1U6QA

Substituted 2-naphthamadine inhibitors of urokinase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Naphthamidine urokinase plasminogen activator inhibitors with improved pharmacokinetic properties.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 49
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2004-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1u6qA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1u6qA01
4HI3A 3BTME 3FP8E 4HZHA 2BD8A 4X1PU 1EOLA 1C5NH 4YTAA 1MBMA 1EOJA 2GZ8A 1GJBB 1AD8H 1ELCA 1MKXH 1GG6B 1ZTJA 2UUYA 1EB2A 2ZFSA 4O03A 2W3KA 1Y5UT 3KEEA 3A83A 1CT2E 1P11E 3P6ZB 1E0FD 1MTWA 5EQRA 2AH4X 2SNWA 3F9GA 4YOJA 2VIOA 2ZTXA 1FI8A 2CHAC 2Z3EA 3IWMA 3Q3KA 3RLWH 1Y5BT 3VGCC 1QL8A 3GY2A 2GTBA 2G52A 1SGCA 2OC8A 1HXFH 1GBJA 1NPMA 1TYNA 3UNSA 3E6PH 2OUAA 4FUCA 2G4TA 3GCHB 1N8OC 2BD5A 1HJAC 3A86A 4NIXA 1O3IA 5HM9A 3RXKA 1BHXF 1F5KU 1ZPBA 3D65E 1DY9A 4GCHF 3A89A 3TU7H 3V7TA 2ZDLA 5DK1A 1C4V2 5AVDA 1E38B 1BIOA 3VB3A 1BTYA 1CA8B 2DE9A 1JBUH 1TNGA 4BTIB 2PV9B 1MAYA 3V13A 1PJPA 1DITH 1QR3E 2HNTE 1TPOA 3TK9A 1E37B 1BUIA 3LIWA 1GHAG 3M36A 1T4VH 4E05H 1S82A 4XFQA 3MTYA 2A1DB 2ASUB 5L2ZH 3MH4A 2A2QH 5BPEA 2P94A 2D26C 3GDUA 1P10A 1W13U 3GCOA 1GCTC 1PFXC 3MU0A 1F0RA 5PTPA 4DT7B 2F3CE 3ZZ7A 2BMGB 2GT7A 2XBYA 2FX6A 2F9UA 4AG2A 1QGFA 3UQOA 1GHBG 1TBQH 3E16B 3W94A 1VZQH 1K1IA 2A7JA 1S0RA 3QK1A 1RIWB 4Y8XA 2C93B 2ANWA 2FO9A 4D9RA 3U98H 4KGAA 1FV9A 5A0AE 1TNJA 1SSXA 1C2DA 2H9TH 3KHVA 4CRFA 1J8AA 1GGDB 1NO9H 5C20A 2IJOB 4E7NA 4GLYA 3BTFE 5C1YA 3MMGA 4ZXXH 4PROA 1DWEH 1GI4A 1C5LH 1WAYB 4IN1A 4KTCA 3VB7A 5AFZH 2OD3B 4Y76A 3TNSA 3A87A 1OYTH 2ZGCA 3VXEH 3ZZ3A 3K65B 1FZZA 4MNXA 1NC6A 1O36A 4B75A 2BDCA 1AMHA 2CN0H 4JK6A 1Z6JH 3A8AA 1S81A 5A09A 2OXSA 1DWDH 4K1SA 2HRVA 1K9OE 4Q7ZA 3EAJA 1KXCA 2G5NA 4A5TS 2FTLE 1YPEH 1THPB 1EASA 1TNLA 2P3UB 2Y6TA 4YESB 1TALA 1X7AC 2PSYA 3UWIA 1G36A 1GHXH 2BZAA 1BDAA 2V35A 4F4OC 5DKMA 1ZRBA 1TMBH 1H9IE 1T8OA 1KTSB 3PWBA 5AHGH 4DOQA 1D6WA 4I8JA 1AUTC 1HYLA 2P16A 3Q00A 1KXAA 1BJUA 2DE8A 4ABIA 3O8RA 1HAXB 1YPKH 1YPMH 2F91A 1DXPA 1ACBE 2Z3CA 1CBWC 2P8OB 2SGAA 1UCYK 2A5IA 7GCHG 1ZSLA 2GV6A 3SORA 3M5LA 4OS4A 1C2EA 1J9CH 1C1OA 3KQDA 1ELVA 2FOCA 3D62A 1GHZA 2R2WU 5H4IB 3ZZ8A 4LXBH 4MTBA 1BTZA 3OSYA 1DUAA 3ZVCA 1MQ6A 2J94A 5LGOA 3RUOA 1MTVA 1LPGB 2ZF0H 1O3BA 2GT8A 7LPRA 2H9HA 2BY9X 1YKTA 3S69A 3LJJA 2GP9B 1OWDA 2RA0A 1C1WH 5T3HA 3MH7A 4LZ1H 1YPLH 1L1JA 4I8LA 1O2YA 2HNTF 4MG3A 2B0FA 1ZGIA 2D8WA 1Y5AT 3TH2H 3K9XB 1Y3XA 2VGCB 2OLGA 3BG4B 3RXLA 1KTTB 5FPTA 1SOZA 2ZDNA 3QO6A 2WINI 1CE5A 1UCYE 3TGJE 1MCVA 3PMHB 1G2LA 1SR5C 4FU9A 2BD4A 1QB1A 1NM6A 5E2OA 1IQNA 3GCTF 3LGTA 5ESBA 2A7CA 5HYOA 3SV8A 4GAWA 1K28D 1VCWA 3U1IB 1TGNA 4Z6AH 4CBOA 3SGBE 1LHFH 1VJ9U 1AWFH 4AYYB 1UVTH 3QGJA 4AGKA 3DFJA 1LVYA 4GHQA 4AB8A 3QX5H 2XBVA 1P9UA 5DJ7A 4CR5A 2EI8A 1O3GA 3IG6B 3DD2H 2QF0A 1TRNA 3LOXA 4NCYA 2XWBI 1EB1H 3GDVA 1THRH 2ZA5A 1V2KT 3ZZ6A 1AVWA 4X1NU 4FUDA 3ZZAA 1TGSZ 3UY9A 5K7RA 1FPHH 1UVPA 2DUCA 3BV9B 1G3EA 3RXVA 4D7GA 1MZAA 2ZHDA 1C2MA 2QY0B 3UFAA 3RXBA 1Y3YA 2UUKB 3UOPA 3RXRA 4ZH8A 2AGGX 1V2LT 4SGAE 1HIAB 1JOUB 2VWOA 2ZC9H 1HJ9A 1TNIA 1SLVB 1LKAA 1BBRK 1ESAA 1KLIH 2BZ6H 4FUEA 5FX6A 4ZUHA 1SGIB 2FYQA 1GHVH 3RLYH 1ELAA 2PKAB 1O5AB 4O97A 1ZPCA 2Z9GA 5C2ZA 5E0HA 3SQHE 2FS8A 1UTQA 1Z8IB 1SL3A 1AN1E 2HPQH 3GISB 3UIRA 1F0TA 4OGXA 1GDUA 1UHBB 3EDXB 1NESE 2AIQA 3PROA 2HPPH 2SNVA 2XCNA 2BD9A 1YPHE 3EA7A 1ARCA 1SC8U 2F9VA 2ANMH 4YT7H 3M3SA 2ZP0H 2AYWA 1BMMH 4DURA 1SGNE 3GCHC 3LT3A 4X2VA 1O35A 3SU3A 1O3AA 4CRGA 1T4UH 3N7OA 4KTSA 5EODA 3AAVA 2RCEA 2HOBA 1V2WT 1BBRE 3QWCH 1OWEA 3OTJE 3SJ8A 1YLDA 4AFZA 1FDPA 2C90B 1QBOA 2FXRA 2C3SA 5DP8A 1O2LA 3MOCA 3BF6H 2G4UA 4LZ4B 3JZ1B 1O5FH 4YO9A 1ORFA 4AYVB 2EI6A 2J9NA 5FAHA 3A8BA 3JZ2B 1MH0A 1SLWB 2A4QA 3UNQA 1FUJA 1C2IA 5EPNA 3VB4A 2SFAA 1MUEB 1YCPH 9ESTA 4AGJA 1C2GA 3SNEA 4WMEA 4IC5A 1S84A 1GJ9B 2ZFRH 1TPSA 2W3IA 3T25A 5C5NA 3DUXH 2HGTH 3QZRA 1KLJH 2GCTB 4ZHAA 1AE5A 2ZDVH 1GI3A 1FLEE 3SW2B 1NT1A 3TH3H 3RXQA 1EAUA 1CSOE 3MNXA 1FONA 5FXLA 2Q1JA 1P02A 1YYY1 1TGBA 2Y5HA 4UFDH 2BDHA 2WV4A 1A46H 1RIWC 3LU9B 2ODPA 1MD7A 1O2ZA 1QHRB 1HDTH 1Q31A 2BDAA 1SG8B 3SU1A 1SFQB 4FVDA 2A7HA 1RRKA 2Y7XA 1P06A 2AERH 8LPRA 4X8SH 3M3VA 1ZHPA 4ABHA 5GPIB 4ZKRU 3L6PA 4NIWA 4F49A 5EG4A 4H6TA 4XSKU 3RXTA 3S0NA 1O2VA 2FZZA 4Y11E 2A31A 3F6UH 3SNCA 3S7HB 2IOTA 1H8IH 1AB9B 1DS2E 3SJKA 1AO5A 1HB0B 1TX6A 2A5AA 3STJA 2AIPA 1UTKA 2JH0D 5C3NA 1BRUP 4YT6H 3UPEA 4X2XA 1VCQA 3HGPA 2PSXA 3TVJB 3KN2A 1NU7B 4YZUA 3PTNA 1CHOG 3VB5A 1EAIA 1MZDA 4B73A 4FU7A 2XBXA 4I8HA 2J38A 2WV5A 4NIVA 2H5DA 3M3TA 1AI8H 5LPFA 1C5WB 1GI9B 5F6MA 1D4PB 4ZROA 2V0BA 5GDSH 1PQ5A 4NSYA 1Z6EA 1P9SA 3SJOA 2W5EA 2BDIA 1W3CA 1EXFA 5F8ZA 1G37A 5GCHF 1TPPA 1KIGH 3ZV9A 3TJOA 4A7IB 1OP0A 1P12E 4RSPA 1YM0A 2ZDAH 4AB9A 2Y80A 4KELA 1FIWA 3FFGA 1OWKA 2BTCE 2CF9H 1C4Y2 1ZLRA 3NK8A 3SNBA 4ZMAH 3SHAH 3UR6A 2P8OC 3NUMA 5SGAE 4AOQA 5E0JA 1SB1H 1O0DH 4JYTA 1MKWK 1F0UA 1QJ1B 3DT0H 2BXTH 4NA8A 2XBWA 5JYIA 1ABJH 1EZSC 1PQ7A 4ZKOU 4WF8A 3NWUA 3SV7A 3NPSA 3V12A 4NG9H 1BTWA 