1U6QA

Substituted 2-naphthamadine inhibitors of urokinase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Urokinase-type plasminogen activator
publication title Naphthamidine urokinase plasminogen activator inhibitors with improved pharmacokinetic properties.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2004-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1u6qA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1u6qA01
1C2JA 4A1VA 3RMMH 3RXPA 1HRTH 5L6NH 3MU4A 1KSNA 4ZXYH 2FOGA 2Z3CA 1KDQB 3FANA 4GCHG 1LKBA 2F9PA 3LH1A 3VFEA 3GY8A 1H9IE 1O39A 1HAXB 1C2MA 1ARCA 1PPFE 2H5DA 1KXBA 1LO6A 1W13U 1YCPK 3NWUA 2A4GA 1DICA 3DHKH 2ZDNA 1TLDA 4FUBA 1HAPH 1BOQA 1V2JT 1VCPA 1O2OA 2OQUA 6GCHG 2WINI 2NU3E 1EAIA 2STBE 3NK8A 3UR9A 1P2KA 1LVMA 1YPLH 1O5AB 1Z71A 3ZZ6A 2C4FH 2NU0E 3K6YA 3LGWA 4GUXA 4DIHH 2ZTZA 2ODPA 4H42U 2BDHA 1C2FA 2BZAA 1BB0B 5C67A 1GDQA 1T8MA 1W11U 4O97A 4U2WA 1A2CH 3ZVAA 2W3KA 3QGNB 2BD8A 3MTYA 1TRYA 2OBQA 4YT6H 1ELVA 2R2MB 2FLBH 5EGMA 1K1MA 1TRNA 5DP6A 3BEIB 3STJA 1NU7B 1TGCA 2K1QA 4B73A 1A4WH 1O2UA 1ZRKA 5IDKA 1MZAA 1QGFA 2CJIA 1NPMA 2DE8A 3RXCA 3N7OA 3TU7H 2STAE 3CS0A 2AH4X 3ODFA 4YLUA 1C2DA 1ETRH 3RU4D 1LVBA 3U69H 3T29A 2VB0A 4CRDA 3TH4H 1SGDE 2VNTA 5TJXA 4Q2KA 1O2VA 2D1JA 3TITA 1YCPM 3ESTA 1FDPA 3TK6A 1BRAA 2HNTF 3W94A 1AN1E 1MQ5A 4ABJA 3SV2H 2ZWLH 3MNCA 3K9XB 4X2VA 2BLWA 1UTOA 4UFFH 1G36A 3SI4H 5C1UA 4YT7H 3UY9A 4CRAA 1EJNA 2BQ6B 1FV9A 2HNTE 3BTTE 5EODA 3UR6A 1ZGIA 3W95A 5T3HA 1XX9A 1ZZZA 3SN8A 1FY3A 5T6DA 3QWCH 3Q3XA 2P94A 3Q77A 4X8UH 3F68H 1YLDA 1MQ6A 1A0HB 2QCYA 3S9BA 1K1PA 1ZSLA 2FM2A 2FX4A 3PWBA 4ABAA 1Q3XA 3Q76A 2VVUA 1QRXA 3NUMA 3A7XA 4FUDA 4TWWA 2ZPQA 3T28A 3M7UA 1TNKA 2D8WA 2XNIA 1ZR0A 2A45B 4RN6A 2I6QA 1JRTA 2ZHDA 4E7NA 4CH8B 1HAHH 1XUKA 3MU0A 4WJG2 2ZECA 1GPZA 1JOUB 4ZH8A 2BY8X 1F0RA 1A46H 5GDSH 1NN6A 3ZZ9A 1MBMA 4Z0KA 1P9SA 2J34A 4BOHA 1EQ9A 2GGVB 1TALA 1LPGB 4XSKU 1V2TT 2WV4A 1BITA 4X8VH 5TCCA 2PSXA 3HK6B 3SUGA 1GI9B 5DGJA 1PPHE 3F6UH 1GDNA 2Y7ZA 1OP2A 2RCEA 4B76A 4TPIZ 1FLEE 4WMDA 1ACBE 2ASUB 1GBBA 1MD7A 3GICB 3AAVA 2A31A 5GCHF 2SGDE 1WYKA 1DX5M 2SNVA 2ZDKA 4K8BA 4LOYH 1SFIA 2B9LA 4K5ZA 2ZU1A 4TY7A 1GBAA 1HPGA 2FYQA 1A5GH 3NKKA 3ATKA 4K2YA 4FUCA 2PWXA 1O3BA 3RM2H 2JETB 2PLXA 5FPSA 1DSUA 1UCYE 3U8OH 2WV5A 2ZU5A 3RXVA 2HPPH 3T5FH 1RS0A 2FESH 6CHAC 4ZUHA 3H7OA 4AB8A 1V2LT 3SU6A 4FU7A 4NIYA 3M5LA 3UNRA 7GCHG 1QJ6B 1B5GH 4J2YB 1O3NA 1SGYE 2XTTB 3IG6B 1H9LB 4NIXA 3EGKH 4DURA 1BTZA 4Q80A 3T2NA 1DM4B 6CHAB 2A2XH 3DUXH 5F8ZA 4ABEA 1K1NA 2PUXB 3F9FA 4X8SH 3QZQA 1XM1A 4JYTA 2FODA 1XUIA 5EQRA 5F6MA 5A0AE 3A85A 2GDDA 3GCTF 4I32A 3F9EA 1L1GA 1C1VH 3V0XA 1CA8B 7ESTE 2BB4A 1O5EH 1MKWK 1SGNE 1GJ9B 2P59A 3U8RH 1FIZA 1V2VT 2ZHWH 5GWZA 5F8XA 5C20A 4ZHAA 4X8TH 1FQ3A 1DOJA 1G2LA 4JK6A 4QT8C 1QJ1B 1TIOA 4Y8ZA 3K65B 2PHBA 1SI5H 3ZZAA 2BX4A 4M7GA 4B1TA 5CHAC 3KQDA 4X2XA 1C1MA 1KXDA 3LGUA 1Y3XA 3E90B 4NG9H 4ZMAH 1OP8A 3FZDA 1GHVH 2H9TH 4D9RA 2VVVA 5EXLA 1AVWA 2GDEH 5BPEA 7LPRA 3QK1A 3U1IB 3LU9B 2JH6D 2PKSC 1AMHA 4ESTE 1KLIH 2F9NA 3F1SB 2FOAA 4F49A 1C1NA 1UTJA 1SL3A 1B7XB 1OSSA 1JRSA 1GJ8B 3PB1E 2R2WU 2YOLA 3V3MA 1GI7B 2JH0D 4ABDA 1C1UH 4X6NA 3TPIZ 1QB1A 3OX7U 4Y8XA 5CHAB 5L2ZH 4D7FA 1BDAA 1DLKB 1YPKH 2G52A 2QAAA 1QL8A 1P06A 3QX5H 4DY7B 1P05A 1O5BB 1H4WA 2BD5A 4R0IA 1HNEE 1HXFH 1SOTA 8LPRA 3MU1A 2G4UA 3BTGE 2PKSB 2ODQA 1C5LH 1C2GA 1GCDA 2R3YA 3RXTA 3HGPA 2D2DA 1GJ6A 1K28D 1WOFA 1THRH 1NESE 2O9QA 1IQKA 5A2MH 1GHBG 2Y80A 1NT1A 5C5NA 2P16A 4CRFA 4YOIA 1ETSH 2PGBB 1W10U 3M5NA 3TH2H 3MHWU 4YM9A 1ZMLA 4AGJA 3Q00A 2A2QH 1G2MA 1Y8TA 2VJ1A 3SGAE 1T8LA 1Z6EA 2QYIA 2ZGBH 3FVFB 1C2KA 4SGAE 4MQAA 2D26C 1C5TA 1C5UA 1C5ZB 1GHZA 2BDBA 2HPQH 2OC7A 1O3GA 2UUYA 1ELGA 4K1EA 3FFGA 3WY8A 3F9GA 2NU4E 1BA8B 1O3OA 5FCKA 3UOPA 1C2IA 3OSYA 3M36A 1YPHC 3BEUA 2ZG0H 1C1SA 1P2NA 4I8HA 3ZZ7A 3LKWA 2W3IA 1EB1H 2WPJS 3HKIB 5G4BA 2FO9A 4WH8A 1AVGH 2BXTH 1QFKH 1N1LA 3U9AH 4CREA 1L1JA 2VH6A 1NC6A 1GG6C 2TRMA 1WAYB 4B75A 3Q3KA 1OYTH 1W12U 3RXKA 3R3GB 2ILNA 4RSPA 1S83A 1CA0C 1O2QA 2BY5X 4RKJB 2FYRA 3KNXA 4ISOA 1E34B 1BQYA 4Y71A 3MOCA 4NA7A 3SHCH 3F9HA 1CO7E 3A7ZA 1PQAA 1O2MA 1O3KA 1XUGA 2A7HA 3E0NB 1NFYA 1T8OA 5FBIA 1GBTA 5DO4H 5C1YA 1GG6B 4X6PA 3VGCC 1O2KA 3RXRA 3HATH 4MLFB 2V35A 1A0LA 1CA0B 5K0HA 4WMFA 2W5EA 1EZXC 5HYOA 3OY6U 5EPYA 3URCA 1BZXE 4K8YA 5GJ4B 2GV6A 2Y5GA 2FS8A 3CP7A 1HLTH 1LDTT 2F9OA 4DVAU 1O2HA 3RP2A 2ANWA 2C8YB 1XUHA 1DT2A 2TBSA 3K2UA 1LCYA 2GT7A 2VWLA 3QLPH 1ZLRA 4MPVA 4I7YH 1BBRK 2NU2E 3MO3A 2C8ZB 3P8GA 3VGCB 1RTFB 1FPHH 3SOSA 5JB8S 4INHA 4ABFA 5I25A 3JZ1B 4AFSA 4WXIA 1Y5AT 3TH3H 3ZVBA 4NSYA 3RMLH 4ISIH 2ZGXH 1F7ZA 3A7YA 4X1PU 1LQEA 1TABE 1XKBC 4AORA 3BF6H 1GHAF 5GXPA 2VIPA 1CVWH 2W7SA 1KY9A 1MBQA 3QO6A 3K6ZA 2ZFSA 3FZZA 4F4OC 1SC8U 2BY7X 2ZDLA 3PYHA 4CRGA 1ABJH 2PKAA 3ZZDA 2P3TB 3NCLA 1GMHF 5J4SA 3RXGA 3SJKA 2VWOA 3P92A 1CBWC 1OWJA 1LQDB 2VIVA 3E91A 1MUEB 3UIRA 4DOQA 4BAKB 1O2WA 3QTOH 1TPSA 4MG3A 2ZEBA 2B7DH 4GAWA 4BTUB 5JBTA 5FPYA 5FHTA 1SR5C 1O5DH 5C2ZA 4Y11E 1RJXB 3A7VA 2BQWB 2Q1JA 2HNTC 2ZU2A 1DLEA 1F0SA 1O0DH 3ZZBA 4Y7AA 