3F2FA

Crystal structure of the mercury-bound form of merb, the organomercurial lyase involved in a bacterial mercury resistance system
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
208
structure length
208
Chain Sequence
MKLAPYILELLTSVNRTNGTADLLVPLLRELAKGRPVSRTTLAGILDWPAERVAAVLEQATSTEYDKDGNIIGYGLTLRETSYVFEIDDRRLYAWCALDTLIFPALIGRTARVSSHCAATGAPVSLTVSPSEIQAVEPAGMAVSLVLPQEAADVRQSFCCHVHFFASVPTAEDWASKHQGLEGLAIVSVHEAFGLGQEFNRHLLQTMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Alkylmercury lyase
publication title Crystal Structures of the Organomercurial Lyase MerB in Its Free and Mercury-bound Forms: INSIGHTS INTO THE MECHANISM OF METHYLMERCURY DEGRADATION
pubmed doi rcsb
source organism Escherichia coli
total genus 61
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 4.99.1.2: Alkylmercury lyase.
pdb deposition date 2008-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03243 MerB Alkylmercury lyase
A PF12324 HTH_15 Helix-turn-helix domain of alkylmercury lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.490 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3f2fA00
3F2FA 3FN8A 5DSFA 5C0UA 3F0PA 3F0OA 5C17A 3F2HA 5C0TA 3F2GA
chains in the Genus database with same CATH superfamily
3LC3A 1C4Y2 1MQ5A 1GHWH 3RLWH 3M61U 1QQUA 2Y81A 3LKWA 1P11E 4AGJA 1YPHC 2HPPH 2YMSD 1CGHA 3F1SB 4X1PU 2XBYA 1FY4A 4I8LA 1V2OT 1O39A 2OQ5A 2SGDE 2XC4A 3SN8A 4JK6A 1E34B 2FMJA 3SU4A 5A8YA 4BANB 5HM2A 1TMUH 1Z8GA 7GCHG 3MQKC 4YXWD 2AGEX 4I8GA 2QGRA 1AGJA 3GY6A 1HGTH 2Y6TA 3HPTB 5JPMH 1ZJKA 3OEHD 3QTVH 4NA7A 2F83A 2VIQA 2FESH 3VGCC 3ZZCA 3MNSA 3A89A 1FX0B 1O2RA 3K2UA 5HXFA 2FTLE 3FOAA 3PV4A 5CHBA 5BPEA 3U8RH 1TRMA 1BJUA 1FIZA 1HAYB 4Y0YE 4PROA 2ZU2A 3M3SA 1GGDC 1GBFA 1OWEA 1P06A 5IK2D 3EAJA 4M9FA 2G81E 4B71A 2R3UA 1DPOA 1PJPA 1QRZA 1TLDA 1O2ZA 1C2HA 2FYQA 1AQ7A 3SQHE 2VWMA 1J16A 4FUEA 3H7TA 2ZFQH 4UDWH 3LOXA 2F9VA 1GBHA 1TMBH 1DM4B 4X2YA 5B6OA 8LPRA 3SV6A 2A0QB 4TSFD 1UVPA 2FS8A 2IJD1 2GT7A 4B6FA 1NFWA 3M5OA 4OGXA 1N6YA 2WV9A 1P2JA 3M5MA 1EJMA 1IQFA 1FY5A 5LH8A 1O2HA 1QL8A 1MKWH 3Q76A 2WUBA 1YM0A 4YOJA 3LT3A 2C8WB 2A4OA 2TIOA 1OKXA 3EA8A 2O8WA 3FP7E 1T8MA 3W94A 4UE7H 2A4RA 4WWYA 4X1RU 3QWCH 1O3DA 6LPRA 3FN8A 1G30B 1ZGVA 2XBWA 1GVZA 1TOCB 1KLTA 1C1WH 2PKAA 2XYAA 4FOUC 1HJ8A 1K9OE 1AMHA 1YLDA 1UK4A 1O36A 1C1OA 2XRCA 2WSSD 3FZZA 1O2SA 1VITG 1ETTH 1AI8H 2QYIA 3TJUA 2VIOA 5KECA 2BD9A 4HG6A 4BAQB 2ZFTA 1K0HA 4FUBA 3SU6A 5C20A 1OXGA 1UTMA 2V35A 1WTGH 3VB6A 8GCHG 2RFKC 3PM3A 2HVYB 2ZECA 2FOMB 1HYLA 1HJ9A 1BQYA 1DXPA 1FQ3A 3HK3B 1QIXB 1HLTH 3F2FA 1O2LA 3ZVEA 1P10A 1C1VH 3SI4H 1XVMA 1L1GA 2PUQH 2OC1A 1BDAA 1F5RA 1LVBA 4KTUA 5GIBA 2ZCLP 3AASA 2BZAA 3LDXH 2WPMS 4IC6A 4A92A 1MTVA 1M9UA 1IQLA 3A7XA 1HNEE 1QHRB 1JIRA 1DANH 1GBKA 1GMDF 3SUDA 1TX8A 2ZO3H 2TBSA 4GUXA 4GHQA 2GDEH 1FY8E 2HVXA 1IQMA 1BRUP 2WYGA 1D9IA 4XRNA 1QBOA 2KR7A 1TBRH 1GI6A 2ESTE 2D8WA 9ESTA 1TNHA 2PKAB 1ZZZA 4WMDA 2W5EA 2A5IA 5EQQA 1VJ9U 2NU4E 3EDXB 2VIDA 1WQVH 5C1UA 2V6NA 4ZUHA 4GAWA 2IJOB 1TFXA 3D49H 4YT6H 4YLQH 2P8OB 1TGSZ 1OWHA 4F49A 4THNH 3A7ZA 4X1SU 2AMQA 1YPEH 3NRLA 4RSPA 1FN6A 1OWIA 4MNXA 1BBRH 4DT7B 1DWBH 1P12E 3GDUA 3BIVH 1QRXA 1VGCC 2C8XB 1ZJDA 3CS0A 2AIPA 1N1LA 3NK8A 1AFQC 2J4IA 3E16B 2ZZUH 4A1VA 4XOJA 1Y3UA 2WUCA 1SGPE 4JZEH 1YWUA 1TGBA 2PP6A 2QXGA 4NWLA 1MBQA 4NG9H 7GCHF 3DD2H 4ZCNA 3S7HB 1WU1A 2F4LA 2CV3A 3FAOA 5DKMA 3UWIA 1O3PB 3RXIA 4X1NU 4UD9H 1D3PB 5C0TA 1TWXB 7ESTE 1C5SA 1YC0A 5EXMA 1LHFH 2HPQH 4B2BA 2Z9KA 2KCYA 3BV9B 4ZAEA 3MU5A 1F0RA 1O0DH 2XTTB 3SUFA 1OOKB 1AZ8A 1ZR0A 2K0QA 1B7XB 1CHGA 3DA9B 1Y3VA 1INCA 1S83A 4Z0KA 1KXDA 2KZ4A 3PWCA 1W0ZU 1YPKH 4CREA 3LIWA 1IQJA 1VKYA 2BZ6H 2PGBB 3SV8A 1WDIA 2PSYA 1SQTA 1GVKB 2O8LA 2VGCB 1IQGA 4IN1A 4I32A 1AB9C 1NRRH 2OP9A 1KIGH 3SJKA 1O2XA 2UWOA 1ZMLA 3RXBA 1PPEE 2BDIA 4P02A 1MTWA 1W13U 1DSTA 2EY4C 4AFUA 5F8ZA 3OTJE 1P04A 5AHGH 5DP4A 1GJ9B 2BDBA 1FN8A 1YY3A 4KTSA 4BTUB 3BTFE 2PHBA 3A7VA 1KY9A 3BEFB 2B0FA 2R2MB 3RU4T 2AS9A 4DURA 3STJA 1S81A 1QJ1B 2AIQA 4UONA 1DLEA 2FM2A 1C5VA 1GJ7B 3UR9A 3ZVCA 1K2I1 6GCHG 3M3VA 1T8NA 1SFIA 2ZDVH 3BG4C 2BQWB 1O3NA 1WQSA 2NU0E 2P95A 4CRBA 3V3MA 1H8IH 1SFQB 1KMHB 1UCYH 1P05A 1DSUA 2PW8H 5F8XA 3U8OH 3SO3A 2AFQB 2O9QA 1C2GA 1H9HE 4MNVA 5GNDA 5C0UA 3SV2H 1OX1A 4MDSA 1YPJH 3ZZAA 3NZIA 1A7SA 1FAKH 1GBEA 4IGDA 4DT4A 3UIRA 1GJCB 1W2KH 1FIWA 1PFXC 2GZ8A 3N7OA 3URDA 4E7RG 1C5LH 2ZHWH 8GCHF 3PMJA 5JBAS 4FVDA 1PPGE 5EQRA 4XE4A 5DSFA 1F0SA 3G01A 5FX5A 6CHAB 1QB9A 5A0AE 5LPEA 3EE0B 2JDID 1OWJA 1SR5C 2F9NA 4XDEA 4AZ2B 3E90B 1QB6A 2JIZD 1LPKB 3GOVB 4K1EA 2VJ1A 1GMHG 2ZF0H 2J9NA 3GCHC 3RUOA 1HCGA 3TH3H 1HIAB 2Z9GA 1N6XA 1RRKA 1ZTKA 2XCFA 2A45B 2YNAA 4VGCC 5JB8S 2Q6GA 1EASA 1XX9A 1DY9A 3W95A 1HJAB 3AAVA 2GMTC 4X6PA 2FODA 1XVOA 2ZP0H 3GS9A 1HBTH 1AO5A 3ATKA 3R0FA 3GY3A 1NRNH 1KXAA 2EEKA 1GI9B 1P3CA 3RC4A 2PLXA 4O97A 3Q3YA 1MAXA 1IHTH 1N8OB 5DPAA 2L6OA 5HM9A 1FLEE 1O2PA 3GY2A 1CT0E 2J95A 5EPYA 1TGNA 1UTNA 2BD8A 1A46H 3BTDE 2G5VA 3L33A 1ELGA 1K1IA 1EB2A 3GDSA 2J97A 4Y8YA 1WTHD 1Y5BT 2Z3EA 2PUXB 4DJZB 3F9HA 2VIVA 3FFGA 2GV6A 2XOKD 2CXVA 5E0HA 3FANA 1ZMJA 1W0JD 4DG4A 2BYAX 4CRAA 3ATMA 3RXGA 1O2IA 2A2XH 1T31A 3FP6E 1GJ6A 1S6LA 1BTYA 3EA9A 4AG2A 2P3TB 2YMSC 4IMZA 3SNBA 1TBQH 1C5PA 1CA0B 3AW0A 2KX4A 3P70B 1O5BB 4BTTB 1ZPBA 2H9EH 4BTIB 4AORA 1C1MA 4LOYH 3RDZA 3MOCA 2RA0A 3LGUA 1LHCH 1V2LT 4SGAE 5JYIA 2SGPE 5A8ZA 3UWJH 1U6QA 5L2ZH 1DDJA 4O3TA 2HRVA 3LU9B 2BX3A 2XW9A 1TE0A 4Y79A 2ZFFH 2VBCA 1TOMH 3LH3A 2Z9LA 3E0PB 4X6MA 2OC0A 2A4QA 3TU7H 5TCCA 1V2WT 3SGAE 3F68H 4ASUD 1GBMA 3O8CA 2VWLA 1SKYE 3QO6A 3F9FA 2TRMA 2BY8X 4MQAA 5E8EH 2ZTXA 1C5MD 2GTBA 4RN6A 3TVJB 1SVPA 3A7WA 1N8OC 4DGJA 4B2AA 5A09A 4X6OA 3RXSA 3RXDA 1HAIH 4E06H 1GG6B 3P8GA 1GVLA 2PKSC 5C5OA 2HOBA 1UTPA 3PRBA 4AFSA 2OCVB 1GCTB 1GJDB 2GD4B 3KQCA 1UJ1A 1LHGH 1BTZA 4FUIA 2B7DH 1GJ4H 2G4TA 2Y80A 4ZKOU 5DP8A 2ULLA 2PWXA 2QIQA 