5GJ4B

Structure of ns2b-ns3 protease from zika virus caught after self-cleavage
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
153
structure length
153
Chain Sequence
TDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQLLAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease subunit NS2B
publication title Structure of the NS2B-NS3 protease from Zika virus after self-cleavage.
pubmed doi rcsb
source organism Zika virus (strain mr 766)
molecule tags Hydrolase
total genus 28
structure length 153
sequence length 153
chains with identical sequence D, F, H
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00949 Peptidase_S7 Peptidase S7, Flavivirus NS3 serine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5gj4B02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5gj4B01
3ZZ4A 4INKA 3D23A 1DWCH 2ILNA 1QRZA 2J2UA 4FUIA 1PFXC 3DA9B 2BY5X 1D6RA 1DDJA 3T25A 1FY8E 1QQUA 5E0JA 1TA6A 1GJ5H 5TCAA 5LPFA 4TYDA 1DFPA 3GY4A 3KQEA 4WXIA 4Y0YE 1BIOA 1O37A 3ZZ9A 2ZFFH 3V0XA 3OTPA 2ASUB 3K9XB 3GCHB 1MMJN 3KQCA 1OSSA 3V7TA 3KHVA 3I78A 3M7UA 4ESTE 1SB1H 3SNEA 1LPZB 3GISB 2FLRH 5SGAE 3HGPA 5TJXA 1AE8H 1K9OE 2GCHF 3VGCB 1C2LA 2OK5A 1SGIB 1FUJA 2NU3E 2EC9H 4WWYA 2HNTE 4X8VH 2GZ9A 4AYVB 5EQSA 1WCZA 1TQ0B 1V6DA 3TNTA 1UVSH 2BVXH 1W7GH 1QL7A 1CVWH 1LTOA 1ORFA 1ETSH 2TGPZ 5JBAS 1XUJA 2ULLA 5DK1A 1MTUA 2Q6DA 2XC4A 4ISLA 1GI7B 3SU2A 1V3XA 2BLQA 1K1PA 1ZOMA 3A83A 1L4ZA 4DVAU 1LMWB 4B6FA 1HAVA 2C8XB 1HAYB 1O39A 2AH4X 1ZTJA 4MPUA 2ZDLA 1J17T 2BLVA 3F9FA 4WH8A 1K1LA 4XSKU 1HNEE 4YOJA 1G3CA 2ZQ2A 3PTNA 2ALPA 1ELFA 1MAYA 4X8UH 3ZZBA 4I8JA 2ZECA 5LH8A 3W94A 2WYGA 3SV2H 4ZKRU 1PYTC 4ABBA 2G00A 4INHA 3E0PB 2ALVA 3SUFA 1AY6H 3A80A 1T4UH 2R3YA 1YPJH 3FZZA 2PTNA 4UDWH 5C67A 1QRXA 3MOCA 2R9PA 3ITIA 2F83A 2ZPSA 1LPKB 3JZ2B 4D9RA 1SMFE 2BD5A 3LDXH 1TBRH 1KDQB 1Z8IB 2P3UB 3U1IB 5L2ZH 1THRH 4WF8A 8LPRA 1ZGIA 2TIOA 2OC7A 3BTKE 2TGAA 2ZFTA 1IQJA 5AF9H 1O3NA 1OP0A 1CHOG 1ELVA 1EPTA 1PPEE 1QIXB 2BQWB 2UUFB 4RSPA 5F6MA 1GVKB 2BY9X 5JBCS 1O30A 3FZDA 5E2OA 3H7OA 1T8NA 1GHBG 3LC5A 1KSNA 1CGHA 2VVUA 3F1SB 2K1QA 2BB4A 2VH6A 5FXLA 3VEQB 1QR3E 4MQAA 4BOHA 2B8OH 4Y76A 1O32A 4ABGA 2Q1JA 4KP0A 1MBMA 1MQ5A 3KEEA 4M9FA 1W3CA 1AKSB 1SC8U 2GCTC 1O34A 1D9IA 3HPTB 3IITA 1KYNA 2OLGA 1UCYK 3PROA 4B6EA 2AEIH 2A7JA 1MKWH 5EODA 1C1WH 2SGDE 2EI8A 3NUMA 4UONA 3ZZ7A 3VB5A 4XBBA 4FUGA 3UQVA 4GCHG 1MKXH 1RS0A 1QB9A 3M3SA 5G4BA 4YTAA 1Z7KA 1WXRA 1GCTB 3BIUH 1EZSC 3A8AA 3MNSA 1FPHH 1MCVA 3CP7A 3T2NA 2P3TB 3LT3A 1GWAA 2SNWA 4BAKB 1GHAF 4OGXA 1ZYOA 4I8KA 1JOUB 1L0ZA 4U2WA 1GJ8B 1CT0E 1S85A 2GKVE 3AK5A 4ZHMU 1Y8TA 1O3AA 2KAIA 1O2WA 2VIVA 1UVPA 2P16A 4JZFH 5A0CA 3DFJA 2GTBA 1P10A 2QXIA 3SW2B 4LZ4B 5PTPA 1JBUH 1L4DA 3LOXA 2PTCE 1O2LA 3NZIA 4IN1A 3RXJA 4Q7ZA 1YYY1 5C3NA 3A88A 1Q3XA 1FPCH 3RXVA 1TMUH 1O2HA 1FONA 1FI8A 4R8TB 4Y0ZE 4B1TA 1GBHA 1P3CA 2OBOA 3I29A 6CHAC 2GCHG 1P2KA 5E8EH 4AFZA 1C5MD 4ZMAH 1TALA 5B6OA 4MPWA 2SGAA 3TJUA 6LPRA 4NWKA 3SU3A 1Y5AT 3SO3A 1G2LA 1Z6JH 2BY6X 3Q3XA 4THNH 4E7NA 1E35B 1EZXC 3RXFA 1ESAA 1EAIA 3STIA 1V2MT 1GGDC 2ZGBH 4UFFH 1C1MA 1PPGE 1S5SA 1V2PT 2XCFA 6ESTA 1HGTH 2FESH 2P8OB 5A0BA 3LU9B 3LGVA 4QT8C 5CHAC 5EG4A 1LKAA 1GMDF 2FO9A 3TU7H 1XM1A 2ZC9H 2AERH 1C2JA 1FV9A 4H42U 3GY8A 1GJ7B 2H9TH 2CV3A 1AVXA 2VIWA 3UWJH 1G36A 3H09A 4HI3A 1Z8JB 4TWWA 4DIIH 1C1PA 2ZGJA 2O9QA 1O3GA 2BDYA 2ZHDA 2ZU3A 2ZQ1A 1DUEA 3O8DA 4AYYB 1H9LB 1K1JA 5FPSA 4FUDA 1IAUA 1K2I1 4TWYA 1DXPA 1F0SA 1S81A 1YLDA 2A5AA 3RXEA 3GICB 1AHTH 3D62A 2PGBB 1O2GH 3R0FA 3SV7A 1NTPA 3D65E 2WINI 1L1JA 1YLCA 2AIQA 1SGTA 4X6NA 4A5TS 4LK4A 3SI4H 1JMOH 4UE7H 3ATLA 4D9QA 3O8RA 1UTLM 2Q6FA 1J16A 1TBZH 1ACBE 3BEUA 4X6PA 1BTZA 1O2NA 3ZVGA 1OWEA 1GG6C 1O2SA 8ESTE 3SZNA 2XCNA 4ABHA 1DICA 2VWNA 2Z7FE 1YM0A 3VB6A 1RFNA 1GL1A 2Y82A 1AVGH 2D1JA 5DJ7A 3SJKA 2W7UA 3A7TA 1C5NH 2RG3A 1LVBA 5BRRE 1ELBA 2ZIQH 2OC1A 5L2YH 5FBIA 1PQAA 1VR1H 1O2IA 1C1UH 1O33A 1TGCA 2R3UA 3A7VA 5EPYA 1VITH 2G5VA 3R3GB 2UUJB 2QF3A 3DUXH 7LPRA 9LPRA 4CRCA 1YKTA 4B75A 4K3JA 5HM9A 2A7HA 1MD8A 1QB6A 1THSH 2QV1A 1P11E 4Y7BA 2ZDKA 2XBWA 3RU4E 2V6NA 2Q6GA 3TGIE 5DG6A 5LPEA 1A1RA 4TPIZ 4B2BA 2UWOA 3F9EA 2FOCA 1C4V2 1IQFA 2VU8E 4IGDA 1O2UA 2ZPQA 4A1TA 2JETC 4CH8B 3MU8A 1C1OA 4MVNA 1LQEA 1SOTA 4I33A 1V2KT 4I8HA 4IBLH 4ISHH 2XWBI 2BDHA 3TGJE 4Q7YA 3HATH 1GHAG 1KXCA 1ABIH 3JZ1B 1G32B 4X8SH 3F6UH 5FAHA 1C4Y2 1H9HE 4DURA 1Y5BT 5DGJA 2C8YB 1ZHPA 3GDUA 4K69A 2BHGA 3PWCA 2BD7A 5C5OA 5CMXH 1JRTA 1P05A 1LHFH 2GCTB 2QIQA 2VGCC 8GCHF 1F0UA 1GMCF 5EQQA 1TFXA 1O3EA 5IYTA 3OY5U 4M7GA 2HWLB 1L2EA 1AKSA 1HJAC 2JKHA 3KIDU 4MPVA 4U01A 4AB8A 3QGJA 3P17H 3PM3A 4JYTA 1O3HA 2A4OA 3SV6A 2ZG0H 3T5FH 1P04A 1RXPA 2C8ZB 4FU7A 3E91A 1AB9B 1UCYH 5GIBA 5HM2A 2C93B 1OP2A 3SUEA 1IHSH 1HAOH 5C2ZA 2VIQA 1NY22 1HXEH 1O5BB 1QFKH 1TNLA 4K8BA 3QLPH 2HVXA 3ZVAA 2FOMB 1ZTLA 3ZYEA 2ZA5A 2FIRH 3RMLH 3ZVCA 2FWWA 4YOIA 1YBWA 3RC6A 1AWFH 1OYTH 1O5EH 1KXBA 3PLBA 4VGCC 1TA2A 1OP8A 1BRBE 2VWOA 5L6NH 5A8ZA 1BMNH 4IMQA 1SGYE 1O2XA 3LJJA 2FZZA 1QCPA 4JZ1A 1ZPBA 1AGJA 2Z9KA 1HPGA 3M3VA 3TJNA 1GMDG 1MH0A 2SGQE 5EU8A 3QDZB 4H4FA 4Q7XA 1OWDA 4ISOA 