1NESE

Structure of the product complex of acetyl-ala-pro-ala with porcine pancreatic elastase at 1.65 angstroms resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE
publication title Structure of the product complex of acetyl-Ala-Pro-Ala with porcine pancreatic elastase at 1.65 A resolution.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 59
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1995-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1nesE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1nesE01
1DT2A 1ZRBA 3JZ1B 1MBQA 1TGSZ 3BEFB 1Y8TA 3RXDA 4X8UH 1DY9A 1NRSH 2Y81A 4MVNA 1PYTD 1TRMA 1ZGVA 1XUGA 1XUKA 1LVYA 1JMOH 3A82A 8LPRA 1BBRH 2FYQA 4F49A 1DVAH 3A7ZA 3RM2H 4A92A 1QJ7B 4K8BA 1N8OB 1K1PA 3BIUH 3DFJA 5AFYH 1HPGA 4Y79A 1BRBE 3RMMH 3SJ8A 1V2JT 1HAPH 1BT7A 3RDZA 3UQOA 3OYPA 3D65E 1AIXH 5EODA 1KSNA 4X2WA 1W0YH 3URDA 2W7SA 2R0KA 3KCGH 4FVDA 2GVFA 1GBMA 5A0BA 4DGJA 1VITG 4KP0A 1QY6A 5C67A 1C2JA 7GCHG 1FY8E 1P2MA 1GMCF 3P6ZB 1GBLA 5L2YH 5A0CA 1W3CA 4AZ2B 4FUJA 4Y10E 4LK4A 4X6PA 3EQ0H 4JYVH 1GHZA 1O5AB 2GDDA 2WV4A 2BXTH 1C4Y2 1QA0A 3OSYA 1P9UA 2O8UA 4KELA 1JRTA 1HJAB 5DO4H 3Q3XA 4IW4E 2G55A 1KLTA 1XUHA 3DD2H 2ZECA 3TK5A 3SNAA 2A4RA 2CMYA 1F0SA 1DY8A 2A7HA 2ZP0H 1WUNH 4FUCA 3ODDA 4YOGA 2ZNKH 1HYLA 3DHKH 1T8LA 3QDZB 4D9QA 5I46H 4X2YA 1X7AC 1ID5H 1JOUB 1JWTA 1HAGE 4LOYH 4AFSA 3EYDA 1OP2A 1WTHD 1DSTA 4X6OA 2FTMA 1BRCE 4K60A 1V2RT 1A46H 4D7FA 1O3IA 3UREA 3NZIA 3F9FA 2GMTC 3S69A 3RXFA 3F68H 4AFZA 3PLKA 2QXIA 1FN6A 4OS1A 3RXSA 3GY8A 4I7YH 5JBBS 2OQ5A 1G30B 4K1TA 1DWBH 1SG8B 2OC1A 1UVSH 1BIOA 3KQDA 3ZVDA 1AKSB 3QUMP 4BAOB 4X0WU 3SJOA 3V7TA 3ZVEA 4ISHH 1OX1A 1PQ5A 3IITA 1ZSJA 3D23A 1GJ5H 1AB9C 2P3TB 1UTQA 4MNYA 5JB8S 4FU8A 4CRGA 1O30A 1AFQC 3K65B 4Y8ZA 1RTLA 3NPSA 3TNSA 2FMJA 4ZKOU 3MU5A 1M9UA 3RM0H 5FAHA 1QQUA 1Z1IA 1WAYB 3MNBA 1Y5UT 3BF6H 