5CHAC 2ZU1A 1YPGH 3OYPA 5A8XA 1P2IA 1NO9H 3ZZDA 1C2JA 1V2RT 4UFFH 3T26A 1ANEA 1AUJA 1YKTA 4CRFA 1Z1IA 5JBCS 4X2WA 3CP7A 2FO9A 2WHXA 3GCTG 1TRYA 4ABHA 1SC8U 1G3EA 2FWWA 1CVWH 3SW2B 3Q00A 5DP6A 4Q7ZA 3SV7A 1TIOA 1FAXA 1W7XH 2A2QH 5J4QA 2OINA 2HWLB 3H7OA 1S6FA 1O3KA 3AAUA 5KEDA 1A1RA 4JCNA 3UB0A 3OTPA 1P2NA 6GCHF 1AVGH 1BTUA 1T7CA 3GISB 4X6NA 2CF8H 2BDCA 1DWCH 3SUEA 4CRDA 2F9BH 1K1NA 5EPNA 3MU8A 2FI3E 4NA8A 5FCKA 1LMWB 2Y7ZA 4A6LA 2A5AA 1QTFA 5KGOA 1GMCG 2EI7A 1F5KU 2BY6X 2IN2A 1TALA 2QC2A 4WMFA 1ELBA 3BIUH 3SU2A 1EAWA 1HUTH 1QGFA 1B5GH 1B0EA 1TGTA 1MAYA 3QK1A 1KDQA 1O2NA 1YCPM 2GV7A 2KCAA 3KN2A 3BTME 2THFB 1SGEE 1SGQE 2A31A 2V3MA 2ZNKH 5EW2H 2Q6FA 1HXEH 2M2AA 3OFND 3FO8D 3IG6B 1F5LA 3LONA 3RXKA 1ZHRA 1V2NT 3KIDU 2J34A 4I8HA 1SQAA 5JB9S 3PMAB 1G36A 2BX4A 3SNCA 5I25A 1K1LA 1DWEH 4DOQA 3DCLA 1GBBA 4RKOB 2ZPSA 4AG1A 5H4IB 1ABIH 2AMPA 1GMHF 1H9LB 1AVXA 1RIWB 1O5FH 4ISHH 1Z71A 3SU1A 4AN7A 4K8BA 1PQ8A 1MD8A 1ESBA 4U2WA 3FP8E 4A1XA 1NY22 2BLQA 4JYUH 3MNXA 1GBLA 1MZDA 4GLYA 3A84A 2FIRH 3GY7A 1YPMH 4HTCH 5AVDA 3VFEA 5EODA 5B6LA 1OWKA 1Y5UT 4SGBE 4YOGA 1OYTH 1FV9A 1W0KD 1FXYA 2DE8A 3LGWA 2QXJA 3O8RA 1NROH 2AERH 1O2VA 3GY5A 3MU4A 2G00A 2WPDD 1TRNA 5FBEA 1FMGA 1KDQB 1NT1A 1FUJA 4CBNA 2ZQ2A 3M7TA 1C2LA 1ACBE 1E79D 1QFKH 1J17T 2JETC 3BEUA 1ANCA 3LGVA 3BEIB 1EPTA 5EGMA 2ZDMA 5GXPA 3TH4H 1VZQH 2J5UA 1JWTA 3B8JA 1NFYA 4A1TA 2LP6A 5BRRE 5FAHA 2YOLA 4IW4E 1DWDH 1TQ0B 3U1IB 2P16A 2RA3A 1RS0A 1MH0A 2UUKB 1O38A 4O3UA 1O33A 5C67A 3FKSD 1WV7H 2A4GA 4X8SH 1C2MA 1RIWC 3ATLA 4YESB 1O3LA 1TA6A 3M36A 2JJ1D 2BOHB 1F92A 2BY7X 5T1VA 2PV9B 2ZPQA 1PPBH 2CGAA 5F53A 4JYTA 1UTJA 3TGIE 1MD7A 1QNJA 1TGCA 3CS7A 4Y7BA 2G8TA 1CT2E 2BXTH 4M7GA 4DIHH 2J38A 2ANMH 1DLKB 1IQNA 1KXFA 1LVMA 4Q4LA 5DGJA 5LGOA 4ZHLU 4INKA 2BD5A 1GHAG 4CRGA 4MNWA 4BNRA 1LQEA 2WYJA 2ASUB 3SYJA 2QAAA 1BTXA 3A8AA 2ODYB 3PTNA 2V3HH 3RP2A 2WZQA 2ZQ1A 2P93A 2QV1A 2XBVA 3EYDA 1SB1H 3U69H 3F2GA 1S6HA 2ZPRA 3KQBA 4WH8A 1Y5AT 3T28A 2J92A 4UFEH 3B23B 1TAWA 1W8BH 1PPHE 2HLCA 1ZHPA 1EPTB 3LPRA 2RDEA 3QZRA 4E7NA 3BTKE 3F0PA 3ZYDA 4X2VA 3GCOA 3HKJB 1TPOA 1YPHE 3HKIB 2Y5GA 4U32A 1NRSH 2GCHG 3BTTE 2VIPA 1MTSA 2ZFSA 2C90B 1EB1H 3S0NA 1J15A 5F03A 5I46H 1TPSA 2C8ZB 2OUAA 2IOTA 5C2ZA 2FS9A 4CHAB 2VVUA 3ELAH 2EI6A 1P3EA 2GJGA 2P59A 1QL7A 2XC5A 1SSXA 5TJXA 5C94A 4FU7A 1S0RA 1P9SA 2IPQX 4I8KA 3ZVAA 4AFQA 4NGAH 1C5UA 2QA9E 4MPUA 1E1QD 1GMCF 2PGQB 1ELAA 1XXFA 5A2MH 3QUMP 1WAYB 1MKWK 1J9CH 2FP7B 2BB4A 2ZTZA 4ISLA 2LNCA 1EJAA 2BVRH 1AWFH 4NZQA 3BTGE 1O3AA 1ELEE 3A88A 5EJ1A 1NESE 4BAOB 1YPLH 2JKHA 3QGJA 3A82A 1RFNA 3W1EA 1HAVA 1WYKA 3ZV8A 4X8UH 1O3BA 1MUEB 3S9CA 1MU8B 2JH6D 4F48B 4JZ1A 1GHYH 2FOCA 3MO6A 1NM6A 4WMEA 2BDGA 1T8LA 1SHYA 2ANKH 4TWYA 1UW7A 5EXNA 2OC8A 1CO7E 4FUJA 3P8FA 1T4UH 2ANWA 1A5GH 2KCPA 1F0TA 3A80A 2Y7XA 1QJ7B 1GL0E 2XXLA 3LJJA 4X0WU 5E0GA 5HIYA 1RTLA 2WV4A 3OU0A 2BDYA 1KTSB 5T6FA 2HNTC 3SJOA 4AFZA 1GBTA 1Z6EA 2GZ9A 1C5YB 1RXPA 1BMFD 2VWOA 2BMGB 4NFFA 1G37A 1CE5A 1KXEA 3RXTA 4X1QU 1NU9A 2J98A 2ZKSA 1SGYE 2HNTF 3P92A 4P00A 3AK5A 2FOGA 3C27B 1GJ5H 1P2QA 1NRQH 5T6DA 1ZYOA 2G5NA 1O3MA 1D4PB 1BCUH 2QF3A 3EE7A 3MO3A 3MU1A 1FNIA 1TPPA 3SNAA 1J8AA 1G3DA 1O34A 1QR3E 3SGQE 1DOJA 1KXBA 1H4WA 2XBXA 2Y5HA 2EQNA 1BUIA 4TY7A 5IDKA 1O5AB 1DFPA 3QTOH 3IWMA 2UWLA 3KQDA 1HAGE 3A8DA 2W6ID 1TQ7B 1T32A 2XWBI 2H1UA 1AFEH 1C2DA 1LQDB 3MI4A 1HAVB 4E05H 2P8OC 1GHBG 5E2OA 5L6NH 2WPJS 3TGKE 1ORFA 1K1PA 2ZCKP 3ODFA 2GVFA 5E0JA 3TJOA 1T8OA 1NFUA 1GHZA 1SOZA 3OX7U 4K8YA 1CHOG 2AH4X 2ZA5A 4DCDA 1DUEA 2DE9A 1VCPA 3BG8A 2PTCE 1O30A 3UREA 2FOEA 4HZHA 1HIAA 1O37A 1PQAA 2ZDNA 3A8BA 1ARBA 2F9UA 4D76A 4R8TB 3NCLA 1IAUA 4ZKRU 5J4SA 2Y82A 3SNEA 3SHCH 4ZHMU 5FPTA 1HXFH 1HAXB 2QF0A 1AHTH 1NN6A 5C1YA 2VU8E 3VG8A 1BBRK 3E8LA 3N99A 2VH0A 2BD3A 4K3JA 1GI2A 3SHAH 2Q6DA 2J98B 4B2CA 3K6ZA 1W12U 3DT0H 3SU3A 1DITH 2BLVA 2Z6BD 1AD8H 1TONA 1ESAA 2CHAB 1O3JA 1SL3A 2VVVA 2GKVE 3PTBA 1COWD 1GI4A 1Y3WA 5E2PA 1SLUB 4NIYA 1BMLA 1V6DA 1D6RA 2KAIA 1GHAF 1VITF 1P9UA 1ABJH 3ZVDA 3ATIA 3PLKA 4RKJB 4GCHG 1MMJN 1GBJA 3N7DA 4NA9H 3QLPH 3H5CB 1P2KA 1BTHH 4Z1MD 1PPFE 5EOKA 2VGCC 2G4UA 3E1XB 3D65E 3OSYA 4X8TH 4J1YA 3TJVA 1P2OA 1RTKA 2FEQH 2Z3DA 1ZTLA 2ZG0H 4OS2A 1C5QA 4RT1A 4TPYA 3RXVA 1JMOH 1EZXC 1Z1JA 1Q3XA 3SGBE 3F3BA 3VPKA 1ZLRA 2GCHF 2C93B 2QF5A 1PPZA 2V3OH 3TH2H 3A86A 1PYTD 4YO9A 3P8NA 1D6WA 4H6SB 3ZYEA 4DW2U 3LC5A 2HNTE 5SGAE 3M7QA 4CH8B 4KGAA 2AEIH 4TY6A 7LPRA 2OD3B 1EAUA 3JZ2B 3OAAD 1ARCA 1O3OA 1OP0A 4FUHA 4WY3A 2UWPA 3P6ZB 4INLA 4WVPE 4BAKB 1C5RA 1PPCE 4LZ4B 3I78A 4B1TA 3ZZ4A 3MU0A 4Q7XA 4TYDA 4B74A 1RTFB 1OYQA 1PQ7A 3F0OA 3NUMA 1LO6A 1UHBB 3LJOA 3UNSA 1SG8B 3UFAA 4Y8ZA 1G3CA 3ATWA 1UTQA 4Z6AH 1QA0A 2ZIQH 1BA8B 2LPRA 1AN1E 1C1RA 1ID5H 3SJ8A 2CHAC 1V2VT 1EP6A 2HALA 3NXPA 2QE7D 2FOFA 2WINI 1FY1A 3ZZ6A 2P3FH 3SORA 2BOKA 2KAIB 1NPMA 1BHXB 3SZEA 4NWKA 4IS5A 3VB3A 1UCYK 4XBDA 5FPYA 1F7ZA 1NU7B 1FI8A 3C1KA 1C5ZB 5FX6A 1EUFA 3R3GB 1ZOMA 2VVCA 2TPIZ 5T3HA 1CSOE 4MTBA 2OC7A 3A83A 3A87A 1LKBA 1EAXA 3I29A 1QURH 1JRSA 1SOTA 1LVOA 1YBWA 6CHAC 2ILNA 4GVUA 2DUCA 3EQ0H 2H9HA 3KL6A 3UR6A 1HAPH 1BRBE 1THSH 1CBWB 1LPZB 1NFXA 1CGIE 2GCTB 1XMNB 4DIIH 3PO1B 2EA3A 3TK9A 1O3FA 3MHWU 1LKAA 3H09A 2OBOA 4OS6A 1BOQA 3M7UA 3A85A 1X7AC 1O2WA 4KELA 3RXAA 3STIA 2J94A 3VB5A 3GYLB 2XC0A 3AW1A 4FUCA 1HJAC 2AGIX 2H9TH 4HI3A 3M5NA 1H1BA 5EQSA 2A7JA 4IMQA 4OS1A 1YLNA 2Z7FE 1TA2A 4K2YA 3PB1E 2ALPA 1H8ED 1Y8TA 2ZHFH 3AVZA 3ODDA 1H8HD 3RXPA 1B0FA 3S7KB 5K7RA 3TGJE 1AY6H 4ASHA 3M35A 1UVOA 3CNRA 2ZU4A 2ZWLH 2BDHA 1ELDE 2F43B 4LXBH 4OS7A 5DO4H 2KM0A 1WOFA 3CENA 3GDVA 1BB0B 3WWFA 1P03A 2ZTYA 3D23A 1EJNA 2H2ZA 3TK5A 4CR5A 1IQEA 1WXRA 5AFYH 3TNTA 2FLRH 2FI5E 1W7GH 4X2XA 4B73A 4Y10E 1O2KA 1IHSH 2H6MA 4F4OC 2A7HA 2Z9IA 4BAHB 3RXFA 1CHOF 5GJ4B 1A3BH 3TITA 1GI3A 5GWZA 1MKXH 2FI4E 5C17A 4ZH8A 2ZGCA 3UNRA 2OLGA 4ABDA 1CA0C 1K1JA 1L2EA 1VCQA 5LPFA 2WV5A 3SZNA 1D3DB 1SLXB 3VB7A 5G4BA 