1U6QA

Substituted 2-naphthamadine inhibitors of urokinase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Naphthamidine urokinase plasminogen activator inhibitors with improved pharmacokinetic properties.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 49
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2004-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1u6qA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1u6qA01
3O8BA 2ZZUH 3HGPA 1SGDE 1QQ4A 2J2UA 2PUQH 1GHXH 1YKTA 4AG1A 1CGHA 3DFLA 3ZZ7A 1LCYA 2VINA 1GBTA 5GPIB 2ZDMA 3TGJE 1P2JA 2GTBA 3PWBA 3KQEA 3SNBA 4FUBA 4JK6A 3TGKE 1TBRH 4GCHF 3SNCA 2QAAA 2BD3A 1BMMH 1NRSH 1AU8A 1HAVA 5B6OA 3LOXA 4UE7H 1ZHMA 4ASHA 2Y5GA 4XBDA 2OQUA 1RGQA 1PPEE 1BTPA 1TMTH 2YNBA 1BZXE 3U8TH 4FU8A 3QO6A 4ZKNU 1HLTH 2Q1JA 5C20A 3LH3A 1N6XA 4LZ1H 5DP9A 1AMHA 3M3VA 3PMJA 1ZLRA 5C5OA 4TY7A 1AZ8A 2WV4A 1HIAA 4DIIH 1MAXA 2ZU3A 3A87A 2ANKH 3F9FA 3IITA 3SNEA 3SO3A 1ZJKA 1KSNA 1O3EA 4D8NA 1O32A 1QNJA 1OPHB 3TH4H 1A7SA 4AB9A 1NZQH 5IYTA 1OWDA 1QB6A 1O5BB 1V2PT 1GI9B 3KL6A 1H8IH 1O0DH 4BAOB 2O8UA 2TIOA 2ZHWH 2ZFTA 4HZHA 4OS7A 1GBKA 1ABJH 5ESBA 5JB9S 3E3TA 3SJOA 3FAOA 1C1TA 4KELA 2BQ6B 1YPHE 3PTBA 2O8TA 3ZZ8A 3UNSA 3SUGA 2TRMA 2SFAA 4CHAC 2UUJB 3ZVEA 4AGKA 3GY5A 1QBVH 3KQBA 4ZH8A 2VH0A 3LU9B 1TNLA 2EA3A 4YZUA 1UTOA 1EJAA 1A61H 2NU0E 4H6TA 1VITH 2BX3A 3TGIE 2AMQA 5DKMA 4UONA 3L33A 3LDXH 1SG8B 8GCHG 3OY5U 3RC4A 1DVAH 1O3PB 1GDUA 2J38A 5DGJA 1O3MA 2H6MA 1ZGVA 1AD8H 2VH6A 1TGNA 1CT4E 2QA9E 4CRCA 1C5YB 2PUXB 1N8OC 1RIWC 2FODA 4K1SA 4FUEA 4TPYA 3ZZ6A 5GWZA 2XYAA 2ZG0H 4FUHA 1D3DB 2UUYA 1Y8TA 3OX7U 3MU4A 3M7TA 4YLUA 2P95A 2F9VA 4MLFB 5H4IB 2ZDKA 3HK6B 2QIQA 1AUTC 1CT0E 4O9VA 2PKSC 4NA7A 4B2CA 3NK8A 4ISIH 3RXIA 3PMAB 1T32A 3GYMA 1RD3B 2ASUB 4E7NA 1PPCE 1CHOF 4YTAA 1SMFE 2HGTH 1ZOMA 2FOMB 1C1WH 2IN2A 3PO1C 6GCHG 1V2RT 5EG4A 4Z0KA 5T3HA 1HB0B 1INCA 3M37A 1O2LA 5JDUB 1GJ6A 2XBYA 2YOLA 2J34A 2ZQ1A 3K9XB 3RXGA 2F3CE 1E34B 3ZVGA 2BDYA 2V3OH 4GCHG 3N7OA 3U1IB 1HAXB 4AN7A 1NFWA 1ACBE 2G55A 3EE0B 2GT7A 3MWIU 1QQUA 4A1XA 1MU8B 1ZHRA 1B5GH 4ZMAH 1A5GH 4OS6A 1K1NA 1QJ7B 2HNTF 1MKXK 4IN1A 3VB7A 1EPTB 3B23B 4VGCB 1UVPA 2OXSA 1F0RA 2FPZA 3MOCA 4TWYA 4ABGA 1TONA 5DP5A 1TNJA 3GY3A 2XWBI 1N1LA 1EKBB 1FY1A 1L4DA 3QUMP 2ZO3H 1ZPCA 3FFGA 3RUOA 2ZP0H 3GDVA 4BAQB 1Z6EA 5EQQA 5EXLA 1JIRA 1FIWA 4DVAU 1O34A 2LNCA 4J2YB 3SJ8A 2C8XB 1GJ8B 4BTUB 2XC5A 3U69H 1ZSKA 2BX4A 1ARBA 2RCEA 2TBSA 2RA0A 1P2MA 4AX9H 3TJNA 1K1LA 1AQ7A 1KLTA 1P12E 4NSVA 3EA8A 4QT8C 3VFEA 2P8OC 1WYKA 1C5VA 3OYPA 1T31A 4GHQA 3Q76A 2AS9A 3NKKA 1NT1A 2VIPA 1H1BA 4UFDH 1P05A 1DLEA 4NFFA 1HRTH 1LHDH 1WUNH 3VXEH 2BQWB 2P3TB 3LT3A 2ZPRA 2HRVA 3RXFA 1JIMA 2Y6TA 1CBWC 1O2RA 3LONA 5DP4A 3S69A 4DOQA 1ANCA 1A4WH 3PLPA 4YOGA 4KTSA 2OINA 3PLBA 4ISHH 5E0HA 1CBWB 2ANYA 5HXFA 1BMNH 5ABWA 3K6YA 5EU8A 1BITA 4ISLA 1HAOH 3M5OA 1MBMA 4MPVA 3RDZA 2Z3CA 5E8EH 3ZZCA 4AGJA 4SGBE 1GI4A 1UTQA 2C90B 5DP6A 5EPYA 5T6FA 1JRTA 1PPHE 2ZTYA 1UVTH 1O36A 1EQ9A 1EP6A 3EQ0H 1C1NA 2ULLA 5TJXA 1HDTH 1Q31A 1DWBH 3I78A 3PM3A 3FP6E 1EB1H 3ZV9A 1AUJA 3R3GB 4ZHMU 1YM0A 1NS3A 5LH8A 2TGTA 1SC8U 3LIWA 1YCPM 2THFB 1BRUP 4K1EA 2GCTB 5DP3A 2ODPA 5FHTA 3FANA 2AERH 1L2EA 1CO7E 3SGAE 3EA9A 5FCKA 3ZZAA 1AFQC 3B9FH 1Y59T 1TPAE 5JYIA 1P9UA 2OD3B 8KME2 7ESTE 1W8BH 2ZC9H 1SOZA 4OGXA 3SU5A 3AVZA 2OC7A 1AFQB 2Y5FA 3D65E 1DXWA 4I31A 1ELVA 1O33A 4MVNA 1EASA 3BF6H 3DD2H 3S9AA 1A3EH 3SV2H 3RXSA 1ZPZA 2FX4A 1CHOG 4JZ1A 3L6PA 1AVWA 1O2KA 1T8MA 3SW2B 2OLGA 2QCYA 4TPIZ 1GBEA 5EQRA 1O2QA 1TQ0B 1SQTA 4Y7AA 1Y3VA 1FN8A 4FUGA 3E1XB 3CP7A 4AFQA 3OTJE 3MHWU 4UFFH 1C1VH 1J9CH 4X8VH 2NWNA 2ZPSA 3ODFA 1LHFH 1TRMA 1TX6A 1O38A 1MTNC 2FDAA 1HAYB 4GAWA 1ZGIA 4CR9A 1MU6B 4IGDA 2O9QA 1P09A 3GCHC 2WYJA 1O2VA 2P94A 3LGWA 3VPKA 1F7ZA 3UPEA 2OBOA 1KXCA 1NFXA 1LPZB 1SSXA 2JKHA 3JZ2B 2RDLA 4B2BA 4JYTA 1L1JA 1DITH 2PW8H 2BHGA 1GBDA 3LKWA 1D6RA 1BRAA 2XBWA 5C1XA 1HUTH 2FZZA 4MNXA 2W26A 1C5TA 1CHGA 1LVOA 2PKAB 4GSOA 1ELCA 2HWLB 1C5MD 3RLWH 1WBGB 1J8AA 1NRRH 1SI5H 2ZU5A 1GBMA 2W5EA 4Z6AH 2ZCKP 1QRXA 1HXFH 1UCYH 1EZQA 1YYY1 1DM4B 3CENA 1EP5A 1P9SA 1ZJDA 1KIGH 2NU2E 1GJ5H 2CGAA 1BUIA 1Z8IB 2HLCA 3FZDA 3SUDA 1N6YA 3BV9B 3NZIA 4CR5A 2BVSH 4IW4E 1Y3YA 3S7KB 4NA8A 4SGAE 3VB4A 4WJG2 1VCQA 1RS0A 5E0JA 2WPIS 1TMBH 4AOQA 1BT7A 1EJMA 3S7HB 1O3HA 5LPEA 2WUBA 4NA9H 1FMGA 1O3CA 1SGQE 2BY5X 3OSYA 1ZRBA 2ZQ2A 3P6ZB 1AE5A 1DSTA 5GDSH 1FPCH 1ZMNA 4DT7B 4U01A 4X6OA 2BVRH 1YPEH 1QTFA 1ZTLA 3ZZ3A 1DPOA 4JYVH 3TK5A 3MNCA 3TVJB 1HAPH 2DE8A 1QFKH 1NRQH 3F6UH 1H8DH 4BAMB 3RXDA 2FM2A 1UTJA 5FPYA 1K9OE 1HAHH 2FYQA 1GHBF 4NZQA 1VZQH 1LHEH 3UUZA 1B0FA 1DUEA 1GVLA 1G3BA 3DA9B 3UOPA 4CREA 4BTTB 3LGUA 2BXUH 1QL8A 1B7XB 1O37A 2TGAA 1UK2A 1SGEE 2G4TA 1FAKH 3F9HA 1S6FA 1GHVH 1GBFA 3A82A 3U9AH 3GISB 4Y8YA 1GMHG 3TJUA 4KP0A 3TK9A 3HKIB 2BVXH 1OP2A 4B2AA 1GMCF 1P10A 4RN6A 2Y82A 5JBCS 2GCHF 2B7DH 3STJA 3HATH 2SGEE 4Y0ZE 1XX9A 5DK1A 1HCGA 8GCHF 1QJ6B 3A89A 4M7GA 1WQVH 2ZF0H 4WMDA 4X2WA 2ZGCA 4I32A 4D9RA 2J94A 1LVBA 5FPTA 3A8DA 4E06H 1ZSJA 3S9CA 2GZ8A 3LH1A 5A0BA 1VGCB 2RG3A 3Q3XA 2LPRA 