3U8OH 1W11U 4GAWA 2FOFA 2XNIA 3A87A 3DFLA 3Q3YA 4O3UA 4CBOA 2UUJB 1ETSH 1KXEA 5G4BA 3F9GA 1GI6A 2ALPA 1F0UA 1UCYK 3FP8E 3ITIA 1YYY1 1ANEA 4MNVA 5GWZA 3ZVAA 1QHRB 4ABDA 3LGIA 1TMTH 3ESTA 1VITF 4I8GA 2BX3A 3K9XB 7GCHF 1PFXC 1LKBA 1ZJDA 2BY7X 1Z6JH 3B8JA 3L3TA 2A0QB 7KMEH 3A8AA 2NU2E 1O39A 4LZ1H 1JIMA 1HRTH 1XMNB 5HYOA 1GJCB 4BAKB 1D3PB 4BNRA 1AI8H 2QXJA 1G3BA 3SHAH 1HXFH 1YLCA 2A5IA 3Q3KA 3SNBA 1O3KA 1ANDA 1Q31A 2CF9H 2IJOB 1SOZA 2HNTF 1HAZB 4CRBA 1W12U 3UPEA 4UDWH 4JZDH 4ABHA 1J8AA 5JBCS 2B5TB 1MKWH 5EOKA 5E0HA 3SNCA 1J16A 1FY1A 1BCUH 2VH6A 3K6YA 3NXPA 4Y71A 2ALVA 2P16A 4MPVA 3UOPA 1CT4E 2B9LA 3PV4A 1P12E 2H2ZA 5F6MA 2OCVB 1Z7KA 3UTUH 1OWKA 5CHAC 1ZPBA 1YPJH 1SLUB 1AB9B 4AORA 1CVWH 3GY4A 4TY6A 3BTME 4Y8YA 1C2HA 1TE0A 4AN7A 2ZFSA 1AFQB 1EQ9A 3STIA 2O8TA 3ZZ5A 2OTVA 2UUYA 5FBEA 5EPNA 1ACBE 5ESBA 4I32A 5EGMA 1SGCA 3RXAA 3TH2H 2JH5D 5TCAA 1HAVA 5F8TA 1SGRE 1O2WA 1PQ8A 1TOCB 2Z9IA 4AG1A 2AIPA 1D4PB 1ESTA 2WPMS 3Q77A 3LPRA 1OP8A 1O5DH 4X1QU 4B2CA 3SUFA 3LGYA 4X1RU 3T2NA 3SU6A 2GD4B 3H5CB 3AW0A 1SBWA 1GBTA 1QGFA 2ZQ2A 2ZDVH 4LZ4B 2Y5HA 2AGEX 2Y82A 4HFPB 1O37A 1XXFA 2AEIH 2ZDKA 2PSYA 5B6OA 2GDEH 1GDNA 3UIRA 1EAWA 4JZEH 3SV7A 3RMLH 4Y8XA 1MKWK 1TNKA 1TPSA 4CREA 3HKIB 1ELDE 1MU8B 1DE7H 1RJXB 1P0SH 1ELTA 1F0RA 1P09A 4ABIA 1LQDB 4BOHA 1CA8B 3RXOA 3A8CA 4BAQB 3HGPA 1EZQA 1O3HA 4FUFA 2BDGA 2ILNA 4NG9H 1O32A 5CHAB 2R3YA 1MD8A 2C8ZB 4Q7XA 4YOIA 4BANB 3ZZDA 3KL6A 4KTCA 2XC0A 1W14U 3PMJA 1LHFH 2BZAA 1A5GH 4CRAA 4MPWA 1QQ4A 2AS9A 1BB0B 4X1PU 2WUBA 1T32A 1DUAA 3TJNA 1GL1A 3B9FH 1RXPA 2QY0B 2XWAA 3V3MA 2VINA 2G5NA 1HUTH 4UE7H 3SU1A 1INCA 1UJ1A 1ARCA 2OBQA 2A2XH 1C1NA 2CHAB 3SJIA 3UUZA 1L4ZA 3L6PA 1QB1A 1FMGA 2Y5GA 6CHAC 1O2XA 3SV2H 5F03A 5I25A 1NZQH 2SGAA 3TK6A 1IOEA 2P8OC 5JDUB 2ZPRA 1EOJA 1IQEA 1D6WA 3LDXH 1N6XA 3TVJB 1E37B 5L6NH 2HGTH 2HOBA 2XBVA 1UHBB 4VGCC 2SNVA 1BTHH 3V0XA 