1NESE

Structure of the product complex of acetyl-ala-pro-ala with porcine pancreatic elastase at 1.65 angstroms resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the product complex of acetyl-Ala-Pro-Ala with porcine pancreatic elastase at 1.65 A resolution.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ELASTASE
total genus 59
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1995-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1nesE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1nesE01
1SGDE 2GCHG 3SUGA 4GLYA 1EAXA 3H5CB 3QK1A 1UK3A 1GHYH 1V2LT 1G9IE 1V6DA 1XUJA 1A3EH 1F0UA 4BAMB 3VB4A 3AAVA 4YOIA 4AN7A 2G8TA 1O5FH 2ZC9H 3DHKH 1Z6JH 1GHZA 2ZGCA 4GPGA 1QA0A 1FPCH 1BITA 4AB9A 1BDAA 3FP8E 1NFUA 1C2MA 1O35A 2IN2A 3CS0A 5AF9H 3PMJA 4B73A 1Q31A 4Y79A 1HIAB 2O8UA 1BTHH 2HWLB 1T4VH 2BDIA 3MYWA 4BXSA 1O3LA 4NIVA 4IC5A 1RJXB 4ZHMU 1C5ZB 5C3NA 1HLTH 2D8WA 5EOKA 5T6FA 3O8RA 3VFEA 1FJSA 4AX9H 1ACBE 2VIVA 2J94A 2HPPH 4O3UA 4B74A 4LZ4B 2QN5T 4B71A 1MU8B 1F0RA 1SOTA 1BMNH 3SQHE 2WPKS 5AVDA 2RA0A 2WUBA 2ZKSA 5A0AE 1DICA 1O37A 2F9PA 5TCCA 3TNSA 3LJOA 1O2PA 1Y59T 1O2NA 1DY8A 1NN6A 2Z3DA 1EQ9A 2BQWB 3O8DA 1O2GH 1XKBC 4AG1A 3OTJE 1Z8RA 3UUZA 2BDBA 4NZQA 5DG6A 1GDUA 3OU0A 2A1DB 2H1UA 4Y8XA 1KTTB 1K1JA 1RD3B 4I7YH 1SVPA 1HJAC 1THRH 1Z6EA 2UUKB 1S82A 1P2KA 5CHAB 1UVUH 3EA8A 4E06H 3F68H 1ZR0A 2BXUH 1TOMH 1K1NA 1VGCB 4F4OC 4FUIA 4WMEA 2G00A 4A1XA 4DY7B 1ZTKA 4X2YA 4Q80A 2A2QH 1UO6A 3K65B 2TGDA 4NA8A 1O3HA 5EXLA 1G2MA 1PYTC 2NU3E 2Y6TA 3MH6A 4X6MA 3SUFA 1KXCA 3U8RH 4UEHH 2ALVA 1W12U 2IOTA 2THFB 2HLCA 1P2IA 1O3GA 4JCNA 2BLOA 1GMCF 2HNTE 1LHFH 1FY3A 3TJUA 1ZHRA 2GZ8A 2AGEX 4Y8ZA 4YESB 1EATA 3U1JB 4Y71A 4ISLA 1T4UH 1TBQH 1TBZH 3RC4A 1HDTH 2PSXA 3GY8A 4MNXA 3PMHB 4CR9A 1KYNA 1S81A 2VB0A 1LQDB 1XMNB 2J95A 2A4QA 1GVLA 1FAKH 4X1SU 1WTHD 4XDEA 3KN2A 2ZFPH 1HAVB 2JETC 4X1QU 4FUEA 4YT7H 4X1NU 1G2LA 1C4V2 3JZ1B 3TNTA 3AW0A 2G55A 1TONA 4JZIA 1NZQH 2BD5A 2FYRA 2TBSA 1D3PB 1V2RT 1GVZA 5L2ZH 2QF0A 3MH5A 3NPSA 3NXPA 2BD7A 1XUGA 1CO7E 1GDNA 3ZYEA 1MD8A 2ALPA 3GY7A 2QF3A 1A46H 1V2TT 3SI3H 2ZGBH 1SGFA 3LU9B 3M3TA 3VGCB 1A5HA 4WF8A 1V2QT 3UNQA 1XKAC 2PGBB 3Q3XA 4FUHA 3GCHB 2XWBI 3UR9A 1P12E 1EXFA 2AYWA 1MTNB 1QJ7B 4NWKA 5AFYH 1GPZA 2QY0B 3D49H 2HNTC 1HAVA 5H4IB 1XUHA 4FUDA 4KELA 3RXUA 1LHGH 1ZMLA 1LHDH 5A8XA 1UMAH 3A86A 1FV9A 3DFLA 1C1RA 1BMMH 2GCTC 5L6NH 3MU1A 1S0QA 2PTNA 4ZKRU 1C5NH 3SGBE 3F9HA 1SR5C 1BJUA 2FI5E 2I6SA 3M3SA 4ABIA 1O5GH 2HGTH 3RXMA 2ZFRH 5JYIA 1GJAB 1GBAA 1YC0A 1HPGA 1BMAA 1UCYE 3K2UA 3EYDA 4ISNA 5DP7A 3GDUA 1A0LA 1BUIA 2F83A 3U69H 1F7ZA 3RXTA 3SGAE 2GZ9A 3RDZA 3VGCC 1SMFE 3BTFE 6LPRA 1YPKH 3UPEA 3SV9A 4TY7A 5EPYA 2FXRA 1WCZA 4FUGA 2SNWA 4D7FA 1WU1A 1EKBB 1O39A 1S6FA 1V3XA 5IYTA 1BRUP 3MU8A 2PKAA 1GGDB 1YYY1 3OSYA 6ESTA 1FDPA 4TY6A 1FN8A 2Z94A 2AERH 1AO5A 2D2DA 4INKA 1BTYA 5E2OA 2G4UA 5E8EH 1Z1IA 2ZTYA 5ESBA 1H8IH 4MPUA 2Y82A 3ZZBA 4INLA 4THNH 2FX6A 1SQAA 3MNSA 2PKSB 1C2EA 1GHBG 2G5NA 1XX9A 2O8MA 2ZCLP 1T8NA 2O8TA 4JZEH 4AGKA 2P93A 5DP3A 4K8YA 3IG6B 4FVDA 4MNVA 5C5NA 1YBWA 5EG4A 1BTUA 3NZIA 1AUTC 2FOHA 1W14U 2UWPA 1A3BH 4Y8YA 3RC6A 2VIDA 4DIHH 6GCHG 1J16A 2BLWA 8ESTE 1GG6B 2WPLS 3I29A 1AVGH 4BNRA 5GIBA 1GHAF 1INCA 1OPHB 1EZXC 5HGGA 1O36A 1PQ5A 1DUAA 3SV6A 2G52A 1A4WH 1A7SA 3SNCA 1AB9C 2DE8A 2FP7B 4AOQA 3RMNH 7GCHF 3SBKA 1QGFA 4Z0KA 2WINI 4MDSA 1WQSA 1RRKA 1DY9A 2QV1A 3BN9A 2XCFA 1GI2A 1WAYB 3HKIB 3UQVA 2TRMA 1NFYA 1Z8JB 1IHSH 4CRGA 2P16A 2GV7A 3QDZB 3MTYA 4YLUA 3GY6A 3M7QA 1W7GH 1OKXA 2PWXA 1UVSH 2FTMA 1VZQH 2FM2A 1RTKA 3E0PB 3ATKA 1XVOA 4BOHA 4TPIZ 1FLEE 2AGIX 1OX1A 1LKBA 2BOHB 8GCHF 4ZXXH 3RXHA 1KDQB 2O8WA 3PWBA 2BY6X 1AE8H 1V2JT 3Q76A 4INHA 1TMBH 2LNCA 1Z1JA 4MNWA 2A31A 3ZZ7A 2G5VA 2GTBA 1NPMA 2AFQB 2VIOA 1XUIA 1O2WA 1ESBA 3EQ0H 4X2VA 2BB4A 1MMJN 4D8NA 3QZQA 1PQ8A 2WUCA 3R3GB 1NFWA 2ZWLH 1AE5A 3D23A 3RU4E 1KXBA 3UWIA 4DCDA 2ZTZA 1V2VT 3HGPA 1A1RA 4X0WU 2XNIA 4A6LA 2BQ7B 1O2LA 3MO6A 3UTUH 2VWLA 4Y76A 1ZSLA 2FTLE 1SQOA 3Q3KA 1MD7A 1DOJA 1CT0E 1FUJA 1OWJA 2ZDLA 3P8NA 1DX5M 4TYDA 1NS3A 3MNXA 1O2YA 1YM0A 1TOCB 2HNTF 1SGTA 3P92A 2CHAC 2ODPA 3P95A 3FZZA 3F1SB 2UWLA 2XBVA 4J2YB 1O3KA 3P8GA 1YPMH 3LGVA 1EOLA 1WSSH 2JETB 1C1UH 4MG3A 1EJAA 2BM2A 1KXDA 2OQ5A 2ZDKA 3Q00A 1C9TA 1RTLA 1K21H 1BHXF 2GX4A 4IW4E 1OWEA 1K1IA 5FAHA 3PM3A 1EX3A 3TVJB 5ABWA 5L30H 1KLIH 3DUXH 2B8OH 2VVVA 3P17H 5JBTA 1YPLH 3L33A 5FCRA 4NIYA 1TRNA 1AD8H 2HRVA 3M35A 3RM2H 1ID5H 4WH8A 3AASA 4NSVA 3F9GA 3MMGA 1GHVH 1LPZB 2BX4A 1JRSA 3NWUA 4X1PU 5J4SA 1AGJA 2KAIB 3UFAA 3ZZ9A 1CHOG 1F2SE 2A45B 1EZSC 1TNIA 1O2QA 4A1VA 1TNGA 3GCOA 4ZKSU 4H6SB 1SOZA 2A5AA 3SJ9A 1NO9H 4A5TS 3ATIA 5DP8A 1AQ7A 1W11U 3RXAA 1QHRB 1O2SA 2PGQB 1XXFA 4UDWH 4UD9H 5CHAC 5HM9A 4KP0A 3BTME 2BYAX 2PKAB 2ZCKP 2EA3A 3KQEA 1RS0A 1Q2WA 1N8OB 2NU4E 7KMEH 4MPXA 9LPRA 5EW1H 4E05H 1BTXA 1L1NA 2G51A 1PQ7A 1HBTH 2PUQH 4HI3A 1TYNA 1AFQC 1J9CH 1F92A 3RMOH 1Z8GA 3BTEE 1UTKA 4K60A 2HPQH 2BY5X 3ZVFA 2F9UA 2ZPRA 2W3KA 1C1SA 1TABE 2VH0A 1N8OC 5E0JA 1DUEA 3BEIB 3MU0A 2Y7XA 1H8DH 2P8OC 2V3HH 3H7OA 1C2JA 1O3BA 2ULLA 1VITH 4Y11E 