1O2ZA 1AY6H 3BTTE 4Y6DA 2BTCE 1P01A 4DCDA 1OWKA 2QXJA 1TQ7B 1ZZZA 2F83A 2VWNA 1G3DA 3S0NA 1HBTH 1YCPH 2JETB 1LDTT 1YPLH 3LGTA 3BG8A 1O3BA 1EAXA 1GG6C 1TBZH 1BB0B 3ELAH 1GBCA 1ELBA 1O5DH 1GJAB 3RXJA 2VIOA 3A8AA 2BDAA 2FYRA 1C5RA 2IJOB 5DP8A 1TRYA 1NM6A 1TOCB 2QYIA 1NO9H 1AB9B 2DE9A 5FAHA 1NRNH 1KLJH 2A31A 3OY6U 1ANEA 4THNH 1SGPE 1OP8A 6GCHF 4ZHLU 3V7TA 4I8KA 8LPRA 1JWTA 1WCZA 2F9BH 1DWEH 1A5IA 4OS1A 3ZYDA 1Y5UT 1OOKB 3EYDA 4F4OC 4OS4A 1H9IE 4TY6A 2PV9B 2XCNA 1S0QA 5DG6A 2UUKB 4NIWA 1GBHA 3A7ZA 1ELTA 1OSSA 3T27A 1WSSH 1JXPA 1LPKB 5LPFA 2ALVA 3LJOA 1LVMA 1IHTH 3ZVAA 3QLPH 1C5XB 1QR3E 3S9BA 2F9NA 1TYNA 4B71A 3T5FH 1BHXB 1T8OA 4UFEH 3UY9A 1A0LA 4MPWA 2SGFE 3IG6B 5TCAA 2AGIX 1W2KH 2ANWA 2NU3E 2WPHS 3A84A 2OC8A 1HFDA 2XC0A 1Y5AT 4A7IB 2BLVA 4GHTA 4UD9H 3BTEE 5C3NA 1SGFA 3LPRA 3ESTA 1L1GA 4ABFA 3TU7H 1YLDA 1V2JT 3QGNB 2AGEX 1SGYE 5HMAA 5F6MA 1NU9A 2D1JA 1UTLM 4ZXYH 2I6QA 1CA8B 3F68H 1IQMA 2XCFA 1HIAB 1DE7H 3JZ1B 1KLIH 3KQDA 3RXUA 4Y10E 1ARCA 1MH0A 1VITG 2F9PA 4ISOA 5IDKA 5A0CA 1ANDA 3I77A 1GGDC 2EEKA 1A5HA 2HOBA 2BOKA 4O3UA 2XXLA 2WPLS 2FOAA 3RMOH 2A4RA 3MH7A 1YPHC 4CRDA 1GHBG 3DUXH 1GGDB 1MCTA 1V2QT 4X8UH 2PSYA 3GY4A 1YLCA 4OS2A 1MAYA 1PPZA 1VCPA 4ABJA 1DUAA 3QK1A 2W3KA 4X1RU 1UVSH 3U1JB 2AMPA 3V3MA 4E05H 2GMTC 2ZFFH 3A81A 1SL3A 1GCDA 4KKDA 3SNAA 1UTMA 5AHGH 1O2OA 1F0UA 2GMTB 2Z6BD 3RC5A 1GMCG 2UWLA 4CH8B 2GCHG 1EB2A 3BTKE 3BTGE 2VWLA 1V2LT 2NU1E 3D62A 1MTVA 2GP9B 1FI8A 3HPTB 4YESB 1O2TA 1PPFE 1UMAH 4YO9A 3SI3H 1UHBB 2TGPZ 3OU0A 1NFUA 1O2WA 3RXVA 3O8CA 4BXSA 3RLYH 1K1PA 4HTCH 2Q6GA 1XVOA 4X1NU 3V0XA 1P2QA 3LC5A 2HALA 2H5DA 2CHAB 1DICA 5T6GA 2QN5T 2OTVA 4DJZB 5FPSA 1TFXA 3URCA 1W13U 1O2NA 4AFSA 3ZZBA 4IMZA 4J1YA 1P11E 3SZNA 1SPJA 1O2JA 1VR1H 1E0FD 1E37B 3TJVA 1P3EA 1XVMA 2STAE 1BTXA 1BMLA 3GY6A 1FJSA 1C1UH 3RP2A 3ATIA 5FX5A 2B8OH 1CA0B 4K2YA 3SUFA 1TPOA 3E8LA 3LGIA 4JCNA 2J9NA 1BRBE 1S5SA 2ZFRH 2G81E 3GCOA 1P04A 4IN2A 1O5FH 4O3TA 1TB6H 1YPKH 3QN7A 3UREA 3TH2H 1UTPA 1KXFA 1L1NA 1TNHA 5F8XA 3EDXB 3SU3A 4O97A 2ZDLA 4ABIA 4TYDA 3T2NA 2BLQA 1ZMJA 2QGRA 1EPTC 4VGCC 6LPRA 5F8ZA 1H9HE 4B1TA 2G4UA 2D2DA 1GBBA 1QL7A 2VIDA 1WOFA 3RXLA 1TOMH 1O35A 1XUKA 2GX4A 1S0RA 5I46H 1HAGE 1HAIH 2A2QH 1V2VT 1AWHB 1A2CH 1ZTJA 4FUJA 3RM2H 5EW1H 4Y8ZA 2A4GA 2BD8A 1JRSA 1BTZA 1ETTH 2F9UA 3ITIA 3QTVH 2UWOA 4RKJB 3QTOH 1TA6A 2A7CA 4NWKA 1C2KA 2B9LA 5EGMA 5JBBS 1ABIH 1C4U2 3SU6A 4R0IA 1PPBH 1GBJA 1ZSLA 2ZU1A 3MU5A 4D9QA 2QC2A 1THRH 3RXMA 1RXPA 2OQ5A 3MU0A 5L2ZH 1FAXA 2A32A 2ZGHA 4OS5A 3SORA 1BBRH 5L6NH 1T8NA 4XE4A 3CS7A 4GVUA 3MFJA 1NN6A 1GI5A 2VB0A 2Y7ZA 3QX5H 3M3TA 4OGYA 1V2UT 4I8JA 1GI2A 2BLWA 7KMEH 3VXFH 1FONA 1G3EA 3GICB 1LHCH 3BTWE 2SNVA 1A0HB 2GZ9A 1GI1A 2FTLE 7GCHG 2V35A 8ESTE 1OWIA 1FPHH 5GJ4B 2OUAA 1TX8A 4FUDA 1C4V2 2ZEBA 1W14U 3UR9A 1IQNA 2ZIQH 2PGQB 1YPJH 1KXEA 3G01A 5HGGA 1NESE 4INLA 3RXPA 2VNTA 2AFQB 1EJNA 1MKWH 2GD4B 2PFEA 6CHAB 2K1QA 5J4QA 3SV7A 5JB8S 2JH6D 2PTCE 2D8WA 3ZVDA 1C1SA 3RU4D 1GBIA 9ESTA 3SN8A 1CE5A 1GWAA 2PSXA 1GJ9B 3H7OA 3W94A 3H5CB 1O3KA 4ABBA 3SQEE 3M5MA 4BAKB 1C5NH 4JZFH 1P0SH 4XSKU 2GCTC 3GCNA 1PQ7A 1RRKA 4D7FA 4HFPB 1GMHF 4LOYH 2Z9LA 3B8JA 5BPEA 4DGJA 2BDBA 1AGJA 1O3LA 1WU1A 2FP7B 2GDDA 2FOBA 3A7WA 1FN6A 1V3XA 1TGBA 1SR5C 2W7SA 4X2VA 1TLDA 4YM9A 5AVDA 1BIOA 3BEFB 3P8NA 1OWHA 1J14A 2WPJS 3ZZ4A 3ZV8A 4IS5A 1AI8H 3QZQA 3MH5A 5CMXH 1XUFA 3QWCH 4TWWA 3T26A 4JZDH 1YP9A 3DHKH 1V2OT 2FO9A 1IAUA 2ZFPH 2F91A 3KIDU 1TMUH 1GJDB 1E38B 3ZYEA 4I7YH 3AAUA 2A4OA 2EI6A 4X1PU 4WH6A 1O2PA 1EAUA 3T29A 3UIRA 3A8CA 3EGKH 1S82A 4RKOB 1PFXC 2ZA5A 3SJ9A 2A4QA 4BAHB 1ANBA 3RXOA 1ZR0A 3TLOA 2A2XH 1HXEH 1SFIA 3HK3B 1Y3WA 4DG4A 4ZHAA 1DWDH 1GI7B 1O2XA 3R0FA 3W95A 2R9PA 1GJCB 2FX6A 3V12A 1A3BH 1YPGH 1RJXB 1TGSZ 1OS8A 4X1SU 3TITA 2D26C 5FXLA 4A92A 2BDHA 1BTUA 3RU4E 3E91A 4WMEA 1QL9A 3RXKA 3WY8A 2ZGJA 1H4WA 1RTKA 2ZGBH 4INHA 5CE1A 2V6NA 1W10U 1OWJA 1MTSA 1W11U 1O2SA 1C5OH 5GCHG 3E0NB 1CVWH 1C5LH 1HPGA 1ID5H 2Z9IA 3TNSA 1UVOA 1OP0A 1KXAA 1ELDE 2P16A 2ZECA 1QCPA 2ALPA 1F92A 1BMAA 1YBWA 3BN9A 1ELGA 1GCTB 1THSH 3AW1A 3FZZA 2PKAA 1V2WT 1QIXB 1NY22 3SU4A 1LHGH 1QA7A 2PR3A 4WMFA 2J95A 1P03A 2BD5A 2H9EH 1XKBC 2QY0B 4O03A 1LKAA 2QXIA 2VGCC 2BXTH 3H7TA 1MD8A 3SV6A 5FX6A 1LVYA 1F5KU 2FXRA 1FQ3A 3P70B 1G37A 5LPRA 4YOJA 2XBVA 3BG4B 2VGCB 4NIXA 1HV7A 4ABEA 1BTYA 1K1JA 1QBNA 2A5KA 3TPIZ 1PQAA 1VITF 1K22H 2KAIA 3E90B 1G3CA 1EZSC 1TPPA 3K2UA 3LC3A 2FOHA 4GLYA 1MQ5A 1XUJA 4MQAA 3U98H 2C3SA 1D6WA 1KDQA 1X7AC 1WTGH 3BEIB 1D3PB 1VJAU 2SGPE 1OWEA 1NTPA 1QB9A 1XUGA 2BDIA 2B5TB 2FIRH 2H5CA 2OCVB 2ANMH 1ELEE 3M35A 3UWJH 2CN0H 2BMGB 3PB1E 1GDNA 4FUFA 3ZZ5A 1DT2A 5SGAE 1ETSH 4Q7XA 4UEHH 3UR6A 5HYOA 2Y7XA 3UFAA 1SOTA 2ZDVH 2STBE 4K8BA 1EATA 1LQDB 3BTHE 1BQYA 1CGIE 2FESH 5CHAC 2FOFA 4XDEA 2H2ZA 3VB5A 2P3FH 1BTWA 1P02A 3FP8E 4B74A 1AKSA 1NROH 3BTDE 2G52A 1C2EA 5CHAB 4MTBA 1WV7H 3ENSB 1Q3XA 2ZU4A 4Y8XA 1AVXA 1VGCC 1DLKB 1AFEH 1C5UA 2UWPA 3VB6A 1ETRH 1GHAG 5TCCA 1QGFA 2GZ7A 5EQSA 1XM1A 3BTME 3Q77A 2AIPA 3RXRA 1O5EH 2JETC 2ZHEH 1O2IA 1O2YA 1F5RA 1XMNB 3A86A 1H9LB 4WF8A 1UO6A 1P57B 2GT8A 