4GVUA 4ISNA 2ZDMA 3TNTA 2ZU3A 1NRRH 4ZHAA 1GBBA 1V2LT 1TALA 1IQGA 1K9OE 1HLTH 2FESH 2I6QA 1DWCH 4KTUA 4UONA 2OQUA 2FS9A 3VXEH 1GBCA 1QCPA 1YPLH 2VIOA 3EDXB 5C2ZA 1L1NA 1NFUA 3GYLB 3EA7A 1BZXE 1C1OA 2ZF0H 1ELFA 1C4V2 1TWXB 5GDSH 4F4OC 1MAYA 1ZOMA 4Y76A 3BG4B 4FU9A 5GJ4B 1TPAE 3AW1A 2BD2A 4GHQA 1A4WH 1O2UA 3FFGA 2P3FH 3O8CA 2DUCA 2BOKA 3ENSB 1AU8A 4UFDH 3PLPA 2OP9A 2QF0A 1G32B 1QB9A 1NRQH 1O3GA 2Y7XA 2C3SA 4UEHH 2CV3A 1QJ6B 1V2QT 2OBOA 2PKSC 1GCTC 3QTVH 4FUGA 1TRYA 1EUFA 2AMDA 1VR1H 2PKAB 2TGDA 4JZFH 4K1EA 1IQKA 3LKWA 3SUGA 1XUJA 1O5FH 1Z8GA 2BD7A 1FDPA 4NZLA 4ZXXH 2Y6TA 3SU3A 2TGPZ 6CHAB 4AB8A 1MCTA 4GSOA 4ZHLU 2P8OB 1MKXH 3LGWA 3GCHC 3PLBA 2ZU1A 4ZKNU 2V35A 4H6SB 1TLDA 3FANA 5DP4A 4DG4A 4QT8C 3U8RH 1AUTC 1BJVA 2D8WA 3V12A 1O5EH 1QURH 3TH3H 1KXDA 1QNJA 2ZGXH 4OS4A 1O2ZA 3VB7A 1GBJA 3GICB 1PJPA 5DP3A 4XOJA 1H9IE 3MNCA 4O03A 2FI4E 2Z9JA 4ABBA 5AFZH 1O33A 1V2ST 3M7QA 1TGNA 2HPQH 2ZG0H 3VB5A 4D9RA 1EZXC 1MQ6A 4O3TA 4CRCA 4THNH 2PTCE 3LIWA 1GG6C 4X2XA 4I8HA 4NSYA 1YPKH 2BY9X 1GBFA 1PQAA 2F9NA 3GY6A 3H7TA 2BY5X 3GYMA 4MPXA 1GI3A 1P11E 1RIWC 3MU8A 2Q1JA 2A5AA 4Z0KA 3UFAA 1B7XB 1IQMA 2J9NA 1D6RA 1AWHB 4WH6A 1WU1A 4K2YA 1O2HA 3RC6A 3P92A 1O2LA 3TIUA 3QO6A 4B73A 1OSSA 3A7VA 1TX7A 1QL8A 1FN8A 1DXWA 1KDQA 1YCPK 3RU4E 2FM2A 1MD7A 1DM4B 1IQNA 3MO6A 3ZV8A 1S5SA 2PKSB 1GCTB 3K6ZA 3PWCA 4GPGA 1PPZA 4NIXA 3PTBA 1ZTJA 1O5CB 3ZZBA 4DW2U 1HAVB 1JIRA 5EXMA 1G2MA 1UTKA 4WVPE 1RFNA 1GMHG 1GJ6A 1LHCH 2FO9A 4NIWA 4K5ZA 1THPB 1UMAH 2GKVE 3KGPA 3O8BA 2BDHA 3SV8A 3SQEE 1OP0A 3GCHB 2OUAA 2C8WB 2QYIA 5A8ZA 1U6QA 1MTVA 2J38A 2XWBI 3ZZAA 2ZGJA 3S7HB 3V13A 2B0FA 2W5EA 1DOJA 2FEQH 4XBCA 3C1KA 4IN2A 1J14A 1GDQA 3HK3B 2AIQA 4ASHA 2FOEA 1EX3A 1S84A 2PSXA 3WY8A 5JBAS 1K1JA 3UR9A 2G00A 5A8XA 1J9CH 2JH0D 2C8YB 2QXHA 1TRNA 2QN5T 4XBDA 1F5LA 2QV1A 3LGTA 2WYGA 1G37A 3TH4H 1Y5AT 4X1NU 4OS6A 2TIOA 1GI2A 