5GJ4B

Structure of ns2b-ns3 protease from zika virus caught after self-cleavage
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
153
structure length
153
Chain Sequence
TDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQLLAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Serine protease subunit NS2B
publication title Structure of the NS2B-NS3 protease from Zika virus after self-cleavage.
pubmed doi rcsb
source organism Zika virus (strain mr 766)
total genus 28
structure length 153
sequence length 153
chains with identical sequence D, F, H
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00949 Peptidase_S7 Peptidase S7, Flavivirus NS3 serine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5gj4B02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5gj4B01
2UUFB 3CP7A 2D1JA 2Q1JA 5JB9S 1Z6EA 3SV2H 3CENA 2VGCB 4AGJA 4UFDH 4Y0YE 4CHAC 4ZROA 1GI8B 1CT0E 3M3TA 1UVUH 2Q6FA 4INLA 3UNQA 3S9CA 3JZ1B 5T6FA 2BDCA 1OKXA 4NFEA 5A8YA 1MAXA 2WPKS 1GMHG 3ATIA 1A3EH 5T1VA 4ZMAH 2VIQA 3MNXA 1C5RA 4MNWA 2GZ9A 2GCHF 2EI8A 1DWBH 1P2JA 2GD4B 1BT7A 1AMHA 5DPAA 2FYRA 1GJDB 4BAQB 4AGKA 3PMAB 3I29A 1K1LA 2PLXA 2HNTE 1S5SA 4D8NA 2A45B 3CS7A 1EZUC 3BG4C 1AIXH 1HAIH 4O3UA 4K8YA 1AWHB 3MU1A 4MTBA 1Y5UT 1GBKA 1P04A 3BTKE 1ZPCA 2ZU1A 1UVOA 5DO4H 2ZEBA 1HAZB 2RDLA 2W5EA 5HYOA 3FAOA 1WV7H 5EPYA 4AFZA 2BQ7B 1GJ4H 1HFDA 4MNYA 4B73A 4Y71A 4M9FA 3GCTF 3LT3A 3F9HA 2H2ZA 1KIGH 1P0SH 1RS0A 4IC6A 1O2YA 2A2XH 1TLDA 1TA2A 1C9TA 2WV9A 1Z1JA 1OWIA 1GI9B 1C2IA 2HALA 2CHAB 2VH6A 1EAIA 1SQAA 3QWCH 1CA0C 3TJUA 1E0FD 4X6PA 4X2YA 2P59A 4ISOA 2TGPZ 1YLCA 1C5XB 1W3CA 2WUBA 1A5GH 5GXPA 2FXRA 2HNTC 1QY6A 8GCHF 4B1TA 3A7YA 1NRSH 1DXWA 1C1TA 3F6UH 4XDEA 1LVOA 4O3TA 2FOAA 2G52A 1F2SE 3BTWE 4H4FA 1THRH 2BX4A 3RMLH 2F91A 5A8ZA 1KTSB 4JZEH 1HAOH 5T3HA 5FCKA 3RXQA 2FS8A 3LU9B 2XC5A 2O8LA 3SU1A 5C1YA 1PPZA 5E2PA 4O97A 3ITIA 2BOHB 2R0KA 2ZCLP 1YC0A 1CQQA 1WQVH 2TBSA 4OS2A 3HK3B 3FP8E 1VJ9U 1MQ6A 1DWDH 1MZDA 1XVOA 1MCVA 1JXPA 1SB1H 4OS1A 3M5LA 1EB1H 1TPOA 2W3IA 1ESTA 1QFKH 3PMJA 1V2NT 1ETTH 1HGTH 1GHBF 5C2ZA 2XBVA 2ZTYA 1O2LA 4CRGA 3ZVCA 3QN7A 1EPTB 4WMDA 1Y5BT 1ELCA 1FXYA 4PROA 4WXVA 5EGMA 3UUZA 4OM9A 3SV8A 4I8JA 4CRFA 5ESTE 1NFWA 5EPNA 1SLXB 4YTAA 2HOBA 3PYHA 2NU1E 5JB8S 1O3LA 5T6GA 2BLOA 1NC6A 4INHA 2JETB 1GHVH 2AIQA 3SQEE 1HNEE 1ARBA 1D6RA 4Y0ZE 1D3TB 1BTWA 2Y7XA 1EUFA 3D23A 4ESTE 1V2PT 1K21H 3TNSA 3A8AA 1O33A 4MQAA 2ODQA 1NFUA 1SLWB 2UWLA 4GLYA 2Z6BD 3CS0A 2Z9LA 2VIVA 3RMMH 3LDXH 1TRYA 1VGCC 1SQOA 2ZWLH 1P2NA 2GV7A 2Q6GA 1QBNA 3AAUA 3LPRA 3V7TA 1EOLA 1Y3XA 4JZFH 1S0QA 2KAIB 2Z7FE 3PM3A 1YF4A 1K9OE 2TGTA 3P6ZB 1RD3B 4NIWA 2W26A 2C90B 2NWNA 5FCRA 1AU8A 5K0HA 4J1YA 5GCHF 3SGAE 1KLJH 2HVXA 4X0WU 1X7AC 5EODA 3DHKH 2FOCA 1BMMH 5DKMA 2BY7X 2FIRH 4NGAH 1FUJA 1TX8A 1AVWA 4X8UH 2TIOA 4K1EA 1L1JA 1W14U 2R0LA 2UWPA 1BTXA 4H42U 1VCQA 5TCAA 2GX4A 3SOSA 1YPMH 1F0UA 2PV9B 4D9QA 4YOJA 1KXDA 4XBBA 4BTTB 1A61H 1VITH 3A83A 2ZDNA 2XBYA 4WH8A 2CF9H 2FOEA 2ZFRH 1QNJA 1YYY1 1AHTH 4NSYA 1CGJE 1DXPA 5GWZA 2GZ8A 4WMEA 2QCYA 3QTVH 3RXSA 3ELAH 4NIVA 1QCPA 1YM0A 4RKOB 5EOKA 2BTCE 4D7FA 2ZZUH 1PPHE 3G01A 3U8TH 2D26C 1ZJKA 3GY6A 4B75A 1XXFA 1RTFB 1C2DA 3ZZ9A 4DVAU 2Y7ZA 2B8OH 3IITA 1HXFH 2F9UA 3SJ9A 3MO3A 1H9LB 2XRCA 5FAHA 1GBCA 1AFQC 5FPYA 3MI4A 4GAWA 1TA6A 1GBHA 3MU5A 1O2IA 1ZTJA 5EQQA 3SU6A 4FUJA 3PO1C 2BLWA 3ZVFA 4J2YB 1FN8A 3FP7E 2BDIA 1L1NA 3ZZDA 1UHBB 1PYTC 1FONA 2PSYA 4B2AA 1C5QA 4WXIA 4X2VA 1HIAB 1ANDA 3M36A 2EI6A 5H4IB 3UY9A 2PHBA 4R8TB 4AYVB 1SGFG 3GCTG 3NWUA 3VEQB 1A1RA 1TX7A 1SLUB 3UFAA 2VIOA 1FMGA 1HAVB 1LHEH 1SL3A 1C5ZB 1TONA 2ZDMA 4LK4A 4TPYA 1LQDB 4FUDA 1V2RT 3E1XB 1F0RA 1V2JT 2BZAA 4K2YA 5E8EH 1V2OT 1G32B 1K22H 1ZHMA 8GCHG 1WSSH 3T28A 3GCOA 2YNAA 5CHAB 4YLQH 5AVDA 2RG3A 2QF3A 2VH0A 3Q3YA 1TGCA 1FPCH 1FY4A 3K2UA 4TY7A 1FI8A 1O2OA 1QB6A 2C3SA 4NA7A 1MBMA 3GYLB 2H1UA 3OSYA 1C1MA 1UVTH 2B5TB 4FU9A 1C5SA 3QK1A 1P05A 3ATWA 2C8ZB 2XWBI 3LOXA 1HJ8A 1P57B 3RXKA 1GHBG 2GTBA 3RXHA 1DY9A 1FLEE 1LQEA 2FPZA 4ABAA 4A6LA 1A0JA 3L6PA 1SC8U 1AKSB 3GY4A 1DPOA 5A0BA 3B8JA 1QTFA 2PUQH 3PTNA 1UK2A 2VWOA 4ABFA 3TJOA 1G2MA 3T27A 1VCWA 1GDNA 1RFNA 5AF9H 3MWIU 1YPHC 2P8OC 1WOFA 1MH0A 2IJD1 1BTYA 1UMAH 2Z9JA 5PTPA 1TGTA 3TJNA 4WJG2 4FVBA 1O2QA 1VR1H 1RIWB 3GY2A 4FUBA 3SO3A 4B6EA 5FXLA 1D9IA 4BXSA 1O2TA 4INKA 3OTJE 2YNBA 2A2QH 2BDYA 1YPKH 1HB0B 4BANB 1O2MA 3PLKA 1H1BA 4MPUA 2XCFA 4A7IB 3EGKH 1ABJH 5EG4A 4MNXA 4TWWA 1TNHA 5FBEA 4CRCA 1CO7E 4ZXYH 3URDA 1AN1E 2A4GA 4Q7YA 3SBKA 1YLDA 3VPKA 5ETXA 2XWAA 1GI6A 1D3DB 1DDJA 1TOCB 2OP9A 3MU8A 4Z6AH 1QJ7B 3Q77A 3SV9A 1P06A 2AGIX 1GBAA 3DFLA 5GCHG 3UWJH 1ELVA 3VGCB 1YGCH 2VIDA 1G3BA 4OS7A 3V12A 3PV2A 1GBFA 1O2GH 2CN0H 1G30B 2STAE 1GDQA 1ETSH 4MPXA 3IWMA 4NCYA 1TGBA 2O8UA 1W13U 4OS6A 1QJ6B 1T32A 1GCTC 1W7XH 1K1IA 1EAXA 1O2UA 4DCDA 1DY8A 6CHAC 3QLPH 2FOMB 1P2OA 7ESTE 4X8VH 3Q76A 2OXSA 2WYJA 1P3EA 2J9NA 1AQ7A 1C1UH 3LGVA 3GDVA 1QB9A 3TH3H 4A1VA 2QYIA 1RGQA 4KTUA 4TYDA 1FY8E 2F9OA 4OGXA 1NFYA 1BBRE 1ZMNA 1ZOMA 4VGCB 2FDAA 1Y3VA 3MYWA 2Z94A 1DUAA 3T2NA 2SGPE 2GT7A 3KQCA 2WPJS 2ZPQA 1LDTT 4IMZA 3EYDA 4YOIA 