4YO9A 3KL6A 3ITIA 3SHCH 5G4BA 1ELVA 1ZPCA 4FVBA 1L4ZA 3LGWA 1QRWA 3ATLA 1O5BB 4DIIH 1SGEE 3LKWA 3RP2A 1LVMA 2B9LA 3ZVBA 1ORFA 4LK4A 1CT4E 1JBUH 1MQ5A 1TNJA 1X7AC 2VIWA 3L3TA 5JPMH 1GI1A 3KQDA 3B8JA 3TH4H 4X6PA 5EXMA 1T8MA 1L0ZA 1GI5A 1AN1E 4GSOA 1YKTA 3A8AA 2ZZUH 1CU1A 2NU1E 2FWWA 1LVYA 1C5SA 3UNSA 1D6WA 1DSTA 1HGTH 3E6PH 5GWZA 1SG8B 1ABJH 1Y3YA 3K9XB 1GMHF 1ELGA 1O3CA 4CBNA 4XFQA 4WXIA 1J8AA 5JBAS 1HCGA 2GDDA 2Z9IA 2CN0H 3PTBA 2XBYA 1CQQA 4HZHA 1OXGA 2FEQH 1ARCA 4ABFA 4X1RU 7ESTE 3PWCA 1O2VA 5FX6A 3PLPA 5C5OA 2XCNA 2ZHDA 2VGCC 2SGPE 1ZGIA 4IN2A 3VXEH 2VIPA 4B76A 1DITH 3QX5H 1QJ6B 3K6ZA 5A0BA 4OGXA 4UFDH 4NFFA 4DVAU 3S7HB 3OY6U 1ZYOA 1UTLM 1TX8A 3MNCA 1BMLA 1SGCA 3GYMA 5DP6A 5GCHG 2BLVA 1G30B 1O2TA 3UR6A 2P3FH 1F0TA 1QTFA 2A7JA 3GCNA 1NRQH 1NU9A 1DWEH 3E90B 3U1IB 1RFNA 1P03A 4U30A 3TK9A 3P70B 3ZZDA 1AZ8A 4BAOB 2VIQA 3GDSA 4ABDA 2ANYA 3BIVH 1QCPA 2OXSA 1O5DH 4LZ1H 4GVUA 2A5IA 4ZHAA 2Y5HA 2UUJB 1G37A 1TRYA 2ASUB 1WOFA 3QTVH 2VNTA 3SW2B 4UONA 3CS7A 1QB1A 8GCHG 1SHHB 1G32B 1YF4A 3TK6A 3EDXB 5C1UA 1ANBA 1ANEA 1YCPM 1B0FA 4CRAA 1H4WA 1MZDA 3MU4A 4IGDA 5AFZH 3BTHE 1Y8TA 2LPRA 4ESTE 4AFUA 4OS1A 3VPKA 4FUJA 1O3IA 3EAJA 4XSKU 3A85A 2CXVA 4CRDA 4CBOA 1MTNC 2ZIQH 3TJNA 4AORA 1Z8IB 2Z9LA 4FU9A 3DFJA 1HXFH 3T62A 1GI9B 1GJ9B 1DFPA 4MTBA 3M5MA 2YNBA 2AS9A 1CE5A 2PLXA 1KXFA 1V2KT 1MAYA 3RXGA 2VH6A 2EEKA 3A7TA 2Z9GA 1AIXH 1F0SA 5I25A 1MAXA 1ESAA 3QN7A 1MZAA 2GDEH 2XC4A 4H42U 1MKXK 2Z9KA 1IQKA 1BOQA 1GMDG 4ZXYH 2FS9A 1PPBH 1T7CA 1GJ5H 2CF9H 2W5EA 2OBQA 1QBOA 1CVWH 1LVBA 1H9IE 2F9VA 1MCVA 4YTAA 1DXPA 1C1MA 3E3TA 2K1QA 4Q2KA 3LC5A 1FPHH 4A1TA 2FOFA 5FCKA 2XBXA 3C27B 3C1KA 1DSUA 1MBQA 3MOCA 1NESE 2ZGXH 3BTWE 3SZNA 1PPZA 2P59A 3ZZ4A 3BIUH 1Y3XA 1IQIA 2XW9A 3PTNA 2OINA 1O31A 5DK1A 2ZPQA 1QURH 3E16B 4Y6DA 2SFAA 1HAPH 3RLWH 4GCHG 1E38B 1UTPA 1LDTT 3CENA 5EQRA 3LPRA 9ESTA 2IPHA 1Y5AT 3GDVA 2ZQ1A 3A7WA 2UUYA 2RG3A 2WYJA 1J17T 1TBRH 1C1VH 1YPEH 1ZPZA 2F3CE 1FZZA 4D76A 1GGDC 1TX7A 1FY5A 1ELCA 4U01A 3M5OA 1QFKH 3V12A 2GD4B 1HAGE 1FMGA 2H9EH 2OC7A 5DP5A 3S69A 5T3HA 4D7GA 1W13U 4JZFH 1JRTA 1LMWB 2FDAA 2A0QB 1GJCB 1TE0A 2AMDA 3KHVA 3T27A 1OP0A 1K1PA 5A8YA 1HV7A 1GCDA 1O3OA 1YGCH 3S7KB 5DP4A 3ZZ6A 3MO9A 2WYGA 1HAXB 4DURA 3FP6E 1V2OT 5FBEA 5F8TA 1TA2A 2BD9A 3LGTA 4HTCH 1JOUB 2A4OA 2ZHFH 3A83A 1C1TA 2GV6A 1OWHA 1HFDA 1C2GA 3TLOA 2XC5A 1MTWA 3KCGH 5HMAA 3PLKA 1C4Y2 2FI4E 1O2XA 1D3TB 1SC8U 1T32A 2WPIS 2GMTC 4YOJA 3V7TA 5IDKA 2P3TB 5T6GA 3RXIA 1ZJKA 2GCTB 5FX5A 1EB1H 3TK5A 1P3CA 1TNHA 1N6XA 1SGFG 1ZJDA 5C1XA 2IJOB 3UY9A 1TPPA 5ESTE 4BTUB 2QXGA 1SFIA 1O38A 2OC1A 2RCEA 1XM1A 4MNYA 1TMUH 1FNIA 5JBBS 1VITF 1OWKA 2BZAA 3HPTB 3E91A 1QY6A 1EB2A 3RMMH 2FI3E 3SU4A 2A7CA 3S9AA 3T28A 3B9FH 3GCHC 3L6PA 1K9OE 1WYKA 1WBGB 5E2PA 3RXRA 2ANWA 1LHCH 2Z9JA 1NFXA 4FU7A 1YCPH 3BTDE 1IQFA 4AG2A 1MTUA 2UWOA 1ZPBA 1S83A 1W10U 3UOUA 2CF8H 1E34B 2C8XB 1PQAA 1TQ0B 2YOLA 1BHXB 5JB9S 1UJ1A 3M3VA 1VR1H 2FOEA 2QA9E 4BXWA 2VWNA 2TGPZ 4R0IA 1JWTA 3LOXA 4CHAC 1QRXA 3MH4A 2HALA 4XOJA 3WY8A 5EODA 4K3JA 1UHBB 1ANCA 2CHAB 1DXWA 2OLGA 4IMQA 1NC6A 2ZHEH 4A7IB 1SGIB 2BD2A 1KIGH 1GJ6A 2ZNKH 2W3IA 2QYIA 3QO6A 2ZPSA 1V2MT 2ZU4A 2HVXA 4Y0YE 3ZZ8A 3ZV8A 1C5UA 1AI8H 3QTOH 2ZU3A 3FZDA 2STBE 1QQUA 1A5IA 4B2BA 1UVTH 2ZDVH 1O2UA 3BSQA 2P95A 5GCHF 3TH2H 1QL7A 3GY4A 2ZDAH 1GCTC 3LC3A 5GDSH 3RXBA 4NA9H 2BX3A 3PV4A 5GXPA 4ZROA 3ZVCA 1TGTA 3HK3B 3HATH 1CBWC 3GY5A 2CV3A 1SI5H 4ZKNU 5TJXA 5F8XA 1C2KA 1E0FD 4AFZA 2SGQE 4IC6A 1AFEH 1GHWH 1Q3XA 2JH0D 3EGKH 5A09A 1QR3E 2Y7ZA 2BMGB 3QGNB 4CRBA 1EPTC 2G81E 3ATWA 4Y0ZE 4MPVA 1KY9A 5FPSA 4B75A 2F9NA 1O2MA 1C5RA 2P3UB 4ZMAH 1ZSJA 1Y5BT 1NY22 4JYTA 2CJIA 1AFQB 1DS2E 1P10A 3GOVB 3VEQB 4NA7A 3ESTA 3K6YA 5FBIA 4AYYB 3A7XA 1C2LA 4WH6A 1Z7KA 2H5DA 2ZU1A 3BF6H 3KF2A 5JDUB 1EPTA 1SGRE 1ZMNA 3OYPA 3QUMP 1NT1A 1W0YH 1DT2A 1FI8A 1NROH 2V3OH 1FAXA 1P3EA 3KQBA 2OD3B 1EAWA 4BAKB 3A7VA 4NFEA 3R0FA 1O2JA 1KXEA 4DT7B 3D65E 1SGNE 3Q3YA 2TPIZ 1H9HE 1MKWH 1SGPE 1GI3A 2A5KA 1HNEE 1S5SA 3PO1C 4SGBE 1YPHE 2OTVA 3ZV9A 3M37A 3LH3A 1GBEA 2PR3A 2WPJS 1DPOA 1A5GH 4QT8C 1TGBA 1MKWK 1KSNA 1VCQA 1HJ8A 3RM0H 1L2EA 4GHQA 5SGAE 1YLDA 2VWMA 3ENSB 2BD3A 3TGIE 4I32A 1IQMA 4FU8A 1GI4A 3SV7A 2Q1JA 4YZUA 1PYTD 2Q6GA 3RXKA 4MQAA 1JXPA 1TGSZ 1O5EH 2H2ZA 1P04A 1EP6A 4BTTB 1O32A 3BG4B 5I46H 1RTFB 1P11E 1P9UA 2BHGA 2AEIH 2NU2E 1O30A 4OS6A 5EW2H 4O03A 5LGOA 5FPYA 3LGYA 4JK5A 4BAHB 2FPZA 3GCTG 1ARBA 4NZLA 2QIQA 4ZKOU 3GYLB 1GBTA 2SGAA 2WPHS 3T26A 1P8VC 3RU4D 4ABJA 1TQ7B 1P57B 4OS2A 4AZ2B 4IMZA 2SGEE 3ODFA 3HKJB 3SNBA 2BD4A 3MFJA 5FXLA 2PHBA 3URCA 4NGAH 4Y7BA 1SB1H 4K5ZA 1KXAA 2P94A 2BDAA 5BRRE 1O3MA 1MTVA 1GHAG 2CMYA 3UNRA 1C5LH 1GBHA 1CA0C 1RIWC 1C5MD 2J9NA 1Y5UT 3BTTE 5EU8A 5F6MA 1GJDB 2H9TH 6CHAC 4OS5A 1C1PA 1BCUH 1TPSA 5K0HA 2EI7A 3TH3H 4I8LA 1MU6B 1JIMA 4LXBH 3SU2A 3Q77A 1BJVA 1SGYE 5A8ZA 1W0ZU 2D1JA 1SSXA 1P01A 2PUXB 3SJOA 3TPIZ 1A0HB 3MNBA 3N7OA 4CREA 4U2WA 3A8DA 2QXHA 1MQ6A 1J15A 4CH2B 1GI6A 2XBWA 5LPRA 4X6OA 5EPNA 1IQLA 3A81A 1IQHA 1SFQB 2J4IA 4NIWA 2FO9A 1AY6H 1ZGVA 1TMTH 4WY3A 4FUBA 1S84A 1CA0B 1RIWB 4RKJB 2AMQA 1UVOA 