1GDQA 1QRWA 2GV7A 2M5TA 3ATMA 2ZCLP 4WVPE 1O3IA 1Q2WA 1AN1E 1SQOA 2O8MA 2VVCA 1B0EA 3O8RA 4INKA 1Z8GA 3GY7A 1QB1A 4FXGH 1TABE 1CSOE 3RXTA 1Y5BT 1TX7A 1AB9C 2AGGX 4R8TB 4AORA 4BANB 1GBAA 5PTPA 1C2LA 4B73A 1GL1A 2BD7A 1MZAA 2C4FH 4D7GA 4WWYA 3NWUA 2ZGXH 1SLXB 1Z6JH 1GJBB 4CH2B 4ESTE 1ELFA 2EC9H 2BD4A 3MNSA 1ZTKA 2XWAA 4X8TH 3A85A 1QY6A 4XBBA 5BRRE 3SQHE 2O8WA 1FLEE 4LZ4B 2AH4X 5J4SA 1C9PA 1SGCA 1G36A 2ODYB 3Q3YA 3BIUH 1LTOA 1Z7KA 2BD2A 4H42U 1GHYH 3BTFE 4A1VA 4CBOA 1P2KA 4I33A 5AF9H 1UTKA 1AZZA 5EXMA 1O2MA 5I25A 3SV9A 2WINI 3HKJB 1DWCH 3MH6A 1A46H 1KTSB 3MO6A 3QZRA 2ZFSA 1IQEA 2YNAA 1OKXA 3MI4A 3C1KA 2H9HA 4PROA 1GI6A 1HAVB 3EAJA 3P17H 1DOJA 1F0SA 2BDCA 5EXNA 5HM2A 1YCPK 1GJ4H 1IQLA 1O5CB 2WPKS 1KTTB 2OC1A 1OX1A 1IQFA 3Q3KA 3T62A 3MH4A 1ZPBA 2SGQE 3A7VA 3PMBB 2BDGA 2Q6DA 1O2GH 1AE8H 2ZNKH 2AEIH 1C5ZB 1C2DA 4IC5A 2A1DB 4X6NA 3FVFB 1SHYA 1UK4A 2BY7X 4I8GA 1FIZA 1L0ZA 2FOGA 3L3TA 3ZZDA 4Q7YA 1KYNA 1DX5M 3A7TA 1LMWB 2P59A 1HNEE 2CJIA 2CF9H 1PPGE 2HVXA 1M9UA 4BXWA 1K2I1 4XOJA 5GIBA 1C1QA 1FUJA 1XUIA 3ODDA 4WXVA 2P93A 3SOSA 2H9TH 7GCHF 3UNQA 1GI8B 1EX3A 3MU1A 4F49A 2V3HH 2R2WU 3SGBE 1IQGA 1SGRE 4CRAA 2Y81A 3BTQE 3DFJA 3RMMH 1TA2A 1S81A 5JBTA 1GMDG 1IOEA 3KQCA 1T7CA 3RU4T 1C1MA 1S85A 2PLXA 4NSYA 4NIVA 4MNWA 1D3QB 3E6PH 4KTUA 1FNIA 1O3OA 1NRPH 1CT2E 3CS0A 1D3TB 4K8YA 1SLWB 5E0GA 1O3FA 1OXGA 4H6SB 4IC6A 1O3JA 1GVKB 2ZU2A 1E35B 4X2XA 1SFQB 3RMNH 4B75A 2BOHB 5AFYH 4CHAB 3UOUA 2ODQA 1C5SA 1LPGB 1YGCH 4KTCA 5GXPA 4MG3A 1SB1H 2CHAC 3QGJA 2R0LA 3SU0A 1HGTH 3BEUA 5E2OA 1S83A 3STIA 1ZHPA 1UHBA 1TWXB 4JZIA 3SV8A 1P2NA 3AAVA 3P8GA 2F9OA 3LGYA 1MMJN 3RXCA 4K3JA 5G4BA 1SLUB 2XTTB 3UNRA 2OC0A 3GCTF 3M5LA 1YPMH 3RXBA 4Y76A 4HI3A 3E0PB 1BOQA 1TAWA 1GHWH 1PJPA 3NUMA 1MKXH 2ZHFH 1CA0C 1P2OA 5K7RA 5LGOA 4D76A 3P95A 3T28A 3KNXA 1C2HA 4BTIB 2Y80A 3GY2A 1EAWA 2FEQH 1TRNA 1J15A 1N8OB 1RIWB 1V2TT 1THPB 3SHCH 1TIOA 4ZKRU 1WAYB 5JBAS 2HPQH 2A7HA 3MNXA 3DT0H 2XNIA 4A5TS 3GDUA 5F03A 2PTNA 4YT7H 4DIHH 1QA0A 4WY3A 2NU4E 4MPUA 1YC0A 1F5LA 1MQ6A 4JMYA 1C1RA 2PKSB 1P2IA 3PYHA 7LPRA 1V6DA 2R3YA 1G30B 1Z8JB 4RSPA 3SNDA 2O8LA 1ZRKA 2BY9X 2SNWA 3P8OA 3ZZ9A 3PV4A 4Y79A 3BIVH 1MTUA 1QHRB 1IQJA 1UK3A 2A45B 4MPXA 4FUCA 1O39A 1JMOH 2Z9GA 1K1IA 3C27B 4X2YA 3K6ZA 1KXBA 1W7XH 2WPMS 1V2KT 3PO1B 1PYTD 1IQIA 2OBQA 3KGPA 3LGVA 5FBIA 1RFNA 4AZ2B 3SGQE 2Z94A 1LO6A 2BZ6H 2ZPQA 4NZLA 3D23A 1MTWA 5GCHF 3TIUA 1T4VH 2BYAX 4ZKOU 1EPTA 1TALA 1BCUH 1AO5A 1XKAC 2FTMA 2R2MB 2FI4E 2TPIZ 2FLRH 5DJ7A 4MNYA 1U6QA 2FWWA 2AMDA 2IOTA 2ZCHP 5F8TA 4GPGA 4DURA 4JZEH 1GBLA 3RXEA 5FCRA 2AIQA 1C4Y2 3PMHB 5L2YH 1K1MA 3A83A 4X0WU 2P3UB 1W0YH 4LK4A 1AHTH 2FMJA 4MNVA 2SGAA 4ABDA 4Q80A 2RA3A 4AYVB 3O8DA 2QV1A 5EW2H 1JOUB 3I29A 2QF0A 1F2SE 1F0TA 5T6DA 2ZTXA 1O5GH 5ETXA 5K0HA 3GYLB 3SU1A 1D4PB 1Z1IA 2XRCA 2ILNA 2V0BA 2BLOA 2FOEA 2Z9KA 1Z71A 3SHAH 4WH8A 4A1TA 1UVUH 4NG9H 3ATKA 3NPSA 4U32A 2ZTZA 4XBCA 4ZROA 4DW2U 1BHXF 2G51A 2BD9A 4FUIA 1O3GA 4JK5A 4YOIA 2Z3EA 2P8OB 2FS9A 3AASA 6CHAC 4ISNA 1BJVA 3U8RH 4ZXXH 5C2ZA 3FP7E 1MD7A 3KCGH 2OP9A 1MCVA 2C93B 2Q6FA 4Q7ZA 2PWXA 3GY8A 3PTNA 3A88A 1BRCE 1GHZA 1SVPA 1FY8E 1PYTC 1BA8B 3VEQB 2GVFA 1TGCA 1PQ5A 1MZDA 4BOHA 6ESTA 3RXHA 1WTHD 1TNGA 1YF4A 4NIYA 1S6HA 1VCWA 4B76A 1TNIA 3GOVB 3ZVFA 4X1QU 5A8YA 2ESTE 1Y3XA 1VJ9U 2JH0D 1BBRK 1EOJA 1Z1JA 1EZUC 2BQ7B 3M3SA 3ZVCA 3A7YA 2GGVB 1KXDA 3ZVBA 4UDWH 1A0JA 2QXHA 2VIVA 1W0ZU 1O2HA 2SGDE 5DPAA 2DUCA 4H4FA 1FY5A 9LPRA 5A8XA 3AW0A 3GCTG 3HGNA 5C1UA 1O31A 1E36B 2WV5A 1GHAF 5AFZH 1S84A 4ABHA 3SJIA 1CU1A 3MMGA 1T8LA 3VB3A 1BBRE 1DY8A 1V2NT 2WUCA 4X8SH 1ESBA 5A8ZA 3K65B 2CXVA 1C5QA 2A5IA 3ATWA 3D49H 2ZHDA 1D9IA 1MKWK 1K28D 2BY6X 4CRGA 4K1TA 4UFGH 2QXGA 1K21H 4Y0YE 2TGDA 3A8BA 3MNBA 4U30A 5C67A 2GKVE 1HJAC 3LJJA 3RXQA 1W12U 4X6MA 1J16A 1P3CA 3MU8A 4U2WA 3URDA 2BY8X 2CV3A 1P8VC 1WQSA 1SBWA 1HJAB 1T4UH 4FU9A 1XXDA 1XUHA 5ESTE 4WXIA 4AB8A 4MDSA 2VIQA 4ABAA 2XW9A 1TPSA 1BDAA 1KY9A 2IPHA 2GV6A 1C2GA 2R3UA 2XC4A 1FY3A 2ZKSA 3IWMA 1GJ7B 1JBUH 2ZFQH 1FY4A 2C8WB 1CGJE 2FLBH 4HGCA 4K5ZA 1DDJA 3PWCA 4I8HA 3VGCC 5EODA 1O2UA 1MTNB 2FS8A 5DO4H 4E7RG 2PHBA 3TNTA 3SUEA 1EZXC 3RC6A 2VU8E 2VJ1A 1O3NA 1G9IE 1MUEB 1QURH 4YT6H 3ATLA 4ZUHA 3U8OH 3VGCB 1SGTA 1AWFH 3GCHB 1GCTC 1QRZA 4X6PA 2A7JA 3SI4H 1BJUA 1O5AB 2VWOA 1A1RA 3TK6A 2A0QB 4JYUH 4Y71A 1O3AA 2XBXA 2AYWA 2ZI2H 3E16B 3SJKA 1NU7B 1O3DA 2FOCA 4I8LA 3TH3H 1FZZA 1HYLA 5FBEA 1BTHH 1UJ1A 3QDZB 3A80A 1V2MT 5A2MH 3RXAA 3NCLA 3P8FA 2CMYA 4FVBA 4LXBH 3KEEA 4AG2A 1EAIA 4GUXA 2VIWA 4NCYA 3RMLH 1QBOA 3BG4C 1ZMLA 1MBQA 1SGNE 1SHHB 1TBQH 5C5NA 2EI7A 1DXPA 3V13A 4AFUA 3P92A 1W7GH 3Q00A 1ESTA 1IQKA 2JH5D 3TJOA 5C1YA 3A7XA 1C9TA 1C1OA 1NC6A 4ZAEA 5A09A 1GL0E 4XFQA 5EOKA 1UTNA 2GDEH 2G5VA 2KAIB 1C2IA 2HPPH 1QJ1B 1EUFA 3MYWA 1HJ9A 3KF2A 1C2FA 1C2JA 2W3IA 2J4IA 1SGFG 3MO3A 4Y11E 2EI8A 1AIXH 1SGIB 1ELAA 1KDQB 2R0KA 2A5AA 4CRBA 2FI5E 3M5NA 1IHSH 1CQQA 3UQOA 1EOLA 3EA7A 1LQEA 1DFPA 3F9GA 5A0AE 3RM0H 1DANH 1AVGH 1GMDF 4ZKSU 2ZHQH 3MTYA 2VWMA 4K69A 4AYYB 2G8TA 3BSQA 1Y3UA 4IBLH 2PGBB 1V2ST 1UCYK 1C2MA 1ESAA 1ZYOA 2Z9JA 5E2PA 1G2LA 3GDSA 1L4ZA 5EPNA 1G32B 2QF3A 4KGAA 1OYTH 1ORFA 5HM9A 1PQ8A 2ZWLH 1NFYA 1AKSB 1TGTA 1FDPA 2B0FA 1C5PA 1O30A 2BB4A 4Y7BA 4CBNA 3F1SB 2CF8H 1Z8RA 3UTUH 1C1PA 3UQVA 1GI3A 1GI0A 2BM2A 4FU7A 1UCYE 1FXYA 1TE0A 4BNRA 2G00A 1FV9A 2BZAA 2J92A 2ZDNA 2H1UA 2C8YB 2WYGA 4NFEA 5JPMH 4DY7B 1DY9A 1HJ8A 4IMQA 1SQAA 5L30H 1NPMA 4AFZA 4K60A 1SLVB 2Y5HA 3F9EA 2G5NA 3SBKA 3KN2A 4YLQH 3MO9A 3KHVA 1GPZA 2VVUA 1IQHA 1J17T 1DS2E 2UUFB 3M36A 1P06A 3M61U 3UWIA 2C8ZB 1DSUA 2HNTC 3M7UA 4A6LA 1TNKA 1GVZA 1HAZB 1XXFA 2W7UA 1K1OA 1RTLA 2Z7FE 3PLKA 2HNTE 1W3CA 3T25A 2FI3E 2VVVA 2ZDAH 3PROA 3SU2A 4NGAH 2Z3DA 4CRFA 1G2MA 1EXFA 2I6SA 1OYQA 4NWLA 1GG6B 4Q2KA 5DP7A 3NXPA 1LKBA 3M7QA 4FVDA 1C5WB 1RTFB