4IC6A 5EXLA 1O2QA 1SHYA 2NU2E 1TGTA 1TAWA 1AFQB 1FPCH 2VIQA 1WBGB 5J4SA 1INCA 1XX9A 4MPWA 1O5CB 3CENA 4OS6A 5JBBS 1QBVH 1AKSB 1O2NA 3H7TA 1SHHB 3GYMA 1ELFA 3SUEA 1VR1H 2Z94A 2VGCC 3BG4C 1K1PA 1SMFE 2Z9JA 1P3EA 5HXFA 1IQHA 1T8LA 2FTMA 2WPHS 5GWZA 3ZVBA 2H1UA 2BQWB 1GBTA 3HPTB 2ZU4A 1ETSH 1PPGE 2STAE 1BHXB 1C5YB 1E34B 1P09A 1CGJE 4K69A 3CP7A 1ZHRA 1DWBH 1RTLA 5E8EH 2FS9A 3MO6A 1AUJA 2GMTB 2G55A 3SUDA 3ZV8A 1K1LA 1GJ5H 3KQBA 1HUTH 1H8DH 1CA0B 1PPBH 2XTTB 4K8BA 2W26A 1N1LA 2VNTA 2A45B 2ZCHP 1DXWA 1KY9A 2D1JA 2FOBA 1TGCA 4X8UH 2K1QA 1YC0A 2ZGXH 3U8OH 1MMJN 3KF2A 3PO1B 4JZDH 1A0LA 1JMOH 1HIAA 1JRSA 1ZRKA 1O3DA 1CHGA 3C1KA 3RP2A 1SQAA 3SQEE 1P2QA 3P8OA 1EZUC 1ZYOA 1V2JT 2XYAA 3B23B 2C8WB 3STIA 2PKAA 1KLTA 1AVGH 1DICA 4K2YA 3MFJA 3KQEA 3M7TA 1TA6A 3P95A 4AX9H 2KAIB 2B8OH 3QLPH 3P8GA 1O2MA 2Y5GA 2Y82A 3EA9A 1O3JA 1DFPA 2PGQB 3SI4H 3AVZA 1O5DH 1C9PA 1UHBA 2M5TA 1O3CA 4R0IA 5GJ4B 3LGVA 1DSTA 1TA2A 1TABE 1DDJA 5FCRA 2A4RA 1GVKB 3R3GB 2GZ9A 2XRCA 1SGDE 3HATH 1KSNA 2QXJA 1GJ4H 1UCYH 2EI7A 3TLOA 3RM2H 3UOUA 1ARBA 5FBEA 4DY7B 2OCVB 1L0ZA 3QGNB 7KMEH 1W14U 2ZPQA 1LHEH 2FPZA 1JRTA 1ANEA 2BDYA 3SJ9A 1V2QT 4D76A 4TY6A 1QBNA 3B8JA 1K1JA 1LPKB 1P2NA 1BRAA 1OKXA 1O2TA 5A2MH 3B9FH 1GMDF 1UTLM 1O34A 1HAZB 2GDEH 3E0PB 2FIRH 1V2MT 1TBRH 1VCPA 1GHWH 1C2JA 1BTUA 1WTHD 2XCFA 1TMTH 1SFIA 2A4OA 3RC4A 5T6GA 1BTPA 4ABJA 4DW2U 3KQCA 3O8DA 3A88A 3BSQA 3U9AH 2TIOA 1IHTH 2OTVA 5A8ZA 1IQKA 2OBOA 1EJMA 1SQTA 1WOFA 4X2YA 3R0FA 5EOKA 3SV6A 1GL1A 3SHCH 2VU8E 2TPIZ 2J92A 1A3BH 4TWYA 4AZ2B 1O2PA 1XUIA 3AASA 2ZU2A 4JK5A 2CGAA 4O3UA 2STBE 2GCTC 4Y0YE 2ZIQH 2R3UA 4OGYA 1C5UA 1NRNH 3EA8A 1V6DA 3A82A 4Y6DA 1GPZA 1F5RA 3RXMA 2PUQH 5EW1H 1DVAH 1P01A 4MDSA 5HMAA 2JH6D 4AFUA 6GCHG 3E91A 1NRRH 1ZMNA 1TFXA 4BTTB 2ZWLH 2F9BH 2PTCE 1QY6A 2EA3A 2B7DH 3BTGE 4Y7BA 4ASHA 2ZPRA 2FP7B 3LKWA 1HAOH 1PQAA 3Q76A 3ZVDA 2QN5T 1ZSJA 1A0JA 8GCHG 4ABEA 1G3BA 1GBCA 2FEQH 5TCAA 1BCUH 1MTNB 2ZHFH 1AU8A 2AMDA 3G01A 3L33A 3PV4A 3BG8A 3BIVH 3UWJH 1O5EH 3RMLH 4CHAB 3F9FA 1O39A 1BBRH 2VH0A 1GI8B 3KCGH 1NS3A 3U8TH 4DGJA 2XXLA 1AB9C 2QXIA 3PM3A 1LQEA 4BAHB 2BD2A 2AS9A 1G9IE 4D7FA 3M61U 1BMLA 1ZHMA 1TOMH 2BOHB 2ZHEH 4WJG2 1UTJA 2VINA 1XXFA 2ZO3H 2UWPA 2ZFQH 1HCGA 3ZVEA 1WQVH 1W7GH 1EZQA 1GMCG 4ISLA 2A0QB 2G5VA 1ZSKA 4ZKSU 1O2GH 1XUKA 4YM9A 3DA9B 4X8TH 3M7QA 2G51A 1GHYH 1GI5A 3MHWU 4Y79A 1FN6A 1WV7H 4U30A 3FP6E 1TQ7B 1C1RA 1JXPA 3FZDA 1O2UA 4X0WU 4TPYA 4BNRA 2UUJB 1E35B 1S6HA 1IQLA 5EQSA 4I31A 1GHBF 1C2HA 2ODQA 3BEIB 1Z1JA 2WPIS 1Y59T 1VITG 4AFSA 1W11U 4Y7AA 3U69H 1LKBA 1LO6A 4GSOA 1SLXB 1F92A 1O3NA 3F68H 3PLPA 4BAMB 1BZXE 2R3YA 4OS2A 2HWLB 3ODDA 1GJAB 1FMGA 2QYIA 4CRCA 1W12U 1QL9A 2FI5E 5DPAA 1HAGE 4HTCH 2BOKA 1Z7KA 1F0SA 1GDQA 1GBEA 3NXPA 2BVXH 1N6XA 1BMAA 2CV3A 1H4WA 1AKSA 4ABDA 1A5GH 1GBFA 3DFLA 3T26A 5I46H 3MH5A 2VIPA 3RXUA 2YOLA 4NA7A 3U1JB 1EX3A 3BTEE 4E7RG 4D9QA 1KDQB 1XM1A 1BB0B 1QA7A 1ZMLA 2XC4A 4BOHA 1OWIA 4I7YH 1G30B 2BB4A 1OPHB 1ZR0A 2O8UA 1G3DA 2C8YB 3P17H 2BLOA 5I25A 2IPHA 2W7UA 2HLCA 3ENSB 1RTFB 1OP8A 4B1TA 4CRAA 2ZU1A 1LQDB 4A1VA 4YOGA 3ZZ9A 1A5IA 3PB1E 1DANH 1G2MA 5L30H 1V2UT 1XUHA 2ZCKP 4I8GA 1CGIE 2H9EH 1C5QA 4XBDA 1AVXA 3SV2H 5C5OA 5JBAS 2VVVA 1ZTKA 1HAVB 3CS0A 3RMNH 3A7TA 4NSVA 2JH5D 4WMDA 1QCPA 2RDLA 4Y8ZA 1P2KA 2GMTC 2SGEE 1GMHG 1PPHE 4JZFH 1CA0C 1HJ8A 3OYPA 3T28A 1GBLA 3ZZ4A 2RA3A 1IQMA 3OY6U 2THFB 1ZPZA 3UQVA 1EJNA 5A0CA 1Y8TA 3AW1A 3O8BA 1GI1A 3PMAB 3Q3XA 4NFEA 1O2KA 1BTXA 3I77A 1GG6C 5TJXA 2GCHG 3SGQE 1ZTLA 4K1EA 2BD7A 5AFYH 7GCHF 3PO1C 1H9LB 3SUFA 1CO7E 4DG4A 3FAOA 5EXMA 4X1QU 3VPKA 4NA9H 3VGCB 2BD3A 1U6QA 1OS8A 2C8ZB 1BRCE 4GUXA 1SGTA 1N8OB 1ESTA 2ZECA 3SNAA 2GDDA 4NIYA 1PPCE 1SGRE 5CHAB 3QZQA 3EYDA 6ESTA 4J1YA 4B2CA 1MAXA 5DP5A 4ESTE 3F9EA 3ZZ5A 2BDGA 5A0BA 1A3EH 3BEFB 1ETRH 2ZDMA 1H9HE 3RDZA 3OY5U 1QJ6B 2FI4E 1GJ8B 4K5ZA 2PLXA 1K2I1 4IGDA 4AN7A 2JETB 3M35A 3SJIA 2PGBB 4BTUB 1MKWH 2O8TA 4NZQA 3T5FH 3PMBB 3S9BA 1W0YH 2H6MA 1L1NA 3EQ0H 1QB6A 1K21H 1XUJA 2FLRH 1PYTC 2PFEA 1D3QB 5E0GA 1O3HA 3ATKA 4TYDA 1MU8B 1TMUH 4K3JA 1THSH 5DO4H 1RGQA 4AORA 3MO9A 2NWNA 3KNXA 1QB9A 3ITIA 1NFWA 1NZQH 2O8LA 2SGDE 1OOKB 2XWAA 4X6NA 4UFFH 2OQ5A 1SGFG 2SGFE 1WCZA 3MO3A 1GBDA 2ILNA 1QRZA 2ANYA 4Q7YA 1UVUH 1O33A 4UD9H 3SU4A 1NRQH 1C5XB 1AZZA 2FM2A 1QRWA 3T62A 1AWHB 3FZZA 1GI0A 3M37A 1J17T 2LPRA 2WPKS 4X6OA 1VGCB 1OYQA 3A8DA 4IS5A 2FYRA 3RXGA 1PPEE 1PPFE 1KXDA 1FJSA 3LH3A 1IOEA 1TNHA 1ZJDA 3VEQB 3TGKE 4CH2B 1O31A 4B74A 1SQOA 4ABAA 8KME2 1PQ8A 1TBZH 3ESTA 1P2MA 3P70B 2QAAA 4Q80A 1IQEA 2BXUH 2VB0A 3E0NB 1B0FA 1GGDC 2NU4E 3VXFH 1EJAA 2TGAA 1ZGVA 1FQ3A 2P59A 3OX7U 3TGIE 3BN9A 5CE1A 3F9HA 4MLFB 4IBLH 3Q77A 1YPGH 6LPRA 3UR9A 1UMAH 2BYAX 1O5BB 1YBWA 3MYWA 1C2LA 2WUBA 3SI3H 1CGHA 1EAWA 1IAUA 4OS1A 2VWMA 3KL6A 2VJ1A 3HGNA 3M5NA 3ZZBA 3BEUA 4X1SU 4FU8A 4RKJB 4KKDA 1XKBC 4R8TB 1BOQA 5C1UA 2ZZUH 3E1XB 4NZLA 3BTWE 3TJNA 1O2RA 1P2JA 3A84A 5EPYA 1MTNC 1DM4B 3GICB 1A7SA 1QTFA 2BM2A 1OSSA 2QV1A 1C5VA 4CHAC 1RTKA 4HGCA 2G8TA 1UTMA 1K1MA 1LHDH 4X8VH 1OWJA 4QT8C 2B9LA 2W7SA 4TPIZ 1O2IA 4Q7XA 4X6PA 2PKSB 5FPYA 3K6YA 