3F2FA

Crystal structure of the mercury-bound form of merb, the organomercurial lyase involved in a bacterial mercury resistance system
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
208
structure length
208
Chain Sequence
MKLAPYILELLTSVNRTNGTADLLVPLLRELAKGRPVSRTTLAGILDWPAERVAAVLEQATSTEYDKDGNIIGYGLTLRETSYVFEIDDRRLYAWCALDTLIFPALIGRTARVSSHCAATGAPVSLTVSPSEIQAVEPAGMAVSLVLPQEAADVRQSFCCHVHFFASVPTAEDWASKHQGLEGLAIVSVHEAFGLGQEFNRHLLQTMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alkylmercury lyase
publication title Crystal Structures of the Organomercurial Lyase MerB in Its Free and Mercury-bound Forms: INSIGHTS INTO THE MECHANISM OF METHYLMERCURY DEGRADATION
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 61
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 4.99.1.2: Alkylmercury lyase.
pdb deposition date 2008-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03243 MerB Alkylmercury lyase
A PF12324 HTH_15 Helix-turn-helix domain of alkylmercury lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.490 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3f2fA00
5C0TA 5DSFA 3F2GA 3F0OA 3F2HA 5C0UA 5C17A 3F0PA 3F2FA 3FN8A
chains in the Genus database with same CATH superfamily
1GBFA 5HMAA 2SNVA 3NCLA 2ZP0H 3PO1B 4CRAA 1ACBE 3TH3H 1WTGH 2HLDD 1QJ1B 1GBHA 3F0PA 5EW2H 3GCHB 1MZAA 4NZLA 4I8HA 1PYTD 9ESTA 1W7XH 1ZZZA 1XKBC 4IN2A 1EXFA 4X1PU 4NSVA 3ATLA 3E8LA 1SGTA 4MVNA 1E34B 2GKVE 2IN2A 3NUMA 4B2BA 2A45B 1ABJH 2J34A 2YMSB 2ZIQH 2A1DB 1YYY1 1SGFA 1CBWC 1LO6A 3FZZA 2PKSB 5KECA 5E2PA 2G5NA 4X6MA 4XD7D 1P2QA 3GCNA 4AZ2B 1V2OT 1Z8RA 1MTNC 1SGPE 5L6NH 5GWZA 1HXEH 7GCHG 1SVPA 1QGFA 1ZHPA 2WV5A 4FVDA 1MTUA 1LMWB 4I7YH 1QL7A 1V2VT 3RXLA 2EEKA 2OP9A 1N6XA 1DUAA 2VU8E 2H2ZA 4ZUHA 3JZ2B 4X2WA 4MNYA 5AFYH 2V0BA 2WPJS 2LP6A 3SNCA 4UDWH 1C2JA 3TK5A 2C8WB 1O32A 2ZO3H 2ZFPH 1OSSA 4BXWA 1P2IA 2ZTXA 3SU6A 3MMGA 3T29A 3FP8E 3FVFB 5AFZH 2HGTH 1O2IA 4WXVA 3SHAH 1C2IA 2FM2A 5EIYA 1RIWB 1GGDB 5T1VA 3ZVAA 1IQGA 3ELAH 2WYGA 3GDSA 1V2ST 2BY5X 5FPYA 3TNSA 1ZR0A 1AB9C 4M9FA 1C1MA 1EB1H 1BQYA 3VXFH 1FPHH 4DY7B 5TCAA 1WAYB 3VG8A 2H5DA 4TYDA 4B1TA 2J95A 1SL3A 1BTYA 1ZYOA 1O38A 1NRPH 2BVRH 3M37A 4FETA 4NG9H 1SGFG 2HWLB 1KTTB 5A0CA 2FODA 3S7KB 2BY7X 1O37A 1TWXB 2TGAA 4ABEA 2PW8H 1LPGB 3SV2H 5DP8A 4OS1A 2LELA 5CMXH 1QQUA 1LVOA 1CBWB 2W5EA 3H5CB 1Z7KA 1EOJA 1ANBA 3AASA 3MI4A 3SU4A 1GWAA 2PHBA 2A7CA 3L6PA 3GCOA 4INLA 1MTNB 1PPBH 3KYFA 1EJNA 4E06H 2RA3A 2C8XB 4D7GA 1D9IA 1Z6EA 1NZQH 2A2QH 1YPHE 2XNIA 2LNCA 4GCHG 1ZMJA 1MQ5A 5JB9S 4R0IA 4NWLA 5C5NA 5HKKD 1LVYA 2KR7A 3T2NA 8GCHF 1KXBA 1QL9A 4OS4A 3OTPA 4HFPB 4J1YA 4VGCC 1TNKA 5E8EH 1A5IA 1OP8A 1SGNE 1D6RA 1FUJA 3P95A 1QQ4A 4RKOB 2QF3A 1GL1A 1O5AB 3OY5U 3URCA 1UTMA 4Y8ZA 1CA0C 2C8YB 1YCPM 5DP5A 1XUKA 1J16A 4JZ1A 5DP7A 1KDQA 3RM0H 2ZCKP 1P06A 2TGTA 4Z0KA 4DT7B 1DWBH 3PMAB 2O8UA 1TYNA 4CR5A 4K1EA 2FXRA 2RA0A 3UWJH 5JBBS 1WDIA 2GVFA 1SKYE 1HAVB 1LCYA 2GCTC 5C1YA 1QA0A 1AI8H 5A8YA 2AGEX 1F0SA 5GCHG 1AB9B 2HALA 1TB6H 1P2MA 2R2WU 1DOJA 1EPTC 1DLEA 2ZGXH 1D3DB 3BTWE 2KZ4A 1GI9B 1O5CB 4KKDA 1UVOA 1DSTA 3GS9A 5LGOA 2THFB 3BSQA 1TONA 5C20A 4X1NU 2P95A 2OQ5A 5K7RA 4ABJA 1GBCA 2VINA 2BY9X 6CHAC 1K1IA 4DOQA 3M61U 1O2QA 1A46H 2STAE 4NIXA 3BTFE 1D3QB 3DSPA 4ISOA 1O2SA 2Y7XA 1LVBA 3LGWA 4LXBH 1ZOMA 2W26A 3A85A 4I8JA 3RXOA 1OP2A 1W0KD 3OX7U 4KELA 1O3JA 3KF2A 3ZZ3A 3PV2A 5ESBA 2FOEA 2GJGA 2FOHA 2GV7A 2VVUA 4VGCB 3RXPA 1P04A 1TGNA 1O2KA 4K8YA 1HV7A 4Y8YA 3TH4H 2G81E 2F83A 3UY9A 3PROA 4K1SA 1L0ZA 2O9QA 2RG3A 1C5MD 1O2GH 2W3IA 4Y10E 1EAXA 4UEHH 1XX9A 2PV9B 1BA8B 3N7DA 2HVXA 1TGBA 1GMCF 1XVOA 2H5CA 2G51A 8LPRA 2GCTB 3A7YA 1IQEA 1HYLA 3VXEH 5EGMA 1A5GH 2BD4A 1LPKB 4YOJA 1NRSH 5JBCS 2HPQH 2W6JD 3RLYH 1EPTB 1OWIA 2XC4A 1AU8A 1PYTC 1ZPZA 1K1MA 2F9VA 2ZF0H 2WZQA 1IOEA 5HYOA 3QUMP 3RU4E 5F6MA 1TMUH 2A4GA 1SQTA 2HNTE 1CE5A 1ESBA 3V0XA 4WY3A 3MH6A 1HAPH 3MU0A 6CHAB 2ZU2A 2KM0A 3D49H 3HGPA 2H6MA 1HAZB 3KQ5A 4BTUB 2KAIB 1H8DH 3F9FA 2ZC9H 2C93B 5EXMA 3Q76A 3BTKE 1FMGA 1BMMH 1CQQA 1YBWA 5LPRA 3V13A 2XWAA 1HRTH 4Q7ZA 1P2KA 4AGJA 4NZQA 1QB6A 1SFIA 2ZHFH 1THSH 4JZEH 1GBAA 1C2HA 3NWUA 1TFXA 1EP6A 1SQRA 3NXPA 2VIWA 2ZDLA 2O8TA 3AAUA 3CP7A 3W95A 3U1IB 2FEQH 1PQ7A 1O3BA 5EPNA 1IQIA 3PV4A 1AZ8A 3QLPH 3LGVA 3MNCA 3WWFA 1V2LT 3UFAA 1OYTH 5FBEA 4JZIA 5C17A 3ZZBA 2BVXH 1C5PA 4LZ4B 1C2MA 1SLVB 1Y3YA 1ZTLA 3PWBA 1KLJH 3MQKC 2KFWA 3F9GA 3S9CA 4OS6A 1S0RA 2AMDA 1F5LA 3P8OA 3GCTG 1YWUA 2NU4E 2VWNA 1U6QA 1WTHD 3ZYDA 3RXTA 1C5QA 2WPDD 1RS0A 5FPSA 2AGIX 4CRCA 1IQJA 2GZ7A 1RTKA 3DHKH 1SLUB 1TRMA 2B9LA 4FUDA 1LHDH 6LPRA 2ZU3A 3NKKA 3MO6A 1B7XB 5DGJA 1VJ9U 3STIA 2BDYA 2D1JA 1C9PA 1Z1IA 2ZGBH 2ZU4A 1E35B 2Z3DA 1DE7H 4CRFA 1BBRH 4ISHH 1O39A 1NC6A 2BD7A 2SFAA 4CRDA 3UNSA 1HGTH 1VITG 4ASHA 1A2CH 4CBOA 1W8BH 4Y8XA 2PLXA 2P3TB 3GY5A 2KCPA 2ZTYA 1CT2E 1PPGE 1Z6JH 1Y3UA 2FS8A 1DFPA 2VBCA 1S85A 3LGYA 1ZSLA 1ZSKA 3RXCA 4X2VA 3QTVH 2P59A 4BAOB 1TAWA 1GHBF 1W12U 2VIPA 1OWHA 1TNLA 1ELAA 3RXKA 2P16A 1AZZA 1TPSA 4H4FA 1O5FH 1TE0A 1C2DA 1A0HB 1EAUA 2PGBB 4X8TH 1FQ3A 1Q2WA 3EDXB 1TOMH 5L2ZH 1BOQA 1P3CA 3QX5H 1DXPA 5EU8A 4FUEA 4I32A 1HB0B 3A89A 2W7SA 4OM9A 1UHBB 2BDGA 3ZVBA 3AAVA 5ESTE 3FFGA 5DPAA 1HLTH 5E0HA 2FI4E 2F91A 1O3LA 1UVPA 1GBEA 1NBMD 2PKAA 1UTQA 3EGKH 1DS2E 2ALPA 2AFQB 2BZ6H 5ETXA 1V2RT 3B8JA 3PWCA 1HAXB 3VB3A 3S9AA 1ZSJA 2ZDNA 1GI7B 4K8BA 1XVMA 3T5FH 5JBTA 2FOGA 3ATIA 2SGAA 1MD7A 1EP5A 2BQWB 2R3UA 3KNXA 1DANH 1T8LA 3BTTE 3GYLB 1EUFA 3SGBE 1NESE 1F92A 4UFEH 1QJ7B 1ARCA 4X1RU 5A8XA 1C9TA 1H9IE 4XBBA 1K2I1 2WYJA 2ZPSA 4RT0A 5FCKA 1BMLA 3RXGA 1GVKB 1KMHB 2WUCA 1VITH 3SQHE 2ULLA 2AYWA 2Z3CA 5CDFE 3FOAA 4BANB 1S0QA 1OS8A 2A0QB 1MABB 3JZ1B 3UR9A 3M36A 3UWIA 3P92A 2WINI 1JWTA 1CGIE 2Y80A 4AC9A 4F4OC 1DM4B 1KXCA 2SNWA 3LU9B 4MTBA 3TGIE 2BQ6B 4BOHA 1HPGA 4IC5A 3RUOA 1A7SA 1GHYH 4MQAA 1GJAB 1MCVA 1OP0A 2BD8A 1ESTA 1JIMA 1EZSC 2ANMH 