3MMGA 4TWWA 2QF4A 3RM0H 2FOAA 1A5HA 3P8OA 2BD2A 2FX6A 2QXHA 2GCTC 4F55A 1T4VH 1KTTB 3E6PH 2ZGXH 1S84A 1GI0A 4MVNA 1VITH 3TIUA 1SI5H 5JDUB 4XFQA 5C1XA 3E0NB 2FLBH 1FJSA 1OSSA 1FDPA 4ABEA 3RXHA 1MZAA 3NWUA 5EJZA 2FDAA 1W14U 4D9QA 3ZZ7A 7KMEH 4NIXA 1JXPA 1TNIA 2D1JA 1WCZA 4JZDH 3BTHE 2A7CA 4IC5A 2ZI2H 3SBKA 3NKKA 2VIWA 3DHKH 2KCOA 3SNDA 1XXDA 1GBAA 1ANDA 1HFDA 1SGFG 3SI3H 2STAE 3SU0A 1YYY1 1KLIH 3VGCB 1GMDG 3LGYA 4GCHF 1GG6C 1O2UA 2BTCE 5ETXA 4AOQA 1OWDA 4K1TA 1XUHA 5T6GA 3FVFB 1GCTC 3M3TA 2F3CE 1ZGIA 3RLYH 1QBNA 4HFPB 1C1SA 1P01A 1EOJA 2R0KA 4FUFA 5FL7D 2RDLA 1E35B 4AYVB 1ELCA 4OS5A 4GPGA 4XBBA 4B6EA 3ITIA 4YT7H 1BRCE 5JBTA 1EKBB 1TX7A 2PR3A 1SGCA 3K65B 4BOHA 4ACBA 1G2MA 1W10U 4FVBA 1BMMH 2AGGX 1KXCA 3ZV9A 1BRAA 3A81A 1LCYA 1Y3XA 1FONA 1SLVB 3QDZB 4D9RA 1QQ4A 2R2WU 1KSNA 5HYOA 2ZDLA 1SGFA 2FX4A 5DP7A 5L30H 3QX5H 1JRTA 1MKXK 1HB0B 3BTWE 1ETRH 5F8TA 1V2KT 3RXCA 3UQVA 1O5DH 4DY7B 1THPB 1TNLA 4YOIA 1O2TA 5EIYA 1S85A 2J2UA 1NC6A 1C9PA 1CU1A 3EGKH 2BQ6B 5FXLA 4AC9A 1W11U 1UVUH 4MNYA 1ZTJA 2O8MA 1C4U2 1A61H 3S9AA 3K9XB 4OM9A 1HV7A 3L6PA 3BN9A 3O8BA 3MNCA 1V3XA 1FZZA 3KF2A 1RGQA 4Y11E 1EOLA 2ZFPH 3TK6A 1C1TA 6ESTA 2TGPZ 1OP8A 3VXFH 5DP5A 5EXLA 3T62A 2F9PA 3PROA 2BVSH 1D3QB 2FOHA 1QZ8A 2P3UB 3UQOA 4AB8A 2HLDD 1QA7A 3DFJA 1MBMA 1UK3A 4MLFB 3RXOA 1EZSC 1C1PA 3E3TA 1AWHB 5ABWA 5GDSH 4H4FA 2A1DB 1EFRD 4FU8A 1V2MT 1O3CA 3KNXA 1TPAE 4FUDA 5AF9H 3OY6U 1C2FA 1A0LA 1GDUA 5JBBS 2ZGJA 2W3KA 4BAMB 3U1JB 1Z8RA 2BVXH 2CF9H 1O3IA 1GI8B 3VXEH 3SUGA 2O8UA 1KYNA 3RXEA 1FPCH 1GHVH 1A5IA 2C8YB 1SGTA 1GBCA 1NZQH 2V0BA 1OHHD 1AE8H 1OP2A 2OTVA 2W7SA 2BDAA 2BXUH 3PRDA 4UFGH 3FZDA 3WWBA 5HIZA 1W3CA 2FOBA 2H5DA 1RD3B 1GJ8B 1L4ZA 2G51A 2VNTA 3DSOA 2STBE 3ZZBA 1P0SH 2G52A 2Q1JA 1E37B 1LVYA 3KQ5A 1DE7H 2PSXA 4I31A 1EQ9A 2JJ2D 3E91A 1AU8A 2F9OA 4I33A 3ZZ3A 4A5TS 1E1RD 4RT0A 1E0FD 3F9GA 3QN7A 4CH2B 3SV9A 4MPWA 1C4V2 1QCPA 3D62A 3GY4A 1LHDH 1CT4E 1ELTA 1NRPH 4INHA 1O2JA 1G32B 1XUFA 1TNJA 2A32A 3RC5A 5GCHG 3SJIA 2SNVA 1L4DA 2BD7A 3GCTF 1JBUH 1GDNA 2ZC9H 5C3NA 1MCTA 1IOEA 2UUJB 2RCEA 3V0XA 2SNWA 1ZPCA 1THRH 1K21H 1P2MA 2CMYA 2ODPA 1C1UH 3O8DA 4ZROA 2ZGBH 1TNGA 3WY8A 3ZIAD 1J14A 2Z94A 1VGCB 5HKKD 2OXSA 1ZSKA 1BZXE 2BY9X 4I7YH 1MQ6A 1AFQB 2VH6A 3MH6A 1OS8A 2V7QD 2SGAA 1DT2A 1HPGA 4Y6DA 3TNSA 1FPHH 3BF6H 1ZRBA 5A0CA 4KTCA 2R3YA 2UUFB 4MPXA 2EC9H 1BBRE 4ABJA 3UTUH 5HMAA 3ZZ8A 4Y0ZE 1QJ6B 3P95A 2FPZA 1DY8A 3GYMA 1AUTC 4K5ZA 1TX6A 3B9FH 1L0ZA 1TYNA 1O32A 3RXLA 2F91A 3DUXH 2SGQE 2C3SA 3HGNA 2W7UA 1DS2E 1K28D 4CR9A 1MU6B 2CJIA 2K8IA 2PFEA 3L3TA 1O2QA 3MH7A 1O3HA 4JMYA 3RXMA 1O3GA 4WJG2 1UTKA 2WPLS 1NBME 2GP9B 1A3EH 1BMAA 4H42U 3MH4A 2G55A 1BJVA 1SPJA 1FY3A 5FCRA 8ESTE 1H9IE 5FHTA 4JK5A 1NBMD 4K1SA 1DICA 1PYTC 1C5TA 1AB9B 3VB4A 1GJAB 1BITA 1V2ST 1EPTC 3RMOH 1SQOA 1ZRKA 4NFEA 3GICB 1ZHMA 3LGTA 1BTWA 1QRWA 2OBQA 1GL1A 3TPIZ 4WXIA 1UTLM 1G3BA 4WF8A 3LGIA 1Z8JB 1NTPA 3DFLA 4B76A 2FZZA 2NU2E 4CHAC 2BQ7B 4YLUA 2BHGA 5AFZH 1GJBB 2TGDA 1WBGB 3T29A 1GDQA 1S0QA 1C2EA 1C5NH 2ODQA 2GGVB 1VJAU 5EW1H 3ZZ9A 5ESTE 1TB6H 4ESTE 2Z9JA 3F6UH 5TCAA 4NCYA 5CDFE 1Q2WA 2NU1E 2NU3E 3BG4B 3F2HA 1GI5A 2EI8A 3V12A 4NSYA 3HATH 3SJ9A 3MH5A 4YTAA 1O5EH 3HK6B 2Z3CA 1F2SE 3QGNB 1UVTH 1SQRA 4K60A 1LPGB 4CRCA 1EX3A 1UO6A 4TT3D 2WPKS 3P17H 1IQIA 5C5NA 2D26C 9LPRA 1ESTA 2M5TA 1MCVA 1XUGA 3S69A 2O8TA 3ESTA 1UCYE 1C2KA 4XBCA 3SU5A 1LDTT 3PLPA 3JZ1B 5PTPA 4ABFA 4ABBA 1K1OA 3OE7D 1CGJE 4Q63A 4OS4A 3KQEA 4Y7AA 1BMNH 3RM2H 4AX9H 1EZQA 1O2OA 1UMAH 1GI7B 1Z6JH 1Z7KA 2GX4A 4ACAA 1HAHH 5CE1A 2ZDKA 3I77A 2JH0D 5GPIB 4ISOA 3KYFA 1MTUA 2QXIA 1A0JA 2VWNA 3M37A 4H6TA 2FTMA 2JH5D 2B8OH 1UHBA 3GCHB 4WXVA 3UOUA 3KEEA 4ZKNU 4VGCB 3Q77A 1YP9A 4YM9A 1EAIA 1XUJA 1SLWB 1Y3YA 4UFDH 3U98H 3MO9A 4AB9A 2GMTB 1ELVA 2W26A 1P02A 1ZPZA 4OGYA 4CBOA 1ZSJA 1C5XB 4K69A 2LELA 3ZVBA 2SGFE 1MTNB 1V2UT 2ZCHP 5LPRA 3RU4E 2XNDD 1JIMA 3U9AH 1H8DH 4Q7YA 1GI1A 1SGDE 2ZU5A 2A5KA 2XNIA 2AYWA 4NZLA 4YZUA 3RU4D 1YCPH 4RI0A 3T25A 1XKBC 1TMTH 1O35A 2FXRA 5ESBA 1ZMNA 5GCHF 2Y5FA 1QY6A 1GBIA 1AZZA 2SFAA 5F6MA 1DUAA 3KGPA 3TLOA 4ZKSU 1O3EA 3NPSA 2OK5A 4LK4A 3MTYA 4O9VA 1JOUB 1YF4A 1O2GH 4UEHH 3T27A 3RMNH 4XD7D 4ISIH 1EZUC 3MWIU 4KP0A 3N7EA 1DX5M 5A0BA 4NIVA 3RXQA 2YMSB 3UY9A 4AYYB 4Q2KA 3VEQB 1IQHA 5DG6A 2R9PA 2VB0A 2FYRA 1QBVH 1LTOA 1P09A 4FXGH 3KYGA 2W3IA 4ISNA 1EP5A 2AMDA 2QN5T 4AGKA 2WPIS 2RG3A 4HGCA 2SGEE 1C5OH 1OPHB 1ZSLA 4B75A 2PTNA 3HGPA 3ENSB 2C4FH 3EA7A 1WUNH 4BXSA 2BY5X 2D2DA 3DSGA 1PQ5A 3BSQA 5DP9A 1AE5A 3S9BA 1G2LA 1P8VC 2WPHS 3A7YA 2UUYA 2I6SA 3OY5U 4I8JA 4QT8C 1E38B 4XSKU 5IYTA 4A7IB 1SBWA 1YLCA 4JZFH 4MG3A 2I6QA 1C5WB 1MTNC 3RC6A 1ETSH 2ZHQH 8KME2 4GHTA 3GY8A 1S5SA 2PKSB 3UAIC 3UPEA 5DN6D 2TGTA 3F9EA 4X8VH 3RXRA 1XKAC 3PLBA 2W6JD 2XWAA 4ABAA 1CA8B 3SOSA 1L1NA 4U30A 3A7TA 1O5GH 2CK3D 1V2TT 4FETA 4JYVH 3A8CA 1Z8IB 5CHAB 1EATA 1DXWA 5DJ7A 1YCPK 4IN2A 1GHXH 4D8NA 1HAOH 2BM2A 1SGNE 1BTPA 4WH6A 1Q31A 2ZHEH 2H5CA 1XUKA 2ANYA 4NIWA 2ALVA 3RMMH 1V2JT 4TPIZ 3M5LA 3BTQE 3K6YA 4Y71A 2BD4A 3T5FH 4Y76A 1G9IE 1QL9A 2XCNA 1ANBA 5EJLA 1AVWA 4R0IA 1A2CH 1GCDA 4JZIA 3V13A 3PMBB 4NSVA 4U01A 4IBLH 3ZZ5A 3MFJA 4FUGA 1VR1H 5DP3A 2TGAA 4Y8XA 1V2PT 2L74A 4Q80A 2P94A 1GBDA 1IQKA 2GT8A 1WSSH 3MNBA 1V2QT 2QCYA 1K22H 3PYHA 1AKSA 1MABB 4GSOA 1XM1A 2OQUA 1A4WH 1SHHB 3ZVFA 1D3TB 1L1JA 1TABE 5L2YH 2BLWA 3U8TH 4LZ1H 1GHBF 2HGTH 3T2NA 4KKDA 1O31A 1P57B 5K0HA 2ZGHA 4I86A 3GCNA 3WW7A 2ZHDA 1TNKA 5DK1A 2AHME 1ELFA 1C2IA 1BHXF 3RXUA 4D7GA 4J2YB 3Q3XA 1NS3A 1EXFA 5CMXH 1C1NA 2QY0B 1BIOA 2BLOA 1KLJH 1RJXB 3RMLH 2IPHA 3KHVA 1CBWC 3Q3KA 1GWAA 1QB1A 1F0UA 1E36B 2R0LA 3PO1C 1SGIB 1HDTH 2GZ7A 1O2MA 4ZHAA 1AIXH 3U28C 1UVSH 3QZQA 3IITA 4O03A 4D7FA 1O5CB 2YNBA 2ZFRH 1K1MA 1TBZH 1SMFE 5FBIA 5HGGA 1UK2A 2GDDA 3MYWA 2KFWA 1GPZA 1HRTH 1SGRE 1UTOA 1C9TA 3ZVGA 3UUZA 2VINA 2B9LA 3KCGH 3TJNA 3PWBA 4BXWA 4ZXXH 1XUIA 2ZU3A 3PMHB 1A0HB 4FU9A 5FPSA 3PV2A 4ZXYH 3V7TA 3URCA 1O2YA 3UNQA 3BTEE 1YGCH 1AKSB 3DSPA 1GGDB 3LH1A 2B5TB 2CN0H 1S82A 4MPVA 1HAZB 2ZDAH 5EG4A 1LHEH 1Y59T 1W0YH 4DVAU 1C1QA 3OEED 4ABGA 3SQEE 5EU8A 3RXJA 2NWNA 4ABIA 2JETB 2K1QA 2ZEBA 4ZMAH 1BT7A 3UOPA 1VCWA 3PV5A 1CQQA 1DVAH