1CBWB 3EGKH 2WPMS 1JWTA 4JZ1A 2Z7FE 5FCKA 3URDA 1LPZB 4X1RU 1OP2A 3QN7A 2BLVA 1LCYA 3A81A 4VGCB 2Z6BD 1HNEE 4B71A 1WSSH 4WY3A 4DIHH 1TB6H 4SGBE 3RXAA 3MU4A 1C1PA 5GIBA 1ABIH 3NKKA 3F1SB 3HK6B 1XVMA 1P04A 1GCDA 4DCDA 5DP9A 1T7CA 1YGCH 4RKOB 3RXIA 3ZYDA 5EW2H 1YF4A 2ZCLP 1HGTH 2Z9KA 3GY8A 1YLCA 1V2PT 3DHKH 1NFUA 1GI6A 2WYGA 3WY8A 3H5CB 1LVMA 3HKJB 4I8KA 5JB8S 5T6FA 4CRBA 2ESTE 1C1SA 1D3TB 3V3MA 1UTPA 4GCHG 4MNYA 5HM2A 4CH8B 3UNRA 1ZOMA 5JDUB 1FAXA 2ZU5A 1FY5A 1HXEH 4XOJA 1SLUB 1AIXH 2ZQ2A 5HGGA 4DVAU 1NN6A 2WUCA 3MNBA 1B5GH 1LHGH 1MBQA 1DE7H 1ZJKA 4BXSA 2PHBA 4K60A 4FXGH 2P95A 4Y8YA 2FI3E 2J34A 4Q2KA 1NFYA 2FDAA 1SVPA 1O2OA 2PR3A 3I78A 5T6DA 2H5CA 2VH6A 1CHOF 4Z0KA 1PYTD 1MTSA 2GD4B 4H4FA 4WXVA 4CREA 4NFFA 1WU1A 4ZAEA 1ELTA 2TGTA 1DOJA 3KIDU 4WVPE 1UK2A 8ESTE 1KXBA 5K0HA 4IW4E 1GJ7B 5IYTA 3SOSA 1IQJA 1XXDA 2NU1E 3LONA 3MU8A 4CR9A 2UUFB 2BDBA 3LC3A 2A2XH 1WQSA 1C4U2 3M5MA 1DY8A 1O38A 3ZYEA 1CU1A 2ZU3A 1DT2A 4FUHA 2V3OH 4FUJA 4AG1A 2FOAA 4INKA 4GVUA 1MU6B 3TNTA 1TLDA 5LH8A 2YNAA 4K8YA 3IITA 3KGPA 4A1XA 4MPVA 4MNVA 1FY3A 5JPMH 1O5GH 1V3XA 1C5PA 2BY6X 4H42U 1FY4A 2QCYA 2PUXB 1PPZA 2ZHQH 1SGYE 2H2ZA 3LPRA 3SU5A 3LGYA 5CHAC 4IMZA 2ANKH 1DPOA 3LGIA 2Z9IA 1GBBA 4BAQB 3LGWA 2R0LA 1RD3B 1H1BA 1T31A 3ELAH 1V2ST 2QGRA 1NROH 1GBKA 5FHTA 4UFGH 4FUIA 4B2BA 2ZI2H 2ZG0H 1EP6A 2GZ7A 4O3TA 5C67A 1UK3A 5G4BA 1C1TA 4E06H 4ZKNU 4UE7H 1XMNB 5ABWA 2JETC 1VJAU 4IMQA 2R0KA 2VIWA 1W2KH 3E3TA 3U8RH 1W7XH 2JKHA 2UWOA 2EEKA 1C5TA 2B5TB 4YLQH 1SPJA 4JYVH 1L4ZA 1SGEE 4NWKA 3NCLA 5B6OA 3MNCA 1BRBE 3SBKA 4A1TA 4ZXYH 2BLQA 3A80A 3TK6A 5DG6A 3L3TA 3NZIA 4X2WA 3URCA 3LJOA 1A0HB 1C5ZB 5F8TA 1HLTH 1ELDE 2G00A 2R2MB 2SGQE 1UK4A 4M7GA 1C1NA 3TITA 1KXEA 4MPUA 2O8MA 1SGFA 1EPTB 1J15A 1IHSH 4O9VA 1A5HA 1CT0E 1VGCC 3ATMA 1TNKA 3T27A 3T2NA 1N6YA 6CHAB 4XDEA 1LTOA 2OC7A 2BX3A 1C5MD 2FOHA 2XNIA 5L2YH 1ELBA 2BHGA 3CS7A 4TY7A 3RXSA 3P8FA 1O2XA 2A32A 3UTUH 4UONA 3QTOH 2F9NA 2VIVA 3SZNA 3GCTG 2PWXA 4GHTA 4K1TA 1MD8A 1J16A 1XKAC 3P8NA 1ELGA 1GL0E 1SGPE 3GDSA 2QXGA 1UVSH 1UTNA 1JIMA 1YPHC 1TQ0B 2AFQB 2OP9A 1J14A 4NWLA 1QL7A 1MKXK 5GXPA 2ULLA 1DUEA 1L2EA 1AZ8A 4A6LA 1UTOA 3HK3B 2C8XB 3MU1A 2GGVB 1S5SA 5DP3A 1C5SA 5DP7A 3SU6A 1C1MA 2OBQA 1EQ9A 3QUMP 2YNBA 3A7YA 2Y5FA 3LDXH 4ZHMU 1GHAF 2OQUA 1WYKA 1V2NT 4YOIA 2ZEBA 2F83A 1C2FA 1GVZA 1O37A 2BQ6B 1ESBA 1O2JA 2TRMA 2O9QA 4JZIA 2ZFFH 1IQGA 5LPEA 4FUBA 1V2VT 3E8LA 1AY6H 3S9AA 1MQ5A 5EXNA 4UEHH 1AGJA 1S85A 2AMQA 1RJXB 4BANB 5IDKA 2ZGJA 4JZEH 1P57B 2GV7A 1Y3UA 2FODA 2PKSC 1AHTH 1C1VH 4RN6A 1EATA 1DX5M 3TIUA 3MNSA 1A4WH 1GJCB 2LNCA 1O3EA 2F9PA 1Q2WA 4DJZB 1K22H 1YPJH 4U2WA 1ZMJA 4LOYH 1RFNA 4VGCC 1GBMA 4WH6A 4CBNA 5EQQA 4KP0A 3M5OA 1S6FA 1S0QA 1QQ4A 4OS5A 3QTVH 3Q3YA 4ZHLU 1C2KA 3AW0A 2P3FH 5JB9S 3RC5A 9LPRA 4INHA 1ZZZA 2R9PA 3GY3A 1W8BH 5JBTA 3RXPA 3BTDE 3RXCA 2OC0A 2QXHA 1C1QA 1W0ZU 1BJVA 1AQ7A 2ZQ1A 1A1RA 2D2DA 4GPGA 3PMJA 1FIZA 3SU0A 1DWCH 1HAYB 5FPSA 1AFQC 1D6RA 2Q6DA 3K2UA 5TCCA 4ISHH 2ZTYA 3V0XA 2ZGBH 6GCHF 3ZVGA 1FY8E 3SU2A 5FX5A 2FMJA 4AFQA 4MVNA 4ISIH 1BITA 1D3DB 4Y71A 1TPAE 4D8NA 1GWAA 8GCHF 4Y0ZE 4XBBA 3UUZA 1GJ6A 3RU4T 3TK5A 2Q6FA 5C1XA 1DLEA 4UFEH 3SN8A 1HV7A 2BLWA 4IN2A 3K6ZA 5A8XA 3GY7A 3HKIB 3ZZCA 1MCTA 3RM0H 3SUGA 2AGEX 2HALA 7ESTE 4U01A 2GKVE 2OC1A 2J4IA 2VWLA 3LGUA 4B76A 3MU5A 1V2TT 4U32A 1UVOA 1GJDB 4I33A 1IQIA 1QFKH 4I32A 2VVCA 5L6NH 4BAOB 2TGDA 1S83A 1D9IA 1GMCF 2I6SA 3TJVA 1GBAA 2BX4A 3S9CA 2NU3E 1FXYA 2RG3A 2UWLA 5DP6A 1RXPA 3VB6A 1BA8B 3A85A 1SBWA 2CHAB 2FWWA 2KAIA 1K1NA 2J2UA 1ANCA 3A7VA 3P92A 4FUGA 1LDTT 5DGJA 1E36B 3GY6A 2WPJS 2WYJA 5JBCS 1GI2A 3E90B 3A7ZA 1LHCH 1LVBA 1F7ZA 3W95A 1CT4E 1HJAB 4JCNA 3GY5A 1L4DA 1VITF 2ZHWH 3BTHE 3RXOA 2PW8H 3SGAE 4J2YB 1K1OA 1LMWB 2ODYB 1Y3VA 2AGIX 5E2PA 2P93A 3TJUA 1QJ7B 2FLBH 1M9UA 1D3PB 3BTQE 4JMYA 1KYNA 2CXVA 3RU4E 2PTNA 1V2RT 3ATIA 3RU4D 2BY5X 4WXIA 3SO3A 1QRXA 4H6SB 1ID5H 4WWYA 3GYLB 4ABFA 1O2WA 1C9TA 2FX4A 1GCTB 4Y10E 1RS0A 2FESH 1HRTH 3MH6A 1Q3XA 1QURH 2A5KA 1HAHH 4FUFA 3ATWA 5EU8A 3RXDA 5GCHG 1WTGH 4UDWH 1ANBA 2SGPE 3TH4H 2NU0E 2Y7ZA 1NTPA 1CQQA 1JIRA 1XUFA 2ALVA 3I29A 1MTUA 4MPXA 1O3MA 2EC9H 2BVSH 1W10U 2ZKSA 2QA9E 1G32B 1O3PB 4ISNA 1O32A 2Z3DA 1DSUA 1GMHF 2VIDA 3LH1A 2P3TB 3SV9A 1TRMA 3LC5A 1HAIH 4MQAA 4TWWA 3PLBA 1EPTA 1YCPM 1EZXC 3VFEA 5ETXA 4MNWA 2Y81A 1G3CA 5F8XA 3RMMH 1QIXB 2ZGHA 2GCHF 3ATLA 5CMXH 1NFXA 1T32A 1OXGA 1Y3WA 2FOGA 1AE8H 3OU0A 1HPGA 5DP4A 2CMYA 1P2OA 1Z1IA 1EPTC 1IQFA 1FN8A 2Q6GA 2WPLS 1UJ1A 3A7WA 6CHAC 1TOCB 1O3FA 2QIQA 2XC0A 3BTKE 3H7OA 1NU9A 2G81E 3QDZB 1O30A 2ZTZA 1O2HA 5J4QA 1SGQE 3UREA 4HFPB 2HVXA 2GX4A 5BRRE 1DLKB 4BAKB 4NGAH 3FANA 3AAUA 3EE0B 1OWHA 2I6QA 2QF3A 1WUNH 3O8CA 2VWNA 1T8NA 3RXFA 2AMPA 2ZPSA 1GBHA 1P8VC 5AF9H 3GOVB 4ISOA 1P05A 1O3OA 4B2AA 2C4FH 2HNTC 3ZZDA 1SOTA 2GVFA 1HFDA 4X6MA 3GY4A 1P0SH 1FY1A 1TX8A 1C5OH 2O8WA 3FVFB 3M7UA 4WMFA 1TONA 1EAXA 3C27B 3RXHA 1GDNA 3RXJA 2CF8H 3ODFA 1ELEE 1Z8RA 5FBIA 2XC5A 4KTUA 1AFEH 5A8YA 1NRSH 2XW9A 1SI5H 1KXFA 1Z71A 1F5LA 2ZNKH 1TE0A 3RC6A 3RXEA 1F2SE 1BT7A 1LVOA 1XVOA 1FNIA 4CRDA 3D49H 1P2IA 3TPIZ 5EGMA 4JYUH 2V6NA 4FVBA 1XUGA 1EP5A 3MI4A 1A61H 1BTHH 4LK4A 1HAPH 2A4GA 3FP7E 1ANDA 2BY8X 3T29A 1QQUA 3A8CA 2OINA 1O3LA 1C1UH 1GI7B 4YLUA 4DIIH 2BVRH 1TRYA 3A7XA 3ZVFA 2J95A 3S7KB 2F9OA 2ALPA 3PWCA 5F03A 1EKBB 3MWIU 1BMNH 1L1GA 2FOMB 1Z8JB 2VVUA 4XE4A 1KDQA 1OX1A 1EUFA 1NY22 4ABGA 2AEIH 1B0EA 2QC2A 1YCPK 2TGPZ 1ETTH 4THNH 3PYHA 1UO6A 1V2OT 2CJIA 5ESTE 4BXWA 1TX7A 4XBCA 2FOFA 4A92A 1TWXB 3GCNA 1QNJA 4ABBA 1QA0A 1NRPH 2ZFTA 4OS7A 2V3HH 1TIOA 2FOEA 1HBTH 3SNDA 1A2CH 1GVLA 3PLKA 3RMOH 1T8MA 1C5RA 1CVWH 1VITH 1HAVA 2BY7X 1P03A 3D23A 3BIUH 2ZFPH 2ZDKA 2IN2A 1Z8GA 1GMDG 1P3CA 1B7XB 1GBIA 3BTTE 1BQYA 1FAKH 4WH8A 2TBSA 5LPRA 1YP9A 2Z9LA 1O2SA 2BQ7B 1O3KA 3PTBA 3ZVAA 4INLA