3VFEA 2G5VA 3KQBA 4Q2KA 1MBMA 3F9HA 2AMPA 3RLYH 5C1UA 1BTZA 1UK2A 2TGAA 1MUEB 1SQTA 2ZIQH 3IG6B 3LH3A 1HBTH 3RXQA 5FX6A 1LVOA 4MG3A 1OWHA 1GL0E 2QC2A 4MDSA 1Q2WA 1A0LA 2BD5A 2NU3E 1GBHA 3CP7A 3QN7A 2FODA 2F9VA 4B74A 4DY7B 4SGBE 1QA7A 1XKBC 1F7ZA 5E2OA 1IQIA 2A4OA 4B71A 2ZHWH 1RRKA 2QA9E 2BQWB 5E0GA 1AHTH 1C1QA 1T8NA 3MOCA 2J4IA 1YC0A 2RG3A 2A1DB 1ZPZA 3E16B 2VIPA 3SV6A 1V2UT 2CN0H 1HAOH 2Z6BD 3UNSA 1UVTH 5DP6A 4MQAA 1BTWA 1EPTA 7LPRA 1ETTH 4TYDA 1LHEH 4ABGA 4FU7A 1NM6A 1V3XA 1BHXB 1Z8RA 1WOFA 1LTOA 1QBNA 1F2SE 1GMHF 1CA0C 2D2DA 1NFWA 1WYKA 1P10A 2PGQB 5CE1A 4A7IB 3R0FA 2PUQH 2PW8H 4ZXYH 1WQVH 1SGYE 2XC4A 1UCYH 1A0JA 2FDAA 2SGPE 1OS8A 1GI8B 4U2WA 3SU2A 3E1XB 1L1JA 1DLEA 1C4U2 1C5NH 1SGDE 4D76A 1ELVA 1GBDA 2ODQA 4AYVB 4ZHMU 1SI5H 3M5OA 1ELBA 3LC3A 1CHOG 1O2IA 3GISB 1YKTA 3PO1B 4YO9A 3F9EA 3A7TA 3M35A 4YTAA 1KXAA 1P2IA 1FY4A 3RUOA 1V6DA 1O2VA 1EAXA 1BTUA 5LH8A 1DFPA 1YLDA 1CQQA 3E91A 1MMJN 3SORA 2ASUB 3SQHE 1KXBA 4XSKU 1VCPA 1ANBA 2STBE 2A45B 2AGIX 1TX8A 1D9IA 1O3MA 1O2YA 1ZYOA 1LMWB 2ZZUH 4GHTA 4OS2A 4U01A 5FXLA 3ZVBA 3RXMA 2O9QA 3E0PB 2YOLA 3UNQA 1BOQA 1C1VH 4BTIB 4LXBH 4UD9H 4Z6AH 2UUFB 2ZFRH 3Q00A 4TPIZ 4B75A 5FCRA 4WXVA 3ATLA 2P95A 3RC4A 4K3JA 4D7GA 1DITH 5JPMH 1MU6B 2BD8A 2JKHA 1FY3A 2XXLA 3A8BA 1CA0B 1C2GA 1MTUA 2BLOA 1ZMLA 3FVFB 1VGCC 4I31A 1UTNA 2I6SA 3GCOA 1QTFA 3OX7U 1A0HB 1OPHB 2F3CE 2TPIZ 1LHDH 1CT2E 2BY6X 4KGAA 5EPYA 4HGCA 1RGQA 2F83A 2AFQB 2ESTE 5LPEA 1ZMJA 5DJ7A 4WF8A 4WH8A 1J15A 1GCDA 2BDAA 5A0AE 1BUIA 5GPIB 2H9TH 1A3EH 3A83A 2AYWA 1TA2A 2BOHB 1ANCA 2GMTB 3GDSA 2ZEBA 2DE9A 1K1LA 2ZHEH 1QR3E 4E7NA 2BD9A 3GOVB 1C5ZB 1CHGA 1SGFA 3S7KB 1QRXA 1ZPCA 1GJBB 1XKAC 1CHOF 1NRNH 2ULLA 3SV9A 1GPZA 2XCFA 3HATH 2BLVA 4JK5A 2FOHA 4CR5A 2O8WA 2UUKB 1HFDA 1A5IA 1RS0A 1WV7H 1C1MA 2ZFPH 1TBQH 4YLUA 3A85A 3KEEA 4ISLA 1MTNC 2VNTA 4CH8B 3FP7E 3RXUA 2HNTC 1O2OA 1TONA 