1E37B 2ZCHP 3ATKA 1HUTH 2FOFA 1EATA 2Z94A 4AFSA 4ZROA 2VINA 5JDUB 1O2ZA 2BDBA 5BPEA 1QGFA 1XKBC 1MD7A 1UJ1A 3HKIB 4X6MA 1CHOF 2D2DA 2R2WU 2V3OH 4Y7AA 4ISIH 2LPRA 1JRSA 1QBVH 2F9OA 1S0RA 2CF8H 2BD4A 1C5SA 1ZJDA 3BTGE 1Y3UA 2W26A 2HOBA 1TNJA 2ZNKH 1ANCA 4O97A 2Y5HA 2BLWA 3NPSA 2BM2A 3S69A 1QB1A 4TY7A 1C5VA 1VGCC 5E2PA 2UWPA 5DP9A 1SFIA 2WPHS 4UFEH 3QZQA 3TLOA 1CT4E 1HDTH 1NRPH 2ZFQH 3TH4H 3MU1A 1ARBA 1QJ7B 2A2XH 1OKXA 3K6ZA 3K65B 1A61H 4ABFA 4B2CA 3BF6H 2A0QB 1C9PA 1S84A 1C5TA 1SL3A 1IOEA 2ZPRA 2F4LA 2O8TA 3RC4A 4BNRA 2NU4E 1LVYA 1RD3B 1V2QT 3GYLB 4OGYA 4ZKNU 2J95A 3RDZA 2HNTF 3UOPA 2R2MB 4INLA 1V2JT 1JIRA 3MO3A 5ESTE 4AOQA 4IC5A 4MG3A 1FIWA 1Y3VA 2FS9A 4GCHF 1GVLA 1A46H 1NZQH 5GCHF 1DPOA 1O5CB 4NA9H 3LGIA 1F5RA 1XVMA 5DP8A 2VNTA 1TWXB 1AFQB 1TRYA 1BMLA 1QBNA 2FS8A 4U30A 1TNKA 3U1JB 4MNYA 4DCDA 1ELDE 2VIDA 4XE4A 4NSVA 2WPMS 1DLKB 1UTOA 1BRAA 4UFGH 1WTHD 1D6WA 1AFEH 1TGTA 1T8OA 3BTWE 2VIOA 5FCRA 3RU4D 1QJ1B 1O36A 1C1QA 1GJ4H 3E6PH 1EJMA 1QA7A 3A8CA 1XUHA 3OX7U 1UTQA 5DKMA 3KNXA 4HGCA 3RXQA 2ZP0H 1F5LA 2WYJA 1EB1H 3RXIA 4E06H 2SGEE 4B71A 1ELCA 4FUHA 1C1RA 1HV7A 3OYPA 1DWBH 3GCOA 2BD9A 1IQHA 2ZGCA 1RRKA 4I8LA 1LVOA 5HGGA 4CHAB 2UWLA 4KGAA 1OXGA 2THFB 1ZSLA 3TH3H 4RI0A 5JB8S 3OSYA 2SFAA 3SNAA 1W12U 1ZJKA 1GBAA 1OWIA 3SNCA 3M35A 1PQ5A 1UVTH 4FVBA 3C1KA 5JBTA 1WSSH 2ZHWH 2FLBH 5A8XA 1GHZA 2ODQA 1Y3YA 3A7ZA 8GCHG 3PV2A 3RXCA 1GMCG 1ZZZA 2XTTB 2A2QH 2ZFPH 1A7SA 1ZR0A 4Y8YA 1IQGA 4K8YA 2A31A 5L30H 2F3CE 3BG4C 3ZV8A 3SGBE 5T6DA 3ZV9A 1C2DA 1SGRE 1YCPH 3RUOA 2BOHB 1SOZA 5EXMA 2J92A 5C20A 1C5RA 3G01A 3QK1A 2TBSA 3M5NA 3MH5A 1MQ6A 3FP7E 1O31A 1LHCH 1ZRKA 2JETB 2B5TB 3PO1C 4ZKOU 2GDDA 4WY3A 2GT7A 1KY9A 4KKDA 1AZ8A 1P8VC 4CREA 1GDUA 3U69H 2PKSB 1HAHH 1P2NA 2IOTA 2P94A 3A8DA 3PLKA 1HBTH 2ZDAH 1CBWC 1GI0A 1ZTKA 1MAXA 2VGCB 3UPEA 4AORA 1DX5M 4GHTA 1FQ3A 4DW2U 4D76A 3ZVEA 3HK3B 1Y3XA 4BAMB 2OUAA 3T27A 3SU5A 2ESTE 1EAXA 3SOSA 1C5PA 2BTCE 3GY5A 1NFXA 2FDAA 1WQVH 5I25A 4MPXA 3TGKE 4ZXYH 1O2JA 1TPOA 3M36A 4GSOA 2STBE 2BD2A 1ANDA 1P2QA 1TMTH 3ATWA 4YT6H 4HTCH 3MO9A 1SGQE 2O8MA 2OINA 4B76A 4K1TA 1MCTA 2BY7X 2J34A 1ZPZA 1Y5UT 2ZU5A 3S7HB 1JIMA 1ZRBA 1QQ4A 3IG6B 1SR5C 5FPTA 4ABAA 2ZFSA 1GHYH 2GV6A 3P70B 3RXDA 1AMHA 3QGNB 3A89A 3P8FA 2P95A 4HZHA 1FN8A 2JH0D 3DFLA 5AFYH 4I7YH 2BQ7B 1BMMH 5A8YA 2ZGHA 3E3TA 3RXKA 3SUGA 3F9GA 4NG9H 2QY0B 3A86A 1ELTA 2BDIA 1RIWC 1GDNA 3A82A 3TH2H 4J1YA 1JWTA 2RA3A 3GCNA 3MNCA 4Y6DA 1YC0A 1UTMA 1BDAA 3VXFH 2XNIA 3TJVA 4ZHLU 1SLVB 3CENA 2G8TA 3LGTA 1CO7E 3MNXA 1FAKH 1WAYB 1GI9B 5GCHG 2UUYA 4MNXA 2GV7A 1A3BH 1KLJH 1S6HA 1W10U 2YNAA 4AZ2B 3P95A 2A5KA 3GCTF 4GAWA 2QXHA 3BTHE 1EAWA 4FVDA 1K21H 1O2TA 2PSYA 1TYNA 1N8OC 1VGCB 2FODA 5JYIA 1YPKH 1SFQB 1O3KA 1W13U 1EPTC 1KLIH 2ZTXA 4ASHA 3QUMP 1B7XB 1W11U 1J9CH 1LHEH 1OS8A 1ESTA 2BOKA 4Y11E 4WVPE 1O5GH 2EI7A 2Y6TA 1NN6A 1TQ7B 5F8ZA 3KQDA 3S9AA 2Y80A 3H7TA 4OS4A 1FJSA 5A0AE 1ETRH 1W0YH 3MWIU 1FLEE 1AQ7A 1GBMA 1K1NA 3QN7A 1SGFA 1CHGA 1G9IE 1XUGA 2BYAX 4BAOB 1AVWA 1J8AA 1BOQA 3MU4A 3H5CB 3LGUA 2JH5D 3S9BA 1SGPE 2Y7ZA 1CGIE 3FP8E 1HCGA 2G81E 2VIPA 2Y81A 3ZZAA 1TOCB 1WUNH 2FI5E 2A4QA 1C5LH 1MTNB 5J4QA 3MTYA 3SHCH 1P2MA 2XW9A 1O3IA 5EGMA 1BHXF 2BMGB 1HRTH 1V2LT 5FPYA 1GMHG 3AASA 3RXBA 1UO6A 1O5DH 1YF4A 3RXAA 1H8IH 3PMBB 2AYWA 1NROH 4OS2A 4JZDH 3O8BA 1C2IA 1PPCE 3S7KB 5EW2H 1C5OH 4OS7A 3HGNA 1Q31A 1F7ZA 3PV5A 1NFUA 5GDSH 2CMYA 1DOJA 4NFFA 1TAWA 1LKBA 2FOBA 1BTPA 1WTGH 1PPHE 2XXLA 2Z3DA 1T32A 1SHHB 3RMMH 3SZEA 3TIUA 3SYJA 3ESTA 2NWNA 4TY6A 4LOYH 2ZTZA 1EZQA 4IS5A 3AAUA 2R0LA 1RJXB 3GY6A 4XFQA 4TPYA 1FXYA 1LDTT 2VBCA 1LHDH 3P6ZB 4ZHAA 1TPPA 4A92A 1AE5A 2AIPA 1OWHA 4NGAH 4IC6A 2ZFRH 4DOQA 2Y5FA 4JYUH 1DWDH 5JB9S 3AW0A 1O5AB 4MTBA 1TNHA 5AHGH 2DE9A 2DE8A 3BG4B 3VPKA 4CH2B 1EKBB 5GJ4B 4YZUA 2ZU1A 3LGWA 1DUAA 3TK6A 2J4IA 2Z3CA 2V35A 1XUKA 5K7RA 1QHRB 2PKAB 2WV9A 2HALA 3ODDA 1LO6A 3ZZ8A 1TPSA 3EGKH 1NRSH 2QYIA 3PWBA 5EQRA 3B9FH 4CRDA 1GJCB 1TE0A 3PO1B 3U8TH 2PFEA 4O3TA 6GCHG 1PYTD 3UTUH 1XKAC 3LGYA 3M5OA 3SU1A 4AGKA 2FXRA 3L6PA 1C1SA 4U32A 4A1VA 1V2OT 4PROA 1C1TA 2ZHFH 1G3BA 4AX9H 1H4WA 1V2TT 1ZMLA 1RGQA 3A8BA 2JH6D 2PWXA 3GCHC 1AO5A 1EB2A 1ELGA 2H5CA 2ZCKP 4NIVA 1EXFA 3PMHB 4GPGA 4YO9A 3SU6A 5DP4A 5F8XA 1DLEA 3KL6A 7GCHG 1S0QA 1NT1A 7KMEH 3AVZA 3T28A 3VGCC 4CR5A 1NFWA 4Q2KA 1C2KA 3V12A 3NCLA 1PPZA 2PSXA 1OOKB 3E1XB 3M3TA 1S83A 1F0RA 1ZHMA 3LONA 5EW1H 3TK9A 3LKWA 1C5WB 3E8LA 2BD8A 2XWAA 1YPHC 2VH0A 2ZU2A 1DM4B 2QC2A 2BLOA 3S9CA 3GCTG 1DWEH 8KME2 4UEHH 1V2WT 1IQLA 5JBBS 2G52A 5F03A 2EEKA 2A32A 4AB9A 2CHAC 4O9VA 1QNJA 1TRMA 3ODFA 4I32A 1GPZA 3OTJE 4SGBE 1QURH 1GBEA 4WMFA 1GCDA 3GDVA 3KN2A 1BT7A 3D49H 4BAHB 1FY4A 3M37A 5DO4H 1YP9A 4R0IA 4A1XA 2W3KA 2TRMA 1GI2A 1CGJE 2Y7XA 3M5LA 1QBOA 1AI8H 3T26A 1XUFA 2ZWLH 1V2UT 4Z6AH 1ESBA 3SHAH 3RMOH 1K22H 1GBTA 1H9IE 5ABWA 3E90B 3BTQE 4K60A 4CRAA 4DIHH 4NZLA 3T62A 5FHTA 3PMAB 4WH6A 3EA8A 5K0HA 2Z9IA 2PUXB 1CE5A 2O8LA 3SBKA 5IDKA 1TNIA 4E7RG 1W8BH 1DVAH 2RCEA 4MLFB 2G4UA 2NU0E 3UOUA 2HGTH 2A4RA 1MBQA 4AN7A 1HAIH 1HAGE 3MH7A 1TGBA 4FUEA 1GI1A 4RN6A 2R0KA 2DUCA 4MNWA 4SGAE 4FUFA 1C5XB 3KF2A 4GVUA 1EUFA 2F91A 