1NESE

Structure of the product complex of acetyl-ala-pro-ala with porcine pancreatic elastase at 1.65 angstroms resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE
publication title Structure of the product complex of acetyl-Ala-Pro-Ala with porcine pancreatic elastase at 1.65 A resolution.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 59
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1995-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1nesE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1nesE01
2BLQA 1G2MA 3BTTE 3FAOA 1UK4A 2SGFE 4IBLH 1LVBA 1PYTC 1BCUH 3RXPA 1ZSJA 1P2KA 3VB7A 1EOJA 1BRCE 2UUYA 2FODA 4I7YH 1Y59T 3RXAA 2Y5FA 1QRZA 1MTNB 2HWLB 4BXWA 1AFQB 2Z9IA 1O2UA 3QWCH 2OQUA 1AMHA 4X6OA 3SI3H 1B0EA 2F83A 4Y7AA 2QY0B 5CE1A 1ORFA 1UTNA 1HB0B 5JBCS 4GVUA 1ESAA 1Z7KA 3SOSA 1S0QA 1Y3YA 2YOLA 4Y71A 3GCHB 2P3TB 1SGCA 1EQ9A 3PWBA 3MNXA 3R3GB 2ZGHA 1P04A 2G52A 3PYHA 4XBCA 1CO7E 1O36A 2VVVA 1W0ZU 4K60A 1AWHB 3FVFB 1UJ1A 4B71A 1GG6B 1S6HA 1C5SA 4A1XA 4HTCH 1QURH 1FPHH 1HAIH 1O2ZA 2ESTE 2FTLE 2NU3E 6GCHF 4BAHB 2C8YB 1NS3A 2W7UA 1W10U 1IQEA 1C5NH 1TGSZ 1TYNA 2Z94A 1Y5AT 4ABDA 3LJJA 4I32A 1FONA 1EPTA 1PPZA 1ETRH 2BDYA 1BBRH 5A8ZA 2AGEX 1N8OB 2HPQH 3TLOA 1HXEH 1C5OH 5JDUB 3GYLB 4J2YB 2C90B 1GGDB 1E38B 5CHAC 4A92A 3ZVFA 1HDTH 2M5TA 2QC2A 4HGCA 1LTOA 2G4UA 3GOVB 4D7FA 1NTPA 5DK1A 2TIOA 4TPIZ 3M3SA 1XX9A 1DVAH 3FP8E 1Q3XA 2AS9A 2PKAA 1TX8A 4H6TA 4CRCA 4A1VA 2B7DH 1WQSA 4U30A 3A86A 1YLCA 3TK9A 1VITG 1ARCA 2R2MB 3UIRA 1EAIA 4IN2A 4UFEH 1BZXE 5FX5A 1D3DB 2FMJA 3SNAA 2VWNA 3IITA 3KIDU 3RXMA 4Y0ZE 2ZHFH 1AZZA 1JXPA 2OINA 2A45B 3TH2H 1EPTB 1T4UH 1A3EH 1OYQA 5FAHA 4SGAE 1RTLA 4NGAH 2PWXA 5L30H 3S7HB 3SV6A 1G32B 1OWIA 3T27A 1C1UH 3BG4B 2FOGA 1NO9H 1GDQA 3MYWA 3O8CA 1UTMA 1YPHE 2G51A 2R0KA 2Y82A 3QGJA 1LVYA 3UOPA 1V2WT 3QLPH 2A5IA 1ACBE 3NWUA 1ZMNA 4KKDA 3S9CA 1CBWB 1FXYA 1MD7A 2BZ6H 1GI2A 2PKAB 4ZROA 1BJUA 3M61U 2BD5A 2BLVA 4YTAA 4XBDA 4TWWA 5JBBS 3E0NB 2PV9B 3O8BA 3SNBA 1AN1E 3KN2A 3ATKA 1D3QB 3DHKH 2PLXA 3L6PA 3D23A 1QQUA 1H8DH 1GBEA 1SMFE 1IQJA 1NFYA 3Q77A 2ZDNA 1ZZZA 1EJNA 4ISHH 2TGPZ 4MNXA 1MTUA 2VJ1A 4LZ4B 4ESTE 2BDIA 4GLYA 1W14U 1Z1IA 4DY7B 2CJIA 4CH2B 2XBXA 2BLOA 2R3YA 3MMGA 3PMJA 3BEUA 3TJVA 5H4IB 1ZJKA 1TPOA 1C2LA 1K9OE 1V2MT 5DKMA 3D62A 1V2QT 1Z1JA 5E0JA 1TQ0B 4UE7H 4Y79A 3BTWE 3W94A 2D26C 2A2XH 3PM3A 1QA0A 3SJ9A 2AFQB 2BY5X 3F9HA 1GCDA 1V2OT 1ZLRA 2ZU3A 5DP3A 4K1SA 4UFDH 1ID5H 1OWKA 2J9NA 5LPFA 3ZZ7A 1UCYE 1AKSA 1HFDA 3SU6A 2THFB 3BV9B 4AG1A 3Q3KA 3LGYA 1G30B 3DT0H 3KGPA 3LDXH 8LPRA 1DDJA 3P92A 2Q6FA 1GDNA 3E0PB 1KDQB 2JH0D 3RLWH 1FLEE 1O35A 1FIWA 4JYTA 1XM1A 4ZH8A 2ZHWH 2WPKS 1XKBC 1P3EA 3QO6A 1GBBA 1GMHG 3UWIA 1JIMA 5DP4A 3SUDA 4IGDA 1YPMH 2HNTF 3ZZ5A 1O30A 1XUGA 1BJVA 1EOLA 2ZTZA 3TGKE 1FY1A 1ANDA 1LHEH 2FIRH 1EAUA 1G3DA 2XTTB 2A4GA 3RM2H 1XUHA 3SV7A 1AUJA 4AGKA 1MZAA 3OY6U 1A4WH 1P11E 3SNCA 1THPB 3M3VA 4X6MA 1AKSB 1SGEE 1NRQH 4DGJA 1UK2A 2QV1A 3MU8A 2ALPA 5E2PA 3A83A 1ZHPA 5F8XA 3ZVCA 1CQQA 1EATA 4XE4A 1ESTA 2QXGA 1RGQA 3P8OA 4KELA 3RMMH 2VNTA 1O3BA 1KXBA 2EA3A 3TIUA 1CU1A 1DE7H 2XW9A 1UTPA 5AFZH 1TGNA 3SJIA 1UVTH 2Z3EA 1SC8U 2FOEA 4I31A 1XMNB 1W12U 2A7HA 2ZGXH 1XXDA 1B7XB 2PUXB 2ZFPH 3UUZA 2R2WU 2BTCE 1A5HA 2Y7ZA 1JOUB 4XSKU 1MUEB 2OXSA 3VFEA 1TNJA 1GHAG 3M7QA 5EW1H 1AHTH 4YZUA 4XFQA 5EQSA 2Y6TA 1HAXB 4AX9H 1SGDE 1O3GA 1VCPA 4D8NA 2J34A 3MNCA 1O3LA 1BBRE 2ZHDA 1A7SA 4BTIB 3LKWA 1K1NA 4A7IB 2ZHEH 1CHGA 1OWEA 2GMTC 1SGPE 1CA0C 4YLQH 2IPHA 1GI7B 3ZV8A 2BXTH 1CVWH 1AI8H 4OS6A 4YOIA 2FI3E 5EW2H 4Y76A 1K1LA 2WUBA 1E34B 1BT7A 2A4QA 3BG8A 3RDZA 1AE5A 3ZV9A 4BTUB 2PKSB 3SQHE 1MAXA 1YKTA 2CGAA 1A5IA 5AF9H 1G36A 3Q00A 1RTFB 1O2TA 3GDUA 4WMFA 1Y3WA 2PGBB 3SHCH 5GPIB 2EC9H 1QGFA 1FPCH 5ABWA 3LJOA 4IW4E 1UTJA 1QTFA 1C5XB 1O2VA 3EA9A 4NSYA 3HK3B 1YPJH 5J4QA 4INHA 1GI3A 3GYMA 1INCA 2BD9A 2P93A 4BAMB 3EGKH 4NIYA 3SNEA 3TPIZ 1LVOA 1GI8B 2RA3A 4K2YA 4F49A 4WF8A 1TABE 1L1GA 5DP7A 2XBYA 4YM9A 1MTNC 4Q2KA 4ZUHA 2O8MA 1AFQC 3V13A 1UTLM 2FOCA 3AASA 1LMWB 1MTSA 2F91A 1BTYA 2Z6BD 3E90B 3F6UH 1LQDB 4MDSA 1O3OA 2Y7XA 4U32A 3WY8A 1K2I1 3I77A 4K8YA 4X8TH 1A3BH 1BRAA 2F9BH 3EYDA 3T5FH 1VJAU 4FUJA 4AORA 3MO3A 2HNTE 3O8RA 1JRTA 2QCYA 1BQYA 4Y0YE 1GG6C 3BF6H 1P2MA 1LHGH 1DUEA 4AB8A 5C3NA 1KYNA 4WJG2 1UCYK 5DPAA 4B73A 2BB4A 3LC3A 2GZ8A 4A5TS 4MQAA 2EEKA 1P9SA 4NSVA 3UNSA 2O9QA 1C5TA 2TGAA 1N8OC 2D8WA 1DY8A 2OUAA 2FO9A 4K3JA 3E8LA 4Q7ZA 4YT6H 4X8SH 4D9QA 1SB1H 2ZA5A 3P70B 1K1MA 1WBGB 4R0IA 1GBTA 1C9TA 4X6PA 3SU5A 4U01A 1U6QA 1MAYA 3E1XB 2H1UA 3A8BA 2ZU1A 4AYVB 1QQ4A 1YYY1 3NKKA 2ZIQH 1TRNA 1ZJDA 5HM2A 1ELEE 1RFNA 2TPIZ 2BVXH 1DWCH 1AVGH 1T8NA 1WCZA 1S82A 2ZEBA 2CF8H 1CHOF 3SW2B 2FWWA 1E36B 4I8GA 1HJ9A 1KTSB 4IC5A 2PFEA 1O2IA 3LC5A 3NK8A 4OGYA 1LO6A 2VIOA 2P59A 3BG4C 3MU5A 1EASA 1QJ1B 1O2XA 4FVDA 5K0HA 2VH6A 2PR3A 5ETXA 2BMGB 2UUFB 1MCTA 3I29A 1GHWH 4H6SB 1SFIA 3RU4T 3ZZAA 3UR9A 1ZGIA 1C1VH 4X2XA 4CRAA 5SGAE 2HRVA 3TVJB 2W3KA 1P2NA 3M7UA 2ZF0H 4AFUA 1H9LB 3F1SB 2O8LA 3U8OH 4JYVH 1NU7B 4K5ZA 3K6YA 1GHXH 1KTTB 2SNVA 1GBDA 2UWOA 1RJXB 2IJOB 1LVMA 