3M3TA 2ANWA 3F6UH 3MU1A 1SGFG 3D49H 1NT1A 4K8YA 1AMHA 3QWCH 2ZHQH 4MPUA 2VVCA 1HIAB 3TJOA 5T3HA 1HCGA 2J95A 1RTFB 5SGAE 1V2PT 4ISIH 1QIXB 1C5LH 1V2NT 2Y7ZA 2V0BA 1GVZA 3ZVGA 5DP8A 5F8XA 2FLBH 4TPYA 2NU4E 4DT7B 5C1YA 2VWLA 2FXRA 1AO5A 3U98H 1ELEE 1Q3XA 3SJKA 1OYQA 3M3SA 3ZYEA 3RMNH 3AVZA 5FBIA 5HM2A 1GHYH 4B1TA 1CGHA 1L2EA 3HGNA 1EJMA 5FPTA 1A1RA 2GCHG 1RD3B 1TB6H 3P95A 2ZFTA 4NA9H 3SZNA 5EQRA 1VJ9U 1TGCA 4XDEA 1P02A 1LO6A 3M61U 3MH6A 2FS8A 1K21H 3P8OA 4SGAE 1C5SA 1C5MD 2XW9A 1YPEH 3U9AH 5HGGA 1AY6H 2QAAA 4A1XA 3QK1A 1ESAA 4ABJA 2H9EH 5L30H 3U69H 1ABJH 4X6MA 1SGQE 3ATWA 3D62A 2FOBA 1SGIB 3Q76A 2ZWLH 4XFQA 1FIWA 5ESTE 4Y11E 3RXTA 4FUBA 4ZUHA 2CF8H 4I8JA 3TGKE 1YPHC 4Q7YA 3LJOA 2HLCA 1BBRE 4O9VA 1SFIA 1MTNB 3LU9B 4A6LA 1C5VA 4U32A 2OC7A 5JBTA 4NCYA 1F5RA 2ZO3H 4AOQA 4WMEA 4U30A 1KTTB 2Z3CA 4MTBA 2F9PA 3BTQE 3PMAB 2XBWA 2PLXA 3MI4A 3VB4A 2ZCKP 1CGIE 1TBRH 4AG2A 3SI3H 2QCYA 1C5TA 1UTJA 2J2UA 1CSOE 1Y3YA 2W26A 2HVXA 1TNIA 4NWKA 2KAIA 1JBUH 3SHCH 3T28A 1T4VH 1O3NA 1T7CA 1SC8U 3MTYA 1S6HA 1UTOA 1V2OT 2ZTYA 1P05A 2BD3A 1JRSA 1XX9A 1SR5C 1B0FA 1GHAG 2A5KA 2XRCA 8GCHG 1XXDA 3M5NA 1P03A 2ZU4A 1SGEE 5AF9H 4M7GA 4NA7A 2OD3B 1S85A 2AMQA 1EZSC 2VVUA 2ZU5A 2ZPSA 2XC5A 1TQ0B 1K28D 1FPHH 1CT0E 2EA3A 3KIDU 3MU4A 2BMGB 5EW2H 1NO9H 5LPFA 3M3VA 2O8MA 3ATKA 1C2KA 4NFFA 1GJ8B 1D3DB 4XBBA 3SGBE 5AVDA 1K1MA 2BX4A 1UO6A 2RA0A 4ZMAH 3UQVA 1Z6EA 3U1JB 3UWJH 4MLFB 4A1VA 2EEKA 1AN1E 3QLPH 3ATMA 3M7UA 3BEIB 2GT7A 4DURA 2PUXB 2XYAA 4CHAC 2SGEE 4Y0YE 1O3FA 1H1BA 2FYRA 2GCHF 4NGAH 1CBWC 1O35A 1FXYA 1QJ1B 4CH2B 4B2BA 2VIQA 4Y0ZE 3PM3A 1MCVA 2XTTB 3VPKA 2VWOA 5GIBA 3QZRA 2A7CA 2H1UA 3MO9A 4JYTA 1PPEE 1TAWA 1P06A 1MZAA 1YCPH 3TGJE 4WWYA 1SHHB 1VCQA 4X8VH 1S0RA 1H4WA 2BM2A 4FUIA 4AFQA 4CRDA 5IYTA 3SGQE 4X2VA 2Z9LA 1P3CA 1QFKH 3ZZ8A 4WJG2 2VB0A 2CJIA 3QX5H 4JK6A 1DXPA 2YNBA 3GDUA 1ZHPA 5FPSA 1HXEH 