A;  1MCT A;  2FO9 A;  5IK2 D;  2RCE A;  1G9I E;  3BSQ A;  1V2L T;  3NCL A;  4ABH A;  3MNB A;  1LPG B;  3SJI A;  3SQH E;  1ETS H;  1SKY E;  4GAW A;  1P09 A;  8KME 2;  4NIV A;  1O3O A;  2GMT C;  5EOD A;  2IOT A;  2HLC A;  2PTN A;  4RT0 A;  2EST E;  2I6Q A;  1TNH A;  1OXG A;  2WV4 A;  1C5P A;  1XVM A;  1NY2 2;  3SGA E;  1SFI A;  4NWK A;  3MQK C;  1FX0 B;  1BIT A;  4ASU D;  8GCH F;  2HPQ H;  1FDP A;  8EST E;  4WH8 A;  3A7V A;  3A7X A;  2Y5H A;  2BVX H;  3UR9 A;  2ZHD A;  1BDA A;  3GDV A;  3VXF H;  3Q3K A;  4OS1 A;  1GJB B;  3DSG A;  1V3X A;  1OSS A;  1BMN H;  2Z9G A;  3HK6 B;  2ZC9 H;  2KFW A;  2LPR A;  1C5Q A;  2P16 A;  1O3M A;  3HAT H;  4DCD A;  4INK A;  2VU8 E;  4FU8 A;  1GBD A;  3OFN D;  4WMF A;  1TNK A;  1UTL M;  2V7Q D;  3QN7 A;  3A8A A;  1RGQ A;  2KAI A;  1CA0 C;  2D8W A;  3A86 A;  1FON A;  1FAK H;  2ZTX A;  2ZU2 A;  1C2F A;  3NWU A;  1PPC E;  3V13 A;  1HNE E;  2A5I A;  1XVO A;  3OU0 A;  1V2V T;  5E2O A;  1B0F A;  1G3B A;  1QUR H;  1NFX A;  1BBR H;  1WXR A;  2CF9 H;  2GT7 A;  1B7X B;  1ANC A;  1GJ7 B;  7EST E;  1IHS H;  2SGF E;  2G5N A;  2C90 B;  3Q3X A;  1GCT C;  1VR1 H;  1ZLR A;  3D62 A;  1GI3 A;  1P04 A;  3BTD E;  2AEI H;  1EB2 A;  2VWO A;  2VVU A;  1T4U H;  2VH0 A;  3SHA H;  2QE7 D;  2Y81 A;  4CH2 B;  2GP9 B;  1HB0 B;  2PGB B;  3GY6 A;  3U1I B;  3ZVC A;  5C1X A;  2RFK C;  4K69 A;  2UUY A;  2NU2 E;  1O2V A;  2ODQ A;  3A84 A;  5DP8 A;  4AN7 A;  2H6M A;  1P2M A;  5E8E H;  2FOB A;  3G01 A;  2VWN A;  3QZR A;  4P02 A;  2XYA A;  1G3E A;  1WQS A;  3BEU A;  3BTH E;  1O2N A;  1SQT A;  1C1Q A;  5F53 A;  1MKW H;  1S0Q A;  3CP7 A;  3DA9 B;  2FM2 A;  4HFP B;  3EDX B;  3SYJ A;  1F5R A;  1MH0 A;  1ELV A;  2QCY A;  2WPI S;  3PO1 C;  1GHW H;  3VPK A;  1SR5 C;  2PLX A;  2G4U A;  2HOB A;  4Y0Y E;  2G81 E;  4AFS A;  4ZXX H;  5FPY A;  1RXP A;  2ZA5 A;  4DT4 A;  3LDX H;  5TJX A;  3TLO A;  3UNS A;  4DG4 A;  3T26 A;  4A6L A;  1AUJ A;  2ZTZ A;  3D65 E;  1EP6 A;  2IPQ X;  5E0G A;  3GY8 A;  3LH1 A;  2FOG A;  3GY5 A;  2IPH A;  1Z6E A;  1O36 A;  3F9F A;  1D4P B;  3SNC A;  4ASH A;  2BOK A;  1C1T A;  4MNY A;  3BF6 H;  3MU1 A;  5HGG A;  1QZ8 A;  2A45 B;  2HRV A;  1K1J A;  1JRT A;  1XM1 A;  1XMN B;  3S0N A;  1IQF A;  1NFW A;  2H9E H;  3OEE D;  1GBI A;  1T8M A;  2B9L A;  4NWL A;  1JXP A;  1ZTL A;  1BTU A;  3KL6 A;  3M5O A;  4XRN A;  1CBW C;  9LPR A;  2CJI A;  1TX7 A;  1Z6J H;  1V2U T;  1HAG E;  