3AAVA 4ZHMU 1O2PA 2FTMA 3U69H 5SGAE 2WPMS 1JMOH 3A88A 3MO9A 1A0LA 1K2I1 4GCHF 1C1PA 3K6ZA 3OTPA 5B6OA 4I8LA 1TIOA 1GGDB 1TWXB 4AN7A 2BD2A 2WV5A 3BEIB 4DIHH 1Y3WA 2ZU2A 4AB9A 2BVSH 1LVBA 3U8OH 2SNWA 2OTVA 4B76A 3ZZ6A 6ESTA 1SHYA 1MCTA 1ELGA 5AFZH 2WV4A 3U1IB 4YESB 1UTJA 1EASA 1ANBA 1BITA 3ZVEA 3GCNA 2A7JA 3VFEA 2ZHWH 2BLQA 2BXTH 2BD7A 1C1QA 1QRXA 1O34A 1CHGA 3D49H 1C2MA 4E06H 1O5CB 3BF6H 1O5DH 1TPAE 1XUGA 3F1SB 4NA9H 4NWLA 5F03A 3LJJA 3UR9A 1TNIA 1TRMA 3A7ZA 1TNKA 1UTMA 2ALPA 2BZ6H 1AI8H 1J16A 1KXAA 3HATH 3QZQA 5EW1H 1O2KA 3SGQE 3BEFB 3H7OA 1O3OA 1PPBH 1SLVB 1UVSH 2FO9A 2QXIA 3ZZ4A 1Z8IB 2BDBA 1YCPK 2BY6X 1OWKA 4JCNA 1BBRH 1NM6A 1GL1A 1LPZB 1ZHRA 2ZDKA 4Y8XA 2A5IA 1ZSLA 2CXVA 5HGGA 3M3SA 4AYYB 1P09A 2AMQA 1GJAB 1BTHH 1DSUA 2PGQB 1GI3A 3SJ8A 2PKSC 2GZ7A 3M35A 1T8MA 2ZFFH 1JIMA 4KELA 4THNH 3SUGA 2GKVE 4K5ZA 4HFPB 3A8CA 5EW2H 1P2MA 4CH8B 4IN2A 2RA0A 4ABIA 4NG9H 4X1SU 1XX9A 2ZIQH 4E05H 3TU7H 3MU0A 1XUKA 4B74A 1SGPE 2QF0A 1E37B 1F5KU 1CHOF 1SGRE 1XMNB 1CT4E 1UTQA 1GJ8B 4X2WA 5F6MA 2XCNA 3TITA 3M7TA 4YT6H 5T6DA 1IHTH 3EA9A 3GICB 1P03A 5C3NA 1PPEE 2FOHA 3AASA 2P94A 2OBOA 5C1UA 1P12E 1NRNH 2SGEE 3PV5A 1SGQE 2QN5T 3I78A 5DP4A 1BJUA 4MPWA 2J4IA 3HPTB 1ZZZA 2HGTH 3GDUA 2H5DA 1ESAA 1S84A 3PMHB 1V2ST 2F9PA 2BM2A 1TPPA 4D9RA 2BD9A 2BVRH 1AY6H 4AFQA 1G3CA 3MU4A 1LPGB 3GYMA 1GHAF 3STIA 1H8DH 3TLOA 1T7CA 2PSXA 4ZHAA 2VIPA 3E90B 1WU1A 3UQOA 3BTTE 1CBWC 5EXNA 1LVYA 1WXRA 1CU1A 1HLTH 3RXJA 3DD2H 1V2MT 3S0NA 2OK5A 2XXLA 1MU8B 1QL7A 1TPSA 1T4UH 1UK4A 5E0GA 3SV6A 4X8TH 1HV7A 4YO9A 5DP6A 4BOHA 1Z6JH 2XC0A 3M5NA 4ZUHA 2ZI2H 1ELFA 3AK5A 3VB5A 2FWWA 1XUJA 3K6YA 1P2QA 1RRKA 4BTUB 3H09A 4HTCH 1UCYK 2GDDA 3GCHB 3W94A 4AFUA 1MTNB 1AB9B 1ELBA 4DIIH 1LHDH 1O32A 4I8HA 6GCHF 3D62A 4X6NA 4NIXA 9ESTA 2GDEH 2ZGXH 2TPIZ 2BYAX 3EA7A 1HDTH 3SZEA 4A5TS 1GVKB 2ZFQH 1GL0E 1N1LA 2VBCA 5K7RA 3SJOA 1GG6B 3MNSA 1O38A 4NZLA 2ZG0H 2ZCKP 1FN6A 1C1RA 1TBRH 1A7SA 2VIWA 3A7TA 5LGOA 3ATMA 3Q00A 3V3MA 2Z3DA 1JOUB 1LO6A 2ZPRA 2ZQ1A 5DP7A 1FAKH 1UJ1A 1JRSA 2GMTC 3ZVBA 1NRPH 1IHSH 1KYNA 4CREA 1P2IA 1C5LH 2QXJA 3RC5A 3SUFA 4GCHG 1TMTH 2CV3A 3LH3A 5DJ7A 1TE0A 1N8OB 1L4ZA 3W95A 2OINA 1O3MA 3BTQE 2C8WB 1EJNA 2BX3A 2ULLA 1SGNE 3EE0B 3T5FH 1ANEA 1SOZA 1OP8A 2HNTF 4K1SA 2Y82A 3RU4D 4XFQA 3TJVA 1O35A 3UNSA 5JBCS 4CHAB 3NK8A 1L2EA 1QL8A 1KLTA 3VXEH 1EP6A 5HXFA 3RC4A 3SUEA 2BY8X 1TMBH 5JBBS 2XNIA 2WYGA 1BRUP 3UWIA 4I31A 1S6FA 4GSOA 1ZR0A 3BEUA 2AS9A 2NU3E 1C1WH 2NU0E 2VJ1A 3KQEA 2HRVA 2RCEA 2F9VA 1TBZH 2ZC9H 3URCA 3P8FA 3BG4B 2A31A 1YCPM 3M3VA 1KLIH 1OSSA 3MNCA 4HGCA 1CVWH 3NCLA 1L0ZA 1CBWB 1ELEE 1G3DA 1C2HA 3RXGA 2PUXB 4U32A 1W2KH 1Q3XA 1FY3A 3T26A 1D3QB 3B23B 1SR5C 4D76A 5DP8A 1MAYA 4TWYA 4JZDH 5IYTA 3RDZA 1C2EA 1CA8B 1CA0B 1EAWA 2EC9H 5I25A 1O3JA 5AHGH 3K65B 1S6HA 3SNCA 2ANYA 3NPSA 3DFJA 3QX5H 2M5TA 1RTKA 2G51A 3KQBA 1GBJA 2P93A 1CHOG 1Q2WA 2ZHQH 3BTEE 2W7SA 1NU9A 5C67A 1EAUA 1IQHA 2HWLB 1VITF 1OYQA 1G36A 2FX4A 4XBDA 1KXFA 1WQSA 1N6YA 3ZZAA 3FANA 2BQ6B 2QXGA 3E0NB 2ZFSA 1HPGA 3QZRA 4BAKB 2C4FH 5DG6A 1YPGH 2GCHG 2ZGJA 1ZPZA 2OCVB 2SGDE 4MNVA 3KEEA 2UUJB 1DT2A 3MH6A 5C1XA 5C5OA 1GJ9B 5TJXA 4UDWH 2W3KA 2QXHA 1SMFE 1ZPBA 2WPLS 1V6DA 1FPHH 1EJMA 1O3GA 1DOJA 2ILNA 1EOJA 4UFFH 4IS5A 3RU4T 5HMAA 1XUIA 1QA0A 3UQVA 1SBWA 3NUMA 1MD8A 4JYUH 3PLPA 1GHAG 8ESTE 3RXTA 1GJ5H 3VB6A 3IG6B 1BTUA 3C27B 3SU0A 3T62A 1O2NA 1O3EA 1GBTA 2XBWA 3ZZ7A 4LXBH 3ZV9A 3GY3A 1THSH 2ESTE 1CSOE 2BDGA 2ZGCA 2JKHA 1PPCE 4U2WA 1ABIH 3M61U 2A4RA 1LMWB 1CGIE 1Y3UA 2JH0D 5DP9A 1MQ5A 1MTWA 2TGAA 2VWNA 2ZO3H 3SNAA 1MBQA 3EQ0H 1ETRH 5ABWA 5L2YH 2F83A 4QT8C 4ASHA 2D2DA 3A85A 1EZQA 3SU5A 4E7RG 6GCHG 1VGCB 2O8MA 1TNGA 1A3BH 1SHHB 3PB1E 3C1KA 2BHGA 5L6NH 4B6FA 4K1TA 1FNIA 2FODA 1HJAC 1ZTKA 1PFXC 1GBDA 2PR3A 3TK9A 1O3AA 1TBQH 2QV1A 5FHTA 1YPHE 3AW1A 2ZFTA 1J15A 4KGAA 2B9LA 5DK1A 4OS4A 1J9CH 1DX5M 1TFXA 3M7UA 4ISLA 1Z71A 1W8BH 5C5NA 1WCZA 2G4UA 2P16A 1NESE 2ZTZA 2K1QA 2BY9X 3NKKA 2Y5FA 2WPIS 2R3UA 1F92A 4MPVA 2AIPA 2A4QA 1LHCH 1ACBE 3N7OA 4JYTA 2J38A 3L3TA 3MO6A 1SVPA 2V0BA 2GCTC 3H5CB 1GJBB 4BAHB 1DVAH 3DUXH 4XSKU 1C5PA 4Y76A 1M9UA 5HM9A 2OUAA 1L1GA 1O3NA 1T8NA 4X2XA 1GHXH 3LGYA 2PKAA 1SGTA 2Y80A 4Y79A 5DGJA 1ZGIA 3KL6A 4ABJA 2QAAA 3STJA 1ELTA 2V35A 3SU3A 3LGUA 1QQUA 1KDQA 1INCA 4X1RU 4MLFB 4GPGA 1GMHF 4Q2KA 3ZYDA 1AFQB 1Z8RA 4CR9A 3LGWA 1IQIA 2QY0B 3GY8A 2EA3A 2BB4A 1L4DA 1XXDA 4ISNA 4AOQA 3EA8A 1OWDA 3ENSB 3PO1B 1HAPH 2PGBB 1YBWA 1FJSA 1PJPA 2VVCA 3RXVA 2BDHA 2FS9A 2TGDA 5A0CA 1AZ8A 3P8NA 5GNDA 1P01A 4B2CA 2IOTA 1DICA 1S0RA 3A80A 2F9BH 1K1PA 4RSPA 4DJZB 1HAHH 1XUHA 2UUYA 3SORA 5TCCA 1AGJA 5L30H 2A0QB 3M37A 2CF8H 1GI0A 4KKDA 3OY5U 4U30A 1H4WA 1AVGH 1GBEA 1GI4A 2OC0A 4XBCA 3GISB 3ZV8A 4DURA 3S7HB 3RXDA 1AUTC 1HJ9A 1G3EA 1MTVA 3A86A 1DWCH 3P8GA 3UR6A 1ZRKA 2FX6A 1OP0A 2J34A 2QIQA 1JBUH 1QBOA 2WPHS 1GHYH 3V0XA 4JYVH 1MKXK 1VITG 3BIVH 1O31A 3HKIB 4UE7H 4RKJB 4I7YH 1QA7A 2BD4A 2OD3B 2ZGHA 2VGCC 2VWLA 6LPRA 1IQLA 3RM2H 2Z3EA 5F8ZA 3A81A 3OYPA 4CRDA 1NTPA 2FOBA 4RI0A 5L2ZH 4CH2B 2FOFA 1IQNA 1LVMA 1MTUA 2Y5GA 3KGPA 3MFJA 2ZECA 4LOYH 3ATKA 5FX6A 1BIOA 4BTIB 2ANWA 1DFPA 1CE5A 1J8AA 