1YPMH 1NFXA 1S6HA 3WY8A 1TQ0B 1MU6B 1UVSH 3T27A 4XSKU 1B0EA 1WYKA 1GI1A 1X7AC 2P93A 3RXEA 1DVAH 1VR1H 2ZZUH 3E1XB 1TOCB 3P8NA 2ZQ2A 3RU4T 2ZU5A 2G8TA 4JMYA 1IHTH 1UVTH 4FUGA 3SUEA 2HRVA 3MU4A 1WSSH 1OWEA 1HJ8A 5JYIA 2Z6BD 2FO9A 4A6LA 2PR3A 3TJNA 3SGQE 1EQ9A 3HK6B 1ZPCA 2K8IA 3E3TA 5C1UA 2HNTF 1YLCA 3LJOA 2O8WA 3UR6A 1BRBE 4B74A 2Z9KA 1O5DH 2KX4A 1T4VH 1T8NA 4Q2KA 4FU7A 1QB9A 1C5RA 3F9HA 1IQHA 2CHAC 1SHHB 4LOYH 1GHZA 2WV4A 1GMDF 1EATA 1MKXK 3RXHA 3PMHB 3SI4H 4HGCA 1SB1H 1KXAA 1Y5UT 3LC5A 1FY3A 4AYYB 2NU0E 1ZJDA 4FUCA 1PQ8A 2XTTB 3DUXH 4TY6A 1FNIA 2TPIZ 3DSGA 4ABIA 2QV1A 1PPFE 3U8RH 1PQ5A 1LPZB 1QBVH 2GT7A 1EZXC 3E16B 3K6YA 5DP9A 1P8VC 1TX7A 2FLBH 1BCUH 3DFLA 4O3UA 1MMJN 4MPUA 3O8CA 4Y7BA 1QA7A 1WU1A 2A5KA 1DWCH 4AX9H 2HPPH 1FI8A 1HAYB 1YP9A 3RXFA 3F1SB 2AS9A 1NTPA 1O2TA 2QF5A 1AY6H 4O9VA 5FPTA 2F9BH 3ZVFA 4TPIZ 1P2OA 3F6UH 5PTPA 1CU1A 4FU9A 1QHRB 5EJ1A 5EPYA 3SJIA 4ESTE 2BX4A 3LOXA 3SQEE 2B7DH 4KTSA 1A0JA 3RC4A 1UW7A 3A7WA 3GYMA 3FP6E 1UTJA 3RXQA 2QXGA 5DJ7A 2XOKD 3LGUA 3PB1E 3T28A 1GHXH 1T7CA 1E1QD 2Q6FA 3S9BA 1G2MA 4O3TA 4YM9A 1TA2A 1KXFA 1O35A 1S81A 1ORFA 1V6DA 2D2DA 3SV8A 1C4Y2 2QN5T 1WXRA 2ANWA 1GHAF 4OGXA 4WMDA 4YO9A 1O5GH 2ZWLH 1VKYA 3ZZAA 2R3YA 2ANYA 3LGIA 4KTUA 4Q4LA 2ZDAH 4XOJA 4Y7AA 2J94A 2OC7A 4U01A 3GOVB 1C5YB 2A32A 1UVUH 1O5EH 2OC8A 2TGPZ 5JPMH 3EA9A 1TIOA 1O2XA 2VIDA 2CHAB 1ANCA 3RXVA 4OS2A 3E6PH 2ZI2H 1J14A 1G36A 1P11E 1D6WA 2QC2A 2QXHA 4JYVH 1HCGA 2CF8H 3SU1A 4YXWD 1C5WB 2ZHEH 2BD9A 4D76A 1HAHH 2O8LA 1SG8B 1OYQA 1ZHRA 3SU0A 3BTEE 2UWOA 1ANEA 4YOIA 2ANKH 1WBGB 3MH5A 2SGEE 1MKWH 1THPB 1C1TA 1CHGA 3LH1A 2IJD1 1P3EA 1V2KT 3UOUA 4YT7H 3ZZ9A 3PLPA 5I25A 1NRNH 1ELDE 3MYWA 5DG6A 3SV9A 1BRAA 2KCAA 4K2YA 3S0NA 1V2JT 1QTFA 1BB0B 2L6OA 2V3OH 3UQVA 1QL8A 3KQEA 2Y5GA 1TX6A 4ZHAA 5T6DA 2XC5A 4AFUA 1UO6A 2GV6A 2BM2A 2ZA5A 1DT2A 3BTGE 4HTCH 4DGJA 1ETTH 2JH6D 1MAYA 3ZVCA 1O3NA 3BEUA 1HDTH 1DWEH 1WCZA 4E7NA 5EXNA 4GLYA 2M2AA 3MNBA 2AIPA 3M5OA 3BTME 2OC1A 2H9TH 3F9EA 1P12E 2FOBA 2P3FH 2ZQ1A 2SGQE 3SBKA 5JDUB 1Y8TA 4GCHF 2BOKA 3MH4A 3L33A 1G3CA 2HVYB 3K2UA 4A1XA 1H8IH 8GCHG 3RXBA 1Y3XA 3BTHE 3SGAE 3OTJE 4D8NA 4A1TA 2FLRH 2WSSD 2TGDA 4MPXA 1RFNA 3BIVH 1GMHF 2OC0A 4GAWA 2WHXA 2C90B 3LDXH 4WXIA 3ZIAD 2GMTC 3EE7A 1FN6A 5EQSA 3A8CA 5FHTA 3RU4D 1QY6A 1ZLRA 3RLWH 3UNRA 1ESAA 4THNH 5C5OA 3P8GA 3SV7A 2EI8A 3HPTB 1HAVA 1FXYA 1YPEH 1SGYE 2ZFRH 2BDCA 2FS9A 1K1NA 1QR3E 1O0DH 1QRZA 2PSXA 5A2MH 2VIQA 2BXUH 3BG4C 3BIUH 1TALA 2EC9H 2BX3A 2BZAA 3QDZB 3MWIU 1GBMA 1XUFA 1LHCH 1KSNA 1QRXA 2FOFA 2J97A 2ZU1A 4K3JA 4Y71A 2WV9A 2A5IA 2RDEA 1K1PA 1OXGA 3A84A 1HBTH 3GY3A 3KN2A 2DUCA 2J5UA 2JH5D 1BRCE 4ABFA 5A0BA 4TWYA 1GBIA 3TLOA 1BTPA 1CA8B 1G37A 3MOCA 3U9AH 3E0PB 3FO8D 2A4RA 2NWNA 1AQ7A 1OWDA 1ETRH 1ELBA 2Z3EA 1O3PB 4UONA 2ILNA 1ELFA 2VIOA 4U2WA 2I6SA 3WWBA 1F0UA 3A7TA 4K1TA 2KCYA 3VB6A 1SGEE 1MQ6A 1THRH 3A8BA 2RDLA 3O8DA 4XRNA 2BD3A 1T8MA 1VCWA 2JH0D 3TJUA 3DCLA 1GCTC 1OPHB 2H9EH 2ASUB 4CR9A 3ODFA 2G52A 2GGVB 6ESTA 1CA0B 2Z9IA 1KYNA 1C4V2 3KQCA 4YLQH 3WW7A 2XYAA 3D23A 3PYHA 5GJ4B 2Z9GA 4CRBA 1L1JA 1BHXB 1P2NA 2ZTZA 1MBMA 3ESTA 1LDTT 3P70B 1C5UA 1BJVA 1LKBA 4NA9H 4ZHLU 5HIYA 3U98H 4AG1A 3ZV8A 2OLGA 1TBRH 1RTLA 4I31A 2P8OC 2QF0A 3BV9B 1O2VA 3GDVA 1K1LA 1FIWA 1GMCG 2FI3E 3BG8A 1HIAA 4OS7A 4ZMAH 5AVDA 2BY8X 2BLWA 1UCYE 1EPTA 1YPHC 2AIQA 2GT8A 3U28C 3UAIC 3HATH 3N7EA 1RJXB 1GDUA 2I6QA 2XC0A 1LKAA 4U30A 1BTXA 2K0QA 3GY8A 3FZDA 5B6OA 1OWJA 5SGAE 2A7JA 1AFQC 4TY7A 1O3FA 1Q31A 3A8AA 3SUDA 3SNDA 1GJ5H 2KAIA 2VIVA 2WPKS 5F8ZA 1ELGA 3HKIB 1P0SH 3QZQA 5C0UA 1L1GA 2YMSD 2V3MA 2TIOA 4ZKNU 1Z8GA 1LHGH 4D7FA 2XXLA 3P6ZB 1WV7H 3TK6A 5F8XA 1BTHH 3QWCH 3DT0H 1UTOA 1H9HE 3Q00A 2XCFA 4JYTA 1SGCA 1NN6A 2BD2A 4IW4E 2Y81A 3A7ZA 1Z71A 4ZKRU 1ELCA 1O3KA 2RCEA 2F9NA 2FX4A 2FYRA 4QT8C 1S84A 2XBWA 4ABAA 2PTCE 2FDAA 1HAGE 5K0HA 2SGFE 2ZNKH 4K60A 1BHXF 1ZGIA 2PWXA 1SR5C 5A09A 4YZUA 1YY3A 4UE7H 5FXLA 2EQNA 4OS5A 1D4PB 1GCTB 4X8SH 1RRKA 1ZTJA 8ESTE 1YPJH 2IOTA 4Y11E 3ZYEA 1ARBA 1VCPA 1QURH 1T4UH 2DE8A 1YPKH 5DP3A 1LVMA 3BEIB 5HM2A 2H9HA 1V2TT 1H1BA 1YPGH 4NIYA 2JDID 2YOLA 5HXFA 1M9UA 3ENSB 2BDAA 3AVZA 4X8VH 2VNTA 1KY9A 2Y5HA 1SC8U 3LIWA 4YT6H 1CGJE 1NS3A 2J4IA 1BTWA 1E0FD 3CENA 1WOFA 2WUBA 5DO4H 3MO3A 1DICA 2P8OB 2Z7FE 2OXSA 4HI3A 3UIRA 3EA7A 1XUIA 5GNDA 3PMBB 4TWWA 3TNTA 1BRUP 4ABHA 1L1NA 1O31A 4O03A 1C5XB 1GI4A 2J98B 1PFXC 4OGYA 3PLBA 1MH0A 5IYTA 2RFKC 1YPLH 1AFQB 2CK3D 3IWMA 2FPZA 2ZCLP 1BUIA 1H9LB 1YLNA 3MU1A 1O2JA 2LPRA 3GY2A 3SJ8A 1AMHA 1GI6A 5EOKA 1UCYK 4ZXXH 1C5NH 3I29A 3QO6A 1EOLA 2Y7ZA 2SGDE 2QXJA 3A87A 1BT7A 1C1VH 1YM0A 2ODQA 4FUIA 3IITA 1NFYA 1EKBB 2BLQA 3QN7A 4WH6A 2P3UB 2AERH 4IN1A 1ZMLA 1GHVH 1BIOA 2BHGA 4JK6A 1XUHA 3MU5A 3RM2H 2ZFSA 3A7VA 2ALVA 2XNDD 2OD3B 2ZHDA 1O3HA 2C4FH 1S82A 2FX6A 1SGDE 5DK1A 4RSPA 4JZDH 1TRNA 2QAAA 3M7UA 2GCHF 1C2FA 4BTIB 4DIHH 1W0ZU 4CBNA 3A81A 4P00A 2D26C 2BD5A 1C2KA 2QF4A 1O3EA 1GHWH 2EA3A 3R0FA 3GICB 2ZGCA 1W7GH 3TH2H 1XKAC 3ZZ5A 1LQDB 1TABE 1YKTA 1EAWA 3OAAD 3ITIA 3LKWA 4IMQA 4CREA 5AHGH 5C1XA 5FBIA 2ZDKA 1CSOE 2G4TA 4H6SB 1GI2A 3W1EA 3UB0A 4B75A 3GDUA 1SFQB 2F43B 2KCOA 1UTNA 1P03A 1V2WT 4BAHB 1W0JD 2HOBA 2IJOB 2XBVA 1GI0A 4DW2U 2CMYA 1W10U 1GJ9B 4FVBA 4MPWA 1C5SA 1S83A 3SNBA 4NCYA 1SGIB 4TPYA 2JIZD 1EZUC 2ODYB 1OOKB 1G9IE 1FDPA 2GD4B 4DT4A 2FTLE 1RTFB 2V7QD 3H09A 2Y5FA 1NFUA 2FOMB 2WPMS 4RT1A 1O36A 2TRMA 1GPZA 1P02A 1SLWB 4YLUA 6GCHG 2QGRA 2HLCA 3FP7E 1BZXE 1PPEE 4IC6A 1P9UA 3P8FA 3RXAA 1MBQA 1L4ZA 1KTSB 1MCTA 2BLVA 3KCGH 3M7TA 3S69A 3LGTA 3PLKA 1AIXH 1C5TA 4A92A 1UMAH 2C3SA 3M35A 1O2WA 1SLXB 4RKJB 4B2CA 2F9PA 3ZVGA 1T32A 3L3TA 1DWDH 1F2SE 2GZ8A 3B23B 1TGTA 3RMOH 1NT1A 3U1JB 1XXFA 2JETC 3PMJA 1Q3XA 3N99A 3M7QA 5E0GA 3SO3A 1QRWA 1D3TB 1YF4A 2B5TB 1GJ6A 3UUZA 4DCDA 3OSYA 2BLOA 1P01A 4YESB 4X6NA 5A0AE 3VPKA 4AN7A 1C2GA 1O34A 1TNJA 3MNSA 4NSYA 4GPGA 2BQ7B 4Q7XA 4ZKSU 1UK3A 4BTTB 3E0NB 1RGQA 2G5VA 1C4U2 3MFJA 