3F9H A;  3SJ8 A;  2F9P A;  2W6J D;  4MG3 A;  1FZZ A;  1W0Y H;  3BG8 A;  2ZKS A;  1QHR B;  3A85 A;  1CA0 B;  4UEH H;  3SGB E;  1TWX B;  4X1N U;  4B75 A;  4YZU A;  1O5B B;  1TGC A;  1YPJ H;  1O5D H;  1A5I A;  1OP0 A;  5LGO A;  3M7U A;  4NIY A;  5DP5 A;  1P2N A;  2P3T B;  1T31 A;  4IBL H;  1BTZ A;  1G2L A;  3ZIA D;  1HAV B;  3ZZ9 A;  4MPX A;  1A0J A;  2C8X B;  2Y5G A;  1WCZ A;  3RM0 H;  1O3J A;  3MYW A;  1GHA G;  4JYU H;  1EJM A;  1MTU A;  3U9A H;  1MQ6 A;  1ARB A;  1FNI A;  4K8Y A;  2VIV A;  1O35 A;  1EZU C;  3A80 A;  2Q6F A;  3EQ0 H;  2V3O H;  1GMC F;  1YPE H;  4BXS A;  4E7R G;  5GDS H;  1QJ1 B;  1QTF A;  2ASU B;  1AD8 H;  2VIN A;  3SU1 A;  4AZ2 B;  4X0W U;  2FTL E;  4ZMA H;  5LH8 A;  1H8I H;  4ZKO U;  2WPM S;  3RMO H;  1SI5 H;  1GHB G;  1P11 E;  5C94 A;  1BTX A;  4TY7 A;  1BMA A;  1VGC B;  3RXJ A;  1O31 A;  3GYL B;  1Z71 A;  1EPT A;  1O3N A;  1ESB A;  1SBW A;  2BD4 A;  1INC A;  1SHY A;  1GHZ A;  1ZHM A;  1S0R A;  1MTN C;  3H7T A;  1OYT H;  3R3G B;  4J1Y A;  2F9N A;  2RDE A;  5CHA C;  2JET C;  4OS5 A;  1KXB A;  4I31 A;  2M5T A;  3I78 A;  1DT2 A;  1OKX A;  1V2T T;  4WWY A;  2FLR H;  2BY8 X;  1LHE H;  3RXG A;  2CGA A;  3SU2 A;  1F5L A;  4NIX A;  4XSK U;  3UUZ A;  1F0U A;  3NUM A;  2WIN I;  1E35 B;  1ZPC A;  2DE8 A;  2PUQ H;  1AI8 H;  3ZZC A;  2ZGJ A;  3SOR A;  2AIQ A;  4IGD A;  1GBT A;  1AKS A;  3OTJ E;  3KF2 A;  2FIR H;  1HUT H;  2C8Y B;  1F92 A;  4JZ1 A;  4O9V A;  3ZZ5 A;  3OAA D;  2W26 A;  3A7W A;  4K8B A;  5IYT A;  3ATK A;  3P8F A;  3SV9 A;  1MU6 B;  3GY4 A;  2BDH A;  1G32 B;  1K9O E;  3SU6 A;  5T3H A;  4ISI H;  2GTB A;  3PMJ A;  4H42 U;  4RSP A;  3EA8 A;  1O2W A;  2FZZ A;  3SI4 H;  2ZPR A;  1TFX A;  1O3I A;  3ZZD A;  6CHA C;  1AGJ A;  4RKO B;  4TPY A;  1QA0 A;  2HNT E;  4ISN A;  4YM9 A;  2K8I A;  4JCN A;  3Q76 A;  3M3T A;  3VB4 A;  1PJP A;  1C5Z B;  1P02 A;  1ZPB A;  3H09 A;  3FO8 D;  4IC5 A;  2WV9 A;  1KXC A;  1RTF B;  2FS8 A;  3VG8 A;  1J17 T;  1GMH G;  4X8U H;  1AVX A;  1FY3 A;  1JRS A;  1K1P A;  2VBC A;  3ATI A;  1UTP A;  1YPL H;  4GHQ A;  4FET A;  1BA8 B;  4ABF A;  3RU4 D;  2ULL A;  2JH0 D;  4X6M A;  2Z7F E;  5HIY A;  1C9P A;  2BVR H;  4JYV H;  2AMQ A;  1TPP A;  2W3K A;  1A3E H;  2PKS C;  4ZKR U;  3AK5 A;  1ETR H;  1SGQ E;  4FVB A;  3F9E A;  1MTN B;  2BHG A;  2IJD 1;  2F4L A;  1SSX A;  2BD3 A;  3GCT G;  3W94 A;  2YMS D;  1GJA B;  5L2Y H;  4MQA A;  1OWI A;  1ZML