5GJ4B

Structure of ns2b-ns3 protease from zika virus caught after self-cleavage
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
153
structure length
153
Chain Sequence
TDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQLLAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease subunit NS2B
publication title Structure of the NS2B-NS3 protease from Zika virus after self-cleavage.
pubmed doi rcsb
source organism Zika virus (strain mr 766)
molecule tags Hydrolase
total genus 28
structure length 153
sequence length 153
chains with identical sequence D, F, H
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00949 Peptidase_S7 Peptidase S7, Flavivirus NS3 serine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5gj4B02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5gj4B01
4BAMB 3MO9A 6GCHG 1EP5A 3EDXB 3MU4A 1UTKA 1MZAA 2HLCA 3TGJE 1ELEE 2BDAA 2ZPRA 4B71A 1GCTC 3SU6A 4OGXA 3SNDA 2ZU1A 2A4RA 4BAKB 1TIOA 1O2GH 3S9AA 2BD9A 4OS5A 5DP3A 3H7TA 4RKJB 1EKBB 3ELAH 2VWNA 3M5OA 4ZKOU 1SB1H 2BDBA 3A8CA 1DY9A 1HCGA 3VB3A 1GJ4H 3SV2H 3KL6A 1DWCH 1S0RA 5T1VA 1EPTA 3TVJB 1TGSZ 3SO3A 5FBIA 3TIUA 1IHSH 2KAIB 1O31A 1PQ8A 1TONA 1ZHRA 3K6ZA 2I6SA 3NZIA 1BBRK 3RXUA 5DP5A 1F92A 4E05H 3SU5A 1G32B 2BY7X 4DJZB 6LPRA 3A7XA 1WYKA 2WPLS 2Z6BD 1QR3E 3TH2H 3Q3XA 1EZSC 1K2I1 1V2MT 5J4QA 1TQ7B 3LH1A 1Y5BT 1P12E 1S84A 3QZRA 3RXHA 1GCDA 2CMYA 4AB9A 1F5RA 1YCPM 4RSPA 3U1JB 3SYJA 3UFAA 3Q00A 3A85A 1BBRE 3QLPH 1O0DH 5GIBA 2G8TA 1BITA 4GVUA 3NK8A 2NU3E 5DJ7A 1MBMA 4R8TB 2UUFB 2UWLA 2WPIS 2P3UB 2XC5A 1C5VA 5FCKA 4A1VA 2BMGB 1UHBB 2Y80A 4TY7A 1CGIE 3SUEA 4KGAA 1O3BA 3ZVFA 1HJAC 1SBWA 1GJAB 2B5TB 5L6NH 1G2LA 1F2SE 1ZMNA 2AMPA 2PKAB 1GBCA 8LPRA 1UVPA 2F83A 4B75A 1QJ7B 1C1MA 1HAIH 2YOLA 1SOZA 4NA7A 1MKXH 4H42U 4UFGH 2Q6DA 2ASUB 1RGQA 3QUMP 1HLTH 4UFEH 3RXQA 4CRCA 3E8LA 1SHHB 2R2WU 3IWMA 4YOJA 5AFZH 2CJIA 4FUJA 3RC6A 1V2PT 1N6XA 4NA9H 3A7YA 3MO6A 4HFPB 1CBWC 1KXDA 4Y8XA 3SNBA 4DCDA 4A1XA 4B6FA 1IAUA 5CHAC 3RXDA 3T28A 3BG4B 4AX9H 2PGQB 1J14A 1E37B 3LGTA 2V35A 4GCHF 1MKWK 1NROH 1ELAA 2P95A 3FANA 4CR5A 2V3HH 2ZFTA 5LPFA 3ZZBA 4FUBA 3S9BA 4OS1A 3HK3B 3E1XB 4ZXXH 1AIXH 1N6YA 2H2ZA 1OWEA 2PKAA 1O5FH 3UREA 4DG4A 1M9UA 2EI6A 1DLKB 3K6YA 2GCTB 4INLA 1GPZA 2M5TA 3SN8A 1XUKA 5F8TA 4JZEH 3GY3A 2FM2A 4FVBA 5E0JA 1FZZA 5I46H 4XFQA 5HXFA 1C1OA 1HV7A 2VB0A 1ESTA 3RLWH 1SGFG 4I7YH 1FAKH 2ZKSA 3ZZ5A 1NESE 1VZQH 1S81A 1FIZA 1TB6H 2OC7A 2AMDA 1E0FD 1TMTH 3URCA 4X1SU 1J16A 4NIXA 3GOVB 1MD8A 3B23B 3SI3H 5C20A 4BANB 1O35A 1LPZB 1E34B 3EA8A 4TY6A 1LCYA 6ESTA 5A8XA 1THSH 3UOUA 1NPMA 1PPCE 2FPZA 2Z94A 3LGIA 4I8JA 2FI3E 2XCNA 3RM0H 3GCOA 5HM2A 1DY8A 2A7HA 1XUFA 3M36A 1V2LT 4K69A 1HXEH 1FJSA 1RIWC 4XBDA 3O8CA 4FUHA 1LTOA 2H9HA 3SGQE 3MH6A 2AMQA 1JIMA 1NN6A 3OX7U 1GG6C 3SGAE 5AF9H 2VIDA 9ESTA 4F49A 2A2XH 2VIVA 2G81E 5B6OA 4JYTA 1HJAB 1XXFA 3ZZCA 3T25A 3EGKH 2C3SA 4BAQB 1D9IA 1ORFA 2B0FA 3KQEA 4K2YA 1L4ZA 2GMTC 3GY6A 4X1RU 2PKSB 2B7DH 1LVYA 1GI5A 2FX6A 4D7FA 1GI8B 2ZCLP 2SGQE 2Q1JA 2Z3EA 4GSOA 3E0PB 1OWHA 4HI3A 3ZVBA 4NZLA 2BYAX 1AVGH 4Q7YA 4ZAEA 3S7HB 1ZGIA 1PYTC 1AQ7A 1CHOG 5IYTA 1BTWA 4NFEA 2BHGA 1UTNA 3FVFB 4Y10E 4GAWA 2WUBA 2XBWA 3LJOA 2GV7A 1C5MD 1CBWB 2ZO3H 1AI8H 2QXHA 1ZHMA 5JDUB 1DSTA 1SMFE 4ABEA 2AIQA 3AVZA 1L1GA 3P8FA 1FNIA 1GHAF 1FDPA 1PJPA 4AGKA 3LC3A 3MH4A 1WV7H 3BF6H 3RMMH 2RDLA 1PFXC 1TMUH 5GCHG 1SR5C 2P59A 1F7ZA 2ZFFH 2A31A 5T6DA 1IQIA 2BD8A 1AFQC 1TQ0B 3FFGA 1C2DA 1E36B 5B6LA 3SU0A 2ZNKH 1TA2A 5F6MA 1UTOA 4D9QA 1O2IA 1TE0A 1P09A 1EX3A 4NSVA 4ABAA 2Z9IA 1O2PA 2O8MA 4B74A 4TPIZ 3K65B 2ZECA 4XBCA 5GJ4B 5SGAE 1BTPA 1XUHA 5JBCS 2DUCA 5JBBS 4ZH8A 1AE5A 4TWYA 4CRDA 4FUIA 1SFIA 2W3KA 1WXRA 2XC4A 4OS2A 1AKSA 3A82A 3T5FH 3PMJA 1V2UT 1OWKA 3STIA 1O3EA 2VWMA 1C5YB 1P0SH 2J2UA 3MO3A 1O2KA 1O2OA 2Z9LA 5HGGA 4IW4E 2P3TB 4ABJA 2LNCA 1K1PA 1JBUH 3BTEE 1OYQA 2H5DA 1BTHH 3ZZAA 2D1JA 1SGYE 4OS6A 1C2MA 3UTUH 1O2JA 2F9NA 3S0NA 5BPEA 1W3CA 4MNXA 3A7WA 1QRZA 2XCFA 2VINA 3BEFB 4MDSA 1GHXH 2PTCE 1BMMH 2WV4A 1HAPH 3P8OA 1D3DB 4BOHA 3V12A 1C9TA 1SC8U 1HGTH 1UVSH 3GCTF 4ISHH 2F9PA 1DT2A 2FOFA 3MFJA 1T31A 1W12U 1HJ9A 1KY9A 2C4FH 3BN9A 2PUQH 3PM3A 3HATH 4CBNA 1P2QA 1MKWH 1Q2WA 4FUFA 1BTZA 4BTTB 1IQKA 2ZPQA 1ZMJA 1P04A 5DG6A 2ZU3A 4KTUA 2C8XB 1RD3B 2GD4B 1SLUB 2GMTB 3GYLB 4A6LA 1P2JA 1LVBA 5BRRE 1GMCG 4ABGA 2QXGA 1C2HA 4A92A 2AS9A 4U32A 4CBOA 1FUJA 1GBEA 1C1RA 1QL7A 1P9UA 1ZPBA 2BY8X 3E0NB 2OXSA 3KF2A 1O37A 1QJ1B 4NZQA 5AVDA 3ZZDA 2H9TH 1SOTA 1YPEH 5FPYA 3RP2A 1Y8TA 1TRNA 1O2TA 1C5ZB 1EASA 2P3FH 1UVOA 1VJAU 3BTWE 3W95A 1SQAA 1O2RA 3BTHE 3VFEA 1HAVA 1WSSH 3STJA 3UWIA 1IHTH 1T32A 1MTSA 2QY0B 1EPTC 3S7KB 1AFQB 1DVAH 1A4WH 1ETRH 3D62A 1C5XB 1SGCA 1DS2E 4DURA 1EB2A 1MTUA 1Z8JB 1ANEA 4O9VA 3SJIA 4GLYA 1MAXA 7GCHF 2YNBA 2D2DA 2O8WA 3UR9A 4YOGA 1RJXB 1QIXB 5TCAA 1O2UA 3RXLA 2RA3A 4CRBA 1Y5UT 2BY5X 1C5TA 3M61U 2G55A 3QDZB 1KTTB 3ZVEA 4O97A 1G3DA 2BM2A 2ZGHA 2IN2A 1TRMA 2ZDKA 1O3FA 3MU1A 1BB0B 4O03A 1LQDB 2BD2A 4Q80A 4AZ2B 1C2IA 1FI8A 2D8WA 1F0TA 2GCHF 1FN6A 1KXFA 4OGYA 5JBAS 2XXLA 3RXBA 2C90B 1HNEE 3H5CB 1GMHF 4ZKSU 3TNSA 2BY6X 2ZFSA 4K8YA 