1YGCH 3D62A 2JJ2D 1HNEE 2QCYA 4FUJA 4DVAU 1TNHA 2Q1JA 1O3OA 1DDJA 1YCPK 2F9UA 1E36B 2ZEBA 1QNJA 4CH2B 3KHVA 1AKSB 4Q80A 3MO9A 1CT0E 1EB2A 4UFDH 2CF9H 1FAXA 3M5NA 1ETSH 3URDA 2YMSC 1J17T 2F3CE 2ZPRA 4MNWA 2ZGJA 4NIVA 3SW2B 1O2RA 4F55A 1GI3A 1TBQH 2EI6A 1P10A 4TT3D 3R3GB 4FXGH 5DP4A 1CHOF 1P09A 2CN0H 1F7ZA 4I8KA 2BY6X 1C5VA 1TGSZ 1A0LA 4FOUC 5A8ZA 1GG6C 3NPSA 1F0TA 3AW0A 1DX5M 1QFKH 1EAIA 1O3DA 1QBNA 3TPIZ 1FONA 4XBCA 4JZFH 3SJKA 9LPRA 2UWLA 1W13U 1DY8A 3RXDA 4Z6AH 2OUAA 2STBE 3Q3XA 4ISLA 2XW9A 3H7OA 3GY4A 5GDSH 2JETB 3TITA 1TMBH 1Z8IB 4MDSA 1SI5H 4ZXYH 1BBRE 1ZRBA 2L74A 1RIWC 1SMFE 3OEHD 1LTOA 3F3BA 2PUQH 1OX1A 1V2UT 1AUJA 1GI8B 3M5LA 4CHAC 3M3VA 4IGDA 1W3CA 1FX0B 5LPFA 7KMEH 1GI5A 3U8TH 1C1WH 1UK2A 2F9OA 3ZZ7A 1MTSA 1XM1A 3BN9A 2CV3A 4KGAA 1AN1E 5ABWA 3RXJA 1TGCA 2B0FA 1DUEA 3TGKE 1OHHD 1A3EH 4FU8A 1AVGH 1O3IA 5EG4A 2BB4A 4ZAEA 1QIXB 5EW1H 3V7TA 4RN6A 4X8UH 2A2XH 1UTLM 7GCHF 3EYDA 3FKSD 1LHEH 1GBTA 3B9FH 3ATWA 3HKJB 1K21H 1T8OA 2W3KA 3QGNB 2VVCA 1VJAU 1AUTC 2SGPE 1BTUA 1P2JA 1GG6B 1O2UA 1GBBA 2FI5E 2UUYA 5C3NA 1GHAG 4WMFA 1BITA 1F5RA 2ZHQH 1NU9A 1UCYH 1GCDA 1H8ED 3LONA 1FN8A 4B6EA 4BAQB 2FYQA 1JBUH 5E0JA 1AE8H 3HGNA 1TA6A 3HK3B 1FY8E 2GDDA 3RMNH 3OYPA 3PRDA 3SU3A 2GTBA 3ZZ4A 3F2HA 1DITH 1K9OE 2QYIA 1IQNA 1HUTH 4FUFA 1H4WA 3VFEA 2VWMA 3SI3H 3RXMA 2M5TA 4GHTA 4H6TA 3LPRA 5J4SA 4SGAE 1L2EA 5CHAC 1C1NA 3SORA 1TBZH 2GZ9A 4AFQA 2Z9JA 4XE4A 3SZEA 3DSOA 2VGCC 1C2EA 1C1OA 4NA8A 1VZQH 1BMFD 4BAMB 1OKXA 2AH4X 4CHAB 5GPIB 3PRBA 2R2MB 1SGRE 1C1SA 1NFWA 3E90B 3VGCC 1P9SA 1Y3VA 1V3XA 2WPLS 4NWKA 5F53A 1TQ7B 1MAXA 3KYGA 2G4UA 1GVZA 1Y59T 1BBRK 3K65B 4P02A 4WMEA 2G55A 4AGKA 2J38A 3E91A 4A5TS 4CH8B 3SUFA 2AHME 5TJXA 3RMMH 4NFFA 5FCRA 1HXFH 1CO7E 5LH8A 1ZMNA 3MTYA 3ZVEA 3Q77A 3SHCH 1C1RA 4XDEA 5T6FA 3O8BA 1AD8H 5EXLA 4GVUA 5EQQA 1T31A 3T26A 1IQMA 1MTVA 1IQKA 3IG6B 3M3TA 4IS5A 3TU7H 2J2UA 3KQDA 4AOQA 3GY6A 1EJMA 2Y82A 3SOSA 3VB7A 3STJA 2B8OH 1S6LA 1VGCC 5FL7D 2AEIH 1PQAA 3CNRA 1BDAA 1C1QA 1O2LA 2ODPA 4XFQA 4B73A 5DKMA 1O2MA 4Q63A 3ZVDA 1JXPA 3OY6U 3D65E 3FAOA 4D9QA 2ZFFH 4FUBA 1PPZA 3SN8A 1GMHG 4MPVA 3Q3KA 3W94A 5F8TA 1FZZA 1QB1A 2XCNA 3MU8A 4LK4A 4ABGA 3KGPA 2PTNA 5CHAB 1INCA 1YLDA 3BEFB 1KDQB 1AWFH 1N8OC 1NM6A 5AF9H 2XRCA 2DE9A 1AGJA 3N7OA 5GCHF 3SJOA 2CJIA 2OQUA 3RMLH 2VGCB 1JOUB 4BAKB 4UD9H 1EFRD 3RXIA 4IMZA 1GJBB 5EJLA 1BMNH 2D8WA 4YOGA 2ZGHA 1L4DA 3VGCB 5JBAS 3A88A 1QZ8A 1PPCE 1FPCH 1FIZA 1A3BH 5CHBA 1NU7B 3ATKA 8KME2 1CVWH 4DG4A 4PROA 2Z94A 1ELVA 1GBKA 5LPEA 1W11U 2UUFB 2PGQB 2BYAX 5CE1A 3TJOA 1GBJA 1F0RA 2BTCE 3G01A 4ACBA 3O8RA 2K1QA 4NIWA 3A86A 5IDKA 1B5GH 4CRGA 4INKA 2A31A 1YCPH 4E7RG 3LH3A 3V3MA 1K28D 4ABBA 2BDBA 5GXPA 2A7HA 3K6ZA 7LPRA 1O5BB 1WQVH 3RC6A 1HJ9A 1UJ1A 4WJG2 2VB0A 3TIUA 3UQOA 1KIGH 1VGCB 3ODDA 4I33A 2PSYA 5FAHA 3F0OA 2GMTB 1GJCB 3I78A 3SNEA 4TSFD 1B0FA 4MNVA 3BTDE 1SPJA 3H7TA 1KLTA 1UTKA 1O33A 3OFND 3S7HB 1HFDA 1NY22 2AGGX 1GDNA 3Q3YA 1MZDA 1Y3WA 5B6LA 4B71A 1FV9A 2H1UA 5DP6A 1G3EA 1N8OB 3PV5A 5HIZA 1MKXH 3A83A 7ESTE 4Y0ZE 3BG4B 1FY4A 1TRYA 2YNAA 1HAIH 1WQSA 1IQFA 4ISIH 1EZQA 4B2AA 2BDIA 2NU1E 1E37B 1A4WH 1C2LA 3VEQB 1Z8JB 4JYUH 1C5ZB 1XUJA 1XXDA 1ELTA 3BTQE 3ZV9A 3SJ9A 4WWYA 1HIAB 1P57B 5L2YH 1XMNB 4I8LA 2P94A 3FN8A 5FX5A 1GDQA 1O2OA 4BXSA 1IHSH 4ASUD 4IBLH 2A5AA 4B6FA 3TK9A 5C2ZA 4X6OA 3ZZCA 1JMOH 1A1RA 4K69A 4AFZA 3UNQA 4WF8A 3UOPA 3RXRA 3SV6A 2PFEA 2FZZA 1O3MA 4YTAA 2ZFTA 1FAKH 2OTVA 3BF6H 3NZIA 4ISNA 2R9PA 1KXEA 1G32B 5FX6A 4O97A 1DSUA 1GBDA 1RD3B 3VB5A 3EE0B 1O2HA 2AMQA 1TPOA 2F4LA 4D9RA 1O3CA 4HZHA 1AVXA 4WVPE 2W7UA 2J92A 4Y0YE 5EJZA 2UWPA 4HG6A 3AK5A 2VJ1A 1DLKB 2XBXA 3A82A 2CGAA 1LHFH 5L30H 2PUXB 3PTBA 2XWBI 1O30A 4ZHMU 4K5ZA 1EJAA 2Y6TA 5EQRA 4A7IB 1NROH 3ZZ8A 1FY5A 3F68H 1W14U 1ZHMA 3T25A 5KGOA 3GCTF 5C0TA 5DSFA 1YC0A 1O2NA 3AW1A 3KQBA 2VVVA 1QCPA 1COWD 1GVLA 2J98A 3P17H 3PM3A 2FOCA 4I86A 3F2GA 1K1OA 3OE7D 1SHYA 1JRSA 4AB9A 1A61H 3ZZDA 1GJ7B 5IK2D 4KTCA 3DD2H 1AHTH 3SZNA 2Q6GA 1V2MT 1ID5H 4UFFH 1ZGVA 2GDEH 3UPEA 1VITF 4ZCNA 3KEEA 2BDHA 3CS0A 1AFEH 2OK5A 3MNXA 2UUJB 1G2LA 4ZROA 2VH6A 3K9XB 2FMJA 1HJAC 1PPHE 2ZG0H 1AWHB 1W2KH 2OBOA 2FOAA 1MUEB 1GHBG 3EA8A 1KLIH 2V6NA 3RXUA 4MG3A 2BOHB 2FTMA 4JCNA 3A7XA 1BMAA 4NA7A 1C5LH 4DIIH 1MU8B 1TLDA 4BNRA 4LZ1H 1XUGA 2QXIA 1S5SA 1SGQE 2HNTC 4X2YA 3I77A 3MHWU 2OBQA 1UHBA 1N1LA 1TPPA 2BMGB 1J15A 1EX3A 1G30B 1P05A 2GCHG 1MKWK 1W0YH 4GHQA 3SU5A 3FANA 1C5OH 1TPAE 4AFSA 4NFEA 2PP6A 5HGGA 3OEED 3A8DA 1OWKA 1SOTA 2G00A 2OINA 2AMPA 2R0LA 1LQEA 2NU3E 1ZTKA 1C1PA 3LC3A 3MH7A 4ZKOU 2V35A 2PKAB 1TMTH 1D3PB 1GJ4H 2ZECA 3CS7A 4NGAH 3QGJA 5G4BA 5T3HA 3LT3A 5J4QA 2GX4A 3SUGA 1JIRA 1H8HD 2EI7A 3V12A 5BRRE 5I46H 1Y5BT 1A5HA 1KXDA 1CT4E 1SOZA 1O3AA 2FESH 3A80A 1FJSA 3RP2A 1ZRKA 1Y5AT 2XBYA 1MD8A 1AE5A 1O2ZA 1QJ6B 1ANDA 3ZZ6A 2QY0B 1RXPA 4SGBE 1PJPA 1J9CH 3RXSA 4ZH8A 4X1QU 1V2PT 2WPHS 5DN6D 2OCVB 1C1UH 1AVWA 2R0KA 1HJAB 5C67A 4M7GA 1ABIH 6GCHF 3QK1A 5T6GA 3UREA 3SYJA 1E79D 4MLFB 3NRLA 2VWLA 2CXVA 4R8TB 3T62A 4Q7YA 4XBDA 2Q6DA 1VCQA 1F5KU 4Y79A 2C8ZB 1UK4A 2ESTE 4KP0A 3PTNA 5KEDA 2EY4C 1K1JA 1O3GA 3KIDU 3RDZA 2Z9LA 5HM9A 3GISB 5H4IB 1SQOA 2JJ1D 1V2NT 1MTWA 1IAUA 3TGJE 2ZCHP 4I8GA 5F03A 4E05H 1E1RD 4H42U 1IQLA 1SBWA 1JRTA 1UTPA 1SQAA 2FP7B 3QTOH 1S6FA 2UUKB 2VWOA 5E2OA 3SNAA 3EQ0H 3VB4A 1SSXA 4U32A 1TNIA 4A1VA 2QE7D 1K0HA 2QIQA 2A4QA 1ELEE 3PO1C 4AYVB 2WPIS 2NU2E 1NO9H 2ZHWH 1BTZA 3EAJA 1NRRH 4MNXA 3M3SA 4UFGH 3GCHC 1J8AA 3NK8A 1O2PA 4DURA 1Z1JA 1ZPBA 1AKSA 1FY1A 2ZDVH 1EASA 4ABDA 3RC5A 3TVJB 1QBOA 3GY7A 4X0WU 1E38B 4GSOA 3QZRA 1K22H 2PKSC 4B76A 4J2YB 3U8OH 2BVSH 3U69H 1NBME 2BXTH 1V2QT 2W6ID 2A4OA 3LJJA 3F2FA 1DY9A 4AG2A 1FLEE 3OU0A 1WUNH 1ZJKA 1GL0E 1NPMA 4RI0A 1G3BA 1CHOG 1HAOH 4AORA 3ATMA 4ACAA 1TNGA 2YNBA 1O2YA 1CGHA 1GJDB 1TX8A 4Z1MD 2FIRH 2J9NA 4AB8A 1BJUA 4INHA 2O8MA 2VH0A 4GUXA 3M5MA 4X1SU 1NRQH 3KL6A 5EODA 1GJ8B 4WH8A 1N6YA 3DFJA 2ZKSA 4F49A 3C1KA 3C27B 1DPOA 3SU2A 3DA9B 2GP9B 4FUHA 1GMDG 2JKHA 5BPEA 2V3HH 1G3DA 5GIBA 4Y6DA 2IPQX 4X2XA 1GGDC 3TJVA 2ZPQA 3UTUH 1GBLA 5C94A 4F48B 2IPHA 4JK5A 1DXWA 4Y76A 5JB8S 2ZDMA 4X6PA 2ZFQH 1AO5A 2FWWA 4DJZB 5TCCA 2TBSA 2QA9E