1D3TB 1H1BA 1QJ6B 2AS9A 5I46H 3F9HA 5F8TA 1DSUA 1P09A 3STJA 1MZDA 1SGFG 1NFYA 1KXEA 5EOKA 1P06A 4OM9A 3EYDA 4NFEA 3SGAE 1NM6A 1W14U 1O0DH 3TJOA 2QAAA 3VFEA 2STAE 1O35A 1EOJA 3ZZ6A 2BDGA 2HPQH 1ZPCA 2HPPH 3K2UA 1HAXB 4NA7A 2ZEBA 1BTYA 3NWUA 1ELEE 6CHAB 4X2XA 5JPMH 1QL9A 2QF0A 1MU8B 3LPRA 3SNDA 3SUDA 2C4FH 3UR9A 4CBNA 1MKWK 1HIAB 2W7SA 4D7GA 3UY9A 2GZ7A 2IPHA 4KTCA 2OTVA 3AW1A 4A7IB 4K1EA 1L1GA 5T3HA 1AWHB 1MKXK 2ANWA 3PB1E 4OS1A 1NU9A 1B5GH 3SJ8A 2I6SA 3P8GA 1FAXA 2XC0A 3SJIA 1GGDB 5GNDA 2BVRH 2OC0A 2WV5A 3ZZ5A 3UNSA 1PPBH 5CHAB 3BSQA 2TGDA 1O2QA 4NIXA 1LQDB 3ZVBA 1GCTC 3TVJB 1Z8RA 1O2KA 2QCYA 4XBCA 3U9AH 3GY2A 1V2ST 5A2MH 1UK4A 1UTNA 1O3FA 2AMDA 3BTME 4BTTB 1O2RA 2WPJS 1V2VT 2FOAA 1BA8B 1BRUP 1ABJH 1C2GA 1TONA 1O2VA 4NWLA 3ELAH 1BBRE 3DD2H 4D7FA 3TNSA 4GHQA 2AGEX 1KTSB 1TGNA 2PUQH 2O8UA 4WMDA 4DGJA 1G30B 1CA0C 2PW8H 4BTIB 1F92A 3UFAA 2H1UA 3NKKA 1EJAA 2ZKSA 3PYHA 2C3SA 1DS2E 1V2NT 1A4WH 1SLUB 1UVOA 2GX4A 2FX6A 4NCYA 4NIWA 1SQOA 3BG8A 1HB0B 5J4SA 1LVMA 3FP6E 2GD4B 2GT8A 1VJAU 1SLWB 2XBXA 4X8TH 2Y5GA 2ZTYA 2HNTC 1O3LA 5AVDA 4Y8XA 1GBCA 1CSOE 2QA9E 3PMJA 1O3CA 1GI4A 1GVZA 2FM2A 1DY8A 1YPMH 5AFZH 4X1PU 2YNBA 2QGRA 1Z71A 2PKAA 1MUEB 3EA9A 2FEQH 1YPGH 1O3DA 2ZF0H 2VVVA 4GLYA 3S0NA 4A6LA 1GG6B 3BV9B 3MU0A 2PR3A 3RXRA 2WUBA 2P8OC 1GI8B 2WZQA 2EI6A 1TB6H 2GVFA 2ZDVH 1T7CA 1VCWA 3C27B 5GXPA 5GWZA 1FZZA 1NC6A 3T29A 4ABJA 1KIGH 5LPRA 1E0FD 3EQ0H 1E38B 1GMHF 4BXSA 1TX7A 1TABE 3CS0A 1O3OA 2ZU4A 2NU2E 2FOHA 3VB3A 2CGAA 2FOEA 3URDA 2FTMA 2P59A 1TMBH 3A7WA 4X0WU 1EAUA 3AAVA 4JCNA 2BQ6B 1Q2WA 2EA3A 3GYMA 1MTSA 1C2HA 1GI6A 1W7XH 3LJOA 2F9BH 2XYAA 1PQ7A 3A7YA 2I6QA 3Q00A 4JK6A 4B74A 2XC5A 2ZHQH 4IN2A 1GI3A 1SG8B 2CHAB 1AD8H 3TPIZ 1DSTA 3GY3A 2ZHEH 3A81A 3B23B 3A7XA 2C8WB 4AFQA 7ESTE 2PLXA 1S6FA 2Z3EA 4J2YB 4JMYA 3UIRA 1M9UA 3Q77A 2BZ6H 3UQOA 1HJAB 2PGQB 5ESBA 2W5EA 3RMNH 3Q3YA 3RXTA 1ELAA 1FY3A 1P2OA 1ANBA 4NZQA 2PV9B 2Z9LA 3OU0A 3BEFB 1WOFA 2J38A 2VVCA 1DANH 1BZXE 3U8RH 3UR6A 2SGPE 1P01A 3GOVB 4JZIA 3PV4A 1KXDA 4CRFA 2FTLE 1C2EA 1P9SA 4Z0KA 4X1NU 1G3EA 2BXUH 2F9VA 1A3EH 6GCHF 2GDEH 4X1QU 1D3DB 2AFQB 5EXNA 4AG2A 1NS3A 1SSXA 1BQYA 3ZZDA 1K1MA 4CRBA 4VGCB 1BMAA 4ABEA 5FCKA 4BAQB 1U6QA 1O3MA 1HAPH 1QRWA 1NU7B 3E16B 3MI4A 1ZHRA 5GPIB 1E34B 7GCHF 3RU4T 1PJPA 3ZZCA 4K5ZA 3QZRA 1T31A 1FMGA 1OX1A 1QA0A 2GMTC 1GL0E 4ABIA 5DP6A 3QTVH 4WXVA 2HLCA 4MNVA 3QWCH 2WHXA 3URCA 3FVFB 2W3IA 3BTFE 5DP5A 5HMAA 3SNBA 1Y3WA 2BDAA 1SHYA 2A1DB 4Q80A 3A84A 2ZDNA 1F0TA 1SPJA 3P8OA 3KCGH 1HIAA 1CQQA 1P57B 4GUXA 3VB7A 2ANKH 1SQTA 2FMJA 3EDXB 1Z1IA 2WPKS 1HFDA 5CE1A 2C90B 4DG4A 2OD3B 1J15A 3Q3KA 1AB9C 2ZGXH 2ZI2H 3L3TA 1C5YB 1UK3A 1NRNH 3B8JA 1BTUA 2BY8X 1O3BA 1FY1A 3NXPA 1THPB 4O03A 2A7CA 1LCYA 4X1RU 1ETTH 4O3UA 1VJ9U 1MTWA 1X7AC 4DY7B 1K28D 5EXLA 1DITH 1B0FA 1BRCE 1P02A 1T8LA 1IQNA 4NIYA 1N6YA 1GBFA 1O2YA 2G5NA 2P93A 3QTOH 1ZMJA 3HK6B 3ZVFA 2D8WA 1C5QA 1HYLA 1OYQA 4CRGA 1KTTB 1CA0B 3LH3A 4ZH8A 2VJ1A 1A0HB 1EASA 1TX6A 3MU5A 1B0EA 1AIXH 4WJG2 2F9PA 5E0HA 3SN8A 1KXFA 2H5DA 3WY8A 3SJ9A 4YESB 4AG1A 1H8DH 3A85A 1GDQA 3RLYH 4XBDA 3Q76A 1DT2A 2FPZA 2A4GA 1ANEA 1QL8A 1GBIA 1QY6A 2FX4A 4OS6A 1XXFA 4LZ1H 1UHBB 1GHVH 1TOMH 1SLXB 2H9HA 1C1VH 1D3PB 1HXFH 1HJ9A 2TGTA 1YCPM 4F4OC 1C5ZB 1WV7H 4RKOB 4X1SU 1A0JA 4Y79A 3IWMA 3BN9A 2YOLA 1BCUH 5DP7A 4ZKSU 1BBRK 3MNBA 3MO6A 3RM0H 3RXHA 2J94A 1A5GH 2A45B 4JK5A 3SORA 4H6SB 1Y59T 1MU6B 1GJAB 4LXBH 5C1UA 1RTFB 2QXGA 3K6YA 3UWIA 4HFPB 5C1XA 1EOLA 1TNGA 4X2VA 1P12E 1G2MA 2OP9A 1GBBA 1IQKA 1GBDA 1UTKA 3ATMA 4IMZA 2NU1E 1GJ9B 3SQEE 2G4TA 4Y71A 5DP3A 1P9UA 3RM2H 2G55A 1UTJA 2VWMA 3RXPA 3KQBA 5A09A 1GJBB 1EQ9A 4JYVH 1AUTC 4FUCA 1BUIA 2F9NA 2OQUA 4FU9A 2SNVA 4Y10E 5LGOA 2FP7B 2OBQA 2ODPA 3EE0B 5HYOA 2LNCA 2IN2A 3VB4A 1TLDA 3RXSA 1VITF 3FANA 3RXMA 3E0NB 1AFQC 1P2JA 2BZAA 3ATIA 2FOGA 5EPNA 5DPAA 2QN5T 1EZUC 1BB0B 3SGQE 2SGFE 3RP2A 1SGNE 2P3FH 1K1IA 1HAZB 3RXUA 1O38A 1V2RT 1YPEH 2CXVA 3N7OA 1ZSKA 3SU4A 4DJZB 2GZ8A 2WUCA 1EP5A 1SI5H 1BTHH 3MMGA 1A5HA 2V3HH 4KTUA 4I8GA 2ANYA 3UNQA 1CBWB 1HLTH 4BTUB 1TIOA 5FX6A 4BXWA 1IQMA 3KGPA 2Z9JA 2BX3A 5FBEA 1CT2E 1J14A 1NRRH 4ZAEA 4UFDH 1PQ8A 1GHXH 4F49A 1T8MA 3FFGA 3RXOA 2BX4A 1SBWA 4CBOA 1A2CH 3TITA 1G37A 3PLPA 1O5FH 3BTTE 1XMNB 4CHAC 3BEIB 1D3QB 2G51A 4UD9H 1E36B 2Z9GA 4FUBA 1NO9H 1Z8GA 2CJIA 4KELA 2A5IA 1NESE 1ZGVA 1C5UA 4ISNA 1FDPA 4YLQH 1CU1A 1YPLH 3M7QA 1IHTH 2GP9B 3MH4A 1O3PB 3SJOA 2ZZUH 1W2KH 4Y8ZA 1YCPK 2FI4E 3UNRA 4ZUHA 1TPAE 3ZZ3A 2TPIZ 1HAVB 2UUKB 2XBVA 2PHBA 4AGJA 1WQSA 1UK2A 1YGCH 3HKJB 2F9UA 1KDQA 2ZDMA 3MHWU 4YOGA 2FI3E 1GI5A 1TRNA 3BIVH 1AUJA 2RA0A 4DT7B 4B73A 4YLUA 3F68H 1ZSJA 3DT0H 2H6MA 3M61U 3ZYDA 4ZXXH 2Z6BD 3P8NA 5ETXA 3NK8A 1FNIA 3MYWA 5C5NA 5T1VA 1O3JA 1GJ6A 1RIWB 2H2ZA 3M7TA 4AFUA 2GMTB 1QTFA 1K1OA 3OY6U 2PKSC 3BTDE 2CN0H 5E0GA 1WBGB 3LIWA 4BANB 3EAJA 4E05H 1C2MA 4X6OA 1P03A 1T4VH 3SV8A 1YPHE 1ID5H 1L1NA 1INCA 1C9TA 2CF9H 4X2WA 3SV9A 1SGEE 1MZAA 1XXDA 4FU8A 1C1NA 2BD3A 2VWLA 1DY9A 1VCQA 2ZCLP 1N8OB 3GDSA 3V13A 3MFJA 3P92A 1EPTB 1OWKA 1UCYE 4XDEA 2AGGX 3MH6A 1AN1E 1IQEA 2WPLS 3L33A 4CR9A 3QO6A 1AU8A 1KLTA 3UUZA 1Z1JA 3V3MA 5B6LA 4JZEH 