1K22H 1N1LA 3AAUA 3RXFA 1U6QA 2TGTA 2W26A 3LIWA 1ELTA 2XC0A 3T2NA 1G3BA 4I8KA 1O2IA 5DO4H 3BV9B 4O97A 1O34A 1ZTJA 1H9LB 1O3DA 1HAHH 4NWLA 3M61U 5A0CA 2D26C 4CRCA 1LO6A 1BBRK 4X8VH 3RXLA 5PTPA 2JH5D 2ODQA 3UIRA 1NM6A 1ZTLA 2ZDNA 3PMAB 1C2FA 3KQCA 1KLJH 2VGCB 1QIXB 1OP2A 1V2NT 1B5GH 1T8OA 1RXPA 1DVAH 1AVXA 2DUCA 3TITA 5HXFA 1BBRH 3SGQE 4KTUA 3I78A 1CA8B 2ESTE 5EGMA 1V2UT 2FX4A 3UOPA 1NTPA 1BRBE 1TB6H 1TX6A 1PPFE 3M7UA 1RGQA 3SUEA 2ANMH 1ZHPA 1EASA 2FODA 1P2OA 5B6OA 2C8WB 1O5AB 1IHTH 1AHTH 2FLBH 2XXLA 1EUFA 1BTZA 5DP9A 3ATMA 1CGHA 3FAOA 2OC0A 4PROA 2R2WU 2BY7X 2ZEBA 4K1TA 2R0KA 2RA3A 4OS4A 1SLVB 2Q6FA 3PO1B 1MUEB 3AVZA 2GT8A 2SGDE 2BDYA 4Z6AH 2BLQA 3S9BA 2ILNA 3A88A 1OP8A 3I77A 3RXOA 2KAIA 3STJA 2ZCHP 1G3DA 4YT6H 1EJNA 1VITG 3DD2H 1EZUC 2NU0E 1OWIA 4Q7ZA 1AWFH 1Y3UA 2FYQA 5F03A 5LPEA 2BDHA 1SPJA 2M5TA 4YOGA 4AYVB 1C2HA 1HRTH 4VGCB 3RXCA 1O5CB 1YPJH 2NWNA 1QQ4A 3NUMA 1HJ9A 2OBOA 3RXJA 1D3DB 4MPWA 3A8CA 3FFGA 4GCHF 4K1EA 1UTJA 2BDCA 2F91A 1FN6A 1L1JA 1DDJA 1O3NA 1P06A 3GCTF 3T29A 4D9RA 3LH1A 1UCYH 5F8ZA 1QA7A 1QNJA 2F9BH 2Q6DA 1CHGA 4UE7H 4A92A 1MTSA 3FVFB 1SL3A 1HXEH 1NRPH 1C5PA 1GWAA 2QXIA 3VB3A 1LKAA 4UFFH 4WJG2 3IITA 3SUDA 1O2ZA 1PPGE 1YCPK 3JZ2B 3BEFB 3H7TA 1IOEA 4R8TB 2AGGX 1QBNA 4Q7YA 1EOJA 1WTGH 3SNDA 1L1GA 4RKOB 2R2MB 4NSYA 1PPEE 4OGYA 5DPAA 1VCWA 2C8ZB 3VB5A 3E0NB 1GMDF 3SV2H 1C1QA 3TGKE 3GY2A 5CE1A 3A84A 6CHAB 4ISIH 1TGCA 2Z3CA 2VVUA 2OCVB 3SU5A 3UREA 1XXDA 3RXSA 1F5RA 2BVXH 5K7RA 1OWDA 1VCPA 2BTCE 1EJMA 3QGJA 4NG9H 1SLWB 1FIWA 3E8LA 4ZH8A 2Y81A 3SI4H 4AGJA 3OX7U 5CMXH 2C3SA 3V13A 3PMBB 4GHTA 5T6DA 1C2IA 1ZHMA 3RMLH 3M5LA 4WMFA 1TWXB 1XUFA 1IQGA 1TIOA 4OS7A 4H4FA 4SGAE 4CHAB 1ZSKA 2H5CA 2W7UA 3RLYH 3KIDU 3ZZ5A 5GPIB 3PYHA 1IQNA 1LHEH 4DOQA 4HGCA 4X2XA 1ZRKA 3M5NA 4MVNA 5BPEA 5L2YH 3E1XB 1T31A 2BD8A 2JKHA 3SNAA 4K2YA 1C5TA 3BG4C 4KTCA 8KME2 1CT2E 2EI8A 1QB6A 2PFEA 4X6NA 2QGRA 1C2DA 1V2WT 4NCYA 3SU3A 5C67A 2A32A 4CH8B 3BEUA 2VU8E 1W8BH 2WV5A 3FP7E 2UUFB 2BVRH 3PROA 3UWJH 4AFQA 1TNLA 3B23B 3T25A 3M36A 4TWYA 4UFEH 1BTPA 2ZFQH 2O8LA 1AKSA 1ZRBA 1ZZZA 4ABEA 4KGAA 1UTQA 3SJKA 2ZFSA 3SO3A 5LH8A 4DJZB 2R0LA 1Z71A 1BQYA 4GAWA 3S9CA 1OYTH 1SQTA 1D6RA 4X8TH 1GL1A 2DE9A 4K8BA 1FONA 2EI6A 1GBLA 1O2KA 1Y3WA 1HUTH 2OUAA 1BRCE 3KGPA 1SLXB 1L4DA 2FIRH 4FUCA 3V3MA 4H6TA 2ZP0H 1JIRA 2VINA 1W3CA 5E0GA 5HM2A 3P8OA 1UHBA 3SORA 2V35A 1VGCC 3MU5A 2C8YB 4XBCA 3MH7A 3QZRA 3SJIA 2BY8X 1K2I1 1VJAU 1HAIH 2BQ6B 1NU7B 2BDGA 3RC5A 3F9FA 3SHAH 1GMHG 2AIPA 4WVPE 1FY4A 1G3CA 4Y7AA 4E7RG 3A87A 4JYVH 4K69A 1PFXC 1BTWA 2SNVA 2H9HA 4D9QA 2BXTH 4X8UH 3P6ZB 3P8FA 1HIAA 3LJJA 1QRZA 2Y5GA 3SU0A 1D4PB 1DWDH 1PJPA 1GMCG 3U98H 2ZHQH 1DANH 4KTSA 4VGCC 4KKDA 4XE4A 1TPOA 2VWOA 3TJVA 4WWYA 1TALA 2ZO3H 4AB8A 1LPGB 4ASHA 2J92A 1Y3VA 1GBJA 3MI4A 1GJBB 1P2MA 5ETXA 1UTNA 1OSSA 2ZA5A 3ZYDA 1CBWB 1ELDE 5FHTA 4DW2U 4DG4A 1O33A 1B0EA 1UVPA 3BTKE 2BVSH 1ZMJA 1DWCH 3W94A 1GCTB 8LPRA 1AWHB 2OP9A 3IWMA 1MCTA 2J2UA 3OY5U 1P0SH 1DM4B 3SN8A 1EAIA 2XYAA 1QL9A 1LQEA 3SJ8A 3ZZ3A 3NCLA 3M7TA 1KTSB 3FANA 1GI0A 3SNEA 3PB1E 3UQOA 4CRFA 2OQUA 1AVWA 2W7SA 2C93B 3U8OH 1UTMA 2ANKH 4WXVA 1FQ3A 2ZTXA 1C1OA 2C4FH 5C2ZA 5EQQA 3GISB 2EC9H 1UK4A 3LGUA 3A7ZA 2GCHF 4TWWA 2A4GA 2QCYA 1V2PT 3O8BA 3BTQE 1HAZB 1THPB 2I6QA 1M9UA 1SHYA 1TGNA 1TLDA 1ELAA 1O3FA 2ZQ2A 3LGIA 1TRMA 3RXEA 3PLBA 1W2KH 3SQEE 3EE0B 2AH4X 2ODYB 4UFGH 1A2CH 3A89A 3F9EA 3RXQA 2GZ7A 4E7NA 3VB7A 2F9OA 2FZZA 1LVOA 1UTOA 2QAAA 3BG8A 1C1NA 3QLPH 2PSYA 2BY9X 1C9PA 1CHOF 1GDQA 3EA7A 4XBDA 2GP9B 2Y80A 1HAYB 1H1BA 1E36B 1UK2A 2GKVE 3URDA 2GT7A 2FMJA 1WV7H 5A2MH 3A7YA 1YPGH 1P2QA 3U8TH 2TGAA 3SU6A 1ABIH 3G01A 4I8GA 1YLCA 2ZU5A 1BBRE 5TCAA 2XWAA 2Y5FA 1G36A 1IQJA 1TAWA 1C5VA 1SBWA 3TU7H 4X8SH 1K1LA 1GHXH 2FOGA 3QWCH 4M7GA 3VB6A 2VJ1A 2GMTB 1CGJE 3RXPA 4GUXA 1BRAA 3ZZCA 1CGIE 2VVCA 2ZFFH 1GBIA 2AMPA 1OYQA 1ZLRA 3O8CA 1P05A 2FOBA 4ZAEA 1GI7B 3U9AH 3T5FH 4DGJA 1EAUA 4ABBA 1GBCA 1A0JA 4ABGA 1C5OH 4WMDA 1P2JA 2YNAA 1C5YB 1D3QB 3SOSA 2O9QA 4I33A 2OC8A 1BIOA 4F49A 5C20A 4RSPA 1ELBA 3NK8A 4AFSA 4BANB 1S0RA 1EZQA 1SLUB 1BB0B 4YLQH 5FPTA 1OS8A 1QL8A 2AIQA 5GJ4B 1DE7H 2QC2A 1E37B 3RU4T 3KNXA 5DJ7A 5LPFA 1AKSB 2PV9B 3DA9B 2JH6D 1K1MA 4IBLH 4O9VA 1AB9B 1YP9A 1QB9A 3BTGE 3RXVA 2GVFA 4B2CA 5DGJA 3LDXH 3TGJE 3KEEA 1PPCE 3RUOA 4BAQB 1GG6C 5DKMA 3A82A 3SU1A 1G3EA 4JZDH 2R3YA 2BOKA 1GJ7B 3ZVEA 5E0HA 1C5XB 1LPKB 1E35B 2B7DH 1T8LA 4Y10E 5EXNA 1O2OA 1TNKA 2B5TB 2H6MA 1EP5A 1GBMA 4X2WA 1BT7A 3F6UH 3ZVAA 3DT0H 4IS5A 1KDQA 4JK6A 5C1YA 2PKSC 2ZGJA 4ISOA 1S85A 1D9IA 1CSOE 1P02A 1UCYK 4B2AA 1K1OA 3TJOA 4JMYA 1GBDA 1WQVH 2CGAA 2G4TA 3ELAH 3LONA 5HYOA 3MWIU 4IN1A 1AZZA 1GI8B 2SGFE 2STAE 1C5QA 2PTCE 2PW8H 2FESH 4ABAA 3CP7A 1N6YA 2TIOA 3A8BA 4K1SA 4I8JA 1IQEA 1FXYA 2FS8A 2J34A 2A4RA 2V0BA 2A2XH 4ZHLU 4I31A 1HJAB 4YM9A 2P8OB 1MBMA 2XRCA 1GJ4H 1AMHA 1XVMA 1P9SA 1ETSH 4ZUHA 3V0XA 4ABHA 1O3AA 3VXFH 1BZXE 2J38A 5EQSA 1S6HA 1BA8B 1KLTA 1O3JA 3NKKA 2ZF0H 3ZZAA 1MKXH 1V2ST 1TPAE 2BZ6H 1ELEE 1ETRH 1IAUA 2Z3EA 3S0NA 4NIXA 4ISHH 3LT3A 1P2NA 1B7XB 1GBKA 2FOCA 1OOKB 2GGVB 1EPTB 1HAOH 1O2RA 1O2HA 1P09A 3STIA 7LPRA 1A61H 4JYUH 1GVKB 1AU8A 2B0FA 2WV4A 3ZVDA 1GJ8B 1DWBH 1JMOH 4MLFB 4BTIB 1LTOA 1F5KU 2ZGHA 2QXJA 1FY1A 1O3PB 1DLKB 4FXGH 1K28D 3MO3A 2ZG0H 4U32A 4HFPB 1FIZA 2R3UA 7GCHG 3HK6B 3SV8A 1DLEA 2ZI2H 4XBBA 1HB0B 2XTTB 3EA9A 4JZ1A 1VJ9U 3AW1A 2WPMS 1C5WB 3A80A 3GY3A 2ZHWH 5JB8S 2FOMB 4J1YA 3GICB 2ZU2A 1NRSH 1SGQE 1F5LA 1GBBA 1THSH 4RN6A 4LOYH 4FUFA 1MH0A 2FLRH 1GL0E 1YPHC 2FOAA 3W95A 1GBFA 1ELFA 3ZVGA 2HOBA 1FY8E 3HGNA 2Z7FE 1ESTA 1PPHE 1ZOMA 5JBCS 1QBVH 2ZFTA 2R9PA 1ETTH 1W7XH 2ZDMA 3D62A 1QJ1B 1XUKA 3MHWU 4I8HA 2A7HA 1J14A 2ZECA 4TPYA 3ODDA 1AUJA 1C4U2 2Z6BD 1NRNH 4B1TA 1TA6A 1NRRH 4CR5A 1LCYA 1O3EA 4O3TA 3RXDA 6GCHF 1C1WH 1HYLA 1GHBF 1O0DH 1TFXA 4Q7XA 5J4QA 2V6NA 3TIUA 2C90B 1WUNH 5AHGH 1ANDA 2RDLA