2W5EA 3M36A 1XUKA 2FOFA 2XCNA 4ABEA 4U2WA 1S84A 1O2KA 5HXFA 2ILNA 1NRSH 4DURA 4ABGA 3SV2H 1C5UA 1V2NT 2BD2A 2G00A 4UD9H 3UWJH 3S9AA 1V6DA 1FNIA 1ZPBA 2V6NA 1UCYH 5C67A 2AMPA 3M5MA 3RXEA 1O39A 4GUXA 1IQLA 2SGEE 2OC8A 3M5NA 5JPMH 4ASHA 1C5RA 3PMAB 3B9FH 1O2HA 4KTUA 4E7RG 3ELAH 1A0HB 4TY6A 2BDHA 1O3IA 3D49H 2ZHQH 4YESB 3T2NA 4R8TB 1AZ8A 2J2UA 2YNAA 3RU4D 1NESE 3VGCC 3PLBA 3EAJA 5JYIA 5C5OA 4X1SU 1ZSKA 1NZQH 5EODA 1C9PA 1TNGA 3P8NA 3A81A 3TJOA 7LPRA 1EKBB 2GV6A 2H9HA 1GBCA 4MVNA 3AW1A 2JKHA 2PGQB 3VB5A 3A88A 1QB6A 1L4ZA 1DWDH 1SLXB 2ZGCA 3VB3A 4CREA 1MBQA 3SN8A 1TALA 3OYPA 5A0BA 1D9IA 8GCHG 1XXFA 1CGHA 2VB0A 5GCHG 1OWHA 1DWBH 3SUGA 3GDSA 1UMAH 4JZEH 1ELAA 1SGNE 3OSYA 1SBWA 3RXOA 2LNCA 3ZZ9A 1TLDA 3CS7A 1G37A 2J94A 3EQ0H 3A80A 1AB9B 1BHXB 5PTPA 1T8OA 2H9EH 3P17H 2ZZUH 3ESTA 1ZTLA 1G3CA 1TGBA 1GMDG 2GKVE 3T26A 2AH4X 1OKXA 2R3UA 1O34A 2FEQH 2DUCA 1DS2E 2YNBA 2K1QA 4DJZB 1N1LA 3PTBA 1FQ3A 5E0GA 5A2MH 1TX7A 4GCHF 1TNKA 5AVDA 1ANEA 2ZDKA 2WV4A 3FP6E 1HJAC 2ANWA 1J15A 2GGVB 2A4RA 4NCYA 3G01A 5GIBA 3ZVBA 1FI8A 2H5CA 4X1NU 1O2PA 2WPIS 1C4V2 4XBBA 1O31A 2AGIX 4FUFA 4I33A 2NU0E 3MH7A 1MZDA 2Y80A 5L2ZH 3GISB 2ZFFH 3H5CB 2AEIH 3JZ1B 1K22H 2PW8H 1GMCG 4FUHA 1YC0A 2PTCE 4BAOB 2GV7A 2ZPRA 1K21H 1WUNH 3MU1A 4X6NA 2JH5D 4I8JA 2F9OA 1TRYA 2RA0A 3RC6A 1GCTB 1A1RA 1G2LA 1GVZA 1MQ5A 4CR5A 2GCHG 4HI3A 4K69A 3PROA 3SV8A 4O03A 1C2HA 3SU3A 4RKJB 1GBIA 3B23B 1G3BA 1ELVA 1C2MA 3M7TA 4D9RA 4XOJA 1HAZB 4FVBA 5C1XA 4O3TA 4K1TA 3UNRA 5IYTA 1HGTH 3MTYA 4D76A 4JK6A 2QXJA 2C3SA 3VXFH 3TNTA 1OX1A 3MO9A 2PKSC 1QB9A 2ZPQA 3SU2A 1WTGH 2ZFTA 1LHCH 1SLWB 1Y3UA 1S81A 1OSSA 1W2KH 2D2DA 4FUIA 1TGCA 1H9IE 2OP9A 1K1OA 3AVZA 2C8ZB 4X1PU 2BVSH 4RN6A 1W8BH 6CHAC 3A85A 3SU4A 1P06A 3V7TA 2NU1E 1O3NA 1HLTH 4LXBH 2ZO3H 3QZQA 2XYAA 5E0HA 3W95A 4BAKB 1TBRH 2BY6X 1AY6H 1AVWA 1ARBA 5AHGH 2XC4A 2BX3A 3FP7E 2SFAA 2XXLA 2A2QH 2BLWA 1YLDA 4KGAA 3A82A 3CS0A 1N6XA 1KXCA 1SG8B 2VINA 5FCKA 1FIZA 1A2CH 1O2WA 3PB1E 4ISOA 1O3AA 2FTMA 1C5YB 1ZYOA 5A8XA 1PPGE 4ISNA 2J92A 5TJXA 2OBQA 2ZDAH 1C1WH 1KDQA 4DG4A 1AO5A 4OS1A 4AYYB 2JH6D 2UWPA 1HXFH 5F8ZA 2BX4A 1L0ZA 3AAVA 1QBVH 2SGQE 2NWNA 2FDAA 1TMTH 5A0CA 4ZXXH 3RXFA 3SORA 4ZKSU 3K65B 1HRTH 2XWAA 3N7OA 3E6PH 4DVAU 2ZI2H 2ODYB 3TGIE 1ZSLA 1BHXF 1D4PB 1GHZA 2BZAA 1DXWA 3RXKA 1KXFA 5HMAA 1GVKB 1P9UA 1QHRB 4GSOA 1OWDA 1SGFG 1TMBH 4K8BA 1HAHH 4INLA 1HAYB 3KNXA 1MKWK 3PWCA 3SUEA 4I8HA 5C2ZA 1QNJA 1J9CH 4FUCA 2WPJS 1XVMA 1F5RA 3GY2A 3A7TA 3BIUH 4MTBA 1ANBA 1O3DA 2F9UA 2PUQH 4B2AA 3VGCB 2ZGBH 1CSOE 3GCOA 2SGAA 1O32A 4F4OC 1FAXA 4KTSA 1SGQE 3GCNA 4JCNA 4YO9A 1IQGA 3ATIA 4H42U 4B1TA 1O38A 3ZZ4A 1F0SA 1H8IH 3ZYDA 3BEIB 3QTVH 3STJA 5DP8A 2A5AA 1F0TA 1IQMA 2ZCKP 2P3UB 1ELTA 2B5TB 1F2SE 4B75A 2VIVA 1QBOA 5HGGA 1ELFA 1P10A 1Z8RA 4ZHAA 3MFJA 1P2JA 5F6MA 2W3IA 3RXDA 1B0FA 3TU7H 1TNLA 1D6WA 1ZGVA 1O3EA 1ABIH 2GT7A 1L1NA 1KXDA 1V2PT 2PSXA 1TA2A 2A1DB 2Y81A 1W7GH 1MQ6A 4MPUA 3SGAE 1ZRBA 1QIXB 2BM2A 1HCGA 3KQDA 1KLIH 1ELDE 2HPPH 2WUCA 4IN1A 3UREA 4CRBA 2RDLA 5EU8A 1FN8A 3R0FA 2FI4E 1TE0A 3C27B 8ESTE 1DWEH 3ZZ6A 1V2KT 1ESBA 2A7JA 1PPHE 4BXSA 1HJAB 1O3HA 1SLVB 4NIXA 3ODFA 3P95A 2G81E 3RXRA 2RG3A 1DM4B 3LGTA 3IG6B 5GDSH 2GCTB 2OLGA 3T62A 1J8AA 1GVLA 1V3XA 4WXVA 3L3TA 5DP6A 4Z0KA 2PHBA 1DLKB 2C8XB 2UWLA 3QX5H 2AIPA 1YGCH 6GCHG 1YM0A 1TMUH 1DXPA 2QF3A 3GCTF 5E2OA 2JETB 1GHBF 5LH8A 1EP5A 1MTVA 4DW2U 1UO6A 5C1YA 3KF2A 4AFZA 1QA7A 3UNQA 1FY5A 3KEEA 4BOHA 1NT1A 5ESBA 4FU9A 1KLJH 1Z8GA 1GL0E 4OS4A 4WY3A 1MKWH 1QFKH 1P57B 1DX5M 3MNSA 2ZQ2A 1GJBB 4ZMAH 2FYQA 5DP5A 4E7NA 4NA8A 2NU2E 3S9BA 1DOJA 1YPLH 3FANA 5A8YA 2C8WB 2Q6DA 4BANB 2FX4A 3SUFA 3E3TA 1SR5C 1GBFA 3UTUH 4Y8XA 1BMLA 1GWAA 1C1NA 1KIGH 6CHAB 2DE9A 2STBE 3EE0B 4AN7A 2B9LA 1XUIA 1O5GH 1F0RA 1C1OA 1JRSA 2OTVA 1TPSA 2ZWLH 1SPJA 4DIIH 1MH0A 1NPMA 1OOKB 7KMEH 1OP0A 1EAXA 4OS5A 1BTZA 1CT0E 3BIVH 3E16B 1MKXK 4RSPA 4NA9H 3RXCA 4GAWA 3MH4A 1AB9C 1C5PA 1ZTKA 1GBHA 5L6NH 3VEQB 3GICB 2V3HH 1UK3A 1OWJA 4IS5A 3MNBA 3TJUA 4D7GA 2HVXA 3HPTB 1PJPA 1CGIE 1GJ4H 1P2QA 3NXPA 3URCA 1F5LA 3QK1A 3GY7A 1LHDH 1HYLA 4CBOA 3FZZA 5G4BA 2VIDA 3MH6A 1C5MD 2BOHB 1GJ8B 1UTKA 4SGBE 2VWMA 7GCHF 1C2DA 1TPPA 3LT3A 5CMXH 2AERH 2VIPA 2ZFRH 5HM9A 4X1RU 3RXHA 1ZOMA 1DT2A 2HALA 1N6YA 1GL1A 1V2RT 3F9GA 4A1TA 3QTOH 1JBUH 1E37B 1UHBB 1JIRA 4BAQB 1BTHH 4NIVA 2XRCA 3UY9A 3KQEA 4DCDA 2O8TA 1WSSH 4KTCA 4YLUA 1QCPA 1C4Y2 4WWYA 1FDPA 2ANKH 2Q6GA 1GCTC 2P8OB 4WMEA 1V2LT 3RLYH 3ZZDA 1O2GH 3SQEE 4GHTA 3TK5A 4FU7A 1Z8IB 4M7GA 5GWZA 1V2TT 4MNYA 1EB1H 3F9EA 2Z9GA 3QGNB 1DPOA 1C2IA 1HPGA 1VITF 3ATMA 3U1IB 3HGPA 1TRMA 2ZTXA 4GPGA 5LPRA 1HBTH 2OC0A 1DSTA 1NRNH 1WV7H 2BXUH 1O2SA 2CF9H 3SJKA 1X7AC 2GP9B 2HGTH 3Q3XA 1O3FA 2ALVA 1GHVH 1YCPM 1GI4A 1P2OA 1BTWA 2GDEH 2J38A 1GBAA 1PQ8A 2BD3A 1C4U2 3TJNA 1GI0A 3SGQE 2FYRA 1O2QA 4YT7H 1LHFH 1A5GH 3OX7U 1QRXA 2AMQA 4AZ2B 4WH6A 3OY5U 4X2WA 1T31A 1C5QA 1GPZA 4NG9H 1P0SH 5DG6A 6LPRA 1P03A 1DANH 3SV9A 2BYAX 1NRPH 1P01A 4UFFH 1C2GA 2BQWB 4UDWH 4CH8B 5JB8S 1FJSA 1ZHMA 4ZKNU 5LGOA 1W7XH 2VVUA 1TB6H 2WYJA 4ISIH 3A7VA 2WPHS 1MKXH 1NROH 3LH3A 1TONA 2Y5HA 1OPHB 1O2LA 