4O3TA 4D7GA 1UJ1A 3ZZCA 4I31A 2ZHQH 2BD2A 4I8KA 1CBWB 1O3JA 2VIOA 1P2JA 4AFUA 2M5TA 1P3EA 1QTFA 1THPB 1BT7A 2R9PA 8KME2 1DPOA 2ANMH 1RIWC 2Q6DA 3AAUA 4D9QA 2CGAA 3NPSA 1VR1H 2H9HA 1BUIA 4GPGA 3GCTG 3I78A 3C27B 1EAUA 3BSQA 4ZKSU 1P04A 2OC0A 2BLVA 2PW8H 1DY9A 1GHYH 1AUJA 4JMYA 3ATMA 1MCVA 2BDYA 2QF0A 4Y79A 3GY5A 4CHAB 1CGIE 1D4PB 2F91A 4NIWA 4NA9H 1C2LA 4X1SU 1AGJA 1EOLA 5JDUB 1OYQA 4IN2A 4CR9A 3VB5A 1RD3B 1KLJH 4YO9A 1W14U 3TLOA 2H2ZA 4J1YA 4D76A 1XUFA 4CRCA 1C9TA 1RIWB 3CENA 1IQIA 1WSSH 3SUEA 1OX1A 1UK4A 3ZV9A 4X2YA 4I8JA 1GBIA 5E0JA 1O3AA 1C1OA 1UVPA 4I8GA 5FCRA 2PKAB 2FLRH 1SQAA 3QTVH 2HLCA 2Y5HA 1V2KT 3DA9B 4YLQH 4AYVB 1S6HA 2GZ9A 1Y3UA 1WQSA 5T6FA 5DK1A 2VWNA 5EQQA 1TFXA 3SNAA 1ANCA 4Q7XA 2BMGB 1C5YB 1SVPA 2FEQH 1D3QB 1THSH 2XC5A 4NCYA 1Z6JH 3RXJA 3GYLB 1D3TB 3PLBA 1BJUA 3OY5U 3LPRA 3ENSB 1P3CA 1EZQA 4NWKA 1OS8A 2YNBA 4ZKOU 1LHFH 2OUAA 4E05H 4UFGH 2FOFA 3P70B 3LJOA 1NROH 1QL9A 5DP9A 1C5PA 1V3XA 1C5WB 4MNXA 3ELAH 4PROA 1LVYA 3RU4T 3STIA 4NWLA 1KTSB 2AMDA 4XBBA 2CN0H 1AVXA 1J8AA 2V3HH 1KXCA 1PPGE 3I29A 3TIUA 3UNQA 3FP8E 4E7RG 4AFQA 2WPIS 1H8IH 3BN9A 4DJZB 2Q6GA 5A8ZA 1ZPBA 2QF3A 3M3VA 5E0GA 3TGKE 3QZRA 1QQUA 3E3TA 5EPNA 1ZSKA 3QDZB 1HAYB 2ZFFH 4FUEA 2GCTC 1NS3A 4JCNA 1DE7H 1HV7A 1SQTA 1C1TA 2ZHFH 2OXSA 3V12A 1UVOA 3H5CB 1ZYOA 1J15A 1TMUH 4K69A 4MDSA 3V7TA 1GBJA 1GJ4H 3SU3A 4DGJA 1C5SA 3LDXH 3RDZA 4MTBA 3ATIA 1EASA 4O03A 2ZHEH 1SFQB 1F2SE 1XXDA 1CE5A 1E0FD 2F83A 3RUOA 1Y5BT 1N8OC 3NZIA 2FX6A 5DP3A 1Z1JA 4YTAA 3CS7A 1O30A 2C8XB 1VJAU 3LGTA 1D6RA 4Y0YE 1C1PA 1ESTA 1PPBH 3PLPA 3RXOA 2Y7XA 1SGEE 3SUFA 1W7XH 3EQ0H 5DP8A 1WV7H 1MTWA 4JZDH 1VJ9U 1QRWA 3B8JA 3M3TA 1Z8GA 1NO9H 3LC3A 1DDJA 2RG3A 2SFAA 2BD3A 2RDLA 1O3CA 4NFEA 1N8OB 3MH6A 1TNJA 1MTNC 2B0FA 1BCUH 1NY22 5LPRA 3GCOA 2FOBA 1CT0E 3RXMA 1GJBB 1Z1IA 2AGIX 2XRCA 3G01A 2BDCA 4KKDA 4A7IB 3TJVA 1NRPH 1E38B 4AGKA 1P9UA 1UTMA 3A87A 2PFEA 4BNRA 1C5NH 3SGQE 3DD2H 3IITA 3M35A 5DG6A 1QIXB 3SQHE 1W7GH 1WU1A 2J92A 4BTIB 1AE8H 1Z8RA 3MFJA 1GVZA 4AZ2B 4FU9A 2WPMS 3RXAA 4K1SA 1EP6A 1OKXA 1MTNB 3RXEA 2ZP0H 1SLVB 1UCYH 1YPGH 1IQFA 1BTYA 1BRCE 2BVSH 1G37A 4MNYA 1PYTC 1ZTKA 1O33A 3KQEA 3SU0A 3URDA 2ZCLP 1BTPA 1ELDE 3D49H 2ZO3H 5FPTA 1GBFA 1SLXB 1SQOA 2HOBA 1GL0E 4OGXA 2OTVA 1WQVH 3S9CA 1FAXA 1NFXA 1TGNA 3HPTB 5HGGA 1Y5UT 1A5IA 1G3EA 2ZQ1A 2BD7A 3E6PH 1SGFG 3D62A 2XBYA 3AW0A 2P95A 4ZKNU 5B6OA 4NGAH 3SJOA 5A0CA 1L0ZA 2GVFA 1ZHRA 1GJ5H 3P17H 2GCHG 1VITH 2Z9IA 1GHXH 2AIQA 1YP9A 4U32A 4DT7B 1UTNA 4LZ1H 5CMXH 3PROA 1TGBA 1F0UA 2P93A 5LH8A 1O2LA 1AWFH 1PPZA 1TA2A 2Z6BD 2BY9X 4XBCA 4HGCA 3ZYEA 1Y3WA 1VITF 3L33A 2FI4E 3LIWA 1YF4A 3UFAA 2A4RA 2R3UA 4NA8A 1O5FH 4AB9A 1IOEA 1O35A 1S84A 4KELA 4B2AA 1F0TA 1B0FA 2BOHB 3ZZ5A 1DSTA 1GI4A 2ANYA 4U01A 5JBCS 1MKWH 4JK5A 1SGFA 3BIUH 1ANEA 1OOKB 1IAUA 3TK9A 5EOKA 1TPOA 4X6OA 4WMEA 1YGCH 1PPEE 2BOKA 1J14A 1NTPA 5JBBS 1LKAA 1C1QA 2W7UA 3S7HB 1HXEH 4UE7H 3PWCA 1IQLA 1DITH 4ZXXH 2FOEA 1H1BA 2UUJB 1XKAC 3BV9B 3RXHA 3ZZ8A 2WYJA 1EJAA 3KL6A 1TE0A 2A7JA 4LXBH 5I46H 5IYTA 1C2EA 5EXNA 1CU1A 2C90B 4VGCC 1P01A 5EQSA 1ZRBA 1W0ZU 1GMCF 2LPRA 1GJCB 1IQGA 1O36A 1UVSH 4IGDA 3DT0H 1UTKA 2C8WB 1CHGA 3SV9A 2BDIA 2THFB 1Y3YA 1ZMJA 2ANKH 1AKSA 2W26A 1UK3A 3GY2A 4XOJA 4GVUA 1IQMA 4CH2B 5LGOA 1MMJN 4WF8A 1G3CA 3MMGA 3O8RA 4VGCB 2TPIZ 1G9IE 3JZ2B 1EJMA 2ZPSA 1HJAC 3KHVA 1FAKH 1HGTH 1XVOA 1G3DA 3EE0B 1ELBA 1GL1A 3L6PA 1JXPA 4Y76A 1TOMH 1EZUC 1ELAA 1TQ0B 3KQCA 1HAVA 3HKJB 4XE4A 2UWOA 3R0FA 4XFQA 1SBWA 2CXVA 4GCHF 1MZDA 2XBVA 5DJ7A 3RXDA 4Q7ZA 1AY6H 1D9IA 2OQ5A 1HIAB 3UQOA 1FPCH 1VZQH 2O8MA 1B0EA 1O34A 1FI8A 1NRNH 2BX3A 2J2UA 1S81A 1HJAB 4JYVH 2VVCA 1K1LA 3ITIA 1C5QA 3RMNH 2BY6X 2A7CA 1QBNA 2A5AA 2QGRA 2VU8E 1O37A 1QB6A 1QCPA 2WUCA 6GCHF 4JZIA 1O2ZA 1C5RA 2GX4A 1BMAA 1ZGVA 1QA0A 2SGQE 4IC5A 1LVOA 3MU8A 1TNHA 1FY4A 1BTXA 2J9NA 2PV9B 2ZZUH 4BTTB 2Y81A 4B2BA 1TONA 1W3CA 2ALPA 2G00A 2NWNA 2JKHA 2VIDA 4BAMB 1MU8B 5DKMA 1GVKB 1WBGB 2AS9A 1U6QA 4I33A 1OXGA 1MTUA 3LT3A 2Z7FE 1A61H 1BTHH 1HUTH 1TMBH 1P03A 3UWIA 1PYTD 1UTPA 1EOJA 5F03A 3KIDU 4HTCH 4A5TS 4KTSA 2A0QB 4U30A 1EZSC 2VGCC 1AKSB 3PO1C 1EAXA 4NZLA 5ESBA 4YZUA 1FUJA 2IOTA 2VIQA 2ZI2H 2O8UA 3ZVDA 2YNAA 2XC0A 3ZYDA 1VCWA 1QQ4A 2QIQA 2GV7A 2ZDMA 1O2TA 4BAHB 1P2OA 2TGTA 1A3BH 4Y10E 3H7TA 5DP7A 5TCAA 2QV1A 1NU9A 4K60A 2ZQ2A 1S5SA 3MNXA 3S7KB 3ATLA 2BTCE 1HAVB 1HFDA 2G81E 2AMQA 3ZVGA 2VGCB 5SGAE 1DS2E 2P3UB 1GJAB 3GCNA 3PO1B 4LK4A 1DVAH 1DWBH 1FY8E 1KIGH 2QXJA 1SMFE 1GGDC 1XUJA 1G30B 4FUGA 1TNIA 3RC4A 3O8CA 1EP5A 4AX9H 1MU6B 5PTPA 2FDAA 3P6ZB 1F5RA 3P95A 3L3TA 1TX8A 2GMTC 3D23A 2OCVB 4OS2A 2UWPA 2GZ8A 1TMTH 1XXFA 2Z3EA 3ZVFA 2ZFRH 2FTLE 4HZHA 4LZ4B 1L1NA 2FMJA 1GGDB 2B5TB 4KTUA 5GCHG 2FIRH 1MKXH 4INKA 3RXBA 2SGPE 1O3LA 1GBEA 4GSOA 1P8VC 1C1RA 1Z8IB 1TNLA 4ISNA 1BBRE 1DY8A 4XDEA 2TGDA 2J4IA 2XC4A 2GMTB 2Z94A 4H4FA 3RM0H 1AHTH 5C3NA 1UTQA 2PTNA 1PQ8A 4OS4A 1UVUH 2I6SA 3V13A 1ZMNA 1LHEH 2VH0A 4OS5A 4UONA 1P12E 4MNVA 2BLQA 3GY6A 5FX5A 1JMOH 3S69A 1A3EH 5HXFA 2VWMA 5DP5A 1G32B 4MPWA 8ESTE 2GZ7A 2CF8H 1AFQC 1BHXF 2J38A 3S0NA 2BHGA 5HMAA 2AGEX 5EXMA 