chains in the Genus database with same CATH topology
2JJ2D 2KFWA 2WV9A 2XCFA 3KEEA 3KF2A 4ZCNA 4K8BA 3PV2A 5ESBA 2F9UA 3SU0A 3KN2A 2J5UA 3SU4A 3P8OA 3L6PA 2OK5A 2XCNA 2HLDD 3KNXA 5H4IB 2JJ1D 2QF4A 3F0PA 3FO8D 3M5NA 3FN8A 2XNIA 1E1RD 2A4RA 2IJD1 2OBOA 2WPDD 1H8ED 3LONA 5FPSA 4ASUD 4B6EA 2YMSC 4B6FA 2FP7B 3OAAD 4NWLA 5HKKD 3LKWA 3WWBA 2KR7A 4F55A 2YMSB 3OYPA 3PRDA 3SU3A 1EFRD 4TT3D 2QE7D 2KCYA 4A1VA 3F2HA 3W1EA 2JDID 1A1RA 3N7DA 2A4QA 2YOLA 3OTPA 3UB0A 4B75A 3SV9A 2KCAA 4WF8A 2F43B 2KCOA 3SV6A 4XD7D 1KMHB 1W0JD 2QV1A 2IJOB 2L6OA 3O8DA 2OBQA 5CHBA 1N1LA 1NS3A 2W6JD 3DCLA 5CDFE 2F9VA 3FOAA 2JIZD 3SU5A 3O8CA 1MABB 3SZEA 2WZQA 3DSOA 2F4LA 2GGVB 2KCPA 3RC5A 4DT4A 3OEED 2V7QD 1BMFD 2A4GA 2M2AA 3H09A 3M5OA 5GNDA 1DY8A 2QF5A 2OC1A 3PRBA 5FPTA 2VBCA 5GPIB 2K1QA 2OINA 3O8RA 4B76A 2FOMB 3WW7A 3AK5A 5IDKA 1CU1A 5GJ4B 2GVFA 3E90B 1SKYE 5EPYA 2P59A 3LOXA 5F53A 1NBME 2KM0A 4NWKA 2W6ID 3F2FA 1DY9A 3RC4A 3SU6A 4A1XA 3OEHD 2CK3D 2XOKD 3SUGA 1RTLA 4I31A 4RI0A 1E1QD 1H8HD 2AHME 2FM2A 2WSSD 2KZ4A 3F3BA 3RC6A 4A1TA 5EQRA 5T1VA 3GS9A 3M5LA 4A92A 2OC0A 3ZIAD 1W3CA 2WHXA 1FX0B 3O8BA 4Z1MD 1DXPA 3SV8A 5C0TA 5DSFA 4I33A 2O8MA 3M5MA 3F0OA 5EQSA 1WXRA 1BT7A 4I32A 3U1JB 3N7EA 4WH8A 5EQQA 3P8NA 4TSFD 4OM9A 5FPYA 3N99A 4M9FA 3SU2A 2K0QA 3SV7A 4WH6A 1COWD 4JMYA 3VG8A 4TYDA 3DSPA 4Q4LA 3SUEA 3OFND 1OHHD 2OC7A 1NBMD 5DN6D 3F2GA 3OE7D 3SUDA 4U01A 3U1IB 2OC8A 3SUFA 5EPNA 4FETA 5B6LA 1S6LA 4B71A 5ETXA 1DXWA 3WWFA 5IK2D 5FL7D 2K8IA 5C0UA 2YMSD 3PV5A 4KTCA 2XNDD 5C17A 3SYJA 1E79D 3NRLA 4B73A 4B74A 3EYDA 4R8TB 1RGQA 3SU1A 4Q63A 4YXWD 2LELA 1JXPA 3FKSD 1W0KD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C0T A;  5DSF A;  3F2G A;  3F0O A;  3F2H A;  5C0U A;  5C17 A;  3F0P A;  3F2F A;  3FN8 A; 
#chains in the Genus database with same CATH topology
 1GBF A;  5HMA A;  2SNV A;  3NCL A;  2ZP0 H;  3PO1 B;  4CRA A;  1ACB E;  3TH3 H;  1WTG H;  2HLD D;  1QJ1 B;  1GBH A;  3F0P A;  5EW2 H;  3GCH B;  1MZA A;  4NZL A;  4I8H A;  1PYT D;  9EST A;  1W7X H;  1ZZZ A;  1XKB C;  4IN2 A;  1EXF A;  4X1P U;  4NSV A;  3ATL A;  3E8L A;  1SGT A;  4MVN A;  1E34 B;  2GKV E;  2IN2 A;  3NUM A;  4B2B A;  2A45 B;  1ABJ H;  2J34 A;  2YMS B;  2ZIQ H;  2A1D B;  1YYY 1;  1SGF A;  1CBW C;  1LO6 A;  3FZZ A;  2PKS B;  5KEC A;  5E2P A;  2G5N A;  4X6M A;  4XD7 D;  1P2Q A;  3GCN A;  4AZ2 B;  1V2O T;  1Z8R A;  1MTN C;  1SGP E;  5L6N H;  5GWZ A;  1HXE H;  7GCH G;  1SVP A;  1QGF A;  1ZHP A;  2WV5 A;  4FVD A;  1MTU A;  1LMW B;  4I7Y H;  1QL7 A;  1V2V T;  3RXL A;  2EEK A;  2OP9 A;  1N6X A;  1DUA A;  2VU8 E;  2H2Z A;  4ZUH A;  3JZ2 B;  4X2W A;  4MNY A;  5AFY H;  2V0B A;  2WPJ S;  2LP6 A;  3SNC A;  4UDW H;  1C2J A;  3TK5 A;  2C8W B;  1O32 A;  2ZO3 H;  2ZFP H;  1OSS A;  4BXW A;  1P2I A;  2ZTX A;  3SU6 A;  3MMG A;  3T29 A;  3FP8 E;  3FVF B;  5AFZ H;  2HGT H;  1O2I A;  4WXV A;  3SHA H;  1C2I A;  2FM2 A;  5EIY A;  1RIW B;  1GGD B;  5T1V A;  3ZVA A;  1IQG A;  3ELA H;  2WYG A;  3GDS A;  1V2S T;  2BY5 X;  5FPY A;  3TNS A;  1ZR0 A;  1AB9 C;  4M9F A;  1C1M A;  1EB1 H;  1BQY A;  3VXF H;  1FPH H;  4DY7 B;  5TCA A;  1WAY B;  3VG8 A;  2H5D A;  4TYD A;  4B1T A;  2J95 A;  1SL3 A;  1BTY A;  1ZYO A;  1O38 A;  1NRP H;  2BVR H;  3M37 A;  4FET A;  4NG9 H;  1SGF G;  2HWL B;  1KTT B;  5A0C A;  2FOD A;  3S7K B;  2BY7 X;  1O37 A;  1TWX B;  2TGA A;  4ABE A;  2PW8 H;  1LPG B;  3SV2 H;  5DP8 A;  4OS1 A;  2LEL A;  5CMX H;  1QQU A;  1LVO A;  1CBW B;  2W5E A;  3H5C B;  1Z7K A;  1EOJ A;  1ANB A;  3AAS A;  3MI4 A;  3SU4 A;  1GWA A;  2PHB A;  2A7C A;  3L6P A;  3GCO A;  4INL A;  1MTN B;  1PPB H;  3KYF A;  1EJN A;  4E06 H;  2RA3 A;  2C8X B;  4D7G A;  1D9I A;  1Z6E A;  1NZQ H;  2A2Q H;  1YPH E;  2XNI A;  2LNC A;  4GCH G;  1ZMJ A;  1MQ5 A;  5JB9 S;  4R0I A;  4NWL A;  5C5N A;  5HKK D;  1LVY A;  2KR7 A;  3T2N A;  8GCH F;  1KXB A;  1QL9 A;  4OS4 A;  3OTP A;  4HFP B;  4J1Y A;  4VGC C;  1TNK A;  5E8E H;  1A5I A;  1OP8 A;  1SGN E;  1D6R A;  1FUJ A;  3P95 A;  1QQ4 A;  4RKO B;  2QF3 A;  1GL1 A;  1O5A B;  3OY5 U;  3URC A;  1UTM A;  4Y8Z A;  1CA0 C;  2C8Y B;  1YCP M;  5DP5 A;  1XUK A;  1J16 A;  4JZ1 A;  5DP7 A;  1KDQ A;  3RM0 H;  2ZCK P;  1P06 A;  2TGT A;  4Z0K A;  4DT7 B;  1DWB H;  3PMA B;  2O8U A;  1TYN A;  4CR5 A;  4K1E A;  2FXR A;  2RA0 A;  3UWJ H;  5JBB S;  1WDI A;  2GVF A;  1SKY E;  1HAV B;  1LCY A;  2GCT C;  5C1Y A;  1QA0 A;  1AI8 H;  5A8Y A;  2AGE X;  1F0S A;  5GCH G;  1AB9 B;  2HAL A;  1TB6 H;  1P2M A;  2R2W U;  1DOJ A;  1EPT C;  1DLE A;  2ZGX H;  1D3D B;  3BTW E;  2KZ4 A;  1GI9 B;  1O5C B;  4KKD A;  1UVO A;  1DST A;  3GS9 A;  5LGO A;  2THF B;  3BSQ A;  1TON A;  5C20 A;  4X1N U;  2P95 A;  2OQ5 A;  5K7R A;  4ABJ A;  1GBC A;  2VIN A;  2BY9 X;  6CHA C;  1K1I A;  4DOQ A;  3M61 U;  1O2Q A;  1A46 H;  2STA E;  4NIX A;  3BTF E;  1D3Q B;  3DSP A;  4ISO A;  1O2S A;  2Y7X A;  1LVB A;  3LGW A;  4LXB H;  1ZOM A;  2W26 A;  3A85 A;  4I8J A;  3RXO A;  1OP2 A;  1W0K D;  3OX7 U;  4KEL A;  1O3J A;  3KF2 A;  3ZZ3 A;  3PV2 A;  5ESB A;  2FOE A;  2GJG A;  2FOH A;  2GV7 A;  2VVU A;  4VGC B;  3RXP A;  1P04 A;  1TGN A;  1O2K A;  4K8Y A;  1HV7 A;  4Y8Y A;  3TH4 H;  2G81 E;  2F83 A;  3UY9 A;  3PRO A;  4K1S A;  1L0Z A;  2O9Q A;  2RG3 A;  1C5M D;  1O2G H;  2W3I A;  4Y10 E;  1EAX A;  4UEH H;  1XX9 A;  2PV9 B;  1BA8 B;  3N7D A;  2HVX A;  1TGB A;  1GMC F;  1XVO A;  2H5C A;  2G51 A;  8LPR A;  2GCT B;  3A7Y A;  1IQE A;  1HYL A;  3VXE H;  5EGM A;  1A5G H;  2BD4 A;  1LPK B;  4YOJ A;  1NRS H;  5JBC S;  2HPQ H;  2W6J D;  3RLY H;  1EPT B;  1OWI A;  2XC4 A;  1AU8 A;  1PYT C;  1ZPZ A;  1K1M A;  2F9V A;  2ZF0 H;  2WZQ A;  1IOE A;  5HYO A;  