chains in the Genus database with same CATH topology
2YOLA 3FN8A 2O8MA 2YMSB 3NRLA 1KMHB 3SU2A 3U1IB 1MABB 3O8DA 2F9UA 4OM9A 2QF4A 2YMSC 4R8TB 2QE7D 3ZIAD 3L6PA 3O8BA 3P8OA 4TT3D 3LKWA 4F55A 3FKSD 2KCAA 2YMSD 1RGQA 3KF2A 3KN2A 1N1LA 2A4GA 5FPTA 5HKKD 5GNDA 5C0UA 3W1EA 2WSSD 4NWKA 3SZEA 3VG8A 4A1VA 3WW7A 5FPYA 4B75A 2V7QD 3N99A 4DT4A 2M2AA 3OFND 3FO8D 3LONA 4NWLA 2AHME 4ZCNA 4KTCA 2HLDD 3SU4A 2F4LA 2VBCA 2OC7A 1NS3A 2JJ1D 3SU3A 3SU6A 3SU5A 1JXPA 2OC0A 5T1VA 2A4QA 5EQRA 4YXWD 5F53A 4ASUD 3O8CA 1DY8A 5C0TA 3OE7D 1SKYE 2OC8A 5DSFA 4Q63A 3OEHD 2KCPA 2KCOA 2FOMB 1COWD 1RTLA 2JDID 1EFRD 1FX0B 3SU0A 2KCYA 3DCLA 3KNXA 1DXPA 4Q4LA 3SUFA 3RC6A 2K0QA 5H4IB 2K8IA 3FOAA 4JMYA 3E90B 2JIZD 3F2FA 5ETXA 5GPIB 1BMFD 5CHBA 2KZ4A 3U1JB 3H09A 2OBOA 3N7DA 3SU1A 5DN6D 3SYJA 4K8BA 2OC1A 1NBME 3PRBA 5IK2D 2W6JD 4A1XA 2XCFA 4M9FA 3SUGA 2KFWA 5FL7D 2WZQA 3KEEA 3SV8A 4B71A 4Z1MD 3AK5A 2QV1A 1DY9A 3EYDA 4A92A 1NBMD 2CK3D 4I32A 3F2GA 3M5NA 5EQSA 4B6EA 1OHHD 4WH8A 4FETA 1H8ED 3GS9A 1H8HD 3OYPA 5B6LA 3PRDA 3SUDA 1DXWA 3WWBA 3F3BA 3F0PA 1W3CA 3RC4A 1W0KD 2LELA 2QF5A 2OBQA 2WHXA 3LOXA 2L6OA 2F9VA 4WH6A 2F43B 5FPSA 5EPYA 2XNDD 3SV6A 3DSOA 4TSFD 2KM0A 3PV2A 2IJD1 3P8NA 4WF8A 4B6FA 3O8RA 4I31A 3M5OA 2JJ2D 3SV7A 3WWFA 2KR7A 2XNIA 3DSPA 4B76A 5IDKA 4I33A 3M5LA 2WV9A 4RI0A 2OINA 1E1RD 3M5MA 1WXRA 2WPDD 4B73A 3OAAD 5EQQA 3SV9A 5ESBA 1A1RA 3UB0A 2W6ID 2XCNA 2XOKD 2P59A 3OTPA 3OEED 1E79D 2GGVB 1W0JD 2FM2A 2IJOB 4U01A 3RC5A 2OK5A 4TYDA 2K1QA 5GJ4B 3SUEA 4B74A 2GVFA 1BT7A 1S6LA 1E1QD 2J5UA 5EPNA 1CU1A 2A4RA 4XD7D 3F0OA 5CDFE 5C17A 3N7EA 3F2HA 3PV5A 4A1TA 2FP7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F2F A;  3FN8 A;  5DSF A;  5C0U A;  3F0P A;  3F0O A;  5C17 A;  3F2H A;  5C0T A;  3F2G A; 
#chains in the Genus database with same CATH topology
 3LC3 A;  1C4Y 2;  1MQ5 A;  1GHW H;  3RLW H;  3M61 U;  1QQU A;  2Y81 A;  3LKW A;  1P11 E;  4AGJ A;  1YPH C;  2HPP H;  2YMS D;  1CGH A;  3F1S B;  4X1P U;  2XBY A;  1FY4 A;  4I8L A;  1V2O T;  1O39 A;  2OQ5 A;  2SGD E;  2XC4 A;  3SN8 A;  4JK6 A;  1E34 B;  2FMJ A;  3SU4 A;  5A8Y A;  4BAN B;  5HM2 A;  1TMU H;  1Z8G A;  7GCH G;  3MQK C;  4YXW D;  2AGE X;  4I8G A;  2QGR A;  1AGJ A;  3GY6 A;  1HGT H;  2Y6T A;  3HPT B;  5JPM H;  1ZJK A;  3OEH D;  3QTV H;  4NA7 A;  2F83 A;  2VIQ A;  2FES H;  3VGC C;  3ZZC A;  3MNS A;  3A89 A;  1FX0 B;  1O2R A;  3K2U A;  5HXF A;  2FTL E;  3FOA A;  3PV4 A;  5CHB A;  5BPE A;  3U8R H;  1TRM A;  1BJU A;  1FIZ A;  1HAY B;  4Y0Y E;  4PRO A;  2ZU2 A;  3M3S A;  1GGD C;  1GBF A;  1OWE A;  1P06 A;  5IK2 D;  3EAJ A;  4M9F A;  2G81 E;  4B71 A;  2R3U A;  1DPO A;  1PJP A;  1QRZ A;  1TLD A;  1O2Z A;  1C2H A;  2FYQ A;  1AQ7 A;  3SQH E;  2VWM A;  1J16 A;  4FUE A;  3H7T A;  2ZFQ H;  4UDW H;  3LOX A;  2F9V A;  1GBH A;  1TMB H;  1DM4 B;  4X2Y A;  5B6O A;  8LPR A;  3SV6 A;  2A0Q B;  4TSF D;  1UVP A;  2FS8 A;  2IJD 1;  2GT7 A;  4B6F A;  1NFW A;  3M5O A;  4OGX A;  1N6Y A;  2WV9 A;  1P2J A;  3M5M A;  1EJM A;  1IQF A;  1FY5 A;  5LH8 A;  1O2H A;  1QL8 A;  1MKW H;  3Q76 A;  2WUB A;  1YM0 A;  4YOJ A;  3LT3 A;  2C8W B;  2A4O A;  2TIO A;  1OKX A;  3EA8 A;  2O8W A;  3FP7 E;  1T8M A;  3W94 A;  4UE7 H;  2A4R A;  4WWY A;  4X1R U;  3QWC H;  1O3D A;  6LPR A;  3FN8 A;  1G30 B;  1ZGV A;  2XBW A;  1GVZ A;  1TOC B;  1KLT A;  1C1W H;  2PKA A;  2XYA A;  4FOU C;  1HJ8 A;  1K9O E;  1AMH A;  1YLD A;  1UK4 A;  1O36 A;  1C1O A;  2XRC A;  2WSS D;  3FZZ A;  1O2S A;  1VIT G;  1ETT H;  1AI8 H;  2QYI A;  3TJU A;  2VIO A;  5KEC A;  2BD9 A;  4HG6 A;  4BAQ B;  2ZFT A;  1K0H A;  4FUB A;  3SU6 A;  5C20 A;  1OXG A;  1UTM A;  2V35 A;  1WTG H;  3VB6 A;  8GCH G;  2RFK C;  3PM3 A;  2HVY B;  2ZEC A;  2FOM B;  1HYL A;  1HJ9 A;  1BQY A;  1DXP A;  1FQ3 A;  3HK3 B;  1QIX B;  1HLT H;  3F2F A;  1O2L A;  3ZVE A;  1P10 A;  1C1V H;  3SI4 H;  1XVM A;  1L1G A;  2PUQ H;  2OC1 A;  1BDA A;  1F5R A;  1LVB A;  4KTU A;  5GIB A;  2ZCL P;  3AAS A;  2BZA A;  3LDX H;  2WPM S;  4IC6 A;  4A92 A;  1MTV A;  1M9U A;  1IQL A;  3A7X A;  1HNE E;  1QHR B;  1JIR A;  1DAN H;  1GBK A;  1GMD F;  3SUD A;  1TX8 A;  2ZO3 H;  2TBS A;  4GUX A;  4GHQ A;  2GDE H;  1FY8 E;  2HVX A;  1IQM A;  1BRU P;  2WYG A;  1D9I A;  4XRN A;  1QBO A;  2KR7 A;  1TBR H;  1GI6 A;  2EST E;  2D8W A;  9EST A;  1TNH A;  2PKA B;  1ZZZ A;  4WMD A;  2W5E A;  2A5I A;  5EQQ A;  1VJ9 U;  2NU4 E;  3EDX B;  2VID A;  1WQV H;  5C1U A;  2V6N A;  4ZUH A;  4GAW A;  2IJO B;  1TFX A;  3D49 H;  4YT6 H;  4YLQ H;  2P8O B;  1TGS Z;  1OWH A;  4F49 A;  4THN H;  3A7Z A;  4X1S U;  2AMQ A;  1YPE H;  3NRL A;  4RSP A;  1FN6 A;  1OWI A;  4MNX A;  1BBR H;  4DT7 B;  1DWB H;  1P12 E;  3GDU A;  3BIV H;  1QRX A;  1VGC C;  2C8X B;  1ZJD A;  3CS0 A;  2AIP A;  1N1L A;  3NK8 A;  1AFQ C;  2J4I A;  3E16 B;  2ZZU H;  4A1V A;  4XOJ A;  1Y3U A;  2WUC A;  1SGP E;  4JZE H;  1YWU A;  1TGB A;  2PP6 A;  2QXG A;  4NWL A;  1MBQ A;  4NG9 H;  7GCH F;  3DD2 H;  4ZCN A;  3S7H B;  1WU1 A;  2F4L A;  2CV3 A;  3FAO A;  5DKM A;  3UWI A;  1O3P B;  3RXI A;  4X1N U;  4UD9 H;  1D3P B;  5C0T A;  1TWX B;  7EST E;  1C5S A;  1YC0 A;  5EXM A;  1LHF H;  2HPQ H;  4B2B A;  2Z9K A;  2KCY A;  3BV9 B;  4ZAE A;  3MU5 A;  1F0R A;  1O0D H;  2XTT B;  3SUF A;  1OOK B;  1AZ8 A;  1ZR0 A;  2K0Q A;  1B7X B;  1CHG A;  3DA9 B;  1Y3V A;  1INC A;  1S83 A;  4Z0K A;  1KXD A;  2KZ4 A;  3PWC A;  1W0Z U;  1YPK H;  4CRE A;  3LIW A;  1IQJ A;  1VKY A;  2BZ6 H;  2PGB B;  3SV8 A;  1WDI A;  2PSY A;  1SQT A;  1GVK B;  2O8L A;  2VGC B;  1IQG A;  4IN1 A;  4I32 A;  1AB9 C;  1NRR H;  2OP9 A;  1KIG H;  3SJK A;  1O2X A;  2UWO A;  1ZML A;  3RXB A;  1PPE E;  2BDI A;  4P02 