chains in the Genus database with same CATH superfamily
1SGDE 2GCHG 3SUGA 2GJGA 4GLYA 1EAXA 3H5CB 3QK1A 1UK3A 2L74A 1GHYH 3FKSD 1V2LT 1G9IE 1V6DA 1XUJA 1A3EH 1F0UA 4BAMB 3VB4A 3AAVA 4YOIA 4AN7A 2G8TA 1O5FH 2ZC9H 3DHKH 1Z6JH 1GHZA 2ZGCA 4GPGA 1QA0A 4P00A 1FPCH 1BITA 4AB9A 1BDAA 3FP8E 1NFUA 1C2MA 1O35A 2IN2A 3CS0A 5AF9H 3PMJA 4B73A 2W6JD 1Q31A 4Y79A 1HIAB 2O8UA 1BTHH 2HWLB 1T4VH 2BDIA 3MYWA 4BXSA 1O3LA 4NIVA 4IC5A 1RJXB 4ZHMU 1C5ZB 5C3NA 3DCLA 2KX4A 1HLTH 2D8WA 5EOKA 5T6FA 3O8RA 3VFEA 1FJSA 4AX9H 1ACBE 2VIVA 2J94A 2HPPH 4O3UA 4B74A 4LZ4B 2QN5T 4B71A 1MU8B 1F0RA 1SOTA 1BMNH 3SQHE 2WPKS 5AVDA 2RA0A 2WUBA 2ZKSA 5A0AE 1DICA 1O37A 2F9PA 5TCCA 3TNSA 3LJOA 1O2PA 1Y59T 1O2NA 1DY8A 1NN6A 2Z3DA 1EQ9A 2BQWB 3O8DA 1O2GH 1XKBC 4AG1A 3OTJE 1Z8RA 3UUZA 4XD7D 2BDBA 4NZQA 5DG6A 1GDUA 3OU0A 2A1DB 2H1UA 4Y8XA 1KTTB 1K1JA 1RD3B 4I7YH 1SVPA 1HJAC 1THRH 1Z6EA 2UUKB 1S82A 1P2KA 5CHAB 1UVUH 3EA8A 4E06H 3F68H 1ZR0A 2BXUH 1TOMH 1K1NA 1VGCB 4F4OC 4FUIA 4WMEA 2G00A 4A1XA 4DY7B 1ZTKA 4X2YA 4Q80A 2A2QH 1UO6A 3K65B 4B6FA 2TGDA 2EQNA 4NA8A 1O3HA 5EXLA 1G2MA 2J98B 1PYTC 5F53A 2NU3E 2Y6TA 3MH6A 4X6MA 3SUFA 1KXCA 3U8RH 2W6ID 4UEHH 2ALVA 1W12U 2IOTA 2THFB 2HLCA 1P2IA 1O3GA 4JCNA 2BLOA 1GMCF 2HNTE 1LHFH 1FY3A 3TJUA 2PP6A 1ZHRA 2GZ8A 2AGEX 4Y8ZA 4YESB 1EATA 3U1JB 4Y71A 4ISLA 1T4UH 1TBQH 1TBZH 3RC4A 1HDTH 2PSXA 3GY8A 4MNXA 3PMHB 4CR9A 1KYNA 1S81A 2VB0A 1LQDB 1XMNB 2J95A 2A4QA 3NRLA 1GVLA 1FAKH 4X1SU 1WTHD 4XDEA 3KN2A 2ZFPH 1HAVB 2JETC 4X1QU 4FUEA 4ACAA 4YT7H 4X1NU 1G2LA 1C4V2 3JZ1B 3TNTA 3AW0A 2G55A 1TONA 4JZIA 1NZQH 2BD5A 2FYRA 4HG6A 2TBSA 1D3PB 1V2RT 1GVZA 5L2ZH 2QF0A 3MH5A 3NPSA 3NXPA 2BD7A 1XUGA 1CO7E 1GDNA 3ZYEA 1MD8A 2ALPA 3GY7A 2QF3A 1A46H 1V2TT 2YMSC 3SI3H 2ZGBH 1SGFA 3LU9B 3M3TA 3VGCB 1A5HA 4WF8A 1V2QT 3UNQA 1XKAC 2PGBB 3Q3XA 4FUHA 3GCHB 2XWBI 3UR9A 1P12E 1EXFA 2AYWA 3WWFA 1MTNB 1QJ7B 4NWKA 5AFYH 1GPZA 2QY0B 1S6LA 3D49H 2HNTC 1HAVA 5H4IB 1XUHA 4FUDA 4KELA 5B6LA 3RXUA 1LHGH 1ZMLA 1LHDH 5A8XA 1UMAH 3A86A 1FV9A 3DFLA 3F2FA 1C1RA 1BMMH 2GCTC 5L6NH 3MU1A 1S0QA 2PTNA 4Q4LA 4ZKRU 1C5NH 3SGBE 3F9HA 1SR5C 1BJUA 2FI5E 2I6SA 3M3SA 4ABIA 1O5GH 2HGTH 3RXMA 2ZFRH 5JYIA 1GJAB 1GBAA 1YC0A 2K8IA 1HPGA 1BMAA 1UCYE 3K2UA 3EYDA 4ISNA 5DP7A 3GDUA 3AK5A 1A0LA 1BUIA 2F83A 3U69H 1F7ZA 3RXTA 3SGAE 3KYFA 2GZ9A 3RDZA 3VGCC 1SMFE 1K0HA 3BTFE 6LPRA 1YPKH 3UPEA 3SV9A 3MQKC 3OEHD 4TY7A 5EPYA 2FXRA 1WCZA 4FUGA 2SNWA 4D7FA 1WU1A 1EKBB 1O39A 1S6FA 1V3XA 5IYTA 1BRUP 3MU8A 2PKAA 1GGDB 1YYY1 3OSYA 3PV2A 6ESTA 1FDPA 4TY6A 5DSFA 3OAAD 1FN8A 2Z94A 5GNDA 2AERH 3U28C 1AO5A 2D2DA 4INKA 1BTYA 5E2OA 2G4UA 5E8EH 1Z1IA 2ZTYA 5ESBA 1H8IH 4MPUA 2Y82A 3ZZBA 4INLA 4THNH 2FX6A 1SQAA 3MNSA 2PKSB 1C2EA 1GHBG 2G5NA 1XX9A 2O8MA 2ZCLP 4ZCNA 1T8NA 2O8TA 4JZEH 4AGKA 2P93A 5DP3A 4K8YA 3IG6B 4FVDA 4MNVA 5C5NA 1YBWA 5EG4A 1BTUA 3NZIA 1AUTC 2FOHA 1W14U 2UWPA 1A3BH 4Y8YA 3RC6A 2VIDA 4DIHH 6GCHG 1J16A 2BLWA 8ESTE 1GG6B 2WPLS 3I29A 1AVGH 4BNRA 5GIBA 1GHAF 1INCA 1OPHB 1EZXC 5HGGA 1O36A 1PQ5A 5EIYA 1DUAA 3SV6A 2G52A 1A4WH 1A7SA 3SNCA 1AB9C 2DE8A 2FP7B 1YY3A 4AOQA 3RMNH 7GCHF 3SBKA 1QGFA 4Z0KA 3DSGA 2WINI 4MDSA 1WQSA 1RRKA 1DY9A 2QV1A 3BN9A 4B6EA 2XCFA 1GI2A 1WAYB 3HKIB 3UQVA 2TRMA 1NFYA 1Z8JB 1IHSH 4CRGA 2P16A 2GV7A 3QDZB 3MTYA 4YLUA 3GY6A 3PRDA 3M7QA 1W7GH 1OKXA 3F2GA 2PWXA 4OM9A 1UVSH 2FTMA 1VZQH 2FM2A 1RTKA 1E1QD 3E0PB 3GS9A 3ATKA 1XVOA 4BOHA 4TPIZ 1FLEE 2AGIX 1OX1A 1LKBA 2BOHB 8GCHF 4ZXXH 3RXHA 1KDQB 2O8WA 3PWBA 2BY6X 1AE8H 1V2JT 3Q76A 4INHA 1TMBH 2LNCA 1Z1JA 4MNWA 2A31A 3ZZ7A 2G5VA 2GTBA 1NPMA 2AFQB 2VIOA 1XUIA 1O2WA 1ESBA 3EQ0H 4X2VA 2BB4A 1MMJN 4D8NA 3QZQA 1PQ8A 2WUCA 3R3GB 1NFWA 2ZWLH 2F4LA 1AE5A 3D23A 3RU4E 1KXBA 3UWIA 4DCDA 2ZTZA 1V2VT 3HGPA 1A1RA 4X0WU 2XNIA 4A6LA 2BQ7B 1O2LA 3MO6A 3UTUH 2VWLA 4Y76A 1ZSLA 2FTLE 1SQOA 3Q3KA 1MD7A 1DOJA 1CT0E 1FUJA 1OWJA 2ZDLA 3P8NA 1DX5M 4TYDA 1NS3A 3MNXA 1O2YA 1YM0A 1TOCB 2HNTF 1SGTA 2YMSD 3P92A 2CHAC 2ODPA 3P95A 3FZZA 3F1SB 2UWLA 2XBVA 4J2YB 1O3KA 5DN6D 3P8GA 1YPMH 3LGVA 1EOLA 1WSSH 2JETB 1C1UH 4MG3A 1EJAA 2BM2A 1KXDA 2OQ5A 2ZDKA 3Q00A 1C9TA 1RTLA 1K21H 1BHXF 2GX4A 4IW4E 1OWEA 1K1IA 2LP6A 5FAHA 3PM3A 1EX3A 3TVJB 5ABWA 5L30H 1KLIH 3DUXH 2B8OH 2VVVA 3P17H 5JBTA 1YPLH 3L33A 5FCRA 4NIYA 1TRNA 1AD8H 2HRVA 3M35A 3RM2H 1H8ED 1ID5H 4WH8A 3AASA 4NSVA 3F9GA 3MMGA 1GHVH 1LPZB 5C0TA 2BX4A 1JRSA 