chains in the Genus database with same CATH superfamily
3O8BA 2ZZUH 3HGPA 1SGDE 1QQ4A 2J2UA 2PUQH 1GHXH 1YKTA 5EJ1A 4AG1A 1CGHA 3DFLA 3ZZ7A 1LCYA 2VINA 1GBTA 5GPIB 2ZDMA 3TGJE 1P2JA 2GTBA 2LP6A 3PWBA 3KQEA 2LELA 4ZCNA 3WW7A 3SNBA 4FUBA 4JK6A 2KCPA 3TGKE 1TBRH 4GCHF 3SNCA 5DN6D 2QAAA 2BD3A 4FOUC 1BMMH 1NRSH 1AU8A 2RFKC 1HAVA 5B6OA 3LOXA 4UE7H 1ZHMA 4ASHA 2Y5GA 4XBDA 2OQUA 1RGQA 1PPEE 1BTPA 1TMTH 2YNBA 1BZXE 3U8TH 4FU8A 3QO6A 4ZKNU 1HLTH 2Q1JA 5C20A 3LH3A 1N6XA 4LZ1H 5DP9A 1AMHA 3M3VA 3PMJA 1ZLRA 5C5OA 4TY7A 1AZ8A 4TSFD 2WV4A 1HIAA 4DIIH 5CDFE 1MAXA 2ZU3A 3A87A 2ANKH 3F9FA 3IITA 3SNEA 3SO3A 1ZJKA 1KSNA 1O3EA 4D8NA 1O32A 1QNJA 2KCAA 1OPHB 3TH4H 1A7SA 4AB9A 1NZQH 5IYTA 1OWDA 1QB6A 1O5BB 1V2PT 1GI9B 3KL6A 1H8IH 1O0DH 4BAOB 2O8UA 2TIOA 2ZHWH 2ZFTA 4HZHA 4OS7A 1GBKA 1ABJH 5ESBA 5JB9S 3E3TA 3SJOA 3FAOA 5T1VA 1C1TA 4KELA 2BQ6B 1YPHE 3PTBA 2O8TA 3ZZ8A 3UNSA 3SUGA 2TRMA 2SFAA 4CHAC 2UUJB 3ZVEA 4AGKA 3GY5A 1QBVH 3KQBA 4ZH8A 2VH0A 3LU9B 1TNLA 2EA3A 4YZUA 1UTOA 1EJAA 1A61H 2NU0E 4H6TA 5IK2D 1VITH 2BX3A 2J98A 3TGIE 2AMQA 5DKMA 4UONA 3L33A 3LDXH 1SG8B 8GCHG 3OY5U 3RC4A 1DVAH 1O3PB 1GDUA 2J38A 5DGJA 1O3MA 2H6MA 1ZGVA 1AD8H 2VH6A 1TGNA 1CT4E 2QA9E 4CRCA 1C5YB 2PUXB 1N8OC 1RIWC 2FODA 4K1SA 4FUEA 4TPYA 3ZZ6A 5GWZA 3ZIAD 2XYAA 2ZG0H 1KMHB 1D3DB 4FUHA 2UUYA 1Y8TA 3OX7U 3MU4A 3M7TA 4YLUA 2P95A 2F9VA 4B6FA 4MLFB 5H4IB 2GJGA 2ZDKA 3HK6B 4DT4A 2QIQA 1AUTC 1CT0E 4O9VA 2PKSC 4NA7A 4B2CA 3NK8A 4ISIH 3RXIA 3PMAB 1T32A 3GYMA 1RD3B 5C17A 2ASUB 4E7NA 1PPCE 1CHOF 4YTAA 1SMFE 2HGTH 1ZOMA 4XD7D 2FOMB 1C1WH 2IN2A 3PO1C 6GCHG 1V2RT 5EG4A 4Z0KA 5T3HA 1HB0B 2XNDD 3SZEA 1INCA 3M37A 1O2LA 5JDUB 1GJ6A 2XBYA 2YOLA 2J34A 2ZQ1A 3K9XB 3RXGA 2F3CE 1E34B 3ZVGA 2BDYA 2V3OH 4GCHG 3N7OA 3U1IB 1HAXB 4AN7A 1NFWA 1ACBE 2G55A 3U28C 3EE0B 2GT7A 3MWIU 1QQUA 4A1XA 1MU8B 1ZHRA 1B5GH 4ZMAH 1A5GH 4OS6A 1K1NA 1QJ7B 2HNTF 1MKXK 4IN1A 3VB7A 1EPTB 3B23B 4VGCB 1UVPA 2PP6A 2OXSA 1F0RA 2FPZA 3MOCA 4TWYA 4ABGA 1TONA 5DP5A 1TNJA 3GY3A 2XWBI 1N1LA 1EKBB 1FY1A 1L4DA 3QUMP 2ZO3H 1ZPCA 3FFGA 3RUOA 2ZP0H 3GDVA 4BAQB 1Z6EA 5EQQA 5EXLA 1JIRA 1FIWA 4DVAU 1O34A 2LNCA 4J2YB 3SJ8A 2C8XB 1GJ8B 4BTUB 2XC5A 3U69H 1ZSKA 2BX4A 1ARBA 2RCEA 2TBSA 2RA0A 1P2MA 4AX9H 3TJNA 1K1LA 1YLNA 1AQ7A 1KLTA 1P12E 4NSVA 3EA8A 4QT8C 3VFEA 2P8OC 1WYKA 1C5VA 3OYPA 1T31A 4GHQA 3Q76A 2AS9A 3NKKA 1NT1A 2VIPA 1VKYA 1H1BA 4UFDH 1P05A 1DLEA 4NFFA 1HRTH 1LHDH 1WUNH 3VXEH 2BQWB 2P3TB 3KQ5A 3LT3A 2ZPRA 2HRVA 3RXFA 1JIMA 2Y6TA 1CBWC 1O2RA 3LONA 5DP4A 3S69A 4DOQA 1ANCA 1A4WH 3PLPA 4YOGA 4KTSA 2OINA 3PLBA 4ISHH 5E0HA 1CBWB 2ANYA 5HXFA 1BMNH 5ABWA 3K6YA 5EU8A 1BITA 4ISLA 1H8ED 1HAOH 3M5OA 1MBMA 4MPVA 3RDZA 2Z3CA 5E8EH 3ZZCA 4AGJA 4SGBE 1GI4A 1UTQA 2C90B 5DP6A 5EPYA 5T6FA 1JRTA 4ACBA 2EQNA 1PPHE 2ZTYA 1UVTH 1O36A 1EQ9A 1EP6A 3EQ0H 1C1NA 2ULLA 5TJXA 1HDTH 1Q31A 1DWBH 3I78A 3PM3A 3FP6E 1EB1H 3ZV9A 1AUJA 3R3GB 4ZHMU 1YM0A 1NS3A 5LH8A 2TGTA 1SC8U 3LIWA 1YCPM 2THFB 4B6EA 1BRUP 4K1EA 2GCTB 5DP3A 2ODPA 5FHTA 3FANA 2AERH 1L2EA 1CO7E 3SGAE 3EA9A 5FCKA 3ZZAA 1AFQC 3B9FH 1Y59T 1TPAE 5JYIA 1W0JD 1P9UA 2OD3B 8KME2 7ESTE 1W8BH 2ZC9H 1SOZA 4OGXA 3SU5A 3AVZA 2OC7A 1AFQB 2Y5FA 3D65E 1DXWA 4I31A 1ELVA 1O33A 4MVNA 1EASA 3BF6H 3DD2H 3S9AA 1A3EH 3F3BA 3SV2H 3RXSA 1ZPZA 2FX4A 1CHOG 4JZ1A 3L6PA 1AVWA 1O2KA 1T8MA 3SW2B 2OLGA 2QCYA 4TPIZ 1GBEA 5EQRA 1O2QA 1TQ0B 1SQTA 4Y7AA 1Y3VA 1FN8A 4FUGA 3E1XB 3CP7A 4AFQA 3OTJE 3MHWU 4UFFH 1C1VH 1J9CH 4X8VH 2NWNA 2ZPSA 3ODFA 1LHFH 1TRMA 1TX6A 1O38A 1MTNC 2FDAA 1HAYB 4GAWA 1ZGIA 4CR9A 1MU6B 4IGDA 2O9QA 1P09A 3GCHC 2WYJA 1O2VA 2P94A 3LGWA 3KYFA 3VPKA 1F7ZA 3UPEA 2OBOA 1KXCA 1NFXA 1LPZB 1SSXA 2JKHA 3OFND 3JZ2B 2RDLA 4B2BA 4JYTA 1L1JA 1DITH 5KEDA 4P00A 2PW8H 1COWD 2JIZD 2BHGA 1GBDA 3LKWA 1D6RA 1BRAA 2XBWA 5C1XA 3CNRA 3OE7D 1HUTH 2FZZA 4MNXA 2W26A 1C5TA 1CHGA 1LVOA 2PKAB 4GSOA 1ELCA 2HWLB 1C5MD 3RLWH 1WBGB 1J8AA 1NRRH 1SI5H 2ZU5A 1GBMA 2W5EA 2KCOA 4Z6AH 2ZCKP 1QRXA 1HXFH 1UCYH 1EZQA 1YYY1 1DM4B 3CENA 1EP5A 1P9SA 1ZJDA 1KIGH 2NU2E 1GJ5H 2CGAA 1BUIA 1Z8IB 2HLCA 3FZDA 3SUDA 1N6YA 3BV9B 3NZIA 4CR5A 2BVSH 4IW4E 1Y3YA 3S7KB 4NA8A 4SGAE 3VB4A 4WJG2 1VCQA 1RS0A 5E0JA 2WPIS 2L6OA 1TMBH 4AOQA 1BT7A 1EJMA 3S7HB 1O3HA 5LPEA 2WUBA 4NA9H 1FMGA 1O3CA 1SGQE 2BY5X 3OSYA 1ZRBA 2ZQ2A 3P6ZB 1AE5A 1DSTA 5GDSH 1FPCH 1ZMNA 4DT7B 4U01A 4X6OA 2BVRH 1YPEH 1QTFA 1ZTLA 3ZZ3A 1DPOA 4JYVH 3TK5A 3MNCA 