1GI8B 9ESTA 3ZZ3A 5C1XA 2H5CA 1NRRH 4AFZA 5JYIA 4Q7YA 1EUFA 3A8AA 4AG1A 1RTKA 4GLYA 1AD8H 2ZCKP 4ZHLU 1LHGH 5J4QA 4H6TA 3VEQB 1OWHA 1C4V2 4IBLH 1D3PB 5E2OA 1ZHPA 3BTME 1ZSJA 7GCHF 4YOGA 1KXEA 1N6XA 2IN2A 4THNH 4DW2U 1L4DA 1CGHA 3PLKA 1AFQB 2FOCA 2PSYA 2ZTYA 5JBAS 1J16A 2Z3DA 2QXHA 1XMNB 2FI3E 1TGSZ 3SJIA 2AEIH 4HI3A 1TGTA 3DFJA 1QBOA 1ELFA 3GISB 1FN6A 1IQJA 1P09A 1V2MT 1AQ7A 2F3CE 4ASHA 2OLGA 1SGPE 1RXPA 1OWIA 1SGIB 2H1UA 5E2PA 1AZ8A 1ZTLA 1IQEA 1C5VA 3EYDA 2Y82A 3MH4A 2CV3A 2G8TA 2OINA 2BZ6H 1G3BA 2VINA 1QRZA 1T31A 1ZPZA 1HAOH 3U8TH 2BYAX 2ZDVH 3A8BA 2EEKA 3HK3B 2ZCHP 1V6DA 2RA3A 1O2GH 1UK2A 2WUBA 1RRKA 1GMDF 1O2XA 4O3UA 3SW2B 1K1IA 1DXWA 1GCTC 1AU8A 3T27A 4A6LA 1HJ9A 1LPKB 4ABHA 1Q2WA 4UDWH 1C2HA 4WH6A 4A1TA 4CR5A 1C5XB 1YCPH 2CHAC 1Y3VA 2ZIQH 1DFPA 1ZPCA 4WXVA 2Y6TA 3GY3A 5C5OA 5GIBA 4JZFH 3OTJE 2ZA5A 2BD9A 2H9EH 1H9HE 1HAZB 3SJ9A 4UD9H 1S6FA 1YPJH 1X7AC 3OU0A 1GCTB 3TJUA 2UUKB 3FP7E 3QN7A 1NRSH 1O5GH 3E0PB 1ZJDA 1W8BH 1XVMA 2G55A 1FONA 1P10A 5LPEA 8GCHF 2FXRA 2H6MA 3MO9A 4K1TA 1E36B 4GHTA 3SNEA 5K7RA 2BD4A 4OGYA 1OWDA 4UFEH 2CHAB 1EKBB 4X2WA 1IHTH 1TPPA 2FP7B 2P8OC 2BXUH 4FUFA 1GVLA 3O8DA 1DWEH 2A32A 5ESTE 3UNSA 4FUJA 2A1DB 2HWLB 5CE1A 3A7TA 1K22H 1HBTH 5EW2H 1GHBF 1T4VH 2TIOA 2QXIA 3LGIA 3GDUA 2AGGX 1BMNH 4K3JA 1YBWA 3MYWA 1F5KU 1ARBA 5T6GA 5BRRE 1TPAE 3RU4E 1O31A 4HFPB 1VGCC 2ZU4A 2CMYA 1EX3A 1O2JA 1O2YA 3UQVA 4Y6DA 2P8OB 2GCTB 1GBHA 3BIVH 5GPIB 1AIXH 1UTLM 1TBZH 1AFEH 1ZHMA 1EXFA 3PMBB 2ZU3A 2C3SA 1TRMA 1C5MD 1CSOE 1SB1H 1GBLA 1O3EA 4XBDA 1E35B 3SUDA 4TWYA 3TVJB 1MH0A 1GBDA 1T4UH 4X1RU 1EPTA 3D65E 1T8NA 1VGCB 2A5KA 3BEFB 3M7TA 5LPFA 5ABWA 2NU1E 3EA9A 1WTGH 1ESBA 2BVRH 4BANB 1FY5A 4SGBE 3KCGH 1ELCA 2ZDAH 3BTDE 3VB3A 5L2YH 1VCQA 2G5NA 3M3SA 3U98H 4X6MA 1O2IA 4ZHMU 1IQNA 2A4OA 1KXAA 2Z9LA 2ZNKH 2PGQB 1ANDA 1P0SH 1V2RT 2ZFQH 1HDTH 3SV6A 3A83A 1V2PT 4CBNA 1EB2A 1P11E 1QY6A 1GJDB 1ETTH 1QB9A 1FY1A 1AUTC 3LC5A 4ZAEA 3SU4A 1SGTA 2IJOB 2O8WA 1GHAG 3RC6A 1TB6H 2AMPA 4BXSA 3RXUA 1SHHB 3PM3A 1M9UA 2F9VA 2V6NA 2EC9H 1MAYA 1SSXA 5A0BA 2ZTXA 4CRBA 1EPTC 4DG4A 1C5OH 4IW4E 3MNSA 1RTLA 3SNBA 2XXLA 2P3FH 1GBKA 2QXGA 1PQ5A 1UVTH 1UCYK 4WWYA 4AG2A 5ETXA 3E16B 1GMHG 2FOHA 3OYPA 1ZJKA 4MPUA 2JETC 1SLWB 4AOQA 1CT2E 4OS1A 1FZZA 5DP4A 4DIIH 3RLWH 3UOUA 5JB9S 1W0YH 1ELTA 2XWAA 1WUNH 3BTEE 2DE9A 1V2ST 4MVNA 3SNCA 1CHOF 1EPTB 1HB0B 2EI8A 2ULLA 3LJJA 2O8LA 2BDAA 2GT8A 4B71A 4FUHA 1FIWA 1N6YA 1PPCE 1PQ7A 3M37A 1DANH 1SGRE 3T26A 1TBRH 4B2CA 2BDGA 3A88A 3Q3YA 3TGIE 2G5VA 4GHQA 1TNGA 2XCNA 2FOMB 4INLA 3A84A 2F9UA 1NFWA 1P2MA 3SU5A 1C1WH 3T62A 1Z7KA 1YPEH 1CQQA 3TNTA 1J9CH 1NRQH 2V3OH 1YC0A 2FS9A 1W2KH 1V2QT 4X1NU 1HIAA 1TQ7B 2XBXA 1EAWA 1MCTA 3P8NA 1BMMH 2ODYB 1ORFA 3UWJH 3VXFH 2V0BA 1KLTA 2UUFB 3P8FA 1NM6A 4KTCA 4Y8YA 1P02A 1RFNA 2KAIA 1BMLA 3LH3A 1S82A 3BTHE 4MNWA 3ZZ4A 4D8NA 1SOZA 1A7SA 1GHWH 1V2UT 4IS5A 1O5CB 1GI0A 1JBUH 3AW1A 9LPRA 2WPLS 1O2SA 2ZPRA 3AASA 3MWIU 3A80A 4FVBA 1GMDG 3TGJE 1GI5A 2AIPA 2PTCE 1YM0A 3ZVCA 1GI6A 2SGAA 3RXFA 3MNBA 1HYLA 2BVXH 2UWLA 5AFZH 3RXIA 4Y0ZE 4R8TB 2XCFA 1WTHD 3BTKE 3BG8A 3A89A 4NIVA 1V2OT 5A09A 1QURH 1O3MA 3LGYA 2WPHS 2FWWA 2FZZA 2O8TA 1J17T 4Y7BA 4WVPE 4BXWA 2Z9JA 2ZGHA 3KF2A 1LMWB 1ANBA 3TJNA 3C1KA 1K21H 4Z6AH 1JWTA 3PV4A 5E8EH 4E06H 4DCDA 2B8OH 1O2PA 4JYUH 8GCHG 3GDVA 2DUCA 2A4QA 3GY4A 2R0KA 3M7QA 3EA7A 3AVZA 2GKVE 1SG8B 1K9OE 2ZKSA 3LONA 3QGJA 3EDXB 1V2WT 2WYGA 2ZC9H 5HM9A 3E1XB 4X1QU 2ALVA 1L2EA 5HM2A 2OP9A 2AYWA 2OC8A 2F9BH 2BM2A 2KAIB 3EA8A 2G51A 2J95A 5AHGH 1F92A 1JIMA 1AE5A 1CT4E 1BHXB 4IN1A 4WY3A 1D3DB 1DUAA 3A8DA 3PMJA 1D6WA 1SLUB 1BTUA 2J94A 4FVDA 2FTMA 1A0JA 1QL7A 3A86A 1DXPA 1PFXC 2EA3A 3LOXA 2FPZA 1QJ7B 1AO5A 3MH5A 3LGVA 3SORA 1HAGE 3GCHC 1YPMH 4H6SB 3KQBA 2OBOA 1GI1A 1GJ7B 1Z8JB 4ABGA 1O3PB 2HVXA 2Y5FA 3UPEA 3KEEA 3MH7A 1FXYA 3SJ8A 1TYNA 4TYDA 1S0QA 1GI2A 1Q31A 3QUMP 3BTWE 1YYY1 3A81A 3P8OA 1GI3A 2G4TA 3RLYH 3MI4A 3SZNA 4I8LA 4FUIA 1O3HA 2ZFPH 6ESTA 3GOVB 1H8DH 3BTFE 2HGTH 1TOCB 3ZV8A 3GCHB 1DUEA 4NSVA 3SI3H 2OC1A 2CF9H 1IHSH 5AFYH 2QA9E 5DPAA 2R0LA 1QR3E 3B9FH 1UO6A 3SV7A 1MTVA 2EI7A 2TGAA 4NFFA 1LTOA 2EI6A 4OS7A 5EU8A 3O8BA 1UHBA 5AF9H 1P57B 4MPXA 1HAIH 1E37B 1GWAA 5FXLA 1C9PA 3VB7A 1QA7A 1YKTA 5E0HA 3UUZA 1MAXA 1JIRA 2BLOA 1ZOMA 2VIWA 1TA6A 3U1JB 1BBRH 1BIOA 1QHRB 2GP9B 4TY6A 3HGNA 3ODDA 3UTUH 2SGFE 5H4IB 1ZTJA 3VB4A 1CGJE 1UMAH 1F5LA 1FMGA 1IQHA 3TK5A 3FAOA 1O38A 4ABBA 4IMQA 1NFUA 3M5MA 3SNDA 2FI5E 2PR3A 3ZVEA 3PMHB 3GDSA 1SPJA 2C93B 2XWBI 3KN2A 2ESTE 2HALA 1O3IA 1DWCH 1LHDH 1TBQH 2OD3B 1BRBE 3DFLA 1QBVH 1BTWA 1O3DA 4KGAA 2XBWA 4IMZA 1OPHB 3EAJA 1EATA 1QNJA 1GBCA 3KGPA 3RC5A 4X0WU 4FU8A 1O3FA 1C4U2 1K1OA 1WCZA 4ZKRU 1P2QA 2WPKS 1ABIH 1MD8A 2TGPZ 4ISHH 1ELEE 2SGEE 2ZGCA 1MKXK 2ZGJA 4RKOB 1CHOG 3M5OA 4O9VA 1OP0A 1AI8H 2QN5T 3FP6E 1FN8A 5AVDA 4NZQA 3RXQA 3SU1A 3SGBE 1SGCA 1K1JA 1ID5H 7KMEH 4YOJA 1KXFA 3BTQE 1INCA 1MTSA 1C4Y2 5L30H 1K2I1 1UHBB 4A92A 1VITG 4BAOB 1T32A 2LNCA 1LHCH 2RA0A 2A5IA 3A7WA 5EG4A 1KDQA 3TNSA 1KYNA 2GCHF 4AN7A 1L4ZA 1AB9C 3MO6A 5F8TA 3SO3A 2XW9A 4A1XA 4CHAC 4JZ1A 3ATWA 4ABIA 3RXSA 1BJVA 6LPRA 2BQ7B 3VXEH 3I77A 1PJPA 4JZEH 1O2NA 1S85A 1SGQE 1T7CA 2JH5D 5A8YA 2Z9KA 2QC2A 5FX6A 4UFDH 2IPHA 3VB6A 4FXGH 3M61U 1KTTB 3VPKA 4BAQB 1DWDH 3MU5A 1OWKA 1V2NT 2XYAA 2SNWA 3RXLA 2QY0B 1AB9B 3PMAB 3BG4C 1OWEA 4YESB 1RGQA 1FNIA 5FAHA 2Z9GA 1A5HA 1LPZB 4ZROA 1GMCG 2GD4B 4AYYB 1HJ8A 1NZQH 1GDUA 1YPHE 1Y59T 3E8LA 3B23B 1FJSA 5A8XA 4OS6A 2GTBA 1AWHB 1TWXB 5JPMH 1HCGA 2HRVA 1TAWA 2ZF0H 2AERH 1GBMA 4IC6A 3SU2A 1A1RA 2AFQB 1S0RA 3PTNA 3PTBA 3NXPA 2ZFTA 4ISLA 5FBEA 2PUQH 1O2RA 1TX7A 5EW1H 4CBOA 3GY7A 3BG4B 3T25A 2Q6FA 1P2IA 3S9AA 3SQEE 3A82A 3IWMA 3RMOH 1SHYA 3SV8A 4UEHH 4TPYA 3SBKA 1ESAA 1O32A 4KP0A 1TX6A 3UREA 4B74A 1AZZA 3GYMA 3TJOA 1BRUP 3SHAH 1YLCA 3A8CA