3NWUA 4X1PU 5J4SA 1AGJA 2KAIB 3UFAA 3ZZ9A 1CHOG 1F2SE 2A45B 1EZSC 1TNIA 1O2QA 4A1VA 1TNGA 3GCOA 4ZKSU 4H6SB 1SOZA 2A5AA 3SJ9A 1NO9H 4A5TS 3ATIA 5DP8A 1AQ7A 1W11U 3RXAA 1QHRB 1O2SA 2PGQB 1XXFA 4UDWH 4UD9H 5CHAC 5HM9A 4KP0A 3BTME 2BYAX 2PKAB 2ZCKP 2EA3A 3KQEA 1RS0A 1Q2WA 1N8OB 2NU4E 7KMEH 4MPXA 9LPRA 5EW1H 4E05H 1BTXA 2JDID 1L1NA 2G51A 1PQ7A 1HBTH 2PUQH 4HI3A 1TYNA 1AFQC 1J9CH 1F92A 3RMOH 1Z8GA 3BTEE 1UTKA 3FO8D 4K60A 2HPQH 2BY5X 3ZVFA 2F9UA 2ZPRA 2W3KA 1C1SA 1TABE 2VH0A 1N8OC 5E0JA 1DUEA 3BEIB 3MU0A 2Y7XA 1H8DH 2P8OC 2V3HH 3H7OA 2KZ4A 1C2JA 1O3BA 2ULLA 1VITH 4Y11E 4YO9A 2RFKC 3KL6A 3ITIA 3SHCH 5G4BA 1ELVA 1ZPCA 3KYGA 4FVBA 1L4ZA 3LGWA 1QRWA 3ATLA 1O5BB 4DIIH 1SGEE 3LKWA 3RP2A 1LVMA 2B9LA 3ZVBA 4DT4A 1ORFA 4LK4A 1CT4E 1JBUH 1MQ5A 1TNJA 1X7AC 2VIWA 3L3TA 5JPMH 1GI1A 3KQDA 3B8JA 3OEED 3TH4H 2KFWA 4X6PA 5EXMA 1T8MA 1L0ZA 1GI5A 1AN1E 1YLNA 4GSOA 1WXRA 1YKTA 3A8AA 2ZZUH 1CU1A 2NU1E 2FWWA 1LVYA 1C5SA 3UNSA 1D6WA 1DSTA 2K0QA 1HGTH 3E6PH 5GWZA 1SG8B 1ABJH 1Y3YA 3K9XB 1GMHF 1ELGA 1O3CA 4CBNA 4XFQA 4WXIA 1J8AA 5JBAS 1HCGA 2GDDA 2Z9IA 2CN0H 3PTBA 5HIZA 2XBYA 1CQQA 4HZHA 1OXGA 2FEQH 1ARCA 4ABFA 4X1RU 7ESTE 3PWCA 1O2VA 2JJ2D 3PLPA 5FX6A 5C5OA 2XCNA 2ZHDA 2VGCC 2SGPE 1ZGIA 4IN2A 2IJD1 2VIPA 3VXEH 4B76A 1DITH 1UW7A 3QX5H 1QJ6B 3K6ZA 5A0BA 4OGXA 4UFDH 4NFFA 4DVAU 3S7HB 3OY6U 1ZYOA 1UTLM 1TX8A 3MNCA 1BMLA 1SGCA 3GYMA 5DP6A 5GCHG 2BLVA 1W0KD 1G30B 1O2TA 3UR6A 2P3FH 1F0TA 1QTFA 2IPQX 2A7JA 3GCNA 1NRQH 1NU9A 1DWEH 3W1EA 3E90B 3U1IB 1RFNA 2XOKD 1P03A 4U30A 3TK9A 3P70B 3ZZDA 1AZ8A 4BAOB 2VIQA 3GDSA 4ABDA 2ANYA 3BIVH 1QCPA 1QZ8A 2OXSA 1O5DH 4LZ1H 4GVUA 2A5IA 4ZHAA 2Y5HA 2OK5A 2UUJB 1G37A 1TRYA 2ASUB 1WOFA 3QTVH 2VNTA 3SW2B 4UONA 3SYJA 3CS7A 3KQ5A 1QB1A 8GCHG 1SHHB 1G32B 1YF4A 3TK6A 3EDXB 5C1UA 1ANBA 1ANEA 1YCPM 1B0FA 4CRAA 1H4WA 1MZDA 3MU4A 4IGDA 5AFZH 3BTHE 1Y8TA 2LPRA 4ESTE 1BMFD 4AFUA 4OS1A 3VPKA 4FUJA 1O3IA 3EAJA 4XSKU 3A85A 2CXVA 2KCOA 4CRDA 4CBOA 1MTNC 2ZIQH 3TJNA 4AORA 1Z8IB 3N7DA 2Z9LA 4FU9A 3DFJA 1HXFH 3T62A 1GI9B 1GJ9B 3OE7D 1DFPA 4MTBA 3M5MA 2YNBA 2AS9A 1CE5A 2PLXA 1KXFA 1V2KT 1MAYA 3RXGA 2VH6A 5HIYA 2EEKA 3A7TA 2Z9GA 1AIXH 3F0OA 1F0SA 5I25A 1MAXA 1ESAA 3QN7A 3SZEA 1MZAA 2GDEH 2XC4A 4H42U 1MKXK 5T1VA 3F0PA 2Z9KA 1IQKA 1BOQA 1GMDG 4ZXYH 2FS9A 1PPBH 1T7CA 1GJ5H 2CF9H 2OBQA 2W5EA 1QBOA 1CVWH 1LVBA 1H9IE 2F9VA 1MCVA 4YTAA 1DXPA 2J97A 1C1MA 3E3TA 2K1QA 4Q2KA 3LC5A 1WDIA 1FPHH 4A1TA 2FOFA 5FCKA 2XBXA 3C27B 3C1KA 4F55A 1DSUA 1MBQA 3MOCA 1NESE 2ZGXH 3BTWE 3SZNA 1PPZA 2P59A 3ZZ4A 3BIUH 1Y3XA 1IQIA 2XW9A 3PTNA 2OINA 1O31A 5DK1A 2ZPQA 1QURH 3E16B 4Y6DA 2SFAA 1HAPH 3RLWH 4GCHG 1E38B 1UTPA 1LDTT 3CENA 5EQRA 3LPRA 4F48B 9ESTA 2IPHA 1Y5AT 3GDVA 2ZQ1A 3A7WA 2UUYA 2WSSD 2RG3A 2WYJA 1J17T 1TBRH 1C1VH 1YPEH 1ZPZA 2F3CE 1FZZA 4D76A 1GGDC 1TX7A 1FY5A 1ELCA 4U01A 3M5OA 1QFKH 3V12A 2GD4B 1HAGE 1FMGA 2H9EH 2OC7A 5DP5A 3S69A 5T3HA 4D7GA 1W13U 4JZFH 1JRTA 1LMWB 2FDAA 2A0QB 1GJCB 4P02A 1TE0A 3VG8A 2AMDA 3KHVA 3T27A 1OP0A 1K1PA 5A8YA 1HV7A 1GCDA 1O3OA 1YGCH 3S7KB 5DP4A 3ZZ6A 3MO9A 2WYGA 1HAXB 4DURA 3FP6E 1V2OT 5FBEA 5F8TA 5KECA 1TA2A 2BD9A 3LGTA 4HTCH 1JOUB 2A4OA 2ZHFH 3A83A 1C1TA 2GV6A 1OWHA 1HFDA 1C2GA 3TLOA 2XC5A 1MTWA 3KCGH 5HMAA 3PLKA 3F3BA 1C4Y2 2FI4E 3UAIC 1O2XA 1D3TB 1SC8U 1T32A 2WPIS 2GMTC 4YOJA 3V7TA 5IDKA 2P3TB 5T6GA 3RXIA 1ZJKA 2GCTB 5FX5A 1EB1H 3TK5A 1P3CA 1TNHA 1COWD 1N6XA 1SGFG 1ZJDA 5C1XA 2IJOB 3UY9A 1TPPA 5ESTE 4BTUB 2QXGA 1SFIA 1O38A 2OC1A 2RCEA 1XM1A 4MNYA 1TMUH 1FNIA 5JBBS 1VITF 1OWKA 2BZAA 3HPTB 3E91A 1QY6A 1EB2A 3RMMH 2FI3E 2LELA 3SU4A 2A7CA 3S9AA 3T28A 3B9FH 3GCHC 3L6PA 1K9OE 1WYKA 3PRBA 1WBGB 3H09A 5E2PA 3RXRA 2ANWA 1LHCH 2Z9JA 1NFXA 4FU7A 1YCPH 3BTDE 1IQFA 4AG2A 1MTUA 2UWOA 1ZPBA 1S83A 1W10U 3UOUA 2CF8H 1E34B 2C8XB 1YWUA 1PQAA 1TQ0B 2YOLA 1BHXB 5JB9S 1UJ1A 3M3VA 1VR1H 2FOEA 2QA9E 4BXWA 2VWNA 2TGPZ 4R0IA 1JWTA 5EJLA 3LOXA 4CHAC 1QRXA 3MH4A 2HALA 4XOJA 2HLDD 3WY8A 5EODA 4K3JA 1UHBB 1ANCA 2CHAB 1DXWA 2OLGA 3WWBA 4IMQA 1NC6A 2ZHEH 4A7IB 1SGIB 2BD2A 1KIGH 1GJ6A 2ZNKH 2W3IA 2QYIA 3QO6A 2ZPSA 1V2MT 2ZU4A 2HVXA 4Y0YE 3ZZ8A 3ZV8A 1C5UA 1AI8H 3QTOH 2ZU3A 3FZDA 2STBE 1QQUA 1A5IA 3UB0A 4B2BA 1UVTH 2ZDVH 1O2UA 3BSQA 2P95A 5C17A 5GCHF 3TH2H 1QL7A 3GY4A 2ZDAH 1GCTC 3LC3A 5GDSH 3RXBA 4NA9H 2BX3A 3PV4A 5GXPA 4ZROA 3ZVCA 1TGTA 3HK3B 3HATH 2J98A 1CBWC 3GY5A 2CV3A 1SI5H 4ZKNU 5TJXA 2V7QD 1C2KA 1E0FD 5F8XA 4AFZA 2SGQE 4IC6A 1AFEH 1GHWH 1Q3XA 2JH0D 3EGKH 3F2HA 5A09A 1QR3E 2Y7ZA 2BMGB 3QGNB 4Q63A 2RDEA 4CRBA 1EPTC 2G81E 3ATWA 4Y0ZE 4MPVA 1KY9A 5FPSA 4B75A 2F9NA 1O2MA 2WPDD 1C5RA 2P3UB 4ZMAH 1ZSJA 1Y5BT 1NY22 4JYTA 2CJIA 1AFQB 1DS2E 1P10A 3GOVB 3VEQB 4NA7A 3ESTA 3K6YA 5FBIA 4AYYB 3A7XA 1C2LA 4WH6A 1Z7KA 2H5DA 2ZU1A 3BF6H 3KF2A 5JDUB 1EPTA 1SGRE 1ZMNA 3OYPA 3QUMP 1NT1A 1W0YH 1DT2A 1FI8A 1NROH 2V3OH 1FAXA 1P3EA 3KQBA 2OD3B 1EAWA 4BAKB 3A7VA 4NFEA 3R0FA 1O2JA 1KXEA 4DT7B 3N99A 3D65E 1SGNE 3Q3YA 1SQRA 2TPIZ 1H9HE 1MKWH 1SGPE 1GI3A 2A5KA 1HNEE 1S5SA 3PO1C 4SGBE 1YPHE 2OTVA 3ZIAD 3ZV9A 3M37A 3LH3A 1GBEA 4XRNA 2PR3A 2WPJS 1DPOA 1A5GH 4QT8C 1TGBA 5EJ1A 1MKWK 1KSNA 1VCQA 1HJ8A 