3QUM P;  3RU4 E;  5F6M A;  1TMU H;  2A4G A;  1SQT A;  2HNT E;  1CE5 A;  1ESB A;  3V0X A;  4WY3 A;  3MH6 A;  1HAP H;  3MU0 A;  6CHA B;  2ZU2 A;  2KM0 A;  3D49 H;  3HGP A;  2H6M A;  1HAZ B;  3KQ5 A;  4BTU B;  2KAI B;  1H8D H;  3F9F A;  2ZC9 H;  2C93 B;  5EXM A;  3Q76 A;  3BTK E;  1FMG A;  1BMM H;  1CQQ A;  1YBW A;  5LPR A;  3V13 A;  2XWA A;  1HRT H;  4Q7Z A;  1P2K A;  4AGJ A;  4NZQ A;  1QB6 A;  1SFI A;  2ZHF H;  1THS H;  4JZE H;  1GBA A;  1C2H A;  3NWU A;  1TFX A;  1EP6 A;  1SQR A;  3NXP A;  2VIW A;  2ZDL A;  2O8T A;  3AAU A;  3CP7 A;  3W95 A;  3U1I B;  2FEQ H;  1PQ7 A;  1O3B A;  5EPN A;  1IQI A;  3PV4 A;  1AZ8 A;  3QLP H;  3LGV A;  3MNC A;  3WWF A;  1V2L T;  3UFA A;  1OYT H;  5FBE A;  4JZI A;  5C17 A;  3ZZB A;  2BVX H;  1C5P A;  4LZ4 B;  1C2M A;  1SLV B;  1Y3Y A;  1ZTL A;  3PWB A;  1KLJ H;  3MQK C;  2KFW A;  3F9G A;  3S9C A;  4OS6 A;  1S0R A;  2AMD A;  1F5L A;  3P8O A;  3GCT G;  1YWU A;  2NU4 E;  2VWN A;  1U6Q A;  1WTH D;  3ZYD A;  3RXT A;  1C5Q A;  2WPD D;  1RS0 A;  5FPS A;  2AGI X;  4CRC A;  1IQJ A;  2GZ7 A;  1RTK A;  3DHK H;  1SLU B;  1TRM A;  2B9L A;  4FUD A;  1LHD H;  6LPR A;  2ZU3 A;  3NKK A;  3MO6 A;  1B7X B;  5DGJ A;  1VJ9 U;  3STI A;  2BDY A;  2D1J A;  1C9P A;  1Z1I A;  2ZGB H;  2ZU4 A;  1E35 B;  2Z3D A;  1DE7 H;  4CRF A;  1BBR H;  4ISH H;  1O39 A;  1NC6 A;  2BD7 A;  2SFA A;  4CRD A;  3UNS A;  1HGT H;  1VIT G;  4ASH A;  1A2C H;  4CBO A;  1W8B H;  4Y8X A;  2PLX A;  2P3T B;  3GY5 A;  2KCP A;  2ZTY A;  1CT2 E;  1PPG E;  1Z6J H;  1Y3U A;  2FS8 A;  1DFP A;  2VBC A;  1S85 A;  3LGY A;  1ZSL A;  1ZSK A;  3RXC A;  4X2V A;  3QTV H;  2P59 A;  4BAO B;  1TAW A;  1GHB F;  1W12 U;  2VIP A;  1OWH A;  1TNL A;  1ELA A;  3RXK A;  2P16 A;  1AZZ A;  1TPS A;  4H4F A;  1O5F H;  1TE0 A;  1C2D A;  1A0H B;  1EAU A;  2PGB B;  4X8T H;  1FQ3 A;  1Q2W A;  3EDX B;  1TOM H;  5L2Z H;  1BOQ A;  1P3C A;  3QX5 H;  1DXP A;  5EU8 A;  4FUE A;  4I32 A;  1HB0 B;  3A89 A;  2W7S A;  4OM9 A;  1UHB B;  2BDG A;  3ZVB A;  3AAV A;  5EST E;  3FFG A;  5DPA A;  1HLT H;  5E0H A;  2FI4 E;  2F91 A;  1O3L A;  1UVP A;  1GBE A;  1NBM D;  2PKA A;  1UTQ A;  3EGK H;  1DS2 E;  2ALP A;  2AFQ B;  2BZ6 H;  5ETX A;  1V2R T;  3B8J A;  3PWC A;  1HAX B;  3VB3 A;  3S9A A;  1ZSJ A;  2ZDN A;  1GI7 B;  4K8B A;  1XVM A;  3T5F H;  5JBT A;  2FOG A;  3ATI A;  2SGA A;  1MD7 A;  1EP5 A;  2BQW B;  2R3U A;  3KNX A;  1DAN H;  1T8L A;  3BTT E;  3GYL B;  1EUF A;  3SGB E;  1NES E;  1F92 A;  4UFE H;  1QJ7 B;  1ARC A;  4X1R U;  5A8X A;  1C9T A;  1H9I E;  4XBB A;  1K2I 1;  2WYJ A;  2ZPS A;  4RT0 A;  5FCK A;  1BML A;  3RXG A;  1GVK B;  1KMH B;  2WUC A;  1VIT H;  3SQH E;  2ULL A;  2AYW A;  2Z3C A;  5CDF E;  3FOA A;  4BAN B;  1S0Q A;  1OS8 A;  2A0Q B;  1MAB B;  3JZ1 B;  3UR9 A;  3M36 A;  3UWI A;  3P92 A;  2WIN I;  1JWT A;  1CGI E;  2Y80 A;  4AC9 A;  4F4O C;  1DM4 B;  1KXC A;  2SNW A;  3LU9 B;  4MTB A;  3TGI E;  2BQ6 B;  4BOH A;  1HPG A;  4IC5 A;  3RUO A;  1A7S A;  1GHY H;  4MQA A;  1GJA B;  1MCV A;  1OP0 A;  2BD8 A;  1EST A;  1JIM A;  1EZS C;  2ANM H;  1YPM H;  1NFX A;  1S6H A;  3WY8 A;  1TQ0 B;  1MU6 B;  1UVS H;  3T27 A;  4XSK U;  1B0E A;  1WYK A;  1GI1 A;  1X7A C;  2P93 A;  3RXE A;  1DVA H;  1VR1 H;  2ZZU H;  3E1X B;  1TOC B;  3P8N A;  2ZQ2 A;  3RU4 T;  2ZU5 A;  2G8T A;  4JMY A;  1IHT H;  1UVT H;  4FUG A;  3SUE A;  2HRV A;  3MU4 A;  1WSS H;  1OWE A;  1HJ8 A;  5JYI A;  2Z6B D;  2FO9 A;  4A6L A;  2PR3 A;  3TJN A;  3SGQ E;  1EQ9 A;  3HK6 B;  1ZPC A;  2K8I A;  3E3T A;  5C1U A;  2HNT F;  1YLC A;  3LJO A;  2O8W A;  3UR6 A;  1BRB E;  4B74 A;  2Z9K A;  1O5D H;  2KX4 A;  1T4V H;  1T8N A;  4Q2K A;  4FU7 A;  1QB9 A;  1C5R A;  3F9H A;  1IQH A;  2CHA C;  1SHH B;  4LOY H;  1GHZ A;  2WV4 A;  1GMD F;  1EAT A;  1MKX K;  3RXH A;  3PMH B;  3SI4 H;  4HGC A;  1SB1 H;  1KXA A;  1Y5U T;  3LC5 A;  1FY3 A;  4AYY B;  2NU0 E;  1ZJD A;  4FUC A;  1PQ8 A;  2XTT B;  3DUX H;  4TY6 A;  1FNI A;  2TPI Z;  3DSG A;  4ABI A;  2QV1 A;  1PPF E;  3U8R H;  1PQ5 A;  1LPZ B;  1QBV H;  2GT7 A;  1EZX C;  3E16 B;  3K6Y A;  5DP9 A;  1P8V C;  1TX7 A;  2FLB H;  1BCU H;  3DFL A;  4O3U A;  1MMJ N;  4MPU A;  3O8C A;  4Y7B A;  1QA7 A;  1WU1 A;  2A5K A;  1DWC H;  4AX9 H;  2HPP H;  1FI8 A;  1HAY B;  1YP9 A;  3RXF A;  3F1S B;  2AS9 A;  1NTP A;  1O2T A;  2QF5 A;  1AY6 H;  4O9V A;  5FPT A;  2F9B H;  3ZVF A;  4TPI Z;  1P2O A;  3F6U H;  5PTP A;  1CU1 A;  4FU9 A;  1QHR B;  5EJ1 A;  5EPY A;  3SJI A;  4EST E;  2BX4 A;  3LOX A;  3SQE E;  2B7D H;  4KTS A;  1A0J A;  3RC4 A;  1UW7 A;  3A7W A;  3GYM A;  3FP6 E;  1UTJ A;  3RXQ A;  2QXG A;  5DJ7 A;  2XOK D;  3LGU A;  3PB1 E;  3T28 A;  1GHX H;  1T7C A;  1E1Q D;  2Q6F A;  3S9B A;  1G2M A;  4O3T A;  4YM9 A;  1TA2 A;  1KXF A;  1O35 A;  1S81 A;  1ORF A;  1V6D A;  2D2D A;  3SV8 A;  1C4Y 2;  2QN5 T;  1WXR A;  2ANW A;  1GHA F;  4OGX A;  4WMD A;  4YO9 A;  1O5G H;  2ZWL H;  1VKY A;  3ZZA A;  2R3Y A;  2ANY A;  3LGI A;  4KTU A;  4Q4L A;  2ZDA H;  4XOJ A;  4Y7A A;  2J94 A;  2OC7 A;  4U01 A;  3GOV B;  1C5Y B;  2A32 A;  1UVU H;  1O5E H;  2OC8 A;  2TGP Z;  5JPM H;  3EA9 A;  1TIO A;  1O2X A;  2VID A;  2CHA B;  1ANC A;  3RXV A;  4OS2 A;  3E6P H;  2ZI2 H;  1J14 A;  1G36 A;  1P11 E;  1D6W A;  2QC2 A;  2QXH A;  4JYV H;  1HCG A;  2CF8 H;  3SU1 A;  4YXW D;  1C5W B;  2ZHE H;  2BD9 A;  4D76 A;  1HAH H;  2O8L A;  1SG8 B;  1OYQ A;  1ZHR A;  3SU0 A;  3BTE E;  2UWO A;  1ANE A;  4YOI A;  2ANK H;  1WBG B;  3MH5 A;  2SGE E;  1MKW H;  1THP B;  1C1T A;  1CHG A;  3LH1 A;  2IJD 1;  1P3E A;  1V2K T;  3UOU A;  4YT7 H;  3ZZ9 A;  3PLP A;  5I25 A;  1NRN H;  1ELD E;  3MYW A;  5DG6 A;  3SV9 A;  1BRA A;  2KCA A;  4K2Y A;  3S0N A;  1V2J T;  1QTF A;  1BB0 B;  2L6O A;  2V3O H;  3UQV A;  1QL8 A;  3KQE A;  2Y5G A;  1TX6 A;  4ZHA A;  5T6D A;  2XC5 A;  4AFU A;  1UO6 A;  2GV6 A;  2BM2 A;  2ZA5 A;  1DT2 A;  3BTG E;  4HTC H;  4DGJ A;  1ETT