chains in the Genus database with same CATH superfamily
4HI3A 3BTME 3FP8E 4HZHA 2BD8A 4X1PU 4XRNA 1EOLA 1C5NH 4YTAA 1MBMA 1EOJA 2GZ8A 3FKSD 1GJBB 1AD8H 1ELCA 1MKXH 1GG6B 1ZTJA 2UUYA 1EB2A 2ZFSA 4O03A 2W3KA 1Y5UT 3KEEA 2QF5A 3A83A 1CT2E 1P11E 3P6ZB 1E0FD 3SYJA 1MTWA 5EQRA 2AH4X 2SNWA 3F9GA 4YOJA 2VIOA 2ZTXA 1FI8A 2CHAC 2Z3EA 3IWMA 3Q3KA 3RLWH 5GNDA 1Y5BT 3VGCC 1QL8A 3GY2A 2GTBA 2G52A 3U28C 1SGCA 2OC8A 1HXFH 1GBJA 1NPMA 1TYNA 3UNSA 3E6PH 1SKYE 2OUAA 4FUCA 2G4TA 3GCHB 1N8OC 2BD5A 1HJAC 3A86A 4NIXA 1O3IA 5HM9A 3RXKA 1BHXF 1F5KU 1ZPBA 3D65E 1DY9A 4GCHF 3A89A 3TU7H 3V7TA 2ZDLA 5DK1A 1C4V2 5AVDA 5IK2D 1E38B 1BIOA 2LELA 3VB3A 1BTYA 1CA8B 2DE9A 1JBUH 1TNGA 4BTIB 2PV9B 1MAYA 3V13A 1PJPA 1DITH 1QR3E 2HNTE 1TPOA 3TK9A 1E37B 5C17A 2YMSD 1BUIA 3LIWA 1GHAG 3M36A 1T4VH 4E05H 1S82A 4XFQA 3MTYA 2A1DB 2ASUB 5L2ZH 3MH4A 2A2QH 5BPEA 2P94A 2D26C 3GDUA 1P10A 3ZIAD 1W13U 3GCOA 1GCTC 1PFXC 3MU0A 1F0RA 5PTPA 4DT7B 2F3CE 3ZZ7A 2BMGB 2IJD1 1E79D 2GT7A 2XBYA 2FX6A 2F9UA 2KFWA 4AG2A 5T1VA 1QGFA 3UQOA 1GHBG 1TBQH 3E16B 3W94A 1VZQH 1K1IA 2A7JA 1S0RA 3QK1A 1RIWB 2EQNA 2C93B 4Y8XA 2ANWA 2FO9A 4D9RA 3U98H 4KGAA 1FV9A 5A0AE 1TNJA 1SSXA 4B6EA 1C2DA 2H9TH 3KHVA 4CRFA 1J8AA 1GGDB 1NO9H 5C20A 2IJOB 4E7NA 4GLYA 3BTFE 5C1YA 3MMGA 4ZXXH 4PROA 1DWEH 1GI4A 1C5LH 1WAYB 4IN1A 4KTCA 3VB7A 5AFZH 2OD3B 4Y76A 3TNSA 2KCAA 3A87A 1OYTH 2ZGCA 3VXEH 3ZZ3A 3K65B 1FZZA 4MNXA 1NC6A 1O36A 4B75A 2BDCA 1AMHA 2CN0H 4JK6A 1Z6JH 3A8AA 1S81A 5A09A 2OXSA 1DWDH 4K1SA 5CHBA 2HRVA 1K9OE 4Q7ZA 3EAJA 1KXCA 2G5NA 4A5TS 2FTLE 1YPEH 1THPB 1EASA 1TNLA 2P3UB 2Y6TA 4YESB 1TALA 1X7AC 2PSYA 3UWIA 1G36A 1GHXH 2BZAA 1BDAA 2V35A 4F4OC 5DKMA 1ZRBA 1TMBH 1H9IE 1T8OA 1KTSB 3PWBA 5AHGH 4DOQA 1D6WA 4I8JA 1AUTC 1HYLA 2P16A 3Q00A 1KXAA 1BJUA 2DE8A 4ABIA 3O8RA 1HAXB 1YPKH 1YPMH 1YWUA 2F91A 1DXPA 1ACBE 2Z3CA 1CBWC 2P8OB 2SGAA 1UCYK 2A5IA 7GCHG 1ZSLA 2GV6A 3SORA 3M5LA 4OS4A 1C2EA 1J9CH 1C1OA 3KQDA 1ELVA 2FOCA 3D62A 1GHZA 2R2WU 5H4IB 3ZZ8A 3PV2A 4LXBH 1BTZA 3OSYA 4MTBA 1DUAA 3ZVCA 1MQ6A 2J94A 5LGOA 2AHME 1MTVA 3RUOA 1LPGB 2ZF0H 1O3BA 2GT8A 7LPRA 2H9HA 2BY9X 1YKTA 3S69A 3GS9A 3LJJA 2GP9B 1OWDA 2RA0A 1C1WH 5T3HA 3MH7A 4LZ1H 1YPLH 2F43B 1L1JA 4I8LA 1O2YA 2HNTF 4MG3A 4HG6A 2B0FA 1ZGIA 2D8WA 1Y5AT 2LP6A 3TH2H 3K9XB 1Y3XA 2VGCB 2OLGA 3BG4B 3RXLA 1KTTB 5FPTA 1SOZA 2ZDNA 1VKYA 3QO6A 2WINI 1CE5A 1UCYE 3TGJE 1MCVA 3PMHB 1G2LA 1SR5C 4FU9A 2BD4A 1QB1A 1NM6A 5E2OA 2K8IA 1IQNA 3GCTF 4P02A 3LGTA 5ESBA 2A7CA 5HYOA 3SV8A 4GAWA 1K28D 1VCWA 3U1IB 1TGNA 4Z6AH 4CBOA 3SGBE 1LHFH 1VJ9U 1AWFH 4AYYB 1UVTH 3QGJA 4AGKA 3DFJA 1LVYA 4GHQA 4AB8A 3QX5H 2XBVA 1P9UA 5DJ7A 4CR5A 2EI8A 1O3GA 3IG6B 3DD2H 2QF0A 1TRNA 3LOXA 4NCYA 2XWBI 4P00A 2XNDD 1EB1H 3GDVA 1THRH 2ZA5A 1V2KT 3ZZ6A 3F0OA 1AVWA 4X1NU 4FUDA 3ZZAA 1TGSZ 3UY9A 5K7RA 1FPHH 1UVPA 2DUCA 3BV9B 1G3EA 3RXVA 4D7GA 1MZAA 2ZHDA 1C2MA 2QY0B 3UFAA 3RXBA 1Y3YA 2UUKB 3UOPA 5C94A 3RXRA 4ZH8A 2AGGX 1V2LT 4SGAE 1HIAB 1JOUB 2VWOA 2ZC9H 3OAAD 1HJ9A 1TNIA 1SLVB 1LKAA 1BBRK 1ESAA 1KLIH 2BZ6H 4FUEA 5FX6A 4ZUHA 1SGIB 2FYQA 1GHVH 3RLYH 1ELAA 2PKAB 1O5AB 4O97A 1ZPCA 2Z9GA 5C2ZA 5E0HA 3SQHE 2FS8A 1UTQA 1Z8IB 1SL3A 1AN1E 2HPQH 3GISB 3UIRA 1F0TA 4OGXA 1GDUA 1UHBB 3EDXB 1NESE 3KYGA 2AIQA 3OE7D 3PROA 2HPPH 2SNVA 2XCNA 2BD9A 1YPHE 3EA7A 1ARCA 1SC8U 2F9VA 2ANMH 4YT7H 3M3SA 2ZP0H 2AYWA 1BMMH 4DURA 1SGNE 3GCHC 3LT3A 4X2VA 1O35A 3SU3A 1O3AA 4CRGA 1T4UH 3N7OA 4KTSA 5EODA 3AAVA 2RCEA 2HOBA 1V2WT 1BBRE 3QWCH 1OWEA 3OTJE 3SJ8A 1YLDA 4AFZA 1FDPA 1FX0B 1QBOA 2C90B 2FXRA 2WZQA 2C3SA 5DP8A 4YXWD 1O2LA 3MOCA 3BF6H 2G4UA 4LZ4B 3JZ1B 1O5FH 4YO9A 1ORFA 4AYVB 2EI6A 2J9NA 5FAHA 3A8BA 3JZ2B 1MH0A 1SLWB 2A4QA 3UNQA 1FUJA 1C2IA 5EPNA 3VB4A 2SFAA 1MUEB 1YCPH 9ESTA 4AGJA 1C2GA 3SNEA 4WMEA 4IC5A 1S84A 1GJ9B 2ZFRH 2KX4A 1TPSA 2W3IA 3T25A 5C5NA 3DUXH 2HGTH 3QZRA 1KLJH 2GCTB 4ZHAA 1AE5A 2ZDVH 1GI3A 1FLEE 3SW2B 1NT1A 3TH3H 3RXQA 1EAUA 1CSOE 3MNXA 1FONA 5FXLA 2Q1JA 1P02A 1YYY1 1TGBA 2Y5HA 4UFDH 2BDHA 2WV4A 1A46H 1RIWC 3LU9B 1MD7A 1O2ZA 2ODPA 1QHRB 2V3MA 1HDTH 2KM0A 3F2HA 1Q31A 2BDAA 1SG8B 3SU1A 1SFQB 4FVDA 2A7HA 1RRKA 2Y7XA 1P06A 2AERH 2L6OA 8LPRA 4X8SH 3M3VA 1ZHPA 4ABHA 5GPIB 4ZKRU 3L6PA 4NIWA 4F49A 5EG4A 4H6TA 4ACAA 4XSKU 3RXTA 3S0NA 1O2VA 2FZZA 4Y11E 2A31A 3F6UH 3SNCA 3S7HB 2IOTA 1H8IH 1AB9B 1DS2E 3SJKA 2IPQX 1AO5A 1HB0B 1TX6A 2A5AA 3STJA 2AIPA 1UTKA 2JH0D 5C3NA 1BRUP 4YT6H 3UPEA 