A;  2KCA A;  2HAL A;  1ANB A;  2TIO A;  1IQN A;  1GHA F;  1YCP K;  4UFG H;  4NG9 H;  1HAZ B;  4DII H;  4I8K A;  1NBM D;  1CGJ E;  1NFU A;  1D6W A;  5EJ1 A;  3TNS A;  5C2Z A;  5JPM H;  2Z9K A;  2A1D B;  3UWI A;  2J2U A;  1WQV H;  4I8L A;  3BG4 C;  1KIG H;  1BTP A;  1GGD C;  1V2S T;  2ZEB A;  3FAN A;  1WUN H;  1UVO A;  1VJA U;  1EAT A;  2G00 A;  4P00 A;  1JIR A;  1LVM A;  1THS H;  3M5M A;  2YNA A;  3S9A A;  2SGE E;  3A8D A;  4AYV B;  1V2W T;  1ELB A;  3GDU A;  3K6Z A;  5GCH F;  4BTU B;  1W0Z U;  1L1J A;  3TH4 H;  2AIP A;  2XNI A;  2Z94 A;  1TGT A;  2PTC E;  3QUM P;  3ZVE A;  4XE4 A;  3A82 A;  4U30 A;  1GDQ A;  1N8O C;  5ESB A;  3SNB A;  3ZVD A;  1Z8G A;  2FX6 A;  1FLE E;  5I25 A;  2EY4 C;  1UCY K;  3GIS B;  2CN0 H;  1UVU H;  4BAM B;  4ABE A;  3CEN A;  3S69 A;  2XW9 A;  4RN6 A;  1S85 A;  4IMZ A;  1OPH B;  1PYT C;  1NC6 A;  2FDA A;  3ENS B;  4ZUH A;  4BTT B;  4WXI A;  1BML A;  1Y3Y A;  3LU9 B;  1GMH F;  3B8J A;  1LVB A;  4NGA H;  3TNT A;  3SNA A;  3MWI U;  4X2X A;  2B8O H;  5KED A;  5AFY H;  3TJU A;  5DN6 D;  2QXJ A;  4YXW D;  3SU3 A;  3MOC A;  2WSS D;  1K1M A;  1T8N A;  2V3H H;  3SHC H;  1C5W B;  4X1R U;  4LZ1 H;  2P59 A;  3VB7 A;  4B71 A;  3TH3 H;  2Y82 A;  5B6L A;  1HAV A;  2HLD D;  1ELC A;  1P57 B;  4BXW A;  4FUF A;  5AHG H;  1GJ6 A;  2RA0 A;  3SZE A;  1EPT C;  1SGD E;  1D3P B;  3RXB A;  1ARC A;  3U69 H;  5DP3 A;  1D3D B;  1Y5B T;  1WDI A;  2XBV A;  3U98 H;  4OM9 A;  1C2M A;  1OWK A;  1ZRB A;  2C8Z B;  2BY5 X;  1HRT H;  4GPG A;  1W14 U;  1GVL A;  1A7S A;  3A81 A;  5FCR A;  5CMX H;  2L74 A;  3I29 A;  1CHG A;  2TGA A;  3ATW A;  2GMT B;  4AG1 A;  1TGB A;  1Y59 T;  3PRB A;  1TAW A;  4ZHM U;  1PPG E;  3RLY H;  2NWN A;  1HGT H;  1L4Z A;  4UE7 H;  4IS5 A;  5AVD A;  2I6S A;  1TNL A;  4K2Y A;  2GV6 A;  1JWT A;  4OS2 A;  3UY9 A;  1TMU H;  3UQV A;  2QXG A;  1Q2W A;  1ABI H;  4AG2 A;  1H9L B;  4ABA A;  3LON A;  1AWF H;  3RU4 T;  3ZVG A;  4YOI A;  1DWE H;  2HGT H;  1LKB A;  4YES B;  4YOJ A;  4FUB A;  1C5Y B;  2J97 A;  1C1R A;  1V6D A;  2UWP A;  3A7Y A;  3K9X B;  2FPZ A;  1SLV B;  5FBE A;  5DJ7 A;  2FOM B;  1LO6 A;  1EAS A;  5F6M A;  2OBO A;  2FES H;  1E34 B;  1HPG A;  1A5G H;  1Y3X A;  2XCF A;  7GCH G;  1GGD B;  1O5A B;  1G2M A;  1FI8 A;  3KNX A;  1W7X H;  2VID A;  2QIQ A;  3TK5 A;  3RXA A;  1FY8 E;  3IG6 B;  1GJ5 H;  1P03 A;  3ZZ7 A;  2LEL A;  2J9N A;  3GDS A;  3TH2 H;  4B2A