A;  1MTW A;  1W13 U;  1DST A;  2EY4 C;  4AFU A;  5F8Z A;  3OTJ E;  1P04 A;  5AHG H;  5DP4 A;  1GJ9 B;  2BDB A;  1FN8 A;  1YY3 A;  4KTS A;  4BTU B;  3BTF E;  2PHB A;  3A7V A;  1KY9 A;  3BEF B;  2B0F A;  2R2M B;  3RU4 T;  2AS9 A;  4DUR A;  3STJ A;  1S81 A;  1QJ1 B;  2AIQ A;  4UON A;  1DLE A;  2FM2 A;  1C5V A;  1GJ7 B;  3UR9 A;  3ZVC A;  1K2I 1;  6GCH G;  3M3V A;  1T8N A;  1SFI A;  2ZDV H;  3BG4 C;  2BQW B;  1O3N A;  1WQS A;  2NU0 E;  2P95 A;  4CRB A;  3V3M A;  1H8I H;  1SFQ B;  1KMH B;  1UCY H;  1P05 A;  1DSU A;  2PW8 H;  5F8X A;  3U8O H;  3SO3 A;  2AFQ B;  2O9Q A;  1C2G A;  1H9H E;  4MNV A;  5GND A;  5C0U A;  3SV2 H;  1OX1 A;  4MDS A;  1YPJ H;  3ZZA A;  3NZI A;  1A7S A;  1FAK H;  1GBE A;  4IGD A;  4DT4 A;  3UIR A;  1GJC B;  1W2K H;  1FIW A;  1PFX C;  2GZ8 A;  3N7O A;  3URD A;  4E7R G;  1C5L H;  2ZHW H;  8GCH F;  3PMJ A;  5JBA S;  4FVD A;  1PPG E;  5EQR A;  4XE4 A;  5DSF A;  1F0S A;  3G01 A;  5FX5 A;  6CHA B;  1QB9 A;  5A0A E;  5LPE A;  3EE0 B;  2JDI D;  1OWJ A;  1SR5 C;  2F9N A;  4XDE A;  4AZ2 B;  3E90 B;  1QB6 A;  2JIZ D;  1LPK B;  3GOV B;  4K1E A;  2VJ1 A;  1GMH G;  2ZF0 H;  2J9N A;  3GCH C;  3RUO A;  1HCG A;  3TH3 H;  1HIA B;  2Z9G A;  1N6X A;  1RRK A;  1ZTK A;  2XCF A;  2A45 B;  2YNA A;  4VGC C;  5JB8 S;  2Q6G A;  1EAS A;  1XX9 A;  1DY9 A;  3W95 A;  1HJA B;  3AAV A;  2GMT C;  4X6P A;  2FOD A;  1XVO A;  2ZP0 H;  3GS9 A;  1HBT H;  1AO5 A;  3ATK A;  3R0F A;  3GY3 A;  1NRN H;  1KXA A;  2EEK A;  1GI9 B;  1P3C A;  3RC4 A;  2PLX A;  4O97 A;  3Q3Y A;  1MAX A;  1IHT H;  1N8O B;  5DPA A;  2L6O A;  5HM9 A;  1FLE E;  1O2P A;  3GY2 A;  1CT0 E;  2J95 A;  5EPY A;  1TGN A;  1UTN A;  2BD8 A;  1A46 H;  3BTD E;  2G5V A;  3L33 A;  1ELG A;  1K1I A;  1EB2 A;  3GDS A;  2J97 A;  4Y8Y A;  1WTH D;  1Y5B T;  2Z3E A;  2PUX B;  4DJZ B;  3F9H A;  2VIV A;  3FFG A;  2GV6 A;  2XOK D;  2CXV A;  5E0H A;  3FAN A;  1ZMJ A;  1W0J D;  4DG4 A;  2BYA X;  4CRA A;  3ATM A;  3RXG A;  1O2I A;  2A2X H;  1T31 A;  3FP6 E;  1GJ6 A;  1S6L A;  1BTY A;  3EA9 A;  4AG2 A;  2P3T B;  2YMS C;  4IMZ A;  3SNB A;  1TBQ H;  1C5P A;  1CA0 B;  3AW0 A;  2KX4 A;  3P70 B;  1O5B B;  4BTT B;  1ZPB A;  2H9E H;  4BTI B;  4AOR A;  1C1M A;  4LOY H;  3RDZ A;  3MOC A;  2RA0 A;  3LGU A;  1LHC H;  1V2L T;  4SGA E;  5JYI A;  2SGP E;  5A8Z A;  3UWJ H;  1U6Q A;  5L2Z H;  1DDJ A;  4O3T A;  2HRV A;  3LU9 B;  2BX3 A;  2XW9 A;  1TE0 A;  4Y79 A;  2ZFF H;  2VBC A;  1TOM H;  3LH3 A;  2Z9L A;  3E0P B;  4X6M A;  2OC0 A;  2A4Q A;  3TU7 H;  5TCC A;  1V2W T;  3SGA E;  3F68 H;  4ASU D;  1GBM A;  3O8C A;  2VWL A;  1SKY E;  3QO6 A;  3F9F A;  2TRM A;  2BY8 X;  4MQA A;  5E8E H;  2ZTX A;  1C5M D;  2GTB A;  4RN6 A;  3TVJ B;  1SVP A;  3A7W A;  1N8O C;  4DGJ A;  4B2A A;  5A09 A;  4X6O A;  3RXS A;  3RXD A;  1HAI H;  4E06 H;  1GG6 B;  3P8G A;  1GVL A;  2PKS C;  5C5O A;  2HOB A;  1UTP A;  3PRB A;  4AFS A;  2OCV B;  1GCT B;  1GJD B;  2GD4 B;  3KQC A;  1UJ1 A;  1LHG H;  1BTZ A;  4FUI A;  2B7D H;  1GJ4 H;  2G4T A;  2Y80 A;  4ZKO U;  5DP8 A;  2ULL A;  2PWX A;  2QIQ A;  5CHA C;  2ZU1 A;  1YPG H;  3OYP A;  5A8X A;  1P2I A;  1NO9 H;  3ZZD A;  1C2J A;  1V2R T;  4UFF H;  3T26 A;  1ANE A;  1AUJ A;  1YKT A;  4CRF A;  1Z1I A;  5JBC S;  4X2W A;  3CP7 A;  2FO9 A;  2WHX A;  3GCT G;  1TRY A;  4ABH A;  1SC8 U;  1G3E A;  2FWW A;  1CVW H;  3SW2 B;  3Q00 A;  5DP6 A;  4Q7Z A;  3SV7 A;  1TIO A;  1FAX A;  1W7X H;  2A2Q H;  5J4Q A;  2OIN A;  2HWL B;  3H7O A;  1S6F A;  1O3K A;  3AAU A;  5KED A;  1A1R A;  4JCN A;  3UB0 A;  3OTP A;  1P2N A;  6GCH F;  1AVG H;  1BTU A;  1T7C A;  3GIS B;  4X6N A;  2CF8 H;  2BDC A;  1DWC H;  3SUE A;  4CRD A;  2F9B H;  1K1N A;  5EPN A;  3MU8 A;  2FI3 E;  4NA8 A;  5FCK A;  1LMW B;  2Y7Z A;  4A6L A;  2A5A A;  1QTF A;  5KGO A;  1GMC G;  2EI7 A;  1F5K U;  2BY6 X;  2IN2 A;  1TAL A;  2QC2 A;  4WMF A;  1ELB A;  3BIU H;  3SU2 A;  1EAW A;  1HUT H;  1QGF A;  1B5G H;  1B0E A;  1TGT A;  1MAY A;  3QK1 A;  1KDQ A;  1O2N A;  1YCP M;  2GV7 A;  2KCA A;  3KN2 A;  3BTM E;  2THF B;  1SGE E;  1SGQ E;  2A31 A;  2V3M A;  2ZNK H;  5EW2 H;  2Q6F A;  1HXE H;  2M2A A;  3OFN D;  3FO8 D;  3IG6 B;  1F5L A;  3LON A;  3RXK A;  1ZHR A;  1V2N T;  3KID U;  2J34 A;  4I8H A;  1SQA A;  5JB9 S;  3PMA B;  1G36 A;  2BX4 A;  3SNC A;  5I25 A;  1K1L A;  1DWE H;  4DOQ A;  3DCL A;  1GBB A;  4RKO B;  2ZPS A;  4AG1 A;  5H4I B;  1ABI H;  2AMP A;  1GMH F;  1H9L B;  1AVX A;  1RIW B;  1O5F H;  4ISH H;  1Z71 A;  3SU1 A;  4AN7 A;  4K8B A;  1PQ8 A;  1MD8 A;  1ESB A;  4U2W A;  3FP8 E;  4A1X A;  1NY2 2;  2BLQ A;  4JYU H;  3MNX A;  1GBL A;  1MZD A;  4GLY A;  3A84 A;  2FIR H;  3GY7 A;  1YPM H;  4HTC H;  5AVD A;  3VFE A;  5EOD A;  5B6L A;  1OWK A;  1Y5U T;  4SGB E;  4YOG A;  1OYT H;  1FV9 A;  1W0K D;  1FXY A;  2DE8 A;  3LGW A;  2QXJ A;  3O8R A;  1NRO H;  2AER H;  1O2V A;  3GY5 A;  3MU4 A;  2G00 A;  2WPD D;  1TRN A;  5FBE A;  1FMG A;  1KDQ B;  1NT1 A;  1FUJ A;  4CBN A;  2ZQ2 A;  3M7T A;  1C2L A;  1ACB E;  1E79 D;  1QFK H;  1J17 T;  2JET C;  3BEU A;  1ANC A;  3LGV A;  3BEI B;  1EPT A;  5EGM A;  2ZDM A;  5GXP A;  3TH4 H;  1VZQ H;  2J5U A;  1JWT A;  3B8J A;  1NFY A;  4A1T A;  2LP6 A;  5BRR E;  5FAH A;  2YOL A;  4IW4 E;  1DWD H;  1TQ0 B;  3U1I B;  2P16 A;  2RA3 A;  1RS0 A;  1MH0 A;  2UUK B;  1O38 A;  4O3U A;  1O33 A;  5C67 A;  3FKS D;  1WV7 H;  2A4G A;  4X8S H;  1C2M A;  1RIW C;  3ATL A;  4YES B;  1O3L A;  1TA6 A;  3M36 A;  2JJ1 D;  2BOH B;  1F92 A;  2BY7 X;  5T1V A;  2PV9 B;  2ZPQ A;  1PPB H;  2CGA A;  5F53 A;  4JYT A;  1UTJ A;  3TGI E;  1MD7 A;  1QNJ A;  1TGC A;  3CS7 A;  4Y7B A;  2G8T A;  1CT2 E;  2BXT H;  4M7G A;  4DIH H;  2J38 A;  2ANM H;  1DLK B;  1IQN A;  1KXF A;  1LVM A;  4Q4L A;  5DGJ A;  5LGO A;  4ZHL U;  4INK A;  2BD5 A;  1GHA G;  4CRG A;  4MNW A;  4BNR A;  1LQE A;  2WYJ A;  2ASU B;  3SYJ A;  2QAA A;  1BTX A;  3A8A A;  2ODY B;  3PTN A;  