H;  2JH6 D;  1MAY A;  3ZVC A;  1O3N A;  3BEU A;  1HDT H;  1DWE H;  1WCZ A;  4E7N A;  5EXN A;  4GLY A;  2M2A A;  3MNB A;  2AIP A;  3M5O A;  3BTM E;  2OC1 A;  2H9T H;  3F9E A;  1P12 E;  2FOB A;  2P3F H;  2ZQ1 A;  2SGQ E;  3SBK A;  5JDU B;  1Y8T A;  4GCH F;  2BOK A;  3MH4 A;  3L33 A;  1G3C A;  2HVY B;  3K2U A;  4A1X A;  1H8I H;  8GCH G;  3RXB A;  1Y3X A;  3BTH E;  3SGA E;  3OTJ E;  4D8N A;  4A1T A;  2FLR H;  2WSS D;  2TGD A;  4MPX A;  1RFN A;  3BIV H;  1GMH F;  2OC0 A;  4GAW A;  2WHX A;  2C90 B;  3LDX H;  4WXI A;  3ZIA D;  2GMT C;  3EE7 A;  1FN6 A;  5EQS A;  3A8C A;  5FHT A;  3RU4 D;  1QY6 A;  1ZLR A;  3RLW H;  3UNR A;  1ESA A;  4THN H;  5C5O A;  3P8G A;  3SV7 A;  2EI8 A;  3HPT B;  1HAV A;  1FXY A;  1YPE H;  1SGY E;  2ZFR H;  2BDC A;  2FS9 A;  1K1N A;  1QR3 E;  1O0D H;  1QRZ A;  2PSX A;  5A2M H;  2VIQ A;  2BXU H;  3BG4 C;  3BIU H;  1TAL A;  2EC9 H;  2BX3 A;  2BZA A;  3QDZ B;  3MWI U;  1GBM A;  1XUF A;  1LHC H;  1KSN A;  1QRX A;  2FOF A;  2J97 A;  2ZU1 A;  4K3J A;  4Y71 A;  2WV9 A;  2A5I A;  2RDE A;  1K1P A;  1OXG A;  3A84 A;  1HBT H;  3GY3 A;  3KN2 A;  2DUC A;  2J5U A;  2JH5 D;  1BRC E;  4ABF A;  5A0B A;  4TWY A;  1GBI A;  3TLO A;  1BTP A;  1CA8 B;  1G37 A;  3MOC A;  3U9A H;  3E0P B;  3FO8 D;  2A4R A;  2NWN A;  1AQ7 A;  1OWD A;  1ETR H;  1ELB A;  2Z3E A;  1O3P B;  4UON A;  2ILN A;  1ELF A;  2VIO A;  4U2W A;  2I6S A;  3WWB A;  1F0U A;  3A7T A;  4K1T A;  2KCY A;  3VB6 A;  1SGE E;  1MQ6 A;  1THR H;  3A8B A;  2RDL A;  3O8D A;  4XRN A;  2BD3 A;  1T8M A;  1VCW A;  2JH0 D;  3TJU A;  3DCL A;  1GCT C;  1OPH B;  2H9E H;  2ASU B;  4CR9 A;  3ODF A;  2G52 A;  2GGV B;  6EST A;  1CA0 B;  2Z9I A;  1KYN A;  1C4V 2;  3KQC A;  4YLQ H;  3WW7 A;  2XYA A;  3D23 A;  3PYH A;  5GJ4 B;  2Z9G A;  4CRB A;  1L1J A;  1BHX B;  1P2N A;  2ZTZ A;  1MBM A;  3EST A;  1LDT T;  3P70 B;  1C5U A;  1BJV A;  1LKB A;  4NA9 H;  4ZHL U;  5HIY A;  3U98 H;  4AG1 A;  3ZV8 A;  2OLG A;  1TBR H;  1RTL A;  4I31 A;  2P8O C;  2QF0 A;  3BV9 B;  1O2V A;  3GDV A;  1K1L A;  1FIW A;  1GMC G;  2FI3 E;  3BG8 A;  1HIA A;  4OS7 A;  4ZMA H;  5AVD A;  2BY8 X;  2BLW A;  1UCY E;  1EPT A;  1YPH C;  2AIQ A;  2GT8 A;  3U28 C;  3UAI C;  3HAT H;  3N7E A;  1RJX B;  1GDU A;  2I6Q A;  2XC0 A;  1LKA A;  4U30 A;  1BTX A;  2K0Q A;  3GY8 A;  3FZD A;  5B6O A;  1OWJ A;  5SGA E;  2A7J A;  1AFQ C;  4TY7 A;  1O3F A;  1Q31 A;  3A8A A;  3SUD A;  3SND A;  1GJ5 H;  2KAI A;  2VIV A;  2WPK S;  5F8Z A;  1ELG A;  3HKI B;  1P0S H;  3QZQ A;  5C0U A;  1L1G A;  2YMS D;  2V3M A;  2TIO A;  4ZKN U;  1Z8G A;  1LHG H;  4D7F A;  2XXL A;  3P6Z B;  1WV7 H;  3TK6 A;  5F8X A;  1BTH H;  3QWC H;  3DT0 H;  1UTO A;  1H9H E;  3Q00 A;  2XCF A;  4JYT A;  1SGC A;  1NN6 A;  2BD2 A;  4IW4 E;  2Y81 A;  3A7Z A;  1Z71 A;  4ZKR U;  1ELC A;  1O3K A;  2RCE A;  2F9N A;  2FX4 A;  2FYR A;  4QT8 C;  1S84 A;  2XBW A;  4ABA A;  2PTC E;  2FDA A;  1HAG E;  5K0H A;  2SGF E;  2ZNK H;  4K60 A;  1BHX F;  1ZGI A;  2PWX A;  1SR5 C;  5A09 A;  4YZU A;  1YY3 A;  4UE7 H;  5FXL A;  2EQN A;  4OS5 A;  1D4P B;  1GCT B;  4X8S H;  1RRK A;  1ZTJ A;  8EST E;  1YPJ H;  2IOT A;  4Y11 E;  3ZYE A;  1ARB A;  1VCP A;  1QUR H;  1T4U H;  2DE8 A;  1YPK H;  5DP3 A;  1LVM A;  3BEI B;  5HM2 A;  2H9H A;  1V2T T;  1H1B A;  1YPG H;  4NIY A;  2JDI D;  2YOL A;  5HXF A;  1M9U A;  3ENS B;  2BDA A;  3AVZ A;  4X8V H;  2VNT A;  1KY9 A;  2Y5H A;  1SC8 U;  3LIW A;  4YT6 H;  1CGJ E;  1NS3 A;  2J4I A;  1BTW A;  1E0F D;  3CEN A;  1WOF A;  2WUB A;  5DO4 H;  3MO3 A;  1DIC A;  2P8O B;  2Z7F E;  2OXS A;  4HI3 A;  3UIR A;  3EA7 A;  1XUI A;  5GND A;  3PMB B;  4TWW A;  3TNT A;  1BRU P;  4ABH A;  1L1N A;  1O31 A;  4O03 A;  1C5X B;  1GI4 A;  2J98 B;  1PFX C;  4OGY A;  3PLB A;  1MH0 A;  5IYT A;  2RFK C;  1YPL H;  1AFQ B;  2CK3 D;  3IWM A;  2FPZ A;  2ZCL P;  1BUI A;  1H9L B;  1YLN A;  3MU1 A;  1O2J A;  2LPR A;  3GY2 A;  3SJ8 A;  1AMH A;  1GI6 A;  5EOK A;  1UCY K;  4ZXX H;  1C5N H;  3I29 A;  3QO6 A;  1EOL A;  2Y7Z A;  2SGD E;  2QXJ A;  3A87 A;  1BT7 A;  1C1V H;  1YM0 A;  2ODQ A;  4FUI A;  3IIT A;  1NFY A;  1EKB B;  2BLQ A;  3QN7 A;  4WH6 A;  2P3U B;  2AER H;  4IN1 A;  1ZML A;  1GHV H;  1BIO A;  2BHG A;  4JK6 A;  1XUH A;  3MU5 A;  3RM2 H;  2ZFS A;  3A7V A;  2ALV A;  2XND D;  2OD3 B;  2ZHD A;  1O3H A;  2C4F H;  1S82 A;  2FX6 A;  1SGD E;  5DK1 A;  4RSP A;  4JZD H;  1TRN A;  2QAA A;  3M7U A;  2GCH F;  1C2F A;  4BTI B;  4DIH H;  1W0Z U;  4CBN A;  3A81 A;  4P00 A;  2D26 C;  2BD5 A;  1C2K A;  2QF4 A;  1O3E A;  1GHW H;  2EA3 A;  3R0F A;  3GIC B;  2ZGC A;  1W7G H;  3TH2 H;  1XKA C;  3ZZ5 A;  1LQD B;  1TAB E;  1YKT A;  1EAW A;  3OAA D;  3ITI A;  3LKW A;  4IMQ A;  4CRE A;  5AHG H;  5C1X A;  5FBI A;  2ZDK A;  1CSO E;  2G4T A;  4H6S B;  1GI2 A;  3W1E A;  3UB0 A;  4B75 A;  3GDU A;  1SFQ B;  2F43 B;  2KCO A;  1UTN A;  1P03 A;  1V2W T;  4BAH B;  1W0J D;  2HOB A;  2IJO B;  2XBV A;  1GI0 A;  4DW2 U;  2CMY A;  1W10 U;  1GJ9 B;  4FVB A;  4MPW A;  1C5S A;  1S83 A;  3SNB A;  4NCY A;  1SGI B;  4TPY A;  2JIZ D;  1EZU C;  2ODY B;  1OOK B;  1G9I E;  1FDP A;  2GD4 B;  4DT4 A;  2FTL E;  1RTF B;  2V7Q D;  3H09 A;  2Y5F A;  1NFU A;  2FOM B;  2WPM S;  4RT1 A;  1O36 A;  2TRM A;  1GPZ A;  1P02 A;  1SLW B;  4YLU A;  6GCH G;  2QGR A;  2HLC A;  3FP7 E;  1BZX E;  1PPE E;  4IC6 A;  1P9U A;  3P8F A;  3RXA A;  1MBQ A;  1L4Z A;  1KTS B;  1MCT A;  2BLV A;  3KCG H;  3M7T A;  3S69 A;  3LGT A;  3PLK A;  1AIX H;  1C5T A;  4A92 A;  1UMA H;  2C3S A;  3M35 A;  1O2W A;  1SLX B;  4RKJ B;  4B2C A;  2F9P A;  3ZVG A;  1T32 A;  3L3T A;  1DWD H;  1F2S E;  2GZ8 A;  3B23 B;  1TGT A;  3RMO H;  1NT1 A;  3U1J B;  1XXF A;  2JET C;  3PMJ A;  1Q3X A;  3N99 A;  3M7Q A;  5E0G A;  3SO3 A;  1QRW A;  1D3T B;  1YF4 A;  2B5T B;  1GJ6 A;  3UUZ A;  4DCD A;  3OSY A;  2BLO A;  1P01 A;  4YES B;  4X6N A;  5A0A E;  3VPK A;  4AN7 A;  1C2G A;  1O34 