A;  1TA6 A;  1AU8 A;  2J95 A;  3RXS A;  1C5X B;  3SW2 B;  5HM2 A;  1FIW A;  2UUF B;  3GCN A;  1DWB H;  1QBN A;  4DVA U;  1GDU A;  3GCT F;  4CRA A;  2Y80 A;  2B0F A;  2W7U A;  1UTO A;  4ZKN U;  2NU4 E;  2UWO A;  1E79 D;  2P3U B;  2P94 A;  5EIY A;  3RXO A;  2G8T A;  4TSF D;  2W3I A;  2FI4 E;  2JKH A;  3Q3Y A;  1G3C A;  2OD3 B;  3SV6 A;  4SGA E;  3A88 A;  3UQO A;  1U6Q A;  1DXW A;  2CHA C;  4MTB A;  3ZV9 A;  1HIA A;  1TAL A;  2VGC B;  2FLB H;  3WWB A;  1NPM A;  4A92 A;  4GUX A;  2R2W U;  5BPE A;  3SI3 H;  4FOU C;  1KDQ A;  3E1X B;  4H6T A;  1BCU H;  4IMQ A;  1QQU A;  1LTO A;  4CBO A;  1SGY E;  2XXL A;  4YO9 A;  3PV4 A;  1BB0 B;  3N7D A;  2BYA X;  2WPD D;  3VB5 A;  3F6U H;  3M3V A;  1C5U A;  2GZ8 A;  4ZRO A;  4Y79 A;  2Z9J A;  5EQQ A;  1YPH C;  4HTC H;  2G52 A;  4D7F A;  3M7Q A;  4GHT A;  1HAY B;  2A7H A;  4GCH G;  1VKY A;  1S6F A;  3V0X A;  1EZS C;  3T27 A;  3M35 A;  1E1Q D;  2SNW A;  4OGY A;  1TRM A;  1O2H A;  2QF0 A;  3RML H;  2FI3 E;  1QB6 A;  4UFF H;  4WXV A;  1FPC H;  1J8A A;  6GCH F;  1HAH H;  1BHX F;  3RC5 A;  3BTK E;  2BD8 A;  3E6P H;  3HGP A;  4A5T S;  2BB4 A;  2F9B H;  2BDI A;  3KYG A;  3LPR A;  4U2W A;  2A4Q A;  1J14 A;  4IN2 A;  2TPI Z;  2HWL B;  1GMC G;  1XXF A;  2C93 B;  1FXY A;  5EGM A;  3A83 A;  3ODF A;  1O32 A;  3VGC C;  1EAU A;  2PUX B;  1C1S A;  5EJL A;  2ZGC A;  2Q6G A;  5CHA B;  1GPZ A;  1T8L A;  1GI0 A;  1C1O A;  2GZ7 A;  1D3T B;  3B9F H;  4NSV A;  2TGP Z;  1YBW A;  1YPM H;  2FOH A;  2XCN A;  3IIT A;  3P6Z B;  2PV9 B;  1TOC B;  5A0A E;  1T8O A;  4TWW A;  3LGT A;  1QB1 A;  3MU4 A;  1V2O T;  3MH7 A;  4FUH A;  1FPH H;  1KSN A;  8GCH G;  2Z3C A;  5EG4 A;  2UUK B;  4AX9 H;  5J4S A;  3F1S B;  3RXI A;  2A4O A;  5T6G A;  4O03 A;  2BY6 X;  1OWJ A;  4Y6D A;  2OC1 A;  5C17 A;  1S83 A;  2XBW A;  5LPF A;  4X1S U;  1IQI A;  2BM2 A;  1QCP A;  3TJO A;  3LT3 A;  5C5N A;  1HXE H;  5GWZ A;  2FYR A;  2ZCH P;  3RXU A;  1S5S A;  3BV9 B;  1Z7K A;  4ABJ A;  2ZU4 A;  2GT8 A;  2BVS H;  2ANK H;  2WZQ A;  3GY7 A;  1T32 A;  1NRR H;  2A4G A;  3DFL A;  3QGJ A;  2VB0 A;  4YOG A;  2J5U A;  4HZH A;  2OP9 A;  3TGJ E;  1ELD E;  2BD5 A;  1XUH A;  4GLY A;  1AY6 H;  2ZDN A;  5JYI A;  2VIW A;  1C4Y 2;  4ISH H;  3T62 A;  3OX7 U;  4X2Y A;  5LPR A;  3A7T A;  1C5M D;  1MMJ N;  3AVZ A;  3E0P B;  1QL9 A;  2C3S A;  1JIM A;  3P8N A;  1C5R A;  4Z0K A;  1PPH E;  5AFZ H;  2CV3 A;  3ITI A;  2F3C E;  