2QF5A 3RM0H 1L2EA 4GHQA 5SGAE 1YLDA 2VWMA 3ENSB 2BD3A 3TGIE 4I32A 1IQMA 4FU8A 1GI4A 3SV7A 2Q1JA 4YZUA 1PYTD 2Q6GA 3RXKA 4MQAA 2WZQA 1JXPA 1TGSZ 1O5EH 2H2ZA 1P04A 1EP6A 4BTTB 1O32A 3BG4B 5I46H 1RTFB 1P11E 1P9UA 2BHGA 2AEIH 2NU2E 1O30A 4OS6A 5EW2H 2J5UA 4O03A 5LGOA 5FPYA 3LGYA 4JK5A 4BAHB 2FPZA 3GCTG 1ARBA 4NZLA 2QIQA 4ZKOU 3GYLB 1GBTA 2SGAA 2WPHS 3T26A 1P8VC 3RU4D 4ABJA 1TQ7B 1P57B 4OS2A 4AZ2B 5KGOA 4IMZA 2SGEE 3ODFA 3HKJB 3SNBA 2BD4A 3MFJA 5FXLA 2PHBA 3URCA 4NGAH 4Y7BA 1SB1H 4K5ZA 1KXAA 2P94A 2BDAA 5BRRE 1O3MA 1MTVA 1GHAG 2CMYA 3UNRA 1C5LH 1NBME 4FOUC 1GBHA 1CA0C 1RIWC 1C5MD 2J9NA 1Y5UT 3BTTE 5EU8A 5F6MA 1GJDB 2H9TH 6CHAC 4OS5A 1C1PA 1BCUH 2WV9A 1TPSA 5K0HA 2EI7A 3TH3H 4I8LA 1MU6B 1JIMA 4LXBH 3SU2A 3Q77A 1BJVA 1SGYE 5A8ZA 1W0ZU 2D1JA 1SSXA 1P01A 2PUXB 3SJOA 3TPIZ 1A0HB 3MNBA 3N7OA 4CREA 4U2WA 3A8DA 2QXHA 1MQ6A 1J15A 4CH2B 1GI6A 2XBWA 5LPRA 4X6OA 5EPNA 1IQLA 2KR7A 3A81A 1IQHA 2KCPA 1SFQB 2J4IA 4NIWA 2FO9A 1AY6H 1ZGVA 1TMTH 4WY3A 4FUBA 1S84A 1CA0B 1RIWB 4RKJB 2AMQA 1UVOA 1K22H 1N1LA 3AAUA 3RXFA 1U6QA 2TGTA 2W26A 3LIWA 1ELTA 2XC0A 3T2NA 1G3BA 4I8KA 1O2IA 5DO4H 3BV9B 4O97A 1O34A 1ZTJA 1H9LB 1O3DA 1HAHH 4NWLA 3M61U 5A0CA 2D26C 4CRCA 1LO6A 1BBRK 4X8VH 3RXLA 5PTPA 2JH5D 2ODQA 3UIRA 1NM6A 1ZTLA 2ZDNA 3PMAB 1C2FA 3KQCA 1KLJH 2VGCB 4ASUD 1QIXB 1OP2A 1V2NT 2KCAA 1B5GH 1T8OA 1RXPA 1DVAH 1AVXA 2DUCA 3TITA 5HXFA 1BBRH 3SGQE 4KTUA 3I78A 1CA8B 2ESTE 5EGMA 1V2UT 2FX4A 3UOPA 1NTPA 1BRBE 1TB6H 1E79D 1TX6A 1PPFE 3M7UA 1RGQA 1EFRD 3SUEA 2ANMH 1ZHPA 1EASA 2FODA 1P2OA 5C0UA 5B6OA 2C8WB 1O5AB 1IHTH 1AHTH 2FLBH 2XXLA 1EUFA 1BTZA 5DP9A 3ATMA 1CGHA 3FAOA 2OC0A 4PROA 2R2WU 2AHME 2BY7X 2ZEBA 4K1TA 2R0KA 2RA3A 4OS4A 1SLVB 2Q6FA 3PO1B 1MUEB 3AVZA 2GT8A 2SGDE 2BDYA 4Z6AH 2BLQA 3S9BA 2ILNA 3A88A 1OP8A 3I77A 3RXOA 1E1RD 2KAIA 4TT3D 3STJA 2ZCHP 1G3DA 4YT6H 1EJNA 1VITG 2VBCA 2HVYB 3DD2H 1EZUC 2NU0E 1OWIA 4RT1A 4Q7ZA 4Z1MD 1AWFH 1Y3UA 2FYQA 5F03A 5LPEA 2BDHA 1SPJA 2M5TA 4YOGA 4AYVB 1C2HA 1HRTH 4VGCB 3RXCA 1O5CB 1YPJH 2NWNA 1QQ4A 3NUMA 1HJ9A 2OBOA 3RXJA 1D3DB 4MPWA 3A8CA 3FFGA 4GCHF 4K1EA 1UTJA 2BDCA 2F91A 1FN6A 1L1JA 1DDJA 1O3NA 1P06A 3GCTF 3T29A 4D9RA 3LH1A 1UCYH 5F8ZA 1QA7A 2F9BH 1QNJA 2Q6DA 1CHGA 4UE7H 4A92A 1MTSA 3FVFB 1SL3A 1HXEH 1NRPH 1C5PA 1GWAA 2QXIA 3VB3A 1LKAA 4UFFH 4WJG2 3IITA 3SUDA 1O2ZA 2QF4A 1PPGE 1OHHD 1YCPK 3JZ2B 3BEFB 3H7TA 1IOEA 4R8TB 2AGGX 1QBNA 3CNRA 4Q7YA 1EOJA 1WTGH 3SNDA 1L1GA 4RKOB 2R2MB 4NSYA 1PPEE 4OGYA 5DPAA 1VCWA 2C8ZB 3VB5A 3E0NB 1GMDF 3SV2H 1C1QA 3TGKE 3GY2A 5CE1A 3A84A 6CHAB 4ISIH 1TGCA 2Z3CA 1FX0B 2VVUA 2OCVB 3SU5A 3UREA 1XXDA 3FOAA 3RXSA 1F5RA 2BVXH 4M9FA 5K7RA 1OWDA 1VCPA 2BTCE 1EJMA 4RI0A 3QGJA 4NG9H 1SLWB 1FIWA 3E8LA 4ZH8A 2Y81A 3SI4H 4AGJA 3OX7U 5CMXH 2C3SA 3V13A 3PMBB 4GHTA 5T6DA 1C2IA 2CK3D 1ZHMA 3RMLH 3M5LA 4WMFA 1TWXB 1XUFA 1IQGA 2V3MA 1TIOA 4OS7A 4H4FA 4SGAE 4CHAB 1ZSKA 2H5CA 2W7UA 3RLYH 3KIDU 3ZZ5A 5GPIB 3PYHA 1IQNA 1LHEH 4DOQA 4HGCA 4X2XA 1ZRKA 3M5NA 4MVNA 5BPEA 5L2YH 3E1XB 1T31A 2BD8A 2JKHA 3SNAA 4K2YA 1C5TA 3BG4C 4KTCA 8KME2 1CT2E 2EI8A 3DSPA 1QB6A 2PFEA 4X6NA 2QGRA 1C2DA 1V2WT 4NCYA 3SU3A 5C67A 2A32A 4CH8B 3BEUA 2VU8E 2KM0A 1W8BH 2WV5A 3FP7E 2UUFB 2BVRH 3PROA 3UWJH 4TSFD 4AFQA 1TNLA 3B23B 3T25A 3M36A 4TWYA 4UFEH 1KMHB 1BTPA 2ZFQH 2O8LA 1AKSA 1ZRBA 1ZZZA 4ABEA 4KGAA 3OTPA 1UTQA 3SJKA 2ZFSA 3SO3A 5LH8A 4DJZB 2R0LA 1Z71A 1BQYA 4GAWA 3S9CA 1OYTH 1SQTA 1D6RA 4X8TH 1GL1A 2DE9A 4K8BA 1FONA 2EI6A 1GBLA 1O2KA 1Y3WA 1HUTH 2OUAA 1BRCE 3KGPA 1SLXB 1L4DA 2FIRH 4FUCA 3V3MA 4H6TA 2ZP0H 1JIRA 2VINA 1W3CA 5E0GA 5HM2A 3P8OA 1UHBA 3SORA 2V35A 1VGCC 3MU5A 2C8YB 4XBCA 3MH7A 3QZRA 3SJIA 2BY8X 1K2I1 1VJAU 1HAIH 2BQ6B 1NU7B 2BDGA 3RC5A 3F9FA 3SHAH 1GMHG 2AIPA 4WVPE 1FY4A 1G3CA 4Y7AA 4E7RG 3A87A 4JYVH 4K69A 1PFXC 1BTWA 2SNVA 2H9HA 4D9QA 2BXTH 4X8UH 3P6ZB 3P8FA 1HIAA 3LJJA 1QRZA 2Y5GA 2M2AA 3SU0A 1D4PB 1DWDH 1PJPA 1GMCG 3U98H 2ZHQH 1DANH 4KTSA 4VGCC 4ACBA 4KKDA 4XE4A 1TPOA 2VWOA 3TJVA 4WWYA 1MABB 1TALA 2ZO3H 4AB8A 1LPGB 4AC9A 4ASHA 2J92A 1Y3VA 1GBJA 3MI4A 1GJBB 1P2MA 5ETXA 1UTNA 1OSSA 2ZA5A 3ZYDA 1CBWB 1ELDE 5FHTA 4DW2U 4DG4A 1O33A 1B0EA 1SKYE 1UVPA 3BTKE 2BVSH 1ZMJA 1DWCH 3W94A 1GCTB 2QE7D 8LPRA 1AWHB 2OP9A 3IWMA 1MCTA 2J2UA 3OY5U 1P0SH 1DM4B 3SN8A 1EAIA 2XYAA 1QL9A 1LQEA 3SJ8A 3ZZ3A 5FL7D 3NCLA 3M7TA 1KTSB 3FANA 1GI0A 3SNEA 2EY4C 3PB1E 3UQOA 4CRFA 2OQUA 1AVWA 2W7SA 2C93B 3U8OH 2JIZD 1UTMA 2ANKH 4WXVA 1FQ3A 2ZTXA 1C1OA 4I86A 2C4FH 5C2ZA 5EQQA 3GISB 2EC9H 1UK4A 3LGUA 3A7ZA 2GCHF 4TWWA 2A4GA 2QCYA 1V2PT 3O8BA 3BTQE 1HAZB 1THPB 2I6QA 1M9UA 1SHYA 1TGNA 1TLDA 1ELAA 1O3FA 2ZQ2A 3LGIA 1TRMA 3RXEA 3PLBA 1W2KH 3SQEE 3EE0B 2AH4X 2ODYB 4UFGH 1A2CH 3A89A 3F9EA 3RXQA 2GZ7A 4E7NA 3OFND 3VB7A 2F9OA 2FZZA 1LVOA 1UTOA 2QAAA 3BG8A 3PV5A 1C1NA 3EE7A 3QLPH 2PSYA 2BY9X 1C9PA 1CHOF 1GDQA 3EA7A 4XBDA 4YXWD 2GP9B 2Y80A 1HAYB 3N7EA 1H1BA 1E36B 1UK2A 2GKVE 3URDA 2GT7A 2FMJA 1WV7H 5A2MH 3A7YA 1YPGH 1P2QA 3U8TH 2TGAA 3SU6A 1ABIH 3G01A 4I8GA 1YLCA 2ZU5A 1BBRE 5TCAA 2XWAA 2Y5FA 1G36A 1IQJA 1TAWA 1C5VA 1SBWA 3TU7H 4X8SH 1K1LA 1GHXH 2FOGA 3QWCH 4M7GA 3VB6A 2VJ1A 2GMTB 1CGJE 3RXPA 