2BLQA 1ELFA 1GWAA 4AFZA 3KQDA 1GJBB 2BXTH 1C1SA 1FIWA 1TNIA 2WINI 1A5GH 1K28D 5EPNA 1TOCB 4YTAA 1BOQA 3I78A 1HAXB 5GDSH 1QB6A 1HPGA 4NIWA 5EXMA 8GCHF 3F6UH 2FTMA 1S83A 4FU8A 2BZAA 1A0LA 1AVXA 1O3KA 1NRPH 4OM9A 2F9BH 2R0LA 4I8KA 1CSOE 1ABIH 2CV3A 3MI4A 2O8UA 1Z8GA 2BD3A 1ID5H 4Q7ZA 5C1UA 4A7IB 1EZQA 4D7GA 3BIVH 5EOKA 5LPRA 1FY8E 1V2OT 4GCHG 3RXIA 5LH8A 1HBTH 3UR6A 3SUGA 3LJJA 2OC1A 2UUYA 1ZLRA 1P06A 3KQBA 3UWJH 4NIVA 1GBLA 1ETTH 1GI2A 1L4DA 3HKJB 4WF8A 2VGCC 3BEUA 4MNVA 1TNKA 2FX4A 2ZGJA 1QQ4A 4X6PA 1GJ6A 1RTFB 1HDTH 1W13U 3LKWA 3UUZA 2ZTXA 3N7OA 1KDQA 1ZPZA 3SV7A 5FBEA 2ZA5A 4JK5A 3BG8A 1E38B 2EC9H 1QRXA 1P05A 4K1TA 1NRRH 2HNTC 3P92A 1TABE 5A2MH 1ZHPA 1W14U 5FX5A 4JZDH 4AG2A 1C4U2 2C93B 3LH3A 2FP7B 1PPBH 1WAYB 1CGJE 2ZP0H 3P95A 3VXFH 1GJ5H 1ANBA 3TK6A 2BQ6B 1MMJN 3SQHE 7ESTE 1HAHH 1MQ5A 2WV5A 2RCEA 5E8EH 3DFLA 5EPYA 2PSXA 1ACBE 1K1LA 2GCTC 2WPKS 3F9GA 1UK2A 3MYWA 5F03A 3K2UA 1DM4B 2VH0A 1GHYH 1IQJA 1HAGE 1N8OB 2WV9A 3M3SA 5DKMA 1BRCE 5I25A 1QA7A 3RXTA 1V2RT 2ODQA 1DANH 1XM1A 4ISOA 1C5UA 1WOFA 3ZZ4A 4B1TA 2SGFE 1QTFA 3HPTB 1TGNA 1V6DA 1P9SA 1VR1H 4Q7XA 4UEHH 3TLOA 2ZDAH 3VB4A 1QNJA 3M7TA 2A7JA 1O2HA 3RDZA 1QGFA 3ZYDA 1O2WA 1KLIH 4AFUA 3QTOH 2OINA 1EXFA 2VVUA 2PLXA 2SGAA 3SV8A 1W7GH 3RXEA 4I31A 4MQAA 4AFSA 1SLXB 1AD8H 1ELTA 1QRWA 1C2FA 1XVMA 3RXSA 5EG4A 1BTXA 1FY5A 2ZDMA 4NA8A 1GMDG 1GL0E 1NFWA 4INKA 2OQUA 1NRQH 4UFDH 1DWEH 3RMOH 3RXRA 3A80A 1P3CA 1ZOMA 1K1JA 1BRBE 3A7VA 2FYQA 3MOCA 1K9OE 3EQ0H 1Y3XA 1H1BA 3SNEA 1CA8B 2QAAA 4ZMAH 2R0KA 1O3PB 1Z6EA 1O5BB 1KIGH 2ODYB 2J4IA 1AZ8A 4CREA 1TAWA 2ZQ2A 2VGCB 2PKSC 2WPJS 1YC0A 5FCRA 2FLRH 1NRSH 4IMQA 4B2AA 2XRCA 4JZFH 5G4BA 1O3GA 1K1IA 4YO9A 1SGPE 2A0QB 3A89A 3GCNA 1YPKH 1VCQA 1JOUB 1DX5M 2QXIA 1CT0E 1O2NA 2Y5GA 2FEQH 1O30A 3O8BA 4I8GA 4XSKU 1AGJA 1OP2A 1DOJA 4X1NU 2ULLA 2ANWA 3BTQE 1OPHB 1SFQB 4TWWA 3RXCA 1C1VH 4DIHH 1D3TB 1YLDA 3MNBA 1Q3XA 2WPHS 3TPIZ 2AERH 4ISNA 1NFUA 1KXBA 1A2CH 1A3BH 3A81A 3MWIU 1SG8B 1HB0B 5EXLA 3UQVA 2FO9A 2J92A 2QCYA 5DGJA 2RG3A 1G30B 1C1PA 1BHXF 2A45B 1A0JA 3ZYEA 2A4QA 3KN2A 3PROA 1TGBA 3ZVGA 4X6MA 1SQOA 1FY4A 1Y59T 2ZCKP 1Z8RA 2VVCA 2HVXA 1O3JA 4X2XA 5A09A 2Y81A 2Z9KA 3GCTG 4X8TH 2A1DB 4UFFH 2BVRH 4KTCA 3OY5U 2WUCA 1BT7A 3DFJA 5EGMA 5IDKA 1T7CA 5A8YA 1W7XH 2OUAA 1IQEA 1Y3YA 5L2ZH 5E2OA 3RLYH 5EW2H 1B5GH 1AUJA 4X0WU 1AU8A 1BMNH 1O33A 1LHEH 2QV1A 4WXVA 2QA9E 1PQ7A 2FS9A 3PMAB 1XUJA 2CF9H 1FY1A 4SGAE 1KYNA 1DWBH 1JRSA 1YGCH 1OYTH 3QX5H 2NU2E 5FPTA 2WYGA 3BTME 1DXWA 1O3NA 4MPUA 3Q77A 4AFQA 5C1YA 1IQNA 3A87A 1D6RA 1O2QA 6GCHF 1WTHD 4MVNA 3U8RH 1BZXE 2TGTA 1ABJH 2JH0D 1C1WH 3EA7A 3UNSA 1UCYK 1Z1IA 1UO6A 2BX3A 4X2WA 3U69H 1V2WT 1PPGE 3ZVAA 3GY4A 2JKHA 3LT3A 1P2MA 5E0HA 3TGIE 2B9LA 5DP9A 3QK1A 2HPQH 2ZFRH 3SU2A 2ZWLH 7GCHG 4HTCH 4BXSA 3U1IB 2CXVA 4ZKRU 3KCGH 2GZ7A 2B8OH 1MD7A 1P57B 2PHBA 1TPPA 3ZZ6A 1ELDE 4NSYA 2EEKA 1NO9H 5ETXA 2BTCE 1QBVH 3AASA 1UCYE 1C2KA 4UONA 4WH8A 1AKSB 3NWUA 1Y3UA 1O34A 4KP0A 2VWOA 1QB9A 1BBRH 2QN5T 1L1JA 2ANMH 1C5QA 2ZU2A 2TGAA 3CENA 2GCHG 1SPJA 3LPRA 2GT7A 2GTBA 3D23A 3PTBA 1YKTA 2GX4A 1E35B 4D9RA 2VBCA 2ANKH 2UWOA 2BQWB 1OKXA 3RXAA 4ZHLU 1T4VH 2H9EH 1A61H 3PO1C 4K60A 4WVPE 4FUGA 3FAOA 2FWWA 4Y8YA 2P94A 1DDJA 1TBZH 3UIRA 1S6FA 3Q3YA 1J8AA 1QBOA 4NWLA 5FHTA 1W0YH 4WJG2 4ZROA 1ARCA 1SGEE 2FOEA 1YCPK 4Y8ZA 4KTSA 2PSYA 3PYHA 3BV9B 3PWBA 1LMWB 3TJUA 2EI8A 4O3TA 1ANCA 8GCHG 1ZMLA 1FLEE 3PLBA 1D3QB 1GBMA 2BDIA 1GI1A 1CE5A 5JB9S 1Y3VA 1XMNB 2GDEH 1FAXA 1QURH 3ATWA 2QYIA 4UE7H 1C5WB 3RXJA 2ZDLA 2QF0A 1TA6A 1B0FA 3CP7A 2CHAC 1VJ9U 1P10A 4IBLH 1B0EA 4K3JA 1UMAH 3P70B 3HK6B 1YPMH 2BX4A 1V2QT 4K1EA 3DD2H 1OXGA 1GHVH 3E6PH 4WMDA 5EQRA 1AVWA 3LOXA 4FVDA 3C27B 1BMLA 1L0ZA 3O8RA 3V0XA 1C1UH 2BLOA 3KNXA 4DVAU 1TYNA 5A0BA 1U6QA 1C2LA 1GJ8B 2H5CA 2VNTA 4X2VA 3PLKA 2SNWA 4ABIA 5C5OA 1QFKH 2ODPA 3R3GB 3SHCH 1C5PA 3KQCA 2TRMA 2G5VA 4IN1A 2ALVA 4NWKA 4LZ1H 1VITH 1J17T 1HAVB 2FYRA 1DFPA 2A5IA 2J94A 4IS5A 4YESB 3ZZ7A 1A5HA 3QGNB 1UTMA 4AOQA 1RTKA 3OYPA 1F0UA 1BQYA 3SJ8A 1EQ9A 3MH5A 1G3EA 1H9IE 4IGDA 2BD7A 3P8GA 1HFDA 1KXCA 2P93A 4J1YA 2OK5A 3SNCA 2NU1E 3L33A 4ZHAA 3ESTA 2A4GA 1FPCH 1UTPA 5ESTE 2BOKA 2Y5FA 2BDHA 1GDQA 1BIOA 2YNAA 4X6NA 4X6OA 2DE9A 1YPLH 4CR9A 2AGGX 1O3DA 2F9UA 1BHXB 4Y76A 2XYAA 3L3TA 2CN0H 1SSXA 2BXUH 2OD3B 2PUXB 3SJ9A 1T8LA 3LC5A 1EAUA 3F9EA 2R9PA 2PWXA 3PMBB 3TJVA 1EZUC 2THFB 2BVSH 1NZQH 3SV9A 2SGEE 2BDYA 1O39A 1AHTH 3UPEA 4H6SB 4GHQA 3PO1B 1ESAA 2V6NA 3QGJA 3TU7H 2ZHEH 4BAOB 1GHZA 3VGCB 1GJ7B 3MNCA 1AB9C 3RMNH 3P6ZB 1S6HA 3RM2H 2BVXH 2ANYA 3AAVA 2R3YA 1CVWH 1EAIA 1T8OA 1GBKA 3CS0A 1D4PB 1HJ8A 2FESH 1MTWA 2AIPA 3SUDA 2HGTH 2VIPA 2ZDNA 1P3EA 3C1KA 1F5KU 1FY3A 3WY8A 1ELVA 1GI3A 8ESTE 1VITF 4E7RG 1C1NA 4I8HA 2ZC9H 2GV6A 1UJ1A 2GDDA 2ZCHP 4M9FA 1LHFH 2FOBA 1C2GA 1RTLA 1LHDH 1G36A 2CHAB 3M5NA 2QC2A 1CHOF 2V0BA 3ATKA 2XNIA 4I33A 2P16A 1IQMA 1AE8H 2SGPE 4THNH 3SGBE 1O5DH 2FOMB 2PTNA 4XE4A 2TIOA 3MNSA 5JYIA 2Z3DA 1N8OC 1BRAA 1PQAA 2ZGCA 2FODA 3SZNA 3NPSA 4FXGH 2BD5A 4JYUH 4A1TA 1QJ6B 1V2VT 1CT2E 1MKXK 4AB8A 1H9HE 4FU9A 4Q2KA 1PYTD 1BJVA 1DWDH 4DT7B 2JETC 1KSNA 2FOGA 3TNTA 3TJNA 4ISLA 5GCHF 2XWAA 