1O2NA 1Y3XA 4B74A 2KAIA 1ZHRA 1ABJH 1NRRH 1IHTH 2XCFA 2FLRH 4ZXYH 1SLUB 4QT8C 5T3HA 2EI7A 2SNWA 1AVXA 2ZTYA 1Q2WA 1MTWA 2ZQ1A 3S69A 1TPAE 2BDGA 3U8TH 2G4TA 4AB9A 3RXTA 1ZR0A 2W26A 3PV4A 4CRGA 5EPNA 1QJ7B 1EZXC 4MG3A 5TCCA 3RC5A 1P2IA 1NU9A 1GI9B 3PLPA 1F0UA 3PO1C 3GY4A 1A0JA 1YPEH 2GTBA 2A4OA 3SJ8A 1RD3B 3K9XB 9LPRA 2Y5GA 1O37A 3RXUA 5F03A 3V12A 3NPSA 2ZDMA 3MU4A 4CRFA 4CR9A 4A6LA 5EXMA 4KP0A 1Z8JB 3RXJA 1IHSH 1UVOA 3M3TA 1S6FA 1WQVH 3P8GA 3UR6A 2KAIB 1SQTA 1S85A 1O3KA 2ZU5A 2BD4A 1O3CA 5I25A 2OBOA 1O3PB 1V2JT 3BTHE 2FM2A 4X2VA 4B76A 1G9IE 1OYTH 1BMMH 3SU1A 4YOGA 2FS8A 3B8JA 4OS7A 4AG2A 2ZC9H 5AFYH 4Y8YA 1GMHF 3RXGA 4TY7A 4AFSA 3VPKA 1MD8A 4JZFH 4FU8A 1BB0B 1HUTH 1CT4E 3IWMA 3VXEH 5JBTA 1ETSH 2FXRA 2ODQA 2TRMA 2Z3CA 1MBMA 2C4FH 1GBMA 4TYDA 1HIAB 3C1KA 4AFQA 5FPYA 1KSNA 3DFJA 2F9NA 1IQHA 1WAYB 2OCVB 1GI5A 3P8FA 1OP2A 1L4DA 1TBQH 3SZNA 1GJAB 4FUBA 5GJ4B 5DO4H 1VGCB 3E91A 1BMNH 1C5ZB 1O5EH 2FOBA 4THNH 1PPFE 2GD4B 1BOQA 3V3MA 1SGTA 1KXAA 1GJ6A 1S0RA 3KL6A 5C20A 4I8KA 4IMZA 3H7TA 1SOZA 2CMYA 5JBAS 1O2JA 2GX4A 2QYIA 1TNIA 4PROA 4IMQA 4OS2A 3LGWA 1TWXB 2QGRA 3EDXB 1Y5BT 2ODPA 2GCTC 1TNHA 1J14A 1LPZB 3NZIA 1RS0A 2CHAB 5A0AE 3RXBA 1ZMLA 2F9PA 3RXQA 5BPEA 4Q7XA 1UVSH 1YPGH 1F92A 1M9UA 1V2VT 3RMLH 7GCHG 3ZVDA 2SGPE 1WOFA 5L2YH 3ZYEA 1C1SA 1W11U 1E35B 1LCYA 3UFAA 4WXIA 2JETC 1GHAF 1K1JA 1NFWA 1PQAA 1IQKA 2HOBA 1O2OA 4VGCB 2D1JA 2VVCA 3UQOA 3TH3H 1DLEA 3BTKE 2VIWA 1K1PA 1BITA 2ZKSA 3HKIB 4Q7YA 1GJDB 1SOTA 4CBNA 3DFLA 3P6ZB 1P8VC 1C1TA 1TGTA 3HKJB 3KQCA 1RTKA 1IQIA 2OC7A 1A61H 1EAWA 1LDTT 2H9TH 2PSYA 1Y3VA 4BTTB 1YF4A 2BOKA 4Y10E 3SHAH 1YBWA 2B0FA 3MU0A 5J4SA 1P02A 3ITIA 1LPGB 3A7WA 4OGXA 1Y8TA 2BDAA 3RXLA 1SSXA 3DUXH 2VGCC 4X1QU 4MNWA 1J17T 3HGNA 1C1MA 3QN7A 4HFPB 4JZ1A 1D6RA 2EI8A 2OD3B 1FZZA 3SBKA 5I46H 3ZZ8A 2Z9LA 5T6FA 3MH5A 1CHOG 1ELBA 1IQFA 1HAGE 2UUKB 4FXGH 2ZU4A 3MO6A 1Z6JH 2OC1A 1C1QA 1YCPK 5HYOA 3RXSA 1AGJA 2ZCLP 1P12E 2ZFQH 5LPEA 4DT7B 2GDDA 1TOMH 3SNDA 1T8MA 1PQ7A 2FOHA 4ISLA 2ZDVH 3RMOH 1H4WA 2QIQA 1RXPA 4RKOB 2A7CA 4J1YA 4ABFA 2V3OH 3MHWU 2W7SA 1S83A 4WMDA 2TBSA 4YOJA 3RM0H 2ZGJA 2ZPSA 5DGJA 2GZ7A 3BSQA 1AWFH 1IQNA 1EUFA 1AFEH 1G3EA 2GVFA 5EXNA 3CP7A 2WINI 3GDVA 1ZPZA 5T6DA 2XC5A 1QJ6B 1SFQB 2BY7X 1GBKA 2LPRA 1RIWB 1LQEA 1BTXA 3D65E 4X0WU 3RUOA 4Z6AH 2CN0H 3HATH 4UONA 2IOTA 2BD7A 3U9AH 1C2FA 1EP6A 2B8OH 1YPHC 3GY6A 4NWKA 2A32A 3PO1B 3RC4A 2P16A 5FBEA 1O3MA 3NCLA 2V35A 2VU8E 4NIWA 1UTOA 3KCGH 2ANYA 2TGDA 1TA6A 3Q3YA 3U8RH 1HV7A 5EXLA 1D3PB 2G5NA 1BDAA 2VWOA 2CV3A 1EXFA 5E8EH 3FFGA 1ZMJA 2XBVA 4XDEA 2BY9X 1QL8A 2ANMH 4MPWA 3MOCA 1BRUP 4MNVA 2H5DA 3H7OA 2HLCA 2A0QB 2P8OC 2G55A 1FAKH 3PMBB 3QDZB 3AW0A 1VCWA 3M37A 1PPBH 1TIOA 1Q31A 2FS9A 3EA8A 5DJ7A 5EQRA 4AGJA 1FMGA 2SGDE 1FY3A 3PTNA 5K7RA 1EX3A 1WTHD 1FUJA 1RRKA 4NFFA 5FPTA 5FBIA 2H6MA 1O5DH 4CHAB 1SVPA 1GI1A 3QUMP 3A8CA 3PLKA 1S5SA 2XNIA 2G5VA 1NY22 3ZZ3A 1IOEA 2FPZA 4FUEA 1YPKH 1EZUC 1MMJN 1C1RA 4O3UA 1DY9A 1LPKB 2FESH 1L1JA 4GHQA 1MU8B 1HAVA 1W13U 1UVUH 5ESTE 2ZP0H 3BTEE 1GHYH 2QXHA 5C5NA 5FHTA 3LOXA 5EG4A 4NZLA 1FY4A 2GZ9A 2I6QA 2A5KA 2F9VA 2RCEA 4B2BA 1YCPH 1VZQH 2FP7B 2ZCHP 2OQ5A 2AYWA 2CXVA 3F9FA 4JZIA 1A46H 3M35A 1F7ZA 4X8VH 1BMAA 2FOAA 1PPCE 4E05H 1O2YA 3LGIA 1W3CA 3SU0A 4DOQA 1EZSC 4JYUH 1ELCA 2BY8X 2QAAA 1HNEE 1AQ7A 1SHYA 4IC6A 1GBJA 2C93B 3ZZBA 1C5WB 1LKBA 6ESTA 4O97A 5B6OA 4Q80A 4GCHG 4X8UH 1GI6A 1B5GH 3SJOA 3BEFB 1DSUA 1JMOH 2P94A 2FZZA 1HAVB 1T4VH 3ZVEA 1SGIB 2BVRH 1YP9A 4H4FA 1O2MA 1SL3A 4ABHA 2G8TA 2WYGA 4CRDA 4E06H 1NFXA 1EJAA 4HZHA 3STIA 1XVOA 2BHGA 2FI5E 2P95A 2Z7FE 3GY5A 1KY9A 1UTQA 4NWLA 1XUFA 3FZDA 2WPLS 5CHAB 3BTDE 2I6SA 3F68H 1TX6A 2QN5T 4WVPE 3V0XA 1SGFA 4ZKOU 1C1PA 2FX6A 1GJ5H 3A8DA 2BQ7B 2VGCB 3Q76A 1K28D 5FCRA 1NM6A 1O5CB 2VWLA 3URDA 5IDKA 1O5FH 2BQ6B 1SQOA 3BTME 3T25A 4LK4A 5A09A 2BD8A 3UQVA 1P09A 3U1JB 2BDBA 1BUIA 3K6ZA 4JMYA 2EI6A 2F3CE 4ABBA 1IAUA 3U98H 1L2EA 3A7YA 1D3TB 5C1UA 1DICA 1CGJE 3MWIU 8GCHF 1WU1A 1UHBA 5GCHF 1PFXC 3BTGE 1ETTH 1P3CA 3EA7A 5FX6A 1VITH 1K1IA 3LU9B 1SGRE 1FN6A 1OXGA 4LOYH 3S7KB 1H9HE 2GT8A 4JZDH 4I8LA 7ESTE 1SQAA 3DA9B 1XUJA 5T6GA 3LGUA 3HK6B 1Z6EA 1T32A 2J95A 1BTPA 2Q1JA 1AU8A 1GMDF 3MI4A 2PTNA 1VGCC 2ZNKH 8KME2 1LKAA 1ZRKA 4NZQA 3S0NA 5EOKA 2ZFSA 3U69H 4X2YA 3A89A 3TK6A 1TFXA 1KLTA 3SGBE 3CENA 1E0FD 1AIXH 1NFUA 2BDCA 4FUDA 1O2RA 1J16A 1SI5H 2QF0A 1THSH 3T28A 4K1EA 4DIHH 1XKAC 3I78A 1FV9A 3GCHC 1T8LA 1VCQA 3UOUA 4NA7A 4ZKRU 1EJMA 1V2ST 3GY8A 3LGVA 3OU0A 1HAPH 4BNRA 3L33A 2CHAC 3TITA 3TH4H 1BRBE 4MPVA 2XBWA 3ENSB 3JZ2B 1GMCF 4LZ1H 1JWTA 1DITH 2IN2A 3A8AA 4B2CA 1DFPA 1MU6B 3BTFE 4Y7BA 4VGCC 1O33A 3TGJE 4O9VA 2ZU2A 3M5OA 2VH0A 2GCHF 3BN9A 2VIQA 1A0LA 2ZECA 3NUMA 1QR3E 2HNTC 1ZPCA 1GJ7B 5BRRE 3KHVA 1GGDC 3A87A 2QA9E 3RMNH 1WYKA 5DP9A 5TCAA 3A84A 2H2ZA 4ABIA 3UPEA 1UVPA 1C2EA 1QY6A 2AMDA 1ELGA 3BTQE 2TGTA 4Y8ZA 2AGGX 1C5VA 1DUAA 1FY8E 1F5KU 1GBLA 1CT2E 2A31A 5FPSA 2QXIA 1HJ8A 2XC0A 1V2UT 1NC6A 2Z9KA 4NFEA 3VB4A 2V0BA 1HAOH 1O3JA 2STAE 2ULLA 1VJ9U 3VB6A 2DE8A 1ANCA 1EPTC 2UUJB 1TAWA 1GJCB 2Z9JA 5EPYA 2Z3DA 2O8WA 1EZQA 1PPEE 1Y5UT 3A7XA 2ASUB 1ZTJA 1BTUA 4AOQA 3ODDA 9ESTA 1CA8B 2R0LA 3LONA 4TWYA 3ZVAA 4UEHH 3T29A 1O0DH 1PQ5A 1O5AB 3SO3A 1BIOA 2J4IA 1C2JA 3LPRA 1VR1H 1SGYE 1T7CA 1QL9A 1OP8A 3TNSA 1SHHB 1CBWC 4FUGA 2XWBI 4TPYA 2WPMS 3K2UA 1AE8H 1TBZH 1H1BA 3GY3A 3LIWA 1GDUA 4ZHLU 3AAUA 4Y6DA 1RIWC 1TQ7B 4WH8A 4MPXA 4JK5A 2NU4E 3OTJE 1TOCB 5GXPA 1GJ9B 3RXVA 1AD8H 4ABAA 2ZDLA 1BBRK 1MCVA 3KQBA 4Y11E 5EQQA 5F8TA 3ZZCA 3ATLA 1BA8B 2P3FH 2R9PA 2ZG0H 1HIAA 3GCTG 3A7ZA 1C5LH 1GHBG 3QZRA 1OS8A 1CE5A 1EB2A 4ABJA 5FXLA 3ATWA 2FLBH 3RU4E 1NN6A 1W0YH 4ZHMU 3RXIA 2GMTB 1CA0B 1AUTC 4ZAEA 1QB1A 1PYTD 1QRWA 1O5BB 1QBNA 4UFGH 3RP2A 3SI4H 2FOMB 1P05A 1QL7A 3LH1A 4CHAC 2O8UA 4INKA 3PMHB 2WV5A 5EGMA 1THRH 3DD2H 3M5LA 1Z71A 1C2KA 3O8DA 3ZVGA 2AIQA 4MLFB 5JB9S 1KXEA
chains in the Genus database with same CATH superfamily
2BLQA 2KCPA 1G2MA 2GJGA 3BTTE 3FAOA 1UK4A 2SGFE 4IBLH 1LVBA 1PYTC 1BCUH 3RXPA 1ZSJA 1P2KA 3VB7A 1EOJA 1BRCE 2UUYA 2FODA 4I7YH 1Y59T 2LELA 1WXRA 3RXAA 2Y5FA 1QRZA 1MTNB 2HWLB 4BXWA 1AFQB 2Z9IA 1O2UA 3QWCH 4OM9A 2OQUA 1AMHA 4X6OA 3SI3H 1B0EA 2F83A 4Y7AA 2QY0B 5CE1A 1ORFA 1UTNA 1HB0B 2HLDD 5JBCS 4GVUA 1ESAA 1Z7KA 3SOSA 1S0QA 1Y3YA 2YOLA 4Y71A 3GCHB 2P3TB 1SGCA 1EQ9A 3PWBA 3MNXA 3R3GB 2ZGHA 1P04A 2G52A 3PYHA 4XBCA 1CO7E 1O36A 2VVVA 1W0ZU 4K60A 1AWHB 3FVFB 1UJ1A 4B71A 2WHXA 1GG6B 1S6HA 1C5SA 4A1XA 4HTCH 1QURH 5CDFE 1FPHH 1HAIH 1O2ZA 2ESTE 2FTLE 2NU3E 6GCHF 2W6ID 4BAHB 2C8YB 1NS3A 2W7UA 1W10U 1IQEA 1C5NH 1TGSZ 1TYNA 2F4LA 2Z94A 1Y5AT 4ABDA 3LJJA 4I32A 1FONA 1EPTA 1PPZA 1ETRH 2BDYA 1BBRH 5A8ZA 2AGEX 1N8OB 2HPQH 3TLOA 1HXEH 1MABB 1C5OH 5JDUB 3GYLB 4J2YB 2C90B 1GGDB 1E38B 5CHAC 4A92A 3ZVFA 1HDTH 2M5TA 2QC2A 4HGCA 1LTOA 2G4UA 4F55A 3GOVB 4D7FA 1NTPA 5DK1A 2TIOA 4TPIZ 3M3SA 1XX9A 1DVAH 3FP8E 1Q3XA 2AS9A 2PKAA 1TX8A 4H6TA 5DSFA 4CRCA 4A1VA 2B7DH 1WQSA 4U30A 3A86A 1YLCA 3TK9A 1VITG 1ARCA 2R2MB 3UIRA 1EAIA 4IN2A 4UFEH 1BZXE 5FX5A 1D3DB 2FMJA 3SNAA 2VWNA 3IITA 2L6OA 3KIDU 3RXMA 4Y0ZE 4F48B 2ZHFH 1AZZA 1JXPA 2OINA 2A45B 3TH2H 1EPTB 1T4UH 1A3EH 1OYQA 5FAHA 4SGAE 1RTLA 4HG6A 4NGAH 2PWXA 5L30H 3S7HB 3SV6A 1G32B 1OWIA 3T27A 5IK2D 1C1UH 3BG4B 2FOGA 1NO9H 1GDQA 3MYWA 3O8CA 1UTMA 1YPHE 2G51A 2R0KA 2Y82A 3QGJA 3H09A 4FOUC 1LVYA 3UOPA 1V2WT 3QLPH 2A5IA 1ACBE 3NWUA 1ZMNA 4KKDA 3S9CA 1CBWB 1FXYA 1MD7A 2BZ6H 1GI2A 2PKAB 4ZROA 1BJUA 3M61U 2BD5A 2BLVA 4YTAA 2WV9A 4XBDA 4TWWA 4ACAA 5JBBS 3E0NB 2PV9B 3O8BA 3SNBA 1AN1E 3KN2A 3ATKA 1D3QB 3DHKH 2PLXA 3L6PA 3D23A 1QQUA 1H8DH 1GBEA 1SMFE 1IQJA 1NFYA 3Q77A 2ZDNA 1ZZZA 1EJNA 4ISHH 2TGPZ 3SZEA 4MNXA 1E79D 4RI0A 1MTUA 2VJ1A 4LZ4B 4ESTE 2BDIA 2CK3D 4GLYA 1W14U 1Z1IA 4DY7B 2CJIA 2W6JD 2XBXA 2BLOA 2R3YA 3MMGA 3PMJA 4CH2B 3BEUA 3TJVA 5H4IB 1ZJKA 1TPOA 1C2LA 1K9OE 1V2MT 2AHME 3D62A 1V2QT 1Z1JA 5DKMA 1TQ0B 4UE7H 4Y79A 3BTWE 4DT4A 3W94A 2D26C 2A2XH 3PM3A 1QA0A 3SJ9A 2AFQB 2BY5X 3F9HA 1GCDA 1V2OT 1ZLRA 2ZU3A 5DP3A 4K1SA 4UFDH 1ID5H 1OWKA 2J9NA 5LPFA 3ZZ7A 1UCYE 1AKSA 1HFDA 3SU6A 2THFB 3BV9B 4AG1A 3Q3KA 3LGYA 1G30B 3DT0H 3KGPA 3LDXH 8LPRA 1DDJA 3P92A 2Q6FA 1GDNA 3E0PB 1KDQB 2JH0D 3RLWH 1FLEE 1O35A 1FIWA 4JYTA 1XM1A 4ZH8A 2ZHWH 2WPKS 1XKBC 1P3EA 5EIYA 3QO6A 1GBBA 1GMHG 3UWIA 1JIMA 5DP4A 3SUDA 4IGDA 1YPMH 2HNTF 3FO8D 3ZZ5A 1O30A 1XUGA 4B6EA 1BJVA 1EOLA 2ZTZA 3TGKE 1FY1A 1ANDA 1LHEH 2FIRH 1EAUA 1G3DA 2XTTB 2A4GA 3RM2H 1XUHA 3SV7A 1AUJA 4AGKA 1MZAA 3OY6U 1A4WH 1P11E 3SNCA 1THPB 3M3VA 4X6MA 1AKSB 1SGEE 1NRQH 4DGJA 1UK2A 2QV1A 3MU8A 2ALPA 5E2PA 3A83A 1ZHPA 5F8XA 3ZVCA 1CQQA 1EATA 4XE4A 1ESTA 2QXGA 1RGQA 2KFWA 3P8OA 4KELA 3RMMH 2VNTA 1O3BA 1KXBA 2EA3A 3TIUA 1CU1A 1DE7H 2XW9A 1UTPA 5AFZH 1TGNA 3SJIA 1UVTH 2Z3EA 1SC8U 2FOEA 4I31A 1XMNB 1W12U 2A7HA 2ZGXH 1XXDA 1B7XB 2PUXB 2ZFPH 3UUZA 2R2WU 2BTCE 1A5HA 2Y7ZA 1JOUB 4XSKU 3AK5A 1MUEB 2OXSA 3VFEA 1TNJA 1GHAG 3M7QA 5EW1H 1AHTH 4YZUA 4XFQA 5EQSA 2Y6TA 1HAXB 4AX9H 1SGDE 1O3GA 1VCPA 3F2FA 4D8NA 2J34A 3MNCA 1O3LA 1BBRE 2ZHDA 1A7SA 4BTIB 3LKWA 1K1NA 4AC9A 4A7IB 2ZHEH 1CHGA 1OWEA 2GMTC 1SGPE 1CA0C 4YLQH 2IPHA 1GI7B 3ZV8A 2BXTH 1CVWH 1AI8H 4OS6A 4YOIA 2FI3E 5HKKD 5EW2H 4Y76A 1K1LA 2WUBA 1E34B 1BT7A 2A4QA 3BG8A 3RDZA 1AE5A 3ZV9A 4BTUB 2PKSB 3SQHE 1MAXA 1YKTA 3EE7A 2CGAA 1A5IA 5AF9H 1G36A 3Q00A 2LP6A 1RTFB 1O2TA 3GDUA 4WMFA 1Y3WA 2PGBB 3SHCH 5GPIB 2EC9H 1QGFA 1FPCH 5ABWA 3LJOA 4IW4E 1UTJA 1QTFA 1C5XB 1O2VA 3EA9A 4NSYA 3HK3B 1YPJH 5J4QA 4INHA 1GI3A 3GYMA 1INCA 2BD9A 2P93A 4BAMB 5EJ1A 3EGKH 4NIYA 3SNEA 3TPIZ 1LVOA 1GI8B 2RA3A 4K2YA 4F49A 4WF8A 1TABE 1L1GA 3UB0A 5DP7A 2XBYA 4YM9A 1MTNC 4Q2KA 4ZUHA 2O8MA 1AFQC 3V13A 1UTLM 2FOCA 3AASA 1LMWB 1MTSA 2F91A 1BTYA 2Z6BD 3E90B 3F6UH 1LQDB 4MDSA 2IJD1 1O3OA 2Y7XA 4U32A 3F3BA 3WY8A 1K2I1 3I77A 3OEHD 4K8YA 3KYFA 1A3BH 4X8TH 1BRAA 2F9BH 3EYDA 3T5FH 1VJAU 4FUJA 4AORA 3MO3A 2HNTE 3O8RA 1JRTA 2QF4A 2QCYA 1BQYA 4Y0YE 1GG6C 3BF6H 1P2MA 1LHGH 1DUEA 4AB8A 5C3NA 1KYNA 5FL7D 3GS9A 4WJG2 1UW7A 1UCYK 5DPAA 4B73A 2BB4A 3LC3A 2GZ8A 4A5TS 4MQAA 2EEKA 1P9SA 4NSVA 3UNSA 2O9QA 1C5TA 2TGAA 1N8OC 2D8WA 1DY8A 2OUAA 2FO9A 4K3JA 3E8LA 4Q7ZA 4YT6H 4X8SH 4D9QA 5KECA 2WZQA 1SB1H 2ZA5A 3P70B 1K1MA 1WBGB 4R0IA 1GBTA 1C9TA 3FOAA 4X6PA 