2V0BA 4FXGH 3FAOA 2ANMH 2J9NA 1XVOA 3SI3H 1RTKA 2FYQA 2BDCA 4I31A 1VZQH 4KTSA 2M5TA 1CA8B 5T6GA 4OS5A 2HRVA 2WPIS 2XRCA 3RLWH 3ZVDA 3O8CA 3CS7A 1GBLA 2AMPA 1C2FA 2XBYA 2B9LA 1KXAA 3UREA 1VCPA 1A0LA 1W0ZU 3ENSB 2IJD1 1ARCA 1IQIA 1DXWA 1BTWA 3I77A 1EP6A 1NRQH 4WMEA 1BITA 3U98H 1EJNA 1G3DA 5C1YA 2AGIX 4FUJA 5TCCA 3W95A 4MDSA 1F2SE 2H9EH 3A87A 1S82A 1FY5A 1BJUA 1SVPA 1LPGB 1SGDE 5T6FA 2D26C 1N1LA 1RTLA 1ZMNA 2VB0A 2AMQA 1GBKA 4D8NA 1OPHB 2ODYB 1P3EA 1PPFE 1BTXA 2RDLA 4B2AA 1FIZA 1GHBF 1VITG 2IJOB 1WU1A 2O8WA 1P0SH 1O2MA 1BJVA 1GJDB 4NA8A 1NPMA 2GGVB 3GY7A 1XUIA 1JXPA 1P2IA 1UHBA 2KAIB 1XX9A 4NSYA 1FN6A 3BTEE 1N6XA 1GHWH 3RC5A 3SU0A 1AZZA 2ZO3H 5HXFA 1D4PB 4X2YA 2B7DH 1A5IA 2OCVB 1DE7H 2FYRA 2OQ5A 1BHXB 5FX5A 2WV4A 3DHKH 1TBQH 3LC3A 1BBRH 3RXLA 3SQHE 4YM9A 1SGCA 2QXJA 3QX5H 1HJ8A 1TX8A 1LHGH 4YT7H 1WYKA 3RXGA 1O2OA 1UMAH 1SQAA 4RKJB 3TK5A 1Z6EA 4H6TA 1MTVA 4K1SA 4XOJA 4K2YA 2OXSA 3LH1A 4ABDA 3U8OH 1ZLRA 1EX3A 3VXEH 3EA7A 3M5MA 1OWJA 1GBJA 2BVSH 9ESTA 2OC8A 1C4U2 2BXTH 1F5KU 1UTPA 1TGSZ 4IW4E 3PTBA 5H4IB 1UVUH 2B0FA 1O2PA 1MTNC
chains in the Genus database with same CATH superfamily
3ZZ4A 4INKA 3D23A 1DWCH 2ILNA 1QRZA 2J2UA 4FUIA 1PFXC 3DA9B 2BY5X 1D6RA 1DDJA 3T25A 1FY8E 1QQUA 5E0JA 1TA6A 2W6ID 4Z1MD 1GJ5H 5TCAA 5LPFA 4TYDA 1DFPA 3GY4A 3KQEA 4WXIA 4Y0YE 1BIOA 1O37A 3ZZ9A 2ZFFH 3OTPA 3V0XA 2ASUB 3DSOA 3K9XB 3GCHB 1MMJN 3KQCA 1OSSA 3V7TA 3KHVA 3I78A 3M7UA 4ESTE 1SB1H 3SNEA 2YMSC 1LPZB 3GISB 2FLRH 5SGAE 3HGPA 5TJXA 1AE8H 1K9OE 2GCHF 3VGCB 1C2LA 2OK5A 1SGIB 1FUJA 2NU3E 2EC9H 4WWYA 2HNTE 4X8VH 2GZ9A 4AYVB 5EQSA 1WCZA 1TQ0B 1YY3A 1V6DA 3TNTA 1UVSH 2BVXH 1W7GH 1QL7A 4HG6A 1CVWH 1LTOA 1ORFA 1ETSH 2JDID 2TGPZ 5JBAS 1XUJA 2ULLA 5DK1A 1MTUA 2Q6DA 2XC4A 4ISLA 1GI7B 2V3MA 3SU2A 1V3XA 2BLQA 1K1PA 1ZOMA 3A83A 1L4ZA 4DVAU 1LMWB 4B6FA 1HAVA 2C8XB 1HAYB 1O39A 2AH4X 1ZTJA 4MPUA 2ZDLA 1J17T 2BLVA 3F9FA 4WH8A 1K1LA 4XSKU 5KECA 1HNEE 4YOJA 1G3CA 2ZQ2A 3PTNA 2ALPA 1ELFA 1MAYA 4X8UH 3ZZBA 4I8JA 2ZECA 5LH8A 3W94A 2WYGA 3SV2H 4ZKRU 1PYTC 4ABBA 2G00A 4INHA 3E0PB 2ALVA 3SUFA 1AY6H 3A80A 1T4UH 2R3YA 1YPJH 3FZZA 2PTNA 4UDWH 5C67A 1QRXA 3MOCA 1E79D 2R9PA 3ITIA 2F83A 2ZPSA 1LPKB 3JZ2B 4D9RA 1SMFE 2BD5A 3LDXH 1TBRH 1KDQB 1Z8IB 2P3UB 3U1IB 5L2ZH 1THRH 4WF8A 8LPRA 1ZGIA 2TIOA 2OC7A 3BTKE 1NBMD 2TGAA 2ZFTA 1IQJA 5AF9H 1O3NA 1OP0A 1CHOG 1ELVA 1EPTA 1PPEE 1QIXB 2BQWB 2UUFB 4RSPA 5C17A 1GVKB 2BY9X 5F6MA 5JBCS 1O30A 3FZDA 5E2OA 3H7OA 1T8NA 1GHBG 3LC5A 1KSNA 1CGHA 2VVUA 4I86A 3F1SB 2K1QA 2BB4A 2VH6A 5FXLA 3VEQB 1QR3E 4MQAA 4Q4LA 4BOHA 2B8OH 4Y76A 1O32A 4ABGA 2Q1JA 4KP0A 1MBMA 1MQ5A 3KEEA 4M9FA 1W3CA 1AKSB 1SC8U 2GCTC 1O34A 1D9IA 3HPTB 3IITA 1KYNA 2OLGA 1UCYK 3PROA 4B6EA 2AEIH 2A7JA 1MKWH 2V7QD 1C1WH 5EODA 2SGDE 2EI8A 3NUMA 4UONA 3ZZ7A 3VB5A 4XBBA 4FUGA 3UQVA 4GCHG 1MKXH 1RS0A 1QB9A 3M3SA 5G4BA 4YTAA 1Z7KA 1WXRA 1GCTB 3BIUH 1EZSC 3A8AA 2HVYB 3MNSA 1FPHH 1MCVA 3CP7A 3T2NA 2P3TB 3LT3A 1GWAA 2SNWA 4BAKB 1GHAF 4OGXA 1ZYOA 4I8KA 1JOUB 1L0ZA 4U2WA 1GJ8B 1CT0E 1S85A 2GKVE 3AK5A 4ZHMU 1Y8TA 1O3AA 2KAIA 1O2WA 2VIVA 1UVPA 2P16A 2L6OA 4JZFH 5A0CA 3DFJA 2GTBA 1P10A 1SKYE 2QXIA 3SW2B 4LZ4B 5PTPA 1JBUH 1L4DA 3LOXA 2PTCE 1O2LA 3NZIA 4IN1A 3RXJA 4Q7ZA 1YYY1 5C3NA 3A88A 1Q3XA 1FPCH 2K8IA 3RXVA 1TMUH 1O2HA 1FONA 1FI8A 2KCAA 4R8TB 4Y0ZE 4B1TA 1GBHA 1P3CA 2OBOA 3I29A 6CHAC 2GCHG 1P2KA 5E8EH 2KCYA 4AFZA 1C5MD 4ZMAH 1TALA 5B6OA 4MPWA 2SGAA 3TJUA 6LPRA 4NWKA 3SU3A 1Y5AT 3SO3A 1G2LA 1Z6JH 2BY6X 3Q3XA 3N7EA 4THNH 4E7NA 1E35B 1EZXC 2KZ4A 3RXFA 1ESAA 1EAIA 3STIA 3UAIC 1V2MT 1GGDC 2ZGBH 4UFFH 1C1MA 1PPGE 1S5SA 1V2PT 2XCFA 6ESTA 1HGTH 2FESH 2P8OB 5A0BA 3LU9B 3LGVA 4QT8C 1E1QD 5CHAC 5EG4A 1LKAA 1GMDF 2FO9A 3TU7H 1XM1A 2ZC9H 2AERH 1C2JA 3MQKC 1FV9A 4H42U 3GY8A 1GJ7B 2H9TH 2YMSB 2CV3A 3KYFA 1AVXA 2VIWA 5HIZA 3UWJH 1G36A 3H09A 4HI3A 1Z8JB 4TWWA 4DIIH 1C1PA 2ZGJA 2O9QA 2PP6A 1O3GA 2BDYA 2ZHDA 2ZU3A 3OAAD 5EJLA 2ZQ1A 1H8ED 1DUEA 3O8DA 4AYYB 1H9LB 1K1JA 5FPSA 4FUDA 1IAUA 1K2I1 4TWYA 1VKYA 1DXPA 1F0SA 1S81A 3DSGA 1YLDA 2A5AA 3RXEA 3GICB 1AHTH 3D62A 2PGBB 1O2GH 3R0FA 3SV7A 1NTPA 2KCPA 3D65E 2WINI 1L1JA 1YLCA 2AIQA 1SGTA 4X6NA 4A5TS 4LK4A 3SI4H 1JMOH 2WPDD 4UE7H 3ATLA 4D9QA 3O8RA 1UTLM 2Q6FA 1J16A 1TBZH 1ACBE 3BEUA 4X6PA 1BTZA 1O2NA 3ZVGA 1OWEA 3CNRA 1GG6C 1O2SA 8ESTE 3SZNA 2XCNA 4ABHA 1DICA 2VWNA 2Z7FE 1YM0A 3VB6A 1RFNA 1GL1A 2Y82A 1AVGH 2D1JA 5DJ7A 3SJKA 2W7UA 3A7TA 1C5NH 2RG3A 1LVBA 5BRRE 1ELBA 2ZIQH 2OC1A 5L2YH 3F2HA 5FBIA 1PQAA 1VR1H 1O2IA 1C1UH 1O33A 1TGCA 2R3UA 3A7VA 5EPYA 1VITH 2G5VA 3R3GB 2UUJB 2QF3A 3DUXH 7LPRA 9LPRA 4CRCA 1YKTA 4B75A 4K3JA 5HM9A 2A7HA 1MD8A 1QB6A 1THSH 2QV1A 1P11E 4Y7BA 3WWFA 2ZDKA 2XBWA 3RU4E 2V6NA 2Q6GA 3TGIE 5DG6A 5LPEA 1A1RA 4TPIZ 4B2BA 2UWOA 3F9EA 2FOCA 1C4V2 1IQFA 2VU8E 4IGDA 2K0QA 1O2UA 2ZPQA 4A1TA 2JETC 4CH8B 3MU8A 1C1OA 4MVNA 1LQEA 1SOTA 4I33A 1V2KT 2J97A 4I8HA 4IBLH 4ISHH 2XWBI 2BDHA 3TGJE 4Q7YA 3HATH 1GHAG 1KXCA 1ABIH 3JZ1B 1G32B 4X8SH 3F6UH 5FAHA 1C4Y2 1H9HE 4DURA 1Y5BT 5DGJA 2C8YB 1ZHPA 3GDUA 4K69A 2BHGA 3PWCA 2BD7A 5C5OA 5CMXH 1JRTA 1P05A 1LHFH 2GCTB 2QIQA 2VGCC 8GCHF 1F0UA 1GMCF 5EQQA 1TFXA 1O3EA 5IYTA 