2H5CA 3RXUA 3TGJE 2LNCA 1TALA 1O2HA 3GDSA 4NFFA 1O3DA 1PYTD 3KF2A 2SFAA 1GVZA 1O36A 3A84A 3AVZA 5JYIA 4KP0A 1EKBB 1PQAA 2P8OB 1HAYB 1UTKA 3PV4A 3U98H 1V2QT 4DT7B 4NA8A 1MKWK 3FZDA 4ABHA 4WY3A 2PTNA 1AWFH 3FVFB 2Z9IA 4O9VA 1C2LA 1O5EH 1RJXB 1HXEH 5LPFA 3SV7A 3MH4A 2A5AA 4X1NU 2CHAC 4DG4A 2A5KA 1GMCF 3FZZA 3EDXB 2ZDLA 3KQDA 1GDUA 3S69A 2QC2A 1EPTA 1SGFA 1O2RA 1V2KT 2BMGB 1YCPH 3DT0H 5CMXH 4U01A 1FY5A 4YLUA 4JMYA 3TNTA 4ABGA 1W7GH 1Y3YA 4ABBA 1K1MA 4E7NA 4IN1A 1TGSZ 1P10A 1XM1A 3ZZBA 5CE1A 1TMUH 4CBNA 1ZSJA 3AW0A 1G9IE 2VINA 2C8XB 3TH4H 1DLKB 5LPEA 1UCYE 2ALVA 4AG2A 1FQ3A 4FUGA 3OY6U 4KTCA 2BOKA 1SI5H 4JK6A 1V2UT 1ORFA 1KY9A 5EU8A 2ZHFH 1GCTB 4IBLH 1ZSKA 2AMPA 1D4PB 6CHAB 1GVLA 4GUXA 3NXPA 1E34B 3ZVGA 3BG8A 1QRZA 2ZDVH 2ODYB 1H9HE 5FX5A 3ZZ8A 3ZZ5A 1GJ6A 2ZP0H 2Z9GA 3SJKA 5GPIB 4Y8YA 1WYKA 5G4BA 2KAIA 1V2TT 1TRNA 1EPTC 3L33A 2A7CA 3UPEA 7GCHF 1SFIA 1U6QA 2F3CE 3MTYA 4XE4A 4Z0KA 4IMQA 2AGGX 5E0JA 1OXGA 3SJIA 4ZHLU 2H6MA 5IDKA 5F8TA 1P2KA 2R2MB 4YZUA 3ZZCA 1JWTA 4BAOB 1GI1A 2ZHDA 2SGQE 2JETC 2SGFE 3O8BA 1IQEA 1TNLA 1V2VT 2GP9B 3MH5A 1DM4B 3SYJA 2H9TH 1H9IE 1QJ1B 1WBGB 1BQYA 1O3KA 3I77A 3SNBA 3UREA 8KME2 3B9FH 2J94A 4AB8A 2ZNKH 1J17T 3HKJB 3TGKE 1MMJN 1HUTH 1AO5A 3RM0H 2ZCHP 4NSVA 2R3YA 4WF8A 2H9EH 2R2WU 5ESBA 4IGDA 4WWYA 1BMNH 1UCYH 1C2GA 4LZ1H 2FI3E 3P70B 1DE7H 1TAWA 1C1OA 1EXFA 2A7HA 2VB0A 3R0FA 4WMFA 2FYQA 2ZF0H 1LTOA 1HAXB 4UFGH 3P95A 1QB1A 1ELDE 4M7GA 4O03A 5BRRE 1GBBA 1BRAA 1MU6B 1KSNA 3LONA 1O39A 2OC8A 2ZU5A 7LPRA 4ABEA 3O8DA 1RXPA 2BY5X 1ZRBA 4X8SH 1C4V2 1C9PA 3A89A 1V2WT 3QGNB 2WHXA 1TQ7B 1UHBA 1C5TA 2G8TA 2O8WA 3OX7U 1FY1A 1HIAA 2THFB 1OS8A 1WTGH 3LC5A 4Y6DA 2LPRA 2FLBH 2AH4X 2ODPA 2NU4E 1FZZA 3RUOA 4Y10E 2FM2A 1C4U2 2PW8H 1OX1A 1A4WH 1AZZA 1C1SA 1BZXE 5EQSA 4YM9A 1HAVA 4ZKRU 2FP7B 2PKSB 3E6PH 1YP9A 1ZLRA 2ANKH 1TGNA 2R9PA 3M7QA 3S7KB 4ISIH 2C93B 1K1NA 3H7TA 1NRRH 1O3PB 4HI3A 3RLWH 2P3FH 3SU4A 2XYAA 1NPMA 2ZGBH 2Q6DA 4NWKA 1Z1IA 2G00A 2QGRA 4MG3A 3F9EA 2SNVA 2PWXA 1PQ5A 3SHAH 1EP5A 1THPB 4FUEA 4I32A 1W10U 3TIUA 3MH7A 3VB4A 1B7XB 4BXWA 4AORA 3TGIE 4FUHA 4AX9H 1UTLM 2AEIH 1MZAA 1ARCA 2A32A 1UTOA 1IQJA 1AFEH 1KTTB 1OPHB 3TPIZ 3UOUA 1UTPA 1BB0B 1QL9A 2P95A 1AD8H 1GPZA 1GJ7B 2C8YB 2W7UA 4AG1A 4NZQA 4CR5A 2XW9A 4FU7A 4Y8ZA 2O8TA 1HRTH 1A5HA 3Q3KA 1W11U 4WH6A 4GVUA 1B0EA 3UNRA 1GI7B 1NT1A 3ZVDA 2GVFA 3BTGE 1AKSA 1GMCG 1UVPA 3LGTA 2XTTB 2AMDA 3QO6A 1ZMLA 3RMOH 1C5YB 1P11E 4I33A 8LPRA 3PROA 3V13A 1O3IA 4KTSA 3SNEA 1E38B 3D65E 1QIXB 9LPRA 3E3TA 3E16B 2J92A 1B0FA 1G2LA 5CHAC 3SZNA 4YOGA 4WVPE 3RXAA 3S9AA 3SW2B 1SGYE 3RLYH 3KHVA 1O5AB 1NU7B 1KXBA 4K69A 2FTLE 3LH1A 3RXMA 2PFEA 2ZA5A 4A92A 1ANCA 1ZTLA 1T8OA 3MHWU 3ZVAA 1S83A 1TQ0B 3SI4H 1C5UA 1EZSC 2BLVA 1O2SA 1AE8H 3RXOA 2DE8A 4CRAA 1DANH 5A09A 3LKWA 1RTLA 3OU0A 2ZDAH 5E0HA 3A82A 1AE5A 1ESBA 1W0ZU 2AERH 2F9NA 1G37A 3PWBA 4BNRA 1BTZA 1Q31A 1PQ7A 2FESH 3O8RA 1XUFA 2XC4A 3E91A 1B5GH 1S85A 1Y59T 7GCHG 1XKAC 2DUCA 4F49A 3DA9B 2VVVA 3BIUH 3BTDE 4H6SB 1F0TA 2FZZA 1O5GH 1TOMH 2OC7A 2GMTB 3F68H 4I8GA 5A8XA 3HGNA 1HYLA 2VU8E 3ODDA 1O5BB 1F7ZA 2CJIA 3LJOA 1W0YH 1BOQA 2O9QA 1C5NH 1O0DH 2VVUA 1E36B 2ZU4A 1FDPA 1D3PB 3O8CA 1VJAU 1RIWC 2PTCE 4FUIA 1SQTA 1BA8B 1T31A 5E2OA 3UOPA 2HLCA 2DE9A 1NS3A 4Y7BA 3QDZB 5J4QA 3P8OA 2ZHEH 1C2FA 1GBMA 1UTNA 1KXEA 3VXFH 1J14A 1T4VH 1MUEB 1W12U 7KMEH 1SGCA 2AFQB 3U9AH 1BJVA 2I6SA 4AFSA 3ODFA 1YPLH 1BDAA 1SFQB 1BCUH 3RXPA 1EB2A 2BVXH 1LHFH 5EXLA 1AVXA 4ZH8A 3TK6A 4UD9H 3SI3H 1SG8B 2B0FA 1AUJA 3PMBB 1C2KA 3A7VA 3HGPA 3ESTA 1BUIA 1MTSA 1O3FA 1OWHA 3U8RH 1QURH 3VGCC 1GHWH 2BD5A 3FFGA 2J2UA 3A7XA 3MNBA 5LPRA 3UTUH 4B2BA 2V3OH 3E0PB 3SHCH 2Y6TA 4OS5A 4FUFA 3ZZ3A 2YOLA 1YPEH 5FPSA 1GI2A 2WUCA 3BTHE 1O5FH 5DP5A 1KXCA 1A2CH 2EEKA 5DP3A 4Q7ZA 1C5VA 3Q3XA 3A8BA 2OQUA 5LH8A 1GJCB 1QBVH 4NIYA 2H9HA 5JBAS 1NY22 4H6TA 1LCYA 1FAXA 1LPKB 1BMAA 1DWEH 4ZKSU 4VGCC 4I8KA 1S82A 1GMDF 3QTOH 1GBLA 4ZKNU 4TY6A 4K3JA 1A5IA 3SQHE 1DSTA 1JIRA 2VWMA 3HK6B 3F9FA 1SPJA 3LC3A 1CGHA 5GIBA 1O2VA 3KN2A 2SGAA 4IW4E 4JZ1A 1K1OA 3P17H 2JH6D 1Z8JB 2IPHA 1O30A 2P3TB 2A1DB 1GGDC 4FU8A 4A1XA 4IC5A 3E8LA 1GHZA 3BTME 4DOQA 3QGJA 2FLRH 3TK5A 2FI5E 1TX6A 1EJAA 1F5RA 1OYTH 4MDSA 1ZMJA 2I6QA 2BXUH 1F5LA 2B7DH 1C5WB 1OOKB 2ANMH 1O3CA 1NFXA 1BTPA 2BDAA 1O3BA 1FV9A 4K8BA 4UONA 1XKBC 3PWCA 3MMGA 4F4OC 4BAMB 3U1JB 1HBTH 4ZXXH 4YT7H 4RN6A 3BN9A 3SN8A 3T29A 3TH2H 1QQ4A 2JH5D 5F8XA 1TNJA 1Y8TA 3GY7A 3BSQA 3ATLA 5HM2A 1O2JA 4K60A 4Y11E 2FEQH 2BD8A 2EI7A 2Z3CA 1ID5H 2VNTA 1SGIB 1P02A 1ZJDA 1GI5A 1BRCE 2RA3A 5C20A 3RP2A 3SUDA 2FOGA 1V2LT 3SNDA 1IOEA 1QR3E 1WAYB 1ZHPA 4CBOA 1EX3A 3P92A 4UFEH 1LKBA 1NO9H 3GY5A 5JDUB 1NN6A 1K1JA 2D8WA 1PPFE 1FIZA 2ZTXA 4SGAE 2UWOA 1HAGE 2V6NA 2AYWA 4Y7AA 2G5VA 1GBIA 1EZXC 2Y81A 1SGDE 1ZGVA 2J95A 1K28D 4Q80A 4FUCA 1UK3A 3RMNH 2WZQA 3WY8A 3A8DA 3BV9B 1TYNA 1A46H 3T25A 3KNXA 1MKXH 3NZIA 1P9SA 4TPIZ 1HJAB 1IQMA 1QGFA 2WINI 5EXMA 1BHXF 1SGEE 2UUKB 5B6LA 1GWAA 1C2JA 3S9BA 3RC6A 2STBE 2GGVB 1O3HA 2P3UB 4Q7XA 1Y5AT 2G55A 2G81E 4GHQA 3RXBA 1VCPA 4DGJA 5A2MH 2BD3A 4X6MA 1DUEA 1T8LA 3RU4E 3VB3A 1C1NA 1V3XA 2GT8A 1D6WA 3GOVB 1OP2A 5GJ4B 1NRQH 