chains in the Genus database with same CATH superfamily
3WWFA 1C2JA 4A1VA 2KCYA 3RMMH 3RXPA 1HRTH 5L6NH 3MU4A 1KSNA 4ZXYH 2FOGA 2Z3CA 1KDQB 3FANA 4GCHG 1LKBA 2F9PA 3LH1A 3VFEA 3GY8A 1H9IE 1O39A 1HAXB 1C2MA 1ARCA 1PPFE 2H5DA 1KXBA 1LO6A 1W13U 1YCPK 3NWUA 2A4GA 2HVYB 2YMSC 1DICA 3DHKH 2ZDNA 1TLDA 4FUBA 1HAPH 1BOQA 1V2JT 1VCPA 1O2OA 2OQUA 6GCHG 2WINI 2NU3E 1EAIA 2STBE 3NK8A 3UR9A 1P2KA 1LVMA 1YPLH 1O5AB 1Z71A 3ZZ6A 3N7EA 2C4FH 2NU0E 3K6YA 3LGWA 4GUXA 4DIHH 2ZTZA 2ODPA 4H42U 2BDHA 1C2FA 2BZAA 1BB0B 5C67A 1GDQA 1T8MA 1W11U 4O97A 4U2WA 1A2CH 3ZVAA 2K0QA 2W3KA 3QGNB 2BD8A 3MTYA 1TRYA 2OBQA 4YT6H 1ELVA 3SYJA 2R2MB 2FLBH 5EGMA 1K1MA 1TRNA 3OTPA 5DP6A 3BEIB 3STJA 1NU7B 1TGCA 2K1QA 4B73A 1A4WH 1O2UA 1ZRKA 5IDKA 1MZAA 1QGFA 2CJIA 1NPMA 2DE8A 3RXCA 3N7OA 3TU7H 3MQKC 2STAE 3CS0A 2AH4X 3ODFA 4YLUA 1C2DA 1ETRH 3RU4D 1LVBA 3U69H 3T29A 2VB0A 4CRDA 3TH4H 1SGDE 2VNTA 5TJXA 4Q2KA 1O2VA 2D1JA 3TITA 1YCPM 3ESTA 1FDPA 3TK6A 1BRAA 2HNTF 3W94A 1AN1E 1MQ5A 4ABJA 3SV2H 2ZWLH 3MNCA 3K9XB 4X2VA 2BLWA 1UTOA 4UFFH 1G36A 2QE7D 3SI4H 5C1UA 4YT7H 3UY9A 4CRAA 5EJLA 1EJNA 2BQ6B 1FV9A 2HNTE 3BTTE 5EODA 3UR6A 1ZGIA 3W95A 5T3HA 1XX9A 1ZZZA 3SN8A 1FY3A 5T6DA 3QWCH 3Q3XA 2P94A 3Q77A 4X8UH 3F68H 1YLDA 1MQ6A 1A0HB 4XD7D 2QCYA 2M2AA 1K1PA 3S9BA 1ZSLA 1H8ED 2FM2A 2FX4A 3PWBA 4ABAA 1Q3XA 3Q76A 2VVUA 1QRXA 3NUMA 3A7XA 4FUDA 4TWWA 2ZPQA 3T28A 3M7UA 1TNKA 2D8WA 2XNIA 1ZR0A 2A45B 4RN6A 2I6QA 1JRTA 2ZHDA 4E7NA 4CH8B 1HAHH 1W0KD 1XUKA 3MU0A 4WJG2 2ZECA 1GPZA 1JOUB 3PV5A 4ZH8A 2BY8X 1F0RA 1A46H 5GDSH 1NN6A 3ZZ9A 1MBMA 4Z0KA 1P9SA 2J34A 4BOHA 1EQ9A 2GGVB 1TALA 1LPGB 4XSKU 1V2TT 1NBME 2WV4A 1BITA 4X8VH 5TCCA 2PSXA 3HK6B 3SUGA 1GI9B 5DGJA 1PPHE 3F6UH 2KCAA 1GDNA 2Y7ZA 1OP2A 2RCEA 4B76A 4TPIZ 1FLEE 4WMDA 1ACBE 2ASUB 1GBBA 1MD7A 3GICB 4FETA 3AAVA 2A31A 5GCHF 2SGDE 1WYKA 1DX5M 2SNVA 2ZDKA 4K8BA 3WWBA 4LOYH 1SFIA 2B9LA 4K5ZA 2ZU1A 4TY7A 1GBAA 2J5UA 1HPGA 2FYQA 1A5GH 3NKKA 3ATKA 4K2YA 4FUCA 2PWXA 1O3BA 3RM2H 2JETB 2PLXA 5FPSA 1DSUA 1UCYE 3U8OH 2WV5A 2ZU5A 3RXVA 2HPPH 3T5FH 1RS0A 2FESH 6CHAC 5HIZA 4F55A 4ZUHA 3H7OA 4AB8A 1V2LT 3SU6A 4FU7A 4NIYA 3M5LA 3UNRA 1WXRA 7GCHG 1QJ6B 1B5GH 4J2YB 1O3NA 1SGYE 2XTTB 3IG6B 1H9LB 4NIXA 3EGKH 4DURA 1BTZA 4Q80A 3T2NA 1DM4B 6CHAB 2A2XH 4I86A 3DUXH 5F8ZA 4ABEA 1K1NA 2PUXB 3F9FA 4X8SH 3QZQA 3GS9A 1XM1A 4JYTA 2FODA 1XUIA 5EQRA 5F6MA 5A0AE 3A85A 2GDDA 3GCTF 4I32A 3F9EA 1L1GA 1C1VH 2YMSD 1CA8B 3V0XA 7ESTE 2BB4A 1O5EH 1MKWK 1SGNE 1GJ9B 2P59A 2VBCA 3U8RH 1FIZA 1V2VT 2ZHWH 5GWZA 5F8XA 5C20A 4ZHAA 4X8TH 1FQ3A 1DOJA 1G2LA 4JK6A 3VG8A 4QT8C 1QJ1B 1TIOA 4Y8ZA 3K65B 2PHBA 2L6OA 1SI5H 3ZZAA 2BX4A 4M7GA 4B1TA 5CHAC 3KQDA 4X2XA 1C1MA 1KXDA 3LGUA 1Y3XA 3E90B 4NG9H 4ZMAH 1OP8A 3FZDA 1GHVH 2H9TH 4D9RA 2VVVA 5EXLA 1AVWA 2GDEH 2W6JD 5BPEA 7LPRA 3QK1A 3U1IB 3LU9B 2JH6D 2WZQA 3ZIAD 2PKSC 1AMHA 4ESTE 1KLIH 2F9NA 3F1SB 2FOAA 4F49A 1C1NA 1UTJA 1SL3A 1B7XB 2RDEA 1OSSA 1JRSA 1GJ8B 3PB1E 2R2WU 2YOLA 3V3MA 1GI7B 2JH0D 4ABDA 1C1UH 4X6NA 1YWUA 3TPIZ 1QB1A 3OX7U 4Y8XA 5CHAB 5L2ZH 4D7FA 1BDAA 1DLKB 1YPKH 2G52A 2QAAA 1QL8A 1P06A 3QX5H 4DY7B 1P05A 1O5BB 2EY4C 1H4WA 4XRNA 2BD5A 4R0IA 1HNEE 1HXFH 1SOTA 8LPRA 3MU1A 2G4UA 3BTGE 2PKSB 2ODQA 1C5LH 1C2GA 1GCDA 2R3YA 3RXTA 3HGPA 2D2DA 1GJ6A 1K28D 1WOFA 1THRH 1NESE 2O9QA 1IQKA 2J98A 5A2MH 1GHBG 2Y80A 1NT1A 5C5NA 2P16A 4CRFA 4YOIA 1ETSH 2PGBB 1W10U 3M5NA 3TH2H 3MHWU 4YM9A 1ZMLA 3F0OA 4AGJA 3Q00A 2A2QH 1G2MA 1Y8TA 2VJ1A 3SGAE 1T8LA 1Z6EA 2QYIA 2ZGBH 3FVFB 1C2KA 5EJZA 4SGAE 4MQAA 2D26C 1C5TA 1C5UA 1C5ZB 1GHZA 2BDBA 2HPQH 2OC7A 1O3GA 2UUYA 1ELGA 4K1EA 3FFGA 3WY8A 3F9GA 2NU4E 1BA8B 1WDIA 1O3OA 5FCKA 3UOPA 1C2IA 3OSYA 3M36A 1YPHC 3BEUA 2ZG0H 5KGOA 1C1SA 1P2NA 4I8HA 3ZZ7A 3LKWA 2W3IA 1EB1H 2WPJS 3HKIB 3N99A 5G4BA 2FO9A 3F2FA 4WH8A 1AVGH 2BXTH 1QFKH 1N1LA 3U9AH 4CREA 1L1JA 2VH6A 1NC6A 1GG6C 2TRMA 1WAYB 4B75A 3Q3KA 1OYTH 1W12U 2WV9A 3RXKA 3R3GB 2ILNA 1S6LA 4RSPA 1S83A 1CA0C 1O2QA 2BY5X 4RKJB 2FYRA 3KNXA 4ISOA 1E34B 1BQYA 4Y71A 3MOCA 4NA7A 3SHCH 3F9HA 1CO7E 3A7ZA 1PQAA 1O2MA 1O3KA 1XUGA 2A7HA 3E0NB 1NFYA 1T8OA 5FBIA 4AC9A 1GBTA 5DO4H 5C1YA 1GG6B 4X6PA 3VGCC 1O2KA 3RXRA 3HATH 4TT3D 4MLFB 2V35A 1H8HD 1A0LA 1CA0B 5K0HA 4WMFA 2W5EA 1EZXC 5HYOA 3OY6U 5EPYA 3URCA 1BZXE 4K8YA 5GJ4B 2GV6A 2J98B 2Y5GA 2FS8A 3CP7A 1HLTH 1LDTT 2F9OA 4DVAU 1O2HA 3RP2A 2ANWA 2C8YB 1XUHA 1DT2A 2TBSA 3K2UA 1LCYA 2GT7A 2VWLA 