1NBME 4X2XA 1VCQA 3HGPA 2PSXA 3TVJB 3KN2A 4I86A 1NU7B 4YZUA 3PTNA 1CHOG 3VB5A 1EAIA 1MZDA 4B73A 4FU7A 5HKKD 2XBXA 4I8HA 2J38A 2WV5A 4NIVA 2H5DA 3M3TA 1AI8H 5LPFA 1C5WB 1GI9B 5F6MA 3NRLA 1D4PB 4ZROA 2V0BA 5GDSH 1PQ5A 4NSYA 1Z6EA 1P9SA 3SJOA 2W5EA 2BDIA 1W3CA 1EXFA 5F8ZA 1G37A 5GCHF 1TPPA 1KIGH 3ZV9A 3TJOA 3OEED 4A7IB 1OP0A 1P12E 4RSPA 1YM0A 2ZDAH 3CNRA 2Y80A 4KELA 4AB9A 1FIWA 3FFGA 1OWKA 2BTCE 2CF9H 1C4Y2 1ZLRA 3NK8A 3SNBA 4ZMAH 3SHAH 3UR6A 2P8OC 3NUMA 5SGAE 4AOQA 5E0JA 1SB1H 1O0DH 4JYTA 1MKWK 1F0UA 1QJ1B 3DT0H 2BXTH 4NA8A 2XBWA 5JYIA 1ABJH 1EZSC 3FO8D 1PQ7A 4ZKOU 4WF8A 3NWUA 3SV7A 3NPSA 3V12A 4NG9H 1BTWA 4IC6A 5EXLA 1O2QA 1SHYA 2NU2E 1TGTA 1TAWA 1AFQB 1FPCH 2VIQA 1WBGB 5J4SA 1INCA 1XX9A 4MPWA 1O5CB 3CENA 4OS6A 5JBBS 2CK3D 1QBVH 1AKSB 1O2NA 3H7TA 1SHHB 3GYMA 1ELFA 3SUEA 1VR1H 2Z94A 2VGCC 3BG4C 1K1PA 1SMFE 2Z9JA 1P3EA 5HXFA 1IQHA 1T8LA 2FTMA 2WPHS 5GWZA 3ZVBA 2H1UA 2BQWB 1GBTA 3HPTB 2ZU4A 1ETSH 1PPGE 2STAE 1BHXB 1C5YB 1E34B 1P09A 1CGJE 4K69A 3CP7A 1ZHRA 1DWBH 1RTLA 5E8EH 2FS9A 3MO6A 1AUJA 2GMTB 2G55A 3SUDA 3ZV8A 1K1LA 1GJ5H 3KQBA 1HUTH 1H8DH 1CA0B 3PRBA 1PPBH 2XTTB 4K8BA 2W26A 1N1LA 2J5UA 2VNTA 2A45B 2ZCHP 1DXWA 1KY9A 2D1JA 2FOBA 1TGCA 4X8UH 1H8HD 2K1QA 1YC0A 2ZGXH 3U8OH 1MMJN 2V7QD 3KF2A 3PO1B 4JZDH 1A0LA 1JMOH 1HIAA 1JRSA 1ZRKA 1O3DA 1CHGA 3C1KA 3RP2A 1SQAA 3SQEE 1P2QA 3P8OA 1EZUC 1ZYOA 1V2JT 2XYAA 3B23B 2C8WB 3STIA 2PKAA 1KLTA 1AVGH 1DICA 4K2YA 3MFJA 3KQEA 3M7TA 1TA6A 3P95A 4AX9H 2KAIB 2B8OH 3QLPH 3P8GA 1O2MA 2Y5GA 2Y82A 3EA9A 1O3JA 1DFPA 2PGQB 3SI4H 3AVZA 1O5DH 1C9PA 1UHBA 2M5TA 1O3CA 4R0IA 5GJ4B 3LGVA 1DSTA 1TA2A 1TABE 1DDJA 5FCRA 2A4RA 1GVKB 3R3GB 2GZ9A 2XRCA 1SGDE 3HATH 1KSNA 2QXJA 1GJ4H 1UCYH 2EI7A 3OTPA 3TLOA 3RM2H 3UOUA 1ARBA 5FBEA 5KGOA 4DY7B 2OCVB 1L0ZA 3QGNB 7KMEH 1W14U 2ZPQA 1LHEH 2FPZA 1JRTA 1ANEA 2BDYA 3SJ9A 1V2QT 4D76A 4TY6A 1QBNA 1S6LA 3B8JA 1K1JA 1LPKB 1P2NA 1BRAA 1OKXA 1O2TA 5A2MH 1UW7A 3B9FH 1GMDF 1UTLM 1O34A 1HAZB 2GDEH 3E0PB 4F55A 2FIRH 1V2MT 1COWD 1TBRH 1VCPA 1GHWH 1C2JA 1BTUA 1WTHD 2XCFA 1TMTH 1SFIA 2A4OA 3RC4A 5T6GA 1BTPA 4ABJA 4DW2U 3KQCA 3O8DA 3A88A 3BSQA 3U9AH 2TIOA 1IHTH 2OTVA 5A8ZA 1IQKA 2OBOA 1EJMA 1SQTA 1WOFA 4X2YA 3R0FA 5EOKA 3SV6A 1GL1A 3SHCH 2JDID 2VU8E 2TPIZ 2J92A 3H09A 1A3BH 4TWYA 4AZ2B 1O2PA 1XUIA 3AASA 2ZU2A 4JK5A 2CGAA 4O3UA 2STBE 2GCTC 4Y0YE 2ZIQH 2R3UA 4OGYA 1C5UA 1NRNH 3EA8A 1V6DA 3A82A 4Y6DA 1GPZA 1F5RA 1W0JD 3RXMA 2PUQH 5F53A 5EW1H 1DVAH 1P01A 4MDSA 5HMAA 2JH6D 4AFUA 6GCHG 3E91A 1NRRH 1ZMNA 3F0PA 1TFXA 4BTTB 2ZWLH 2F9BH 2PTCE 1QY6A 2EA3A 2B7DH 3BTGE 4Y7BA 3FN8A 2ZPRA 4ASHA 2FP7B 4F48B 3LKWA 1HAOH 1PQAA 3Q76A 3ZVDA 2QN5T 1ZSJA 1A0JA 8GCHG 4ABEA 1G3BA 1GBCA 1YLNA 2FEQH 5TCAA 1BCUH 1MTNB 2YMSB 2ZHFH 1AU8A 2AMDA 3G01A 3L33A 3PV4A 3BG8A 3BIVH 5DSFA 3DSPA 3UWJH 1O5EH 3RMLH 4CHAB 3F9FA 1O39A 1BBRH 2VH0A 1GI8B 2JJ2D 3KCGH 1NS3A 3U8TH 4DGJA 2XXLA 1AB9C 2QXIA 3PM3A 3WWFA 1LQEA 4BAHB 2BD2A 2AS9A 1G9IE 4D7FA 3M61U 1BMLA 1ZHMA 1TOMH 2BOHB 2ZHEH 4WJG2 1UTJA 2VINA 1XXFA 2ZO3H 2UWPA 2ZFQH 1HCGA 3ZVEA 1WQVH 1W7GH 1EZQA 1GMCG 4ISLA 2A0QB 2G5VA 1ZSKA 4ZCNA 4ZKSU 1O2GH 1XUKA 4YM9A 3DA9B 4X8TH 3M7QA 2G51A 1GHYH 1GI5A 3MHWU 4Y79A 1FN6A 1WV7H 4U30A 3FP6E 1TQ7B 1C1RA 1JXPA 3FZDA 1O2UA 4X0WU 4TPYA 4BNRA 2UUJB 1E35B 1S6HA 1IQLA 5EQSA 4I31A 1GHBF 1C2HA 2ODQA 4Q63A 3N99A 3BEIB 1Z1JA 2WPIS 1Y59T 3WWBA 1VITG 4AFSA 4ASUD 1W11U 4Y7AA 3U69H 1LKBA 1LO6A 4GSOA 1SLXB 1F92A 1O3NA 3F68H 3PLPA 4BAMB 1BZXE 2R3YA 4OS2A 2HWLB 3ODDA 1GJAB 1FMGA 2QYIA 4CRCA 1W12U 1QL9A 1YY3A 2FI5E 1HAGE 4HTCH 2BOKA 5DPAA 1Z7KA 1F0SA 1GDQA 1GBEA 3N7EA 3NXPA 2BVXH 5KEDA 1N6XA 1BMAA 2CV3A 1H4WA 1AKSA 4ABDA 1A5GH 1GBFA 3DFLA 3T26A 5I46H 3MH5A 2VIPA 3RXUA 2YOLA 4NA7A 3U1JB 1EX3A 3BTEE 4E7RG 4D9QA 1KDQB 1XM1A 1BB0B 1QA7A 1ZMLA 2XC4A 4BOHA 1OWIA 4I7YH 1G30B 2BB4A 2WHXA 1OPHB 1ZR0A 2O8UA 4DT4A 1G3DA 2C8YB 3P17H 2BLOA 5I25A 2IPHA 2W7UA 2HLCA 3ENSB 1RTFB 1OP8A 4B1TA 4B6FA 4CRAA 2ZU1A 1LQDB 4A1VA 4YOGA 5HIZA 3ZZ9A 1A5IA 3PB1E 1DANH 1G2MA 5L30H 1V2UT 1XUHA 2ZCKP 4I8GA 1CGIE 2H9EH 1C5QA 4XBDA 1AVXA 3SV2H 5C5OA 5JBAS 2VVVA 1ZTKA 1HAVB 3CS0A 3RMNH 3A7TA 4NSVA 2JH5D 4WMDA 3KYFA 1QCPA 2RDLA 4Y8ZA 1P2KA 2GMTC 2SGEE 1GMHG 1PPHE 4JZFH 1CA0C 1HJ8A 3OYPA 3T28A 4AC9A 1GBLA 3ZZ4A 2RA3A 1IQMA 3OY6U 2THFB 1ZPZA 3UQVA 1EJNA 5A0CA 1Y8TA 3AW1A 3O8BA 1GI1A 3PMAB 2QF4A 3Q3XA 4NFEA 1O2KA 1BTXA 3I77A 1GG6C 5TJXA 2GCHG 3SGQE 1ZTLA 4K1EA 2BD7A 5AFYH 7GCHF 3PO1C 4RI0A 1H9LB 3SUFA 1CO7E 4DG4A 3FAOA 5EXMA 4X1QU 3VPKA 4NA9H 3VGCB 2JIZD 2BD3A 2J98B 1U6QA 4FETA 3FOAA 1OS8A 2C8ZB 1BRCE 4GUXA 1SGTA 1N8OB 1ESTA 5B6LA 2ZECA 3SNAA 2GDDA 2KZ4A 1PPCE 1SGRE 4NIYA 5CHAB 3QZQA 3EYDA 6ESTA 4J1YA 4B2CA 1MAXA 5DP5A 4ESTE 3F9EA 3N7DA 3ZZ5A 2BDGA 5A0BA 1A3EH 3BEFB 1ETRH 2ZDMA 1H9HE 3RDZA 3OY5U 1QJ6B 2FI4E 1GJ8B 4K5ZA 2PLXA 3WW7A 1K2I1 4IGDA 4AN7A 2JETB 3M35A 3SJIA 2PGBB 4BTUB 1MKWH 2O8TA 4FOUC 4ACBA 4NZQA 3T5FH 3PMBB 3S9BA 1W0YH 2H6MA 1L1NA 3EQ0H 1QB6A 1K21H 1XUJA 2FLRH 1PYTC 2PFEA 1D3QB 3W1EA 5E0GA 1O3HA 3ATKA 4TYDA 1MU8B 2OK5A 1TMUH 4K3JA 1THSH 2L74A 5DN6D 5DO4H 1RGQA 4AORA 2F4LA 3MO9A 