1LPGB 1NU7B 5AHGH 2ZG0H 1C1TA 2A4OA 2EA3A 1AO5A 1TNJA 2A5KA 1KDQB 3LONA 4IC6A 3MMGA 3VXEH 1K22H 1V2KT 2Z9JA 1ETSH 1EOJA 1Y3WA 5GNDA 4Y0ZE 3T29A 1YPHE 1P2IA 1Z71A 2C8YB 3GCHC 3W94A 1HIAA 1BCUH 3R0FA 2BB4A 2FZZA 2O8TA 4BXWA 3JZ1B 3UNQA 2TGPZ 2BLWA 1YYY1 3Q3KA 5HM9A 5L2YH 1C5OH 1TWXB 4B2CA 2RA0A 5DP6A 3KEEA 2WPMS 3LGYA 1GI9B 1O3OA 4GHTA 1TMBH 1WU1A 1GBHA 1LPKB 2FI5E 5C67A 4D8NA 1O2LA 1YP9A 1GBDA 3V7TA 1EZXC 1LVOA 2ALPA 1O3LA 3GY2A 5TCCA 1JXPA 2ZTZA 2OC0A 4AG1A 1NRNH 2CGAA 1ZZZA 2BD4A 3RU4T 4JCNA 1O38A 1Z6JH 2AYWA 5J4SA 3DHKH 3A8AA 4FUEA 4CRGA 3E16B 1GI6A 5PTPA 2R2MB 1WQSA 1LDTT 3B8JA 1Y5AT 1AB9B 3H09A 1J15A 2NU4E 2V3OH 1A1RA 4ZXYH 4RI0A 1BUIA 3OU0A 4MTBA 4UD9H 2G51A 5EW1H 1OWDA 1GHBF 1GI4A 3FP8E 1W0ZU 2J9NA 3ODDA 5JB8S 1AFEH 3PV5A 2VJ1A 1QBNA 1TALA 3H7OA 2G52A 1QL8A 4YM9A 1G2MA 1P2KA 1AMHA 3CS7A 3LU9B 3PV2A 5JPMH 1LHCH 1SGNE 3L6PA 1Z1JA 1YPGH 5JBTA 1HAZB 1ZPCA 2GZ9A 2O8LA 1A46H 4IMZA 1ZJDA 2ZHFH 3IG6B 1ZJKA 3SUFA 4CH8B 2O9QA 2AGIX 1P11E 1OX1A 1C5LH 3ITIA 2A7CA 2Q6FA 1AWHB 2CF8H 2TBSA 3SNAA 4BAHB 3ATMA 3PMHB 1XXDA 5E0GA 2HRVA 2G00A 1G9IE 3G01A 4NFFA 2Z9GA 1S82A 1C2EA 1EB1H 2FDAA 2JETB 3GY7A 2SFAA 2W5EA 1C5RA 2FMJA 1GDUA 3MTYA 4WY3A 1SVPA 5F8XA 4U01A 5GWZA 2XBVA 3AW1A 1EAWA 1V2NT 4J2YB 3RXKA 1TNHA 1CGHA 5C3NA 4ABBA 4E7NA 2OBOA 3SU3A 3I77A 2J38A 2GZ8A 5CE1A 2WHXA 3GCHB 3QTVH 6CHAC 1LVMA 1LQEA 1HAOH 1XKBC 1O5EH 1LHGH 2IJD1 4Y11E 3U98H 3NCLA 1CA0C 1T8MA 3PB1E 3T62A 3RUOA 3ZZ9A 3V13A 1P8VC 4YT6H 2XTTB 1ESBA 3T2NA 2FOCA 1DE7H 3PV4A 2FS8A 1GHAG 3LDXH 4Y7AA 4MNYA 2UUJB 1S0QA 4AYYB 3D65E 4OS7A 3RXPA 3BEIB 5EXNA 3I29A 5FX6A 5EU8A 3SU1A 2FLBH 2UWPA 1LKAA 1YPJH 1SGDE 4BTIB 5L30H 1O3CA 1JRTA 1XUGA 1SGFA 3S69A 4MPWA 1OOKB 2SNVA 3UOPA 2C8ZB 2F3CE 2JH5D 4Y79A 7LPRA 4CRFA 2ZQ1A 4X1PU 1A3EH 1AY6H 1ZRKA 1P2OA 5LGOA 3SV6A 4DOQA 2KAIA 4K8BA 2Y7ZA 2OQ5A 1DUAA 1ZSKA 1YM0A 1CU1A 1V2TT 1GDNA 1DXPA 3GDUA 4CHAC 1ZTKA 3PWCA 5T6FA 2OP9A 3F9HA 2Y82A 2XBYA 3IITA 1GGDC 5FXLA 4XBBA 2G4UA 1BTUA 1NU9A 3BTTE 1TX6A 2ZI2H 5C5NA 1P01A 4VGCB 2R3UA 3HKIB 1GBFA 2W7SA 4NGAH 1K1MA 1MU6B 4UDWH 1SI5H 3A84A 5H4IB 1F0SA 4FUDA 4LZ4B 1Q31A 3U8OH 4ABHA 4X8VH 1O2SA 4B6EA 1NY22 1WUNH 1P02A 2Y5HA 1BDAA 4JZ1A 1FN8A 4AGJA 2NWNA 1UK3A 1SHYA 1BTYA 3SZEA 1KLJH 1UHBA 1GVLA 3E3TA 1S5SA 3SORA 2Q6GA 3T27A 1K1NA 1VCWA 4SGBE 1GCTB 2HALA 1UTJA 3TK9A 2BQ7B 2Z3CA 4ABFA 5C2ZA 8KME2 5A0CA 1NFXA 2ILNA 3PLPA 5T6GA 1ELBA 1GL1A 4ESTE 1O5CB 1ZR0A 1F0RA 1EOLA 1O5GH 3OTPA 5TJXA 1AZZA 3GYMA 5T3HA 3KGPA 3O8DA 2VWLA 2JH6D 3D49H 5ABWA 1AN1E 3A8BA 2AEIH 1EATA 1TNGA 2HNTE 3VEQB 1GBTA 3MHWU 4GPGA 4XOJA 2G5NA 2VIQA 1EP6A 3FZDA 3VB6A 1HUTH 1JMOH 2K1QA 1O2YA 2GVFA 2SGDE 1C5SA 3UQOA 1TRYA 2GKVE 6CHAB 3M7QA 2ZEBA 1SGTA 5C1XA 1CA0B 2ZFQH 1XUIA 1FV9A 1Z7KA 5DP4A 4R0IA 3ENSB 4ZHMU 2VIOA 2W26A 1BMAA 4WMFA 2F4LA 1BA8B 2ZU4A 2TPIZ 1MCTA 5A8ZA 3E90B 4NCYA 3JZ2B 3GICB 4H6TA 4MPVA 1VCPA 4MLFB 1S85A 1V3XA 3UNRA 1TX8A 1X7AC 3LGWA 3OSYA 3GDSA 1MH0A 3M5LA 4K1SA 3FZZA 1QB1A 1LKBA 1MU8B 1K1OA 2WZQA 1DSUA 1THPB 2GT8A 3MNXA 3ZVDA 1EAXA 4MG3A 1SLWB 3RMLH 3QZQA 4YLUA 4ZUHA 1SGRE 3K9XB 3SJKA 4CHAB 1MQ6A 2IJOB 1TBRH 3Q76A 1GGDB 1VITG 4ISIH 4NG9H 1GJDB 3VB7A 1THRH 1WBGB 1O3HA 5GXPA 3DA9B 4LK4A 3E91A 1NTPA 2FTLE 1G3CA 3GY5A 2AFQB 4H4FA 1PPZA 4IC5A 1UVTH 5K0HA 3A88A 2OTVA 2F91A 1GJ9B 1NT1A 1W2KH 3V3MA 1NS3A 1GMHG 1T4UH 1JWTA 3EE0B 1IQHA 1ZYOA 1FONA 1GMDF 2OCVB 3T26A 1TOMH 5CHAB 4BNRA 2XWBI 3VGCC 4Z6AH 1KTSB 4U2WA 1CHGA 1GBIA 1OSSA 1P2NA 3BIUH 3TGKE 1C5NH 1CT4E 2ZHDA 2J95A 4DW2U 2FIRH 5EQSA 1DLEA 3P17H 1H8IH 4CH2B 9LPRA 4X1QU 1QHRB 1IQGA 3SW2B 1GVZA 1GHWH 1DICA 1TPOA 4YOIA 3ODFA 3U8TH 4TYDA 3AK5A 1O2VA 2VU8E 3A7ZA 5FAHA 1EJNA 2OLGA 1TFXA 4BTUB 1UK4A 2ZGXH 3BTFE 4D76A 1YPHC 3GY8A 1RS0A 2FI4E 5AFYH 1KLTA 1XKAC 2ZZUH 4PROA 2DE8A 3EA9A 5EQQA 3RXGA 1H4WA 1CQQA 1NFYA 1UTLM 1SGIB 5HMAA 2VVVA 2XW9A 3M37A 3RC4A 2GP9B 1OWIA 1MAYA 3F9FA 1A7SA 1TGTA 4HZHA 1XVOA 4RN6A 1TPSA 3QO6A 1C9PA 2P8OC 2ESTE 4QT8C 3SHAH 4X2YA 1FXYA 3ZV9A 4AN7A 1A0HB 5EODA 1HAYB 1NC6A 1O36A 2QGRA 4WMEA 1RIWB 1K21H 3F1SB 3A7TA 4Y6DA 4F4OC 3M3VA 3NKKA 4TPYA 2W7UA 1ELGA 2H6MA 2AGEX 1FPHH 1GG6B 1YBWA 1YLCA 3HGNA 2NU0E 1EUFA 1G37A 4B73A 1GHBG 4ABDA 4AORA 1GBBA 5DP8A 4U30A 3ZZ8A 2ZHWH 1VGCC 4YT7H 3BSQA 3SJOA 2PGBB 2PFEA 3HGPA 4GUXA 2G4TA 4A5TS 4KELA 2Y6TA 5FPSA 2ZHQH 3ATLA 1BJUA 3QWCH 3TH4H 2BY9X 1TLDA 1MBQA 3MU8A 1EJAA 2OC8A 3OTJE 2XBXA 1INCA 1ZSJA 4IN2A 1HYLA 1PQ5A 1PPEE 1B7XB 1QQUA 1T8NA 2ZDVH 3EAJA 3NUMA 3ZVCA 1O2MA 1GVKB 1TPAE 2UUKB 2F9OA 4WH6A 1PPHE 1XX9A 2BLVA 2EI7A 2A2QH 4FUCA 1MCVA 1NM6A 2Z7FE 3DT0H 2ZPSA 3NXPA 1DITH 3LIWA 3PTNA 1BRUP 1EJMA 3KHVA 4RKOB 3VPKA 2H1UA 3RXVA 3SBKA 3KIDU 2TGDA 3EYDA 2WYJA 2ZFPH 1AWFH 3AAUA 2ZGBH 2A5AA 1Z8IB 2QF3A 4YLQH 4E06H 2W3IA 5ESBA 5E2PA 1J9CH 1ARBA 1O32A 2LPRA 2PW8H 1W8BH 1L1NA 1IQFA 1RRKA 3DUXH 4Y7BA 4AYVB 4DY7B 3RC5A 1ELCA 2Y7XA 1G3BA 2BDCA 3MH7A 4FU7A 1TNLA 1RFNA 4JMYA 4K5ZA 1O3IA 3VB5A 1OP8A 1HIAB 4NIYA 4O3UA 1UCYH 4LXBH 2XC0A 3A83A 4ZKNU 3RXMA 4Y71A 1UVUH 1MTNC 1C4Y2 3URDA 5HYOA 2F9VA 1SL3A 2ZF0H 1O2ZA 1F5LA 3M3TA 1V2ST 1C2JA 3BTDE 2GGVB 2IPHA 1WQVH 4Y0YE 3M35A 1D6WA 4X8UH 1O5AB 