5FBIA 1C5MD 4ZKOU 1DS2E 4FVDA 4FXGH 2ZPSA 1VZQH 4DY7B 2NU2E 1P8VC 1O2XA 1C5OH 1O2ZA 3KIDU 1WUNH 2AGEX 2Y5HA 1DITH 4D7GA 3RXRA 2GCTB 3SU2A 2ZQ2A 3EAJA 2OLGA 3MOCA 1Z7KA 1GCDA 1N6XA 1XVMA 1NROH 4MVNA 3TVJB 2ZKSA 1O37A 1FIWA 1C1VH 2FMJA 3RXEA 4JZIA 1O2WA 4SGBE 1MKWH 2OBQA 4OGYA 1WTHD 2CMYA 4UEHH 3RXLA 2ASUB 5AFYH 2BQWB 5GDSH 1ZYOA 3JZ2B 1F0SA 3LGIA 4JK5A 1OWJA 4ZAEA 1QHRB 3M5OA 2XBXA 1IAUA 1Z8GA 2F4LA 2QA9E 5BPEA 4AZ2B 5J4SA 3SGBE 1SSXA 1C4Y2 2CGAA 1IQGA 4HZHA 5FPTA 1BHXB 2G4TA 4GHTA 4XOJA 1SOTA 2IJOB 3LIWA 3M5MA 1P3CA 3GCHC 5I46H 1MTNC 1EATA 1AB9C 4X1PU 1JRTA 1QRWA 3RXIA 3ZYEA 1HCGA 2GV6A 5JBTA 1S81A 5JPMH 3R3GB 1A0HB 3QUMP 1NZQH 2IN2A 4X1QU 2Z9KA 4R0IA 1MD7A 1TABE 4B71A 2HPPH 2OQ5A 1BRBE 1EQ9A 3F9GA 4ISHH 1PPGE 1CT2E 1E35B 4X6OA 3PLBA 1YKTA 3BTFE 1PQ8A 4LZ4B 2ZFPH 2TRMA 1BMLA 2OC1A 3RXCA 1GG6C 3PTBA 2HPQH 1LHGH 1ELAA 3UIRA 3A87A 1UO6A 1YPJH 4ABDA 1BBRK 1GMDG 2PKAB 1H8IH 1DLEA 1IQFA 1P9UA 2G5NA 3VB7A 3RXFA 1LKAA 1OWEA 3A7WA 4A1TA 5EQRA 3K9XB 1KDQB 2A4OA 2V3HH 2ZU3A 3FP6E 1TB6H 1IQKA 3KCGH 2FI4E 5A0AE 1N8OC 4DW2U 4CRBA
chains in the Genus database with same CATH superfamily
2UUFB 3CP7A 2D1JA 1OHHD 2Q1JA 5JB9S 1Z6EA 3SV2H 3CENA 2VGCB 4AGJA 4UFDH 4Y0YE 4CHAC 4ZROA 1GI8B 1CT0E 3M3TA 1UVUH 2Q6FA 4INLA 3UNQA 3S9CA 3JZ1B 5T6FA 2BDCA 4ZCNA 1OKXA 4NFEA 5A8YA 1MAXA 2WPKS 1GMHG 3ATIA 1A3EH 5T1VA 4ZMAH 2VIQA 3MNXA 1C5RA 4MNWA 1KMHB 2GZ9A 2GCHF 2EI8A 1DWBH 1P2JA 2GD4B 1BT7A 1AMHA 5DPAA 2FYRA 1GJDB 4BAQB 4AGKA 3PMAB 3I29A 1K1LA 3OE7D 2PLXA 2HNTE 1S5SA 2KCYA 4D8NA 2A45B 3CS7A 1EZUC 3BG4C 1AIXH 1HAIH 4O3UA 4K8YA 3WWFA 1AWHB 3MU1A 4MTBA 1Y5UT 1GBKA 1P04A 3BTKE 1ZPCA 2ZU1A 1UVOA 5DO4H 2ZEBA 1HAZB 2RDLA 2W5EA 5HYOA 3FAOA 1WV7H 5EPYA 4AFZA 2BQ7B 1GJ4H 1HFDA 4MNYA 4B73A 4Y71A 4M9FA 3GCTF 3LT3A 3F9HA 4RT1A 2H2ZA 1KIGH 1P0SH 1RS0A 4IC6A 1O2YA 2A2XH 1TLDA 1TA2A 1C9TA 2WV9A 1Z1JA 1OWIA 1GI9B 1C2IA 2HALA 2CHAB 2VH6A 1EAIA 1SQAA 3QWCH 1CA0C 3TJUA 1E0FD 4X6PA 4X2YA 2P59A 4ISOA 2TGPZ 1YLCA 1C5XB 1W3CA 2WUBA 1A5GH 5GXPA 3FO8D 2FXRA 2HNTC 4HG6A 1QY6A 8GCHF 4B1TA 3A7YA 1NRSH 1DXWA 1C1TA 3F6UH 4XDEA 1LVOA 4O3TA 2FOAA 2G52A 1F2SE 3BTWE 4H4FA 1THRH 2BX4A 3RMLH 2F91A 5A8ZA 1KTSB 4JZEH 1HAOH 5T3HA 5FCKA 3RXQA 2FS8A 3LU9B 2XC5A 2O8LA 3SU1A 5C1YA 1PPZA 5E2PA 4O97A 3ITIA 2BOHB 2R0KA 2ZCLP 1YC0A 1CQQA 1WQVH 2TBSA 4OS2A 3HK3B 3FP8E 1VJ9U 1MQ6A 1DWDH 1MZDA 3F2HA 1XVOA 1MCVA 1JXPA 1SB1H 4OS1A 3M5LA 1EB1H 1TPOA 2W3IA 1ESTA 1QFKH 3PMJA 1V2NT 1ETTH 1HGTH 1GHBF 5C2ZA 2XBVA 2ZTYA 1O2LA 4CRGA 3ZVCA 3QN7A 1EPTB 4WMDA 1Y5BT 1ELCA 1FXYA 4PROA 4WXVA 5EGMA 4OM9A 3UUZA 3SV8A 4I8JA 4CRFA 3F2GA 5ESTE 1NFWA 5EPNA 1SLXB 4YTAA 2HOBA 3PYHA 2NU1E 5JB8S 1O3LA 5T6GA 2BLOA 1NC6A 4INHA 2JETB 1GHVH 2AIQA 3SQEE 1HNEE 1ARBA 1D6RA 4Y0ZE 1D3TB 1BTWA 2Y7XA 1EUFA 3D23A 4ESTE 3WW7A 1V2PT 1K21H 3TNSA 1UW7A 3A8AA 1O33A 4MQAA 2ODQA 1NFUA 1SLWB 2UWLA 4GLYA 2Z6BD 3CS0A 2Z9LA 2VIVA 3RMMH 3LDXH 1TRYA 1VGCC 1SQOA 2ZWLH 1P2NA 2GV7A 3OAAD 2Q6GA 1QBNA 3AAUA 3LPRA 3V7TA 1EOLA 1Y3XA 4JZFH 1S0QA 2KAIB 2Z7FE 3FOAA 1YF4A 3PM3A 1K9OE 3WWBA 2TGTA 3P6ZB 1RD3B 4NIWA 2W26A 2C90B 2NWNA 5FCRA 1AU8A 5K0HA 4J1YA 2RFKC 5GCHF 3SGAE 1KLJH 2HVXA 4X0WU 1X7AC 4F55A 5EODA 3DHKH 2FOCA 1BMMH 5DKMA 2BY7X 2FIRH 4NGAH 1FUJA 1TX8A 2HLDD 1AVWA 4X8UH 2TIOA 4K1EA 1L1JA 1W14U 2R0LA 2UWPA 1BTXA 4H42U 1VCQA 5TCAA 2GX4A 3SOSA 1YPMH 1F0UA 5C1XA 2PV9B 4D9QA 4YOJA 1KXDA 4XBBA 4BTTB 1A61H 1VITH 2EQNA 3A83A 2ZDNA 2XBYA 4WH8A 2CF9H 2FOEA 2ZFRH 1QNJA 1YYY1 1AHTH 5DSFA 4NSYA 1CGJE 1DXPA 5GWZA 2GZ8A 4WMEA 2QCYA 3QTVH 3RXSA 3ELAH 4NIVA 1QCPA 1YM0A 4RKOB 5EOKA 2BTCE 4D7FA 2ZZUH 1PPHE 3G01A 3U8TH 2D26C 1ZJKA 3GY6A 4B75A 1XXFA 1RTFB 1C2DA 3ZZ9A 4DVAU 2Y7ZA 2B8OH 3IITA 1HXFH 2F9UA 3SJ9A 3MO3A 1H9LB 2XRCA 5FAHA 1GBCA 1AFQC 5FPYA 3MI4A 4GAWA 1TA6A 1GBHA 3MU5A 1O2IA 1ZTJA 5EQQA 3SU6A 4FUJA 3PO1C 2BLWA 3ZVFA 4J2YB 1FN8A 3FP7E 2BDIA 1L1NA 3ZZDA 1UHBB 1PYTC 1FONA 2PSYA 4B2AA 1C5QA 4WXIA 4X2VA 1HIAB 1ANDA 3M36A 2EI6A 5H4IB 3UY9A 2PHBA 4R8TB 4AYVB 1SGFG 3GCTG 2QE7D 5HKKD 3NWUA 3VEQB 1A1RA 1TX7A 1SLUB 4TSFD 3UFAA 2VIOA 1FMGA 1HAVB 1LHEH 1SL3A 1C5ZB 1TONA 2ZDMA 4LK4A 4TPYA 1LQDB 2AHME 4FUDA 1V2RT 3E1XB 1F0RA 1V2JT 2BZAA 4K2YA 5E8EH 1V2OT 1G32B 5C0TA 1K22H 1ZHMA 3UB0A 8GCHG 1WSSH 3T28A 3GCOA 2YNAA 5CHAB 4YLQH 5AVDA 2RG3A 2QF3A 2VH0A 3Q3YA 1TGCA 1FPCH 1FY4A 3K2UA 4TY7A 1FI8A 1O2OA 1QB6A 2C3SA 3PRDA 4NA7A 1MBMA 3GYLB 2H1UA 3OSYA 1C1MA 1UVTH 2B5TB 4FU9A 1C5SA 3QK1A 1P05A 3ATWA 2C8ZB 5CDFE 5C17A 2XWBI 1NBME 3LOXA 1HJ8A 1P57B 3RXKA 1EFRD 1GHBG 2GTBA 3RXHA 1DY9A 1FLEE 1LQEA 2FPZA 3F2FA 4A6LA 4ABAA 1A0JA 3L6PA 1SC8U 1AKSB 3GY4A 1DPOA 5A0BA 3B8JA 1QTFA 2PUQH 3PTNA 1YWUA 1UK2A 2VWOA 4ABFA 2WPDD 3TJOA 1G2MA 3T27A 1VCWA 1GDNA 1RFNA 5AF9H 3MWIU 1YPHC 2P8OC 1WOFA 1MH0A 2IJD1 1BTYA 1UMAH 2Z9JA 5PTPA 1TGTA 3TJNA 4WJG2 4FVBA 1O2QA 1VR1H 1RIWB 3GY2A 4FUBA 3SO3A 4B6EA 4F48B 2J97A 5FXLA 1D9IA 4BXSA 1O2TA 4INKA 3OTJE 2YNBA 2A2QH 2BDYA 1YPKH 1HB0B 4BANB 1O2MA 3PLKA 1H1BA 3PRBA 4MPUA 2XCFA 4A7IB 3EGKH 1ABJH 5EG4A 4MNXA 4TWWA 1TNHA 5FBEA 4CRCA 1CO7E 4ZXYH 3URDA 1AN1E 2A4GA 4Q7YA 3SBKA 1YLDA 3VPKA 5ETXA 2XWAA 3FN8A 1GI6A 1D3DB 