3TVJB 1HAPH 2DE8A 1QFKH 1NRQH 3F6UH 1H8DH 4BAMB 3RXDA 2FM2A 1UTJA 5FPYA 1K9OE 1HAHH 2FYQA 1GHBF 4NZQA 1VZQH 2WPDD 3OEED 1LHEH 3UUZA 1B0FA 1DUEA 1GVLA 1G3BA 3DA9B 3UOPA 4CREA 2RDEA 4BTTB 3LGUA 2BXUH 1QL8A 1B7XB 1O37A 2TGAA 1UK2A 1BMFD 1SGEE 2G4TA 1FAKH 3F9HA 1FX0B 1S6FA 1GHVH 1GBFA 3A82A 3U9AH 3F0OA 3GISB 4Y8YA 1GMHG 3TJUA 4KP0A 3TK9A 3HKIB 2BVXH 1OP2A 4B2AA 4Z1MD 1GMCF 1P10A 4RN6A 2Y82A 5JBCS 2GCHF 5DSFA 4RI0A 2B7DH 3STJA 3HATH 2SGEE 4Y0ZE 1XX9A 5DK1A 1HCGA 8GCHF 1QJ6B 3A89A 4M7GA 1WQVH 2ZF0H 4WMDA 4X2WA 3N7EA 2ZGCA 4I32A 4D9RA 2J94A 1LVBA 5FPTA 3A8DA 4E06H 1ZSJA 2J97A 3S9CA 2GZ8A 3LH1A 5A0BA 1VGCB 2RG3A 3Q3XA 2LPRA 1O2ZA 1AY6H 3BTTE 4Y6DA 2BTCE 1P01A 4DCDA 1EFRD 1OWKA 2QXJA 1TQ7B 1ZZZA 2F83A 2VWNA 1G3DA 5KGOA 3S0NA 1HBTH 1YCPH 2JETB 1LDTT 1YPLH 3LGTA 2QF4A 3BG8A 1O3BA 1EAXA 1GG6C 1TBZH 1BB0B 3ELAH 1GBCA 1ELBA 1O5DH 1GJAB 4ASUD 3RXJA 2HVYB 2VIOA 3A8AA 2BDAA 2FYRA 1C5RA 2IJOB 5DP8A 1TRYA 1NM6A 1TOCB 2QYIA 1NO9H 1AB9B 2DE9A 5FAHA 1NRNH 1KLJH 2A31A 3OY6U 1ANEA 4THNH 3OEHD 1SGPE 1OP8A 6GCHF 4ZHLU 3V7TA 4I8KA 8LPRA 1JWTA 1WCZA 2F9BH 1DWEH 1A5IA 4OS1A 3ZYDA 1Y5UT 2KCYA 1OOKB 3EYDA 4F4OC 4OS4A 1H9IE 4TY6A 2PV9B 2XCNA 1S0QA 5DG6A 2UUKB 4NIWA 1GBHA 3A7ZA 1ELTA 1OSSA 3T27A 1WSSH 1JXPA 3DSGA 1LPKB 5LPFA 2ALVA 3LJOA 1LVMA 2WZQA 1IHTH 3ZVAA 3QLPH 1C5XB 1QR3E 3S9BA 2F9NA 1TYNA 4B71A 3T5FH 1BHXB 1T8OA 4UFEH 3UY9A 1A0LA 4MPWA 2SGFE 3IG6B 5TCAA 2AGIX 1W2KH 2ANWA 2NU3E 2WPHS 3A84A 2OC8A 1HFDA 2XC0A 1Y5AT 4A7IB 2BLVA 4GHTA 4UD9H 3BTEE 5C3NA 1SGFA 3LPRA 3ESTA 1SKYE 1L1GA 4ABFA 3TU7H 3PRBA 1YLDA 1V2JT 3QGNB 5EJLA 2AGEX 1SGYE 5HMAA 5F6MA 1NU9A 2D1JA 1UTLM 4ZXYH 2I6QA 1CA8B 1S6LA 3F68H 1IQMA 2XCFA 1HIAB 1DE7H 3JZ1B 1KLIH 3KQDA 3RXUA 4Y10E 1ARCA 1MH0A 1VITG 2F9PA 4ISOA 5EJZA 5A0CA 5IDKA 1ANDA 3I77A 1GGDC 2EEKA 1A5HA 2HOBA 2BOKA 4O3UA 2XXLA 2WPLS 2FOAA 3RMOH 2A4RA 3MH7A 1YPHC 4CRDA 1GHBG 3DUXH 1GGDB 1MCTA 1V2QT 4X8UH 2PSYA 3GY4A 1YLCA 4OS2A 1MAYA 1PPZA 3AK5A 1VCPA 4ABJA 1DUAA 2CK3D 3QK1A 2W3KA 4X1RU 2AHME 1UVSH 3U1JB 2AMPA 3V3MA 4E05H 2GMTC 2ZFFH 3A81A 5C0UA 1SL3A 1GCDA 4KKDA 3SNAA 1UTMA 5AHGH 3FO8D 1O2OA 1F0UA 2GMTB 2Z6BD 3RC5A 1GMCG 2UWLA 4CH8B 2GCHG 1EB2A 3BTKE 5KECA 3BTGE 2VWLA 2L74A 1V2LT 2NU1E 3D62A 1MTVA 2GP9B 1FI8A 3HPTB 4YESB 1O2TA 1PPFE 1UMAH 4YO9A 2J98B 3SI3H 1UHBB 2TGPZ 3OU0A 1NFUA 1O2WA 3RXVA 3O8CA 4BXSA 3RLYH 1K1PA 4HTCH 2Q6GA 1XVOA 4X1NU 3V0XA 1P2QA 3LC5A 2HALA 2H5DA 2CHAB 1DICA 5T6GA 2QN5T 2OTVA 4DJZB 5FPSA 1TFXA 3URCA 1W13U 1O2NA 4AFSA 3ZZBA 4IMZA 2KFWA 1P11E 4J1YA 1SPJA 4Q4LA 3SZNA 3WWFA 1O2JA 5CHBA 1VR1H 1E0FD 1E37B 3TJVA 1P3EA 1XVMA 2STAE 1BTXA 4YXWD 1BMLA 3GY6A 1FJSA 1C1UH 3RP2A 3ATIA 5FX5A 2B8OH 3DSPA 1CA0B 4K2YA 3SUFA 2YMSB 1TPOA 3E8LA 3LGIA 4JCNA 2J9NA 3H09A 1BRBE 1S5SA 2ZFRH 2G81E 3GCOA 1P04A 4IN2A 1O5FH 4O3TA 1TB6H 1YPKH 3QN7A 3UREA 3TH2H 1UTPA 1KXFA 1L1NA 1TNHA 3OTPA 5F8XA 2WV9A 3EDXB 3SU3A 4O97A 2ZDLA 4ABIA 4TYDA 1E1RD 2BLQA 1ZMJA 2QGRA 1EPTC 3T2NA 4VGCC 6LPRA 5F8ZA 1H9HE 4B1TA 2G4UA 2D2DA 1GBBA 1QL7A 2VIDA 1WOFA 3RXLA 1TOMH 2J5UA 1O35A 1XUKA 2GX4A 1S0RA 5I46H 1HAGE 1HAIH 2A2QH 1V2VT 1AWHB 1A2CH 1ZTJA 4FUJA 3RM2H 5EW1H 4Y8ZA 2KX4A 2A4GA 2BD8A 1JRSA 1BTZA 1ETTH 2F9UA 3ITIA 3QTVH 2UWOA 4RKJB 3QTOH 1TA6A 1H8HD 2A7CA 4NWKA 1C2KA 2B9LA 5EGMA 5JBBS 1ABIH 1C4U2 3SU6A 4R0IA 1PPBH 1GBJA 1ZSLA 2ZU1A 3MU5A 4D9QA 2QC2A 1THRH 3RXMA 1RXPA 2OQ5A 3MU0A 3WWBA 5L2ZH 1FAXA 2A32A 2ZGHA 4OS5A 3SORA 1BBRH 5L6NH 1T8NA 4XE4A 2IJD1 3CS7A 4GVUA 3MFJA 3UB0A 1NN6A 1GI5A 2VB0A 2Y7ZA 3QX5H 3M3TA 4OGYA 5FL7D 4RT1A 1V2UT 4I8JA 1GI2A 2BLWA 7KMEH 3PV5A 3VXFH 1FONA 2WHXA 1G3EA 3GICB 1LHCH 3BTWE 2SNVA 1A0HB 2GZ9A 1GI1A 2FTLE 7GCHG 2V35A 8ESTE 1OWIA 1FPHH 5GJ4B 2OUAA 1TX8A 4FUDA 1C4V2 2ZEBA 1W14U 3UR9A 1IQNA 2ZIQH 2PGQB 1YPJH 1KXEA 3G01A 5HGGA 1NESE 5EIYA 4INLA 3RXPA 2VNTA 2AFQB 1EJNA 1MKWH 2GD4B 3MQKC 2PFEA 6CHAB 2K1QA 5J4QA 3SV7A 5JB8S 2JH6D 2PTCE 2D8WA 3ZVDA 1C1SA 3RU4D 1GBIA 9ESTA 3SN8A 1CE5A 1GWAA 2PSXA 4FETA 1GJ9B 3H7OA 3W94A 3H5CB 1O3KA 4ABBA 3SQEE 3M5MA 4BAKB 1C5NH 4JZFH 1P0SH 4XSKU 2GCTC 3GCNA 1PQ7A 1RRKA 4D7FA 4HFPB 1GMHF 4LOYH 2Z9LA 3B8JA 5BPEA 4DGJA 2BDBA 1AGJA 1O3LA 1WU1A 2FP7B 2GDDA 2FOBA 3A7WA 1FN6A 1V3XA 1TGBA 1SR5C 2W7SA 4X2VA 1TLDA 4YM9A 5AVDA 1BIOA 3BEFB 3P8NA 1OWHA 1J14A 2WPJS 3ZZ4A 3ZV8A 4IS5A 1AI8H 3QZQA 3MH5A 5CMXH 1XUFA 3QWCH 4TWWA 3T26A 4JZDH 1YP9A 3DHKH 1V2OT 2FO9A 1IAUA 2ZFPH 2F91A 3KIDU 1TMUH 1GJDB 1E38B 3ZYEA 4I7YH 3AAUA 2A4OA 2EI6A 4X1PU 4WH6A 1O2PA 1EAUA 3T29A 3UIRA 3A8CA 3EGKH 1S82A 4RKOB 1PFXC 1NBMD 2ZA5A 3SJ9A 2A4QA 4BAHB 1ANBA 3RXOA 2KM0A 1ZR0A 2A2XH 1HXEH 1SFIA 3TLOA 3HK3B 1Y3WA 4DG4A 4ZHAA 1DWDH 1GI7B 1O2XA 3F2HA 3R0FA 3W95A 2R9PA 1GJCB 2FX6A 3V12A 1A3BH 1YPGH 1RJXB 1TGSZ 1OS8A 4X1SU 3TITA 2D26C 5FXLA 4A92A 2BDHA 1BTUA 3RU4E 3E91A 4WMEA 5HIYA 1QL9A 3RXKA 3WY8A 2ZGJA 1H4WA 1RTKA 2ZGBH 4INHA 5CE1A 2V6NA 1W10U 1OWJA 1MTSA 1W11U 1O2SA 1C5OH 5GCHG 3E0NB 1CVWH 1C5LH 1HPGA 1ID5H 2Z9IA 3TNSA 1UVOA 1OP0A 2IPQX 1KXAA 1ELDE 2P16A 2ZECA 1QCPA 2ALPA 1F92A 1BMAA 1YBWA 3BN9A 1ELGA 1GCTB 1THSH 3AW1A 3FZZA 2PKAA 1V2WT 1QIXB 1NY22 