4WWYA 3S9CA 4MPXA 2ZIQH 3SOSA 2HNTF 3TH3H 2ZU5A 5DK1A 2QXJA 3RXOA 3F68H 3MU0A 5LPEA 1OWJA 3BTKE 4DGJA 1V2JT 2P8OB 4I8LA 2PV9B 3TK5A 3ZZ3A 1GBAA 1N1LA 1RXPA 5CMXH 7KMEH 4WXIA 3M5MA 3MU5A 1P03A 1CO7E 3TJOA 2HPPH 4LOYH 3ATIA 2HWLB 2J34A 4JYVH 4KKDA 4B2BA 2STBE 1O3MA 3A8DA 1ZTJA 1QA0A 1HRTH 2VH6A 3SI4H 1D3PB 3A86A 3RXFA 1ZTLA 2C8WB 5DP7A 1VGCB 3SQEE 1YCPH 2STAE 3OY6U 4XDEA 2A32A 1ZGVA 1W10U 2BZ6H 5DO4H 3GDVA 1JIRA 2ZTYA 3U9AH 2IOTA 1FQ3A 4HGCA 5F8ZA 3ZV8A 4MNWA 3LGUA 2BOHB 4B76A 1L2EA 1TX7A 4OS4A 1GI0A 4JZIA 1A5IA 1OS8A 1LO6A 4X8SH 2QIQA 1SQTA 1SGQE 2I6QA 3SU4A 2HOBA 1GBJA 5A0AE 1KXEA 3GISB 1UTQA 1MZDA 1O2XA 4DIIH 3FP6E 2FOAA 1ZSLA 1QL9A 1GJCB 3M7UA 1H9LB 1KXAA 3FP7E 3AW0A 2AH4X 4CRAA 3P8NA 2OBQA 1HXFH 1W11U 2D26C 1DUEA 1IQLA 1FMGA 3RU4E 4YZUA 5K7RA 3UY9A 3TITA 4VGCC 1QCPA 2PR3A 1EPTB 1AUTC 1OP0A 1SLVB 1MTVA 2FXRA 5GPIB 1WCZA 4INHA 2VIWA 2BDGA 3BTGE 1GMCF 1C1QA 1WTGH 1YF4A 1H8DH 4Z0KA 1C4V2 1ANDA 1O3AA 1TBQH 4I32A 1IOEA 1ZRBA 4M7GA 1PPFE 5DPAA 2FOHA 1MUEB 3B9FH 3QN7A 1TGCA 4ASHA 3BG4C 1DPOA 1MTNB 1QY6A 1GI7B 3RU4D 3LGVA 4JK6A
chains in the Genus database with same CATH superfamily
4BAMB 3MO9A 6GCHG 1EP5A 3EDXB 3MU4A 1UTKA 3FKSD 1MZAA 2HLCA 3TGJE 1ELEE 2BDAA 2ZPRA 4B71A 1GCTC 3SU6A 4OGXA 3SNDA 2ZU1A 2A4RA 4BAKB 1TIOA 1O2GH 3S9AA 2BD9A 4OS5A 5DP3A 3H7TA 4RKJB 1EKBB 3ELAH 2VWNA 3M5OA 4ZKOU 1SB1H 2BDBA 3A8CA 1DY9A 1HCGA 3VB3A 1GJ4H 3SV2H 3KL6A 1DWCH 1S0RA 5T1VA 1EPTA 3TVJB 1TGSZ 2KCOA 3SO3A 5FBIA 3TIUA 1IHSH 2KAIB 1O31A 1PQ8A 1TONA 1ZHRA 3K6ZA 2I6SA 3NZIA 1BBRK 3RXUA 5DP5A 1F92A 4E05H 3SU5A 1G32B 2BY7X 4DJZB 6LPRA 3A7XA 1WYKA 2WPLS 2XOKD 3FN8A 2Z6BD 1QR3E 3TH2H 3Q3XA 1EZSC 1K2I1 1V2MT 5J4QA 1TQ7B 3LH1A 5C17A 1Y5BT 1P12E 1S84A 3QZRA 3RXHA 1GCDA 2CMYA 4AB9A 1F5RA 1YCPM 4RSPA 3SYJA 3U1JB 3UFAA 3Q00A 3A85A 1BBRE 3QLPH 1O0DH 5GIBA 2G8TA 1BITA 4GVUA 3NK8A 2NU3E 5DJ7A 1MBMA 4R8TB 2UUFB 2UWLA 2WPIS 2P3UB 2XC5A 1C5VA 5FCKA 4A1VA 2BMGB 1UHBB 2Y80A 4TY7A 1CGIE 3SUEA 4KGAA 1O3BA 3ZVFA 1HJAC 1SBWA 1GJAB 2B5TB 5L6NH 1G2LA 1F2SE 1ZMNA 2AMPA 2PKAB 1GBCA 8LPRA 1UVPA 2F83A 4B75A 1QJ7B 1C1MA 1HAIH 2YOLA 1SOZA 4NA7A 1MKXH 4H42U 4UFGH 3N7EA 2Q6DA 2ASUB 1RGQA 3QUMP 1HLTH 4UFEH 3RXQA 4CRCA 3E8LA 1SHHB 2R2WU 3IWMA 4YOJA 5AFZH 2CJIA 4FUJA 3RC6A 1V2PT 2JDID 1YWUA 1N6XA 4NA9H 3A7YA 3MO6A 4HFPB 1CBWC 1KXDA 4Y8XA 3SNBA 4DCDA 4A1XA 4B6FA 1IAUA 5CHAC 3RXDA 3T28A 3BG4B 4AX9H 2PGQB 1J14A 1E37B 3LGTA 2V35A 4GCHF 1MKWK 1NROH 1ELAA 2P95A 3FANA 4CR5A 4I86A 2V3HH 2ZFTA 5LPFA 3ZZBA 4FUBA 3S9BA 4OS1A 3HK3B 1E1QD 3E1XB 2QF5A 4ZXXH 1AIXH 1N6YA 2H2ZA 1OWEA 2PKAA 1O5FH 3UREA 4DG4A 1M9UA 2EI6A 1DLKB 3K6YA 2GCTB 4INLA 1GPZA 2M5TA 3SN8A 1XUKA 5F8TA 4JZEH 3GY3A 2FM2A 4FVBA 5E0JA 1FZZA 5I46H 4XFQA 5HXFA 1C1OA 1HV7A 2VB0A 1ESTA 3RLWH 1SGFG 4I7YH 1FAKH 2ZKSA 3ZZ5A 1NESE 1VZQH 1S81A 1FIZA 1TB6H 2OC7A 2AMDA 1E0FD 1TMTH 3URCA 4X1SU 1J16A 3GS9A 4NIXA 3GOVB 1MD8A 3B23B 3SI3H 5C20A 4BANB 1O35A 1LPZB 1E34B 1QZ8A 3EA8A 4TY6A 1LCYA 6ESTA 5A8XA 1THSH 3UOUA 1NPMA 1PPCE 2FPZA 2Z94A 3LGIA 4I8JA 2FI3E 2XCNA 3RM0H 1YY3A 3GCOA 5HM2A 1DY8A 2A7HA 1XUFA 3M36A 1V2LT 4K69A 1HXEH 1FJSA 1RIWC 4XBDA 3VG8A 3O8CA 4FUHA 1LTOA 2H9HA 3SGQE 3MH6A 2AMQA 1JIMA 1NN6A 3OX7U 1GG6C 3SGAE 5AF9H 2VIDA 9ESTA 4F49A 2A2XH 2VIVA 2G81E 5B6OA 4JYTA 1HJAB 1XXFA 3F2GA 3ZZCA 3T25A 3EGKH 3EE7A 2C3SA 4BAQB 1D9IA 1ORFA 2B0FA 3KQEA 4K2YA 1L4ZA 2GMTC 3GY6A 4X1RU 2PKSB 2B7DH 1LVYA 1GI5A 3CNRA 2FX6A 4D7FA 1GI8B 2ZCLP 2SGQE 2Q1JA 2Z3EA 4GSOA 3E0PB 1OWHA 4HI3A 3ZVBA 4NZLA 2BYAX 1AVGH 4Q7YA 4ZAEA 3S7HB 1ZGIA 1PYTC 1AQ7A 1CHOG 5IYTA 1BTWA 4NFEA 2BHGA 1UTNA 3FVFB 4Y10E 4GAWA 2WUBA 2XBWA 3LJOA 2GV7A 1C5MD 1CBWB 2ZO3H 1AI8H 2QXHA 1ZHMA 5JDUB 1DSTA 1SMFE 4ABEA 2AIQA 3AVZA 2KCPA 1L1GA 3P8FA 1FNIA 1GHAF 1FDPA 1PJPA 4AGKA 3LC3A 3MH4A 1WV7H 3BF6H 3RMMH 2RDLA 1E1RD 1PFXC 1TMUH 5GCHG 1SR5C 2P59A 1F7ZA 2ZFFH 2A31A 5T6DA 2W6ID 5EJ1A 1IQIA 2BD8A 1AFQC 3UAIC 1TQ0B 3FFGA 1C2DA 1E36B 5B6LA 3SU0A 2ZNKH 1TA2A 5F6MA 1UTOA 4D9QA 1O2IA 1TE0A 1P09A 1EX3A 4NSVA 4ABAA 2Z9IA 1O2PA 2O8MA 4B74A 4TPIZ 3K65B 2ZECA 4XBCA 5GJ4B 5SGAE 1BTPA 1XUHA 5JBCS 2DUCA 5JBBS 4ZH8A 1AE5A 4TWYA 4CRDA 4FUIA 1SFIA 2W3KA 2JJ1D 1WXRA 2XC4A 4OS2A 1AKSA 3A82A 3T5FH 3PMJA 1V2UT 1OWKA 3STIA 1O3EA 2VWMA 1C5YB 1P0SH 2J2UA 3MO3A 1O2KA 1O2OA 2Z9LA 5HGGA 4IW4E 1UW7A 2P3TB 4ABJA 2LNCA 1K1PA 1JBUH 3BTEE 1OYQA 2H5DA 1BTHH 3ZZAA 2D1JA 1SGYE 2LELA 4OS6A 1C2MA 3UTUH 1O2JA 2F9NA 3DSGA 3S0NA 5BPEA 1W3CA 4MNXA 3A7WA 1QRZA 2XCFA 2VINA 3BEFB 4MDSA 1GHXH 2PTCE 1BMMH 2WV4A 1HAPH 3P8OA 1D3DB 4BOHA 3V12A 1C9TA 1SC8U 1HGTH 1UVSH 3GCTF 4ISHH 2F9PA 1DT2A 2FOFA 3MFJA 1T31A 1W12U 1HJ9A 1KY9A 2C4FH 3BN9A 2PUQH 3PM3A 3HATH 4CBNA 1P2QA 1MKWH 1Q2WA 4FUFA 1BTZA 4BTTB 1IQKA 2ZPQA 1ZMJA 1P04A 5DG6A 2ZU3A 4KTUA 2C8XB 1RD3B 2GD4B 1SLUB 2GMTB 3GYLB 4A6LA 1P2JA 1LVBA 5BRRE 1GMCG 4ABGA 2QXGA 1C2HA 4A92A 2AS9A 2WPDD 4U32A 4CBOA 1FUJA 1GBEA 1C1RA 1QL7A 1P9UA 1ZPBA 2BY8X 3E0NB 2OXSA 3KF2A 1O37A 1QJ1B 4NZQA 5AVDA 3MQKC 3ZZDA 2H9TH 1SOTA 1YPEH 5FPYA 3RP2A 1Y8TA 1TRNA 1O2TA 5HKKD 1C5ZB 1EASA 2P3FH 1UVOA 4TSFD 1VJAU 3KQ5A 3BTWE 3W95A 1SQAA 1O2RA 3BTHE 3VFEA 1HAVA 1WSSH 