3QLPH 1ZLRA 4MPVA 4I7YH 1BBRK 2NU2E 3MO3A 2C8ZB 3P8GA 3VGCB 1RTFB 1FPHH 3SOSA 5JB8S 3AK5A 4INHA 4ABFA 5I25A 3JZ1B 5T1VA 4AFSA 4WXIA 1Y5AT 3TH3H 3ZVBA 1YY3A 4NSYA 3RMLH 4ISIH 2ZGXH 1F7ZA 3A7YA 4X1PU 1LQEA 1TABE 1XKBC 4AORA 3H09A 3BF6H 1GHAF 5GXPA 2VIPA 1CVWH 2W7SA 1KY9A 1MBQA 3QO6A 3K6ZA 2ZFSA 3FZZA 4F4OC 1SC8U 2BY7X 2ZDLA 3PYHA 4CRGA 1ABJH 2PKAA 4F48B 3ZZDA 2P3TB 3NCLA 3U28C 3F0PA 1GMHF 5J4SA 3RXGA 4M9FA 3SJKA 2VWOA 3P92A 1CBWC 1OWJA 1LQDB 5GNDA 2VIVA 3E91A 1MUEB 3UIRA 4DOQA 4BAKB 1O2WA 3QTOH 1TPSA 4MG3A 2ZEBA 2B7DH 4GAWA 4BTUB 5JBTA 5FPYA 5FHTA 1SR5C 1O5DH 5C2ZA 4Y11E 1RJXB 3A7VA 2BQWB 2Q1JA 2HNTC 2ZU2A 1DLEA 1F0SA 1O0DH 3FO8D 3ZZBA 4Y7AA 4O3TA 4D7GA 1UJ1A 2EQNA 3ZZCA 4I31A 2ZHQH 2BD2A 4I8KA 1CBWB 1O3JA 2VIOA 1P2JA 4AFUA 2M5TA 1P3EA 1QTFA 1THPB 1BT7A 2R9PA 8KME2 1DPOA 2ANMH 1RIWC 2Q6DA 3AAUA 3PV2A 2CGAA 4D9QA 3NPSA 1VR1H 2H9HA 1BUIA 4GPGA 3GCTG 3I78A 3C27B 1EAUA 3BSQA 4ZKSU 1P04A 2OC0A 2BLVA 2PW8H 1DY9A 1GHYH 1AUJA 4JMYA 3ATMA 1MCVA 2BDYA 2QF0A 4Y79A 3UB0A 3GY5A 4CHAB 1CGIE 1D4PB 2F91A 4NIWA 4NA9H 1C2LA 4X1SU 1AGJA 1EOLA 5JDUB 1OYQA 4IN2A 4CR9A 3VB5A 1RD3B 1KLJH 4YO9A 1W14U 3TLOA 2H2ZA 4J1YA 4D76A 1XUFA 4CRCA 1C9TA 1RIWB 3CENA 1IQIA 1WSSH 3SUEA 1OX1A 1UK4A 3ZV9A 4X2YA 4I8JA 1GBIA 5E0JA 1O3AA 1C1OA 1UVPA 4I8GA 5FCRA 2PKAB 2FLRH 1SQAA 3QTVH 2HLCA 2Y5HA 1V2KT 3DA9B 2KR7A 4YLQH 4AYVB 1S6HA 2GZ9A 1Y3UA 1WQSA 5T6FA 5DK1A 2VWNA 5EQQA 1TFXA 3SNAA 1ANCA 4Q7XA 2BMGB 1C5YB 1SVPA 2FEQH 1D3QB 1THSH 2XC5A 4NCYA 1Z6JH 3RXJA 3GYLB 1D3TB 3PLBA 1BJUA 3OY5U 3LPRA 3ENSB 1P3CA 1EZQA 4NWKA 1OS8A 2YNBA 1UW7A 4ZKOU 1LHFH 2OUAA 4E05H 4UFGH 2FOFA 3P70B 2AHME 2F4LA 3LJOA 1NROH 1QL9A 5DP9A 1C5PA 1V3XA 1C5WB 4MNXA 3ELAH 4PROA 1LVYA 3RU4T 3STIA 4NWLA 1KTSB 2AMDA 4XBBA 2CN0H 1AVXA 1J8AA 5C94A 2V3HH 1KXCA 1PPGE 3I29A 3TIUA 3UNQA 3FP8E 4E7RG 4AFQA 2KCOA 1H8IH 2WPIS 3BN9A 4DJZB 2Q6GA 5A8ZA 1ZPBA 2QF3A 3M3VA 5E0GA 3TGKE 3QZRA 1QQUA 3E3TA 2YMSB 5EPNA 1MABB 1ZSKA 3F2GA 3QDZB 1HAYB 2ZFFH 4FUEA 2GCTC 1NS3A 4JCNA 5EIYA 1DE7H 1HV7A 1SQTA 1C1TA 2ZHFH 2XOKD 2OXSA 4P02A 3V12A 1UVOA 3H5CB 1ZYOA 1J15A 1TMUH 4K69A 4MDSA 3V7TA 1GBJA 1GJ4H 3SU3A 4DGJA 1C5SA 3LDXH 3RDZA 4MTBA 3ATIA 1EASA 3W1EA 4O03A 2ZHEH 1SFQB 1F2SE 1XXDA 1CE5A 1E0FD 2F83A 3RUOA 1Y5BT 1N8OC 3NZIA 2FX6A 5DP3A 5CDFE 1Z1JA 4YTAA 3CS7A 1O30A 2C8XB 4YXWD 1VJAU 3LGTA 1D6RA 4Y0YE 1C1PA 1ESTA 1PPBH 3PLPA 3RXOA 2Y7XA 1SGEE 3SUFA 1W7XH 3EQ0H 5DP8A 1WV7H 1MTWA 4JZDH 1VJ9U 1QRWA 3B8JA 3M3TA 1Z8GA 1NO9H 3LC3A 1DDJA 2RG3A 2SFAA 2BD3A 2RDLA 1O3CA 3F2HA 1QZ8A 4NFEA 1N8OB 3MH6A 1TNJA 1MTNC 2B0FA 1BCUH 1NY22 5LPRA 3GCOA 2FOBA 1CT0E 3RXMA 1GJBB 1Z1IA 2AGIX 2XRCA 3G01A 2BDCA 4KKDA 4A7IB 3TJVA 1NRPH 1E38B 4AGKA 1P9UA 1UTMA 3A87A 2PFEA 4BNRA 1C5NH 3SGQE 3DD2H 3IITA 3M35A 5DG6A 1QIXB 3SQHE 1W7GH 1WU1A 2J92A 4BTIB 1AE8H 1Z8RA 3MFJA 1GVZA 4AZ2B 4FU9A 2WPMS 3RXAA 5KEDA 4K1SA 1EP6A 1OKXA 1MTNB 3RXEA 2ZP0H 1SLVB 1UCYH 1YPGH 1IQFA 1BTYA 1BRCE 2BVSH 1G37A 4MNYA 4TSFD 1COWD 1PYTC 1ZTKA 1O33A 3KQEA 3SU0A 3URDA 2KM0A 2ZCLP 1BTPA 1ELDE 3D49H 3KYFA 2ZO3H 5FPTA 1GBFA 1SLXB 1SQOA 2HOBA 1GL0E 4OGXA 2OTVA 1NBMD 1WQVH 3S9CA 1FAXA 1NFXA 1TGNA 3HPTB 5HGGA 1Y5UT 1A5IA 1G3EA 2ZQ1A 2BD7A 3E6PH 1SGFG 5HKKD 3D62A 2XBYA 5EJ1A 3AW0A 2P95A 4ZKNU 5B6OA 4NGAH 3SJOA 5A0CA 5C0TA 1L0ZA 2GVFA 1ZHRA 4ACBA 3F3BA 3DSPA 1GJ5H 3P17H 2GCHG 1VITH 2Z9IA 1GHXH 2AIQA 1YP9A 4U32A 4DT7B 1UTNA 4LZ1H 5CMXH 3PROA 1TGBA 5HIYA 1F0UA 2P93A 5LH8A 2XNDD 1O2LA 1AWFH 1PPZA 1TA2A 2Z6BD 2BY9X 4XBCA 4HGCA 3ZYEA 1Y3WA 1VITF 3L33A 2FI4E 3LIWA 1YF4A 3UFAA 2A4RA 2R3UA 4NA8A 1O5FH 4AB9A 1IOEA 1O35A 1S84A 4KELA 4B2AA 1F0TA 1B0FA 2BOHB 3ZZ5A 1DSTA 1GI4A 2ANYA 4U01A 5JBCS 1MKWH 4JK5A 1SGFA 3BIUH 1ANEA 1OOKB 1IAUA 3TK9A 5EOKA 1TPOA 4X6OA 4WMEA 1YGCH 1PPEE 2BOKA 1J14A 1NTPA 5JBBS 1LKAA 1C1QA 2W7UA 3S7HB 1HXEH 4UE7H 3PWCA 1IQLA 1DITH 4ZXXH 2FOEA 1H1BA 2UUJB 1XKAC 3BV9B 3RXHA 3ZZ8A 2WYJA 1EJAA 3KL6A 1TE0A 2A7JA 4LXBH 5I46H 5IYTA 1C2EA 5EXNA 1CU1A 2C90B 4VGCC 1P01A 5EQSA 1ZRBA 1W0ZU 1GMCF 2LPRA 1GJCB 1IQGA 1O36A 1UVSH 4IGDA 3DT0H 1UTKA 2C8WB 1CHGA 3FOAA 3SV9A 2BDIA 2LELA 2THFB 1Y3YA 1ZMJA 2ANKH 1AKSA 2W26A 1UK3A 3GY2A 4XOJA 4GVUA 1IQMA 4CH2B 5LGOA 1MMJN 4WF8A 5DN6D 1G3CA 3MMGA 3O8RA 4VGCB 2TPIZ 1G9IE 3JZ2B 1EJMA 2ZPSA 1HJAC 3KHVA 1E79D 2PP6A 1FAKH 1HGTH 1XVOA 1G3DA 3EE0B 1ELBA 1GL1A 3L6PA 1JXPA 4Y76A 1TOMH 1EZUC 1ELAA 1TQ0B 3KQCA 1HAVA 2JIZD 3HKJB 4XE4A 2UWOA 3R0FA 4XFQA 1SBWA 2CXVA 4GCHF 1MZDA 2XBVA 5DJ7A 3RXDA 4Q7ZA 1AY6H 1D9IA 2OQ5A 1HIAB 3UQOA 1FPCH 1VZQH 2O8MA 1B0EA 1O34A 1FI8A 1NRNH 2BX3A 2J2UA 2JJ2D 1S81A 3DCLA 1HJAB 4JYVH 2VVCA 1K1LA 3ITIA 1C5QA 3RMNH 1W0JD 2BY6X 2A7CA 1QBNA 2A5AA 2QGRA 2VU8E 1O37A 1QB6A 1QCPA 2WUCA 6GCHF 4JZIA 1O2ZA 1C5RA 2GX4A 1BMAA 1ZGVA 1QA0A 2SGQE 4IC5A 1LVOA 3MU8A 1TNHA 3SZEA 1FY4A 1BTXA 2J9NA 2PV9B 2ZZUH 4BTTB 2Y81A 4B2BA 1TONA 1W3CA 3OFND 2ALPA 2G00A 2NWNA 2JKHA 2VIDA 4BAMB 1MU8B 5DKMA 1GVKB 1WBGB 2AS9A 1U6QA 4I33A 1OXGA 1MTUA 3LT3A 2Z7FE 1A61H 1BTHH 1HUTH 1TMBH 1P03A 3UWIA 1PYTD 1UTPA 1EOJA 5F03A 3KIDU 4HTCH 4A5TS 4KTSA 2A0QB 2IJD1 4U30A 1EZSC 2VGCC 5CHBA 