3SU4A 1LHGH 1QA7A 2PR3A 4WMFA 2J95A 1P03A 2BD5A 2H9EH 1XKBC 4TT3D 2QY0B 2K0QA 4O03A 1LKAA 2QXIA 2VGCC 2BXTH 1W0KD 3H7TA 1MD8A 3SV6A 5FX6A 1LVYA 1F5KU 2FXRA 3NRLA 1FQ3A 3P70B 1G37A 5LPRA 4YOJA 2XBVA 3BG4B 2VGCB 4NIXA 1HV7A 4ABEA 1BTYA 1K1JA 1NBME 1QBNA 2A5KA 3TPIZ 1PQAA 3DSOA 1VITF 1K22H 2KAIA 3E90B 1G3CA 1EZSC 1TPPA 3K2UA 3LC3A 2FOHA 4GLYA 2OK5A 1MQ5A 1XUJA 4MQAA 3U98H 2C3SA 1D6WA 1KDQA 1X7AC 1WTGH 3BEIB 1D3PB 1VJAU 2SGPE 1OWEA 1NTPA 1QB9A 1XUGA 2BDIA 2B5TB 2FIRH 2H5CA 2OCVB 2ANMH 1ELEE 3M35A 3UWJH 2CN0H 2BMGB 3PB1E 1GDNA 4FUFA 3ZZ5A 1DT2A 5SGAE 1ETSH 4Q7XA 4UEHH 3UR6A 5HYOA 2Y7XA 3UFAA 4ACAA 1SOTA 2ZDVH 2STBE 4K8BA 1EATA 1LQDB 3BTHE 1BQYA 1CGIE 2FESH 5CHAC 2FOFA 4XDEA 2H2ZA 3VB5A 2P3FH 1BTWA 1P02A 3FP8E 4B74A 1AKSA 1NROH 3BTDE 2G52A 1C2EA 5CHAB 4MTBA 1WV7H 3ENSB 1Q3XA 2ZU4A 4Y8XA 1AVXA 1VGCC 1DLKB 1AFEH 1C5UA 2UWPA 3VB6A 1ETRH 1GHAG 5TCCA 1QGFA 2GZ7A 5EQSA 1XM1A 3BTME 3Q77A 2AIPA 3RXRA 1O5EH 2JETC 2ZHEH 1O2IA 1O2YA 1F5RA 1XMNB 3A86A 1H9LB 4WF8A 1UO6A 1P57B 2GT8A 1GDQA 1QRWA 2GV7A 2M5TA 3ATMA 2ZCLP 4WVPE 1O3IA 1Q2WA 1AN1E 1SQOA 2O8MA 2VVCA 1B0EA 3O8RA 4INKA 1Z8GA 3GY7A 1QB1A 4FXGH 1TABE 4AC9A 1CSOE 3RXTA 1Y5BT 1TX7A 1AB9C 2AGGX 4R8TB 4AORA 4BANB 1GBAA 5PTPA 1C2LA 4B73A 1GL1A 2BD7A 1MZAA 2C4FH 3EE7A 4D7GA 4WWYA 3NWUA 2ZGXH 1SLXB 1Z6JH 1GJBB 4CH2B 4ESTE 1ELFA 2EC9H 2BD4A 3MNSA 1ZTKA 2XWAA 4X8TH 1WXRA 3A85A 1QY6A 4XBBA 5BRRE 3SQHE 2O8WA 5B6LA 1FLEE 4LZ4B 2AH4X 2M2AA 5J4SA 1C9PA 1SGCA 1G36A 2ODYB 3Q3YA 3BIUH 1LTOA 1Z7KA 2BD2A 2KR7A 1GHYH 3BTFE 4H42U 4HG6A 4A1VA 1P2KA 4I33A 5AF9H 4CBOA 1UTKA 1AZZA 5EXMA 1O2MA 5I25A 3SV9A 2WINI 3HKJB 1DWCH 3MH6A 1A46H 1KTSB 3MO6A 3QZRA 2ZFSA 1IQEA 2YNAA 1OKXA 3MI4A 2W6ID 3C1KA 2H9HA 4PROA 1GI6A 1HAVB 3EAJA 3P17H 1DOJA 1F0SA 2BDCA 5EXNA 5HM2A 1YCPK 1GJ4H 1IQLA 1O5CB 2WPKS 1KTTB 2OC1A 1OX1A 5C0TA 1IQFA 3Q3KA 3T62A 3MH4A 1ZPBA 2SGQE 3A7VA 3PMBB 2BDGA 2Q6DA 1O2GH 2JJ2D 1AE8H 3GS9A 2ZNKH 2AEIH 1C5ZB 1C2DA 4IC5A 2A1DB 4X6NA 3FVFB 1SHYA 1UK4A 2BY7X 4OM9A 4I8GA 1FIZA 1L0ZA 2FOGA 3L3TA 3ZZDA 4Q7YA 1KYNA 1DX5M 3A7TA 1LMWB 2P59A 1HNEE 2CJIA 2CF9H 2JDID 1PPGE 2HVXA 2YMSD 1M9UA 4BXWA 1K2I1 4XOJA 5GIBA 1C1QA 1K0HA 1FUJA 1XUIA 3ODDA 4WXVA 2P93A 3SOSA 2H9TH 7GCHF 3UNQA 1GI8B 1EX3A 3MU1A 4F49A 2V3HH 2R2WU 3SGBE 1IQGA 1SGRE 4CRAA 2Y81A 3BTQE 3DFJA 3RMMH 1TA2A 5GNDA 1S81A 5JBTA 1GMDG 3N99A 1IOEA 3KQCA 1T7CA 3RU4T 1C1MA 1S85A 2PLXA 4NSYA 4NIVA 4MNWA 1D3QB 3E6PH 4KTUA 1FNIA 1O3OA 1NRPH 1CT2E 3CS0A 1D3TB 4K8YA 1SLWB 5E0GA 1E79D 1O3FA 1OXGA 4H6SB 4IC6A 1O3JA 1GVKB 2ZU2A 1E35B 4X2XA 1SFQB 3RMNH 4B75A 4XRNA 2BOHB 5AFYH 4CHAB 3UOUA 2ODQA 1C5SA 1LPGB 1YGCH 4KTCA 5GXPA 4MG3A 1SB1H 2CHAC 3QGJA 2R0LA 3SU0A 5F53A 1HGTH 3BEUA 5E2OA 1S83A 3STIA 1ZHPA 1UHBA 1TWXB 1MABB 4JZIA 3SV8A 1P2NA 3AAVA 3P8GA 2F9OA 3LGYA 1MMJN 3RXCA 4K3JA 5G4BA 1SLUB 2XTTB 3UNRA 2OC0A 3GCTF 1E1QD 3M5LA 1YPMH 3RXBA 4Y76A 4HI3A 3E0PB 1BOQA 1TAWA 1GHWH 1PJPA 3NUMA 1MKXH 2ZHFH 1CA0C 1P2OA 5K7RA 5LGOA 4D76A 3P95A 3T28A 3KNXA 1C2HA 4BTIB 2YMSC 2Y80A 3GY2A 3F2FA 2V3MA 1EAWA 2FEQH 1TRNA 1J15A 1N8OB 1RIWB 1V2TT 1THPB 3SHCH 1TIOA 4ZKRU 1WAYB 5JBAS 2HPQH 2A7HA 2HLDD 3MNXA 3DT0H 2XNIA 4I86A 3GDUA 5F03A 4A5TS 2PTNA 4YT7H 4DIHH 1QA0A 4WY3A 2NU4E 4MPUA 1YC0A 3KYGA 1F5LA 1MQ6A 4JMYA 1C1RA 2PKSB 1P2IA 3FN8A 3PYHA 7LPRA 1V6DA 2R3YA 1G30B 1Z8JB 4RSPA 3SNDA 2O8LA 1ZRKA 2BY9X 2SNWA 3P8OA 3ZZ9A 3PV4A 4Y79A 2F43B 1MTUA 1QHRB 1IQJA 1UK3A 2A45B 3BIVH 4MPXA 4FUCA 1O39A 1JMOH 2Z9GA 1K1IA 4P02A 3C27B 4X2YA 3K6ZA 1KXBA 1W7XH 3F2GA 2WPMS 1V2KT 3PO1B 1PYTD 1IQIA 2OBQA 3KGPA 3LGVA 5FBIA 1RFNA 4AZ2B 3SGQE 2Z94A 1LO6A 2BZ6H 2ZPQA 4NZLA 5HKKD 3D23A 1MTWA 5GCHF 3TIUA 1T4VH 2BYAX 4ZKOU 1EPTA 1TALA 1BCUH 1AO5A 1XKAC 2FTMA 2R2MB 2FI4E 3PRDA 2TPIZ 2FLRH 5DJ7A 4MNYA 1U6QA 2FWWA 2AMDA 2IOTA 2ZCHP 5F8TA 4GPGA 4DURA 4JZEH 1GBLA 3RXEA 5FCRA 2AIQA 1C4Y2 3PMHB 5L2YH 1K1MA 3A83A 4X0WU 2P3UB 1W0YH 4LK4A 1AHTH 2FMJA 4MNVA 2SGAA 3F0PA 4Q80A 4ABDA 2RA3A 4AYVB 3O8DA 2QV1A 5EW2H 1JOUB 3I29A 3W1EA 2QF0A 1F2SE 1F0TA 5T6DA 2ZTXA 1O5GH 5ETXA 5K0HA 3GYLB 3SU1A 1D4PB 1Z1IA 1QZ8A 2XRCA 2ILNA 2V0BA 2BLOA 2FOEA 2Z9KA 1Z71A 3SHAH 4WH8A 4A1TA 1UVUH 4NG9H 3ATKA 3NPSA 4U32A 2ZTZA 3DCLA 4XBCA 4ZROA 4DW2U 1BHXF 2G51A 2BD9A 4FUIA 1O3GA 4JK5A 4YOIA 2EY4C 2Z3EA 2P8OB 2FS9A 3AASA 6CHAC 4ISNA 1BJVA 3U8RH 4ZXXH 5C2ZA 3FP7E 1MD7A 3KCGH 2OP9A 1MCVA 2C93B 2Q6FA 4Q7ZA 2PWXA 3GY8A 3PTNA 3A88A 1BRCE 1GHZA 1SVPA 1FY8E 2VBCA 1PYTC 1BA8B 3VEQB 2GVFA 1TGCA 1PQ5A 4RT0A 1MZDA 4BOHA 6ESTA 3RXHA 2K8IA 1WTHD 1TNGA 1YF4A 4NIYA 1S6HA 1VCWA 4B76A 1TNIA 3GOVB 3ZVFA 4X1QU 5A8YA 2QE7D 5HIZA 2ESTE 1Y3XA 1VJ9U 2JH0D 1BBRK 1UW7A 1EOJA 1Z1JA 1EZUC 2BQ7B 2KZ4A 3M3SA 3ZVCA 3A7YA 2GGVB 1KXDA 3ZVBA 4UDWH 1A0JA 2QXHA 2VIVA 1W0ZU 1O2HA 2SGDE 5DPAA 2DUCA 4H4FA 1FY5A 9LPRA 5A8XA 3AW0A 3GCTG 3HGNA 5C1UA 1O31A 1E36B 2WV5A 1GHAF 5AFZH 1S84A 4ABHA 3SJIA 1CU1A 1YWUA 3MMGA 1T8LA 3VB3A 1BBRE 1DY8A 1V2NT 2WUCA 4X8SH 1ESBA 5A8ZA 3K65B 2CXVA 1C5QA 2A5IA 3ATWA 3D49H 2ZHDA 1D9IA 1MKWK 1K28D 2BY6X 4CRGA 4K1TA 4UFGH 2QXGA 1K21H 4Y0YE 2TGDA 3A8BA 3MNBA 4U30A 5C67A 2GKVE 1HJAC 