3SU5A 4U01A 1U6QA 1MAYA 3E1XB 2H1UA 3A8BA 2F43B 2ZU1A 4AYVB 1QQ4A 1YYY1 3NKKA 2ZIQH 1TRNA 1ZJDA 5HM2A 1ELEE 1RFNA 2TPIZ 2BVXH 1DWCH 1AVGH 1T8NA 5E0JA 1WCZA 1S82A 2ZEBA 2CF8H 1CHOF 3SW2B 2FWWA 3CNRA 1E36B 4I8GA 1HJ9A 1KTSB 4IC5A 2PFEA 1O2IA 3LC5A 3NK8A 4OGYA 1LO6A 1K0HA 2VIOA 2P59A 3BG4C 3MU5A 1EASA 1QJ1B 1O2XA 4FVDA 5K0HA 3F2GA 2VH6A 2PR3A 2QE7D 5ETXA 2BMGB 2UUFB 1MCTA 3I29A 1GHWH 4H6SB 1SFIA 3RU4T 3ZZAA 3UR9A 1ZGIA 1C1VH 4X2XA 4CRAA 5SGAE 2HRVA 3TVJB 2W3KA 3PRDA 1P2NA 3M7UA 2ZF0H 4AFUA 1H9LB 3F1SB 1NBMD 2O8LA 3U8OH 4JYVH 1NU7B 4K5ZA 3K6YA 1GHXH 1KTTB 2SNVA 5C94A 1GBDA 2UWOA 1RJXB 2IJOB 1LVMA 2W5EA 2WPDD 3M36A 1XUKA 2FOFA 2JJ2D 1KMHB 2XCNA 4ABEA 4U2WA 1S84A 1O2KA 5HXFA 2ILNA 1NRSH 4DURA 4ABGA 3SV2H 1C5UA 1V2NT 2BD2A 2G00A 4UD9H 3UWJH 3S9AA 1V6DA 1FNIA 1ZPBA 2V6NA 1UCYH 5C67A 2AMPA 3M5MA 3RXEA 1O39A 4GUXA 1SKYE 1IQLA 2SGEE 2OC8A 3M5NA 5JPMH 4ASHA 1C5RA 3PMAB 3B9FH 1O2HA 4KTUA 4E7RG 3ELAH 1A0HB 4P00A 4TY6A 2BDHA 1O3IA 3D49H 2ZHQH 4YESB 3T2NA 4R8TB 1AZ8A 2J2UA 2YNAA 3RU4D 1NESE 3VGCC 3PLBA 3EAJA 5JYIA 5C5OA 4X1SU 1ZSKA 1NZQH 5EODA 1C9PA 1TNGA 3P8NA 3A81A 3TJOA 7LPRA 1EKBB 2GV6A 2H9HA 1GBCA 4MVNA 3AW1A 2JKHA 2PGQB 3VB5A 3A88A 1QZ8A 1QB6A 1L4ZA 1DWDH 1SLXB 2ZGCA 3VB3A 4CREA 1MBQA 3SN8A 1TALA 3OYPA 5A0BA 1D9IA 8GCHG 1XXFA 1CGHA 4ASUD 2VB0A 5GCHG 5CHBA 1OWHA 1DWBH 3SUGA 3GDSA 1UMAH 4JZEH 1ELAA 1SGNE 3F2HA 1SBWA 3OSYA 3RXOA 2LNCA 3ZZ9A 4XD7D 1TLDA 3CS7A 1G37A 2J94A 3EQ0H 3A80A 1AB9B 1BHXB 5PTPA 1T8OA 2H9EH 2QF5A 3P17H 2ZZUH 3ESTA 1ZTLA 1G3CA 1TGBA 1GMDG 2GKVE 3T26A 2AH4X 1OKXA 5EJZA 2R3UA 1O34A 2FEQH 2DUCA 1DS2E 2YNBA 2K1QA 4DJZB 1N1LA 1BMFD 3PTBA 1FQ3A 5E0GA 5A2MH 1TX7A 4GCHF 1TNKA 5AVDA 1ANEA 2ZDKA 2WV4A 3FP6E 1HJAC 2ANWA 1J15A 2GGVB 2A4RA 4NCYA 3WW7A 3G01A 5GIBA 3ZVBA 1FI8A 2H5CA 4X1NU 1O2PA 2WPIS 1C4V2 4XBBA 1O31A 2AGIX 4FUFA 4I33A 2NU0E 3MH7A 1MZDA 2Y80A 5L2ZH 3GISB 2ZFFH 3H5CB 2AEIH 3JZ1B 1K22H 4M9FA 2PW8H 1GMCG 4FUHA 1YC0A 2PTCE 4BAOB 2GV7A 2ZPRA 1S6LA 1K21H 1WUNH 3MU1A 4X6NA 2JH5D 3OE7D 2L74A 4I8JA 3WWFA 2F9OA 1TRYA 2RA0A 3RC6A 1GCTB 1A1RA 1G2LA 1GVZA 1MQ5A 4CR5A 3F0OA 2GCHG 4HI3A 4K69A 3PROA 3SV8A 4O03A 1C2HA 3SU3A 4RKJB 1GBIA 3B23B 1G3BA 1ELVA 1C2MA 3M7TA 4D9RA 4XOJA 1HAZB 4FVBA 5C1XA 3DSGA 4O3TA 4K1TA 3UNRA 5IYTA 1HGTH 2EQNA 3MTYA 4D76A 4JK6A 2QXJA 2C3SA 2KCAA 3VXFH 3TNTA 3UAIC 1OX1A 3MO9A 2PKSC 1QB9A 2ZPQA 3SU2A 1WTGH 2ZFTA 1LHCH 1SLWB 1Y3UA 1S81A 1OSSA 1W2KH 2D2DA 4FUIA 1TGCA 1H9IE 2OP9A 1K1OA 3AVZA 2C8ZB 4X1PU 2BVSH 4RN6A 1W8BH 6CHAC 3A85A 3SU4A 1P06A 3V7TA 2NU1E 1O3NA 1HLTH 4LXBH 2ZO3H 3QZQA 1WDIA 2XYAA 5E0HA 3W95A 4BAKB 1TBRH 2BY6X 1AY6H 1AVWA 1ARBA 5AHGH 2XC4A 2BX3A 3FP7E 2SFAA 2XXLA 2A2QH 2BLWA 1YLDA 4KGAA 3A82A 3CS0A 1N6XA 2RFKC 1KXCA 1SG8B 2VINA 5FCKA 1FIZA 1A2CH 1O2WA 3PB1E 4ISOA 1O3AA 2FTMA 1C5YB 1ZYOA 3KYGA 1PPGE 4ISNA 2J92A 5A8XA 5TJXA 2OBQA 2ZDAH 1C1WH 1KDQA 4DG4A 1AO5A 4OS1A 4AYYB 2JH6D 2UWPA 1HXFH 5F8ZA 2BX4A 1L0ZA 3AAVA 1QBVH 2SGQE 2NWNA 2FDAA 1TMTH 5A0CA 4ZXXH 3RXFA 3SORA 4ZKSU 3K65B 1HRTH 2XWAA 3N7OA 3E6PH 4DVAU 2ZI2H 2ODYB 3WWBA 3TGIE 1ZSLA 1BHXF 1D4PB 1GHZA 2BZAA 1DXWA 3RXKA 1KXFA 5HMAA 1GVKB 1P9UA 1QHRB 4GSOA 1OWDA 1SGFG 1TMBH 4K8BA 1HAHH 4INLA 1HAYB 3KNXA 1MKWK 3PWCA 3SUEA 4I8HA 5C2ZA 1QNJA 1J9CH 4FUCA 2WPJS 1XVMA 1F5RA 3GY2A 5C17A 3A7TA 3BIUH 4MTBA 1ANBA 1O3DA 2F9UA 2PUQH 4B2AA 2K8IA 4ZCNA 3VGCB 2ZGBH 1CSOE 4TT3D 3GCOA 2SGAA 1O32A 4F4OC 1FAXA 4KTSA 1SGQE 3GCNA 4JCNA 4YO9A 1IQGA 3ATIA 4H42U 4B1TA 1O38A 3ZZ4A 1F0SA 1H8IH 3ZYDA 3BEIB 3QTVH 3STJA 5DP8A 2A5AA 1F0TA 1IQMA 2ZCKP 2P3UB 1ELTA 2B5TB 1F2SE 4B75A 2VIVA 1QBOA 5HGGA 1ELFA 1P10A 1Z8RA 4ZHAA 3MFJA 1P2JA 5F6MA 2W3IA 3RXDA 1B0FA 3TU7H 1TNLA 3N7DA 1D6WA 1ZGVA 1O3EA 1ABIH 2GT7A 1L1NA 1KXDA 1V2PT 2PSXA 1TA2A 2A1DB 2Y81A 1W7GH 1MQ6A 4MPUA 3SGAE 1ZRBA 1QIXB 3OFND 2BM2A 1HCGA 3KQDA 1KLIH 1ELDE 2HPPH 2WUCA 4IN1A 3UREA 4CRBA 2RDLA 5EU8A 1FN8A 1FX0B 3R0FA 2FI4E 1TE0A 3C27B 8ESTE 1DWEH 3ZZ6A 3F0PA 1V2KT 4ACBA 1ESBA 2A7JA 1PPHE 4BXSA 5GNDA 1HJAB 1O3HA 1SLVB 4NIXA 3ODFA 3P95A 2G81E 3RXRA 2RG3A 1DM4B 3LGTA 3IG6B 5GDSH 2GCTB 2KCYA 2OLGA 3T62A 1J8AA 1GVLA 1V3XA 4WXVA 3L3TA 5DP6A 2XOKD 4Z0KA 2PHBA 1DLKB 2C8XB 2UWLA 3QX5H 2AIPA 1YGCH 6GCHG 1YM0A 1TMUH 1DXPA 2QF3A 3GCTF 5E2OA 2JETB 1YLNA 1GHBF 5LH8A 1EP5A 1MTVA 4DW2U 1UO6A 5C1YA 3KF2A 4AFZA 1QA7A 3UNQA 1FY5A 3KEEA 4BOHA 1NT1A 5ESBA 4FU9A 2V7QD 1KLJH 1Z8GA 1GL0E 4OS4A 4WY3A 1MKWH 1QFKH 1P57B 1YY3A 1DX5M 3MNSA 2ZQ2A 1GJBB 4ZMAH 2FYQA 5DP5A 4E7NA 4NA8A 1H8HD 2NU2E 3S9BA 1DOJA 1YPLH 3FANA 5A8YA 2C8WB 2Q6DA 4BANB 2FX4A 3OAAD 3SUFA 3N7EA 3E3TA 1SR5C 1GBFA 3UTUH 4Y8XA 1BMLA 1GWAA 1C1NA 1KIGH 6CHAB 2DE9A 2STBE 3EE0B 4AN7A 2B9LA 1XUIA 1O5GH 1F0RA 1C1OA 1JRSA 2OTVA 1TPSA 2ZWLH 1SPJA 4DIIH 1MH0A 1NPMA 1OOKB 7KMEH 1OP0A 1EAXA 4OS5A 1BTZA 1CT0E 1E1QD 3BIVH 3E16B 5EJLA 1MKXK 4RSPA 4Q4LA 4NA9H 3RXCA 4GAWA 3MH4A 1AB9C 1C5PA 1ZTKA 1GBHA 5L6NH 3VEQB 3GICB 2V3HH 1UK3A 1OWJA 4IS5A 3MNBA 3TJUA 4D7GA 5C0UA 2HVXA 3HPTB 1PJPA 1CGIE 1GJ4H 1P2QA 3NXPA 3URCA 1F5LA 3QK1A 3GY7A 1LHDH 1HYLA 4CBOA 3FZZA 5G4BA 2VIDA 3MH6A 1C5MD 2BOHB 1GJ8B 1UTKA 4SGBE 