1DDJA 1TOCB 2OP9A 3MU8A 4Z6AH 1QJ7B 3Q77A 3SV9A 1P06A 2AGIX 1GBAA 3DFLA 5GCHG 3UWJH 1ELVA 3VGCB 1YGCH 2VIDA 1G3BA 4OS7A 3V12A 3VG8A 5IK2D 3PV2A 1GBFA 1O2GH 2CN0H 1G30B 2STAE 1GDQA 1ETSH 4MPXA 3IWMA 4NCYA 1TGBA 2O8UA 1W13U 5HIZA 4OS6A 1QJ6B 1T32A 1GCTC 1W7XH 1K1IA 1EAXA 1O2UA 4DCDA 1DY8A 6CHAC 3QLPH 2FOMB 1P2OA 7ESTE 4X8VH 3Q76A 2OXSA 2WYJA 1P3EA 1MABB 2J9NA 1AQ7A 1C1UH 3LGVA 3GDVA 1QB9A 3TH3H 4A1VA 2QYIA 2KR7A 1RGQA 4KTUA 4TYDA 1FY8E 2F9OA 4OGXA 1NFYA 1BBRE 1ZMNA 1ZOMA 4VGCB 2FDAA 1Y3VA 3MYWA 2Z94A 1DUAA 3T2NA 2SGPE 2GT7A 3KQCA 2YMSD 2WPJS 2ZPQA 1LDTT 4IMZA 3EYDA 4YOIA 3AAVA 4ZHMU 1O2PA 2FTMA 3U69H 5SGAE 2WPMS 1JMOH 3A88A 3MO9A 1A0LA 1K2I1 4GCHF 1C1PA 5EJZA 3K6ZA 3OTPA 5B6OA 4I8LA 1TIOA 1GGDB 1TWXB 4AN7A 2BD2A 2IPQX 2WV5A 3BEIB 4DIHH 1Y3WA 2ZU2A 4AB9A 2BVSH 1LVBA 3U8OH 2SNWA 2OTVA 4B76A 3ZZ6A 6ESTA 1SHYA 1MCTA 1ELGA 5AFZH 2WV4A 3U1IB 4YESB 1UTJA 1EASA 1ANBA 1BITA 3ZVEA 3GCNA 2V7QD 2A7JA 3VFEA 2ZHWH 2BLQA 2BXTH 2BD7A 1C1QA 1QRXA 1O34A 1CHGA 3D49H 1C2MA 4E06H 1O5CB 3BF6H 1O5DH 2KCPA 1TPAE 1XUGA 3F1SB 4NA9H 4NWLA 5F03A 3LJJA 3UR9A 1TNIA 1TRMA 3A7ZA 1TNKA 4XD7D 1UTMA 2ALPA 2BZ6H 1AI8H 1J16A 1KXAA 3HATH 3QZQA 5EW1H 1O2KA 1S6LA 3SGQE 3BEFB 3H7OA 1O3OA 3ZIAD 1PPBH 1SLVB 1UVSH 2FO9A 2QXIA 3ZZ4A 1Z8IB 4Q4LA 2BDBA 1YCPK 2BY6X 1OWKA 4JCNA 1BBRH 1NM6A 1GL1A 1LPZB 1ZHRA 2ZDKA 4Y8XA 2A5IA 1ZSLA 2CXVA 5HGGA 3M3SA 4AYYB 1P09A 2AMQA 1GJAB 1BTHH 1DSUA 2PGQB 5KECA 1GI3A 3SJ8A 2PKSC 2GZ7A 3M35A 1T8MA 2ZFFH 1JIMA 4KELA 4THNH 3SUGA 2GKVE 4K5ZA 4HFPB 3A8CA 5EW2H 1P2MA 4CH8B 4IN2A 2RA0A 4ABIA 4NG9H 4X1SU 1XX9A 2ZIQH 4E05H 3TU7H 3MU0A 1XUKA 4B74A 1SGPE 2QF0A 1E37B 1F5KU 1CHOF 1SGRE 1XMNB 1CT4E 1UTQA 1GJ8B 4X2WA 5F6MA 2XCNA 3TITA 3M7TA 4YT6H 5T6DA 1IHTH 3EA9A 3GICB 1P03A 5C3NA 1PPEE 2FOHA 3AASA 2P94A 2OBOA 5C1UA 1P12E 1NRNH 2SGEE 3PV5A 1SGQE 2QN5T 3I78A 5DP4A 1BJUA 4MPWA 2J4IA 3HPTB 1ZZZA 2HGTH 3GDUA 2H5DA 2J98A 1ESAA 1S84A 3PMHB 1V2ST 2F9PA 2BM2A 1TPPA 4D9RA 2BD9A 2BVRH 1AY6H 4AFQA 2JDID 1G3CA 3MU4A 1LPGB 3GYMA 1GHAF 3STIA 1H8DH 3TLOA 1T7CA 2PSXA 4ZHAA 2VIPA 3E90B 1WU1A 3UQOA 3BTTE 1CBWC 5EXNA 1LVYA 1WXRA 1CU1A 1HLTH 3RXJA 3DD2H 1V2MT 2OK5A 3S0NA 2XXLA 5HIYA 1MU8B 1QL7A 1TPSA 1T4UH 1UK4A 5E0GA 3SV6A 4X8TH 1HV7A 4YO9A 5DP6A 4BOHA 1Z6JH 2XC0A 3M5NA 4ZUHA 2ZI2H 2GJGA 1ELFA 4AC9A 3AK5A 3VB5A 2FWWA 1XUJA 3K6YA 1P2QA 1RRKA 4BTUB 3H09A 4HTCH 1UCYK 2GDDA 3GCHB 3W94A 4AFUA 1MTNB 1AB9B 1ELBA 4DIIH 1LHDH 1O32A 4I8HA 6GCHF 3D62A 4X6NA 4NIXA 2KM0A 9ESTA 2GDEH 2ZGXH 2TPIZ 2BYAX 3EA7A 1HDTH 3SZEA 4A5TS 1GVKB 2ZFQH 1GL0E 1N1LA 2VBCA 5K7RA 3SJOA 1GG6B 3MNSA 1O38A 4NZLA 2ZG0H 2ZCKP 2KCAA 1FN6A 1C1RA 1TBRH 1A7SA 2VIWA 3A7TA 5LGOA 3ATMA 3Q00A 3V3MA 2Z3DA 1JOUB 1LO6A 2ZPRA 2ZQ1A 5DP7A 1FAKH 1UJ1A 1JRSA 2GMTC 3ZVBA 1NRPH 1IHSH 1KYNA 4CREA 1P2IA 1C5LH 2QXJA 3RC5A 3SUFA 4GCHG 1TMTH 2CV3A 3LH3A 5DJ7A 1TE0A 2XOKD 1N8OB 1L4ZA 3W95A 2OINA 1O3MA 3BTQE 2C8WB 1EJNA 2BX3A 2ULLA 1SGNE 3EE0B 3T5FH 1ANEA 1SOZA 1OP8A 2HNTF 4K1SA 2Y82A 4I86A 3RU4D 4XFQA 3TJVA 1O35A 3UNSA 5JBCS 4CHAB 3NK8A 1L2EA 1QL8A 1KLTA 3VXEH 1EP6A 5HXFA 3RC4A 3SUEA 2BY8X 1TMBH 5JBBS 2XNIA 2WYGA 1BRUP 3UWIA 4I31A 1S6FA 4GSOA 1ZR0A 3BEUA 2AS9A 2NU3E 1C1WH 2NU0E 2VJ1A 3KQEA 2HRVA 2RCEA 2F9VA 1TBZH 2ZC9H 3URCA 3P8FA 3BG4B 2A31A 3EE7A 1YCPM 3M3VA 1KLIH 1OSSA 3MNCA 4HGCA 1CVWH 3NCLA 1L0ZA 1CBWB 1ELEE 1G3DA 1C2HA 3RXGA 2PUXB 4U32A 1W2KH 1Q3XA 1FY3A 3T26A 1D3QB 3B23B 1SR5C 4D76A 5DP8A 1MAYA 4TWYA 4JZDH 5IYTA 3RDZA 3FKSD 1C2EA 1CA8B 1CA0B 1EAWA 2EC9H 5I25A 1O3JA 5AHGH 3K65B 1S6HA 3SNCA 2ANYA 4Q63A 3NPSA 3DFJA 3QX5H 2M5TA 1RTKA 2G51A 3KQBA 1GBJA 2P93A 1CHOG 1Q2WA 2ZHQH 3BTEE 2W7SA 1NU9A 5C67A 1EAUA 2L74A 1IQHA 4TT3D 2HWLB 1VITF 1OYQA 1G36A 2FX4A 4Z1MD 4XBDA 1KXFA 1WQSA 1N6YA 3ZZAA 3FANA 1FX0B 2BQ6B 2QXGA 3E0NB 2ZFSA 1HPGA 3QZRA 4BAKB 2C4FH 5DG6A 5KGOA 1YPGH 2GCHG 2ZGJA 1SQRA 1ZPZA 2OCVB 2SGDE 3KEEA 2UUJB 1DT2A 3MH6A 4MNVA 3DSGA 5C5OA 1GJ9B 5TJXA 4UDWH 2W3KA 2QXHA 1SMFE 1ZPBA 2WPLS 1V6DA 1FPHH 1EJMA 1O3GA 1DOJA 2YMSC 2ILNA 1EOJA 4UFFH 2LP6A 2JJ1D 4IS5A 3RU4T 5HMAA 1XUIA 1QA0A 3UQVA 1SBWA 3NUMA 1MD8A 4JYUH 3PLPA 1GHAG 8ESTE 3RXTA 1GJ5H 3VB6A 3IG6B 1BTUA 3C27B 3SU0A 3T62A 1O2NA 1O3EA 1GBTA 2XBWA 3ZZ7A 4LXBH 3ZV9A 3GY3A 1THSH 2ESTE 1CSOE 2BDGA 2ZGCA 3N7DA 2JKHA 1PPCE 4U2WA 1ABIH 3M61U 2A4RA 1LMWB 1CGIE 1Y3UA 2JH0D 1YLNA 5DP9A 1MQ5A 1MTWA 2TGAA 2VWNA 2ZO3H 3SNAA 1MBQA 3EQ0H 1ETRH 5ABWA 5EIYA 5L2YH 2F83A 4QT8C 4ASHA 2D2DA 3A85A 1EZQA 3SU5A 4E7RG 6GCHG 1VGCB 2O8MA 1TNGA 1A3BH 1SHHB 3PB1E 1K0HA 3C1KA 2BHGA 5L6NH 4B6FA 2JIZD 4K1TA 1FNIA 2FODA 1HJAC 1ZTKA 1PFXC 1GBDA 2PR3A 3TK9A 1O3AA 1TBQH 2QV1A 5FHTA 1YPHE 3AW1A 2ZFTA 1J15A 4KGAA 2B9LA 5DK1A 4OS4A 2W6ID 1J9CH 1DX5M 1TFXA 3M7UA 4ISLA 1Z71A 1W8BH 5C5NA 1QZ8A 1WCZA 2G4UA 2P16A 1NESE 2ZTZA 2K1QA 2BY9X 3NKKA 4ACBA 2Y5FA 2WPIS 2R3UA 1F92A 4MPVA 2AIPA 2A4QA 1LHCH 1ACBE 3N7OA 4JYTA 2J38A 3L3TA 3MO6A 1SVPA 2V0BA 2GCTC 3H5CB 1GJBB 1YY3A 4BAHB 1DVAH 3DUXH 4XSKU 1C5PA 4Y76A 1M9UA 5HM9A 2OUAA 1L1GA 1O3NA 1T8NA 4X2XA 4DT4A 1GHXH 3LGYA 2PKAA 1SGTA 2Y80A 4Y79A 5DGJA 1ZGIA 3KL6A 4ABJA 2QAAA 3STJA 1ELTA 2V35A 3SU3A 3LGUA 1QQUA 1KDQA 