A;  1TNJ A;  3MNS A;  4NSY A;  4GPG A;  2BQ7 B;  4Q7X A;  4ZKS U;  1UK3 A;  4BTT B;  3E0N B;  1RGQ A;  2G5V A;  1C4U 2;  3MFJ A;  1YGC H;  3D62 A;  2JJ2 D;  1HNE E;  2QCY A;  4FUJ A;  4DVA U;  1TNH A;  2Q1J A;  1O3O A;  1DDJ A;  1YCP K;  2F9U A;  1E36 B;  2ZEB A;  1QNJ A;  4CH2 B;  3KHV A;  1AKS B;  4Q80 A;  3MO9 A;  1CT0 E;  1EB2 A;  4UFD H;  2CF9 H;  1FAX A;  3M5N A;  1ETS H;  3URD A;  2YMS C;  1J17 T;  2F3C E;  2ZPR A;  4MNW A;  2ZGJ A;  4NIV A;  3SW2 B;  1O2R A;  4F55 A;  1GI3 A;  1TBQ H;  2EI6 A;  1P10 A;  4TT3 D;  3R3G B;  4FXG H;  5DP4 A;  1CHO F;  1P09 A;  2CN0 H;  1F7Z A;  4I8K A;  2BY6 X;  1C5V A;  1TGS Z;  1A0L A;  4FOU C;  5A8Z A;  1GG6 C;  3NPS A;  1F0T A;  3AW0 A;  1DX5 M;  1QFK H;  1EAI A;  1O3D A;  1QBN A;  3TPI Z;  1FON A;  4XBC A;  4JZF H;  3SJK A;  9LPR A;  2UWL A;  1W13 U;  1DY8 A;  3RXD A;  4Z6A H;  2OUA A;  2STB E;  3Q3X A;  4ISL A;  2XW9 A;  3H7O A;  3GY4 A;  5GDS H;  2JET B;  3TIT A;  1TMB H;  1Z8I B;  4MDS A;  1SI5 H;  4ZXY H;  1BBR E;  1ZRB A;  2L74 A;  1RIW C;  1SMF E;  3OEH D;  1LTO A;  3F3B A;  2PUQ H;  1OX1 A;  1V2U T;  1AUJ A;  1GI8 B;  3M5L A;  4CHA C;  3M3V A;  4IGD A;  1W3C A;  1FX0 B;  5LPF A;  7KME H;  1GI5 A;  3U8T H;  1C1W H;  1UK2 A;  2F9O A;  3ZZ7 A;  1MTS A;  1XM1 A;  3BN9 A;  2CV3 A;  4KGA A;  1AN1 E;  5ABW A;  3RXJ A;  1TGC A;  2B0F A;  1DUE A;  3TGK E;  1OHH D;  1A3E H;  4FU8 A;  1AVG H;  1O3I A;  5EG4 A;  2BB4 A;  4ZAE A;  1QIX B;  5EW1 H;  3V7T A;  4RN6 A;  4X8U H;  2A2X H;  1UTL M;  7GCH F;  3EYD A;  3FKS D;  1LHE H;  1GBT A;  3B9F H;  3ATW A;  3HKJ B;  1K21 H;  1T8O A;  2W3K A;  3QGN B;  2VVC A;  1VJA U;  1AUT C;  2SGP E;  1BTU A;  1P2J A;  1GG6 B;  1O2U A;  1GBB A;  2FI5 E;  2UUY A;  5C3N A;  1GHA G;  4WMF A;  1BIT A;  1F5R A;  2ZHQ H;  1NU9 A;  1UCY H;  1GCD A;  1H8E D;  3LON A;  1FN8 A;  4B6E A;  4BAQ B;  2FYQ A;  1JBU H;  5E0J A;  1AE8 H;  3HGN A;  1TA6 A;  3HK3 B;  1FY8 E;  2GDD A;  3RMN H;  3OYP A;  3PRD A;  3SU3 A;  2GTB A;  3ZZ4 A;  3F2H A;  1DIT H;  1K9O E;  2QYI A;  1IQN A;  1HUT H;  4FUF A;  1H4W A;  3VFE A;  2VWM A;  3SI3 H;  3RXM A;  2M5T A;  4GHT A;  4H6T A;  3LPR A;  5J4S A;  4SGA E;  1L2E A;  5CHA C;  1C1N A;  3SOR A;  1TBZ H;  2GZ9 A;  4AFQ A;  2Z9J A;  4XE4 A;  3SZE A;  3DSO A;  2VGC C;  1C2E A;  1C1O A;  4NA8 A;  1VZQ H;  1BMF D;  4BAM B;  1OKX A;  2AH4 X;  4CHA B;  5GPI B;  3PRB A;  2R2M B;  1SGR E;  1C1S A;  1NFW A;  3E90 B;  3VGC C;  1P9S A;  1Y3V A;  1V3X A;  2WPL S;  4NWK A;  5F53 A;  1TQ7 B;  1MAX A;  3KYG A;  2G4U A;  1GVZ A;  1Y59 T;  1BBR K;  3K65 B;  4P02 A;  4WME A;  2G55 A;  4AGK A;  2J38 A;  3E91 A;  4A5T S;  4CH8 B;  3SUF A;  2AHM E;  5TJX A;  3RMM H;  4NFF A;  5FCR A;  1HXF H;  1CO7 E;  5LH8 A;  1ZMN A;  3MTY A;  3ZVE A;  3Q77 A;  3SHC H;  1C1R A;  4XDE A;  5T6F A;  3O8B A;  1AD8 H;  5EXL A;  4GVU A;  5EQQ A;  1T31 A;  3T26 A;  1IQM A;  1MTV A;  1IQK A;  3IG6 B;  3M3T A;  4IS5 A;  3TU7 H;  2J2U A;  3KQD A;  4AOQ A;  3GY6 A;  1EJM A;  2Y82 A;  3SOS A;  3VB7 A;  3STJ A;  2B8O H;  1S6L A;  1VGC C;  5FL7 D;  2AEI H;  1PQA A;  3CNR A;  1BDA A;  1C1Q A;  1O2L A;  2ODP A;  4XFQ A;  4B73 A;  5DKM A;  1O2M A;  4Q63 A;  3ZVD A;  1JXP A;  3OY6 U;  3D65 E;  3FAO A;  4D9Q A;  2ZFF H;  4FUB A;  1PPZ A;  3SN8 A;  1GMH G;  4MPV A;  3Q3K A;  3W94 A;  5F8T A;  1FZZ A;  1QB1 A;  2XCN A;  3MU8 A;  4LK4 A;  4ABG A;  3KGP A;  2PTN A;  5CHA B;  1INC A;  1YLD A;  3BEF B;  1KDQ B;  1AWF H;  1N8O C;  1NM6 A;  5AF9 H;  2XRC A;  2DE9 A;  1AGJ A;  3N7O A;  5GCH F;  3SJO A;  2CJI A;  2OQU A;  3RML H;  2VGC B;  1JOU B;  4BAK B;  4UD9 H;  1EFR D;  3RXI A;  4IMZ A;  1GJB B;  5EJL A;  1BMN H;  2D8W A;  4YOG A;  2ZGH A;  1L4D A;  3VGC B;  5JBA S;  3A88 A;  1QZ8 A;  1PPC E;  1FPC H;  1FIZ A;  1A3B H;  5CHB A;  1NU7 B;  3ATK A;  8KME 2;  1CVW H;  4DG4 A;  4PRO A;  2Z94 A;  1ELV A;  1GBK A;  5LPE A;  1W11 U;  2UUF B;  2PGQ B;  2BYA X;  5CE1 A;  3TJO A;  1GBJ A;  1F0R A;  2BTC E;  3G01 A;  4ACB A;  3O8R A;  2K1Q A;  4NIW A;  3A86 A;  5IDK A;  1B5G H;  4CRG A;  4INK A;  2A31 A;  1YCP H;  4E7R G;  3LH3 A;  3V3M A;  1K28 D;  4ABB A;  2BDB A;  5GXP A;  2A7H A;  3K6Z A;  7LPR A;  1O5B B;  1WQV H;  3RC6 A;  1HJ9 A;  1UJ1 A;  4WJG 2;  2VB0 A;  3TIU A;  3UQO A;  1KIG H;  1VGC B;  3ODD A;  4I33 A;  2PSY A;  5FAH A;  3F0O A;  2GMT B;  1GJC B;  3I78 A;  3SNE A;  4TSF D;  1B0F A;  4MNV A;  3BTD E;  1SPJ A;  3H7T A;  1KLT A;  1UTK A;  1O33 A;  3OFN D;  3S7H B;  1HFD A;  1NY2 2;  2AGG X;  1GDN A;  3Q3Y A;  1MZD A;  1Y3W A;  5B6L A;  4B71 A;  1FV9 A;  2H1U A;  5DP6 A;  1G3E A;  1N8O B;  3PV5 A;  5HIZ A;  1MKX H;  3A83 A;  7EST E;  4Y0Z E;  3BG4 B;  1FY4 A;  1TRY A;  2YNA A;  1HAI H;  1WQS A;  1IQF A;  4ISI H;  1EZQ A;  4B2A A;  2BDI A;  2NU1 E;  1E37 B;  1A4W H;  1C2L A;  3VEQ B;  1Z8J B;  4JYU H;  1C5Z B;  1XUJ A;  1XXD A;  1ELT A;  3BTQ E;  3ZV9 A;  3SJ9 A;  4WWY A;  1HIA B;  1P57 B;  5L2Y H;  1XMN B;  4I8L A;  2P94 A;  3FN8 A;  5FX5 A;  1GDQ A;  1O2O A;  4BXS A;  1IHS H;  4ASU D;  4IBL H;  2A5A A;  4B6F A;  3TK9 A;  5C2Z A;  4X6O A;  3ZZC A;  1JMO H;  1A1R A;  4K69 A;  4AFZ A;  3UNQ A;  4WF8 A;  3UOP A;  3RXR A;  3SV6 A;  2PFE A;  2FZZ A;  1O3M A;  4YTA A;  2ZFT A;  1FAK H;  2OTV A;  3BF6 H;  3NZI A;  4ISN A;  2R9P A;  1KXE A;  1G32 B;  5FX6 A;  4O97 A;  1DSU A;  1GBD A;  1RD3 B;  3VB5 A;  3EE0 B;  1O2H A;  2AMQ A;  1TPO A;  2F4L A;  4D9R A;  1O3C A;  4HZH A;  1AVX A;  4WVP E;  2W7U A;  2J92 A;  4Y0Y E;  5EJZ A;  2UWP A;  4HG6 A;  3AK5 A;  2VJ1 A;  1DLK B;  2XBX A;  3A82 A;  2CGA A;  1LHF H;  5L30 H;  2PUX B;  3PTB A;  2XWB I;  1O30 A;  4ZHM U;  4K5Z A;  1EJA A;  2Y6T A;  5EQR A;  4A7I B;  1NRO H;  3ZZ8 A;  1FY5 A;  3F68 H;  1W14 U;  1ZHM A;  3T25 A;  5KGO A;  3GCT F;  5C0T A;  5DSF A;  1YC0 A;  1O2N A;  3AW1 A;  3KQB A;  2VVV A;  1QCP A;  1COW D;  1GVL