3LJJA 3RXQA 1W12U 4X6MA 1J16A 1P3CA 3MU8A 4U2WA 3URDA 2BY8X 2CV3A 1P8VC 1WQSA 1SBWA 1HJAB 1T4UH 4FU9A 1XXDA 1XUHA 5ESTE 4WXIA 4AB8A 4MDSA 2QF5A 2VIQA 4ABAA 2XW9A 1TPSA 1BDAA 3VG8A 1KY9A 2IPHA 2GV6A 1C2GA 2R3UA 2XC4A 1FY3A 2ZKSA 3IWMA 1GJ7B 2F4LA 1JBUH 2ZFQH 1FY4A 2C8WB 1CGJE 2FLBH 4HGCA 4K5ZA 3SYJA 1DDJA 3PWCA 4I8HA 3VGCC 5EODA 1O2UA 1MTNB 2FS8A 5DO4H 4E7RG 2PHBA 3TNTA 3SUEA 1EZXC 3RC6A 2VU8E 2VJ1A 1O3NA 1G9IE 1MUEB 1QURH 4YT6H 3ATLA 4ZUHA 3U8OH 2WSSD 3VGCB 1SGTA 1AWFH 3GCHB 1GCTC 1QRZA 4X6PA 2A7JA 3SI4H 1BJUA 1O5AB 2VWOA 1A1RA 3TK6A 2A0QB 4JYUH 4Y71A 1O3AA 2XBXA 2AYWA 2ZI2H 3E16B 3SJKA 3PV2A 1NU7B 1O3DA 2FOCA 4I8LA 3TH3H 1FZZA 1HYLA 5FBEA 5C94A 1BTHH 1UJ1A 3QDZB 3A80A 1V2MT 5A2MH 3RXAA 3NCLA 3P8FA 2CMYA 4FVBA 4LXBH 3KEEA 4AG2A 1EAIA 4GUXA 2VIWA 4NCYA 3RMLH 1QBOA 3BG4C 1ZMLA 1MBQA 1SGNE 1SHHB 1TBQH 5C5NA 2EI7A 1DXPA 3V13A 4AFUA 3FOAA 3P92A 1W7GH 3Q00A 1ESTA 1IQKA 2JH5D 3TJOA 5C1YA 3A7XA 1C9TA 1C1OA 1NC6A 4ZAEA 5A09A 4F55A 1GL0E 4XFQA 5EOKA 1UTNA 2GDEH 2G5VA 2KAIB 1C2IA 2HPPH 1QJ1B 1EUFA 3MYWA 1HJ9A 3KF2A 1C2FA 1C2JA 2W3IA 2J4IA 1SGFG 3MO3A 4Y11E 2EI8A 1AIXH 1SGIB 3UAIC 1ELAA 1KDQB 2R0KA 2A5AA 4CRBA 2FI5E 3M5NA 1IHSH 1CQQA 2W6JD 3UQOA 1EOLA 3EA7A 1LQEA 1DFPA 3F9GA 2JJ1D 5A0AE 3RM0H 1DANH 1AVGH 1GMDF 3N7DA 4ZKSU 2ZHQH 3MTYA 2VWMA 4K69A 4AYYB 2G8TA 3BSQA 1Y3UA 4IBLH 2PGBB 1V2ST 1UCYK 1C2MA 1ESAA 1ZYOA 1YY3A 2Z9JA 5E2PA 1G2LA 3GDSA 1OHHD 1L4ZA 3FKSD 5EPNA 1G32B 2QF3A 4KGAA 4M9FA 1OYTH 1ORFA 5HM9A 3OAAD 1PQ8A 2ZWLH 1NFYA 4F48B 1AKSB 1TGTA 1FDPA 2B0FA 1C5PA 1O30A 2BB4A 4Y7BA 4CBNA 1WDIA 3F1SB 2CF8H 1Z8RA 3UTUH 1C1PA 3UQVA 1GI3A 1SQRA 1GI0A 2BM2A 4FU7A 1UCYE 1FXYA 1TE0A 4BNRA 2G00A 1FV9A 2BZAA 2J92A 2ZDNA 2H1UA 2C8YB 2WYGA 4NFEA 5JPMH 4DY7B 1DY9A 1HJ8A 4IMQA 1SQAA 5L30H 1NPMA 4AFZA 4K60A 1SLVB 2Y5HA 3F9EA 2G5NA 3SBKA 3KN2A 4YLQH 3MO9A 3KHVA 1GPZA 2VVUA 1IQHA 1J17T 1DS2E 2UUFB 3M36A 1P06A 3M61U 3UWIA 2C8ZB 1DSUA 2HNTC 3M7UA 4A6LA 1TNKA 1GVZA 1HAZB 1XXFA 2W7UA 1K1OA 1RTLA 2Z7FE 3PLKA 2HNTE 1W3CA 3T25A 2FI3E 2VVVA 2ZDAH 3PROA 3SU2A 4NGAH 2Z3DA 4CRFA 1G2MA 1EXFA 2I6SA 1OYQA 4NWLA 4Q63A 1GG6B 2XOKD 4Q2KA 5DP7A 3NXPA 1LKBA 2V7QD 3M7QA 4FVDA 1C5WB 1RTFB
chains in the Genus database with same CATH topology
3O8BA 2ZZUH 3HGPA 1SGDE 1QQ4A 2J2UA 2PUQH 1GHXH 1YKTA 4AG1A 1CGHA 3DFLA 3ZZ7A 1LCYA 2VINA 1GBTA 5GPIB 2ZDMA 3TGJE 1P2JA 2GTBA 3PWBA 3KQEA 3SNBA 4FUBA 4JK6A 3TGKE 1TBRH 4GCHF 3SNCA 2QAAA 2BD3A 1BMMH 1NRSH 1AU8A 1HAVA 5B6OA 3LOXA 4UE7H 1ZHMA 4ASHA 2Y5GA 4XBDA 2OQUA 1RGQA 1PPEE 1BTPA 1TMTH 2YNBA 1BZXE 3U8TH 4FU8A 3QO6A 4ZKNU 1HLTH 2Q1JA 5C20A 3LH3A 1N6XA 4LZ1H 5DP9A 1AMHA 3M3VA 3PMJA 1ZLRA 5C5OA 4TY7A 1AZ8A 2WV4A 1HIAA 4DIIH 1MAXA 2ZU3A 3A87A 2ANKH 3F9FA 3IITA 3SNEA 3SO3A 1ZJKA 1KSNA 1O3EA 4D8NA 1O32A 1QNJA 1OPHB 3TH4H 1A7SA 4AB9A 1NZQH 5IYTA 1OWDA 1QB6A 1O5BB 1V2PT 1GI9B 3KL6A 1H8IH 1O0DH 4BAOB 2O8UA 2TIOA 2ZHWH 2ZFTA 4HZHA 4OS7A 1GBKA 1ABJH 5ESBA 5JB9S 3E3TA 3SJOA 3FAOA 1C1TA 4KELA 2BQ6B 1YPHE 3PTBA 2O8TA 3ZZ8A 3UNSA 3SUGA 2TRMA 2SFAA 4CHAC 2UUJB 3ZVEA 4AGKA 3GY5A 1QBVH 3KQBA 4ZH8A 2VH0A 3LU9B 1TNLA 2EA3A 4YZUA 1UTOA 1EJAA 1A61H 2NU0E 4H6TA 1VITH 2BX3A 3TGIE 2AMQA 5DKMA 4UONA 3L33A 3LDXH 1SG8B 8GCHG 3OY5U 3RC4A 1DVAH 1O3PB 1GDUA 2J38A 5DGJA 1O3MA 2H6MA 1ZGVA 1AD8H 2VH6A 1TGNA 1CT4E 2QA9E 4CRCA 1C5YB 2PUXB 1N8OC 1RIWC 2FODA 4K1SA 4FUEA 4TPYA 3ZZ6A 5GWZA 2XYAA 2ZG0H 4FUHA 1D3DB 2UUYA 1Y8TA 3OX7U 3MU4A 3M7TA 4YLUA 2P95A 2F9VA 4MLFB 5H4IB 2ZDKA 3HK6B 2QIQA 1AUTC 1CT0E 4O9VA 2PKSC 4NA7A 4B2CA 3NK8A 4ISIH 3RXIA 3PMAB 1T32A 3GYMA 1RD3B 2ASUB 4E7NA 1PPCE 1CHOF 4YTAA 1SMFE 2HGTH 1ZOMA 2FOMB 1C1WH 2IN2A 3PO1C 6GCHG 1V2RT 5EG4A 4Z0KA 5T3HA 1HB0B 1INCA 3M37A 1O2LA 5JDUB 1GJ6A 2XBYA 2YOLA 2J34A 2ZQ1A 3K9XB 3RXGA 2F3CE 1E34B 3ZVGA 2BDYA 2V3OH 4GCHG 3N7OA 3U1IB 1HAXB 4AN7A 1NFWA 1ACBE 2G55A 3EE0B 2GT7A 3MWIU 1QQUA 4A1XA 1MU8B 1ZHRA 1B5GH 4ZMAH 1A5GH 4OS6A 1K1NA 1QJ7B 2HNTF 1MKXK 4IN1A 3VB7A 1EPTB 3B23B 4VGCB 1UVPA 2OXSA 1F0RA 2FPZA 3MOCA 4TWYA 4ABGA 1TONA 5DP5A 1TNJA 3GY3A 2XWBI 1N1LA 1EKBB 1FY1A 1L4DA 3QUMP 2ZO3H 1ZPCA 3FFGA 3RUOA 2ZP0H 3GDVA 4BAQB 1Z6EA 5EQQA 5EXLA 1JIRA 1FIWA 4DVAU 1O34A 2LNCA 4J2YB 3SJ8A 2C8XB 1GJ8B 4BTUB 2XC5A 3U69H 1ZSKA 2BX4A 1ARBA 2RCEA 2TBSA 2RA0A 1P2MA 4AX9H 3TJNA 1K1LA 1AQ7A 1KLTA 1P12E 4NSVA 3EA8A 4QT8C 3VFEA 2P8OC 1WYKA 1C5VA 3OYPA 1T31A 4GHQA 3Q76A 2AS9A 3NKKA 1NT1A 2VIPA 1H1BA 4UFDH 1P05A 1DLEA 4NFFA 1HRTH 1LHDH 1WUNH 3VXEH 2BQWB 2P3TB 3LT3A 2ZPRA 2HRVA 3RXFA 1JIMA 2Y6TA 1CBWC 1O2RA 3LONA 5DP4A 3S69A 4DOQA 1ANCA 1A4WH 3PLPA 4YOGA 4KTSA 2OINA 3PLBA 4ISHH 5E0HA 1CBWB 2ANYA 5HXFA 1BMNH 5ABWA 3K6YA 5EU8A 1BITA 4ISLA 1HAOH 3M5OA 1MBMA 4MPVA 3RDZA 2Z3CA 5E8EH 3ZZCA 4AGJA 4SGBE 1GI4A 1UTQA 2C90B 5DP6A 5EPYA 5T6FA 1JRTA 1PPHE 2ZTYA 1UVTH 1O36A 1EQ9A 1EP6A 3EQ0H 1C1NA 2ULLA 5TJXA 1HDTH 1Q31A 1DWBH 3I78A 3PM3A 3FP6E 1EB1H 3ZV9A 1AUJA 3R3GB 4ZHMU 1YM0A 1NS3A 5LH8A 2TGTA 1SC8U 3LIWA 1YCPM 2THFB 1BRUP 4K1EA 2GCTB 5DP3A 2ODPA 5FHTA 3FANA 2AERH 1L2EA 1CO7E 3SGAE 3EA9A 5FCKA 3ZZAA 1AFQC 3B9FH 1Y59T 1TPAE 5JYIA 1P9UA 2OD3B 8KME2 