2NWNA 3KNXA 1QB9A 3ITIA 1NFWA 1NZQH 2O8LA 2SGDE 1OOKB 2XWAA 4X6NA 4UFFH 2OQ5A 1SGFG 2SGFE 1WCZA 3MO3A 1GBDA 2ILNA 1QRZA 2ANYA 4Q7YA 1UVUH 1O33A 4UD9H 3SU4A 1NRQH 1C5XB 1AZZA 2FM2A 1QRWA 3T62A 1AWHB 3FZZA 1GI0A 3M37A 5KECA 1J17T 2LPRA 2WPKS 4X6OA 1VGCB 1OYQA 3A8DA 4IS5A 2FYRA 3RXGA 1PPEE 3EE7A 1PPFE 1KXDA 1FJSA 3LH3A 1IOEA 1TNHA 1ZJDA 3VEQB 3TGKE 4CH2B 1O31A 4B74A 1SQOA 4ABAA 8KME2 1PQ8A 1TBZH 3ESTA 1P2MA 3P70B 2QAAA 4Q80A 1IQEA 2BXUH 2VB0A 3E0NB 1B0FA 1GGDC 2NU4E 3VXFH 1EJAA 2TGAA 1ZGVA 4XD7D 1FQ3A 2P59A 3OX7U 3TGIE 3F3BA 3BN9A 5CE1A 3F9HA 4MLFB 4IBLH 3Q77A 1YPGH 6LPRA 3UR9A 1UMAH 2BYAX 1O5BB 1YBWA 3MYWA 1C2LA 2WUBA 3SI3H 1CGHA 1EAWA 1IAUA 4OS1A 2VWMA 3KL6A 2VJ1A 3HGNA 3M5NA 3ZZBA 3BEUA 2KCPA 5CDFE 4X1SU 4FU8A 4RKJB 4KKDA 1XKBC 4R8TB 1BOQA 5C1UA 2ZZUH 3E1XB 4NZLA 3BTWE 3TJNA 1O2RA 1P2JA 3A84A 5EPYA 1MTNC 2YMSC 1DM4B 1OHHD 3GICB 1A7SA 1QTFA 2BM2A 1OSSA 2QV1A 1C5VA 4CHAC 1RTKA 4HGCA 2G8TA 1UTMA 1K1MA 1LHDH 2K0QA 4X8VH 1OWJA 4QT8C 2B9LA 2W7SA 4TPIZ 1O2IA 4Q7XA 4X6PA 2PKSB 1SQRA 5FPYA 3K6YA 1CBWB 3EGKH 2WPMS 2RFKC 1JWTA 4JZ1A 2Z7FE 5FCKA 3URDA 1LPZB 4X1RU 1OP2A 3QN7A 2BLVA 1LCYA 3A81A 4VGCB 2Z6BD 1HNEE 4B71A 1WSSH 4WY3A 4DIHH 1TB6H 2WV9A 4SGBE 3RXAA 3MU4A 1C1PA 5GIBA 1ABIH 3NKKA 3F1SB 3HK6B 1XVMA 1P04A 1GCDA 4DCDA 5DP9A 1T7CA 1YGCH 4RKOB 3RXIA 3ZYDA 5EW2H 1YF4A 2ZCLP 1HGTH 2Z9KA 3GY8A 3DCLA 1YLCA 1V2PT 3DHKH 1NFUA 1GI6A 2WYGA 3WY8A 3H5CB 1LVMA 3HKJB 4I8KA 5JB8S 5T6FA 4CRBA 2ESTE 1C1SA 1D3TB 3V3MA 1UTPA 4GCHG 4MNYA 5FL7D 3PRDA 5HM2A 4CH8B 3UNRA 1ZOMA 5JDUB 1FAXA 2ZU5A 1FY5A 1HXEH 4XOJA 1SLUB 1AIXH 2ZQ2A 5HGGA 4DVAU 2KCYA 1K0HA 1NN6A 2WUCA 3MNBA 1B5GH 1LHGH 1MBQA 1DE7H 1ZJKA 4BXSA 2HLDD 2PHBA 4K60A 3DSGA 2P95A 4FXGH 4Y8YA 2FI3E 1EFRD 2J34A 4Q2KA 1NFYA 2FDAA 1SVPA 1O2OA 2PR3A 3I78A 5T6DA 2H5CA 2VH6A 1CHOF 4Z0KA 1PYTD 1MTSA 1E1RD 2GD4B 4H4FA 4WXVA 4CREA 4NFFA 1WU1A 4ZAEA 5C0TA 1ELTA 2TGTA 1DOJA 3KIDU 3MQKC 4WVPE 1UK2A 8ESTE 1KXBA 2J97A 5K0HA 4IW4E 1GJ7B 5IYTA 3SOSA 1IQJA 1XXDA 2NU1E 3LONA 3MU8A 4CR9A 2UUFB 2BDBA 3LC3A 2A2XH 1WQSA 1C4U2 3M5MA 1DY8A 1O38A 3ZYEA 1CU1A 2ZU3A 2J98A 1KMHB 2PP6A 1DT2A 4FUHA 2V3OH 4FUJA 4AG1A 2FOAA 4INKA 4GVUA 1MU6B 3TNTA 1TLDA 5LH8A 2YNAA 4K8YA 3F2GA 3IITA 3KGPA 4A1XA 4MPVA 4MNVA 1FY3A 5JPMH 1O5GH 1V3XA 1C5PA 2BY6X 4H42U 1FY4A 2QCYA 2PUXB 1W0KD 1PPZA 2ZHQH 1SGYE 5EIYA 2H2ZA 3LPRA 3SU5A 3LGYA 5CHAC 4IMZA 2ANKH 1DPOA 3LGIA 2Z9IA 1GBBA 4BAQB 3LGWA 2R0LA 1RD3B 1H1BA 1T31A 3ELAH 1V2ST 2QGRA 1NROH 1GBKA 5FHTA 4UFGH 4FUIA 4B2BA 2ZI2H 2ZG0H 2JJ1D 1EP6A 2GZ7A 4O3TA 5C67A 1UK3A 5G4BA 1C1TA 3VG8A 4E06H 4ZKNU 4UE7H 1XMNB 5ABWA 2JETC 1VJAU 4IMQA 2R0KA 2VIWA 1W2KH 3E3TA 3U8RH 1W7XH 2JKHA 2UWOA 2EEKA 1C5TA 2B5TB 4YLQH 1SPJA 4JYVH 2W6JD 1L4ZA 1SGEE 4NWKA 3NCLA 5B6OA 3MNCA 1H8ED 1BRBE 3SBKA 4A1TA 4ZXYH 2BLQA 3A80A 3TK6A 5DG6A 3L3TA 3NZIA 4X2WA 3URCA 3LJOA 1A0HB 1C5ZB 5F8TA 1HLTH 1ELDE 2G00A 2R2MB 2SGQE 1UK4A 4M7GA 1C1NA 3TITA 1KXEA 4MPUA 2O8MA 1SGFA 1EPTB 1J15A 1IHSH 4O9VA 1A5HA 1CT0E 2M2AA 1VGCC 3ATMA 1TNKA 3T27A 3T2NA 1N6YA 6CHAB 4XDEA 1LTOA 2OC7A 2BX3A 1C5MD 2FOHA 2XNIA 2KR7A 5L2YH 1ELBA 2BHGA 3CS7A 4TY7A 3RXSA 3P8FA 1O2XA 2A32A 3UTUH 4UONA 3QTOH 2F9NA 2VIVA 3SZNA 3GCTG 2PWXA 4GHTA 4K1TA 1MD8A 1J16A 1XKAC 3P8NA 1ELGA 1GL0E 5EJ1A 1SGPE 3GDSA 2QXGA 1UVSH 1UTNA 1JIMA 1YPHC 1TQ0B 2AFQB 2OP9A 1J14A 2WPDD 3PV5A 4NWLA 1QL7A 1MKXK 5GXPA 2ULLA 1DUEA 2HVYB 1L2EA 3UB0A 1AZ8A 4A6LA 1UTOA 3HK3B 2C8XB 3MU1A 2GGVB 4RT1A 1S5SA 5DP3A 5EJLA 1C5SA 5DP7A 3SU6A 1C1MA 2OBQA 1EQ9A 3QUMP 2YNBA 3A7YA 2Y5FA 1BMFD 3LDXH 4ZHMU 1GHAF 2OQUA 1WYKA 1V2NT 4YOIA 2ZEBA 2F83A 1C2FA 1GVZA 1O37A 2BQ6B 1ESBA 1O2JA 2TRMA 2O9QA 4JZIA 2ZFFH 4OM9A 1IQGA 5LPEA 4FUBA 5C0UA 1V2VT 3E8LA 3AK5A 1AY6H 3S9AA 1MQ5A 5EXNA 4UEHH 1AGJA 1S85A 2AMQA 1RJXB 4BANB 5IDKA 2ZGJA 4JZEH 1P57B 2GV7A 1Y3UA 2FODA 2PKSC 1AHTH 1C1VH 4RN6A 1EATA 1DX5M 3TIUA 3MNSA 1A4WH 1GJCB 2LNCA 1O3EA 2F9PA 1Q2WA 4DJZB 1K22H 1YPJH 4U2WA 1ZMJA 4LOYH 1RFNA 4VGCC 1GBMA 4TT3D 4WH6A 4CBNA 5EQQA 4KP0A 3M5OA 1QZ8A 1S6FA 1S0QA 1QQ4A 4OS5A 3QTVH 3Q3YA 4ZHLU 1C2KA 3AW0A 2P3FH 5JB9S 3RC5A 9LPRA 4INHA 1ZZZA 2R9PA 3GY3A 1W8BH 5JBTA 3RXPA 3BTDE 3RXCA 2OC0A 2QXHA 1C1QA 1W0ZU 1BJVA 1AQ7A 2ZQ1A 1A1RA 2D2DA 4GPGA 3PMJA 1FIZA 3SU0A 1DWCH 1HAYB 5FPSA 1AFQC 1D6RA 2Q6DA 3K2UA 5TCCA 4ISHH 2ZTYA 3V0XA 2ZGBH 6GCHF 3ZVGA 1FY8E 3SU2A 5FX5A 2FMJA 4AFQA 4MVNA 4ISIH 1BITA 1D3DB 4Y71A 1TPAE 4D8NA 1GWAA 8GCHF 4Y0ZE 4XBBA 3UUZA 1GJ6A 3RU4T 3TK5A 2Q6FA 5C1XA 1DLEA 4UFEH 3SN8A 1HV7A 2BLWA 4IN2A 3K6ZA 5A8XA 3GY7A 3HKIB 3ZZCA 2W6ID 1MCTA 3RM0H 3SUGA 3OEHD 2AGEX 2HALA 7ESTE 4U01A 2GKVE 2OC1A 2J4IA 2VWLA 3LGUA 4B76A 3MU5A 1V2TT 4U32A 1UVOA 1GJDB 4I33A 1IQIA 1QFKH 4I32A 2VVCA 5L6NH 4BAOB 4M9FA 2TGDA 1S83A 1D9IA 1GMCF 2I6SA 3TJVA 1GBAA 2BX4A 3S9CA 2NU3E 1FXYA 2RG3A 2UWLA 5DP6A 1RXPA 3VB6A 1BA8B 3A85A 1SBWA 2CHAB 2FWWA 2KAIA 1K1NA 2J2UA 1ANCA 1WDIA 3A7VA 3P92A 4FUGA 1LDTT 5DGJA 1E36B 3GY6A 2WPJS 2WYJA 5JBCS 1GI2A 3E90B 3A7ZA 1LHCH 1LVBA 1F7ZA 3W95A 4TSFD 3OFND 1CT4E 1HJAB 4JCNA 3GY5A 1L4DA 1VITF 2ZHWH 3BTHE 3RXOA 2PW8H 3SGAE 4J2YB 1K1OA 1MABB 