1AKSB 3PO1C 1EAXA 4NZLA 5ESBA 4YZUA 1FUJA 2IOTA 2VIQA 2ZI2H 2O8UA 3ZVDA 2YNAA 2XC0A 3ZYDA 1VCWA 1QQ4A 2QIQA 2GV7A 2ZDMA 1O2TA 4BAHB 1P2OA 2TGTA 1A3BH 4Y10E 3H7TA 5DP7A 5TCAA 2QV1A 1NU9A 4K60A 5IK2D 2ZQ2A 1S5SA 3MNXA 3S7KB 3ATLA 4OM9A 2BTCE 1HAVB 1HFDA 2G81E 2AMQA 3ZVGA 2VGCB 5SGAE 1DS2E 2P3UB 1GJAB 3GCNA 3PO1B 4LK4A 1DVAH 1DWBH 1FY8E 1KIGH 2QXJA 1SMFE 1GGDC 4Q4LA 1XUJA 1G30B 4FUGA 1TNIA 3RC4A 3O8CA 1EP5A 4AX9H 1MU6B 5PTPA 2FDAA 3P6ZB 1F5RA 3P95A 3L3TA 1TX8A 2GMTC 3D23A 2OCVB 4OS2A 2UWPA 2GZ8A 1TMTH 1XXFA 2Z3EA 3ZVFA 2ZFRH 2FTLE 4HZHA 4LZ4B 1L1NA 2FMJA 1GGDB 2WSSD 2B5TB 4KTUA 5GCHG 2FIRH 1MKXH 4INKA 3RXBA 2SGPE 1O3LA 1GBEA 4GSOA 1P8VC 1C1RA 1Z8IB 1TNLA 4ISNA 1BBRE 1DY8A 4XDEA 2TGDA 2J4IA 2XC4A 2GMTB 2Z94A 3PRDA 4H4FA 3RM0H 1AHTH 5C3NA 1UTQA 2PTNA 1PQ8A 4OS4A 1UVUH 2I6SA 3V13A 1ZMNA 1LHEH 2VH0A 4OS5A 4UONA 1P12E 4MNVA 2BLQA 3GY6A 5FX5A 1JMOH 3S69A 1A3EH 5HXFA 2VWMA 5DP5A 1G32B 4MPWA 8ESTE 2GZ7A 2CF8H 2V3MA 1AFQC 1BHXF 2J38A 3S0NA 2BHGA 5HMAA 2AGEX 5EXMA 1GI8B 9ESTA 3ZZ3A 5C1XA 2H5CA 1NRRH 4AFZA 5JYIA 4Q7YA 1EUFA 3A8AA 4AG1A 1RTKA 4GLYA 1AD8H 2ZCKP 4ZHLU 1LHGH 5F53A 5J4QA 4ACAA 4H6TA 3VEQB 1OWHA 1C4V2 4IBLH 1D3PB 3FN8A 5E2OA 1ZHPA 3BTME 1ZSJA 7GCHF 4YOGA 1KXEA 1N6XA 2IN2A 4THNH 4DW2U 1L4DA 1CGHA 3PLKA 1AFQB 2FOCA 2PSYA 2ZTYA 5JBAS 1J16A 2Z3DA 2QXHA 1XMNB 2FI3E 2KZ4A 1TGSZ 3SJIA 2AEIH 4HI3A 1TGTA 3DFJA 1QBOA 1ELFA 3GISB 1FN6A 1IQJA 1P09A 1V2MT 1AQ7A 2F3CE 4ASHA 2OLGA 1SGPE 1RXPA 1OWIA 1SGIB 2H1UA 5E2PA 1AZ8A 1ZTLA 1IQEA 1C5VA 3EYDA 2Y82A 3MH4A 2CV3A 2G8TA 2OINA 2BZ6H 1G3BA 2VINA 1QRZA 1T31A 1ZPZA 1HAOH 3U8TH 4B6FA 2BYAX 2ZDVH 4P00A 3A8BA 2EEKA 3HK3B 2ZCHP 1V6DA 2RA3A 1O2GH 1UK2A 2WUBA 1RRKA 1GMDF 1O2XA 4O3UA 3SW2B 1K1IA 1DXWA 1GCTC 1AU8A 3T27A 4A6LA 1HJ9A 1LPKB 4ABHA 1Q2WA 4UDWH 2KFWA 3FKSD 1C2HA 4WH6A 4A1TA 4CR5A 1C5XB 1YCPH 2CHAC 1Y3VA 2ZIQH 1DFPA 1ZPCA 4WXVA 2Y6TA 3GY3A 5C5OA 5GIBA 4JZFH 3OTJE 2ZA5A 2BD9A 2H9EH 1H9HE 1HAZB 3SJ9A 4UD9H 1OHHD 1E1RD 1S6FA 1YPJH 1X7AC 3OU0A 1GCTB 3TJUA 2UUKB 3FP7E 3QN7A 1NRSH 1O5GH 3E0PB 1ZJDA 1W8BH 1XVMA 2G55A 1K0HA 1FONA 1P10A 5LPEA 8GCHF 2FXRA 2H6MA 3MO9A 4K1TA 1E36B 4GHTA 3SNEA 5K7RA 2BD4A 4OGYA 1OWDA 4UFEH 2CHAB 1EKBB 4X2WA 1IHTH 1TPPA 2FP7B 2P8OC 2BXUH 4FUFA 1GVLA 3O8DA 1DWEH 2A32A 5ESTE 3UNSA 4FUJA 2A1DB 2HWLB 5CE1A 3A7TA 1K22H 1HBTH 5EW2H 1GHBF 1T4VH 2TIOA 2QXIA 3LGIA 3GDUA 2AGGX 1BMNH 4K3JA 1YBWA 2GJGA 3MYWA 1F5KU 1ARBA 5T6GA 5BRRE 1TPAE 3RU4E 1O31A 4HFPB 1VGCC 2ZU4A 5KECA 2CMYA 1EX3A 1O2JA 1O2YA 3UQVA 4Y6DA 2P8OB 2GCTB 1GBHA 3BIVH 5GPIB 1AIXH 1UTLM 1TBZH 1AFEH 1ZHMA 1EXFA 3PMBB 2ZU3A 2C3SA 1TRMA 1C5MD 1CSOE 1SB1H 1GBLA 1O3EA 4XBDA 1E35B 3SUDA 4TWYA 3TVJB 1MH0A 1GBDA 1T4UH 4X1RU 1EPTA 3D65E 2JJ1D 1T8NA 1VGCB 2A5KA 3BEFB 3M7TA 5LPFA 5ABWA 2NU1E 3EA9A 1WTGH 1ESBA 2BVRH 4BANB 1FY5A 4SGBE 3KCGH 4RT1A 1ELCA 2ZDAH 3BTDE 3VB3A 5L2YH 1VCQA 2G5NA 3M3SA 3U98H 4X6MA 1O2IA 4ZHMU 1IQNA 2A4OA 3N7DA 1KXAA 2Z9LA 2ZNKH 2PGQB 1ANDA 1P0SH 1V2RT 2ZFQH 1HDTH 3SV6A 3A83A 1V2PT 4CBNA 1EB2A 1P11E 1QY6A 1GJDB 1ETTH 1QB9A 1FY1A 1AUTC 3LC5A 4ZAEA 3SU4A 1SGTA 2IJOB 2O8WA 1GHAG 3RC6A 1TB6H 2AMPA 4BXSA 3RXUA 1SHHB 3PM3A 1M9UA 2F9VA 2V6NA 2EC9H 1MAYA 1SSXA 5A0BA 2ZTXA 4CRBA 1EPTC 4DG4A 1C5OH 4IW4E 2KX4A 3MNSA 1RTLA 3SNBA 2XXLA 2P3FH 1GBKA 2QXGA 1PQ5A 1UVTH 1UCYK 3EE7A 1E1QD 4WWYA 4AG2A 5ETXA 3E16B 1GMHG 2FOHA 3OYPA 1ZJKA 4MPUA 2JETC 1SLWB 4RT0A 4AOQA 1CT2E 4OS1A 1FZZA 5DP4A 3KYGA 4DIIH 1EFRD 3RLWH 3UOUA 5JB9S 1W0YH 1ELTA 2XWAA 1WUNH 3BTEE 2DE9A 2QF5A 1V2ST 4MVNA 3SNCA 2IPQX 1CHOF 1EPTB 1HB0B 2EI8A 2ULLA 3LJJA 2O8LA 2BDAA 2GT8A 4B71A 4FUHA 1FIWA 1N6YA 1PPCE 1PQ7A 3M37A 5C0UA 1DANH 1VKYA 1SGRE 3T26A 1TBRH 4B2CA 2BDGA 3A88A 3Q3YA 3TGIE 2G5VA 4GHQA 1TNGA 2XCNA 2FOMB 4INLA 3A84A 2F9UA 1NFWA 1P2MA 3SU5A 1C1WH 3T62A 2RFKC 1Z7KA 1YPEH 1CQQA 3TNTA 1J9CH 1NRQH 3PRBA 2V3OH 1YC0A 2FS9A 1W2KH 1V2QT 4X1NU 1HIAA 1TQ7B 2XBXA 1EAWA 1MCTA 3P8NA 1BMMH 5DSFA 2ODYB 1ORFA 3UWJH 3VXFH 2V0BA 5FL7D 1KLTA 2UUFB 3P8FA 1NM6A 4KTCA 4Y8YA 1P02A 1RFNA 2KAIA 1BMLA 3LH3A 1S82A 2L74A 3BTHE 4MNWA 3ZZ4A 4D8NA 1SOZA 3OE7D 1A7SA 1GHWH 1V2UT 4IS5A 1O5CB 1GI0A 1JBUH 3AW1A 9LPRA 3NRLA 2WPLS 1O2SA 2ZPRA 3AASA 3MWIU 3A80A 4FVBA 1GMDG 3TGJE 1GI5A 2AIPA 2PTCE 1YM0A 3ZVCA 1GI6A 4DT4A 2SGAA 3RXFA 4ZCNA 3MNBA 1HYLA 2BVXH 2UWLA 5AFZH 3RXIA 4Y0ZE 4R8TB 3OAAD 2XCFA 1WTHD 3BTKE 2J97A 3BG8A 3A89A 4NIVA 1V2OT 5A09A 1QURH 2OK5A 1O3MA 3LGYA 2WPHS 2FWWA 2FZZA 3KQ5A 2O8TA 1J17T 4Y7BA 4WVPE 4BXWA 2Z9JA 2ZGHA 3KF2A 1LMWB 1ANBA 4HG6A 2LP6A 3TJNA 3C1KA 2F43B 1K21H 4Z6AH 1JWTA 3PV4A 5E8EH 4E06H 4DCDA 2B8OH 1O2PA 4JYUH 8GCHG 3GDVA 2DUCA 2A4QA 3GY4A 2R0KA 3M7QA 3EA7A 3AVZA 2GKVE 3CNRA 1SG8B 1K9OE 2ZKSA 3LONA 3QGJA 3EDXB 1V2WT 2WYGA 2ZC9H 5HM9A 3E1XB 4X1QU 2ALVA 1L2EA 5HM2A 2OP9A 2AYWA 2OC8A 2F9BH 2BM2A 2KAIB 3EA8A 2G51A 2J95A 5AHGH 1F92A 1JIMA 1AE5A 1CT4E 1BHXB 4IN1A 5C17A 4WY3A 1D3DB 1DUAA 3A8DA 3PMJA 1D6WA 1SLUB 1BTUA 2J94A 4FVDA 2FTMA 1A0JA 1QL7A 3A86A 1DXPA 1PFXC 2EA3A 3LOXA 2FPZA 1QJ7B 1AO5A 3MH5A 3LGVA 3SORA 1HAGE 3GCHC 1YPMH 4H6SB 3KQBA 2OBOA 1FX0B 1GI1A 4ASUD 1GJ7B 1Z8JB 