1INCA 4X1RU 4MLFB 4GPGA 1GMHF 4Q2KA 3ZYDA 1AFQB 1Z8RA 4CR9A 3LGWA 1IQIA 2QY0B 3GY8A 2EA3A 2BB4A 1L4DA 1XXDA 4ISNA 4AOQA 3EA8A 1OWDA 3ENSB 3PO1B 1HAPH 3N99A 2PGBB 1YBWA 1FJSA 1PJPA 2VVCA 3RXVA 2BDHA 2FS9A 2TGDA 5A0CA 1AZ8A 2L6OA 3P8NA 5GNDA 1P01A 2KX4A 4B2CA 2IOTA 1DICA 1S0RA 3A80A 2F9BH 1K1PA 4RSPA 4DJZB 1HAHH 1XUHA 2UUYA 3SORA 5TCCA 1AGJA 3U28C 5L30H 2A0QB 3M37A 2CF8H 1GI0A 4KKDA 3OY5U 4U30A 1H4WA 1AVGH 1GBEA 1GI4A 2OC0A 4XBCA 3GISB 3ZV8A 4DURA 3S7HB 3N7EA 3RXDA 1AUTC 1HJ9A 1G3EA 1MTVA 3A86A 1DWCH 3P8GA 3UR6A 1ZRKA 2FX6A 1OP0A 4FOUC 2J34A 2QIQA 1JBUH 1QBOA 2WPHS 1GHYH 3V0XA 4JYVH 1MKXK 1VITG 3BIVH 1O31A 3HKIB 5KEDA 4UE7H 4RKJB 4I7YH 1QA7A 2BD4A 2OD3B 2ZGHA 3DSOA 2VGCC 2VWLA 6LPRA 1IQLA 3RM2H 2Z3EA 5F8ZA 3A81A 3OYPA 4CRDA 1NTPA 2FOBA 4RI0A 5L2ZH 1W0JD 4CH2B 2FOFA 1IQNA 1LVMA 1MTUA 2Y5GA 3KGPA 3MFJA 2ZECA 4LOYH 3ATKA 5FX6A 1BIOA 4BTIB 2ANWA 1DFPA 1CE5A 1J8AA 2H5CA 3RXUA 3TGJE 2LNCA 1TALA 1O2HA 3GDSA 4NFFA 1O3DA 1PYTD 3KF2A 2SFAA 1GVZA 1O36A 3A84A 3AVZA 5JYIA 4KP0A 1EKBB 1PQAA 2P8OB 1HAYB 1UTKA 3PV4A 3U98H 1V2QT 4DT7B 4NA8A 1MKWK 3FZDA 4ABHA 4WY3A 2PTNA 1AWFH 3FVFB 2Z9IA 4O9VA 1C2LA 1O5EH 1RJXB 1HXEH 5LPFA 3SV7A 3MH4A 2A5AA 4X1NU 2CHAC 4DG4A 2A5KA 1GMCF 3FZZA 3EDXB 2ZDLA 3KQDA 1GDUA 3S69A 2QC2A 1EPTA 1SGFA 4XRNA 1O2RA 1V2KT 2BMGB 1YCPH 3DT0H 5CMXH 4U01A 1FY5A 4YLUA 4JMYA 3TNTA 4ABGA 1W7GH 3UAIC 1Y3YA 4ABBA 1K1MA 4E7NA 4IN1A 1TGSZ 1P10A 1XM1A 1BMFD 3ZZBA 5CE1A 1TMUH 4CBNA 1ZSJA 3AW0A 1G9IE 2VINA 2C8XB 3TH4H 1DLKB 5C0UA 5LPEA 1UCYE 2ALVA 4AG2A 1FQ3A 4FUGA 2KCOA 3OY6U 4KTCA 2BOKA 1SI5H 4JK6A 1V2UT 1ORFA 1KY9A 5EU8A 2ZHFH 1GCTB 4IBLH 4ASUD 1ZSKA 2AMPA 1D4PB 6CHAB 1GVLA 4GUXA 3NXPA 1E34B 5FL7D 3ZVGA 3BG8A 1QRZA 2ZDVH 2ODYB 1H9HE 5FX5A 3ZZ8A 3ZZ5A 1GJ6A 5CHBA 2ZP0H 2Z9GA 3SJKA 5GPIB 4Y8YA 1WYKA 5G4BA 2KAIA 1V2TT 1TRNA 1EPTC 3L33A 2A7CA 3UPEA 7GCHF 1SFIA 1U6QA 2F3CE 3MTYA 4XE4A 4Z0KA 4IMQA 2AGGX 5E0JA 1OXGA 3SJIA 4ZHLU 2H6MA 5IDKA 2EY4C 5F8TA 2QF5A 1P2KA 2R2MB 4YZUA 3ZZCA 1JWTA 1NBMD 4BAOB 1GI1A 2ZHDA 2SGQE 2JETC 2SGFE 3O8BA 1IQEA 1TNLA 1V2VT 2GP9B 2HVYB 3MH5A 1DM4B 3SYJA 2H9TH 1H9IE 1QJ1B 1WBGB 1BQYA 1O3KA 3I77A 3SNBA 3UREA 8KME2 3B9FH 2J94A 4AB8A 2ZNKH 1J17T 3HKJB 3TGKE 1MMJN 1HUTH 3KYGA 1AO5A 3RM0H 2ZCHP 4NSVA 2R3YA 4WF8A 2KZ4A 2H9EH 2R2WU 5ESBA 4IGDA 4WWYA 1BMNH 1UCYH 1C2GA 4LZ1H 2FI3E 3P70B 1DE7H 1TAWA 1VKYA 1C1OA 1EXFA 2A7HA 2VB0A 3R0FA 4WMFA 2FYQA 5DN6D 2ZF0H 1LTOA 1HAXB 4UFGH 3P95A 1QB1A 1ELDE 4M7GA 4O03A 5BRRE 1GBBA 1BRAA 1MU6B 1KSNA 3LONA 1O39A 2OC8A 2ZU5A 7LPRA 4ABEA 3O8DA 1RXPA 2BY5X 1ZRBA 4X8SH 1C4V2 1C9PA 3A89A 3OEED 1V2WT 2WHXA 3QGNB 3CNRA 1TQ7B 1UHBA 1C5TA 2G8TA 2O8WA 3OX7U 1FY1A 1HIAA 2THFB 1OS8A 1WTGH 3LC5A 4Y6DA 2LPRA 2FLBH 2AH4X 2ODPA 2NU4E 1FZZA 3RUOA 4Y10E 2FM2A 1C4U2 2PW8H 1OX1A 1A4WH 1AZZA 1C1SA 1BZXE 5EQSA 4YM9A 5EJLA 1HAVA 4ZKRU 2LELA 2FP7B 2PKSB 3E6PH 4YXWD 1YP9A 1ZLRA 2ANKH 1TGNA 2R9PA 3M7QA 3S7KB 4ISIH 3DCLA 2C93B 1K1NA 3H7TA 1NRRH 1O3PB 4HI3A 3RLWH 2P3FH 3SU4A 2XYAA 1NPMA 2ZGBH 2Q6DA 4NWKA 1Z1IA 2G00A 2QGRA 4MG3A 3F9EA 2SNVA 2PWXA 1PQ5A 3SHAH 1EP5A 4DW2U 1THPB 4FUEA 4I32A 4CRBA 1W10U 3TIUA 3MH7A 2K0QA 1B7XB 3VB4A 4BXWA 4AORA 3TGIE 4FUHA 4AX9H 1UTLM 2AEIH 1MZAA 1ARCA 2A32A 1UTOA 1IQJA 1AFEH 1KTTB 1OPHB 3TPIZ 3UOUA 1UTPA 1BB0B 1QL9A 2P95A 1AD8H 1GPZA 1GJ7B 2C8YB 2W7UA 4AG1A 4NZQA 4CR5A 2XW9A 4FU7A 4Y8ZA 5EJ1A 2O8TA 1HRTH 1A5HA 3Q3KA 1W11U 4WH6A 4GVUA 1B0EA 3UNRA 3F0PA 1GI7B 1NT1A 3ZVDA 2GVFA 3BTGE 1AKSA 1GMCG 1UVPA 3LGTA 2XTTB 2AMDA 3QO6A 1ZMLA 3RMOH 1C5YB 1P11E 4I33A 8LPRA 3PROA 3V13A 1O3IA 4KTSA 3SNEA 1E38B 3D65E 1QIXB 9LPRA 3F3BA 3E3TA 3E16B 3GS9A 2J92A 1B0FA 1G2LA 5CHAC 3SZNA 4YOGA 4WVPE 3RXAA 3S9AA 3SW2B 1SGYE 3RLYH 3KHVA 1O5AB 1NU7B 1KXBA 4K69A 2FTLE 2KFWA 3LH1A 3RXMA 2PFEA 2ZA5A 4A92A 1ANCA 1ZTLA 1T8OA 3MHWU 3ZVAA 1S83A 1TQ0B 3SI4H 1C5UA 1EZSC 2BLVA 1O2SA 1AE8H 3RXOA 2DE8A 4CRAA 1DANH 5A09A 3LKWA 1RTLA 3OU0A 2J98B 2ZDAH 5E0HA 3A82A 1AE5A 1ESBA 1W0ZU 2AERH 2F9NA 1G37A 3PWBA 4BNRA 1BTZA 1Q31A 1PQ7A 2FESH 3O8RA 1XUFA 2XC4A 3E91A 1B5GH 1S85A 1Y59T 7GCHG 1XKAC 2DUCA 4F49A 3DA9B 2M2AA 2VVVA 3BIUH 3NRLA 2WSSD 3BTDE 4H6SB 1F0TA 2FZZA 1O5GH 1TOMH 2OC7A 2GMTB 3F68H 4I8GA 5A8XA 3HGNA 1HYLA 2VU8E 3ODDA 1O5BB 1F7ZA 2CJIA 1COWD 1W0YH 3LJOA 1BOQA 2O9QA 1C5NH 1O0DH 2VVUA 1E36B 2ZU4A 1FDPA 1D3PB 3O8CA 1VJAU 1RIWC 2PTCE 4FUIA 1SQTA 1BA8B 1T31A 2W6JD 1WDIA 5E2OA 3UOPA 2HLCA 2DE9A 1NS3A 4Y7BA 3QDZB 5J4QA 3P8OA 2ZHEH 1C2FA 1GBMA 1E1RD 1UTNA 1KXEA 4RT0A 3VXFH 1J14A 1T4VH 1MUEB 1W12U 7KMEH 1SGCA 2AFQB 3U9AH 1BJVA 2I6SA 4AFSA 3ODFA 1YPLH 1BDAA 1SFQB 1BCUH 3RXPA 1EB2A 2BVXH 1LHFH 5EXLA 1AVXA 4ZH8A 3KQ5A 3TK6A 4UD9H 3SI3H 1SG8B 3OEHD 2B0FA 1AUJA 3PMBB 1C2KA 3A7VA 3HGPA 3ESTA 1BUIA 1MTSA 1O3FA 2RDEA 1OWHA 3U8RH 1QURH 3VGCC 1GHWH 2BD5A 3FFGA 2J2UA 3A7XA 3MNBA 5LPRA 3UTUH 4B2BA 2V3OH 3E0PB 3SHCH 2Y6TA 4OS5A 1E1QD 4FUFA 3ZZ3A 2YOLA 1YPEH 5FPSA 1GI2A 2WUCA 3BTHE 4P00A 1O5FH 5DP5A 1KXCA 1A2CH 2EEKA 3OFND 5DP3A 4Q7ZA 1C5VA 3Q3XA 3A8BA 3F0OA 2OQUA 5LH8A 1GJCB 2JJ2D 1QBVH 4NIYA 2H9HA 5JBAS 2XNDD 1NY22 4H6TA 1LCYA 1FAXA 1LPKB 1BMAA 1DWEH 4ZKSU 4VGCC 4I8KA 1S82A 1GMDF 3QTOH 