1LMWB 2ODYB 3UAIC 1Y3VA 2AGIX 5E2PA 2P93A 3TJUA 1QJ7B 2FLBH 1M9UA 1D3PB 3BTQE 4JMYA 1KYNA 2CXVA 3RU4E 2PTNA 1V2RT 3ATIA 3RU4D 2BY5X 4WXIA 3SO3A 1QRXA 4H6SB 1ID5H 4WWYA 3GYLB 4ABFA 1O2WA 1C9TA 2FX4A 1GCTB 2EY4C 4Y10E 1RS0A 2FESH 1WXRA 1HRTH 3MH6A 1Q3XA 1QURH 2A5KA 1HAHH 4FUFA 3ATWA 5EU8A 3RXDA 5GCHG 1WTGH 4UDWH 1ANBA 2SGPE 3TH4H 2NU0E 2Y7ZA 1NTPA 1CQQA 1JIRA 1XUFA 2ALVA 3I29A 1MTUA 4MPXA 1O3MA 2EC9H 2BVSH 1W10U 4Q4LA 2ZKSA 2QA9E 1G32B 1O3PB 4ISNA 1O32A 2Z3DA 1DSUA 1GMHF 2VIDA 3LH1A 2P3TB 3SV9A 1TRMA 3LC5A 1HAIH 4MQAA 4TWWA 3PLBA 1EPTA 1YCPM 1EZXC 3VFEA 5ETXA 3KQ5A 4MNWA 2Y81A 1G3CA 5F8XA 3RMMH 1QIXB 2ZGHA 2GCHF 3ATLA 5CMXH 1NFXA 1T32A 1OXGA 1Y3WA 2FOGA 1AE8H 3OU0A 1HPGA 5DP4A 2CMYA 1P2OA 1Z1IA 1EPTC 1IQFA 1FN8A 2Q6GA 2WPLS 1UJ1A 3A7WA 6CHAC 1TOCB 1O3FA 2QIQA 2VBCA 2XC0A 3BTKE 3H7OA 1NU9A 2G81E 3QDZB 1O30A 2ZTZA 1O2HA 5J4QA 1SGQE 3UREA 4HFPB 2HVXA 2GX4A 5BRRE 5HIYA 1DLKB 4BAKB 4NGAH 3FANA 3AAUA 3EE0B 1OWHA 2I6QA 2QF3A 1WUNH 3O8CA 2VWNA 1T8NA 3RXFA 2AMPA 2ZPSA 1GBHA 1P8VC 5AF9H 3GOVB 4ISOA 1P05A 1O3OA 4B2AA 2C4FH 2HNTC 5EJZA 3ZZDA 1SOTA 2GVFA 1HFDA 4X6MA 3GY4A 1P0SH 1FY1A 1TX8A 4RT0A 1C5OH 2O8WA 3FVFB 2GJGA 3M7UA 4WMFA 1NBMD 1TONA 1EAXA 3C27B 3RXHA 1GDNA 3RXJA 2CF8H 3ODFA 1ELEE 1Z8RA 3DSOA 5FBIA 2XC5A 4KTUA 1AFEH 4Z1MD 5A8YA 1NRSH 2XW9A 1SI5H 2KCOA 1KXFA 1Z71A 1F5LA 2ZNKH 1TE0A 3RC6A 3RXEA 1F2SE 1BT7A 1LVOA 1XVOA 1FNIA 4CRDA 3D49H 1P2IA 3TPIZ 5EGMA 4JYUH 1E1QD 2V6NA 4FVBA 1XUGA 1EP5A 3MI4A 1A61H 1BTHH 4LK4A 1HAPH 2A4GA 3FP7E 2QE7D 1ANDA 2BY8X 3T29A 1QQUA 3A8CA 2OINA 1O3LA 1C1UH 1GI7B 4YLUA 4DIIH 2BVRH 1TRYA 3A7XA 3ZVFA 2J95A 2RDEA 3S7KB 2F9OA 2ALPA 3PWCA 5F03A 1EKBB 3MWIU 1BMNH 1L1GA 2FOMB 1Z8JB 2VVUA 4XE4A 1KDQA 1OX1A 1EUFA 1NY22 4ABGA 2AEIH 1B0EA 2QC2A 1YCPK 2TGPZ 1ETTH 2XOKD 4THNH 3PYHA 1UO6A 1V2OT 2CJIA 2WSSD 5ESTE 4BXWA 1TX7A 4XBCA 2FOFA 4A92A 1TWXB 3F2FA 3GCNA 1QNJA 4ABBA 1QA0A 1NRPH 2ZFTA 4OS7A 2V3HH 1TIOA 2FOEA 1HBTH 3SNDA 1A2CH 1GVLA 3PLKA 3RMOH 1T8MA 1C5RA 1CVWH 1VITH 1HAVA 2BY7X 1P03A 3SZEA 3D23A 3BIUH 2ZFPH 2ZDKA 2IN2A 1Z8GA 1GMDG 1P3CA 1B7XB 1GBIA 3BTTE 1BQYA 1FAKH 4WH8A 2TBSA 5LPRA 1YP9A 2Z9LA 1O2SA 2BQ7B 1O3KA 3PTBA 3ZVAA 4INLA
chains in the Genus database with same CATH topology
4HI3A 3BTME 3FP8E 4HZHA 2BD8A 4X1PU 1EOLA 1C5NH 4YTAA 1MBMA 1EOJA 2GZ8A 1GJBB 1AD8H 1ELCA 1MKXH 1GG6B 1ZTJA 2UUYA 1EB2A 2ZFSA 4O03A 2W3KA 1Y5UT 3KEEA 3A83A 1CT2E 1P11E 3P6ZB 1E0FD 1MTWA 5EQRA 2AH4X 2SNWA 3F9GA 4YOJA 2VIOA 2ZTXA 1FI8A 2CHAC 2Z3EA 3IWMA 3Q3KA 3RLWH 1Y5BT 3VGCC 1QL8A 3GY2A 2GTBA 2G52A 1SGCA 2OC8A 1HXFH 1GBJA 1NPMA 1TYNA 3UNSA 3E6PH 2OUAA 4FUCA 2G4TA 3GCHB 1N8OC 2BD5A 1HJAC 3A86A 4NIXA 1O3IA 5HM9A 3RXKA 1BHXF 1F5KU 1ZPBA 3D65E 1DY9A 4GCHF 3A89A 3TU7H 3V7TA 2ZDLA 5DK1A 1C4V2 5AVDA 1E38B 1BIOA 3VB3A 1BTYA 1CA8B 2DE9A 1JBUH 1TNGA 4BTIB 2PV9B 1MAYA 3V13A 1PJPA 1DITH 1QR3E 2HNTE 1TPOA 3TK9A 1E37B 1BUIA 3LIWA 1GHAG 3M36A 1T4VH 4E05H 1S82A 4XFQA 3MTYA 2A1DB 2ASUB 5L2ZH 3MH4A 2A2QH 5BPEA 2P94A 2D26C 3GDUA 1P10A 1W13U 3GCOA 1GCTC 1PFXC 3MU0A 1F0RA 5PTPA 4DT7B 2F3CE 3ZZ7A 2BMGB 2GT7A 2XBYA 2FX6A 2F9UA 4AG2A 1QGFA 3UQOA 1GHBG 1TBQH 3E16B 3W94A 1VZQH 1K1IA 2A7JA 1S0RA 3QK1A 1RIWB 4Y8XA 2C93B 2ANWA 2FO9A 4D9RA 3U98H 4KGAA 1FV9A 5A0AE 1TNJA 1SSXA 1C2DA 2H9TH 3KHVA 4CRFA 1J8AA 1GGDB 1NO9H 5C20A 2IJOB 4E7NA 4GLYA 3BTFE 5C1YA 3MMGA 4ZXXH 4PROA 1DWEH 1GI4A 1C5LH 1WAYB 4IN1A 4KTCA 3VB7A 5AFZH 2OD3B 4Y76A 3TNSA 3A87A 1OYTH 2ZGCA 3VXEH 3ZZ3A 3K65B 1FZZA 4MNXA 1NC6A 1O36A 4B75A 2BDCA 1AMHA 2CN0H 4JK6A 1Z6JH 3A8AA 1S81A 5A09A 2OXSA 1DWDH 4K1SA 2HRVA 1K9OE 4Q7ZA 3EAJA 1KXCA 2G5NA 4A5TS 2FTLE 1YPEH 1THPB 1EASA 1TNLA 2P3UB 2Y6TA 4YESB 1TALA 1X7AC 2PSYA 3UWIA 1G36A 1GHXH 2BZAA 1BDAA 2V35A 4F4OC 5DKMA 1ZRBA 1TMBH 1H9IE 1T8OA 1KTSB 3PWBA 5AHGH 4DOQA 1D6WA 4I8JA 1AUTC 1HYLA 2P16A 3Q00A 1KXAA 1BJUA 2DE8A 4ABIA 3O8RA 1HAXB 1YPKH 1YPMH 2F91A 1DXPA 1ACBE 2Z3CA 1CBWC 2P8OB 2SGAA 1UCYK 2A5IA 7GCHG 1ZSLA 2GV6A 3SORA 3M5LA 4OS4A 1C2EA 1J9CH 1C1OA 3KQDA 1ELVA 2FOCA 3D62A 1GHZA 2R2WU 5H4IB 3ZZ8A 4LXBH 4MTBA 1BTZA 3OSYA 1DUAA 3ZVCA 1MQ6A 2J94A 5LGOA 3RUOA 1MTVA 1LPGB 2ZF0H 1O3BA 2GT8A 7LPRA 2H9HA 2BY9X 1YKTA 3S69A 3LJJA 2GP9B 1OWDA 2RA0A 1C1WH 5T3HA 3MH7A 4LZ1H 1YPLH 1L1JA 4I8LA 1O2YA 2HNTF 4MG3A 2B0FA 1ZGIA 2D8WA 1Y5AT 3TH2H 3K9XB 1Y3XA 2VGCB 2OLGA 3BG4B 3RXLA 1KTTB 5FPTA 1SOZA 2ZDNA 3QO6A 2WINI 1CE5A 1UCYE 3TGJE 1MCVA 3PMHB 1G2LA 1SR5C 4FU9A 2BD4A 1QB1A 1NM6A 5E2OA 1IQNA 3GCTF 3LGTA 5ESBA 2A7CA 5HYOA 3SV8A 4GAWA 1K28D 1VCWA 3U1IB 1TGNA 4Z6AH 4CBOA 3SGBE 1LHFH 1VJ9U 1AWFH 4AYYB 1UVTH 3QGJA 4AGKA 3DFJA 1LVYA 4GHQA 4AB8A 3QX5H 2XBVA 1P9UA 5DJ7A 4CR5A 2EI8A 1O3GA 3IG6B 3DD2H 2QF0A 1TRNA 3LOXA 4NCYA 2XWBI 1EB1H 3GDVA 1THRH 2ZA5A 1V2KT 3ZZ6A 1AVWA 4X1NU 4FUDA 3ZZAA 1TGSZ 3UY9A 5K7RA 1FPHH 1UVPA 2DUCA 3BV9B 1G3EA 3RXVA 4D7GA 1MZAA 2ZHDA 1C2MA 2QY0B 3UFAA 3RXBA 1Y3YA 2UUKB 3UOPA 3RXRA 4ZH8A 2AGGX 1V2LT 4SGAE 1HIAB 1JOUB 2VWOA 2ZC9H 1HJ9A 1TNIA 1SLVB 1LKAA 1BBRK 1ESAA 1KLIH 2BZ6H 4FUEA 5FX6A 4ZUHA 1SGIB 2FYQA 1GHVH 3RLYH 1ELAA 2PKAB 1O5AB 4O97A 1ZPCA 2Z9GA 5C2ZA 