2V3H H;  3RP2 A;  2WZQ A;  2ZQ1 A;  2P93 A;  2QV1 A;  2XBV A;  3EYD A;  1SB1 H;  3U69 H;  3F2G A;  1S6H A;  2ZPR A;  3KQB A;  4WH8 A;  1Y5A T;  3T28 A;  2J92 A;  4UFE H;  3B23 B;  1TAW A;  1W8B H;  1PPH E;  2HLC A;  1ZHP A;  1EPT B;  3LPR A;  2RDE A;  3QZR A;  4E7N A;  3BTK E;  3F0P A;  3ZYD A;  4X2V A;  3GCO A;  3HKJ B;  1TPO A;  1YPH E;  3HKI B;  2Y5G A;  4U32 A;  1NRS H;  2GCH G;  3BTT E;  2VIP A;  1MTS A;  2ZFS A;  2C90 B;  1EB1 H;  3S0N A;  1J15 A;  5F03 A;  5I46 H;  1TPS A;  2C8Z B;  2OUA A;  2IOT A;  5C2Z A;  2FS9 A;  4CHA B;  2VVU A;  3ELA H;  2EI6 A;  1P3E A;  2GJG A;  2P59 A;  1QL7 A;  2XC5 A;  1SSX A;  5TJX A;  5C94 A;  4FU7 A;  1S0R A;  1P9S A;  2IPQ X;  4I8K A;  3ZVA A;  4AFQ A;  4NGA H;  1C5U A;  2QA9 E;  4MPU A;  1E1Q D;  1GMC F;  2PGQ B;  1ELA A;  1XXF A;  5A2M H;  3QUM P;  1WAY B;  1MKW K;  1J9C H;  2FP7 B;  2BB4 A;  2ZTZ A;  4ISL A;  2LNC A;  1EJA A;  2BVR H;  1AWF H;  4NZQ A;  3BTG E;  1O3A A;  1ELE E;  3A88 A;  5EJ1 A;  1NES E;  4BAO B;  1YPL H;  2JKH A;  3QGJ A;  3A82 A;  1RFN A;  3W1E A;  1HAV A;  1WYK A;  3ZV8 A;  4X8U H;  1O3B A;  1MUE B;  3S9C A;  1MU8 B;  2JH6 D;  4F48 B;  4JZ1 A;  1GHY H;  2FOC A;  3MO6 A;  1NM6 A;  4WME A;  2BDG A;  1T8L A;  1SHY A;  2ANK H;  4TWY A;  1UW7 A;  5EXN A;  2OC8 A;  1CO7 E;  4FUJ A;  3P8F A;  1T4U H;  2ANW A;  1A5G H;  2KCP A;  1F0T A;  3A80 A;  2Y7X A;  1QJ7 B;  1GL0 E;  2XXL A;  3LJJ A;  4X0W U;  5E0G A;  5HIY A;  1RTL A;  2WV4 A;  3OU0 A;  2BDY A;  1KTS B;  5T6F A;  2HNT C;  3SJO A;  4AFZ A;  1GBT A;  1Z6E A;  2GZ9 A;  1C5Y B;  1RXP A;  1BMF D;  2VWO A;  2BMG B;  4NFF A;  1G37 A;  1CE5 A;  1KXE A;  3RXT A;  4X1Q U;  1NU9 A;  2J98 A;  2ZKS A;  1SGY E;  2HNT F;  3P92 A;  4P00 A;  3AK5 A;  2FOG A;  3C27 B;  1GJ5 H;  1P2Q A;  1NRQ H;  5T6D A;  1ZYO A;  2G5N A;  1O3M A;  1D4P B;  1BCU H;  2QF3 A;  3EE7 A;  3MO3 A;  3MU1 A;  1FNI A;  1TPP A;  3SNA A;  1J8A A;  1G3D A;  1O34 A;  1QR3 E;  3SGQ E;  1DOJ A;  1KXB A;  1H4W A;  2XBX A;  2Y5H A;  2EQN A;  1BUI A;  4TY7 A;  5IDK A;  1O5A B;  1DFP A;  3QTO H;  3IWM A;  2UWL A;  3KQD A;  1HAG E;  3A8D A;  2W6I D;  1TQ7 B;  1T32 A;  2XWB I;  2H1U A;  1AFE H;  1C2D A;  1LQD B;  3MI4 A;  1HAV B;  4E05 H;  2P8O C;  1GHB G;  5E2O A;  5L6N H;  2WPJ S;  3TGK E;  1ORF A;  1K1P A;  2ZCK P;  3ODF A;  2GVF A;  5E0J A;  3TJO A;  1T8O A;  1NFU A;  1GHZ A;  1SOZ A;  3OX7 U;  4K8Y A;  1CHO G;  2AH4 X;  2ZA5 A;  4DCD A;  1DUE A;  2DE9 A;  1VCP A;  3BG8 A;  2PTC E;  1O30 A;  3URE A;  2FOE A;  4HZH A;  1HIA A;  1O37 A;  1PQA A;  2ZDN A;  3A8B A;  1ARB A;  2F9U A;  4D76 A;  4R8T B;  3NCL A;  1IAU A;  4ZKR U;  5J4S A;  2Y82 A;  3SNE A;  3SHC H;  4ZHM U;  5FPT A;  1HXF H;  1HAX B;  2QF0 A;  1AHT H;  1NN6 A;  5C1Y A;  2VU8 E;  3VG8 A;  1BBR K;  3E8L A;  3N99 A;  2VH0 A;  2BD3 A;  4K3J A;  1GI2 A;  3SHA H;  2Q6D A;  2J98 B;  4B2C A;  3K6Z A;  1W12 U;  3DT0 H;  3SU3 A;  1DIT H;  2BLV A;  2Z6B D;  1AD8 H;  1TON A;  1ESA A;  2CHA B;  1O3J A;  1SL3 A;  2VVV A;  2GKV E;  3PTB A;  1COW D;  1GI4 A;  1Y3W A;  5E2P A;  1SLU B;  4NIY A;  1BML A;  1V6D A;  1D6R A;  2KAI A;  1GHA F;  1VIT F;  1P9U A;  1ABJ H;  3ZVD A;  3ATI A;  3PLK A;  4RKJ B;  4GCH G;  1MMJ N;  1GBJ A;  3N7D A;  4NA9 H;  3QLP H;  3H5C B;  1P2K A;  1BTH H;  4Z1M D;  1PPF E;  5EOK A;  2VGC C;  2G4U A;  3E1X B;  3D65 E;  3OSY A;  4X8T H;  4J1Y A;  3TJV A;  1P2O A;  1RTK A;  2FEQ H;  2Z3D A;  1ZTL A;  2ZG0 H;  4OS2 A;  1C5Q A;  4RT1 A;  4TPY A;  3RXV A;  1JMO H;  1EZX C;  1Z1J A;  1Q3X A;  3SGB E;  3F3B A;  3VPK A;  1ZLR A;  2GCH F;  2C93 B;  2QF5 A;  1PPZ A;  2V3O H;  3TH2 H;  3A86 A;  1PYT D;  4YO9 A;  3P8N A;  1D6W A;  4H6S B;  3ZYE A;  4DW2 U;  3LC5 A;  2HNT E;  5SGA E;  3M7Q A;  4CH8 B;  4KGA A;  2AEI H;  4TY6 A;  7LPR A;  2OD3 B;  1EAU A;  3JZ2 B;  3OAA D;  1ARC A;  1O3O A;  1OP0 A;  4FUH A;  4WY3 A;  2UWP A;  3P6Z B;  4INL A;  4WVP E;  4BAK B;  1C5R A;  1PPC E;  4LZ4 B;  3I78 A;  4B1T A;  3ZZ4 A;  3MU0 A;  4Q7X A;  4TYD A;  4B74 A;  1RTF B;  1OYQ A;  1PQ7 A;  3F0O A;  3NUM A;  1LO6 A;  1UHB B;  3LJO A;  3UNS A;  1SG8 B;  3UFA A;  4Y8Z A;  1G3C A;  3ATW A;  1UTQ A;  4Z6A H;  1QA0 A;  2ZIQ H;  1BA8 B;  2LPR A;  1AN1 E;  1C1R A;  1ID5 H;  3SJ8 A;  2CHA C;  1V2V T;  1EP6 A;  2HAL A;  3NXP A;  2QE7 D;  2FOF A;  2WIN I;  1FY1 A;  3ZZ6 A;  2P3F H;  3SOR A;  2BOK A;  2KAI B;  1NPM A;  1BHX B;  3SZE A;  4NWK A;  4IS5 A;  3VB3 A;  1UCY K;  4XBD A;  5FPY A;  1F7Z A;  1NU7 B;  1FI8 A;  3C1K A;  1C5Z B;  5FX6 A;  1EUF A;  3R3G B;  1ZOM A;  2VVC A;  2TPI Z;  5T3H A;  1CSO E;  4MTB A;  2OC7 A;  3A83 A;  3A87 A;  1LKB A;  1EAX A;  3I29 A;  1QUR H;  1JRS A;  1SOT A;  1LVO A;  1YBW A;  6CHA C;  2ILN A;  4GVU A;  2DUC A;  3EQ0 H;  2H9H A;  3KL6 A;  3UR6 A;  1HAP H;  1BRB E;  1THS H;  1CBW B;  1LPZ B;  1NFX A;  1CGI E;  2GCT B;  1XMN B;  4DII H;  3PO1 B;  2EA3 A;  3TK9 A;  1O3F A;  3MHW U;  1LKA A;  3H09 A;  2OBO A;  4OS6 A;  1BOQ A;  3M7U A;  3A85 A;  1X7A C;  1O2W A;  4KEL A;  3RXA A;  3STI A;  2J94 A;  3VB5 A;  3GYL B;  2XC0 A;  3AW1 A;  4FUC A;  1HJA C;  2AGI X;  2H9T H;  4HI3 A;  3M5N A;  1H1B A;  5EQS A;  2A7J A;  4IMQ A;  4OS1 A;  1YLN A;  2Z7F E;  1TA2 A;  4K2Y A;  3PB1 E;  2ALP A;  1H8E D;  1Y8T A;  2ZHF H;  3AVZ A;  3ODD A;  1H8H D;  3RXP A;  1B0F A;  3S7K B;  5K7R A;  3TGJ E;  1AY6 H;  4ASH A;  3M35 A;  1UVO A;  3CNR A;  2ZU4 A;  2ZWL H;  2BDH A;  1ELD E;  2F43 B;  4LXB H;  4OS7 A;  5DO4 H;  2KM0 A;  1WOF A;  3CEN A;  3GDV A;  1BB0 B;  3WWF A;  1P03 A;  2ZTY A;  3D23 A;  1EJN A;  2H2Z A;  3TK5 A;  4CR5 A;  1IQE A;  1WXR A;  5AFY H;  3TNT A;  2FLR H;  2FI5 E;  1W7G H;  4X2X A;  4B73 A;  4Y10 E;  1O2K A;  1IHS H;  2H6M A;  4F4O C;  2A7H A;  2Z9I A;  4BAH B;  3RXF A;  1CHO F;  5GJ4 B;  1A3B H;  3TIT A;  1GI3 A;  5GWZ A;  1MKX H;  2FI4 E;  5C17 A;  4ZH8 A;  2ZGC A;  