A;  2J98 A;  3P17 H;  3PM3 A;  2FOC A;  4I86 A;  3F2G A;  1K1O A;  3OE7 D;  1SHY A;  1JRS A;  4AB9 A;  1A61 H;  3ZZD A;  1GJ7 B;  5IK2 D;  4KTC A;  3DD2 H;  1AHT H;  3SZN A;  2Q6G A;  1V2M T;  1ID5 H;  4UFF H;  1ZGV A;  2GDE H;  3UPE A;  1VIT F;  4ZCN A;  3KEE A;  2BDH A;  3CS0 A;  1AFE H;  2OK5 A;  3MNX A;  2UUJ B;  1G2L A;  4ZRO A;  2VH6 A;  3K9X B;  2FMJ A;  1HJA C;  1PPH E;  2ZG0 H;  1AWH B;  1W2K H;  2OBO A;  2FOA A;  1MUE B;  1GHB G;  3EA8 A;  1KLI H;  2V6N A;  3RXU A;  4MG3 A;  2BOH B;  2FTM A;  4JCN A;  3A7X A;  1BMA A;  4NA7 A;  1C5L H;  4DII H;  1MU8 B;  1TLD A;  4BNR A;  4LZ1 H;  1XUG A;  2QXI A;  1S5S A;  1SGQ E;  2HNT C;  4X2Y A;  3I77 A;  3MHW U;  2OBQ A;  1UHB A;  1N1L A;  1TPP A;  2BMG B;  1J15 A;  1EX3 A;  1G30 B;  1P05 A;  2GCH G;  1MKW K;  1W0Y H;  4GHQ A;  3SU5 A;  3FAN A;  1C5O H;  1TPA E;  4AFS A;  4NFE A;  2PP6 A;  5HGG A;  3OEE D;  3A8D A;  1OWK A;  1SOT A;  2G00 A;  2OIN A;  2AMP A;  2R0L A;  1LQE A;  2NU3 E;  1ZTK A;  1C1P A;  3LC3 A;  3MH7 A;  4ZKO U;  2V35 A;  2PKA B;  1TMT H;  1D3P B;  1GJ4 H;  2ZEC A;  3CS7 A;  4NGA H;  3QGJ A;  5G4B A;  5T3H A;  3LT3 A;  5J4Q A;  2GX4 A;  3SUG A;  1JIR A;  1H8H D;  2EI7 A;  3V12 A;  5BRR E;  5I46 H;  1Y5B T;  1A5H A;  1KXD A;  1CT4 E;  1SOZ A;  1O3A A;  2FES H;  3A80 A;  1FJS A;  3RP2 A;  1ZRK A;  1Y5A T;  2XBY A;  1MD8 A;  1AE5 A;  1O2Z A;  1QJ6 B;  1AND A;  3ZZ6 A;  2QY0 B;  1RXP A;  4SGB E;  1PJP A;  1J9C H;  3RXS A;  4ZH8 A;  4X1Q U;  1V2P T;  2WPH S;  5DN6 D;  2OCV B;  1C1U H;  1AVW A;  2R0K A;  1HJA B;  5C67 A;  4M7G A;  1ABI H;  6GCH F;  3QK1 A;  5T6G A;  3URE A;  3SYJ A;  1E79 D;  4MLF B;  3NRL A;  2VWL A;  2CXV A;  4R8T B;  3T62 A;  4Q7Y A;  4XBD A;  2Q6D A;  1VCQ A;  1F5K U;  4Y79 A;  2C8Z B;  1UK4 A;  2EST E;  4KP0 A;  3PTN A;  5KED A;  2EY4 C;  1K1J A;  1O3G A;  3KID U;  3RDZ A;  2Z9L A;  5HM9 A;  3GIS B;  5H4I B;  1SQO A;  2JJ1 D;  1V2N T;  1MTW A;  1IAU A;  3TGJ E;  2ZCH P;  4I8G A;  5F03 A;  4E05 H;  1E1R D;  4H42 U;  1IQL A;  1SBW A;  1JRT A;  1UTP A;  1SQA A;  2FP7 B;  3QTO H;  1S6F A;  2UUK B;  2VWO A;  5E2O A;  3SNA A;  3EQ0 H;  3VB4 A;  1SSX A;  4U32 A;  1TNI A;  4A1V A;  2QE7 D;  1K0H A;  2QIQ A;  2A4Q A;  1ELE E;  3PO1 C;  4AYV B;  2WPI S;  2NU2 E;  1NO9 H;  2ZHW H;  1BTZ A;  3EAJ A;  1NRR H;  4MNX A;  3M3S A;  4UFG H;  3GCH C;  1J8A A;  3NK8 A;  1O2P A;  4DUR A;  1Z1J A;  1ZPB A;  1AKS A;  1FY1 A;  2ZDV H;  1EAS A;  4ABD A;  3RC5 A;  3TVJ B;  1QBO A;  3GY7 A;  4X0W U;  1E38 B;  4GSO A;  3QZR A;  1K22 H;  2PKS C;  4B76 A;  4J2Y B;  3U8O H;  2BVS H;  3U69 H;  1NBM E;  2BXT H;  1V2Q T;  2W6I D;  2A4O A;  3LJJ A;  3F2F A;  1DY9 A;  4AG2 A;  1FLE E;  3OU0 A;  1WUN H;  1ZJK A;  1GL0 E;  1NPM A;  4RI0 A;  1G3B A;  1CHO G;  1HAO H;  4AOR A;  3ATM A;  4ACA A;  1TNG A;  2YNB A;  1O2Y A;  1CGH A;  1GJD B;  1TX8 A;  4Z1M D;  2FIR H;  2J9N A;  4AB8 A;  1BJU A;  4INH A;  2O8M A;  2VH0 A;  4GUX A;  3M5M A;  4X1S U;  1NRQ H;  3KL6 A;  5EOD A;  1GJ8 B;  4WH8 A;  1N6Y A;  3DFJ A;  2ZKS A;  4F49 A;  3C1K A;  3C27 B;  1DPO A;  3SU2 A;  3DA9 B;  2GP9 B;  4FUH A;  1GMD G;  2JKH A;  5BPE A;  2V3H H;  1G3D A;  5GIB A;  4Y6D A;  2IPQ X;  4X2X A;  1GGD C;  3TJV A;  2ZPQ A;  3UTU H;  1GBL A;  5C94 A;  4F48 B;  2IPH A;  4JK5 A;  1DXW A;  4Y76 A;  5JB8 S;  2ZDM A;  4X6P A;  2ZFQ H;  1AO5 A;  2FWW A;  4DJZ B;  5TCC A;  2TBS A;  2QA9 E; 
#chains in the Genus database with same CATH homology
 2JJ2 D;  2KFW A;  2WV9 A;  2XCF A;  3KEE A;  3KF2 A;  4ZCN A;  4K8B A;  3PV2 A;  5ESB A;  2F9U A;  3SU0 A;  3KN2 A;  2J5U A;  3SU4 A;  3P8O A;  3L6P A;  2OK5 A;  2XCN A;  2HLD D;  3KNX A;  5H4I B;  2JJ1 D;  2QF4 A;  3F0P A;  3FO8 D;  3M5N A;  3FN8 A;  2XNI A;  1E1R D;  2A4R A;  2IJD 1;  2OBO A;  2WPD D;  1H8E D;  3LON A;  5FPS A;  4ASU D;  4B6E A;  2YMS C;  4B6F A;  2FP7 B;  3OAA D;  4NWL A;  5HKK D;  3LKW A;  3WWB A;  2KR7 A;  4F55 A;  2YMS B;  3OYP A;  3PRD A;  3SU3 A;  1EFR D;  4TT3 D;  2QE7 D;  2KCY A;  4A1V A;  3F2H A;  3W1E A;  2JDI D;  1A1R A;  3N7D A;  2A4Q A;  2YOL A;  3OTP A;  3UB0 A;  4B75 A;  3SV9 A;  2KCA A;  4WF8 A;  2F43 B;  2KCO A;  3SV6 A;  4XD7 D;  1KMH B;  1W0J D;  2QV1 A;  2IJO B;  2L6O A;  3O8D A;  2OBQ A;  5CHB A;  1N1L A;  1NS3 A;  2W6J D;  3DCL A;  5CDF E;  2F9V A;  3FOA A;  2JIZ D;  3SU5 A;  3O8C A;  1MAB B;  3SZE A;  2WZQ A;  3DSO A;  2F4L A;  2GGV B;  2KCP A;  3RC5 A;  4DT4 A;  3OEE D;  2V7Q D;  1BMF D;  2A4G A;  2M2A A;  3H09 A;  3M5O A;  5GND A;  1DY8 A;  2QF5 A;  2OC1 A;  3PRB A;  5FPT A;  2VBC A;  5GPI B;  2K1Q A;  2OIN A;  3O8R A;  4B76 A;  2FOM B;  3WW7 A;  3AK5 A;  5IDK A;  1CU1 A;  5GJ4 B;  2GVF A;  3E90 B;  1SKY E;  5EPY A;  2P59 A;  3LOX A;  5F53 A;  1NBM E;  2KM0 A;  4NWK A;  2W6I D;  3F2F A;  1DY9 A;  3RC4 A;  3SU6 A;  4A1X A;  3OEH D;  2CK3 D;  2XOK D;  3SUG A;  1RTL A;  4I31 A;  4RI0 A;  1E1Q D;  1H8H D;  2AHM E;  2FM2 A;  2WSS D;  2KZ4 A;  3F3B A;  3RC6 A;  4A1T A;  5EQR A;  5T1V A;  3GS9 A;  3M5L A;  4A92 A;  2OC0 A;  3ZIA D;  1W3C A;  2WHX A;  1FX0 B;  3O8B A;  4Z1M D;  1DXP A;  3SV8 A;  5C0T A;  5DSF A;  4I33 A;  2O8M A;  3M5M A;  3F0O A;  5EQS A;  1WXR A;  1BT7 A;  4I32 A;  3U1J B;  3N7E A;  4WH8 A;  5EQQ A;  3P8N A;  4TSF D;  4OM9 A;  5FPY A;  3N99 A;  4M9F A;  3SU2 A;  2K0Q A;  3SV7 A;  4WH6 A;  1COW D;  4JMY A;  3VG8 A;  4TYD A;  3DSP A;  4Q4L A;  3SUE A;  3OFN D;  1OHH D;  2OC7 A;  1NBM D;  5DN6 D;  3F2G A;  3OE7 D;  3SUD A;  4U01 A;  3U1I B;  2OC8 A;  3SUF A;  5EPN A;  4FET A;  5B6L A;  1S6L A;  4B71 A;  5ETX A;  1DXW A;  3WWF A;  5IK2 D;  5FL7 D;  2K8I A;  5C0U A;  2YMS D;  3PV5 A;  4KTC A;  2XND D;  5C17 A;  3SYJ A;  1E79 D;  3NRL A;  4B73 A;  4B74 A;  3EYD A;  4R8T B;  1RGQ A;  3SU1 A;  4Q63 A;  4YXW D;  2LEL A;  1JXP A;  3FKS D;  1W0K D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...