5E0HA 3SQHE 2FS8A 1UTQA 1Z8IB 1SL3A 1AN1E 2HPQH 3GISB 3UIRA 1F0TA 4OGXA 1GDUA 1UHBB 3EDXB 1NESE 2AIQA 3PROA 2HPPH 2SNVA 2XCNA 2BD9A 1YPHE 3EA7A 1ARCA 1SC8U 2F9VA 2ANMH 4YT7H 3M3SA 2ZP0H 2AYWA 1BMMH 4DURA 1SGNE 3GCHC 3LT3A 4X2VA 1O35A 3SU3A 1O3AA 4CRGA 1T4UH 3N7OA 4KTSA 5EODA 3AAVA 2RCEA 2HOBA 1V2WT 1BBRE 3QWCH 1OWEA 3OTJE 3SJ8A 1YLDA 4AFZA 1FDPA 2C90B 1QBOA 2FXRA 2C3SA 5DP8A 1O2LA 3MOCA 3BF6H 2G4UA 4LZ4B 3JZ1B 1O5FH 4YO9A 1ORFA 4AYVB 2EI6A 2J9NA 5FAHA 3A8BA 3JZ2B 1MH0A 1SLWB 2A4QA 3UNQA 1FUJA 1C2IA 5EPNA 3VB4A 2SFAA 1MUEB 1YCPH 9ESTA 4AGJA 1C2GA 3SNEA 4WMEA 4IC5A 1S84A 1GJ9B 2ZFRH 1TPSA 2W3IA 3T25A 5C5NA 3DUXH 2HGTH 3QZRA 1KLJH 2GCTB 4ZHAA 1AE5A 2ZDVH 1GI3A 1FLEE 3SW2B 1NT1A 3TH3H 3RXQA 1EAUA 1CSOE 3MNXA 1FONA 5FXLA 2Q1JA 1P02A 1YYY1 1TGBA 2Y5HA 4UFDH 2BDHA 2WV4A 1A46H 1RIWC 3LU9B 2ODPA 1MD7A 1O2ZA 1QHRB 1HDTH 1Q31A 2BDAA 1SG8B 3SU1A 1SFQB 4FVDA 2A7HA 1RRKA 2Y7XA 1P06A 2AERH 8LPRA 4X8SH 3M3VA 1ZHPA 4ABHA 5GPIB 4ZKRU 3L6PA 4NIWA 4F49A 5EG4A 4H6TA 4XSKU 3RXTA 3S0NA 1O2VA 2FZZA 4Y11E 2A31A 3F6UH 3SNCA 3S7HB 2IOTA 1H8IH 1AB9B 1DS2E 3SJKA 1AO5A 1HB0B 1TX6A 2A5AA 3STJA 2AIPA 1UTKA 2JH0D 5C3NA 1BRUP 4YT6H 3UPEA 4X2XA 1VCQA 3HGPA 2PSXA 3TVJB 3KN2A 1NU7B 4YZUA 3PTNA 1CHOG 3VB5A 1EAIA 1MZDA 4B73A 4FU7A 2XBXA 4I8HA 2J38A 2WV5A 4NIVA 2H5DA 3M3TA 1AI8H 5LPFA 1C5WB 1GI9B 5F6MA 1D4PB 4ZROA 2V0BA 5GDSH 1PQ5A 4NSYA 1Z6EA 1P9SA 3SJOA 2W5EA 2BDIA 1W3CA 1EXFA 5F8ZA 1G37A 5GCHF 1TPPA 1KIGH 3ZV9A 3TJOA 4A7IB 1OP0A 1P12E 4RSPA 1YM0A 2ZDAH 4AB9A 2Y80A 4KELA 1FIWA 3FFGA 1OWKA 2BTCE 2CF9H 1C4Y2 1ZLRA 3NK8A 3SNBA 4ZMAH 3SHAH 3UR6A 2P8OC 3NUMA 5SGAE 4AOQA 5E0JA 1SB1H 1O0DH 4JYTA 1MKWK 1F0UA 1QJ1B 3DT0H 2BXTH 4NA8A 2XBWA 5JYIA 1ABJH 1EZSC 1PQ7A 4ZKOU 4WF8A 3NWUA 3SV7A 3NPSA 3V12A 4NG9H 1BTWA 4IC6A 5EXLA 1O2QA 1SHYA 2NU2E 1TGTA 1TAWA 1AFQB 1FPCH 2VIQA 1WBGB 5J4SA 1INCA 1XX9A 4MPWA 1O5CB 3CENA 4OS6A 5JBBS 1QBVH 1AKSB 1O2NA 3H7TA 1SHHB 3GYMA 1ELFA 3SUEA 1VR1H 2Z94A 2VGCC 3BG4C 1K1PA 1SMFE 2Z9JA 1P3EA 5HXFA 1IQHA 1T8LA 2FTMA 2WPHS 5GWZA 3ZVBA 2H1UA 2BQWB 1GBTA 3HPTB 2ZU4A 1ETSH 1PPGE 2STAE 1BHXB 1C5YB 1E34B 1P09A 1CGJE 4K69A 3CP7A 1ZHRA 1DWBH 1RTLA 5E8EH 2FS9A 3MO6A 1AUJA 2GMTB 2G55A 3SUDA 3ZV8A 1K1LA 1GJ5H 3KQBA 1HUTH 1H8DH 1CA0B 1PPBH 2XTTB 4K8BA 2W26A 1N1LA 2VNTA 2A45B 2ZCHP 1DXWA 1KY9A 2D1JA 2FOBA 1TGCA 4X8UH 2K1QA 1YC0A 2ZGXH 3U8OH 1MMJN 3KF2A 3PO1B 4JZDH 1A0LA 1JMOH 1HIAA 1JRSA 1ZRKA 1O3DA 1CHGA 3C1KA 3RP2A 1SQAA 3SQEE 1P2QA 3P8OA 1EZUC 1ZYOA 1V2JT 2XYAA 3B23B 2C8WB 3STIA 2PKAA 1KLTA 1AVGH 1DICA 4K2YA 3MFJA 3KQEA 3M7TA 1TA6A 3P95A 4AX9H 2KAIB 2B8OH 3QLPH 3P8GA 1O2MA 2Y5GA 2Y82A 3EA9A 1O3JA 1DFPA 2PGQB 3SI4H 3AVZA 1O5DH 1C9PA 1UHBA 2M5TA 1O3CA 4R0IA 5GJ4B 3LGVA 1DSTA 1TA2A 1TABE 1DDJA 5FCRA 2A4RA 1GVKB 3R3GB 2GZ9A 2XRCA 1SGDE 3HATH 1KSNA 2QXJA 1GJ4H 1UCYH 2EI7A 3TLOA 3RM2H 3UOUA 1ARBA 5FBEA 4DY7B 2OCVB 1L0ZA 3QGNB 7KMEH 1W14U 2ZPQA 1LHEH 2FPZA 1JRTA 1ANEA 2BDYA 3SJ9A 1V2QT 4D76A 4TY6A 1QBNA 3B8JA 1K1JA 1LPKB 1P2NA 1BRAA 1OKXA 1O2TA 5A2MH 3B9FH 1GMDF 1UTLM 1O34A 1HAZB 2GDEH 3E0PB 2FIRH 1V2MT 1TBRH 1VCPA 1GHWH 1C2JA 1BTUA 1WTHD 2XCFA 1TMTH 1SFIA 2A4OA 3RC4A 5T6GA 1BTPA 4ABJA 4DW2U 3KQCA 3O8DA 3A88A 3BSQA 3U9AH 2TIOA 1IHTH 2OTVA 5A8ZA 1IQKA 2OBOA 1EJMA 1SQTA 1WOFA 4X2YA 3R0FA 5EOKA 3SV6A 1GL1A 3SHCH 2VU8E 2TPIZ 2J92A 1A3BH 4TWYA 4AZ2B 1O2PA 1XUIA 3AASA 2ZU2A 4JK5A 2CGAA 4O3UA 2STBE 2GCTC 4Y0YE 2ZIQH 2R3UA 4OGYA 1C5UA 1NRNH 3EA8A 1V6DA 3A82A 4Y6DA 1GPZA 1F5RA 3RXMA 2PUQH 5EW1H 1DVAH 1P01A 4MDSA 5HMAA 2JH6D 4AFUA 6GCHG 3E91A 1NRRH 1ZMNA 1TFXA 4BTTB 2ZWLH 2F9BH 2PTCE 1QY6A 2EA3A 2B7DH 3BTGE 4Y7BA 4ASHA 2ZPRA 2FP7B 3LKWA 1HAOH 1PQAA 3Q76A 3ZVDA 2QN5T 1ZSJA 1A0JA 8GCHG 4ABEA 1G3BA 1GBCA 2FEQH 5TCAA 1BCUH 1MTNB 2ZHFH 1AU8A 2AMDA 3G01A 3L33A 3PV4A 3BG8A 3BIVH 3UWJH 1O5EH 3RMLH 4CHAB 3F9FA 1O39A 1BBRH 2VH0A 1GI8B 3KCGH 1NS3A 3U8TH 4DGJA 2XXLA 1AB9C 2QXIA 3PM3A 1LQEA 4BAHB 2BD2A 2AS9A 1G9IE 4D7FA 3M61U 1BMLA 1ZHMA 1TOMH 2BOHB 2ZHEH 4WJG2 1UTJA 2VINA 1XXFA 2ZO3H 2UWPA 2ZFQH 1HCGA 3ZVEA 1WQVH 1W7GH 1EZQA 1GMCG 4ISLA 2A0QB 2G5VA 1ZSKA 4ZKSU 1O2GH 1XUKA 4YM9A 3DA9B 4X8TH 3M7QA 2G51A 1GHYH 1GI5A 3MHWU 4Y79A 1FN6A 1WV7H 4U30A 3FP6E 1TQ7B 1C1RA 1JXPA 3FZDA 1O2UA 4X0WU 4TPYA 4BNRA 2UUJB 1E35B 1S6HA 1IQLA 5EQSA 4I31A 1GHBF 1C2HA 2ODQA 3BEIB 1Z1JA 2WPIS 1Y59T 1VITG 4AFSA 1W11U 4Y7AA 3U69H 1LKBA 1LO6A 4GSOA 1SLXB 1F92A 1O3NA 3F68H 3PLPA 4BAMB 1BZXE 2R3YA 4OS2A 2HWLB 3ODDA 1GJAB 1FMGA 2QYIA 4CRCA 1W12U 1QL9A 2FI5E 5DPAA 1HAGE 4HTCH 2BOKA 1Z7KA 1F0SA 1GDQA 1GBEA 3NXPA 2BVXH 1N6XA 1BMAA 2CV3A 1H4WA 1AKSA 4ABDA 1A5GH 1GBFA 3DFLA 3T26A 5I46H 3MH5A 2VIPA 3RXUA 2YOLA 4NA7A 3U1JB 1EX3A 3BTEE 4E7RG 4D9QA 1KDQB 1XM1A 1BB0B 1QA7A 1ZMLA 2XC4A 4BOHA 1OWIA 4I7YH 1G30B 2BB4A 1OPHB 1ZR0A 2O8UA 1G3DA 2C8YB 3P17H 2BLOA 5I25A 2IPHA 2W7UA 2HLCA 3ENSB 1RTFB 1OP8A 4B1TA 4CRAA 2ZU1A 1LQDB 4A1VA 4YOGA 3ZZ9A 1A5IA 3PB1E 1DANH 1G2MA 5L30H 1V2UT 1XUHA 2ZCKP 4I8GA 1CGIE 2H9EH 1C5QA 4XBDA 1AVXA 3SV2H 5C5OA 5JBAS 2VVVA 1ZTKA 1HAVB 3CS0A 3RMNH 3A7TA 4NSVA 2JH5D 4WMDA 1QCPA 2RDLA 4Y8ZA 1P2KA 2GMTC 2SGEE