3UNR A;  2OLG A;  4ABD A;  1CA0 C;  1K1J A;  1L2E A;  1VCQ A;  5LPF A;  2WV5 A;  3SZN A;  1D3D B;  1SLX B;  3VB7 A;  5G4B A;  3MMG A;  4TWW A;  2QF4 A;  3RM0 H;  2FOA A;  1A5H A;  3P8O A;  2BD2 A;  2FX6 A;  2QXH A;  2GCT C;  4F55 A;  1T4V H;  1KTT B;  3E6P H;  2ZGX H;  1S84 A;  1GI0 A;  4MVN A;  1VIT H;  3TIU A;  1SI5 H;  5JDU B;  4XFQ A;  5C1X A;  3E0N B;  2FLB H;  1FJS A;  1OSS A;  1FDP A;  4ABE A;  3RXH A;  1MZA A;  3NWU A;  5EJZ A;  2FDA A;  1W14 U;  4D9Q A;  3ZZ7 A;  7KME H;  4NIX A;  1JXP A;  1TNI A;  2D1J A;  1WCZ A;  4JZD H;  3BTH E;  2A7C A;  4IC5 A;  2ZI2 H;  3SBK A;  3NKK A;  2VIW A;  3DHK H;  2KCO A;  3SND A;  1XXD A;  1GBA A;  1AND A;  1HFD A;  1SGF G;  3SI3 H;  2STA E;  3SU0 A;  1YYY 1;  1KLI H;  3VGC B;  1GMD G;  3LGY A;  4GCH F;  1GG6 C;  1O2U A;  2BTC E;  5ETX A;  4AOQ A;  1OWD A;  4K1T A;  1XUH A;  5T6G A;  3FVF B;  1GCT C;  3M3T A;  2F3C E;  1ZGI A;  3RLY H;  1QBN A;  4HFP B;  1C1S A;  1P01 A;  1EOJ A;  2R0K A;  4FUF A;  5FL7 D;  2RDL A;  1E35 B;  4AYV B;  1ELC A;  4OS5 A;  4GPG A;  4XBB A;  4B6E A;  3ITI A;  4YT7 H;  1BRC E;  5JBT A;  1EKB B;  1TX7 A;  2PR3 A;  1SGC A;  3K65 B;  4BOH A;  4ACB A;  1G2M A;  1W10 U;  4FVB A;  1BMM H;  2AGG X;  1KXC A;  3ZV9 A;  1BRA A;  3A81 A;  1LCY A;  1Y3X A;  1FON A;  1SLV B;  3QDZ B;  4D9R A;  1QQ4 A;  2R2W U;  1KSN A;  5HYO A;  2ZDL A;  1SGF A;  2FX4 A;  5DP7 A;  5L30 H;  3QX5 H;  1JRT A;  1MKX K;  1HB0 B;  3BTW E;  1ETR H;  5F8T A;  1V2K T;  3RXC A;  3UQV A;  1O5D H;  4DY7 B;  1THP B;  1TNL A;  4YOI A;  1O2T A;  5EIY A;  1S85 A;  2J2U A;  1NC6 A;  1C9P A;  1CU1 A;  3EGK H;  2BQ6 B;  5FXL A;  4AC9 A;  1W11 U;  1UVU H;  4MNY A;  1ZTJ A;  2O8M A;  1C4U 2;  1A61 H;  3S9A A;  3K9X B;  4OM9 A;  1HV7 A;  3L6P A;  3BN9 A;  3O8B A;  3MNC A;  1V3X A;  1FZZ A;  3KF2 A;  1RGQ A;  4Y11 E;  1EOL A;  2ZFP H;  3TK6 A;  1C1T A;  6EST A;  2TGP Z;  1OP8 A;  3VXF H;  5DP5 A;  5EXL A;  3T62 A;  2F9P A;  3PRO A;  2BVS H;  1D3Q B;  2FOH A;  1QZ8 A;  2P3U B;  3UQO A;  4AB8 A;  2HLD D;  1QA7 A;  3DFJ A;  1MBM A;  1UK3 A;  4MLF B;  3RXO A;  1EZS C;  1C1P A;  3E3T A;  1AWH B;  5ABW A;  5GDS H;  4H4F A;  2A1D B;  1EFR D;  4FU8 A;  1V2M T;  1O3C A;  3KNX A;  1TPA E;  4FUD A;  5AF9 H;  3OY6 U;  1C2F A;  1A0L A;  1GDU A;  5JBB S;  2ZGJ A;  2W3K A;  4BAM B;  3U1J B;  1Z8R A;  2BVX H;  2CF9 H;  1O3I A;  1GI8 B;  3VXE H;  3SUG A;  2O8U A;  1KYN A;  3RXE A;  1FPC H;  1GHV H;  1A5I A;  2C8Y B;  1SGT A;  1GBC A;  1NZQ H;  2V0B A;  1OHH D;  1AE8 H;  1OP2 A;  2OTV A;  2W7S A;  2BDA A;  2BXU H;  3PRD A;  4UFG H;  3FZD A;  3WWB A;  5HIZ A;  1W3C A;  2FOB A;  2H5D A;  1RD3 B;  1GJ8 B;  1L4Z A;  2G51 A;  2VNT A;  3DSO A;  2STB E;  3ZZB A;  1P0S H;  2G52 A;  2Q1J A;  1E37 B;  1LVY A;  3KQ5 A;  1DE7 H;  2PSX A;  4I31 A;  1EQ9 A;  2JJ2 D;  3E91 A;  1AU8 A;  2F9O A;  4I33 A;  3ZZ3 A;  4A5T S;  1E1R D;  4RT0 A;  1E0F D;  3F9G A;  3QN7 A;  4CH2 B;  3SV9 A;  4MPW A;  1C4V 2;  1QCP A;  3D62 A;  3GY4 A;  1LHD H;  1CT4 E;  1ELT A;  1NRP H;  4INH A;  1O2J A;  1G32 B;  1XUF A;  1TNJ A;  2A32 A;  3RC5 A;  5GCH G;  3SJI A;  2SNV A;  1L4D A;  2BD7 A;  3GCT F;  1JBU H;  1GDN A;  2ZC9 H;  5C3N A;  1MCT A;  1IOE A;  2UUJ B;  2RCE A;  3V0X A;  2SNW A;  1ZPC A;  1THR H;  1K21 H;  1P2M A;  2CMY A;  2ODP A;  1C1U H;  3O8D A;  4ZRO A;  2ZGB H;  1TNG A;  3WY8 A;  3ZIA D;  1J14 A;  2Z94 A;  1VGC B;  5HKK D;  2OXS A;  1ZSK A;  1BZX E;  2BY9 X;  4I7Y H;  1MQ6 A;  1AFQ B;  2VH6 A;  3MH6 A;  1OS8 A;  2V7Q D;  2SGA A;  1DT2 A;  1HPG A;  4Y6D A;  3TNS A;  1FPH H;  3BF6 H;  1ZRB A;  5A0C A;  4KTC A;  2R3Y A;  2UUF B;  4MPX A;  2EC9 H;  1BBR E;  4ABJ A;  3UTU H;  5HMA A;  3ZZ8 A;  4Y0Z E;  1QJ6 B;  3P95 A;  2FPZ A;  1DY8 A;  3GYM A;  1AUT C;  4K5Z A;  1TX6 A;  3B9F H;  1L0Z A;  1TYN A;  1O32 A;  3RXL A;  2F91 A;  3DUX H;  2SGQ E;  2C3S A;  3HGN A;  2W7U A;  1DS2 E;  1K28 D;  4CR9 A;  1MU6 B;  2CJI A;  2K8I A;  2PFE A;  3L3T A;  1O2Q A;  3MH7 A;  1O3H A;  4JMY A;  3RXM A;  1O3G A;  4WJG 2;  1UTK A;  2WPL S;  1NBM E;  2GP9 B;  1A3E H;  1BMA A;  4H42 U;  3MH4 A;  2G55 A;  1BJV A;  1SPJ A;  1FY3 A;  5FCR A;  8EST E;  1H9I E;  5FHT A;  4JK5 A;  1NBM D;  4K1S A;  1DIC A;  1PYT C;  1C5T A;  1AB9 B;  3VB4 A;  1GJA B;  1BIT A;  1V2S T;  1EPT C;  3RMO H;  1SQO A;  1ZRK A;  4NFE A;  3GIC B;  1ZHM A;  3LGT A;  1BTW A;  1QRW A;  2OBQ A;  1GL1 A;  3TPI Z;  4WXI A;  1UTL M;  1G3B A;  4WF8 A;  3LGI A;  1Z8J B;  1NTP A;  3DFL A;  4B76 A;  2FZZ A;  2NU2 E;  4CHA C;  2BQ7 B;  4YLU A;  2BHG A;  5AFZ H;  1GJB B;  2TGD A;  1WBG B;  3T29 A;  1GDQ A;  1S0Q A;  1C2E A;  1C5N H;  2ODQ A;  2GGV B;  1VJA U;  5EW1 H;  3ZZ9 A;  5EST E;  1TB6 H;  4EST E;  2Z9J A;  3F6U H;  5TCA A;  4NCY A;  5CDF E;  1Q2W A;  2NU1 E;  2NU3 E;  3BG4 B;  3F2H A;  1GI5 A;  2EI8 A;  3V12 A;  4NSY A;  3HAT H;  3SJ9 A;  3MH5 A;  4YTA A;  1O5E H;  3HK6 B;  2Z3C A;  1F2S E;  3QGN B;  1UVT H;  1SQR A;  4K60 A;  1LPG B;  4CRC A;  1EX3 A;  1UO6 A;  4TT3 D;  2WPK S;  3P17 H;  1IQI A;  5C5N A;  2D26 C;  9LPR A;  1EST A;  2M5T A;  1MCV A;  1XUG A;  3S69 A;  2O8T A;  3EST A;  1UCY E;  1C2K A;  4XBC A;  3SU5 A;  1LDT T;  3PLP A;  3JZ1 B;  5PTP A;  4ABF A;  4ABB A;  1K1O A;  3OE7 D;  1CGJ E;  4Q63 A;  4OS4 A;  3KQE A;  4Y7A A;  1BMN H;  3RM2 H;  4AX9 H;  1EZQ A;  1O2O A;  1UMA H;  1GI7 B;  1Z6J H;  1Z7K A;  2GX4 A;  4ACA A;  1HAH H;  5CE1 A;  2ZDK A;  3I77 A;  2JH0 D;  5GPI B;  4ISO A;  3KYF A;  1MTU A;  2QXI A;  1A0J A;  2VWN A;  3M37 A;  4H6T A;  2FTM A;  2JH5 D;  2B8O H;  1UHB A;  3GCH B;  4WXV A;  3UOU A;  3KEE A;  4ZKN U;  4VGC B;  3Q77 A;  1YP9 A;  4YM9 A;  1EAI A;  1XUJ A;  1SLW B;  1Y3Y A;  4UFD H;  3U98 H;  3MO9 A;  4AB9 A;  2GMT B;  1ELV A;  2W26 A;  1P02 A;  1ZPZ A;  4OGY A;  4CBO A;  1ZSJ A;  1C5X B;  4K69 A;  2LEL A;  3ZVB A;  2SGF E;  1MTN B;  1V2U T;  2ZCH