2VWMA 7GCHF 1C2DA 1TPPA 3LT3A 5CMXH 2AERH 2VIPA 2ZFRH 5HM9A 4X1RU 3RXHA 1ZOMA 1DT2A 2HALA 1N6YA 1GL1A 1V2RT 2YMSD 3F9GA 4A1TA 3QTOH 1JBUH 1E37B 1UHBB 1JIRA 2J97A 4BAQB 1BTHH 4NIVA 2XRCA 3UY9A 3KQEA 4DCDA 4I86A 2O8TA 1WSSH 4KTCA 4YLUA 1QCPA 1C4Y2 2KCOA 4WWYA 1FDPA 2ANKH 2Q6GA 1GCTC 2P8OB 4WMEA 1V2LT 3RLYH 3ZZDA 1O2GH 3SQEE 4GHTA 3TK5A 4FU7A 1Z8IB 4M7GA 5GWZA 2YMSC 1V2TT 4RT0A 4MNYA 1EB1H 3F9EA 2Z9GA 3QGNB 1DPOA 1C2IA 1HPGA 1VITF 3ATMA 4P02A 3HGPA 1TRMA 2WSSD 2ZTXA 4GPGA 5LPRA 2JDID 1HBTH 2OC0A 1DSTA 1NRNH 1WV7H 2BXUH 1O2SA 2CF9H 3ZIAD 3SJKA 1X7AC 2GP9B 2HGTH 2KR7A 3Q3XA 1W0JD 1O3FA 2ALVA 1GHVH 1YCPM 1GI4A 4YXWD 1P2OA 1BTWA 2GDEH 2J38A 1GBAA 1PQ8A 2BD3A 1C4U2 5HIYA 3TJNA 1GI0A 3SGQE 2FYRA 1O2QA 4YT7H 1LHFH 1A5GH 3OX7U 1QRXA 2AMQA 4AZ2B 4WH6A 3OY5U 4X2WA 1T31A 1C5QA 1GPZA 4NG9H 1P0SH 5DG6A 6LPRA 2M2AA 1P03A 1DANH 3SV9A 2BYAX 1NRPH 1P01A 4UFFH 1C2GA 2BQWB 4UDWH 4CH8B 5JB8S 1FJSA 1ZHMA 4ZKNU 5LGOA 1W7XH 2VVUA 1TB6H 2WYJA 4ISIH 3A7VA 2WPHS 1MKXH 1NROH 3MQKC 3LH3A 1TONA 2Y5HA 1OPHB 1O2LA 1O2NA 1Y3XA 4B74A 2KAIA 1ZHRA 1ABJH 1NRRH 1IHTH 5HIZA 5T1VA 2XCFA 2FLRH 4ZXYH 1SLUB 4QT8C 5T3HA 3OTPA 2EI7A 2SNWA 1AVXA 2ZTYA 1Q2WA 1MTWA 2ZQ1A 3S69A 1TPAE 2BDGA 3U8TH 2G4TA 4AB9A 3RXTA 1ZR0A 2W26A 3PV4A 4CRGA 5EPNA 1QJ7B 1EZXC 4MG3A 5TCCA 3RC5A 1P2IA 1NU9A 1GI9B 3PLPA 1F0UA 3PO1C 3GY4A 1A0JA 1YPEH 2GTBA 2A4OA 3SJ8A 1RD3B 3K9XB 9LPRA 2Y5GA 5KGOA 1O37A 3RXUA 5F03A 3V12A 3NPSA 2ZDMA 3MU4A 4CRFA 4CR9A 4A6LA 5EXMA 4KP0A 1Z8JB 3RXJA 1IHSH 1UVOA 3M3TA 1S6FA 1WQVH 3P8GA 3UR6A 2KAIB 1EFRD 1SQTA 1S85A 1O3KA 2ZU5A 2BD4A 1O3CA 5I25A 2OBOA 1O3PB 1V2JT 3BTHE 2FM2A 4X2VA 4B76A 1G9IE 1OYTH 1BMMH 3SU1A 4YOGA 2FS8A 3B8JA 4OS7A 4AG2A 2ZC9H 5AFYH 4Y8YA 1GMHF 3RXGA 4TY7A 4AFSA 3VPKA 1MD8A 4JZFH 4FU8A 1BB0B 1HUTH 1CT4E 3IWMA 3VXEH 5JBTA 1ETSH 2FXRA 2ODQA 2TRMA 2Z3CA 1MBMA 2C4FH 1GBMA 4TYDA 1HIAB 3C1KA 4AFQA 5FPYA 1KSNA 3DFJA 2F9NA 1IQHA 1WAYB 4FETA 2OCVB 1GI5A 3P8FA 1OP2A 1L4DA 1TBQH 4XRNA 3SZNA 1GJAB 4FUBA 5GJ4B 5DO4H 1VGCB 3E91A 3PV2A 1BMNH 1C5ZB 1O5EH 2FOBA 4THNH 1PPFE 2GD4B 1BOQA 3U28C 3V3MA 1SGTA 1KXAA 1GJ6A 1S0RA 3KL6A 5C20A 4I8KA 4IMZA 3H7TA 1SOZA 2CMYA 5JBAS 1O2JA 2GX4A 2QYIA 1TNIA 4PROA 2JIZD 4IMQA 4OS2A 3LGWA 1TWXB 2QGRA 3EDXB 1Y5BT 2ODPA 2GCTC 1TNHA 1J14A 1LPZB 3NZIA 1RS0A 2CHAB 3W1EA 3RXBA 5A0AE 1ZMLA 2F9PA 3RXQA 5BPEA 4Q7XA 1UVSH 1YPGH 1F92A 1M9UA 1V2VT 3RMLH 7GCHG 3ZVDA 2SGPE 1WOFA 5L2YH 3ZYEA 1C1SA 1W11U 1E35B 1LCYA 3UFAA 4WXIA 2JETC 1GHAF 1K1JA 1NFWA 1PQAA 1IQKA 2HOBA 1O2OA 4VGCB 2D1JA 2VVCA 3UQOA 3TH3H 1DLEA 3BTKE 2VIWA 1K1PA 1BITA 2ZKSA 3HKIB 4Q7YA 1GJDB 1SOTA 4CBNA 3DFLA 3P6ZB 1P8VC 1C1TA 1TGTA 2YMSB 3HKJB 3KQCA 1RTKA 1IQIA 2OC7A 1A61H 1EAWA 1LDTT 2H9TH 2PSYA 1Y3VA 4BTTB 1YF4A 2BOKA 4Y10E 3SHAH 1YBWA 2B0FA 3MU0A 5J4SA 1P02A 3ITIA 1LPGB 3A7WA 4OGXA 1Y8TA 2BDAA 3RXLA 1SSXA 3DUXH 2VGCC 4X1QU 3DCLA 4MNWA 1J17T 3HGNA 1C1MA 3QN7A 4HFPB 4JZ1A 1D6RA 2EI8A 2OD3B 1FZZA 3SBKA 5I46H 3ZZ8A 2Z9LA 5T6FA 3MH5A 1CHOG 1ELBA 1IQFA 1HAGE 2UUKB 4FXGH 2ZU4A 3MO6A 1Z6JH 2OC1A 1C1QA 1YCPK 5HYOA 3RXSA 1AGJA 2ZCLP 1P12E 2ZFQH 5LPEA 4DT7B 2GDDA 1TOMH 3SNDA 1T8MA 1PQ7A 2FOHA 4ISLA 2ZDVH 3RMOH 1H4WA 5C0TA 2QIQA 1RXPA 4RKOB 2A7CA 4J1YA 4ABFA 2V3OH 3MHWU 2V3MA 1S83A 2W7SA 4WMDA 2TBSA 4YOJA 3RM0H 2ZGJA 2ZPSA 5DGJA 2GZ7A 3BSQA 1AWFH 1IQNA 1EUFA 1AFEH 1G3EA 2GVFA 5EXNA 3CP7A 2WINI 3GDVA 1ZPZA 2XNDD 5T6DA 2XC5A 1QJ6B 1SFQB 2BY7X 3DSPA 1GBKA 2LPRA 1RIWB 1LQEA 1BTXA 3D65E 4X0WU 3RUOA 4Z6AH 2CN0H 3HATH 4UONA 2IOTA 2BD7A 3U9AH 1C2FA 1EP6A 2B8OH 1YPHC 3GY6A 4NWKA 2A32A 3PO1B 3RC4A 2P16A 5FBEA 1O3MA 3SYJA 3NCLA 2V35A 2VU8E 4NIWA 1UTOA 3KCGH 2ANYA 2TGDA 2KZ4A 1TA6A 3Q3YA 2HVYB 3U8RH 1HV7A 5EXLA 1D3PB 2G5NA 1BDAA 2VWOA 2CV3A 1EXFA 5E8EH 3FFGA 1ZMJA 2XBVA 4XDEA 2BY9X 1QL8A 2ANMH 4MPWA 3MOCA 1BRUP 4MNVA 2H5DA 3H7OA 2HLCA 2A0QB 2P8OC 2G55A 1FAKH 3PMBB 3QDZB 3AW0A 1VCWA 3M37A 1PPBH 1TIOA 1Q31A 2FS9A 3EA8A 5DJ7A 5EQRA 4AGJA 1FMGA 2SGDE 1FY3A 3PTNA 5K7RA 1EX3A 1WTHD 1FUJA 1RRKA 4NFFA 5F53A 5FPTA 5FBIA 2H6MA 1O5DH 4CHAB 1SVPA 1GI1A 3QUMP 3A8CA 3PLKA 1S5SA 2XNIA 2G5VA 1NY22 3ZZ3A 1IOEA 1YWUA 2FPZA 2J98A 4FUEA 1YPKH 1EZUC 1MMJN 1C1RA 4O3UA 1DY9A 1LPKB 2FESH 1L1JA 4GHQA 1MU8B 1HAVA 1W13U 1UVUH 5ESTE 2ZP0H 3BTEE 1GHYH 2QXHA 5C5NA 5FHTA 3LOXA 5EG4A 4NZLA 1W0KD 1FY4A 2GZ9A 2I6QA 1COWD 2A5KA 2F9VA 2RCEA 4B2BA 1YCPH 1VZQH 2FP7B 2ZCHP 2OQ5A 2AYWA 2CXVA 3F9FA 4JZIA 1A46H 3M35A 1F7ZA 4X8VH 1BMAA 2FOAA 1PPCE 4E05H 1O2YA 3LGIA 1W3CA 3SU0A 4DOQA 1EZSC 4JYUH 1ELCA 2BY8X 2QAAA 1HNEE 1AQ7A 1SHYA 4IC6A 1GBJA 2C93B 3ZZBA 1C5WB 2J98B 1LKBA 6ESTA 4O97A 5B6OA 4Q80A 4GCHG 4X8UH 1GI6A 1B5GH 3SJOA 3BEFB 1DSUA 1JMOH 2P94A 3FKSD 2FZZA 1HAVB 1T4VH 2K0QA 3ZVEA 1SGIB 2BVRH 1YP9A 4H4FA 1O2MA 1SL3A 4ABHA 2RDEA 2G8TA 2WYGA 4CRDA 4E06H 1NFXA 1EJAA 4HZHA 3N99A 1XVOA 3STIA 2BHGA 2FI5E 2VBCA 2P95A 2Z7FE 3GY5A 1KY9A 1UTQA 4NWLA 1XUFA 3FZDA 2WPLS 5CHAB 3BTDE 2I6SA 3F68H 1TX6A 2QN5T 4WVPE 3V0XA 1SGFA 4ZKOU 1C1PA 2FX6A 1GJ5H 3A8DA 3VG8A 2BQ7B 2VGCB 3Q76A 1K28D 5FCRA 1NM6A 1O5CB 2VWLA 3URDA 5IDKA 1O5FH 2BQ6B 1SQOA 3BTME 3T25A 4LK4A 5A09A 2BD8A 3UQVA 