3OY5U 4M7GA 2HWLB 1L2EA 4AC9A 1AKSA 1HJAC 2JKHA 3KIDU 4MPVA 4U01A 4AB8A 3QGJA 3P17H 3PM3A 4JYTA 1O3HA 3WW7A 2A4OA 3SV6A 2ZG0H 3T5FH 1P04A 1RXPA 2W6JD 2C8ZB 4FU7A 3E91A 1AB9B 1UCYH 5GIBA 5HM2A 2C93B 1OP2A 3SUEA 1IHSH 1HAOH 5C2ZA 1COWD 1NY22 2VIQA 1HXEH 1O5BB 1QFKH 1TNLA 4K8BA 3QLPH 2HVXA 3ZVAA 2FOMB 1ZTLA 3ZYEA 2ZA5A 2FIRH 3RMLH 3F2FA 3ZVCA 2FWWA 4YOIA 1YBWA 3RC6A 1AWFH 1OYTH 1O5EH 1KXBA 3PLBA 4VGCC 1TA2A 1OP8A 1BRBE 2VWOA 5L6NH 5A8ZA 1BMNH 4IMQA 1SGYE 1O2XA 3LJJA 2FZZA 1QCPA 4JZ1A 1ZPBA 1AGJA 2Z9KA 1HPGA 3M3VA 3TJNA 1GMDG 1MH0A 2SGQE 5EU8A 3QDZB 4H4FA 4Q7XA 1OWDA 4ISOA 1E37B 2ZCHP 3ATKA 1HUTH 2FOFA 1EATA 2Z94A 4AFSA 4ZROA 2VINA 5JDUB 2GJGA 1O2ZA 2BDBA 5BPEA 1QGFA 1XKBC 1MD7A 1UJ1A 3HKIB 4X6MA 1CHOF 2D2DA 2R2WU 2V3OH 4Y7AA 4ISIH 2LPRA 1JRSA 1QBVH 2F9OA 1S0RA 2CF8H 2BD4A 1C5SA 1ZJDA 3BTGE 1Y3UA 2W26A 2HOBA 1TNJA 2ZNKH 1ANCA 2L74A 4O97A 2Y5HA 2BLWA 3NPSA 2BM2A 3S69A 3WWBA 1QB1A 4TY7A 1C5VA 1VGCC 5E2PA 2UWPA 5DP9A 1SFIA 2WPHS 4UFEH 4F55A 3QZQA 3TLOA 1CT4E 1HDTH 1NRPH 2ZFQH 3OEHD 3MU1A 3TH4H 1ARBA 1QJ7B 2A2XH 1OKXA 3K6ZA 3K65B 1A61H 4ABFA 4B2CA 3BF6H 2A0QB 1C9PA 1S84A 1C5TA 1SL3A 1IOEA 2M2AA 2ZPRA 2F4LA 2O8TA 3RC4A 4BNRA 2NU4E 1LVYA 1RD3B 1V2QT 3GYLB 4OGYA 4ZKNU 2J95A 3RDZA 2HNTF 3UOPA 2R2MB 4INLA 1V2JT 1JIRA 3MO3A 5ESTE 4AOQA 4IC5A 4MG3A 1FIWA 1Y3VA 2FS9A 4GCHF 1GVLA 1A46H 1NZQH 5GCHF 1DPOA 1O5CB 4NA9H 3LGIA 1F5RA 1XVMA 5DP8A 2VNTA 1TWXB 1AFQB 1TRYA 1BMLA 1QBNA 2FS8A 4U30A 1TNKA 3U1JB 4MNYA 4DCDA 1ELDE 2VIDA 4XE4A 4NSVA 2WPMS 1DLKB 1UTOA 1BRAA 4UFGH 1WTHD 1D6WA 1AFEH 1TGTA 1T8OA 3BTWE 2VIOA 5FCRA 3RU4D 1QJ1B 1O36A 1C1QA 1GJ4H 3E6PH 1EJMA 1QA7A 3A8CA 1XUHA 3OX7U 1UTQA 5DKMA 3KNXA 4HGCA 3RXQA 2ZP0H 1F5LA 2WYJA 1EB1H 3RXIA 4E06H 2SGEE 4B71A 1ELCA 4FUHA 1C1RA 1HV7A 3OYPA 1DWBH 3GCOA 2BD9A 1IQHA 2ZGCA 1RRKA 4I8LA 1LVOA 5HGGA 1MABB 4CHAB 1W0JD 2UWLA 4KGAA 1OXGA 2THFB 1ZSLA 4RI0A 3TH3H 5JB8S 3OSYA 2SFAA 3SNAA 1W12U 1ZJKA 1GBAA 1OWIA 3SNCA 3M35A 1PQ5A 1UVTH 4FVBA 3C1KA 5JBTA 1WSSH 2ZHWH 2FLBH 5A8XA 1GHZA 2ODQA 1Y3YA 3A7ZA 3PV2A 8GCHG 3RXCA 1GMCG 1ZZZA 2XTTB 2A2QH 2ZFPH 1A7SA 1ZR0A 4Y8YA 1IQGA 4K8YA 2A31A 5L30H 2F3CE 3BG4C 3ZV8A 3SGBE 5T6DA 3ZV9A 1C2DA 1SGRE 1YCPH 3RUOA 2BOHB 1SOZA 5EXMA 2J92A 5C20A 1C5RA 3G01A 3QK1A 2TBSA 3M5NA 3MH5A 1MQ6A 3FP7E 1O31A 1LHCH 1ZRKA 2JETB 5FL7D 2B5TB 3PO1C 4ZKOU 2GDDA 4WY3A 2GT7A 1KY9A 4KKDA 1AZ8A 1P8VC 4CREA 1GDUA 3U69H 2PKSB 1HAHH 1P2NA 2IOTA 2P94A 4Q63A 3A8DA 3PLKA 1HBTH 2ZDAH 1CBWC 1GI0A 1ZTKA 1MAXA 2VGCB 3UPEA 4AORA 1DX5M 4GHTA 1FQ3A 4DW2U 4D76A 3ZVEA 3HK3B 1Y3XA 4BAMB 2OUAA 3T27A 3SU5A 2ESTE 1EAXA 3SOSA 1C5PA 2BTCE 3GY5A 1NFXA 2FDAA 1WQVH 5I25A 4MPXA 3TGKE 4ZXYH 1O2JA 1TPOA 3M36A 4GSOA 2STBE 2BD2A 1ANDA 1P2QA 1TMTH 4TSFD 3ATWA 4YT6H 4HTCH 3MO9A 1SGQE 2O8MA 2OINA 4B76A 4K1TA 1MCTA 2BY7X 2J34A 1ZPZA 1Y5UT 2ZU5A 3S7HB 1JIMA 1ZRBA 1QQ4A 3IG6B 1SR5C 5FPTA 4ABAA 2ZFSA 1GHYH 2GV6A 1BMFD 3P70B 3RXDA 1AMHA 3QGNB 3A89A 3P8FA 2P95A 4HZHA 1FN8A 2JH0D 3DFLA 2KM0A 5AFYH 4I7YH 2BQ7B 1BMMH 5A8YA 2ZGHA 3E3TA 3RXKA 3SUGA 3F9GA 4NG9H 2QY0B 3A86A 1ELTA 2BDIA 1RIWC 1GDNA 3A82A 3TH2H 4J1YA 1JWTA 2RA3A 3GCNA 3MNCA 4Y6DA 5EIYA 1YC0A 1UTMA 1BDAA 3VXFH 2XNIA 3TJVA 4ZHLU 1SLVB 3CENA 2G8TA 3LGTA 1CO7E 3MNXA 1FAKH 1WAYB 1GI9B 5GCHG 2UUYA 4MNXA 2GV7A 1A3BH 1KLJH 1S6HA 1W10U 2YNAA 4AZ2B 3P95A 2A5KA 3GCTF 4GAWA 2QXHA 3BTHE 1EAWA 4FVDA 1K21H 1O2TA 2PSYA 1TYNA 1N8OC 1VGCB 2FODA 5JYIA 1YPKH 1SFQB 1O3KA 1W13U 1EPTC 1KLIH 2ZTXA 4ASHA 3QUMP 1B7XB 1W11U 1J9CH 1LHEH 1OS8A 3F0PA 1ESTA 4RT0A 2BOKA 4Y11E 4WVPE 1O5GH 2EI7A 2Y6TA 1NN6A 1TQ7B 5F8ZA 3NRLA 3KQDA 3S9AA 2Y80A 3H7TA 3PRBA 4OS4A 1FJSA 5A0AE 1W0YH 1ETRH 3MWIU 1FLEE 1H8HD 1AQ7A 1GBMA 1K1NA 3QN7A 1SGFA 1CHGA 1G9IE 1XUGA 2BYAX 4BAOB 1AVWA 1J8AA 1BOQA 3MU4A 3H5CB 3LGUA 2JH5D 3S9BA 1S6LA 1SGPE 1KMHB 2Y7ZA 1CGIE 3FP8E 1HCGA 2G81E 2VIPA 2Y81A 3ZZAA 1TOCB 1WUNH 4ZCNA 2FI5E 2A4QA 1C5LH 1MTNB 2HLDD 2LP6A 5J4QA 3MTYA 3SHCH 1P2MA 2XW9A 1O3IA 5EGMA 1BHXF 2BMGB 1HRTH 1V2LT 4XD7D 1GMHG 5FPYA 3AASA 5EJZA 3RXBA 1UO6A 1O5DH 1YF4A 3RXAA 1H8IH 3PMBB 2AYWA 1NROH 4OS2A 4JZDH 3O8BA 1C2IA 1PPCE 3S7KB 5EW2H 1C5OH 4OS7A 3HGNA 2RFKC 3DSPA 1Q31A 1F7ZA 3PV5A 5IK2D 1NFUA 2KCOA 5GDSH 1FX0B 2CMYA 1DOJA 4NFFA 1TAWA 1LKBA 2FOBA 1BTPA 1WTGH 1PPHE 2XXLA 2Z3DA 1T32A 1SHHB 3RMMH 3SZEA 3SYJA 3TIUA 3ESTA 2NWNA 4TY6A 5C0TA 4DT4A 4LOYH 2ZTZA 1EZQA 4IS5A 3AAUA 2R0LA 1RJXB 3GY6A 4XFQA 4TPYA 1FXYA 1LDTT 2VBCA 1LHDH 3P6ZB 4ZHAA 1TPPA 4A92A 1AE5A 3N99A 2AIPA 1OWHA 4NGAH 4IC6A 2ZFRH 4DOQA 2Y5FA 4JYUH 1DWDH 5JB9S 3AW0A 1O5AB 4MTBA 1TNHA 5AHGH 2DE9A 2DE8A 3BG4B 3VPKA 4CH2B 1EKBB 5GJ4B 4YZUA 2ZU1A 3LGWA 1DUAA 3TK6A 2J4IA 3F3BA 2Z3CA 2V35A 1XUKA 3FN8A 5K7RA 1QHRB 2PKAB 2WV9A 2HALA 3ODDA 1LO6A 3ZZ8A 1TPSA 4ACAA 3EGKH 1NRSH 2QYIA 3PWBA 5EQRA 3B9FH 4CRDA 1GJCB 1TE0A 3PO1B 3U8TH 2PFEA 4O3TA 6GCHG 1PYTD 3UTUH 1XKAC 3LGYA 3M5OA 3SU1A 4AGKA 2FXRA 3L6PA 1C1SA 4U32A 4A1VA 1V2OT 4PROA 3FKSD 2AHME 1C1TA 2ZHFH 1G3BA 4AX9H 1H4WA 1V2TT 1ZMLA 1RGQA 3A8BA 2JH6D 2PWXA 3GCHC 1AO5A 1EB2A 1ELGA 2H5CA 2ZCKP 4NIVA 1EXFA 3PMHB 4GPGA 4ACBA 4YO9A 3SU6A 5DP4A 5F8XA 1DLEA 3KL6A 7GCHG 1S0QA 1NT1A 7KMEH 