4GUXA 1BRAA 3ZZCA 1CGIE 2JJ1D 4FETA 2VVCA 2ZFFH 1GBIA 2AMPA 1OYQA 1ZLRA 3O8CA 1P05A 2FOBA 4ZAEA 1GI7B 1VKYA 3U9AH 3T5FH 4DGJA 1EAUA 4ABBA 1GBCA 1A0JA 4ABGA 1C5OH 4WMDA 1P2JA 2YNAA 1C5YB 1D3QB 3SOSA 2O9QA 4I33A 2OC8A 1BIOA 4F49A 5C20A 4RSPA 1ELBA 3NK8A 4AFSA 4BANB 5IK2D 2YMSB 1S0RA 1EZQA 1SLUB 1BB0B 4YLQH 5FPTA 1OS8A 1QL8A 2AIQA 5GJ4B 1DE7H 2QC2A 1E37B 3RU4T 3KNXA 5DJ7A 5LPFA 1AKSB 2PV9B 3DA9B 2JH6D 1K1MA 4IBLH 4O9VA 1AB9B 1YP9A 1QB9A 2XNDD 3BTGE 3RXVA 2GVFA 4B2CA 5DGJA 3LDXH 3TGJE 3KEEA 1PPCE 1NBMD 2WHXA 3RUOA 4BAQB 1GG6C 5DKMA 3A82A 3SU1A 1G3EA 4JZDH 2R3YA 2BOKA 1GJ7B 3ZVEA 5E0HA 1C5XB 1LPKB 1E35B 2B7DH 1T8LA 4Y10E 5EXNA 1O2OA 1TNKA 2B5TB 2H6MA 1EP5A 1GBMA 4X2WA 1BT7A 3F6UH 3ZVAA 3DT0H 4IS5A 1KDQA 4JK6A 2L6OA 5C1YA 2PKSC 2ZGJA 4ISOA 1S85A 1D9IA 1CSOE 1P02A 1UCYK 2KCYA 5KEDA 4B2AA 1K1OA 3TJOA 4JMYA 1GBDA 1WQVH 2CGAA 2G4TA 3ELAH 3LONA 5EJZA 5HYOA 3MWIU 4IN1A 1AZZA 1GI8B 2SGFE 2STAE 1C5QA 2PTCE 2PW8H 2FESH 4ABAA 3CP7A 1N6YA 2TIOA 3A8BA 4K1SA 4I8JA 1IQEA 1FXYA 2FS8A 2J34A 2A4RA 2V0BA 3FN8A 2A2XH 4ZHLU 4I31A 1HJAB 4YM9A 2P8OB 1MBMA 2XRCA 5CHBA 1GJ4H 1AMHA 1XVMA 1P9SA 1ETSH 4ZUHA 3V0XA 4ABHA 1O3AA 3VXFH 1BZXE 2J38A 5EQSA 1S6HA 1BA8B 1KLTA 1O3JA 3NKKA 2ZF0H 3ZZAA 1MKXH 1V2ST 4RT0A 1TPAE 2BZ6H 1ELEE 1ETRH 1IAUA 2Z3EA 3S0NA 4NIXA 4ISHH 3LT3A 1P2NA 1B7XB 1GBKA 2FOCA 1OOKB 2GGVB 1EPTB 1HAOH 1O2RA 1O2HA 1P09A 5CDFE 3STIA 7LPRA 3DSOA 1A61H 4JYUH 1GVKB 1AU8A 2B0FA 2WV4A 3ZVDA 1GJ8B 1DWBH 1JMOH 4MLFB 4BTIB 1LTOA 1F5KU 2ZGHA 2QXJA 5C94A 1FY1A 1O3PB 1DLKB 4FXGH 1K28D 3MO3A 2ZG0H 4U32A 4HFPB 1W0JD 1FIZA 2R3UA 7GCHG 5HKKD 3HK6B 3SV8A 1DLEA 2ZI2H 4XBBA 1HB0B 2XTTB 3EA9A 2F43B 1VJ9U 3AW1A 2WPMS 4JZ1A 1C5WB 3A80A 3GY3A 2ZHWH 5JB8S 2FOMB 4J1YA 3GICB 2ZU2A 1NRSH 1SGQE 1F5LA 1GBBA 1THSH 4RN6A 4LOYH 4FUFA 1MH0A 2FLRH 3WW7A 1GL0E 1YPHC 2FOAA 3W95A 1GBFA 1ELFA 3ZVGA 2HOBA 1FY8E 3HGNA 2Z7FE 1ESTA 1PPHE 1ZOMA 5JBCS 1QBVH 2ZFTA 2R9PA 1ETTH 1W7XH 2ZDMA 3D62A 1QJ1B 1XUKA 3MHWU 4I8HA 2A7HA 1J14A 2ZECA 4TPYA 3ODDA 1AUJA 1C4U2 2Z6BD 1NRNH 4B1TA 1TA6A 1NRRH 4CR5A 1LCYA 1O3EA 4O3TA 3RXDA 6GCHF 1C1WH 1HYLA 1GHBF 1O0DH 1TFXA 4Q7XA 1H8HD 2V6NA 3TIUA 2C90B 5J4QA 1WUNH 5AHGH 1ANDA 2RDLA
chains in the Genus database with same CATH topology
1SGDE 2GCHG 3SUGA 4GLYA 1EAXA 3H5CB 3QK1A 1UK3A 1GHYH 1V2LT 1G9IE 1V6DA 1XUJA 1A3EH 1F0UA 4BAMB 3VB4A 3AAVA 4YOIA 4AN7A 2G8TA 1O5FH 2ZC9H 3DHKH 1Z6JH 1GHZA 2ZGCA 4GPGA 1QA0A 1FPCH 1BITA 4AB9A 1BDAA 3FP8E 1NFUA 1C2MA 1O35A 2IN2A 3CS0A 5AF9H 3PMJA 4B73A 1Q31A 4Y79A 1HIAB 2O8UA 1BTHH 2HWLB 1T4VH 2BDIA 3MYWA 4BXSA 1O3LA 4NIVA 4IC5A 1RJXB 4ZHMU 1C5ZB 5C3NA 1HLTH 2D8WA 5EOKA 5T6FA 3O8RA 3VFEA 1FJSA 4AX9H 1ACBE 2VIVA 2J94A 2HPPH 4O3UA 4B74A 4LZ4B 2QN5T 4B71A 1MU8B 1F0RA 1SOTA 1BMNH 3SQHE 2WPKS 5AVDA 2RA0A 2WUBA 2ZKSA 5A0AE 1DICA 1O37A 2F9PA 5TCCA 3TNSA 3LJOA 1O2PA 1Y59T 1O2NA 1DY8A 1NN6A 2Z3DA 1EQ9A 2BQWB 3O8DA 1O2GH 1XKBC 4AG1A 3OTJE 1Z8RA 3UUZA 2BDBA 4NZQA 5DG6A 1GDUA 3OU0A 2A1DB 2H1UA 4Y8XA 1KTTB 1K1JA 1RD3B 4I7YH 1SVPA 1HJAC 1THRH 1Z6EA 2UUKB 1S82A 1P2KA 5CHAB 1UVUH 3EA8A 4E06H 3F68H 1ZR0A 2BXUH 1TOMH 1K1NA 1VGCB 4F4OC 4FUIA 4WMEA 2G00A 4A1XA 4DY7B 1ZTKA 4X2YA 4Q80A 2A2QH 1UO6A 3K65B 2TGDA 4NA8A 1O3HA 5EXLA 1G2MA 1PYTC 2NU3E 2Y6TA 3MH6A 4X6MA 3SUFA 1KXCA 3U8RH 4UEHH 2ALVA 1W12U 2IOTA 2THFB 2HLCA 1P2IA 1O3GA 4JCNA 2BLOA 1GMCF 2HNTE 1LHFH 1FY3A 3TJUA 1ZHRA 2GZ8A 2AGEX 4Y8ZA 4YESB 1EATA 3U1JB 4Y71A 4ISLA 1T4UH 1TBQH 1TBZH 3RC4A 1HDTH 2PSXA 3GY8A 4MNXA 3PMHB 4CR9A 1KYNA 1S81A 2VB0A 1LQDB 1XMNB 2J95A 2A4QA 1GVLA 1FAKH 4X1SU 1WTHD 4XDEA 3KN2A 2ZFPH 1HAVB 2JETC 4X1QU 4FUEA 4YT7H 4X1NU 1G2LA 1C4V2 3JZ1B 3TNTA 3AW0A 2G55A 1TONA 4JZIA 1NZQH 2BD5A 2FYRA 2TBSA 1D3PB 1V2RT 1GVZA 5L2ZH 2QF0A 3MH5A 3NPSA 3NXPA 2BD7A 1XUGA 1CO7E 1GDNA 3ZYEA 1MD8A 2ALPA 3GY7A 2QF3A 1A46H 1V2TT 3SI3H 2ZGBH 1SGFA 3LU9B 3M3TA 3VGCB 1A5HA 4WF8A 1V2QT 3UNQA 1XKAC 2PGBB 3Q3XA 4FUHA 3GCHB 2XWBI 3UR9A 1P12E 1EXFA 2AYWA 1MTNB 1QJ7B 4NWKA 5AFYH 1GPZA 2QY0B 3D49H 2HNTC 1HAVA 5H4IB 1XUHA 4FUDA 4KELA 3RXUA 1LHGH 1ZMLA 1LHDH 5A8XA 1UMAH 3A86A 1FV9A 3DFLA 1C1RA 1BMMH 2GCTC 5L6NH 3MU1A 1S0QA 2PTNA 4ZKRU 1C5NH 3SGBE 3F9HA 1SR5C 1BJUA 2FI5E 2I6SA 3M3SA 4ABIA 1O5GH 2HGTH 3RXMA 2ZFRH 5JYIA 1GJAB 1GBAA 1YC0A 1HPGA 1BMAA 1UCYE 3K2UA 3EYDA 4ISNA 5DP7A 3GDUA 1A0LA 1BUIA 2F83A 3U69H 1F7ZA 3RXTA 3SGAE 2GZ9A 3RDZA 3VGCC 1SMFE 3BTFE 6LPRA 1YPKH 3UPEA 3SV9A 4TY7A 5EPYA 2FXRA 1WCZA 4FUGA 2SNWA 4D7FA 1WU1A 1EKBB 1O39A 1S6FA 1V3XA 5IYTA 1BRUP 3MU8A 2PKAA 1GGDB 1YYY1 3OSYA 6ESTA 1FDPA 4TY6A 1FN8A 2Z94A 2AERH 1AO5A 2D2DA 4INKA 1BTYA 5E2OA 2G4UA 5E8EH 1Z1IA 2ZTYA 5ESBA 1H8IH 4MPUA 2Y82A 3ZZBA 4INLA 4THNH 2FX6A 1SQAA 3MNSA 2PKSB 1C2EA 1GHBG 2G5NA 1XX9A 2O8MA 2ZCLP 1T8NA 2O8TA 4JZEH 4AGKA 2P93A 5DP3A 4K8YA 3IG6B 4FVDA 4MNVA 5C5NA 1YBWA 5EG4A 1BTUA 3NZIA 1AUTC 2FOHA 1W14U 2UWPA 1A3BH 4Y8YA 3RC6A 2VIDA 4DIHH 6GCHG 1J16A 2BLWA 8ESTE 1GG6B 2WPLS 3I29A 1AVGH 4BNRA 5GIBA 1GHAF 1INCA 1OPHB 1EZXC 5HGGA 1O36A 1PQ5A 1DUAA 3SV6A 2G52A 1A4WH 1A7SA 3SNCA 1AB9C 2DE8A 2FP7B 4AOQA 3RMNH 7GCHF 3SBKA 1QGFA 4Z0KA 2WINI 4MDSA 