3STJA 3UWIA 1IHTH 1T32A 1MTSA 2QY0B 1EPTC 3S7KB 1AFQB 1DVAH 1A4WH 1ETRH 3D62A 1C5XB 1SGCA 1DS2E 4DURA 1EB2A 1MTUA 1Z8JB 2EY4C 1ANEA 4O9VA 3SJIA 4GLYA 1MAXA 7GCHF 2YNBA 2KCYA 2D2DA 2O8WA 3UR9A 4YOGA 1RJXB 1QIXB 4DT4A 5TCAA 1O2UA 3RXLA 2RA3A 4CRBA 1Y5UT 2BY5X 1C5TA 3M61U 2G55A 3QDZB 1KTTB 3ZVEA 4O97A 1G3DA 2BM2A 2ZGHA 2IN2A 1TRMA 2ZDKA 1O3FA 3MU1A 1BB0B 4O03A 1LQDB 2BD2A 4Q80A 4AZ2B 1C2IA 1FI8A 2D8WA 2AHME 1F0TA 2GCHF 1FN6A 1KXFA 4OGYA 5JBAS 2XXLA 3RXBA 2C90B 1HNEE 3H5CB 1GMHF 4ZKSU 3TNSA 2BY6X 2ZFSA 4K8YA 2BLQA 1ELFA 1GWAA 4AFZA 3KQDA 1GJBB 2BXTH 1C1SA 1FIWA 1TNIA 2WINI 5KECA 1A5GH 1K28D 2XNDD 5EPNA 1TOCB 4YTAA 1BOQA 3I78A 1HAXB 5GDSH 1WDIA 1QB6A 1HPGA 3NRLA 4NIWA 5EXMA 8GCHF 3F6UH 2FTMA 1S83A 4FU8A 2BZAA 1A0LA 1AVXA 1O3KA 1NRPH 4OM9A 2F9BH 2R0LA 4I8KA 1CSOE 1ABIH 2EQNA 2CV3A 2KX4A 3MI4A 2O8UA 4AC9A 1Z8GA 2QE7D 2BD3A 1ID5H 4Q7ZA 5C1UA 4A7IB 1EZQA 4D7GA 3BIVH 5EOKA 5LPRA 1FY8E 1V2OT 4GCHG 3RXIA 5LH8A 1HBTH 3UR6A 3SUGA 3LJJA 2OC1A 2UUYA 2K8IA 1ZLRA 1P06A 3KQBA 3UWJH 4NIVA 1GBLA 1ETTH 1GI2A 1L4DA 3HKJB 4WF8A 2VGCC 3BEUA 4MNVA 1TNKA 2FX4A 2ZGJA 1QQ4A 4X6PA 1OHHD 1GJ6A 1RTFB 1HDTH 1W13U 3LKWA 3UUZA 2ZTXA 3N7OA 1KDQA 1ZPZA 3SV7A 5FBEA 2ZA5A 4JK5A 3BG8A 1E38B 2J98A 2EC9H 1QRXA 1P05A 4K1TA 1NRRH 2HNTC 3P92A 1TABE 5A2MH 1ZHPA 1W14U 5FX5A 4JZDH 4AG2A 1C4U2 2C93B 3LH3A 1EFRD 2FP7B 1PPBH 1WAYB 1CGJE 2ZP0H 3P95A 3KYGA 3VXFH 1GJ5H 1ANBA 3TK6A 2BQ6B 1MMJN 3SQHE 7ESTE 1HAHH 1MQ5A 2WV5A 2RCEA 5E8EH 3DFLA 5EPYA 2PSXA 1ACBE 1K1LA 2GCTC 2WPKS 3F9GA 2L74A 1UK2A 3MYWA 5F03A 3K2UA 1DM4B 2VH0A 1GHYH 1IQJA 1HAGE 1N8OB 2WV9A 3M3SA 5DKMA 1BRCE 5I25A 1QA7A 3RXTA 1V2RT 3ZIAD 2ODQA 1DANH 1XM1A 4ISOA 1C5UA 1WOFA 5F53A 3ZZ4A 4B1TA 2SGFE 1QTFA 3HPTB 1TGNA 1V6DA 1P9SA 1VR1H 4Q7XA 4UEHH 3F0OA 3TLOA 2ZDAH 3VB4A 1QNJA 3M7TA 2A7JA 1O2HA 3RDZA 1QGFA 3ZYDA 1O2WA 4ACBA 1KLIH 2V3MA 4AFUA 3QTOH 2OINA 1EXFA 2VVUA 2PLXA 2SGAA 3SV8A 1W7GH 3RXEA 4I31A 4MQAA 4AFSA 1SLXB 1AD8H 1ELTA 1QRWA 1C2FA 1XVMA 3RXSA 2YMSD 5EG4A 1BTXA 1FY5A 2ZDMA 4NA8A 1GMDG 1GL0E 1NFWA 4INKA 2OQUA 1NRQH 2W6JD 1DWEH 4UFDH 3RMOH 3RXRA 3W1EA 3A80A 1P3CA 1ZOMA 3DSOA 1K1JA 5EJLA 1BRBE 3A7VA 2FYQA 3MOCA 1K9OE 3EQ0H 1Y3XA 1H1BA 3SNEA 1CA8B 2QAAA 4ZMAH 2R0KA 1O3PB 1Z6EA 1O5BB 1KIGH 2LP6A 2J4IA 2ODYB 1AZ8A 4CREA 1TAWA 2ZQ2A 2VGCB 2PKSC 2WPJS 1YC0A 5FCRA 2FLRH 1NRSH 4IMQA 4B2AA 2XRCA 4JZFH 5G4BA 1O3GA 1K1IA 4YO9A 1SGPE 2A0QB 3A89A 3GCNA 1YPKH 1VCQA 1JOUB 1DX5M 2QXIA 1CT0E 1O2NA 2Y5GA 2KZ4A 2FEQH 1O30A 3O8BA 4I8GA 4XSKU 1AGJA 3OFND 1OP2A 3N7DA 1DOJA 4X1NU 2ULLA 2ANWA 3BTQE 1OPHB 1SFQB 4TWWA 3RXCA 1C1VH 4DIHH 1D3TB 1YLDA 3MNBA 1Q3XA 2WPHS 3TPIZ 2AERH 4ISNA 1NFUA 2HLDD 1KXBA 1A2CH 1A3BH 4F55A 3A81A 3MWIU 1SG8B 1HB0B 1FX0B 5EXLA 3UQVA 2FO9A 3DCLA 2J92A 2QCYA 5DGJA 2RG3A 1G30B 3PRDA 1C1PA 1BHXF 2A45B 1A0JA 3ZYEA 2A4QA 3KN2A 3PROA 1TGBA 3ZVGA 4X6MA 1SQOA 1FY4A 1Y59T 2ZCKP 1Z8RA 2VVCA 2HVXA 1O3JA 1MABB 4X2XA 5A09A 2Y81A 2Z9KA 3GCTG 4X8TH 2A1DB 4UFFH 2BVRH 4KTCA 1W0KD 2CK3D 3OY5U 2WUCA 1BT7A 3DFJA 5EGMA 2L6OA 5IDKA 1T7CA 5A8YA 1W7XH 2OUAA 1IQEA 1Y3YA 5L2ZH 5E2OA 3RLYH 5EW2H 1B5GH 1AUJA 4X0WU 1AU8A 1BMNH 1O33A 1LHEH 1BMFD 2QV1A 4WXVA 2QA9E 1PQ7A 2FS9A 3PMAB 1XUJA 2CF9H 1FY1A 3F2FA 4SGAE 1KYNA 3F3BA 1DWBH 1JRSA 1YGCH 1OYTH 3QX5H 3FO8D 2NU2E 3F2HA 5FPTA 2WYGA 3BTME 1DXWA 1O3NA 4MPUA 3Q77A 4AFQA 5C1YA 1IQNA 3A87A 1D6RA 1O2QA 6GCHF 1WTHD 4MVNA 3U8RH 1BZXE 2HVYB 2TGTA 1ABJH 2JH0D 1C1WH 3EA7A 3UNSA 1UCYK 1Z1IA 1UO6A 2BX3A 4X2WA 3U69H 1V2WT 1PPGE 3ZVAA 3OEHD 3GY4A 2JKHA 3LT3A 1P2MA 5E0HA 3TGIE 2B9LA 5DP9A 3QK1A 2HPQH 2ZFRH 3SU2A 2ZWLH 7GCHG 1SKYE 4TT3D 4HTCH 4BXSA 3U1IB 2CXVA 4ZKRU 3KCGH 2GZ7A 2B8OH 1MD7A 1P57B 2PHBA 1TPPA 2KR7A 3ZZ6A 1ELDE 4NSYA 2EEKA 1NO9H 5ETXA 2BTCE 1QBVH 3AASA 1UCYE 1C2KA 4UONA 4WH8A 1AKSB 3NWUA 1Y3UA 1O34A 4KP0A 2F43B 2VWOA 1QB9A 1BBRH 2QN5T 1YLNA 1L1JA 2ANMH 1C5QA 2ZU2A 2TGAA 4Q4LA 3CENA 2GCHG 1SPJA 3LPRA 2GT7A 2GTBA 3D23A 3PTBA 1YKTA 2GX4A 1E35B 4D9RA 2VBCA 2ANKH 2UWOA 2BQWB 1OKXA 3RXAA 4ZHLU 1T4VH 2H9EH 1A61H 3PO1C 4K60A 4WVPE 4FUGA 3FAOA 2FWWA 4Y8YA 1DDJA 1TBZH 2P94A 3UIRA 5EIYA 1S6FA 3Q3YA 1J8AA 1QBOA 4NWLA 5FHTA 1W0YH 4WJG2 4ZROA 1ARCA 1SGEE 2FOEA 2IPQX 1YCPK 4Y8ZA 4KTSA 2PSYA 5EJZA 3PYHA 3BV9B 3PWBA 1LMWB 3TJUA 2EI8A 4O3TA 1ANCA 8GCHG 1ZMLA 1FLEE 4RT1A 3PLBA 1D3QB 1GBMA 2BDIA 1GI1A 1CE5A 5JB9S 1Y3VA 1XMNB 2GDEH 1FAXA 4FETA 1QURH 3ATWA 2QYIA 4UE7H 1C5WB 3RXJA 2ZDLA 2QF0A 1TA6A 1B0FA 3CP7A 2CHAC 1VJ9U 1P10A 4IBLH 1B0EA 4K3JA 1UMAH 3P70B 3HK6B 1YPMH 2BX4A 1V2QT 4K1EA 3DD2H 1OXGA 1GHVH 3E6PH 4WMDA 5EQRA 1AVWA 3LOXA 4FVDA 3C27B 1BMLA 1L0ZA 3O8RA 3V0XA 1C1UH 2BLOA 3KNXA 4DVAU 1TYNA 5A0BA 1U6QA 1C2LA 1GJ8B 2H5CA 2VNTA 4X2VA 3PLKA 2SNWA 4ABIA 5C5OA 1QFKH 2J97A 2ODPA 3R3GB 3SHCH 1C5PA 3KQCA 4HG6A 2TRMA 2G5VA 4IN1A 2ALVA 4NWKA 4LZ1H 1VITH 1J17T 1HAVB 2FYRA 1DFPA 2A5IA 2J94A 4IS5A 4YESB 3ZZ7A 1A5HA 3QGNB 1UTMA 4AOQA 1RTKA 3OYPA 1F0UA 1BQYA 3SJ8A 1EQ9A 3MH5A 1G3EA 1H9IE 4IGDA 2BD7A 3P8GA 1HFDA 1KXCA 2KM0A 2P93A 4J1YA 2OK5A 2NU1E 3SNCA 3L33A 4ZHAA 3ESTA 2A4GA 1SQRA 1FPCH 1UTPA 5ESTE 2BOKA 2Y5FA 2BDHA 1GDQA 1BIOA 2YNAA 4X6NA 4X6OA 2KFWA 2DE9A 1YPLH 