1GBLA 4ZKNU 4TY6A 4K3JA 1A5IA 3SQHE 1DSTA 1JIRA 2VWMA 3HK6B 3F9FA 1SPJA 2F43B 3LC3A 1CGHA 5GIBA 1O2VA 3KN2A 2SGAA 4IW4E 4JZ1A 1K1OA 3P17H 2JH6D 1W0KD 1Z8JB 2IPHA 1O30A 2P3TB 2A1DB 1GGDC 4FU8A 4A1XA 4IC5A 3E8LA 1GHZA 3BTME 4DOQA 3QGJA 2FLRH 3TK5A 2FI5E 3MQKC 1TX6A 1EJAA 1F5RA 1OYTH 4MDSA 1ZMJA 2I6QA 2BXUH 1F5LA 2B7DH 2CK3D 1C5WB 1OOKB 2ANMH 1O3CA 1NFXA 1BTPA 2BDAA 1O3BA 1FV9A 4K8BA 4UONA 1XKBC 3PWCA 3MMGA 2YMSB 4BAMB 4F4OC 3U1JB 1HBTH 4ZXXH 4YT7H 4RN6A 3BN9A 3SN8A 3T29A 3TH2H 1QQ4A 2JH5D 5F8XA 1TNJA 1Y8TA 3GY7A 3BSQA 3ATLA 5HM2A 1O2JA 4K60A 4Y11E 2FEQH 2BD8A 2EI7A 2Z3CA 1ID5H 2VNTA 1SGIB 1P02A 1ZJDA 1GI5A 1BRCE 2RA3A 5C20A 3RP2A 3SUDA 2FOGA 1V2LT 4P02A 3SNDA 1IOEA 1QR3E 1WAYB 1ZHPA 2QF4A 4CBOA 1EX3A 3P92A 4UFEH 1LKBA 1NO9H 3GY5A 5JDUB 1NN6A 1K1JA 2D8WA 1PPFE 1FIZA 2ZTXA 4SGAE 2UWOA 1HAGE 2V6NA 2AYWA 4Y7AA 2G5VA 1GBIA 1EZXC 3DSPA 2Y81A 1SGDE 1ZGVA 2J95A 1K28D 4Q80A 4FUCA 1UK3A 3RMNH 2WZQA 3WY8A 3A8DA 3BV9B 1TYNA 1A46H 3T25A 3KNXA 1MKXH 3NZIA 1P9SA 4TPIZ 2J5UA 4FETA 1HJAB 1IQMA 1QGFA 2WINI 5EXMA 1BHXF 1SGEE 2UUKB 5B6LA 1GWAA 1C2JA 3S9BA 5C94A 3RC6A 2STBE 2GGVB 1O3HA 2P3UB 4Q7XA 1Y5AT 2G55A 2G81E 2V3MA 4GHQA 1VCPA 3RXBA 4DGJA 5A2MH 2BD3A 4X6MA 1DUEA 1T8LA 3RU4E 3VB3A 1C1NA 1V3XA 2GT8A 1D6WA 3GOVB 1OP2A 5GJ4B 1NRQH 5FBIA 1C5MD 4ZKOU 1DS2E 4FVDA 4FXGH 2ZPSA 1VZQH 2K8IA 4DY7B 2NU2E 1P8VC 1O2XA 1C5OH 1O2ZA 3KIDU 1WUNH 2AGEX 2Y5HA 1DITH 4D7GA 3RXRA 2GCTB 3SU2A 2ZQ2A 3EAJA 2OLGA 3MOCA 1Z7KA 1GCDA 1N6XA 1XVMA 1NROH 4MVNA 3TVJB 2ZKSA 1O37A 1FIWA 1C1VH 2FMJA 3RXEA 4JZIA 1O2WA 4SGBE 1MKWH 2OBQA 4OGYA 1WTHD 2CMYA 4UEHH 3RXLA 2ASUB 5AFYH 2BQWB 5GDSH 1ZYOA 3JZ2B 1F0SA 3LGIA 4JK5A 1OWJA 4ZAEA 1QHRB 3M5OA 2XBXA 3W1EA 1IAUA 1Z8GA 2F4LA 2QA9E 5BPEA 4AZ2B 5J4SA 3SGBE 1SSXA 1C4Y2 2CGAA 1IQGA 4HZHA 5FPTA 4ACAA 1BHXB 2G4TA 4GHTA 4XOJA 1SOTA 2IJOB 3LIWA 3M5MA 1P3CA 3GCHC 5I46H 1MTNC 1EATA 1AB9C 4X1PU 1JRTA 1QRWA 3RXIA 3ZYEA 1HCGA 2GV6A 5JBTA 1S81A 5JPMH 3KYFA 1A0HB 3R3GB 3QUMP 1NZQH 2IN2A 4X1QU 2Z9KA 4R0IA 1MD7A 1TABE 4B71A 2HPPH 2OQ5A 1BRBE 1EQ9A 3F9GA 4ISHH 1PPGE 1CT2E 1E35B 4X6OA 3PLBA 1YKTA 3BTFE 1PQ8A 4LZ4B 2ZFPH 2TRMA 1BMLA 2OC1A 3RXCA 1GG6C 3PTBA 2HPQH 1LHGH 1ELAA 3UIRA 3A87A 1E79D 1UO6A 1YPJH 4ABDA 1BBRK 1GMDG 2PKAB 1H8IH 1DLEA 1IQFA 1P9UA 2G5NA 3VB7A 3RXFA 1LKAA 1OWEA 3A7WA 4A1TA 5EQRA 3K9XB 1KDQB 2A4OA 2V3HH 2ZU3A 3FP6E 2PP6A 1TB6H 1IQKA 3KCGH 2FI4E 5A0AE 5F53A 1N8OC 1SKYE 1H8ED 1H8HD
chains in the Genus database with same CATH topology
2UUFB 3CP7A 2D1JA 2Q1JA 5JB9S 1OHHD 1Z6EA 3SV2H 3CENA 2VGCB 4AGJA 4UFDH 4Y0YE 4CHAC 4ZROA 1GI8B 1CT0E 3M3TA 1UVUH 2Q6FA 4INLA 3UNQA 3S9CA 3JZ1B 5T6FA 2BDCA 4ZCNA 1OKXA 4NFEA 5A8YA 1MAXA 2WPKS 1GMHG 3ATIA 1A3EH 5T1VA 4ZMAH 2VIQA 3MNXA 1C5RA 4MNWA 1KMHB 2GZ9A 2GCHF 2EI8A 1DWBH 1P2JA 2GD4B 1BT7A 1AMHA 5DPAA 2FYRA 1GJDB 4BAQB 4AGKA 3PMAB 3I29A 1K1LA 3OE7D 2PLXA 2HNTE 1S5SA 4D8NA 2KCYA 2A45B 3CS7A 1EZUC 3BG4C 1AIXH 1HAIH 4O3UA 4K8YA 3WWFA 1AWHB 3MU1A 4MTBA 1Y5UT 1GBKA 1P04A 3BTKE 1ZPCA 2ZU1A 1UVOA 5DO4H 2ZEBA 1HAZB 2RDLA 2W5EA 5HYOA 3FAOA 1WV7H 5EPYA 4AFZA 2BQ7B 1GJ4H 1HFDA 4MNYA 4B73A 4Y71A 4M9FA 3GCTF 3LT3A 3F9HA 2H2ZA 1KIGH 1P0SH 1RS0A 4IC6A 1O2YA 2A2XH 1TLDA 1TA2A 1C9TA 2WV9A 1Z1JA 1OWIA 1GI9B 1C2IA 2HALA 2CHAB 2VH6A 1EAIA 1SQAA 3QWCH 1CA0C 3TJUA 1E0FD 4X6PA 4X2YA 2P59A 4ISOA 2TGPZ 1YLCA 1C5XB 1W3CA 2WUBA 1A5GH 5GXPA 3FO8D 2FXRA 2HNTC 1QY6A 8GCHF 4B1TA 3A7YA 1NRSH 1DXWA 1C1TA 3F6UH 4XDEA 1LVOA 4O3TA 2FOAA 2G52A 1F2SE 3BTWE 4H4FA 1THRH 2BX4A 3RMLH 2F91A 5A8ZA 1KTSB 4JZEH 1HAOH 5T3HA 5FCKA 3RXQA 2FS8A 3LU9B 2XC5A 2O8LA 3SU1A 5C1YA 1PPZA 5E2PA 4O97A 3ITIA 2BOHB 2R0KA 2ZCLP 1YC0A 1CQQA 1WQVH 2TBSA 4OS2A 3HK3B 3FP8E 1VJ9U 1MQ6A 1DWDH 1MZDA 3F2HA 1XVOA 1MCVA 1JXPA 1SB1H 4OS1A 3M5LA 1EB1H 1TPOA 2W3IA 1ESTA 1QFKH 3PMJA 1V2NT 1ETTH 1HGTH 1GHBF 5C2ZA 2XBVA 2ZTYA 1O2LA 4CRGA 3ZVCA 3QN7A 1EPTB 4WMDA 1Y5BT 1ELCA 1FXYA 4PROA 4WXVA 5EGMA 3UUZA 4OM9A 3SV8A 4I8JA 4CRFA 3F2GA 5ESTE 1NFWA 5EPNA 1SLXB 4YTAA 2HOBA 3PYHA 2NU1E 5JB8S 1O3LA 5T6GA 2BLOA 1NC6A 4INHA 2JETB 1GHVH 2AIQA 3SQEE 1HNEE 1ARBA 1D6RA 4Y0ZE 1D3TB 1BTWA 2Y7XA 1EUFA 3D23A 4ESTE 3WW7A 1V2PT 1K21H 3TNSA 3A8AA 1O33A 4MQAA 2ODQA 1NFUA 1SLWB 2UWLA 4GLYA 2Z6BD 3CS0A 2Z9LA 2VIVA 3RMMH 3LDXH 1TRYA 1VGCC 1SQOA 2ZWLH 1P2NA 2GV7A 3OAAD 2Q6GA 1QBNA 3AAUA 3LPRA 3V7TA 1EOLA 1Y3XA 4JZFH 1S0QA 2KAIB 2Z7FE 3PM3A 1YF4A 3FOAA 1K9OE 3WWBA 2TGTA 3P6ZB 1RD3B 4NIWA 2W26A 2C90B 2NWNA 5FCRA 1AU8A 5K0HA 4J1YA 5GCHF 3SGAE 1KLJH 2HVXA 4X0WU 1X7AC 4F55A 5EODA 3DHKH 2FOCA 1BMMH 5DKMA 2BY7X 2FIRH 4NGAH 1FUJA 1TX8A 2HLDD 1AVWA 4X8UH 2TIOA 4K1EA 1L1JA 1W14U 2R0LA 2UWPA 1BTXA 4H42U 1VCQA 5TCAA 2GX4A 3SOSA 1YPMH 1F0UA 2PV9B 4D9QA 4YOJA 1KXDA 4XBBA 4BTTB 1A61H 1VITH 3A83A 2ZDNA 2XBYA 4WH8A 2CF9H 2FOEA 2ZFRH 1QNJA 1YYY1 1AHTH 5DSFA 4NSYA 1CGJE 1DXPA 5GWZA 2GZ8A 4WMEA 2QCYA 3QTVH 3RXSA 3ELAH 4NIVA 1QCPA 1YM0A 4RKOB 5EOKA 2BTCE 4D7FA 2ZZUH 1PPHE 3G01A 3U8TH 2D26C 1ZJKA 3GY6A 4B75A 1XXFA 1RTFB 1C2DA 3ZZ9A 4DVAU 2Y7ZA 2B8OH 3IITA 1HXFH 2F9UA 3SJ9A 3MO3A 1H9LB 2XRCA 5FAHA 1GBCA 1AFQC 5FPYA 3MI4A 4GAWA 1TA6A 1GBHA 3MU5A 1O2IA 1ZTJA 5EQQA 