4ABGA 1O3PB 2HVXA 2Y5FA 3UPEA 3KEEA 3MH7A 1FXYA 3SJ8A 1TYNA 4TYDA 1S0QA 1GI2A 1Q31A 3QUMP 3BTWE 1YYY1 3A81A 3P8OA 1GI3A 2G4TA 3RLYH 3MI4A 3SZNA 4I8LA 4FUIA 1O3HA 2ZFPH 6ESTA 2WPDD 4Q63A 3GOVB 1H8DH 3BTFE 2HGTH 1TOCB 3ZV8A 3GCHB 1DUEA 4NSVA 3SI3H 2OC1A 2CF9H 1IHSH 5AFYH 2QA9E 5DPAA 2R0LA 1QR3E 3B9FH 1UO6A 3SV7A 1MTVA 2EI7A 2TGAA 4NFFA 1LTOA 2EI6A 4OS7A 5EU8A 3O8BA 1UHBA 5AF9H 1P57B 4MPXA 1SKYE 1HAIH 1E37B 1GWAA 5FXLA 1C9PA 3VB7A 1QA7A 1YKTA 5E0HA 3UUZA 1MAXA 1JIRA 2BLOA 1ZOMA 2VIWA 1TA6A 3U1JB 1BBRH 1BIOA 1QHRB 2GP9B 4TY6A 3HGNA 3ODDA 3UTUH 2SGFE 5H4IB 1ZTJA 3VB4A 1CGJE 1UMAH 1F5LA 1FMGA 1IQHA 3TK5A 3FAOA 3DSGA 1O38A 4ABBA 2K8IA 4IMQA 1NFUA 3M5MA 3SNDA 2FI5E 2PR3A 3ZVEA 3PMHB 3GDSA 1SPJA 1SQRA 2C93B 2XWBI 3KN2A 2ESTE 2HALA 1O3IA 1DWCH 1LHDH 1TBQH 2OD3B 1BRBE 3DFLA 1QBVH 1BTWA 1O3DA 2V7QD 4KGAA 2XBWA 4IMZA 1OPHB 3OEHD 3EAJA 1EATA 1QNJA 1GBCA 3KGPA 3RC5A 4X0WU 5B6LA 4FU8A 1O3FA 1C4U2 1K1OA 1WCZA 4ZKRU 1P2QA 2WPKS 2JDID 1ABIH 1MD8A 1BMFD 2TGPZ 4ISHH 1ELEE 2SGEE 2ZGCA 1MKXK 2ZGJA 4RKOB 1CHOG 3M5OA 4O9VA 1OP0A 1AI8H 2QN5T 3FP6E 1FN8A 5AVDA 4NZQA 3RXQA 3SU1A 2HLDD 3SGBE 1SGCA 1K1JA 1ID5H 7KMEH 4YOJA 1KXFA 3BTQE 1INCA 1MTSA 3WW7A 1C4Y2 5L30H 1K2I1 1UHBB 4A92A 1VITG 4BAOB 1T32A 4RI0A 2LNCA 1LHCH 2RA0A 2A5IA 3A7WA 5EG4A 1KDQA 3OEED 3TNSA 1KYNA 2GCHF 4AN7A 1L4ZA 1AB9C 3MO6A 5F8TA 3SO3A 2XW9A 4A1XA 4CHAC 4JZ1A 3ATWA 4ABIA 3RXSA 1BJVA 6LPRA 2BQ7B 3VXEH 1KMHB 3I77A 1PJPA 4JZEH 1O2NA 1S85A 1SGQE 1T7CA 2JH5D 5A8YA 2Z9KA 2QC2A 5FX6A 4UFDH 4B6EA 2IPHA 3VB6A 4Z1MD 4FXGH 2W6ID 3M61U 1KTTB 3VPKA 4BAQB 1DWDH 3MU5A 1OWKA 1V2NT 2XYAA 2SNWA 3RXLA 2QY0B 1AB9B 3PMAB 2WHXA 3BG4C 3UAIC 1OWEA 4YESB 1RGQA 1FNIA 5FAHA 2Z9GA 1A5HA 1LPZB 1YLNA 1GMCG 2GD4B 4ZROA 4AYYB 1HJ8A 1NZQH 1GDUA 1YPHE 1Y59T 2CK3D 3B23B 1FJSA 3E8LA 5A8XA 4OS6A 2GTBA 1AWHB 1TWXB 4FOUC 5JPMH 1HCGA 2HRVA 1TAWA 2ZF0H 2QF4A 2AERH 1GBMA 4IC6A 3SU2A 1A1RA 2AFQB 1S0RA 3PTNA 3PTBA 3NXPA 2ZFTA 4ISLA 5FBEA 2PUQH 1O2RA 1TX7A 5EW1H 4CBOA 3GY7A 3BG4B 3T25A 2Q6FA 1P2IA 3S9AA 3SQEE 3A82A 3IWMA 3RMOH 1SHYA 3SV8A 4UEHH 4TPYA 3SBKA 1ESAA 1O32A 4KP0A 1TX6A 3DSOA 3UREA 4B74A 2KCPA 1AZZA 3GYMA 3TJOA 1BRUP 3SHAH 1YLCA 3A8CA
chains in the Genus database with same CATH topology
1C2JA 4A1VA 3RMMH 3RXPA 1HRTH 5L6NH 3MU4A 1KSNA 4ZXYH 2FOGA 2Z3CA 1KDQB 3FANA 4GCHG 1LKBA 2F9PA 3LH1A 3VFEA 3GY8A 1H9IE 1O39A 1HAXB 1C2MA 1ARCA 1PPFE 2H5DA 1KXBA 1LO6A 1W13U 1YCPK 3NWUA 2A4GA 1DICA 3DHKH 2ZDNA 1TLDA 4FUBA 1HAPH 1BOQA 1V2JT 1VCPA 1O2OA 2OQUA 6GCHG 2WINI 2NU3E 1EAIA 2STBE 3NK8A 3UR9A 1P2KA 1LVMA 1YPLH 1O5AB 1Z71A 3ZZ6A 2C4FH 2NU0E 3K6YA 3LGWA 4GUXA 4DIHH 2ZTZA 2ODPA 4H42U 2BDHA 1C2FA 2BZAA 1BB0B 5C67A 1GDQA 1T8MA 1W11U 4O97A 4U2WA 1A2CH 3ZVAA 2W3KA 3QGNB 2BD8A 3MTYA 1TRYA 2OBQA 4YT6H 1ELVA 2R2MB 2FLBH 5EGMA 1K1MA 1TRNA 5DP6A 3BEIB 3STJA 1NU7B 1TGCA 2K1QA 4B73A 1A4WH 1O2UA 1ZRKA 5IDKA 1MZAA 1QGFA 2CJIA 1NPMA 2DE8A 3RXCA 3N7OA 3TU7H 2STAE 3CS0A 2AH4X 3ODFA 4YLUA 1C2DA 1ETRH 3RU4D 1LVBA 3U69H 3T29A 2VB0A 4CRDA 3TH4H 1SGDE 2VNTA 5TJXA 4Q2KA 1O2VA 2D1JA 3TITA 1YCPM 3ESTA 1FDPA 3TK6A 1BRAA 2HNTF 3W94A 1AN1E 1MQ5A 4ABJA 3SV2H 2ZWLH 3MNCA 3K9XB 4X2VA 2BLWA 1UTOA 4UFFH 1G36A 3SI4H 5C1UA 4YT7H 3UY9A 4CRAA 1EJNA 2BQ6B 1FV9A 2HNTE 3BTTE 5EODA 3UR6A 1ZGIA 3W95A 5T3HA 1XX9A 1ZZZA 3SN8A 1FY3A 5T6DA 3QWCH 3Q3XA 2P94A 3Q77A 4X8UH 3F68H 1YLDA 1MQ6A 1A0HB 2QCYA 3S9BA 1K1PA 1ZSLA 2FM2A 2FX4A 3PWBA 4ABAA 1Q3XA 3Q76A 2VVUA 1QRXA 3NUMA 3A7XA 4FUDA 4TWWA 2ZPQA 3T28A 3M7UA 1TNKA 2D8WA 2XNIA 1ZR0A 2A45B 4RN6A 2I6QA 1JRTA 2ZHDA 4E7NA 4CH8B 1HAHH 1XUKA 3MU0A 4WJG2 2ZECA 1GPZA 1JOUB 4ZH8A 2BY8X 1F0RA 1A46H 5GDSH 1NN6A 3ZZ9A 1MBMA 4Z0KA 1P9SA 2J34A 4BOHA 1EQ9A 2GGVB 1TALA 1LPGB 4XSKU 1V2TT 2WV4A 1BITA 4X8VH 5TCCA 2PSXA 3HK6B 3SUGA 1GI9B 5DGJA 1PPHE 3F6UH 1GDNA 2Y7ZA 1OP2A 2RCEA 4B76A 4TPIZ 1FLEE 4WMDA 1ACBE 2ASUB 1GBBA 1MD7A 3GICB 3AAVA 2A31A 5GCHF 2SGDE 1WYKA 1DX5M 2SNVA 2ZDKA 4K8BA 4LOYH 1SFIA 2B9LA 4K5ZA 2ZU1A 4TY7A 1GBAA 1HPGA 2FYQA 1A5GH 3NKKA 3ATKA 4K2YA 4FUCA 2PWXA 1O3BA 3RM2H 2JETB 2PLXA 5FPSA 1DSUA 1UCYE 3U8OH 2WV5A 2ZU5A 3RXVA 2HPPH 3T5FH 1RS0A 2FESH 6CHAC 4ZUHA 3H7OA 4AB8A 1V2LT 3SU6A 4FU7A 4NIYA 3M5LA 3UNRA 7GCHG 1QJ6B 1B5GH 4J2YB 1O3NA 1SGYE 2XTTB 3IG6B 1H9LB 4NIXA 3EGKH 4DURA 1BTZA 4Q80A 3T2NA 1DM4B 6CHAB 2A2XH 3DUXH 5F8ZA 4ABEA 1K1NA 2PUXB 3F9FA 4X8SH 3QZQA 1XM1A 4JYTA 2FODA 1XUIA 5EQRA 5F6MA 5A0AE 3A85A 2GDDA 3GCTF 4I32A 3F9EA 1L1GA 1C1VH 3V0XA 1CA8B 7ESTE 2BB4A 1O5EH 1MKWK 1SGNE 1GJ9B 2P59A 3U8RH 1FIZA 1V2VT 2ZHWH 5GWZA 5F8XA 5C20A 4ZHAA 4X8TH 1FQ3A 1DOJA 1G2LA 4JK6A 4QT8C 1QJ1B 1TIOA 4Y8ZA 3K65B 2PHBA 1SI5H 3ZZAA 2BX4A 4M7GA 4B1TA 5CHAC 3KQDA 4X2XA 1C1MA 1KXDA 3LGUA 1Y3XA 3E90B 4NG9H 4ZMAH 1OP8A 3FZDA 1GHVH 2H9TH 4D9RA 2VVVA 5EXLA 1AVWA 2GDEH 5BPEA 7LPRA 3QK1A 3U1IB 3LU9B 2JH6D 2PKSC 1AMHA 4ESTE 1KLIH 2F9NA 3F1SB 2FOAA 4F49A 1C1NA 1UTJA 1SL3A 1B7XB 1OSSA 1JRSA 1GJ8B 3PB1E 2R2WU 2YOLA 3V3MA 1GI7B 2JH0D 4ABDA 1C1UH 4X6NA 3TPIZ 1QB1A 3OX7U 4Y8XA 5CHAB 5L2ZH 4D7FA 1BDAA 1DLKB 1YPKH 2G52A 2QAAA 1QL8A 1P06A 3QX5H 4DY7B 1P05A 1O5BB 