1WQSA 1RRKA 1DY9A 2QV1A 3BN9A 2XCFA 1GI2A 1WAYB 3HKIB 3UQVA 2TRMA 1NFYA 1Z8JB 1IHSH 4CRGA 2P16A 2GV7A 3QDZB 3MTYA 4YLUA 3GY6A 3M7QA 1W7GH 1OKXA 2PWXA 1UVSH 2FTMA 1VZQH 2FM2A 1RTKA 3E0PB 3ATKA 1XVOA 4BOHA 4TPIZ 1FLEE 2AGIX 1OX1A 1LKBA 2BOHB 8GCHF 4ZXXH 3RXHA 1KDQB 2O8WA 3PWBA 2BY6X 1AE8H 1V2JT 3Q76A 4INHA 1TMBH 2LNCA 1Z1JA 4MNWA 2A31A 3ZZ7A 2G5VA 2GTBA 1NPMA 2AFQB 2VIOA 1XUIA 1O2WA 1ESBA 3EQ0H 4X2VA 2BB4A 1MMJN 4D8NA 3QZQA 1PQ8A 2WUCA 3R3GB 1NFWA 2ZWLH 1AE5A 3D23A 3RU4E 1KXBA 3UWIA 4DCDA 2ZTZA 1V2VT 3HGPA 1A1RA 4X0WU 2XNIA 4A6LA 2BQ7B 1O2LA 3MO6A 3UTUH 2VWLA 4Y76A 1ZSLA 2FTLE 1SQOA 3Q3KA 1MD7A 1DOJA 1CT0E 1FUJA 1OWJA 2ZDLA 3P8NA 1DX5M 4TYDA 1NS3A 3MNXA 1O2YA 1YM0A 1TOCB 2HNTF 1SGTA 3P92A 2CHAC 2ODPA 3P95A 3FZZA 3F1SB 2UWLA 2XBVA 4J2YB 1O3KA 3P8GA 1YPMH 3LGVA 1EOLA 1WSSH 2JETB 1C1UH 4MG3A 1EJAA 2BM2A 1KXDA 2OQ5A 2ZDKA 3Q00A 1C9TA 1RTLA 1K21H 1BHXF 2GX4A 4IW4E 1OWEA 1K1IA 5FAHA 3PM3A 1EX3A 3TVJB 5ABWA 5L30H 1KLIH 3DUXH 2B8OH 2VVVA 3P17H 5JBTA 1YPLH 3L33A 5FCRA 4NIYA 1TRNA 1AD8H 2HRVA 3M35A 3RM2H 1ID5H 4WH8A 3AASA 4NSVA 3F9GA 3MMGA 1GHVH 1LPZB 2BX4A 1JRSA 3NWUA 4X1PU 5J4SA 1AGJA 2KAIB 3UFAA 3ZZ9A 1CHOG 1F2SE 2A45B 1EZSC 1TNIA 1O2QA 4A1VA 1TNGA 3GCOA 4ZKSU 4H6SB 1SOZA 2A5AA 3SJ9A 1NO9H 4A5TS 3ATIA 5DP8A 1AQ7A 1W11U 3RXAA 1QHRB 1O2SA 2PGQB 1XXFA 4UDWH 4UD9H 5CHAC 5HM9A 4KP0A 3BTME 2BYAX 2PKAB 2ZCKP 2EA3A 3KQEA 1RS0A 1Q2WA 1N8OB 2NU4E 7KMEH 4MPXA 9LPRA 5EW1H 4E05H 1BTXA 1L1NA 2G51A 1PQ7A 1HBTH 2PUQH 4HI3A 1TYNA 1AFQC 1J9CH 1F92A 3RMOH 1Z8GA 3BTEE 1UTKA 4K60A 2HPQH 2BY5X 3ZVFA 2F9UA 2ZPRA 2W3KA 1C1SA 1TABE 2VH0A 1N8OC 5E0JA 1DUEA 3BEIB 3MU0A 2Y7XA 1H8DH 2P8OC 2V3HH 3H7OA 1C2JA 1O3BA 2ULLA 1VITH 4Y11E 4YO9A 3KL6A 3ITIA 3SHCH 5G4BA 1ELVA 1ZPCA 4FVBA 1L4ZA 3LGWA 1QRWA 3ATLA 1O5BB 4DIIH 1SGEE 3LKWA 3RP2A 1LVMA 2B9LA 3ZVBA 1ORFA 4LK4A 1CT4E 1JBUH 1MQ5A 1TNJA 1X7AC 2VIWA 3L3TA 5JPMH 1GI1A 3KQDA 3B8JA 3TH4H 4X6PA 5EXMA 1T8MA 1L0ZA 1GI5A 1AN1E 4GSOA 1YKTA 3A8AA 2ZZUH 1CU1A 2NU1E 2FWWA 1LVYA 1C5SA 3UNSA 1D6WA 1DSTA 1HGTH 3E6PH 5GWZA 1SG8B 1ABJH 1Y3YA 3K9XB 1GMHF 1ELGA 1O3CA 4CBNA 4XFQA 4WXIA 1J8AA 5JBAS 1HCGA 2GDDA 2Z9IA 2CN0H 3PTBA 2XBYA 1CQQA 4HZHA 1OXGA 2FEQH 1ARCA 4ABFA 4X1RU 7ESTE 3PWCA 1O2VA 5FX6A 3PLPA 5C5OA 2XCNA 2ZHDA 2VGCC 2SGPE 1ZGIA 4IN2A 3VXEH 2VIPA 4B76A 1DITH 3QX5H 1QJ6B 3K6ZA 5A0BA 4OGXA 4UFDH 4NFFA 4DVAU 3S7HB 3OY6U 1ZYOA 1UTLM 1TX8A 3MNCA 1BMLA 1SGCA 3GYMA 5DP6A 5GCHG 2BLVA 1G30B 1O2TA 3UR6A 2P3FH 1F0TA 1QTFA 2A7JA 3GCNA 1NRQH 1NU9A 1DWEH 3E90B 3U1IB 1RFNA 1P03A 4U30A 3TK9A 3P70B 3ZZDA 1AZ8A 4BAOB 2VIQA 3GDSA 4ABDA 2ANYA 3BIVH 1QCPA 2OXSA 1O5DH 4LZ1H 4GVUA 2A5IA 4ZHAA 2Y5HA 2UUJB 1G37A 1TRYA 2ASUB 1WOFA 3QTVH 2VNTA 3SW2B 4UONA 3CS7A 1QB1A 8GCHG 1SHHB 1G32B 1YF4A 3TK6A 3EDXB 5C1UA 1ANBA 1ANEA 1YCPM 1B0FA 4CRAA 1H4WA 1MZDA 3MU4A 4IGDA 5AFZH 3BTHE 1Y8TA 2LPRA 4ESTE 4AFUA 4OS1A 3VPKA 4FUJA 1O3IA 3EAJA 4XSKU 3A85A 2CXVA 4CRDA 4CBOA 1MTNC 2ZIQH 3TJNA 4AORA 1Z8IB 2Z9LA 4FU9A 3DFJA 1HXFH 3T62A 1GI9B 1GJ9B 1DFPA 4MTBA 3M5MA 2YNBA 2AS9A 1CE5A 2PLXA 1KXFA 1V2KT 1MAYA 3RXGA 2VH6A 2EEKA 3A7TA 2Z9GA 1AIXH 1F0SA 5I25A 1MAXA 1ESAA 3QN7A 1MZAA 2GDEH 2XC4A 4H42U 1MKXK 2Z9KA 1IQKA 1BOQA 1GMDG 4ZXYH 2FS9A 1PPBH 1T7CA 1GJ5H 2CF9H 2W5EA 2OBQA 1QBOA 1CVWH 1LVBA 1H9IE 2F9VA 1MCVA 4YTAA 1DXPA 1C1MA 3E3TA 2K1QA 4Q2KA 3LC5A 1FPHH 4A1TA 2FOFA 5FCKA 2XBXA 3C27B 3C1KA 1DSUA 1MBQA 3MOCA 1NESE 2ZGXH 3BTWE 3SZNA 1PPZA 2P59A 3ZZ4A 3BIUH 1Y3XA 1IQIA 2XW9A 3PTNA 2OINA 1O31A 5DK1A 2ZPQA 1QURH 3E16B 4Y6DA 2SFAA 1HAPH 3RLWH 4GCHG 1E38B 1UTPA 1LDTT 3CENA 5EQRA 3LPRA 9ESTA 2IPHA 1Y5AT 3GDVA 2ZQ1A 3A7WA 2UUYA 2RG3A 2WYJA 1J17T 1TBRH 1C1VH 1YPEH 1ZPZA 2F3CE 1FZZA 4D76A 1GGDC 1TX7A 1FY5A 1ELCA 4U01A 3M5OA 1QFKH 3V12A 2GD4B 1HAGE 1FMGA 2H9EH 2OC7A 5DP5A 3S69A 5T3HA 4D7GA 1W13U 4JZFH 1JRTA 1LMWB 2FDAA 2A0QB 1GJCB 1TE0A 2AMDA 3KHVA 3T27A 1OP0A 1K1PA 5A8YA 1HV7A 1GCDA 1O3OA 1YGCH 3S7KB 5DP4A 3ZZ6A 3MO9A 2WYGA 1HAXB 4DURA 3FP6E 1V2OT 5FBEA 5F8TA 1TA2A 2BD9A 3LGTA 4HTCH 1JOUB 2A4OA 2ZHFH 3A83A 1C1TA 2GV6A 1OWHA 1HFDA 1C2GA 3TLOA 2XC5A 1MTWA 3KCGH 5HMAA 3PLKA 1C4Y2 2FI4E 1O2XA 1D3TB 1SC8U 1T32A 2WPIS 2GMTC 4YOJA 3V7TA 5IDKA 2P3TB 5T6GA 3RXIA 1ZJKA 2GCTB 5FX5A 1EB1H 3TK5A 1P3CA 1TNHA 1N6XA 1SGFG 1ZJDA 5C1XA 2IJOB 3UY9A 1TPPA 5ESTE 4BTUB 2QXGA 1SFIA 1O38A 2OC1A 2RCEA 1XM1A 4MNYA 1TMUH 1FNIA 5JBBS 1VITF 1OWKA 2BZAA 3HPTB 3E91A 1QY6A 1EB2A 3RMMH 2FI3E 3SU4A 2A7CA 3S9AA 3T28A 3B9FH 3GCHC 3L6PA 1K9OE 1WYKA 1WBGB 5E2PA 3RXRA 2ANWA 1LHCH 2Z9JA 1NFXA 4FU7A 1YCPH 3BTDE 1IQFA 4AG2A 1MTUA 2UWOA 1ZPBA 1S83A 1W10U 3UOUA 2CF8H 1E34B 2C8XB 1PQAA 1TQ0B 2YOLA 1BHXB 5JB9S 1UJ1A 3M3VA 1VR1H 2FOEA 2QA9E 4BXWA 2VWNA 2TGPZ 4R0IA 1JWTA 3LOXA 4CHAC 1QRXA 3MH4A 2HALA 4XOJA 3WY8A 5EODA 4K3JA 1UHBB 1ANCA 2CHAB 1DXWA 2OLGA 4IMQA 1NC6A 2ZHEH 4A7IB 1SGIB 2BD2A 1KIGH 1GJ6A 2ZNKH 2W3IA 2QYIA 3QO6A 2ZPSA 1V2MT 2ZU4A 2HVXA 4Y0YE 3ZZ8A 3ZV8A 1C5UA 1AI8H 3QTOH 2ZU3A 3FZDA 2STBE 1QQUA 1A5IA 4B2BA 1UVTH 2ZDVH 1O2UA 3BSQA 2P95A 5GCHF 3TH2H 1QL7A 3GY4A 2ZDAH 1GCTC 3LC3A 5GDSH 3RXBA 4NA9H 2BX3A 3PV4A 5GXPA 4ZROA 3ZVCA 1TGTA