5SGA E;  1EST A;  4KKD A;  4WY3 A;  3PO1 B;  5CDF E;  3TIT A;  1CHO F;  1GJD B;  1TRY A;  1MD7 A;  2JH5 D;  4THN H;  1AN1 E;  1V2Q T;  2M2A A;  2ODY B;  2ZU1 A;  2OCV B;  1YWU A;  1NU7 B;  1E37 B;  3MU0 A;  1O3L A;  1VCQ A;  2G4T A;  1CT0 E;  1DST A;  1QBO A;  5F03 A;  1DM4 B;  4K60 A;  1E36 B;  2QN5 T;  1IQE A;  3URE A;  3V7T A;  4M9F A;  4K1S A;  3RU4 E;  3A8C A;  2YNB A;  3UWJ H;  1SGF G;  4CHA C;  4NZQ A;  5DPA A;  3V3M A;  1HAI H;  2XWA A;  3BEI B;  1WSS H;  1L0Z A;  3F3B A;  3MHW U;  1RFN A;  4K5Z A;  1NM6 A;  1UTQ A;  2G55 A;  3H7O A;  2ANM H;  3Q77 A;  2ZFT A;  1N1L A;  1TGN A;  1ZR0 A;  1BMM H;  2ZQ1 A;  2ZI2 H;  5L30 H;  2JDI D;  2VGC C;  5ETX A;  5DK1 A;  4H4F A;  3URC A;  1SGI B;  3A8B A;  2AGI X;  1P2J A;  1O2T A;  2UUJ B;  1XUK A;  1YCP M;  1CO7 E;  3PMH B;  2ILN A;  3TGK E;  2BD2 A;  2JIZ D;  1TPA E;  4AOQ A;  5FBI A;  1N6X A;  1ZTJ A;  5A2M H;  1P3E A;  4FUD A;  2GJG A;  2Y5F A;  2AMD A;  1L4D A;  3ZVB A;  4VGC C;  3GCH C;  4LOY H;  1EAX A;  2W7S A;  1IQM A;  5TCA A;  1GHB F;  3TK6 A;  1IQK A;  2QYI A;  1BTH H;  3CS0 A;  2H5C A;  1P2Q A;  4UFE H;  4B1T A;  5A8X A;  1C1N A;  3RC6 A;  3A89 A;  4DUR A;  1LPZ B;  1BUI A;  3QWC H;  5FL7 D;  3S7K B;  2BX3 A;  2J92 A;  1ACB E;  1UTK A;  1PQ5 A;  4I8H A;  1P10 A;  1W3C A;  2KCP A;  5HMA A;  4BAN B;  1ELG A;  4U01 A;  2P95 A;  3RM2 H;  4BAH B;  5T6D A;  3ZYE A;  2J98 B;  3MO3 A;  4JZD H;  2PR3 A;  1IQJ A;  1C5L H;  3BTE E;  3UNR A;  1GJ4 H;  1O5F H;  1BTW A;  3F0O A;  4ACA A;  2OC7 A;  2BDC A;  1GVZ A;  2CXV A;  4I8G A;  4X2V A;  1K22 H;  2W5E A;  5DP6 A;  2XBY A;  3PRD A;  2A7J A;  3B23 B;  2ZTY A;  1TBR H;  2J94 A;  1LHC H;  2BDG A;  1DIT H;  2GKV E;  1ANE A;  2QAA A;  4NZL A;  1O5G H;  1O33 A;  2ZGB H;  2ZEC A;  1AB9 B;  3RXC A;  2Q6D A;  3T29 A;  3UNQ A;  3GY2 A;  1TQ0 B;  2GCT C;  1TAB E;  4Y8Z A;  1LHF H;  1AND A;  2Q1J A;  4TY6 A;  3RDZ A;  4D7G A;  3BG4 B;  3STJ A;  4JZF H;  1DOJ A;  1C4U 2;  1A3B H;  1UVT H;  2PGQ B;  2L6O A;  4GVU A;  3O8R A;  4X6P A;  5C0U A;  1KXD A;  1HLT H;  2ALV A;  1GBA A;  1QRZ A;  2J98 A;  1DE7 H;  1E38 B;  1HJ9 A;  1O2G H;  5FCK A;  3E90 B;  1N8O B;  3BTF E;  2FS9 A;  4NIW A;  2SGP E;  3VXE H;  2BXT H;  4NA9 H;  4Y7B A;  3QTO H;  1SMF E;  1TBQ H;  1GL0 E;  4X6N A;  3H5C B;  2FEQ H;  3TIU A;  2Z9I A;  3F9G A;  1B5G H;  1F7Z A;  4A1V A;  4UON A;  1ZOM A;  1ZSK A;  3FOA A;  5DGJ A;  1KXF A;  2ZHF H;  3TU7 H;  1FV9 A;  4CBN A;  2SGA A;  1AFQ B;  2B7D H;  1KYN A;  3SOS A;  4INH A;  1TMT H;  1C2H A;  1RIW C;  1RS0 A;  2ZO3 H;  2BY9 X;  1ZJD A;  5JBB S;  2ZDK A;  2ALP A;  2ZHW H;  1BHX B;  1JMO H;  5J4Q A;  2JH6 D;  4GCH F;  3HKI B;  1SLX B;  2V3M A;  1O2I A;  4ACB A;  1IOE A;  3D23 A;  2QF4 A;  3M5L A;  2CMY A;  3HK3 B;  5H4I B;  2FOE A;  1L1G A;  4XDE A;  3M5N A;  3UAI C;  1O3H A;  2QF3 A;  3OEH D;  2GCT B;  1GG6 C;  4OS4 A;  2EA3 A;  1F5K U;  1WTH D;  1UO6 A;  1EX3 A;  5T1V A;  1SPJ A;  5EQS A;  3MNS A;  1S81 A;  1PQ7 A;  2SFA A;  1MUE B;  1A4W H;  2GV7 A;  3CNR A;  3QDZ B;  3RXV A;  2RA3 A;  2K1Q A;  1O3D A;  1XUJ A;  2R9P A;  1GG6 B;  1ORF A;  1Y5U T;  2PP6 A;  3TK9 A;  2ZCK P;  5DKM A;  4I86 A;  1TBZ H;  1YLD A;  1YM0 A;  4NCY A;  3SN8 A;  2SGQ E;  3O8B A;  3W1E A;  1C1V H;  2AER H;  4IC6 A;  4M7G A;  4K1T A;  1CGI E;  1SGP E;  2ZCL P;  1AZZ A;  4EST E;  3QO6 A;  4FXG H;  1MCV A;  1D6R A;  1NT1 A;  1K0H A;  2EQN A;  1C2K A;  3T28 A;  2ZDA H;  1W0K D;  4HGC A;  1GBF A;  3SU5 A;  1MZD A;  4Q7X A;  4OS6 A;  1AFQ C;  2ZIQ H;  5C20 A;  1SHH B;  3LGI A;  1KY9 A;  4YLQ H;  1K21 H;  2OC0 A;  2FI5 E;  3F2F A;  1M9U A;  1Y5A T;  1GVK B;  1W10 U;  1YGC H;  1Z1J A;  5A0B A;  1VCW A;  1P3C A;  5HYO A;  2FXR A;  2WPH S;  2AGE X;  2GCH G;  4CRB A;  5C3N A;  1W11 U;  3L3T A;  1H9H E;  1PQ8 A;  5FXL A;  3MNX A;  1KXA A;  3MTY A;  1G3D A;  4Q63 A;  4AC9 A;  4O3U A;  1EZQ A;  5B6O A;  1Z8I B;  4ABI A;  2ZPS A;  1FY5 A;  1GBH A;  1NBM E;  1O2U A;  2BX4 A;  2HPP H;  3LGV A;  4A7I B;  2BD9 A;  3OSY A;  1L2E A;  2ZDM A;  1NO9 H;  3PWC A;  1ZJK A;  1O2R A;  4KTC A;  2H9H A;  3DCL A;  1SL3 A;  3DT0 H;  2EI8 A;  3AW1 A;  2CF8 H;  1F2S E;  3QZQ A;  1V2K T;  2D26 C;  1GL1 A;  2D2D A;  3SUG A;  4J2Y B;  5L2Z H;  1S6H A;  3E16 B;  1C9T A;  2Y6T A;  4DT7 B;  4Z6A H;  2ZP0 H;  2EC9 H;  1C1U H;  3KQE A;  1HV7 A;  1A2C H;  5C1Y A;  1SLW B;  4FUG A;  1YLN A;  1O34 A;  3DUX H;  6EST A;  4XD7 D;  3URD A;  1DLE A;  1LQE A;  1OHH D;  1IAU A;  3SND A;  2XC5 A;  4CRC A;  3KYF A;  4WME A;  1MQ5 A;  2GDE H;  2TGT A;  3U8R H;  1Q3X A;  1O2O A;  5EXN A;  1BRA A;  1CGH A;  1TE0 A;  3D49 H;  5KGO A;  4CRG A;  1HFD A;  1ELT A;  1D3Q B;  1H4W A;  4OS7 A;  3MH6 A;  4D9R A;  3UFA A;  2ZHE H;  1Y8T A;  3F68 H;  3NPS A;  4BOH A;  4F4O C;  1EJA A;  1MTS A;  2FP7 B;  4I7Y H;  1BBR K;  3LKW A;  