P;  5LPR A;  3RU4 E;  2XND D;  1JIM A;  3U9A H;  1H8D H;  4Q7Y A;  1GI1 A;  1SGD E;  2ZU5 A;  2A5K A;  2XNI A;  2AYW A;  4NZL A;  4YZU A;  3RU4 D;  1YCP H;  4RI0 A;  3T25 A;  1XKB C;  1TMT H;  1O35 A;  2FXR A;  5ESB A;  1ZMN A;  5GCH F;  2Y5F A;  1QY6 A;  1GBI A;  1AZZ A;  2SFA A;  5F6M A;  1DUA A;  3KGP A;  3TLO A;  4ZKS U;  1O3E A;  3NPS A;  2OK5 A;  4LK4 A;  3MTY A;  4O9V A;  1JOU B;  1YF4 A;  1O2G H;  4UEH H;  3T27 A;  3RMN H;  4XD7 D;  4ISI H;  1EZU C;  3MWI U;  4KP0 A;  3N7E A;  1DX5 M;  5A0B A;  4NIV A;  3RXQ A;  2YMS B;  3UY9 A;  4AYY B;  4Q2K A;  3VEQ B;  1IQH A;  5DG6 A;  2R9P A;  2VB0 A;  2FYR A;  1QBV H;  1LTO A;  1P09 A;  4FXG H;  3KYG A;  2W3I A;  4ISN A;  1EP5 A;  2AMD A;  2QN5 T;  4AGK A;  2WPI S;  2RG3 A;  4HGC A;  2SGE E;  1C5O H;  1OPH B;  1ZSL A;  4B75 A;  2PTN A;  3HGP A;  3ENS B;  2C4F H;  3EA7 A;  1WUN H;  4BXS A;  2BY5 X;  2D2D A;  3DSG A;  1PQ5 A;  3BSQ A;  5DP9 A;  1AE5 A;  3S9B A;  1G2L A;  1P8V C;  2WPH S;  3A7Y A;  2UUY A;  2I6S A;  3OY5 U;  4I8J A;  4QT8 C;  1E38 B;  4XSK U;  5IYT A;  4A7I B;  1SBW A;  1YLC A;  4JZF H;  4MG3 A;  2I6Q A;  1C5W B;  1MTN C;  3RC6 A;  1ETS H;  2ZHQ H;  8KME 2;  4GHT A;  3GY8 A;  1S5S A;  2PKS B;  3UAI C;  3UPE A;  5DN6 D;  2TGT A;  3F9E A;  4X8V H;  3RXR A;  1XKA C;  3PLB A;  2W6J D;  2XWA A;  4ABA A;  1CA8 B;  3SOS A;  1L1N A;  4U30 A;  3A7T A;  1O5G H;  2CK3 D;  1V2T T;  4FET A;  4JYV H;  3A8C A;  1Z8I B;  5CHA B;  1EAT A;  1DXW A;  5DJ7 A;  1YCP K;  4IN2 A;  1GHX H;  4D8N A;  1HAO H;  2BM2 A;  1SGN E;  1BTP A;  4WH6 A;  1Q31 A;  2ZHE H;  2H5C A;  1XUK A;  2ANY A;  4NIW A;  2ALV A;  3RMM H;  1V2J T;  4TPI Z;  3M5L A;  3BTQ E;  3K6Y A;  4Y71 A;  2BD4 A;  3T5F H;  4Y76 A;  1G9I E;  1QL9 A;  2XCN A;  1ANB A;  5EJL A;  1AVW A;  4R0I A;  1A2C H;  1GCD A;  4JZI A;  3V13 A;  3PMB B;  4NSV A;  4U01 A;  4IBL H;  3ZZ5 A;  3MFJ A;  4FUG A;  1VR1 H;  5DP3 A;  2TGA A;  4Y8X A;  1V2P T;  2L74 A;  4Q80 A;  2P94 A;  1GBD A;  1IQK A;  2GT8 A;  1WSS H;  3MNB A;  1V2Q T;  2QCY A;  1K22 H;  3PYH A;  1AKS A;  1MAB B;  4GSO A;  1XM1 A;  2OQU A;  1A4W H;  1SHH B;  3ZVF A;  1D3T B;  1L1J A;  1TAB E;  5L2Y H;  2BLW A;  3U8T H;  4LZ1 H;  1GHB F;  2HGT H;  3T2N A;  4KKD A;  1O31 A;  1P57 B;  5K0H A;  2ZGH A;  4I86 A;  3GCN A;  3WW7 A;  2ZHD A;  1TNK A;  5DK1 A;  2AHM E;  1ELF A;  1C2I A;  1BHX F;  3RXU A;  4D7G A;  4J2Y B;  3Q3X A;  1NS3 A;  1EXF A;  5CMX H;  1C1N A;  2QY0 B;  1BIO A;  2BLO A;  1KLJ H;  1RJX B;  3RML H;  2IPH A;  3KHV A;  1CBW C;  3Q3K A;  1GWA A;  1QB1 A;  1F0U A;  1E36 B;  2R0L A;  3PO1 C;  1SGI B;  1HDT H;  2GZ7 A;  1O2M A;  4ZHA A;  1AIX H;  3U28 C;  1UVS H;  3QZQ A;  3IIT A;  4O03 A;  4D7F A;  1O5C B;  2YNB A;  2ZFR H;  1K1M A;  1TBZ H;  1SMF E;  5FBI A;  5HGG A;  1UK2 A;  2GDD A;  3MYW A;  2KFW A;  1GPZ A;  1HRT H;  1SGR E;  1UTO A;  1C9T A;  3ZVG A;  3UUZ A;  2VIN A;  2B9L A;  3KCG H;  3TJN A;  3PWB A;  4BXW A;  4ZXX H;  1XUI A;  2ZU3 A;  3PMH B;  1A0H B;  4FU9 A;  5FPS A;  3PV2 A;  4ZXY H;  3V7T A;  3URC A;  1O2Y A;  3UNQ A;  3BTE E;  1YGC H;  1AKS B;  3DSP A;  1GGD B;  3LH1 A;  2B5T B;  2CN0 H;  1S82 A;  4MPV A;  1HAZ B;  2ZDA H;  5EG4 A;  1LHE H;  1Y59 T;  1W0Y H;  4DVA U;  1C1Q A;  3OEE D;  4ABG A;  3SQE E;  5EU8 A;  3RXJ A;  2NWN A;  4ABI A;  2JET B;  2K1Q A;  2ZEB A;  4ZMA H;  1BT7 A;  3UOP A;  1VCW A;  3PV5 A;  1CQQ A;  1DVA H; 
#chains in the Genus database with same CATH homology
 2YOL A;  3FN8 A;  2O8M A;  2YMS B;  3NRL A;  1KMH B;  3SU2 A;  3U1I B;  1MAB B;  3O8D A;  2F9U A;  4OM9 A;  2QF4 A;  2YMS C;  4R8T B;  2QE7 D;  3ZIA D;  3L6P A;  3O8B A;  3P8O A;  4TT3 D;  3LKW A;  4F55 A;  3FKS D;  2KCA A;  2YMS D;  1RGQ A;  3KF2 A;  3KN2 A;  1N1L A;  2A4G A;  5FPT A;  5HKK D;  5GND A;  5C0U A;  3W1E A;  2WSS D;  4NWK A;  3SZE A;  3VG8 A;  4A1V A;  3WW7 A;  5FPY A;  4B75 A;  2V7Q D;  3N99 A;  4DT4 A;  2M2A A;  3OFN D;  3FO8 D;  3LON A;  4NWL A;  2AHM E;  4ZCN A;  4KTC A;  2HLD D;  3SU4 A;  2F4L A;  2VBC A;  2OC7 A;  1NS3 A;  2JJ1 D;  3SU3 A;  3SU6 A;  3SU5 A;  1JXP A;  2OC0 A;  5T1V A;  2A4Q A;  5EQR A;  4YXW D;  5F53 A;  4ASU D;  3O8C A;  1DY8 A;  5C0T A;  3OE7 D;  1SKY E;  2OC8 A;  5DSF A;  4Q63 A;  3OEH D;  2KCP A;  2KCO A;  2FOM B;  1COW D;  1RTL A;  2JDI D;  1EFR D;  1FX0 B;  3SU0 A;  2KCY A;  3DCL A;  3KNX A;  1DXP A;  4Q4L A;  3SUF A;  3RC6 A;  2K0Q A;  5H4I B;  2K8I A;  3FOA A;  4JMY A;  3E90 B;  2JIZ D;  3F2F A;  5ETX A;  5GPI B;  1BMF D;  5CHB A;  2KZ4 A;  3U1J B;  3H09 A;  2OBO A;  3N7D A;  3SU1 A;  5DN6 D;  3SYJ A;  4K8B A;  2OC1 A;  1NBM E;  3PRB A;  5IK2 D;  2W6J D;  4A1X A;  2XCF A;  4M9F A;  3SUG A;  2KFW A;  5FL7 D;  2WZQ A;  3KEE A;  3SV8 A;  4B71 A;  4Z1M D;  3AK5 A;  2QV1 A;  1DY9 A;  3EYD A;  4A92 A;  1NBM D;  2CK3 D;  4I32 A;  3F2G A;  3M5N A;  5EQS A;  4B6E A;  1OHH D;  4WH8 A;  4FET A;  1H8E D;  3GS9 A;  1H8H D;  3OYP A;  5B6L A;  3PRD A;  3SUD A;  1DXW A;  3WWB A;  3F3B A;  3F0P A;  1W3C A;  3RC4 A;  1W0K D;  2LEL A;  2QF5 A;  2OBQ A;  2WHX A;  3LOX A;  2L6O A;  2F9V A;  4WH6 A;  2F43 B;  5FPS A;  5EPY A;  2XND D;  3SV6 A;  3DSO A;  4TSF D;  2KM0 A;  3PV2 A;  2IJD 1;  3P8N A;  4WF8 A;  4B6F A;  3O8R A;  4I31 A;  3M5O A;  2JJ2 D;  3SV7 A;  3WWF A;  2KR7 A;  2XNI A;  3DSP A;  4B76 A;  5IDK A;  4I33 A;  3M5L A;  2WV9 A;  4RI0 A;  2OIN A;  1E1R D;  3M5M A;  1WXR A;  2WPD D;  4B73 A;  3OAA D;  5EQQ A;  3SV9 A;  5ESB A;  1A1R A;  3UB0 A;  2W6I D;  2XCN A;  2XOK D;  2P59 A;  3OTP A;  3OEE D;  1E79 D;  2GGV B;  1W0J D;  2FM2 A;  2IJO B;  4U01 A;  3RC5 A;  2OK5 A;  4TYD A;  2K1Q A;  5GJ4 B;  3SUE A;  4B74 A;  2GVF A;  1BT7 A;  1S6L A;  1E1Q D;  2J5U A;  5EPN A;  1CU1 A;  2A4R A;  4XD7 D;  3F0O A;  5CDF E;  5C17 A;  3N7E A;  3F2H A;  3PV5 A;  4A1T A;  2FP7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...