3AVZA 3T28A 3VGCC 4CR5A 1NFWA 4Q2KA 1C2KA 3V12A 2RDEA 2WSSD 3NCLA 1PPZA 2PSXA 1OOKB 3E1XB 3M3TA 1S83A 1F0RA 1ZHMA 3LONA 5EW1H 3TK9A 3LKWA 1C5WB 3E8LA 3OEED 5CHBA 2BD8A 2XWAA 1YPHC 2VH0A 2ZU2A 1DM4B 2QC2A 2BLOA 3S9CA 3GCTG 1DWEH 1EFRD 8KME2 4UEHH 1V2WT 1IQLA 5JBBS 2G52A 5F03A 2EEKA 2A32A 4AB9A 2CHAC 4O9VA 1QNJA 1TRMA 3ODFA 4I32A 1GPZA 3OTJE 4SGBE 1QURH 1GBEA 3GS9A 4WMFA 1GCDA 3GDVA 3KN2A 1BT7A 3D49H 4BAHB 1FY4A 3M37A 5DO4H 1YP9A 3FO8D 4R0IA 2W3KA 4A1XA 2TRMA 1GI2A 1CGJE 2Y7XA 3M5LA 1QBOA 1AI8H 3T26A 1XUFA 2ZWLH 1V2UT 4Z6AH 1ESBA 3SHAH 3RMOH 1K22H 1GBTA 1H9IE 5ABWA 3E90B 3BTQE 4K60A 4CRAA 4DIHH 4NZLA 3T62A 5FHTA 3PMAB 4WH6A 3EA8A 5K0HA 2Z9IA 2PUXB 1CE5A 2JIZD 2O8LA 3SBKA 5IDKA 1TNIA 3F0OA 4E7RG 1W8BH 1DVAH 2RCEA 4MLFB 2G4UA 2NU0E 3UOUA 2HGTH 2A4RA 1MBQA 4AN7A 3FOAA 1HAIH 1HAGE 3MH7A 1TGBA 4FUEA 5KEDA 1GI1A 4RN6A 5KGOA 2R0KA 2DUCA 4MNWA 4SGAE 4FUFA 1C5XB 3KF2A 4GVUA 2KFWA 1EUFA 2F91A 1D3TB 1H1BA 1QJ6B 2AS9A 5I46H 3F9HA 1WDIA 5F8TA 1DSUA 1P09A 3STJA 1MZDA 1SGFG 1NFYA 1KXEA 5EOKA 1P06A 4OM9A 3EYDA 4NFEA 3SGAE 1NM6A 1W14U 1O0DH 3TJOA 2QAAA 3VFEA 2STAE 1O35A 1EOJA 3ZZ6A 2BDGA 2HPQH 1ZPCA 2HPPH 3K2UA 1HAXB 4NA7A 2ZEBA 1BTYA 3NWUA 1ELEE 6CHAB 4X2XA 5JPMH 1QL9A 2QF0A 1MU8B 3LPRA 3SNDA 3SUDA 2C4FH 3UR9A 4CBNA 1MKWK 1HIAB 2W7SA 4D7GA 3UY9A 2GZ7A 2IPHA 4KTCA 2OTVA 3AW1A 4A7IB 4K1EA 1L1GA 5T3HA 1AWHB 1MKXK 2ANWA 3PB1E 4OS1A 1NU9A 1B5GH 3SJ8A 2I6SA 3P8GA 1FAXA 2XC0A 3SJIA 1GGDB 5GNDA 2BVRH 2OC0A 2WV5A 3ZZ5A 3UNSA 1PPBH 5CHAB 3BSQA 2TGDA 1O2QA 4NIXA 1YWUA 1LQDB 3ZVBA 1GCTC 3TVJB 4TT3D 1Z8RA 1O2KA 2QCYA 4XBCA 3U9AH 3GY2A 1V2ST 5A2MH 1UK4A 1UTNA 1O3FA 2AMDA 3BTME 4P02A 1O2RA 4BTTB 2WPJS 1V2VT 2FOAA 1BA8B 1BRUP 1ABJH 1C2GA 1TONA 4P00A 1O2VA 4NWLA 3ELAH 1BBRE 3DD2H 4D7FA 3TNSA 4GHQA 2AGEX 1KTSB 1TGNA 2PUQH 2O8UA 4WMDA 4DGJA 1G30B 1CA0C 2PW8H 4BTIB 1F92A 3UFAA 2H1UA 3NKKA 1EJAA 2ZKSA 5DSFA 3PYHA 2C3SA 1DS2E 1V2NT 1A4WH 1SLUB 1UVOA 2GX4A 2FX6A 4NCYA 4NIWA 1SQOA 3BG8A 1HB0B 5J4SA 1LVMA 3FP6E 2GD4B 2GT8A 1VJAU 1SLWB 2XBXA 4X8TH 2Y5GA 2ZTYA 2HNTC 1O3LA 5AVDA 5F53A 4Y8XA 1GBCA 1CSOE 2QA9E 3PMJA 1O3CA 1GI4A 1GVZA 2FM2A 1DY8A 1YPMH 5AFZH 4X1PU 2YNBA 2QGRA 1Z71A 2PKAA 1MUEB 3EA9A 2FEQH 1YPGH 1O3DA 2ZF0H 2VVVA 4GLYA 3S0NA 3W1EA 4A6LA 1GG6B 3BV9B 3MU0A 2PR3A 3RXRA 2WUBA 2P8OC 1GI8B 2WZQA 2EI6A 1TB6H 2GVFA 2ZDVH 1T7CA 1VCWA 3C27B 3ZIAD 5GXPA 5GWZA 1FZZA 1NC6A 3T29A 2IPQX 4ABJA 1KIGH 5LPRA 1E0FD 3EQ0H 1E38B 1GMHF 4BXSA 1TX7A 1TABE 3CS0A 1O3OA 2ZU4A 2NU2E 2FOHA 3VB3A 2CGAA 2FOEA 3URDA 2J5UA 3F2GA 2FTMA 2P59A 3KQ5A 1TMBH 3A7WA 4X0WU 1EAUA 3AAVA 4JCNA 2BQ6B 1Q2WA 2EY4C 2EA3A 3GYMA 1MTSA 1C2HA 1GI6A 3DCLA 1W7XH 3LJOA 2F9BH 2XYAA 1PQ7A 3A7YA 2I6QA 3Q00A 4JK6A 4B74A 2XC5A 2ZHQH 4IN2A 1GI3A 1SG8B 2CHAB 4FETA 1AD8H 3TPIZ 1DSTA 2LELA 3GY3A 2ZHEH 2J98B 3A81A 3B23B 5HIYA 3A7XA 2C8WB 4AFQA 7ESTE 2PLXA 1UW7A 1S6FA 2Z3EA 4J2YB 4JMYA 3UIRA 1M9UA 3Q77A 2BZ6H 3UQOA 1HJAB 2PGQB 5ESBA 2W5EA 3RMNH 3Q3YA 3RXTA 1ELAA 1FY3A 1P2OA 1ANBA 2QF5A 4NZQA 2PV9B 2CK3D 2Z9LA 3OU0A 3BEFB 1WOFA 2JJ2D 5DN6D 1SQRA 2J38A 2VVCA 1DANH 1BZXE 3U8RH 3UR6A 2SGPE 1P01A 3GOVB 4JZIA 3PV4A 4FOUC 1KXDA 4CRFA 2FTLE 1C2EA 5HKKD 1P9SA 4Z0KA 4X1NU 1G3EA 2BXUH 2F9VA 1A3EH 6GCHF 2GDEH 4X1QU 1D3DB 2AFQB 5EXNA 4AG2A 1NS3A 1SSXA 1BQYA 3ZZDA 1K1MA 4CRBA 4VGCB 3PRDA 1BMAA 4ABEA 5FCKA 4BAQB 1U6QA 1O3MA 1HAPH 1QRWA 1NU7B 3E16B 3MI4A 1ZHRA 5GPIB 1E34B 7GCHF 3RU4T 1PJPA 3ZZCA 4K5ZA 3QZRA 1T31A 1FMGA 1OX1A 1QA0A 2GMTC 1GL0E 4ABIA 5DP6A 3QTVH 4WXVA 2HLCA 4MNVA 3QWCH 2WHXA 3URCA 3FVFB 5EJ1A 2W3IA 3BTFE 5DP5A 5HMAA 3SNBA 1Y3WA 2BDAA 1SHYA 2A1DB 4Q80A 3A84A 2ZDNA 1F0TA 1SPJA 3P8OA 3KCGH 1HIAA 1CQQA 1P57B 4GUXA 3VB7A 2ANKH 1SQTA 2FMJA 3EDXB 1Z1IA 2WPKS 3U28C 1HFDA 5CE1A 2C90B 4DG4A 2OD3B 1J15A 3Q3KA 1AB9C 2ZGXH 2ZI2H 3L3TA 1C5YB 1UK3A 1NRNH 3B8JA 1BTUA 2BY8X 1O3BA 1FY1A 3NXPA 1THPB 4O03A 2A7CA 1LCYA 4X1RU 1ETTH 4O3UA 1VJ9U 1MTWA 1X7AC 4DY7B 1K28D 5EXLA 1DITH 1B0FA 1BRCE 1P02A 1T8LA 1IQNA 4NIYA 1N6YA 1GBFA 1O2YA 2G5NA 2P93A 3QTOH 1ZMJA 3HK6B 3ZVFA 2D8WA 1C5QA 1HYLA 1OYQA 4CRGA 1KTTB 1CA0B 3LH3A 4ZH8A 2VJ1A 1A0HB 1EASA 1TX6A 3MU5A 1B0EA 1AIXH 4WJG2 2F9PA 5E0HA 3SN8A 1KXFA 2H5DA 3WY8A 3SJ9A 4YESB 4AG1A 1H8DH 3A85A 1GDQA 3RLYH 4XBDA 3Q76A 1DT2A 2FPZA 2A4GA 1ANEA 1QL8A 1GBIA 1QY6A 2FX4A 4OS6A 1XXFA 4LZ1H 1UHBB 1GHVH 1TOMH 1YLNA 1SLXB 2YMSD 2H9HA 1C1VH 1D3PB 1HXFH 1HJ9A 2TGTA 1YCPM 4F4OC 1C5ZB 1WV7H 4RKOB 4X1SU 1A0JA 4Y79A 3IWMA 3BN9A 2YOLA 1BCUH 5DP7A 4ZKSU 1BBRK 3MNBA 3MO6A 3RM0H 3RXHA 2J94A 1A5GH 2A45B 4JK5A 3SORA 4H6SB 1Y59T 1MU6B 1GJAB 4LXBH 5C1UA 1RTFB 2QXGA 3K6YA 3UWIA 4HFPB 5C1XA 1EOLA 1TNGA 4X2VA 1P12E 1G2MA 1UTKA 1GBBA 1IQKA 1GBDA 2OP9A 3VG8A 3ATMA 4IMZA 2NU1E 1GJ9B 3EE7A 3SQEE 2G4TA 4Y71A 5DP3A 1P9UA 3RM2H 2G55A 1UTJA 2VWMA 3RXPA 3KQBA 5A09A 1GJBB 1EQ9A 4JYVH 1AUTC 4FUCA 1BUIA 2F9NA 2OQUA 4FU9A 2SNVA 4Y10E 5LGOA 2FP7B 2OBQA 2ODPA 3EE0B 5HYOA 2LNCA 2IN2A 3VB4A 1TLDA 3RXSA 1VITF 3FANA 3RXMA 3E0NB 1AFQC 1P2JA 2BZAA 3ATIA 2FOGA 5EPNA 5DPAA 2QN5T 1EZUC 1BB0B 3SGQE 2SGFE 3RP2A 1SGNE 2P3FH 1K1IA 1HAZB 3RXUA 1O38A 1V2RT 2KX4A 1YPEH 2CXVA 3N7OA 1ZSKA 3SU4A 4DJZB 