2VJ1 A;  1HCG A;  3EE7 A;  1PPB H;  3LC3 A;  1GI2 A;  3F0P A;  1O3K A;  3LIW A;  1T7C A;  1HJA B;  4D9Q A;  1GBE A;  1P9U A;  1VGC C;  2ZFR H;  1DLK B;  3N7E A;  1GI9 B;  4NSY A;  1DUA A;  1NRP H;  5BRR E;  1ELE E;  5LPE A;  2NU1 E;  3TGI E;  1DXP A;  5GIB A;  4DY7 B;  1ABJ H;  3OTP A;  1QRW A;  1JBU H;  4IN1 A;  1O3A A;  2FMJ A;  4JMY A;  1TQ7 B;  4Q4L A;  4BNR A;  1O37 A;  2BLW A;  3PRO A;  5FPT A;  5E2P A;  1KXE A;  4KP0 A;  4WH6 A;  3TJV A;  5FX5 A;  2GX4 A;  4CR9 A;  2F9V A;  1QJ6 B;  1QQ4 A;  2OK5 A;  2WUC A;  4X1P U;  2GD4 B;  1F0T A;  1A5H A;  3W95 A;  3TPI Z;  3I77 A;  1OS8 A;  2BOH B;  2KR7 A;  1BTY A;  1DY9 A;  1UHB A;  1P8V C;  6CHA B;  3ZZ8 A;  2FOC A;  2FX4 A;  1LPK B;  1WU1 A;  5T6F A;  3ELA H;  1O5C B;  3M36 A;  1KMH B;  2OUA A;  1KLI H;  3MI4 A;  4WF8 A;  4CHA B;  4Q7Y A;  1SOZ A;  3RC4 A;  3VB6 A;  1CT4 E;  1NTP A;  1NZQ H;  1TIO A;  4Q7Z A;  2C4F H;  1AHT H;  1H8D H;  3RXL A;  2BDB A;  2PHB A;  4E06 H;  2VH6 A;  3GCH B;  1EZX C;  1GHV H;  3RXP A;  1XUF A;  4AYY B;  1HAP H;  1MAY A;  4SGB E;  1EP5 A;  2A2Q H;  2EEK A;  4FUC A;  1BJU A;  2P8O B;  1RD3 B;  1GCD A;  3NKK A;  1O2P A;  2QGR A;  4I32 A;  1V2N T;  2ZNK H;  2KZ4 A;  2VVC A;  1V2M T;  1UK4 A;  2HVY B;  1XKB C;  2XC0 A;  4MLF B;  3KQ5 A;  2BTC E;  1MZA A;  1MKX K;  1OP2 A;  2AGG X;  1NRS H;  3RLW H;  5F8T A;  4JZI A;  1O2J A;  1C1W H;  1CA8 B;  4MNW A;  1DWC H;  1DIC A;  4JK6 A;  3KQD A;  3E3T A;  2CHA B;  4TPI Z;  1SB1 H;  3UIR A;  1P9S A;  3O8C A;  1TNJ A;  1EAI A;  1SGR E;  3KQC A;  1TPO A;  2THF B;  2OQ5 A;  1QNJ A;  1V2R T;  2BQ7 B;  1FIZ A;  2AYW A;  3IWM A;  4YT6 H;  1GBC A;  1OOK B;  1SVP A;  3QGN B;  4U32 A;  2A7C A;  2F91 A;  1DAN H;  2PSX A;  1O3B A;  5FHT A;  1AO5 A;  1X7A C;  1TMB H;  2F9O A;  2ANW A;  5A8Z A;  2TGD A;  4Q80 A;  4XOJ A;  1W12 U;  3ZV8 A;  2NU3 E;  1Y3V A;  2BXU H;  3LC5 A;  5FPS A;  5EW1 H;  3DD2 H;  1V2J T;  1HXF H;  1UVP A;  5DSF A;  1MBM A;  2QY0 B;  3MU8 A;  3RMN H;  2Z3E A;  2SNV A;  1GMD G;  5IDK A;  5CHB A;  1BRU P;  1HJ8 A;  3ODD A;  3P8G A;  2KCO A;  1C4V 2;  3AAU A;  4DIH H;  3GIC B;  3QLP H;  2B5T B;  2ZPQ A;  1Y3U A;  2LNC A;  4VGC B;  1ZGI A;  4X6O A;  1K1O A;  5JBA S;  1YY3 A;  3BEF B;  1EOL A;  1O2Q A;  4BAO B;  3M61 U;  1GI1 A;  3RXE A;  3KID U;  1H8E D;  2STB E;  3EST A;  4AFQ A;  5JBT A;  3K6Y A;  1BQY A;  1BRB E; 
#chains in the Genus database with same CATH homology