4CR9A 2AGGX 2GJGA 1O3DA 2F9UA 1BHXB 4Y76A 2XYAA 3L3TA 2CN0H 1SSXA 2BXUH 2OD3B 2PUXB 3SJ9A 1T8LA 3LC5A 1EAUA 3F9EA 2R9PA 2PWXA 3PMBB 3TJVA 1EZUC 2THFB 3OE7D 2BVSH 1NZQH 3SV9A 2SGEE 2BDYA 1O39A 1AHTH 3UPEA 4H6SB 4GHQA 3PO1B 1ESAA 2V6NA 3QGJA 3TU7H 2ZHEH 4BAOB 1GHZA 3VGCB 1GJ7B 3MNCA 1AB9C 3RMNH 3U28C 3PRBA 3P6ZB 1S6HA 3RM2H 2BVXH 2ANYA 3AAVA 2R3YA 1CVWH 1EAIA 1T8OA 1GBKA 5KGOA 3CS0A 1D4PB 1HJ8A 2FESH 2YMSC 1MTWA 2AIPA 3SUDA 2HGTH 2VIPA 2ZDNA 1P3EA 3C1KA 1F5KU 1FY3A 3WY8A 1ELVA 1GI3A 8ESTE 1VITF 4E7RG 5CDFE 1C1NA 4I8HA 2JJ2D 2ZC9H 4ASUD 2GV6A 1UJ1A 2GDDA 2ZCHP 4M9FA 1LHFH 2FOBA 1C2GA 1RTLA 1LHDH 1G36A 2CHAB 3M5NA 2QC2A 1CHOF 2V0BA 3ATKA 2XNIA 4I33A 2P16A 1IQMA 1AE8H 2SGPE 4THNH 3SGBE 1O5DH 2FOMB 2PTNA 4XE4A 2TIOA 3MNSA 3WWFA 5JYIA 2Z3DA 1N8OC 1BRAA 1PQAA 2ZGCA 2FODA 3SZNA 3NPSA 4FXGH 2BD5A 4JYUH 4A1TA 1QJ6B 1V2VT 1CT2E 1MKXK 4AB8A 1H9HE 4FU9A 4Q2KA 1PYTD 1BJVA 1DWDH 4DT7B 2JETC 1KSNA 2FOGA 3TNTA 3TJNA 4ISLA 5GCHF 2XWAA 1LPGB 1NU7B 5AHGH 2ZG0H 1C1TA 2A4OA 2EA3A 1AO5A 1TNJA 2A5KA 1KDQB 3LONA 4IC6A 3WW7A 3MMGA 3VXEH 1K22H 1V2KT 2Z9JA 1ETSH 1EOJA 1Y3WA 2J98B 5GNDA 2WSSD 4Y0ZE 1COWD 1YPHE 1P2IA 1Z71A 2C8YB 3GCHC 3T29A 3W94A 1HIAA 1BCUH 2PP6A 3R0FA 2BB4A 2FZZA 2O8TA 4BXWA 3JZ1B 3UNQA 2TGPZ 2BLWA 1YYY1 4RT0A 3Q3KA 5HM9A 5L2YH 1C5OH 1TWXB 4B2CA 2RA0A 5DP6A 3KEEA 2WPMS 3LGYA 1GI9B 1O3OA 4GHTA 1TMBH 1WU1A 1GBHA 1LPKB 2FI5E 2RFKC 5C67A 4D8NA 1O2LA 1YP9A 1GBDA 3V7TA 1EZXC 1LVOA 2ALPA 3F0PA 3N99A 1O3LA 3GY2A 5TCCA 1JXPA 2ZTZA 2OC0A 4AG1A 1NRNH 2CGAA 1ZZZA 2BD4A 3RU4T 4JCNA 1O38A 1Z6JH 2AYWA 5J4SA 1K0HA 3DHKH 3A8AA 4FUEA 4CRGA 5C0TA 3E16B 1GI6A 5PTPA 2R2MB 1WQSA 1LDTT 3B8JA 1Y5AT 1AB9B 3H09A 1J15A 2NU4E 2V3OH 1A1RA 4ZXYH 4RI0A 1BUIA 3OU0A 4MTBA 4UD9H 2G51A 5EW1H 1OWDA 1GHBF 1GI4A 3FP8E 1W0ZU 2J9NA 3ODDA 5JB8S 1AFEH 3PV5A 2VJ1A 1QBNA 1TALA 3H7OA 2YMSB 2G52A 1QL8A 4YM9A 1G2MA 1P2KA 1AMHA 3CS7A 3LU9B 3PV2A 5JPMH 1LHCH 1SGNE 5FL7D 3L6PA 1Z1JA 1YPGH 5JBTA 1HAZB 1ZPCA 2GZ9A 2O8LA 1A46H 4IMZA 1ZJDA 2ZHFH 3IG6B 1ZJKA 3SUFA 4CH8B 2O9QA 3KYFA 2AGIX 1P11E 1OX1A 1C5LH 3ITIA 1KMHB 2A7CA 2Q6FA 1AWHB 2CF8H 2TBSA 3SNAA 4BAHB 3ATMA 3PMHB 1XXDA 5E0GA 2HRVA 2G00A 1G9IE 3G01A 4NFFA 4Z1MD 2Z9GA 1S82A 1C2EA 1EB1H 2FDAA 2JETB 3GY7A 2SFAA 2W5EA 1C5RA 2FMJA 1GDUA 3MTYA 4WY3A 1SVPA 5F8XA 4U01A 5GWZA 2XBVA 3AW1A 1EAWA 1V2NT 4J2YB 3RXKA 1TNHA 1CGHA 5C3NA 4ABBA 4E7NA 2OBOA 3SU3A 3I77A 2J38A 2GZ8A 2WHXA 5CE1A 3GCHB 3QTVH 6CHAC 1LVMA 2M2AA 1LQEA 1HAOH 1XKBC 1O5EH 1LHGH 2IJD1 4Y11E 3U98H 3NCLA 1CA0C 1T8MA 3PB1E 3T62A 3RUOA 3ZZ9A 3V13A 1P8VC 4YT6H 2XTTB 1ESBA 3T2NA 2FOCA 1DE7H 3PV4A 2FS8A 1GHAG 3LDXH 4Y7AA 4MNYA 2UUJB 1S0QA 4AYYB 3D65E 4OS7A 3RXPA 3BEIB 5EXNA 3I29A 5FX6A 5EU8A 3SU1A 2FLBH 2UWPA 1LKAA 1YPJH 1SGDE 4ACAA 4BTIB 4ZCNA 5L30H 1O3CA 3OEED 1JRTA 1XUGA 1SGFA 3S69A 4MPWA 1OOKB 2SNVA 3UOPA 2C8ZB 2F3CE 2JH5D 4Y79A 7LPRA 4CRFA 2ZQ1A 4X1PU 1A3EH 1AY6H 1ZRKA 1P2OA 5LGOA 3SV6A 4DOQA 2KAIA 4K8BA 2Y7ZA 2OQ5A 1DUAA 1ZSKA 1YM0A 1CU1A 1V2TT 1GDNA 1DXPA 3GDUA 4CHAC 1ZTKA 3PWCA 5T6FA 2OP9A 3F9HA 2Y82A 2XBYA 3IITA 1GGDC 5FXLA 4XBBA 2G4UA 1BTUA 1NU9A 3BTTE 1TX6A 2ZI2H 5C5NA 1P01A 4VGCB 2R3UA 3HKIB 1GBFA 2W7SA 4NGAH 1K1MA 1MU6B 4UDWH 1SI5H 3A84A 5H4IB 1F0SA 4FUDA 4LZ4B 1Q31A 4F48B 3U8OH 4ABHA 4X8VH 1O2SA 4B6EA 1NY22 1WUNH 1P02A 2Y5HA 1BDAA 4JZ1A 1FN8A 4AGJA 2NWNA 1UK3A 1SHYA 1BTYA 3SZEA 1KLJH 1UHBA 1GVLA 3E3TA 1S5SA 3SORA 4YXWD 2Q6GA 3T27A 1K1NA 1VCWA 4SGBE 1GCTB 2HALA 1UTJA 3TK9A 2BQ7B 2Z3CA 4ABFA 5C2ZA 8KME2 5A0CA 1NFXA 2ILNA 3PLPA 5T6GA 5DSFA 1ELBA 1GL1A 4ESTE 1O5CB 1ZR0A 1F0RA 1EOLA 1O5GH 3OTPA 5TJXA 1AZZA 3GYMA 5T3HA 3KGPA 3O8DA 2VWLA 2JH6D 3D49H 5ABWA 1AN1E 3A8BA 4FOUC 2AEIH 1EATA 1TNGA 2HNTE 3VEQB 1GBTA 3MHWU 4GPGA 4XOJA 2G5NA 1NBME 2VIQA 1EP6A 3FZDA 3VB6A 5C0UA 1HUTH 1JMOH 2K1QA 1O2YA 2QF4A 2GVFA 2SGDE 1C5SA 3UQOA 1TRYA 2GKVE 6CHAB 3M7QA 2ZEBA 1SGTA 5C1XA 1CA0B 2ZFQH 1XUIA 1FV9A 1Z7KA 5DP4A 4R0IA 3ENSB 4ZHMU 2VIOA 2W26A 1BMAA 2F4LA 4WMFA 1BA8B 2ZU4A 4P00A 2TPIZ 1MCTA 5A8ZA 3E90B 4NCYA 3JZ2B 3GICB 4H6TA 4MPVA 1VCPA 4MLFB 1NBMD 1S85A 1V3XA 3UNRA 1TX8A 1X7AC 3LGWA 3OSYA 3GDSA 1MH0A 3M5LA 3DSPA 4K1SA 3FZZA 1QB1A 1LKBA 1MU8B 1K1OA 2WZQA 1DSUA 1THPB 2GT8A 3MNXA 3ZVDA 1EAXA 4MG3A 1SLWB 3RMLH 3QZQA 4YLUA 4ZUHA 1SGRE 3K9XB 3SJKA 4CHAB 1MQ6A 2IJOB 3WWBA 1TBRH 3Q76A 1GGDB 1VITG 4ISIH 4NG9H 1GJDB 3VB7A 1THRH 1WBGB 1O3HA 5GXPA 3DA9B 4LK4A 3E91A 1NTPA 2FTLE 1G3CA 3GY5A 2AFQB 4H4FA 1PPZA 4IC5A 1UVTH 5K0HA 3A88A 2OTVA 2F91A 1GJ9B 1NT1A 1W2KH 3V3MA 1NS3A 1GMHG 1T4UH 1JWTA 3EE0B 1IQHA 1ZYOA 1FONA 1GMDF 2OCVB 3T26A 1TOMH 5CHAB 4BNRA 2XWBI 3VGCC 4Z6AH 1KTSB 4U2WA 1CHGA 1GBIA 1OSSA 1P2NA 3BIUH 3TGKE 1C5NH 1CT4E 1W0JD 2ZHDA 2J95A 4DW2U 2FIRH 5EQSA 2KCAA 1DLEA 3P17H 1H8IH 4CH2B 9LPRA 4X1QU 1QHRB 3OAAD 1IQGA 3SW2B 1GVZA 1GHWH 1DICA 1TPOA 4YOIA 2RDEA 3ODFA 3U8TH 4TYDA 3AK5A 1O2VA 2VU8E 3A7ZA 5FAHA 1EJNA 2J5UA 2OLGA 1TFXA 4BTUB 1UK4A 2ZGXH 3BTFE 4D76A 1YPHC 3GY8A 1RS0A 2FI4E 5AFYH 1KLTA 1XKAC 2ZZUH 4PROA 2DE8A 3EA9A 5EQQA 3RXGA 1H4WA 1CQQA 1NFYA 1UTLM 1SGIB 5HMAA 2VVVA 2XW9A 1H8HD 3M37A 3RC4A 2GP9B 1OWIA 1MAYA 3F9FA 5C94A 1A7SA 1TGTA 