7ESTE 1W8BH 2ZC9H 1SOZA 4OGXA 3SU5A 3AVZA 2OC7A 1AFQB 2Y5FA 3D65E 1DXWA 4I31A 1ELVA 1O33A 4MVNA 1EASA 3BF6H 3DD2H 3S9AA 1A3EH 3SV2H 3RXSA 1ZPZA 2FX4A 1CHOG 4JZ1A 3L6PA 1AVWA 1O2KA 1T8MA 3SW2B 2OLGA 2QCYA 4TPIZ 1GBEA 5EQRA 1O2QA 1TQ0B 1SQTA 4Y7AA 1Y3VA 1FN8A 4FUGA 3E1XB 3CP7A 4AFQA 3OTJE 3MHWU 4UFFH 1C1VH 1J9CH 4X8VH 2NWNA 2ZPSA 3ODFA 1LHFH 1TRMA 1TX6A 1O38A 1MTNC 2FDAA 1HAYB 4GAWA 1ZGIA 4CR9A 1MU6B 4IGDA 2O9QA 1P09A 3GCHC 2WYJA 1O2VA 2P94A 3LGWA 3VPKA 1F7ZA 3UPEA 2OBOA 1KXCA 1NFXA 1LPZB 1SSXA 2JKHA 3JZ2B 2RDLA 4B2BA 4JYTA 1L1JA 1DITH 2PW8H 2BHGA 1GBDA 3LKWA 1D6RA 1BRAA 2XBWA 5C1XA 1HUTH 2FZZA 4MNXA 2W26A 1C5TA 1CHGA 1LVOA 2PKAB 4GSOA 1ELCA 2HWLB 1C5MD 3RLWH 1WBGB 1J8AA 1NRRH 1SI5H 2ZU5A 1GBMA 2W5EA 4Z6AH 2ZCKP 1QRXA 1HXFH 1UCYH 1EZQA 1YYY1 1DM4B 3CENA 1EP5A 1P9SA 1ZJDA 1KIGH 2NU2E 1GJ5H 2CGAA 1BUIA 1Z8IB 2HLCA 3FZDA 3SUDA 1N6YA 3BV9B 3NZIA 4CR5A 2BVSH 4IW4E 1Y3YA 3S7KB 4NA8A 4SGAE 3VB4A 4WJG2 1VCQA 1RS0A 5E0JA 2WPIS 1TMBH 4AOQA 1BT7A 1EJMA 3S7HB 1O3HA 5LPEA 2WUBA 4NA9H 1FMGA 1O3CA 1SGQE 2BY5X 3OSYA 1ZRBA 2ZQ2A 3P6ZB 1AE5A 1DSTA 5GDSH 1FPCH 1ZMNA 4DT7B 4U01A 4X6OA 2BVRH 1YPEH 1QTFA 1ZTLA 3ZZ3A 1DPOA 4JYVH 3TK5A 3MNCA 3TVJB 1HAPH 2DE8A 1QFKH 1NRQH 3F6UH 1H8DH 4BAMB 3RXDA 2FM2A 1UTJA 5FPYA 1K9OE 1HAHH 2FYQA 1GHBF 4NZQA 1VZQH 1LHEH 3UUZA 1B0FA 1DUEA 1GVLA 1G3BA 3DA9B 3UOPA 4CREA 4BTTB 3LGUA 2BXUH 1QL8A 1B7XB 1O37A 2TGAA 1UK2A 1SGEE 2G4TA 1FAKH 3F9HA 1S6FA 1GHVH 1GBFA 3A82A 3U9AH 3GISB 4Y8YA 1GMHG 3TJUA 4KP0A 3TK9A 3HKIB 2BVXH 1OP2A 4B2AA 1GMCF 1P10A 4RN6A 2Y82A 5JBCS 2GCHF 2B7DH 3STJA 3HATH 2SGEE 4Y0ZE 1XX9A 5DK1A 1HCGA 8GCHF 1QJ6B 3A89A 4M7GA 1WQVH 2ZF0H 4WMDA 4X2WA 2ZGCA 4I32A 4D9RA 2J94A 1LVBA 5FPTA 3A8DA 4E06H 1ZSJA 3S9CA 2GZ8A 3LH1A 5A0BA 1VGCB 2RG3A 3Q3XA 2LPRA 1O2ZA 1AY6H 3BTTE 4Y6DA 2BTCE 1P01A 4DCDA 1OWKA 2QXJA 1TQ7B 1ZZZA 2F83A 2VWNA 1G3DA 3S0NA 1HBTH 1YCPH 2JETB 1LDTT 1YPLH 3LGTA 3BG8A 1O3BA 1EAXA 1GG6C 1TBZH 1BB0B 3ELAH 1GBCA 1ELBA 1O5DH 1GJAB 3RXJA 2VIOA 3A8AA 2BDAA 2FYRA 1C5RA 2IJOB 5DP8A 1TRYA 1NM6A 1TOCB 2QYIA 1NO9H 1AB9B 2DE9A 5FAHA 1NRNH 1KLJH 2A31A 3OY6U 1ANEA 4THNH 1SGPE 1OP8A 6GCHF 4ZHLU 3V7TA 4I8KA 8LPRA 1JWTA 1WCZA 2F9BH 1DWEH 1A5IA 4OS1A 3ZYDA 1Y5UT 1OOKB 3EYDA 4F4OC 4OS4A 1H9IE 4TY6A 2PV9B 2XCNA 1S0QA 5DG6A 2UUKB 4NIWA 1GBHA 3A7ZA 1ELTA 1OSSA 3T27A 1WSSH 1JXPA 1LPKB 5LPFA 2ALVA 3LJOA 1LVMA 1IHTH 3ZVAA 3QLPH 1C5XB 1QR3E 3S9BA 2F9NA 1TYNA 4B71A 3T5FH 1BHXB 1T8OA 4UFEH 3UY9A 1A0LA 4MPWA 2SGFE 3IG6B 5TCAA 2AGIX 1W2KH 2ANWA 2NU3E 2WPHS 3A84A 2OC8A 1HFDA 2XC0A 1Y5AT 4A7IB 2BLVA 4GHTA 4UD9H 3BTEE 5C3NA 1SGFA 3LPRA 3ESTA 1L1GA 4ABFA 3TU7H 1YLDA 1V2JT 3QGNB 2AGEX 1SGYE 5HMAA 5F6MA 1NU9A 2D1JA 1UTLM 4ZXYH 2I6QA 1CA8B 3F68H 1IQMA 2XCFA 1HIAB 1DE7H 3JZ1B 1KLIH 3KQDA 3RXUA 4Y10E 1ARCA 1MH0A 1VITG 2F9PA 4ISOA 5IDKA 5A0CA 1ANDA 3I77A 1GGDC 2EEKA 1A5HA 2HOBA 2BOKA 4O3UA 2XXLA 2WPLS 2FOAA 3RMOH 2A4RA 3MH7A 1YPHC 4CRDA 1GHBG 3DUXH 1GGDB 1MCTA 1V2QT 4X8UH 2PSYA 3GY4A 1YLCA 4OS2A 1MAYA 1PPZA 1VCPA 4ABJA 1DUAA 3QK1A 2W3KA 4X1RU 1UVSH 3U1JB 2AMPA 3V3MA 4E05H 2GMTC 2ZFFH 3A81A 1SL3A 1GCDA 4KKDA 3SNAA 1UTMA 5AHGH 1O2OA 1F0UA 2GMTB 2Z6BD 3RC5A 1GMCG 2UWLA 4CH8B 2GCHG 1EB2A 3BTKE 3BTGE 2VWLA 1V2LT 2NU1E 3D62A 1MTVA 2GP9B 1FI8A 3HPTB 4YESB 1O2TA 1PPFE 1UMAH 4YO9A 3SI3H 1UHBB 2TGPZ 3OU0A 1NFUA 1O2WA 3RXVA 3O8CA 4BXSA 3RLYH 1K1PA 4HTCH 2Q6GA 1XVOA 4X1NU 3V0XA 1P2QA 3LC5A 2HALA 2H5DA 2CHAB 1DICA 5T6GA 2QN5T 2OTVA 4DJZB 5FPSA 1TFXA 3URCA 1W13U 1O2NA 4AFSA 3ZZBA 4IMZA 4J1YA 1P11E 3SZNA 1SPJA 1O2JA 1VR1H 1E0FD 1E37B 3TJVA 1P3EA 1XVMA 2STAE 1BTXA 1BMLA 3GY6A 1FJSA 1C1UH 3RP2A 3ATIA 5FX5A 2B8OH 1CA0B 4K2YA 3SUFA 1TPOA 3E8LA 3LGIA 4JCNA 2J9NA 1BRBE 1S5SA 2ZFRH 2G81E 3GCOA 1P04A 4IN2A 1O5FH 4O3TA 1TB6H 1YPKH 3QN7A 3UREA 3TH2H 1UTPA 1KXFA 1L1NA 1TNHA 5F8XA 3EDXB 3SU3A 4O97A 2ZDLA 4ABIA 4TYDA 3T2NA 2BLQA 1ZMJA 2QGRA 1EPTC 4VGCC 6LPRA 5F8ZA 1H9HE 4B1TA 2G4UA 2D2DA 1GBBA 1QL7A 2VIDA 1WOFA 3RXLA 1TOMH 1O35A 1XUKA 2GX4A 1S0RA 5I46H 1HAGE 1HAIH 2A2QH 1V2VT 1AWHB 1A2CH 1ZTJA 4FUJA 3RM2H 5EW1H 4Y8ZA 2A4GA 2BD8A 1JRSA 1BTZA 1ETTH 2F9UA 3ITIA 3QTVH 2UWOA 4RKJB 3QTOH 1TA6A 2A7CA 4NWKA 1C2KA 2B9LA 5EGMA 5JBBS 1ABIH 1C4U2 3SU6A 4R0IA 1PPBH 1GBJA 1ZSLA 2ZU1A 3MU5A 4D9QA 2QC2A 1THRH 3RXMA 1RXPA 2OQ5A 3MU0A 5L2ZH 1FAXA 2A32A 2ZGHA 4OS5A 3SORA 1BBRH 5L6NH 1T8NA 4XE4A 3CS7A 4GVUA 3MFJA 1NN6A 1GI5A 2VB0A 2Y7ZA 3QX5H 3M3TA 4OGYA 1V2UT 4I8JA 1GI2A 2BLWA 7KMEH 3VXFH 1FONA 1G3EA 3GICB 1LHCH 3BTWE 2SNVA 1A0HB 2GZ9A 1GI1A 2FTLE 7GCHG 2V35A 8ESTE 1OWIA 1FPHH 5GJ4B 2OUAA 1TX8A 4FUDA 1C4V2 2ZEBA 1W14U 3UR9A 1IQNA 2ZIQH 2PGQB 1YPJH 1KXEA 3G01A 5HGGA 1NESE 4INLA 3RXPA 2VNTA 2AFQB 1EJNA 1MKWH 2GD4B 2PFEA 6CHAB 2K1QA 5J4QA 3SV7A 5JB8S 2JH6D 2PTCE 2D8WA 3ZVDA 1C1SA 3RU4D 1GBIA 9ESTA 3SN8A 1CE5A 1GWAA 2PSXA 1GJ9B 3H7OA 3W94A 3H5CB 1O3KA 4ABBA 3SQEE 3M5MA 4BAKB 1C5NH 4JZFH 1P0SH 4XSKU 2GCTC 3GCNA 1PQ7A 1RRKA 4D7FA 4HFPB 1GMHF 4LOYH 2Z9LA 3B8JA 5BPEA 4DGJA 2BDBA 1AGJA 1O3LA 1WU1A 2FP7B 2GDDA 2FOBA 3A7WA 1FN6A 1V3XA 1TGBA 1SR5C 2W7SA 4X2VA 1TLDA 4YM9A 5AVDA 1BIOA 3BEFB 3P8NA