 3SUF A;  1E79 D;  2IJO B;  2JJ2 D;  2QF4 A;  2WSS D;  3M5L A;  3PV2 A;  4TSF D;  4F55 A;  2YMS B;  3F2H A;  3SV8 A;  3ZIA D;  1BMF D;  5H4I B;  2K8I A;  2XOK D;  4B74 A;  2K0Q A;  2QE7 D;  3M5N A;  3SV6 A;  2P59 A;  3P8O A;  3FKS D;  3RC6 A;  3OEH D;  2QV1 A;  3U1I B;  3N99 A;  3H09 A;  3WW7 A;  2F43 B;  3FO8 D;  4XD7 D;  4B71 A;  1DXW A;  2WZQ A;  5B6L A;  2HLD D;  2WV9 A;  1OHH D;  2A4G A;  5FL7 D;  3SUE A;  3VG8 A;  3WWB A;  3GS9 A;  4A92 A;  3SUD A;  2J5U A;  5C0T A;  5T1V A;  3SZE A;  1W3C A;  2KCP A;  5IK2 D;  5EQS A;  2VBC A;  4I32 A;  2KM0 A;  4U01 A;  2KZ4 A;  1NS3 A;  3DSO A;  2K1Q A;  4A1T A;  3N7D A;  2WPD D;  1SKY E;  4FET A;  4OM9 A;  3F2G A;  3F0O A;  3P8N A;  2GVF A;  5EQQ A;  2OC7 A;  3SU1 A;  4B73 A;  3OE7 D;  2A4R A;  3O8B A;  4Z1M D;  3W1E A;  3PRD A;  5GND A;  5F53 A;  4TT3 D;  2QF5 A;  4I33 A;  3L6P A;  4A1X A;  3PRB A;  2YMS C;  3AK5 A;  2F9U A;  1E1Q D;  5CDF E;  4TYD A;  3KEE A;  2FM2 A;  3SYJ A;  5HKK D;  1A1R A;  2IJD 1;  2F4L A;  2FP7 B;  3FN8 A;  4NWK A;  1FX0 B;  2M2A A;  3LKW A;  2YMS D;  3OYP A;  3KN2 A;  2CK3 D;  4ASU D;  4RI0 A;  2KCA A;  3O8C A;  1W0K D;  2OC8 A;  3F0P A;  3SU5 A;  3SV7 A;  2YOL A;  1NBM D;  4WH8 A;  1S6L A;  5FPY A;  3RC5 A;  3SU4 A;  2KCY A;  2JJ1 D;  3LON A;  4DT4 A;  3UB0 A;  3N7E A;  2L6O A;  2OC0 A;  3O8R A;  3LOX A;  5EPN A;  3NRL A;  3F2F A;  4M9F A;  5C0U A;  1CU1 A;  2A4Q A;  2O8M A;  3PV5 A;  1DXP A;  4I31 A;  3OTP A;  1BT7 A;  1EFR D;  1RTL A;  4B6E A;  2KFW A;  4JMY A;  4R8T B;  3M5M A;  3E90 B;  2FOM B;  3SU2 A;  4Q4L A;  2OBO A;  5FPS A;  3F3B A;  5DSF A;  2XCF A;  3EYD A;  5FPT A;  3O8D A;  4Q63 A;  1W0J D;  1DY8 A;  2AHM E;  3WWF A;  3U1J B;  2XNI A;  3KNX A;  3OFN D;  1N1L A;  2OIN A;  2V7Q D;  5CHB A;  2GGV B;  5IDK A;  3OEE D;  2XCN A;  2OBQ A;  4WH6 A;  4NWL A;  1JXP A;  1RGQ A;  5ESB A;  4A1V A;  2JDI D;  3M5O A;  3FOA A;  2KCO A;  5ETX A;  2F9V A;  3SU0 A;  1NBM E;  1MAB B;  2W6I D;  2XND D;  1H8H D;  2LEL A;  3KF2 A;  2OK5 A;  4ZCN A;  3OAA D;  5EQR A;  4K8B A;  2WHX A;  2W6J D;  5GJ4 B;  3SV9 A;  2JIZ D;  2KR7 A;  4KTC A;  1DY9 A;  3DCL A;  4B76 A;  4B75 A;  1WXR A;  3SU6 A;  3DSP A;  1KMH B;  4WF8 A;  2OC1 A;  5GPI B;  1E1R D;  3RC4 A;  5C17 A;  1COW D;  1H8E D;  3SUG A;  5EPY A;  5DN6 D;  4YXW D;  4B6F A;  3SU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...