1H4WA 2BD5A 4R0IA 1HNEE 1HXFH 1SOTA 8LPRA 3MU1A 2G4UA 3BTGE 2PKSB 2ODQA 1C5LH 1C2GA 1GCDA 2R3YA 3RXTA 3HGPA 2D2DA 1GJ6A 1K28D 1WOFA 1THRH 1NESE 2O9QA 1IQKA 5A2MH 1GHBG 2Y80A 1NT1A 5C5NA 2P16A 4CRFA 4YOIA 1ETSH 2PGBB 1W10U 3M5NA 3TH2H 3MHWU 4YM9A 1ZMLA 4AGJA 3Q00A 2A2QH 1G2MA 1Y8TA 2VJ1A 3SGAE 1T8LA 1Z6EA 2QYIA 2ZGBH 3FVFB 1C2KA 4SGAE 4MQAA 2D26C 1C5TA 1C5UA 1C5ZB 1GHZA 2BDBA 2HPQH 2OC7A 1O3GA 2UUYA 1ELGA 4K1EA 3FFGA 3WY8A 3F9GA 2NU4E 1BA8B 1O3OA 5FCKA 3UOPA 1C2IA 3OSYA 3M36A 1YPHC 3BEUA 2ZG0H 1C1SA 1P2NA 4I8HA 3ZZ7A 3LKWA 2W3IA 1EB1H 2WPJS 3HKIB 5G4BA 2FO9A 4WH8A 1AVGH 2BXTH 1QFKH 1N1LA 3U9AH 4CREA 1L1JA 2VH6A 1NC6A 1GG6C 2TRMA 1WAYB 4B75A 3Q3KA 1OYTH 1W12U 3RXKA 3R3GB 2ILNA 4RSPA 1S83A 1CA0C 1O2QA 2BY5X 4RKJB 2FYRA 3KNXA 4ISOA 1E34B 1BQYA 4Y71A 3MOCA 4NA7A 3SHCH 3F9HA 1CO7E 3A7ZA 1PQAA 1O2MA 1O3KA 1XUGA 2A7HA 3E0NB 1NFYA 1T8OA 5FBIA 1GBTA 5DO4H 5C1YA 1GG6B 4X6PA 3VGCC 1O2KA 3RXRA 3HATH 4MLFB 2V35A 1A0LA 1CA0B 5K0HA 4WMFA 2W5EA 1EZXC 5HYOA 3OY6U 5EPYA 3URCA 1BZXE 4K8YA 5GJ4B 2GV6A 2Y5GA 2FS8A 3CP7A 1HLTH 1LDTT 2F9OA 4DVAU 1O2HA 3RP2A 2ANWA 2C8YB 1XUHA 1DT2A 2TBSA 3K2UA 1LCYA 2GT7A 2VWLA 3QLPH 1ZLRA 4MPVA 4I7YH 1BBRK 2NU2E 3MO3A 2C8ZB 3P8GA 3VGCB 1RTFB 1FPHH 3SOSA 5JB8S 4INHA 4ABFA 5I25A 3JZ1B 4AFSA 4WXIA 1Y5AT 3TH3H 3ZVBA 4NSYA 3RMLH 4ISIH 2ZGXH 1F7ZA 3A7YA 4X1PU 1LQEA 1TABE 1XKBC 4AORA 3BF6H 1GHAF 5GXPA 2VIPA 1CVWH 2W7SA 1KY9A 1MBQA 3QO6A 3K6ZA 2ZFSA 3FZZA 4F4OC 1SC8U 2BY7X 2ZDLA 3PYHA 4CRGA 1ABJH 2PKAA 3ZZDA 2P3TB 3NCLA 1GMHF 5J4SA 3RXGA 3SJKA 2VWOA 3P92A 1CBWC 1OWJA 1LQDB 2VIVA 3E91A 1MUEB 3UIRA 4DOQA 4BAKB 1O2WA 3QTOH 1TPSA 4MG3A 2ZEBA 2B7DH 4GAWA 4BTUB 5JBTA 5FPYA 5FHTA 1SR5C 1O5DH 5C2ZA 4Y11E 1RJXB 3A7VA 2BQWB 2Q1JA 2HNTC 2ZU2A 1DLEA 1F0SA 1O0DH 3ZZBA 4Y7AA 4O3TA 4D7GA 1UJ1A 3ZZCA 4I31A 2ZHQH 2BD2A 4I8KA 1CBWB 1O3JA 2VIOA 1P2JA 4AFUA 2M5TA 1P3EA 1QTFA 1THPB 1BT7A 2R9PA 8KME2 1DPOA 2ANMH 1RIWC 2Q6DA 3AAUA 4D9QA 2CGAA 3NPSA 1VR1H 2H9HA 1BUIA 4GPGA 3GCTG 3I78A 3C27B 1EAUA 3BSQA 4ZKSU 1P04A 2OC0A 2BLVA 2PW8H 1DY9A 1GHYH 1AUJA 4JMYA 3ATMA 1MCVA 2BDYA 2QF0A 4Y79A 3GY5A 4CHAB 1CGIE 1D4PB 2F91A 4NIWA 4NA9H 1C2LA 4X1SU 1AGJA 1EOLA 5JDUB 1OYQA 4IN2A 4CR9A 3VB5A 1RD3B 1KLJH 4YO9A 1W14U 3TLOA 2H2ZA 4J1YA 4D76A 1XUFA 4CRCA 1C9TA 1RIWB 3CENA 1IQIA 1WSSH 3SUEA 1OX1A 1UK4A 3ZV9A 4X2YA 4I8JA 1GBIA 5E0JA 1O3AA 1C1OA 1UVPA 4I8GA 5FCRA 2PKAB 2FLRH 1SQAA 3QTVH 2HLCA 2Y5HA 1V2KT 3DA9B 4YLQH 4AYVB 1S6HA 2GZ9A 1Y3UA 1WQSA 5T6FA 5DK1A 2VWNA 5EQQA 1TFXA 3SNAA 1ANCA 4Q7XA 2BMGB 1C5YB 1SVPA 2FEQH 1D3QB 1THSH 2XC5A 4NCYA 1Z6JH 3RXJA 3GYLB 1D3TB 3PLBA 1BJUA 3OY5U 3LPRA 3ENSB 1P3CA 1EZQA 4NWKA 1OS8A 2YNBA 4ZKOU 1LHFH 2OUAA 4E05H 4UFGH 2FOFA 3P70B 3LJOA 1NROH 1QL9A 5DP9A 1C5PA 1V3XA 1C5WB 4MNXA 3ELAH 4PROA 1LVYA 3RU4T 3STIA 4NWLA 1KTSB 2AMDA 4XBBA 2CN0H 1AVXA 1J8AA 2V3HH 1KXCA 1PPGE 3I29A 3TIUA 3UNQA 3FP8E 4E7RG 4AFQA 2WPIS 1H8IH 3BN9A 4DJZB 2Q6GA 5A8ZA 1ZPBA 2QF3A 3M3VA 5E0GA 3TGKE 3QZRA 1QQUA 3E3TA 5EPNA 1ZSKA 3QDZB 1HAYB 2ZFFH 4FUEA 2GCTC 1NS3A 4JCNA 1DE7H 1HV7A 1SQTA 1C1TA 2ZHFH 2OXSA 3V12A 1UVOA 3H5CB 1ZYOA 1J15A 1TMUH 4K69A 4MDSA 3V7TA 1GBJA 1GJ4H 3SU3A 4DGJA 1C5SA 3LDXH 3RDZA 4MTBA 3ATIA 1EASA 4O03A 2ZHEH 1SFQB 1F2SE 1XXDA 1CE5A 1E0FD 2F83A 3RUOA 1Y5BT 1N8OC 3NZIA 2FX6A 5DP3A 1Z1JA 4YTAA 3CS7A 1O30A 2C8XB 1VJAU 3LGTA 1D6RA 4Y0YE 1C1PA 1ESTA 1PPBH 3PLPA 3RXOA 2Y7XA 1SGEE 3SUFA 1W7XH 3EQ0H 5DP8A 1WV7H 1MTWA 4JZDH 1VJ9U 1QRWA 3B8JA 3M3TA 1Z8GA 1NO9H 3LC3A 1DDJA 2RG3A 2SFAA 2BD3A 2RDLA 1O3CA 4NFEA 1N8OB 3MH6A 1TNJA 1MTNC 2B0FA 1BCUH 1NY22 5LPRA 3GCOA 2FOBA 1CT0E 3RXMA 1GJBB 1Z1IA 2AGIX 2XRCA 3G01A 2BDCA 4KKDA 4A7IB 3TJVA 1NRPH 1E38B 4AGKA 1P9UA 1UTMA 3A87A 2PFEA 4BNRA 1C5NH 3SGQE 3DD2H 3IITA 3M35A 5DG6A 1QIXB 3SQHE 1W7GH 1WU1A 2J92A 4BTIB 1AE8H 1Z8RA 3MFJA 1GVZA 4AZ2B 4FU9A 2WPMS 3RXAA 4K1SA 1EP6A 1OKXA 1MTNB 3RXEA 2ZP0H 1SLVB 1UCYH 1YPGH 1IQFA 1BTYA 1BRCE 2BVSH 1G37A 4MNYA 1PYTC 1ZTKA 1O33A 3KQEA 3SU0A 3URDA 2ZCLP 1BTPA 1ELDE 3D49H 2ZO3H 5FPTA 1GBFA 1SLXB 1SQOA 2HOBA 1GL0E 4OGXA 2OTVA 1WQVH 3S9CA 1FAXA 1NFXA 1TGNA 3HPTB 5HGGA 1Y5UT 1A5IA 1G3EA 2ZQ1A 2BD7A 3E6PH 1SGFG 3D62A 2XBYA 3AW0A 2P95A 4ZKNU 5B6OA 4NGAH 3SJOA 5A0CA 1L0ZA 2GVFA 1ZHRA 1GJ5H 3P17H 2GCHG 1VITH 2Z9IA 1GHXH 2AIQA 1YP9A 4U32A 4DT7B 1UTNA 4LZ1H 5CMXH 3PROA 1TGBA 1F0UA 2P93A 5LH8A 1O2LA 1AWFH 1PPZA 1TA2A 2Z6BD 2BY9X 4XBCA 4HGCA 3ZYEA 1Y3WA 1VITF 3L33A 2FI4E 3LIWA 1YF4A 3UFAA 2A4RA 2R3UA 4NA8A 1O5FH 4AB9A 1IOEA 1O35A 1S84A 4KELA 4B2AA 1F0TA 1B0FA 2BOHB 3ZZ5A 1DSTA 1GI4A 2ANYA 4U01A 5JBCS 1MKWH 4JK5A 1SGFA 3BIUH 1ANEA 1OOKB 1IAUA 3TK9A 5EOKA 1TPOA 4X6OA 4WMEA 1YGCH 1PPEE 2BOKA 1J14A 1NTPA 5JBBS 1LKAA 1C1QA 2W7UA 3S7HB 1HXEH 4UE7H 3PWCA 1IQLA 1DITH 4ZXXH 2FOEA 1H1BA 2UUJB 1XKAC 3BV9B 3RXHA 3ZZ8A 2WYJA 1EJAA 3KL6A 1TE0A 2A7JA 4LXBH 5I46H 5IYTA 1C2EA 5EXNA 1CU1A 2C90B 4VGCC 1P01A 5EQSA 1ZRBA 1W0ZU 1GMCF 2LPRA 1GJCB 1IQGA 1O36A 1UVSH 4IGDA 3DT0H 1UTKA 2C8WB 1CHGA 3SV9A 2BDIA 2THFB 1Y3YA 1ZMJA 2ANKH 1AKSA 2W26A 1UK3A 3GY2A 4XOJA 4GVUA 1IQMA 4CH2B 5LGOA 1MMJN 4WF8A 1G3CA 3MMGA 3O8RA 4VGCB