2KX4A 1P09A 3U1JB 2BDBA 1BUIA 3K6ZA 4JMYA 2EI6A 2F3CE 4ABBA 1IAUA 3U98H 1L2EA 3A7YA 1D3TB 5C1UA 1DICA 3OEED 1CGJE 3MWIU 8GCHF 1WU1A 1UHBA 2OK5A 5GCHF 1PFXC 3BTGE 1ETTH 1P3CA 3EA7A 5FX6A 1VITH 1K1IA 3LU9B 1SGRE 1FN6A 1OXGA 4LOYH 3S7KB 1H9HE 2GT8A 4JZDH 4I8LA 7ESTE 1SQAA 3DA9B 4RT1A 1XUJA 5T6GA 3LGUA 3HK6B 1Z6EA 1T32A 2J95A 1BTPA 2Q1JA 5B6LA 1AU8A 1GMDF 3MI4A 2PTNA 1VGCC 2ZNKH 8KME2 1LKAA 1ZRKA 4NZQA 3S0NA 5EOKA 2ZFSA 3U69H 4X2YA 3A89A 3TK6A 1TFXA 1KLTA 3SGBE 3CENA 1E0FD 1AIXH 1NFUA 2KM0A 2BDCA 4FUDA 1O2RA 1J16A 1SI5H 2QF0A 1THSH 3T28A 4K1EA 1E1RD 4DIHH 1XKAC 3I78A 1FV9A 3GCHC 1T8LA 1VCQA 3UOUA 4NA7A 5DN6D 4ZKRU 1EJMA 1V2ST 3GY8A 3LGVA 3OU0A 1HAPH 4BNRA 3L33A 2CHAC 3TITA 2EY4C 3TH4H 1BRBE 4MPVA 2XBWA 3ENSB 3JZ2B 1GMCF 4LZ1H 1JWTA 1DITH 2IN2A 3A8AA 4B2CA 4Z1MD 1DFPA 4B6FA 1MU6B 3BTFE 4Y7BA 4VGCC 1O33A 3TGJE 4O9VA 2ZU2A 3M5OA 2VH0A 2GCHF 3BN9A 2VIQA 1A0LA 2ZECA 3NUMA 2IPQX 1H8ED 1QR3E 2HNTC 1ZPCA 1GJ7B 5BRRE 3KHVA 1GGDC 3A87A 2QA9E 1OHHD 3RMNH 1WYKA 5DP9A 5TCAA 3A84A 2H2ZA 4ABIA 3UPEA 1UVPA 3PRBA 1C2EA 1QY6A 2AMDA 1ELGA 1SQRA 3BTQE 2TGTA 4Y8ZA 2AGGX 1C5VA 1DUAA 1FY8E 1F5KU 1GBLA 1CT2E 2A31A 5FPSA 2QXIA 1HJ8A 2XC0A 3DSOA 1V2UT 1NC6A 2Z9KA 4NFEA 3VB4A 2V0BA 1HAOH 1O3JA 2STAE 2ULLA 1VKYA 1VJ9U 3VB6A 2DE8A 1ANCA 1EPTC 2UUJB 1TAWA 1GJCB 2Z9JA 5EPYA 2Z3DA 2O8WA 1EZQA 1PPEE 1Y5UT 3A7XA 2ASUB 1ZTJA 1BTUA 4AOQA 3ODDA 9ESTA 1CA8B 2R0LA 3LONA 4TWYA 3ZVAA 4UEHH 3T29A 1O0DH 1PQ5A 1O5AB 3SO3A 1BIOA 2J4IA 1NBME 1C2JA 2J5UA 3LPRA 1VR1H 3PV5A 5KEDA 1SGYE 1T7CA 1QL9A 1OP8A 3TNSA 1SHHB 1CBWC 4FUGA 2XWBI 4TPYA 2WPMS 3K2UA 1AE8H 1TBZH 1H1BA 3GY3A 3LIWA 1GDUA 4ZHLU 3AAUA 4Y6DA 1RIWC 1TQ7B 4WH8A 4MPXA 4JK5A 2NU4E 3OTJE 2PP6A 1TOCB 5GXPA 1GJ9B 3RXVA 1AD8H 4ABAA 2ZDLA 1BBRK 1MCVA 3KQBA 4Y11E 5EQQA 3KQ5A 5F8TA 2JJ1D 3ZZCA 3ATLA 1BA8B 2P3FH 2R9PA 2ZG0H 1HIAA 3GCTG 3A7ZA 1C5LH 1GHBG 3U1IB 3QZRA 1OS8A 1CE5A 1EB2A 4ABJA 5FXLA 3ATWA 2FLBH 3RU4E 3NRLA 1NN6A 1W0YH 4ZHMU 3RXIA 2GMTB 1CA0B 1AUTC 4TSFD 4ZAEA 1QB1A 1PYTD 1QRWA 1O5BB 1QBNA 4UFGH 3RP2A 3SI4H 2FOMB 1P05A 1QL7A 3LH1A 4CHAC 2O8UA 4INKA 3PMHB 2WV5A 5EGMA 3FN8A 1THRH 3DD2H 3M5LA 1Z71A 1C2KA 3O8DA 3ZVGA 2AIQA 4MLFB 5JB9S 4Q63A 1KXEA
chains in the Genus database with same CATH topology
2BLQA 1G2MA 3BTTE 3FAOA 1UK4A 2SGFE 4IBLH 1LVBA 1PYTC 1BCUH 3RXPA 1ZSJA 1P2KA 3VB7A 1EOJA 1BRCE 2UUYA 2FODA 4I7YH 1Y59T 3RXAA 2Y5FA 1QRZA 1MTNB 2HWLB 4BXWA 1AFQB 2Z9IA 1O2UA 3QWCH 2OQUA 1AMHA 4X6OA 3SI3H 1B0EA 2F83A 4Y7AA 2QY0B 5CE1A 1ORFA 1UTNA 1HB0B 5JBCS 4GVUA 1ESAA 1Z7KA 3SOSA 1S0QA 1Y3YA 2YOLA 4Y71A 3GCHB 2P3TB 1SGCA 1EQ9A 3PWBA 3MNXA 3R3GB 2ZGHA 1P04A 2G52A 3PYHA 4XBCA 1CO7E 1O36A 2VVVA 1W0ZU 4K60A 1AWHB 3FVFB 1UJ1A 4B71A 1GG6B 1S6HA 1C5SA 4A1XA 4HTCH 1QURH 1FPHH 1HAIH 1O2ZA 2ESTE 2FTLE 2NU3E 6GCHF 4BAHB 2C8YB 1NS3A 2W7UA 1W10U 1IQEA 1C5NH 1TGSZ 1TYNA 2Z94A 1Y5AT 4ABDA 3LJJA 4I32A 1FONA 1EPTA 1PPZA 1ETRH 2BDYA 1BBRH 5A8ZA 2AGEX 1N8OB 2HPQH 3TLOA 1HXEH 1C5OH 5JDUB 3GYLB 4J2YB 2C90B 1GGDB 1E38B 5CHAC 4A92A 3ZVFA 1HDTH 2M5TA 2QC2A 4HGCA 1LTOA 2G4UA 3GOVB 4D7FA 1NTPA 5DK1A 2TIOA 4TPIZ 3M3SA 1XX9A 1DVAH 3FP8E 1Q3XA 2AS9A 2PKAA 1TX8A 4H6TA 4CRCA 4A1VA 2B7DH 1WQSA 4U30A 3A86A 1YLCA 3TK9A 1VITG 1ARCA 2R2MB 3UIRA 1EAIA 4IN2A 4UFEH 1BZXE 5FX5A 1D3DB 2FMJA 3SNAA 2VWNA 3IITA 3KIDU 3RXMA 4Y0ZE 2ZHFH 1AZZA 1JXPA 2OINA 2A45B 3TH2H 1EPTB 1T4UH 1A3EH 1OYQA 5FAHA 4SGAE 1RTLA 4NGAH 2PWXA 5L30H 3S7HB 3SV6A 1G32B 1OWIA 3T27A 1C1UH 3BG4B 2FOGA 1NO9H 1GDQA 3MYWA 3O8CA 1UTMA 1YPHE 2G51A 2R0KA 2Y82A 3QGJA 1LVYA 3UOPA 1V2WT 3QLPH 2A5IA 1ACBE 3NWUA 1ZMNA 4KKDA 3S9CA 1CBWB 1FXYA 1MD7A 2BZ6H 1GI2A 2PKAB 4ZROA 1BJUA 3M61U 2BD5A 2BLVA 4YTAA 4XBDA 4TWWA 5JBBS 3E0NB 2PV9B 3O8BA 3SNBA 1AN1E 3KN2A 3ATKA 1D3QB 3DHKH 2PLXA 3L6PA 3D23A 1QQUA 1H8DH 1GBEA 1SMFE 1IQJA 1NFYA 3Q77A 2ZDNA 1ZZZA 1EJNA 4ISHH 2TGPZ 4MNXA 1MTUA 2VJ1A 4LZ4B 4ESTE 2BDIA 4GLYA 1W14U 1Z1IA 4DY7B 2CJIA 4CH2B 2XBXA 2BLOA 2R3YA 3MMGA 3PMJA 3BEUA 3TJVA 5H4IB 1ZJKA 1TPOA 1C2LA 1K9OE 1V2MT 5DKMA 3D62A 1V2QT 1Z1JA 5E0JA 1TQ0B 4UE7H 4Y79A 3BTWE 3W94A 2D26C 2A2XH 3PM3A 1QA0A 3SJ9A 2AFQB 2BY5X 3F9HA 1GCDA 1V2OT 1ZLRA 2ZU3A 5DP3A 4K1SA 4UFDH 1ID5H 1OWKA 2J9NA 5LPFA 3ZZ7A 1UCYE 1AKSA 1HFDA 3SU6A 2THFB 3BV9B 4AG1A 3Q3KA 3LGYA 1G30B 3DT0H 3KGPA 3LDXH 8LPRA 1DDJA 3P92A 2Q6FA 1GDNA 3E0PB 1KDQB 2JH0D 3RLWH 1FLEE 1O35A 1FIWA 4JYTA 1XM1A 4ZH8A 2ZHWH 2WPKS 1XKBC 1P3EA 3QO6A 1GBBA 1GMHG 3UWIA 1JIMA 5DP4A 3SUDA 4IGDA 1YPMH 2HNTF 3ZZ5A 1O30A 1XUGA 1BJVA 1EOLA 2ZTZA 3TGKE 1FY1A 1ANDA 1LHEH 2FIRH 1EAUA 1G3DA 2XTTB 2A4GA 3RM2H 1XUHA 3SV7A 1AUJA 4AGKA 1MZAA 3OY6U 1A4WH 1P11E 3SNCA 1THPB 3M3VA 4X6MA 1AKSB 1SGEE 1NRQH 4DGJA 1UK2A 2QV1A 3MU8A 2ALPA 5E2PA 3A83A 1ZHPA 5F8XA 3ZVCA 1CQQA 1EATA 4XE4A 1ESTA 2QXGA 1RGQA 3P8OA 4KELA 3RMMH 2VNTA 1O3BA 1KXBA 2EA3A 3TIUA 1CU1A 1DE7H 2XW9A 1UTPA 5AFZH 1TGNA 3SJIA 1UVTH 2Z3EA 1SC8U 2FOEA 4I31A 1XMNB 1W12U 2A7HA 2ZGXH 1XXDA 1B7XB 2PUXB 2ZFPH 3UUZA 2R2WU 2BTCE 1A5HA 2Y7ZA 1JOUB 4XSKU 1MUEB 2OXSA 3VFEA 1TNJA 1GHAG 3M7QA 5EW1H 1AHTH 4YZUA 4XFQA 5EQSA 2Y6TA 1HAXB 4AX9H 1SGDE 1O3GA 1VCPA 4D8NA 