4HZHA 1XVOA 4RN6A 1TPSA 3QO6A 1C9PA 2P8OC 2ESTE 4QT8C 3SHAH 4X2YA 1FXYA 3ZV9A 4AN7A 1A0HB 5EODA 1HAYB 1NC6A 1O36A 2QGRA 4WMEA 1RIWB 1K21H 3F1SB 3A7TA 4Y6DA 4F4OC 3M3VA 3NKKA 4TPYA 2W7UA 1ELGA 2H6MA 2AGEX 1FPHH 1GG6B 1YBWA 1YLCA 3HGNA 2NU0E 1EUFA 1G37A 5HIZA 5HIYA 4B73A 1GHBG 4ABDA 4AORA 1GBBA 5DP8A 4U30A 3ZZ8A 2ZHWH 1VGCC 4YT7H 3BSQA 3SJOA 2PGBB 2PFEA 3HGPA 4GUXA 2G4TA 4A5TS 4KELA 5DN6D 2Y6TA 5FPSA 2ZHQH 3ATLA 1BJUA 3QWCH 3TH4H 2BY9X 1TLDA 1MBQA 3MU8A 1EJAA 2OC8A 3OTJE 2XBXA 1INCA 1ZSJA 4IN2A 1HYLA 1PQ5A 1PPEE 1B7XB 1QQUA 1T8NA 2ZDVH 3EAJA 3NUMA 3ZVCA 1O2MA 1GVKB 1TPAE 2UUKB 2F9OA 4WH6A 1PPHE 1XX9A 2BLVA 2EI7A 2A2QH 4FUCA 1MCVA 1NM6A 2Z7FE 3DT0H 2ZPSA 3NXPA 1DITH 3LIWA 3PTNA 1BRUP 1EJMA 3KHVA 4RKOB 3VPKA 2H1UA 3RXVA 3SBKA 3KIDU 2TGDA 3EYDA 2WYJA 2ZFPH 1AWFH 3AAUA 2ZGBH 2A5AA 1Z8IB 2QF3A 4YLQH 4E06H 2W3IA 5ESBA 5E2PA 1J9CH 1ARBA 1O32A 2LPRA 2PW8H 1W8BH 1L1NA 1IQFA 1RRKA 3DUXH 4Y7BA 4XD7D 4AYVB 4DY7B 3RC5A 1ELCA 2Y7XA 1G3BA 2BDCA 3MH7A 5CHBA 2V7QD 4FU7A 5IK2D 1TNLA 1RFNA 1E79D 4JMYA 4K5ZA 1O3IA 3VB5A 1OP8A 1HIAB 4NIYA 4O3UA 1UCYH 4LXBH 2XC0A 3A83A 4ZKNU 3RXMA 4Y71A 1UVUH 1MTNC 1C4Y2 3URDA 5HYOA 2F9VA 1SL3A 2ZF0H 1O2ZA 1F5LA 3M3TA 4P02A 5KEDA 1V2ST 1C2JA 3BTDE 2GGVB 2IPHA 1WQVH 4Y0YE 3M35A 1D6WA 4X8UH 1O5AB 4WWYA 3S9CA 4MPXA 2ZIQH 3SOSA 2HNTF 4Q63A 3TH3H 2ZU5A 5DK1A 2QXJA 3RXOA 3F68H 3MU0A 5LPEA 1OWJA 3BTKE 4DGJA 1V2JT 2P8OB 4I8LA 1VKYA 2PV9B 3TK5A 3ZZ3A 2JIZD 1GBAA 1N1LA 1RXPA 5CMXH 7KMEH 4WXIA 3M5MA 3MU5A 1P03A 1CO7E 3TJOA 2HPPH 4LOYH 3ATIA 2HWLB 2J34A 4JYVH 4KKDA 4B2BA 2STBE 1O3MA 3A8DA 1ZTJA 1QA0A 1HRTH 2VH6A 3SI4H 1D3PB 3A86A 3RXFA 1ZTLA 2C8WB 5DP7A 1VGCB 3SQEE 1YCPH 2STAE 3OY6U 4XDEA 2A32A 1ZGVA 1W10U 2BZ6H 5DO4H 3GDVA 1JIRA 2ZTYA 3U9AH 2IOTA 1FQ3A 4HGCA 5F8ZA 3ZV8A 4MNWA 3LGUA 2BOHB 4B76A 1L2EA 1TX7A 4OS4A 1GI0A 4JZIA 3FOAA 1A5IA 1OS8A 1LO6A 4X8SH 2QIQA 1SQTA 1SGQE 2I6QA 3SU4A 2HOBA 1GBJA 5A0AE 1KXEA 3GISB 1UTQA 1MZDA 1O2XA 4DIIH 2K0QA 3FP6E 2FOAA 1ZSLA 1QL9A 1GJCB 1S6LA 3M7UA 1H9LB 1KXAA 3FP7E 3AW0A 2AH4X 4CRAA 3P8NA 2OBQA 1HXFH 1W11U 2D26C 1DUEA 1IQLA 1FMGA 3RU4E 4YZUA 5K7RA 3UY9A 3TITA 4VGCC 1QCPA 2PR3A 1EPTB 1AUTC 1OP0A 1SLVB 1MTVA 2FXRA 5GPIB 1WCZA 4INHA 2VIWA 2BDGA 4XRNA 3BTGE 1GMCF 1C1QA 1WTGH 1YF4A 1H8DH 4Z0KA 1C4V2 1ANDA 1O3AA 1TBQH 4I32A 1IOEA 1ZRBA 4M7GA 1PPFE 5DPAA 2FOHA 3UB0A 1MUEB 3B9FH 3QN7A 1TGCA 4ASHA 3BG4C 1H8ED 1DPOA 1MTNB 1QY6A 1GI7B 3RU4D 3LGVA 4JK6A
chains in the Genus database with same CATH topology
4BAMB 3MO9A 6GCHG 1EP5A 3EDXB 3MU4A 1UTKA 3FKSD 1MZAA 2HLCA 3TGJE 1ELEE 2BDAA 2ZPRA 4B71A 1GCTC 3SU6A 4OGXA 3SNDA 2ZU1A 2A4RA 4BAKB 1TIOA 1O2GH 3S9AA 2BD9A 4OS5A 5DP3A 3H7TA 4RKJB 1EKBB 3ELAH 2VWNA 3M5OA 4ZKOU 1SB1H 2BDBA 3A8CA 1DY9A 1HCGA 3VB3A 1GJ4H 3SV2H 3KL6A 1DWCH 1S0RA 5T1VA 1EPTA 3TVJB 1TGSZ 2KCOA 3SO3A 5FBIA 3TIUA 1IHSH 2KAIB 1O31A 1PQ8A 1TONA 1ZHRA 3K6ZA 2I6SA 3NZIA 1BBRK 3RXUA 5DP5A 1F92A 4E05H 3SU5A 1G32B 2BY7X 4DJZB 6LPRA 3A7XA 1WYKA 2WPLS 2XOKD 3FN8A 2Z6BD 1QR3E 3TH2H 3Q3XA 1EZSC 1K2I1 1V2MT 5J4QA 1TQ7B 3LH1A 5C17A 1Y5BT 1P12E 1S84A 3QZRA 3RXHA 1GCDA 2CMYA 4AB9A 1F5RA 1YCPM 4RSPA 3U1JB 3SYJA 3UFAA 3Q00A 3A85A 1BBRE 3QLPH 1O0DH 5GIBA 2G8TA 1BITA 4GVUA 3NK8A 2NU3E 5DJ7A 1MBMA 4R8TB 2UUFB 2UWLA 2WPIS 2P3UB 2XC5A 1C5VA 5FCKA 4A1VA 2BMGB 1UHBB 2Y80A 4TY7A 1CGIE 3SUEA 4KGAA 1O3BA 3ZVFA 1HJAC 1SBWA 1GJAB 2B5TB 5L6NH 1G2LA 1F2SE 1ZMNA 2AMPA 2PKAB 1GBCA 8LPRA 1UVPA 2F83A 4B75A 1QJ7B 1C1MA 1HAIH 2YOLA 1SOZA 4NA7A 1MKXH 4H42U 4UFGH 3N7EA 2Q6DA 2ASUB 1RGQA 3QUMP 1HLTH 4UFEH 3RXQA 4CRCA 3E8LA 1SHHB 2R2WU 3IWMA 4YOJA 5AFZH 2CJIA 4FUJA 3RC6A 1V2PT 2JDID 1N6XA 4NA9H 3A7YA 3MO6A 4HFPB 1CBWC 1KXDA 4Y8XA 3SNBA 4DCDA 4A1XA 4B6FA 1IAUA 5CHAC 3RXDA 3T28A 3BG4B 4AX9H 2PGQB 1J14A 1E37B 3LGTA 2V35A 4GCHF 1MKWK 1NROH 1ELAA 2P95A 3FANA 4CR5A 2V3HH 2ZFTA 5LPFA 3ZZBA 4FUBA 3S9BA 4OS1A 3HK3B 1E1QD 3E1XB 2QF5A 4ZXXH 1AIXH 1N6YA 2H2ZA 1OWEA 2PKAA 1O5FH 3UREA 4DG4A 1M9UA 2EI6A 1DLKB 3K6YA 2GCTB 4INLA 1GPZA 2M5TA 3SN8A 1XUKA 5F8TA 4JZEH 3GY3A 2FM2A 4FVBA 5E0JA 1FZZA 5I46H 4XFQA 5HXFA 1C1OA 1HV7A 2VB0A 1ESTA 3RLWH 1SGFG 4I7YH 1FAKH 2ZKSA 3ZZ5A 1NESE 1VZQH 1S81A 1FIZA 1TB6H 2OC7A 2AMDA 1E0FD 1TMTH 3URCA 4X1SU 1J16A 4NIXA 3GS9A 3GOVB 1MD8A 3B23B 3SI3H 5C20A 4BANB 1O35A 1LPZB 1E34B 3EA8A 4TY6A 1LCYA 6ESTA 5A8XA 1THSH 3UOUA 1NPMA 1PPCE 2FPZA 2Z94A 3LGIA 4I8JA 2FI3E 2XCNA 3RM0H 3GCOA 5HM2A 1DY8A 2A7HA 1XUFA 3M36A 1V2LT 4K69A 1HXEH 1FJSA 1RIWC 4XBDA 3VG8A 3O8CA 4FUHA 1LTOA 2H9HA 3SGQE 3MH6A 2AMQA 1JIMA 1NN6A 3OX7U 1GG6C 3SGAE 5AF9H 2VIDA 9ESTA 4F49A 2A2XH 2VIVA 2G81E 5B6OA 4JYTA 1HJAB 1XXFA 3F2GA 3ZZCA 3T25A 3EGKH 2C3SA 4BAQB 1D9IA 1ORFA 2B0FA 3KQEA 4K2YA 1L4ZA 2GMTC 3GY6A 4X1RU 2PKSB 2B7DH 1LVYA 1GI5A 2FX6A 4D7FA 1GI8B 2ZCLP 2SGQE 2Q1JA 2Z3EA 4GSOA 3E0PB 1OWHA 4HI3A 3ZVBA 4NZLA 2BYAX 1AVGH 4Q7YA 4ZAEA 3S7HB 1ZGIA 1PYTC 1AQ7A 1CHOG 5IYTA 1BTWA 4NFEA 2BHGA 1UTNA 3FVFB 4Y10E 4GAWA 2WUBA 2XBWA 3LJOA 2GV7A 1C5MD 1CBWB 2ZO3H 1AI8H 2QXHA 1ZHMA 5JDUB 1DSTA 1SMFE 4ABEA 2AIQA 3AVZA 2KCPA 1L1GA 3P8FA 1FNIA 1GHAF 1FDPA 1PJPA 4AGKA 3LC3A 3MH4A 1WV7H 3BF6H 3RMMH 2RDLA 1PFXC 1E1RD 