4XRNA 2GZ8A 2WUCA 1EP5A 1SI5H 1BTHH 3MMGA 1A5HA 2V3HH 4KTUA 1OHHD 4I8GA 2ANYA 3UNQA 1CBWB 1HLTH 4BTUB 1TIOA 5FX6A 4BXWA 1IQMA 3KGPA 2Z9JA 2BX3A 5FBEA 1CT2E 1J14A 1NRRH 4ZAEA 4UFDH 1PQ8A 1GHXH 4F49A 1T8MA 3OE7D 3FFGA 3RXOA 2BX4A 1SBWA 2J98A 4CBOA 5C0UA 1A2CH 3TITA 1G37A 3PLPA 1O5FH 2EQNA 3BTTE 1XMNB 4CHAC 3BEIB 1D3QB 2G51A 4UD9H 2F43B 1E36B 2Z9GA 4FUBA 4YXWD 1NO9H 1Z8GA 2CJIA 4KELA 2A5IA 1W0KD 1NESE 1ZGVA 1C5UA 4ISNA 1FDPA 4YLQH 1CU1A 1YPLH 2XOKD 3M7QA 1IHTH 2GP9B 3MH4A 1O3PB 3SJOA 2ZZUH 1W2KH 4Y8ZA 1YCPK 2FI4E 3UNRA 4ZUHA 1TPAE 3ZZ3A 2TPIZ 1HAVB 2UUKB 2XBVA 2PHBA 4AGJA 1WQSA 1UK2A 2KR7A 1YGCH 3HKJB 2F9UA 1KDQA 2ZDMA 3MHWU 4YOGA 2FI3E 1GI5A 1TRNA 3BIVH 1AUJA 2RA0A 4DT7B 4B73A 4YLUA 5CDFE 3F68H 1ZSJA 3DT0H 2H6MA 3M61U 2JJ1D 3ZYDA 4ZXXH 4ASUD 2Z6BD 3P8NA 5ETXA 3NK8A 1FNIA 3MYWA 5T1VA 5C5NA 1O3JA 1GJ6A 1RIWB 2H2ZA 3M7TA 4AFUA 2GMTB 1QTFA 1K1OA 3OY6U 2PKSC 3BTDE 2CN0H 5E0GA 1WBGB 3N7DA 3LIWA 4BANB 3EAJA 4E05H 1C2MA 4X6OA 1P03A 1T4VH 3SV8A 1YPHE 1ID5H 1L1NA 1INCA 1C9TA 2CF9H 4X2WA 3SV9A 1SGEE 1MZAA 1XXDA 4FU8A 1C1NA 2BD3A 2VWLA 1DY9A 1VCQA 2ZCLP 1N8OB 3GDSA 3V13A 3MFJA 3P92A 1EPTB 1OWKA 3OFND 1UCYE 4F48B 4XDEA 2AGGX 3MH6A 1AN1E 1IQEA 2WPLS 3L33A 4CR9A 3QO6A 1AU8A 1KLTA 3UB0A 3UUZA 1Z1JA 3V3MA 5B6LA 4JZEH 2V0BA 4FXGH 3FAOA 2ANMH 2J9NA 1XVOA 3SI3H 1RTKA 2FYQA 2BDCA 4I31A 1VZQH 4KTSA 1QZ8A 1CA8B 2M5TA 5T6GA 4OS5A 2HRVA 2WPIS 2XRCA 3RLWH 3ZVDA 3O8CA 3KYGA 3CS7A 1GBLA 2AMPA 1C2FA 2XBYA 2B9LA 1KXAA 3UREA 1VCPA 1A0LA 1W0ZU 2XNDD 3ENSB 2IJD1 1ARCA 1IQIA 1DXWA 1BTWA 3I77A 1EP6A 1NRQH 4WMEA 1BITA 3U98H 1EJNA 1G3DA 5C1YA 2AGIX 4FUJA 5TCCA 3W95A 4MDSA 1F2SE 2H9EH 3A87A 1S82A 1FY5A 1BJUA 1SVPA 1LPGB 1SGDE 5T6FA 2D26C 1N1LA 1RTLA 1ZMNA 2VB0A 2AMQA 1GBKA 4D8NA 1OPHB 2ODYB 1P3EA 1PPFE 1BTXA 2QF4A 2RDLA 4B2AA 1FIZA 1GHBF 1VITG 2IJOB 5C94A 1WU1A 1NBME 1P0SH 2O8WA 1O2MA 1BJVA 1GJDB 4NA8A 1NPMA 2GGVB 3GY7A 1XUIA 1JXPA 1P2IA 1UHBA 2KAIB 1XX9A 4NSYA 1FN6A 3BTEE 1N6XA 1GHWH 3RC5A 3SU0A 1AZZA 2ZO3H 5HXFA 1D4PB 4X2YA 2B7DH 1A5IA 2OCVB 1DE7H 2FYRA 2OQ5A 1BHXB 5FX5A 2WV4A 3DHKH 1TBQH 3LC3A 1BBRH 3RXLA 3SQHE 4YM9A 1SGCA 2QXJA 3QX5H 1HJ8A 1TX8A 1LHGH 4YT7H 1WYKA 3RXGA 1O2OA 1UMAH 1SQAA 4RKJB 1K0HA 3TK5A 1Z6EA 4RT1A 4H6TA 1MTVA 4K1SA 4XOJA 4K2YA 2OXSA 3LH1A 4ABDA 3U8OH 1ZLRA 1EX3A 2QE7D 3EA7A 3VXEH 3M5MA 1OWJA 1E1RD 2BVSH 1GBJA 9ESTA 1C4U2 2BXTH 2OC8A 1F5KU 1UTPA 1TGSZ 4IW4E 3PTBA 5H4IB 1UVUH 2B0FA 1O2PA 1MTNC
chains in the Genus database with same CATH topology
3ZZ4A 4INKA 3D23A 1DWCH 2ILNA 1QRZA 2J2UA 4FUIA 1PFXC 3DA9B 2BY5X 1D6RA 1DDJA 3T25A 1FY8E 1QQUA 5E0JA 1TA6A 2W6ID 4Z1MD 1GJ5H 5TCAA 5LPFA 4TYDA 1DFPA 3GY4A 3KQEA 4WXIA 4Y0YE 1BIOA 1O37A 3ZZ9A 2ZFFH 3V0XA 3OTPA 2ASUB 3K9XB 3DSOA 3GCHB 1MMJN 3KQCA 1OSSA 3V7TA 3KHVA 3I78A 3M7UA 4ESTE 1SB1H 3SNEA 2YMSC 1LPZB 3GISB 2FLRH 5SGAE 3HGPA 5TJXA 1AE8H 1K9OE 2GCHF 3VGCB 1C2LA 2OK5A 1SGIB 1FUJA 2NU3E 2EC9H 4WWYA 2HNTE 4X8VH 2GZ9A 4AYVB 5EQSA 1WCZA 1TQ0B 1V6DA 3TNTA 1UVSH 2BVXH 1W7GH 1QL7A 1CVWH 1LTOA 1ORFA 1ETSH 2JDID 2TGPZ 5JBAS 1XUJA 2ULLA 5DK1A 1MTUA 2Q6DA 2XC4A 4ISLA 1GI7B 3SU2A 1V3XA 2BLQA 1K1PA 1ZOMA 3A83A 1L4ZA 4DVAU 1LMWB 4B6FA 1HAVA 2C8XB 1HAYB 1O39A 2AH4X 1ZTJA 4MPUA 2ZDLA 1J17T 2BLVA 3F9FA 4WH8A 1K1LA 4XSKU 1HNEE 4YOJA 1G3CA 2ZQ2A 3PTNA 2ALPA 1ELFA 1MAYA 4X8UH 3ZZBA 4I8JA 2ZECA 5LH8A 3W94A 2WYGA 3SV2H 4ZKRU 1PYTC 4ABBA 2G00A 4INHA 3E0PB 2ALVA 3SUFA 1AY6H 3A80A 1T4UH 2R3YA 1YPJH 3FZZA 2PTNA 4UDWH 5C67A 1QRXA 3MOCA 1E79D 2R9PA 3ITIA 2F83A 2ZPSA 1LPKB 3JZ2B 4D9RA 1SMFE 2BD5A 3LDXH 1TBRH 1KDQB 1Z8IB 2P3UB 3U1IB 5L2ZH 1THRH 4WF8A 8LPRA 1ZGIA 2TIOA 2OC7A 3BTKE 1NBMD 2TGAA 2ZFTA 1IQJA 5AF9H 1O3NA 1OP0A 1CHOG 1ELVA 1EPTA 1PPEE 1QIXB 2BQWB 2UUFB 4RSPA 5F6MA 1GVKB 2BY9X 5JBCS 5C17A 1O30A 3FZDA 5E2OA 3H7OA 1T8NA 1GHBG 3LC5A 1KSNA 1CGHA 2VVUA 3F1SB 2K1QA 2BB4A 2VH6A 5FXLA 3VEQB 1QR3E 4MQAA 4Q4LA 4BOHA 2B8OH 4Y76A 1O32A 4ABGA 2Q1JA 4KP0A 1MBMA 1MQ5A 3KEEA 4M9FA 1W3CA 1AKSB 1SC8U 2GCTC 1O34A 1D9IA 3HPTB 3IITA 1KYNA 2OLGA 1UCYK 3PROA 4B6EA 2AEIH 2A7JA 1MKWH 5EODA 1C1WH 2V7QD 2SGDE 2EI8A 3NUMA 4UONA 3ZZ7A 3VB5A 4XBBA 4FUGA 3UQVA 4GCHG 1MKXH 1RS0A 1QB9A 3M3SA 5G4BA 4YTAA 1Z7KA 1WXRA 1GCTB 3BIUH 1EZSC 3A8AA 3MNSA 1FPHH 1MCVA 3CP7A 3T2NA 2P3TB 3LT3A 1GWAA 2SNWA 4BAKB 1GHAF 4OGXA 1ZYOA 4I8KA 1JOUB 1L0ZA 4U2WA 1GJ8B 1CT0E 1S85A 2GKVE 3AK5A 4ZHMU 1Y8TA 1O3AA 2KAIA 1O2WA 2VIVA 1UVPA 2P16A 4JZFH 2L6OA 5A0CA 3DFJA 2GTBA 1P10A 2QXIA 3SW2B 1SKYE 4LZ4B 5PTPA 1JBUH 1L4DA 3LOXA 2PTCE 1O2LA 3NZIA 4IN1A 3RXJA 4Q7ZA 1YYY1 5C3NA 3A88A 1Q3XA 1FPCH 3RXVA 2K8IA 1TMUH 1O2HA 1FONA 1FI8A 2KCAA 4R8TB 4Y0ZE 4B1TA 1GBHA 1P3CA 2OBOA 3I29A 6CHAC 2GCHG 1P2KA 5E8EH 2KCYA 4AFZA 1C5MD 4ZMAH 1TALA 5B6OA 4MPWA 2SGAA 3TJUA 6LPRA 4NWKA 3SU3A 1Y5AT 3SO3A 1G2LA 1Z6JH 2BY6X 3Q3XA 3N7EA 4THNH 4E7NA 1E35B 1EZXC 2KZ4A 3RXFA 1ESAA 1EAIA 3STIA 1V2MT 1GGDC 2ZGBH 4UFFH 1C1MA 1PPGE 1S5SA 1V2PT 2XCFA 6ESTA 1HGTH 2FESH 2P8OB 5A0BA 3LU9B 3LGVA 4QT8C 5CHAC 1E1QD 5EG4A 1LKAA 1GMDF 2FO9A 3TU7H 1XM1A 2ZC9H 2AERH 1C2JA 1FV9A 4H42U 3GY8A 1GJ7B 2H9TH 2YMSB 2CV3A 1AVXA 2VIWA 3UWJH 1G36A 3H09A 4HI3A 1Z8JB 4TWWA 4DIIH 