2J34A 3MNCA 1O3LA 1BBRE 2ZHDA 1A7SA 4BTIB 3LKWA 1K1NA 4A7IB 2ZHEH 1CHGA 1OWEA 2GMTC 1SGPE 1CA0C 4YLQH 2IPHA 1GI7B 3ZV8A 2BXTH 1CVWH 1AI8H 4OS6A 4YOIA 2FI3E 5EW2H 4Y76A 1K1LA 2WUBA 1E34B 1BT7A 2A4QA 3BG8A 3RDZA 1AE5A 3ZV9A 4BTUB 2PKSB 3SQHE 1MAXA 1YKTA 2CGAA 1A5IA 5AF9H 1G36A 3Q00A 1RTFB 1O2TA 3GDUA 4WMFA 1Y3WA 2PGBB 3SHCH 5GPIB 2EC9H 1QGFA 1FPCH 5ABWA 3LJOA 4IW4E 1UTJA 1QTFA 1C5XB 1O2VA 3EA9A 4NSYA 3HK3B 1YPJH 5J4QA 4INHA 1GI3A 3GYMA 1INCA 2BD9A 2P93A 4BAMB 3EGKH 4NIYA 3SNEA 3TPIZ 1LVOA 1GI8B 2RA3A 4K2YA 4F49A 4WF8A 1TABE 1L1GA 5DP7A 2XBYA 4YM9A 1MTNC 4Q2KA 4ZUHA 2O8MA 1AFQC 3V13A 1UTLM 2FOCA 3AASA 1LMWB 1MTSA 2F91A 1BTYA 2Z6BD 3E90B 3F6UH 1LQDB 4MDSA 1O3OA 2Y7XA 4U32A 3WY8A 1K2I1 3I77A 4K8YA 4X8TH 1A3BH 1BRAA 2F9BH 3EYDA 3T5FH 1VJAU 4FUJA 4AORA 3MO3A 2HNTE 3O8RA 1JRTA 2QCYA 1BQYA 4Y0YE 1GG6C 3BF6H 1P2MA 1LHGH 1DUEA 4AB8A 5C3NA 1KYNA 4WJG2 1UCYK 5DPAA 4B73A 2BB4A 3LC3A 2GZ8A 4A5TS 4MQAA 2EEKA 1P9SA 4NSVA 3UNSA 2O9QA 1C5TA 2TGAA 1N8OC 2D8WA 1DY8A 2OUAA 2FO9A 4K3JA 3E8LA 4Q7ZA 4YT6H 4X8SH 4D9QA 1SB1H 2ZA5A 3P70B 1K1MA 1WBGB 4R0IA 1GBTA 1C9TA 4X6PA 3SU5A 4U01A 1U6QA 1MAYA 3E1XB 2H1UA 3A8BA 2ZU1A 4AYVB 1QQ4A 1YYY1 3NKKA 2ZIQH 1TRNA 1ZJDA 5HM2A 1ELEE 1RFNA 2TPIZ 2BVXH 1DWCH 1AVGH 1T8NA 1WCZA 1S82A 2ZEBA 2CF8H 1CHOF 3SW2B 2FWWA 1E36B 4I8GA 1HJ9A 1KTSB 4IC5A 2PFEA 1O2IA 3LC5A 3NK8A 4OGYA 1LO6A 2VIOA 2P59A 3BG4C 3MU5A 1EASA 1QJ1B 1O2XA 4FVDA 5K0HA 2VH6A 2PR3A 5ETXA 2BMGB 2UUFB 1MCTA 3I29A 1GHWH 4H6SB 1SFIA 3RU4T 3ZZAA 3UR9A 1ZGIA 1C1VH 4X2XA 4CRAA 5SGAE 2HRVA 3TVJB 2W3KA 1P2NA 3M7UA 2ZF0H 4AFUA 1H9LB 3F1SB 2O8LA 3U8OH 4JYVH 1NU7B 4K5ZA 3K6YA 1GHXH 1KTTB 2SNVA 1GBDA 2UWOA 1RJXB 2IJOB 1LVMA 2W5EA 3M36A 1XUKA 2FOFA 2XCNA 4ABEA 4U2WA 1S84A 1O2KA 5HXFA 2ILNA 1NRSH 4DURA 4ABGA 3SV2H 1C5UA 1V2NT 2BD2A 2G00A 4UD9H 3UWJH 3S9AA 1V6DA 1FNIA 1ZPBA 2V6NA 1UCYH 5C67A 2AMPA 3M5MA 3RXEA 1O39A 4GUXA 1IQLA 2SGEE 2OC8A 3M5NA 5JPMH 4ASHA 1C5RA 3PMAB 3B9FH 1O2HA 4KTUA 4E7RG 3ELAH 1A0HB 4TY6A 2BDHA 1O3IA 3D49H 2ZHQH 4YESB 3T2NA 4R8TB 1AZ8A 2J2UA 2YNAA 3RU4D 1NESE 3VGCC 3PLBA 3EAJA 5JYIA 5C5OA 4X1SU 1ZSKA 1NZQH 5EODA 1C9PA 1TNGA 3P8NA 3A81A 3TJOA 7LPRA 1EKBB 2GV6A 2H9HA 1GBCA 4MVNA 3AW1A 2JKHA 2PGQB 3VB5A 3A88A 1QB6A 1L4ZA 1DWDH 1SLXB 2ZGCA 3VB3A 4CREA 1MBQA 3SN8A 1TALA 3OYPA 5A0BA 1D9IA 8GCHG 1XXFA 1CGHA 2VB0A 5GCHG 1OWHA 1DWBH 3SUGA 3GDSA 1UMAH 4JZEH 1ELAA 1SGNE 3OSYA 1SBWA 3RXOA 2LNCA 3ZZ9A 1TLDA 3CS7A 1G37A 2J94A 3EQ0H 3A80A 1AB9B 1BHXB 5PTPA 1T8OA 2H9EH 3P17H 2ZZUH 3ESTA 1ZTLA 1G3CA 1TGBA 1GMDG 2GKVE 3T26A 2AH4X 1OKXA 2R3UA 1O34A 2FEQH 2DUCA 1DS2E 2YNBA 2K1QA 4DJZB 1N1LA 3PTBA 1FQ3A 5E0GA 5A2MH 1TX7A 4GCHF 1TNKA 5AVDA 1ANEA 2ZDKA 2WV4A 3FP6E 1HJAC 2ANWA 1J15A 2GGVB 2A4RA 4NCYA 3G01A 5GIBA 3ZVBA 1FI8A 2H5CA 4X1NU 1O2PA 2WPIS 1C4V2 4XBBA 1O31A 2AGIX 4FUFA 4I33A 2NU0E 3MH7A 1MZDA 2Y80A 5L2ZH 3GISB 2ZFFH 3H5CB 2AEIH 3JZ1B 1K22H 2PW8H 1GMCG 4FUHA 1YC0A 2PTCE 4BAOB 2GV7A 2ZPRA 1K21H 1WUNH 3MU1A 4X6NA 2JH5D 4I8JA 2F9OA 1TRYA 2RA0A 3RC6A 1GCTB 1A1RA 1G2LA 1GVZA 1MQ5A 4CR5A 2GCHG 4HI3A 4K69A 3PROA 3SV8A 4O03A 1C2HA 3SU3A 4RKJB 1GBIA 3B23B 1G3BA 1ELVA 1C2MA 3M7TA 4D9RA 4XOJA 1HAZB 4FVBA 5C1XA 4O3TA 4K1TA 3UNRA 5IYTA 1HGTH 3MTYA 4D76A 4JK6A 2QXJA 2C3SA 3VXFH 3TNTA 1OX1A 3MO9A 2PKSC 1QB9A 2ZPQA 3SU2A 1WTGH 2ZFTA 1LHCH 1SLWB 1Y3UA 1S81A 1OSSA 1W2KH 2D2DA 4FUIA 1TGCA 1H9IE 2OP9A 1K1OA 3AVZA 2C8ZB 4X1PU 2BVSH 4RN6A 1W8BH 6CHAC 3A85A 3SU4A 1P06A 3V7TA 2NU1E 1O3NA 1HLTH 4LXBH 2ZO3H 3QZQA 2XYAA 5E0HA 3W95A 4BAKB 1TBRH 2BY6X 1AY6H 1AVWA 1ARBA 5AHGH 2XC4A 2BX3A 3FP7E 2SFAA 2XXLA 2A2QH 2BLWA 1YLDA 4KGAA 3A82A 3CS0A 1N6XA 1KXCA 1SG8B 2VINA 5FCKA 1FIZA 1A2CH 1O2WA 3PB1E 4ISOA 1O3AA 2FTMA 1C5YB 1ZYOA 5A8XA 1PPGE 4ISNA 2J92A 5TJXA 2OBQA 2ZDAH 1C1WH 1KDQA 4DG4A 1AO5A 4OS1A 4AYYB 2JH6D 2UWPA 1HXFH 5F8ZA 2BX4A 1L0ZA 3AAVA 1QBVH 2SGQE 2NWNA 2FDAA 1TMTH 5A0CA 4ZXXH 3RXFA 3SORA 4ZKSU 3K65B 1HRTH 2XWAA 3N7OA 3E6PH 4DVAU 2ZI2H 2ODYB 3TGIE 1ZSLA 1BHXF 1D4PB 1GHZA 2BZAA 1DXWA 3RXKA 1KXFA 5HMAA 1GVKB 1P9UA 1QHRB 4GSOA 1OWDA 1SGFG 1TMBH 4K8BA 1HAHH 4INLA 1HAYB 3KNXA 1MKWK 3PWCA 3SUEA 4I8HA 5C2ZA 1QNJA 1J9CH 4FUCA 2WPJS 1XVMA 1F5RA 3GY2A 3A7TA 3BIUH 4MTBA 1ANBA 1O3DA 2F9UA 2PUQH 4B2AA 3VGCB 2ZGBH 1CSOE 3GCOA 2SGAA 1O32A 4F4OC 1FAXA 4KTSA 1SGQE 3GCNA 4JCNA 4YO9A 1IQGA 3ATIA 4H42U 4B1TA 1O38A 3ZZ4A 1F0SA 1H8IH 3ZYDA 3BEIB 3QTVH 3STJA 5DP8A 2A5AA 1F0TA 1IQMA 2ZCKP 2P3UB 1ELTA 2B5TB 1F2SE 4B75A 2VIVA 1QBOA 5HGGA 1ELFA 1P10A 1Z8RA 4ZHAA 3MFJA 1P2JA 5F6MA 2W3IA 3RXDA 1B0FA 3TU7H 1TNLA 1D6WA 1ZGVA 1O3EA 1ABIH 2GT7A 1L1NA 1KXDA 1V2PT 2PSXA 1TA2A 2A1DB 2Y81A 1W7GH 1MQ6A 4MPUA 3SGAE 1ZRBA 1QIXB 2BM2A 1HCGA 3KQDA 1KLIH 1ELDE 2HPPH 2WUCA 4IN1A 3UREA 4CRBA 2RDLA 5EU8A 1FN8A 3R0FA 2FI4E 1TE0A 3C27B 8ESTE 1DWEH 3ZZ6A 1V2KT 1ESBA 2A7JA 1PPHE 4BXSA 1HJAB 1O3HA 1SLVB 4NIXA 3ODFA 3P95A 2G81E 3RXRA 2RG3A 1DM4B 3LGTA 3IG6B 5GDSH 2GCTB 2OLGA 3T62A 1J8AA 1GVLA 1V3XA 4WXVA 3L3TA 5DP6A 4Z0KA 2PHBA 1DLKB 2C8XB 2UWLA 3QX5H 2AIPA 1YGCH 6GCHG 1YM0A 1TMUH 1DXPA 2QF3A 3GCTF 5E2OA 2JETB 1GHBF 5LH8A 1EP5A 1MTVA 4DW2U 1UO6A 5C