1TMUH 5GCHG 1SR5C 2P59A 1F7ZA 2ZFFH 2A31A 5T6DA 2W6ID 1IQIA 2BD8A 1AFQC 1TQ0B 3FFGA 1C2DA 1E36B 5B6LA 3SU0A 2ZNKH 1TA2A 5F6MA 1UTOA 4D9QA 1O2IA 1TE0A 1P09A 1EX3A 4NSVA 4ABAA 2Z9IA 1O2PA 2O8MA 4B74A 4TPIZ 3K65B 2ZECA 4XBCA 5GJ4B 5SGAE 1BTPA 1XUHA 5JBCS 2DUCA 5JBBS 4ZH8A 1AE5A 4TWYA 4CRDA 4FUIA 1SFIA 2W3KA 2JJ1D 1WXRA 2XC4A 4OS2A 1AKSA 3A82A 3T5FH 3PMJA 1V2UT 1OWKA 3STIA 1O3EA 2VWMA 1C5YB 1P0SH 2J2UA 3MO3A 1O2KA 1O2OA 2Z9LA 5HGGA 4IW4E 2P3TB 4ABJA 2LNCA 1K1PA 1JBUH 3BTEE 1OYQA 2H5DA 1BTHH 3ZZAA 2D1JA 1SGYE 2LELA 4OS6A 1C2MA 3UTUH 1O2JA 2F9NA 3S0NA 5BPEA 1W3CA 4MNXA 3A7WA 1QRZA 2XCFA 2VINA 3BEFB 4MDSA 1GHXH 2PTCE 1BMMH 2WV4A 1HAPH 3P8OA 1D3DB 4BOHA 3V12A 1C9TA 1SC8U 1HGTH 1UVSH 3GCTF 4ISHH 2F9PA 1DT2A 2FOFA 3MFJA 1T31A 1W12U 1HJ9A 1KY9A 2C4FH 3BN9A 2PUQH 3PM3A 3HATH 4CBNA 1P2QA 1MKWH 1Q2WA 4FUFA 1BTZA 4BTTB 1IQKA 2ZPQA 1ZMJA 1P04A 5DG6A 2ZU3A 4KTUA 2C8XB 1RD3B 2GD4B 1SLUB 2GMTB 3GYLB 4A6LA 1P2JA 1LVBA 5BRRE 1GMCG 4ABGA 2QXGA 1C2HA 4A92A 2AS9A 2WPDD 4U32A 4CBOA 1FUJA 1GBEA 1C1RA 1QL7A 1P9UA 1ZPBA 2BY8X 3E0NB 2OXSA 3KF2A 1O37A 1QJ1B 4NZQA 5AVDA 3ZZDA 2H9TH 1SOTA 1YPEH 5FPYA 3RP2A 1Y8TA 1TRNA 1O2TA 5HKKD 1C5ZB 1EASA 2P3FH 1UVOA 4TSFD 1VJAU 3BTWE 3W95A 1SQAA 1O2RA 3BTHE 3VFEA 1HAVA 1WSSH 3STJA 3UWIA 1IHTH 1T32A 1MTSA 2QY0B 1EPTC 3S7KB 1AFQB 1DVAH 1A4WH 1ETRH 3D62A 1C5XB 1SGCA 1DS2E 4DURA 1EB2A 1MTUA 1Z8JB 1ANEA 4O9VA 3SJIA 4GLYA 1MAXA 7GCHF 2YNBA 2KCYA 2D2DA 2O8WA 3UR9A 4YOGA 1RJXB 1QIXB 4DT4A 5TCAA 1O2UA 3RXLA 2RA3A 4CRBA 1Y5UT 2BY5X 1C5TA 3M61U 2G55A 3QDZB 1KTTB 3ZVEA 4O97A 1G3DA 2BM2A 2ZGHA 2IN2A 1TRMA 2ZDKA 1O3FA 3MU1A 1BB0B 4O03A 1LQDB 2BD2A 4Q80A 4AZ2B 1C2IA 1FI8A 2D8WA 2AHME 1F0TA 2GCHF 1FN6A 1KXFA 4OGYA 5JBAS 2XXLA 3RXBA 2C90B 1HNEE 3H5CB 1GMHF 4ZKSU 3TNSA 2BY6X 2ZFSA 4K8YA 2BLQA 1ELFA 1GWAA 4AFZA 3KQDA 1GJBB 2BXTH 1C1SA 1FIWA 1TNIA 2WINI 1A5GH 1K28D 2XNDD 5EPNA 1TOCB 4YTAA 1BOQA 3I78A 1HAXB 5GDSH 1QB6A 1HPGA 3NRLA 4NIWA 5EXMA 8GCHF 3F6UH 2FTMA 1S83A 4FU8A 2BZAA 1A0LA 1AVXA 1O3KA 1NRPH 4OM9A 2F9BH 2R0LA 4I8KA 1CSOE 1ABIH 2CV3A 3MI4A 2O8UA 1Z8GA 2QE7D 2BD3A 1ID5H 4Q7ZA 5C1UA 4A7IB 1EZQA 4D7GA 3BIVH 5EOKA 5LPRA 1FY8E 1V2OT 4GCHG 3RXIA 5LH8A 1HBTH 3UR6A 3SUGA 3LJJA 2OC1A 2UUYA 2K8IA 1ZLRA 1P06A 3KQBA 3UWJH 4NIVA 1GBLA 1ETTH 1GI2A 1L4DA 3HKJB 4WF8A 2VGCC 3BEUA 4MNVA 1TNKA 2FX4A 2ZGJA 1QQ4A 4X6PA 1OHHD 1GJ6A 1RTFB 1HDTH 1W13U 3LKWA 3UUZA 2ZTXA 3N7OA 1KDQA 1ZPZA 3SV7A 5FBEA 2ZA5A 4JK5A 3BG8A 1E38B 2EC9H 1QRXA 1P05A 4K1TA 1NRRH 2HNTC 3P92A 1TABE 5A2MH 1ZHPA 1W14U 5FX5A 4JZDH 4AG2A 1C4U2 2C93B 3LH3A 1EFRD 2FP7B 1PPBH 1WAYB 1CGJE 2ZP0H 3P95A 3VXFH 1GJ5H 1ANBA 3TK6A 2BQ6B 1MMJN 3SQHE 7ESTE 1HAHH 1MQ5A 2WV5A 2RCEA 5E8EH 3DFLA 5EPYA 2PSXA 1ACBE 1K1LA 2GCTC 2WPKS 3F9GA 1UK2A 3MYWA 5F03A 3K2UA 1DM4B 2VH0A 1GHYH 1IQJA 1HAGE 1N8OB 2WV9A 3M3SA 5DKMA 1BRCE 5I25A 1QA7A 3RXTA 1V2RT 3ZIAD 2ODQA 1DANH 1XM1A 4ISOA 1C5UA 1WOFA 3ZZ4A 5F53A 4B1TA 2SGFE 1QTFA 3HPTB 1TGNA 1V6DA 1P9SA 1VR1H 4Q7XA 4UEHH 3F0OA 3TLOA 2ZDAH 3VB4A 1QNJA 3M7TA 2A7JA 1O2HA 3RDZA 1QGFA 3ZYDA 1O2WA 1KLIH 4AFUA 3QTOH 2OINA 1EXFA 2VVUA 2PLXA 2SGAA 3SV8A 1W7GH 3RXEA 4I31A 4MQAA 4AFSA 1SLXB 1AD8H 1ELTA 1QRWA 1C2FA 1XVMA 3RXSA 5EG4A 2YMSD 1BTXA 1FY5A 2ZDMA 4NA8A 1GMDG 1GL0E 1NFWA 4INKA 2OQUA 1NRQH 4UFDH 1DWEH 3RMOH 3RXRA 2W6JD 3W1EA 3A80A 1P3CA 1ZOMA 3DSOA 1K1JA 1BRBE 3A7VA 2FYQA 3MOCA 1K9OE 3EQ0H 1Y3XA 1H1BA 3SNEA 1CA8B 2QAAA 4ZMAH 2R0KA 1O3PB 1Z6EA 1O5BB 1KIGH 2ODYB 2J4IA 1AZ8A 4CREA 1TAWA 2ZQ2A 2VGCB 2PKSC 2WPJS 1YC0A 5FCRA 2FLRH 1NRSH 4IMQA 4B2AA 2XRCA 4JZFH 5G4BA 1O3GA 1K1IA 4YO9A 1SGPE 2A0QB 3A89A 3GCNA 1YPKH 1VCQA 1JOUB 1DX5M 2QXIA 1CT0E 1O2NA 2Y5GA 2KZ4A 2FEQH 1O30A 3O8BA 4I8GA 4XSKU 1AGJA 3OFND 1OP2A 3N7DA 1DOJA 4X1NU 2ULLA 2ANWA 3BTQE 1OPHB 1SFQB 4TWWA 3RXCA 1C1VH 4DIHH 1D3TB 1YLDA 3MNBA 1Q3XA 2WPHS 3TPIZ 2AERH 4ISNA 1NFUA 2HLDD 1KXBA 1A2CH 1A3BH 4F55A 3A81A 3MWIU 1SG8B 1HB0B 1FX0B 5EXLA 3UQVA 2FO9A 3DCLA 2J92A 2QCYA 5DGJA 2RG3A 1G30B 3PRDA 1C1PA 1BHXF 2A45B 1A0JA 3ZYEA 2A4QA 3KN2A 3PROA 1TGBA 3ZVGA 4X6MA 1SQOA 1FY4A 1Y59T 2ZCKP 1Z8RA 2VVCA 2HVXA 1O3JA 1MABB 4X2XA 5A09A 2Y81A 2Z9KA 3GCTG 4X8TH 2A1DB 4UFFH 2BVRH 4KTCA 1W0KD 2CK3D 3OY5U 2WUCA 1BT7A 3DFJA 5EGMA 2L6OA 5IDKA 1T7CA 5A8YA 1W7XH 2OUAA 1IQEA 1Y3YA 5L2ZH 5E2OA 3RLYH 5EW2H 1B5GH 1AUJA 4X0WU 1AU8A 1BMNH 1O33A 1LHEH 2QV1A 1BMFD 4WXVA 2QA9E 1PQ7A 2FS9A 3PMAB 1XUJA 2CF9H 1FY1A 4SGAE 3F2FA 1KYNA 3F3BA 1DWBH 1JRSA 1YGCH 1OYTH 3QX5H 3FO8D 2NU2E 3F2HA 5FPTA 2WYGA 3BTME 1DXWA 1O3NA 4MPUA 3Q77A 4AFQA 5C1YA 1IQNA 3A87A 1D6RA 1O2QA 6GCHF 1WTHD 4MVNA 3U8RH 1BZXE 2TGTA 1ABJH 2JH0D 1C1WH 3EA7A 3UNSA 1UCYK 1Z1IA 1UO6A 2BX3A 4X2WA 3U69H 1V2WT 1PPGE 3ZVAA 3OEHD 3GY4A 2JKHA 3LT3A 1P2MA 5E0HA 3TGIE 2B9LA 5DP9A 3QK1A 2HPQH 2ZFRH 3SU2A 2ZWLH 7GCHG 1SKYE 4TT3D 4HTCH 4BXSA 3U1IB 2CXVA 4ZKRU 3KCGH 2GZ7A 2B8OH 1MD7A 1P57B 2PHBA 1TPPA 2KR7A 3ZZ6A 1ELDE 4NSYA 2EEKA 1NO9H 5ETXA 2BTCE 1QBVH 3AASA 1UCYE 1C2KA 4UONA 4WH8A 1AKSB 3NWUA 1Y3UA 1O34A 4KP0A 2F43B 2VWOA 1QB9A 1BBRH 2QN5T 1L1JA 2ANMH 1C5QA 2ZU2A 2TGAA 4Q4LA 3CENA 2GCHG 1SPJA 3LPRA 2GT7A 2GTBA 3D23A 3PTBA 1YKTA 2GX4A 1E35B 4D9RA