1C1PA 2ZGJA 2O9QA 1O3GA 2BDYA 2ZHDA 2ZU3A 3OAAD 2ZQ1A 1H8ED 1DUEA 3O8DA 4AYYB 1H9LB 1K1JA 5FPSA 4FUDA 1IAUA 1K2I1 4TWYA 1DXPA 1F0SA 1S81A 1YLDA 2A5AA 3RXEA 3GICB 1AHTH 3D62A 2PGBB 1O2GH 3R0FA 3SV7A 1NTPA 2KCPA 3D65E 2WINI 1L1JA 1YLCA 2AIQA 1SGTA 4X6NA 4A5TS 4LK4A 3SI4H 1JMOH 2WPDD 4UE7H 3ATLA 4D9QA 3O8RA 1UTLM 2Q6FA 1J16A 1TBZH 1ACBE 3BEUA 4X6PA 1BTZA 1O2NA 3ZVGA 1OWEA 1GG6C 1O2SA 8ESTE 3SZNA 2XCNA 4ABHA 1DICA 2VWNA 2Z7FE 1YM0A 3VB6A 1RFNA 1GL1A 2Y82A 1AVGH 2D1JA 5DJ7A 3SJKA 2W7UA 3A7TA 1C5NH 2RG3A 1LVBA 5BRRE 1ELBA 2ZIQH 2OC1A 5L2YH 5FBIA 3F2HA 1PQAA 1VR1H 1O2IA 1C1UH 1O33A 1TGCA 2R3UA 3A7VA 5EPYA 1VITH 2G5VA 3R3GB 2UUJB 2QF3A 3DUXH 7LPRA 9LPRA 4CRCA 1YKTA 4B75A 4K3JA 5HM9A 2A7HA 1MD8A 1QB6A 1THSH 2QV1A 1P11E 4Y7BA 3WWFA 2ZDKA 2XBWA 3RU4E 2V6NA 2Q6GA 3TGIE 5DG6A 5LPEA 1A1RA 4TPIZ 4B2BA 2UWOA 3F9EA 2FOCA 1C4V2 1IQFA 2VU8E 4IGDA 2K0QA 1O2UA 2ZPQA 4A1TA 2JETC 4CH8B 3MU8A 1C1OA 4MVNA 1LQEA 1SOTA 4I33A 1V2KT 4I8HA 4IBLH 4ISHH 2XWBI 2BDHA 3TGJE 4Q7YA 3HATH 1GHAG 1KXCA 1ABIH 3JZ1B 1G32B 4X8SH 3F6UH 5FAHA 1C4Y2 1H9HE 4DURA 1Y5BT 5DGJA 2C8YB 1ZHPA 3GDUA 4K69A 2BHGA 3PWCA 2BD7A 5C5OA 5CMXH 1JRTA 1P05A 1LHFH 2GCTB 2QIQA 2VGCC 8GCHF 1F0UA 1GMCF 5EQQA 1TFXA 1O3EA 5IYTA 3OY5U 4M7GA 2HWLB 1L2EA 1AKSA 1HJAC 2JKHA 3KIDU 4MPVA 4U01A 4AB8A 3QGJA 3P17H 3PM3A 4JYTA 1O3HA 3WW7A 2A4OA 3SV6A 2ZG0H 3T5FH 1P04A 1RXPA 2W6JD 2C8ZB 4FU7A 3E91A 1AB9B 1UCYH 5GIBA 5HM2A 2C93B 1OP2A 3SUEA 1IHSH 1HAOH 5C2ZA 2VIQA 1NY22 1COWD 1HXEH 1O5BB 1QFKH 1TNLA 4K8BA 3QLPH 2HVXA 3ZVAA 2FOMB 1ZTLA 3ZYEA 2ZA5A 2FIRH 3RMLH 3ZVCA 3F2FA 2FWWA 4YOIA 1YBWA 3RC6A 1AWFH 1OYTH 1O5EH 1KXBA 3PLBA 4VGCC 1TA2A 1OP8A 1BRBE 2VWOA 5L6NH 5A8ZA 1BMNH 4IMQA 1SGYE 1O2XA 3LJJA 2FZZA 1QCPA 4JZ1A 1ZPBA 1AGJA 2Z9KA 1HPGA 3M3VA 3TJNA 1GMDG 1MH0A 2SGQE 5EU8A 3QDZB 4H4FA 4Q7XA 1OWDA 4ISOA 1E37B 2ZCHP 3ATKA 1HUTH 2FOFA 1EATA 2Z94A 4AFSA 4ZROA 2VINA 5JDUB 1O2ZA 2BDBA 5BPEA 1QGFA 1XKBC 1MD7A 1UJ1A 3HKIB 4X6MA 1CHOF 2D2DA 2R2WU 2V3OH 4Y7AA 4ISIH 2LPRA 1JRSA 1QBVH 2F9OA 1S0RA 2CF8H 2BD4A 1C5SA 1ZJDA 3BTGE 1Y3UA 2W26A 2HOBA 1TNJA 2ZNKH 1ANCA 4O97A 2Y5HA 2BLWA 3NPSA 2BM2A 3S69A 3WWBA 1QB1A 4TY7A 1C5VA 1VGCC 5E2PA 2UWPA 5DP9A 1SFIA 2WPHS 4UFEH 4F55A 3QZQA 3TLOA 1CT4E 1HDTH 1NRPH 2ZFQH 3TH4H 3MU1A 3OEHD 1ARBA 1QJ7B 2A2XH 1OKXA 3K6ZA 3K65B 1A61H 4ABFA 4B2CA 3BF6H 2A0QB 1C9PA 1S84A 1C5TA 1SL3A 1IOEA 2M2AA 2ZPRA 2F4LA 2O8TA 3RC4A 4BNRA 2NU4E 1LVYA 1RD3B 1V2QT 3GYLB 4OGYA 4ZKNU 2J95A 3RDZA 2HNTF 3UOPA 2R2MB 4INLA 1V2JT 1JIRA 3MO3A 5ESTE 4AOQA 4IC5A 4MG3A 1FIWA 1Y3VA 2FS9A 4GCHF 1GVLA 1A46H 1NZQH 5GCHF 1DPOA 1O5CB 4NA9H 3LGIA 1F5RA 1XVMA 5DP8A 2VNTA 1TWXB 1AFQB 1TRYA 1BMLA 1QBNA 2FS8A 4U30A 1TNKA 3U1JB 4MNYA 4DCDA 1ELDE 2VIDA 4XE4A 4NSVA 2WPMS 1DLKB 1UTOA 1BRAA 4UFGH 1WTHD 1D6WA 1AFEH 1TGTA 1T8OA 3BTWE 2VIOA 5FCRA 3RU4D 1QJ1B 1O36A 1C1QA 1GJ4H 3E6PH 1EJMA 1QA7A 3A8CA 1XUHA 3OX7U 1UTQA 5DKMA 3KNXA 4HGCA 3RXQA 2ZP0H 1F5LA 2WYJA 1EB1H 3RXIA 4E06H 2SGEE 4B71A 1ELCA 4FUHA 1C1RA 1HV7A 3OYPA 1DWBH 3GCOA 2BD9A 1IQHA 2ZGCA 1RRKA 4I8LA 1LVOA 5HGGA 1MABB 4CHAB 1W0JD 2UWLA 4KGAA 1OXGA 2THFB 1ZSLA 3TH3H 4RI0A 5JB8S 3OSYA 2SFAA 3SNAA 1W12U 1ZJKA 1GBAA 1OWIA 3SNCA 3M35A 1PQ5A 1UVTH 4FVBA 3C1KA 5JBTA 1WSSH 2ZHWH 2FLBH 5A8XA 1GHZA 2ODQA 1Y3YA 3A7ZA 8GCHG 3PV2A 3RXCA 1GMCG 1ZZZA 2XTTB 2A2QH 2ZFPH 1A7SA 1ZR0A 4Y8YA 1IQGA 4K8YA 2A31A 5L30H 2F3CE 3BG4C 3ZV8A 3SGBE 5T6DA 3ZV9A 1C2DA 1SGRE 1YCPH 3RUOA 2BOHB 1SOZA 5EXMA 2J92A 5C20A 1C5RA 3G01A 3QK1A 2TBSA 3M5NA 3MH5A 1MQ6A 3FP7E 1O31A 1LHCH 1ZRKA 2JETB 5FL7D 2B5TB 3PO1C 4ZKOU 2GDDA 4WY3A 2GT7A 1KY9A 4KKDA 1AZ8A 1P8VC 4CREA 1GDUA 3U69H 2PKSB 1HAHH 1P2NA 2IOTA 2P94A 4Q63A 3A8DA 3PLKA 1HBTH 2ZDAH 1CBWC 1GI0A 1ZTKA 1MAXA 2VGCB 3UPEA 4AORA 1DX5M 4GHTA 1FQ3A 4DW2U 4D76A 3ZVEA 3HK3B 1Y3XA 4BAMB 2OUAA 3T27A 3SU5A 2ESTE 1EAXA 3SOSA 1C5PA 2BTCE 3GY5A 1NFXA 2FDAA 1WQVH 5I25A 4MPXA 3TGKE 4ZXYH 1O2JA 1TPOA 3M36A 4GSOA 2STBE 2BD2A 1ANDA 1P2QA 1TMTH 4TSFD 3ATWA 4YT6H 4HTCH 3MO9A 1SGQE 2O8MA 2OINA 4B76A 4K1TA 1MCTA 2BY7X 2J34A 1ZPZA 1Y5UT 2ZU5A 3S7HB 1JIMA 1ZRBA 1QQ4A 3IG6B 1SR5C 5FPTA 4ABAA 2ZFSA 1GHYH 2GV6A 1BMFD 3P70B 3RXDA 1AMHA 3QGNB 3A89A 3P8FA 2P95A 4HZHA 1FN8A 2JH0D 3DFLA 2KM0A 5AFYH 4I7YH 2BQ7B 1BMMH 5A8YA 2ZGHA 3E3TA 3RXKA 3SUGA 3F9GA 4NG9H 2QY0B 3A86A 1ELTA 2BDIA 1RIWC 1GDNA 3A82A 3TH2H 4J1YA 1JWTA 2RA3A 3GCNA 3MNCA 4Y6DA 1YC0A 1UTMA 1BDAA 3VXFH 2XNIA 3TJVA 4ZHLU 1SLVB 3CENA 2G8TA 3LGTA 1CO7E 3MNXA 1FAKH 1WAYB 1GI9B 5GCHG 2UUYA 4MNXA 2GV7A 1A3BH 1KLJH 1S6HA 1W10U 2YNAA 4AZ2B 3P95A 2A5KA 3GCTF 4GAWA 2QXHA 3BTHE 1EAWA 4FVDA 1K21H 1O2TA 2PSYA 1TYNA 1N8OC 1VGCB 2FODA 5JYIA 1YPKH 1SFQB 1O3KA 1W13U 1EPTC 1KLIH 2ZTXA 4ASHA 3QUMP 1B7XB 1W11U 1J9CH 1LHEH 1OS8A 3F0PA 1ESTA 2BOKA 4Y11E 4WVPE 1O5GH 2EI7A 2Y6TA 1NN6A 1TQ7B 5F8ZA 3NRLA 3KQDA 3S9AA 2Y80A 3H7TA 4OS4A 3PRBA 1FJSA 5A0AE 1ETRH 1W0YH 3MWIU 1FLEE 1H8HD 1AQ7A 1GBMA 1K1NA 3QN7A 1SGFA 1CHGA 1G9IE 1XUGA 2BYAX 4BAOB 1AVWA 1J8AA 1BOQA 3MU4A 3H5CB 3LGUA 2JH5D 3S9BA 1S6LA 1SGPE 2Y7ZA 1KMHB 1CGIE 3FP8E 1HCGA 2G81E 2VIPA 2Y81A 3ZZAA 1TOCB 1WUNH 4ZCNA 2FI5E 2A4QA 1C5LH 1MTNB 2HLDD 5J4QA 3MTYA