3SU6A 4FUJA 3PO1C 2BLWA 3ZVFA 4J2YB 1FN8A 3FP7E 2BDIA 1L1NA 3ZZDA 1UHBB 1PYTC 1FONA 2PSYA 4B2AA 1C5QA 4WXIA 4X2VA 1HIAB 1ANDA 3M36A 2EI6A 5H4IB 3UY9A 2PHBA 4R8TB 4AYVB 1SGFG 3GCTG 2QE7D 5HKKD 3NWUA 3VEQB 1A1RA 1TX7A 1SLUB 4TSFD 3UFAA 2VIOA 1FMGA 1HAVB 1LHEH 1SL3A 1C5ZB 1TONA 2ZDMA 4LK4A 4TPYA 1LQDB 2AHME 4FUDA 1V2RT 3E1XB 1F0RA 1V2JT 2BZAA 4K2YA 5E8EH 1V2OT 1G32B 5C0TA 1K22H 1ZHMA 8GCHG 3UB0A 1WSSH 3T28A 3GCOA 2YNAA 5CHAB 4YLQH 5AVDA 2RG3A 2QF3A 2VH0A 3Q3YA 1TGCA 1FPCH 1FY4A 3K2UA 4TY7A 1FI8A 1O2OA 1QB6A 2C3SA 4NA7A 3PRDA 1MBMA 3GYLB 2H1UA 3OSYA 1C1MA 1UVTH 2B5TB 4FU9A 1C5SA 3QK1A 1P05A 3ATWA 2C8ZB 5CDFE 5C17A 2XWBI 1NBME 3LOXA 1HJ8A 1P57B 3RXKA 1EFRD 1GHBG 2GTBA 3RXHA 1DY9A 1FLEE 1LQEA 2FPZA 4ABAA 4A6LA 3F2FA 1A0JA 3L6PA 1SC8U 1AKSB 3GY4A 1DPOA 5A0BA 3B8JA 1QTFA 2PUQH 3PTNA 1UK2A 2VWOA 4ABFA 2WPDD 3TJOA 1G2MA 3T27A 1VCWA 1GDNA 1RFNA 5AF9H 3MWIU 1YPHC 2P8OC 1WOFA 1MH0A 2IJD1 1BTYA 1UMAH 2Z9JA 5PTPA 1TGTA 3TJNA 4WJG2 4FVBA 1O2QA 1VR1H 1RIWB 3GY2A 4FUBA 3SO3A 4B6EA 5FXLA 1D9IA 4BXSA 1O2TA 4INKA 3OTJE 2YNBA 2A2QH 2BDYA 1YPKH 1HB0B 4BANB 1O2MA 3PLKA 1H1BA 4MPUA 3PRBA 2XCFA 4A7IB 3EGKH 1ABJH 5EG4A 4MNXA 4TWWA 1TNHA 5FBEA 4CRCA 1CO7E 4ZXYH 3URDA 1AN1E 2A4GA 4Q7YA 3SBKA 1YLDA 3VPKA 5ETXA 2XWAA 3FN8A 1GI6A 1D3DB 1DDJA 1TOCB 2OP9A 3MU8A 4Z6AH 1QJ7B 3Q77A 3SV9A 1P06A 2AGIX 1GBAA 3DFLA 5GCHG 3UWJH 1ELVA 3VGCB 1YGCH 2VIDA 1G3BA 4OS7A 3V12A 3VG8A 5IK2D 3PV2A 1GBFA 1O2GH 2CN0H 1G30B 2STAE 1GDQA 1ETSH 4MPXA 3IWMA 4NCYA 1TGBA 2O8UA 1W13U 4OS6A 1QJ6B 1T32A 1GCTC 1W7XH 1K1IA 1EAXA 1O2UA 4DCDA 1DY8A 6CHAC 3QLPH 2FOMB 1P2OA 7ESTE 4X8VH 3Q76A 2OXSA 2WYJA 1P3EA 1MABB 2J9NA 1AQ7A 1C1UH 3LGVA 3GDVA 1QB9A 3TH3H 4A1VA 2QYIA 2KR7A 1RGQA 4KTUA 4TYDA 1FY8E 2F9OA 4OGXA 1NFYA 1BBRE 1ZMNA 1ZOMA 4VGCB 2FDAA 1Y3VA 3MYWA 2Z94A 1DUAA 3T2NA 2SGPE 2GT7A 3KQCA 2YMSD 2WPJS 2ZPQA 1LDTT 4IMZA 3EYDA 4YOIA 3AAVA 4ZHMU 1O2PA 2FTMA 3U69H 5SGAE 2WPMS 1JMOH 3A88A 3MO9A 1A0LA 1K2I1 4GCHF 1C1PA 3K6ZA 3OTPA 5B6OA 4I8LA 1TIOA 1GGDB 1TWXB 4AN7A 2BD2A 2WV5A 3BEIB 4DIHH 1Y3WA 2ZU2A 4AB9A 2BVSH 1LVBA 3U8OH 2SNWA 2OTVA 4B76A 3ZZ6A 6ESTA 1SHYA 1MCTA 1ELGA 5AFZH 2WV4A 3U1IB 4YESB 1UTJA 1EASA 1ANBA 1BITA 3ZVEA 3GCNA 2V7QD 2A7JA 3VFEA 2ZHWH 2BLQA 2BXTH 2BD7A 1C1QA 1QRXA 1O34A 1CHGA 3D49H 1C2MA 4E06H 1O5CB 3BF6H 1O5DH 2KCPA 1TPAE 1XUGA 3F1SB 4NA9H 4NWLA 5F03A 3LJJA 3UR9A 1TNIA 1TRMA 3A7ZA 1TNKA 4XD7D 1UTMA 2ALPA 2BZ6H 1AI8H 1J16A 1KXAA 3HATH 3QZQA 5EW1H 1O2KA 3SGQE 1S6LA 3BEFB 3H7OA 1O3OA 3ZIAD 1PPBH 1SLVB 1UVSH 2FO9A 2QXIA 3ZZ4A 1Z8IB 4Q4LA 2BDBA 1YCPK 2BY6X 1OWKA 4JCNA 1BBRH 1NM6A 1GL1A 1LPZB 1ZHRA 2ZDKA 4Y8XA 2A5IA 1ZSLA 2CXVA 5HGGA 3M3SA 4AYYB 1P09A 2AMQA 1GJAB 1BTHH 1DSUA 2PGQB 1GI3A 3SJ8A 2PKSC 2GZ7A 3M35A 1T8MA 2ZFFH 1JIMA 4KELA 4THNH 3SUGA 2GKVE 4K5ZA 4HFPB 3A8CA 5EW2H 1P2MA 4CH8B 4IN2A 2RA0A 4ABIA 4NG9H 4X1SU 1XX9A 2ZIQH 4E05H 3TU7H 3MU0A 1XUKA 4B74A 1SGPE 2QF0A 1E37B 1F5KU 1CHOF 1SGRE 1XMNB 1CT4E 1UTQA 1GJ8B 4X2WA 5F6MA 2XCNA 3TITA 3M7TA 4YT6H 5T6DA 1IHTH 3EA9A 3GICB 1P03A 5C3NA 1PPEE 2FOHA 3AASA 2P94A 2OBOA 5C1UA 1P12E 1NRNH 2SGEE 3PV5A 1SGQE 2QN5T 3I78A 5DP4A 1BJUA 4MPWA 2J4IA 3HPTB 1ZZZA 2HGTH 3GDUA 2H5DA 1ESAA 1S84A 3PMHB 1V2ST 2F9PA 2BM2A 1TPPA 4D9RA 2BD9A 2BVRH 1AY6H 4AFQA 2JDID 1G3CA 3MU4A 1LPGB 3GYMA 1GHAF 3STIA 1H8DH 3TLOA 1T7CA 2PSXA 4ZHAA 2VIPA 3E90B 1WU1A 3UQOA 3BTTE 1CBWC 5EXNA 1LVYA 1WXRA 1CU1A 1HLTH 3RXJA 3DD2H 1V2MT 3S0NA 2OK5A 2XXLA 1MU8B 1QL7A 1TPSA 1T4UH 1UK4A 5E0GA 3SV6A 4X8TH 1HV7A 4YO9A 5DP6A 4BOHA 1Z6JH 2XC0A 3M5NA 4ZUHA 2ZI2H 1ELFA 3AK5A 3VB5A 2FWWA 1XUJA 3K6YA 1P2QA 1RRKA 4BTUB 3H09A 4HTCH 1UCYK 2GDDA 3GCHB 3W94A 4AFUA 1MTNB 1AB9B 1ELBA 4DIIH 1LHDH 1O32A 4I8HA 6GCHF 3D62A 4X6NA 4NIXA 2KM0A 9ESTA 2GDEH 2ZGXH 2TPIZ 2BYAX 3EA7A 1HDTH 3SZEA 4A5TS 1GVKB 2ZFQH 1GL0E 1N1LA 2VBCA 5K7RA 3SJOA 1GG6B 3MNSA 1O38A 4NZLA 2ZG0H 2ZCKP 2KCAA 1FN6A 1C1RA 1TBRH 1A7SA 2VIWA 3A7TA 5LGOA 3ATMA 3Q00A 3V3MA 2Z3DA 1JOUB 1LO6A 2ZPRA 2ZQ1A 5DP7A 1FAKH 1UJ1A 1JRSA 2GMTC 3ZVBA 1NRPH 1IHSH 1KYNA 4CREA 1P2IA 1C5LH 2QXJA 3RC5A 3SUFA 4GCHG 1TMTH 2CV3A 3LH3A 5DJ7A 1TE0A 2XOKD 1N8OB 1L4ZA 3W95A 2OINA 1O3MA 3BTQE 2C8WB 1EJNA 2BX3A 2ULLA 1SGNE 3EE0B 3T5FH 1ANEA 1SOZA 1OP8A 2HNTF 4K1SA 2Y82A 3RU4D 4XFQA 3TJVA 1O35A 3UNSA 5JBCS 4CHAB 3NK8A 1L2EA 1QL8A 1KLTA 3VXEH 1EP6A 5HXFA 3RC4A 3SUEA 2BY8X 1TMBH 5JBBS 2XNIA 2WYGA 1BRUP 3UWIA 4I31A 1S6FA 4GSOA 1ZR0A 3BEUA 2AS9A 2NU3E 1C1WH 2NU0E 2VJ1A 3KQEA 2HRVA 2RCEA 2F9VA 1TBZH 2ZC9H 3URCA 3P8FA 3BG4B 2A31A 1YCPM 3M3VA 1KLIH 1OSSA 3MNCA 4HGCA 1CVWH 3NCLA 1L0ZA 1CBWB 1ELEE 1G3DA 1C2HA 3RXGA 2PUXB 4U32A 1W2KH 1Q3XA 1FY3A 3T26A 1D3QB 3B23B 1SR5C 4D76A 5DP8A 1MAYA 4TWYA 4JZDH 5IYTA 3RDZA 3FKSD 1C2EA 1CA8B 1CA0B 1EAWA 2EC9H 5I25A 1O3JA 5AHGH 3K65B 1S6HA 3SNCA 2ANYA 4Q63A 3NPSA 3DFJA 3QX5H 2M5TA 1RTKA 2G51A 3KQBA 1GBJA 2P93A 1CHOG 1Q2WA 2ZHQH 3BTEE 2W7SA 1NU9A 5C67A 1EAUA 1IQHA 4TT3D 2HWLB 1VITF 1OYQA 1G36A 2FX4A 4Z1MD 4XBDA 1KXFA 1WQSA 1N6YA 3ZZAA 3FANA 1FX0B 2BQ6B 2QXGA 3E0NB 2ZFSA 1HPGA 3QZRA 4BAKB 2C4FH 5DG6A 1YPGH 2GCHG 2ZGJA 1ZPZA 2OCVB 2SGDE 4MNVA 3KEEA 2UUJB 1DT2A 3MH6A 5C1XA 5C5OA 1GJ9