2ZCLP 1HAHH 1ZTKA 1C1UH 3SO3A 1O36A 3A80A 4JMYA 4VGCB 3SU0A 1SLVB 3ZVFA 3VB6A 3SJ9A 3UR6A 1EJAA 1H8DH 2GCTC 4GCHG 3BTDE 3SU4A 4ABAA 4J1YA 1LPGB 3S9BA 2VGCC 3P8NA 1LHGH 2EI7A 2R2MB 2Z9GA 4JZIA 1B0EA 3MWIU 1SOTA 1SL3A 3T25A 3MMGA 1EOLA 1GHAF 1E34B 1UK4A 3RP2A 8GCHF 3KNXA 2W3IA 1K1OA 1ZMNA 2XCNA 4WMDA 1ARBA 1FAXA 2R0LA 1HJ8A 2PR3A 4KKDA 1EJNA 1P2NA 1Z1JA 3S0NA 3LH1A 1O31A 1P8VC 8KME2 1QBVH 3BV9B 3LGVA 2P93A 2IOTA 4ISOA 1Z71A 2F9BH 1AE5A 1TX6A 1IQLA 3QTOH 1T4UH 4YOJA 3VGCC 1BRAA 3A84A 3EA8A 2OLGA 1TIOA 3PROA 5EQQA 1CO7E 4R8TB 1UTMA 1W7GH 3ELAH 1DUEA 4UFEH 1UVUH 4A1TA 2WUCA 1WCZA 4A5TS 3L33A 3TJUA 1A3BH 1GJDB 1O3JA 2B7DH 4YESB 4UFFH 5EU8A 1DSUA 1BTYA 1WQSA 4ESTE 1V2TT 3TU7H 2UWPA 5TCCA 5DK1A 1G3EA 1TBZH 2NWNA 4ZKRU 1FI8A 3VEQB 3HKJB 3B23B 2J92A 1V2WT 3BTWE 5L2ZH 1UTPA 2RA3A 1E36B 1SQAA 1FV9A 1BMLA 2GCTB 1O2PA 4FUHA 3OTJE 4K1SA 1HAXB 3ZYDA 1C1RA 1O3AA 1SLXB 4I8KA 2VGCB 2D26C 1O2SA 2QIQA 1QL7A 2BD4A 4YT7H 4GLYA 3PMHB 3GY3A 3MNSA 1OWJA 1YGCH 2FTLE 3LC5A 5CMXH 1GG6B 2P59A 1GGDC 1G9IE 2HNTE 2GT8A 1DLKB 1O3DA 1F0TA 1PPFE 3AASA 3ZV9A 1Z8JB 5C20A 1RIWB 1ESBA 1P3EA 3EAJA 4E7RG 4E06H 1FQ3A 1ZZZA 1HAIH 4GCHF 1T8MA 3RXRA 1NFYA 4X6NA 2BDCA 3O8RA 4DIIH 5PTPA 3SW2B 2ANYA 2J34A 1J17T 2C93B 2ZHDA 1HJAC 3GDVA 3RXJA 5AHGH 4B76A 1C5QA 5E2PA 2HPPH 2STAE 3RXKA 1LPZB 2VIVA 1P9SA 5K0HA 3PB1E 3M5MA 1O5BB 2LNCA 4FUDA 2BQ7B 4WMFA 2SNWA 2BZ6H 5DG6A 1LCYA 3M37A 4HI3A 2TRMA 1HJ9A 5H4IB 4INKA 3C27B 1YCPM 3KHVA 1SLWB 2Q6DA 1QRWA 1AGJA 1AUJA 4FXGH 2EC9H 1E38B 1TGTA 3LGUA 4H42U 3U1IB 1EAUA 2ZI2H 1C2LA 3ATIA 2WPLS 2XBYA 2KAIB 3A89A 4YZUA 2FZZA 1QBOA 2VWNA 4OGYA 3PTNA 3LONA 3BTKE 1EXFA 3STJA 1BITA 1ELGA 3T27A 3OU0A 3M36A 1UVOA 1GBEA 1PYTC 2C8XB 4J2YB 2ZA5A 1O2QA 3IWMA 3TK9A 4WY3A 5HXFA 1C5WB 4BTUB 4YLQH 1GI1A 1NY22 2RDLA 2ODYB 3NCLA 1GHBG 3SGAE 3MH7A 1Y59T 4OS5A 1YPHE 3NK8A 1PPBH 3OY5U 1O38A 1KLIH 2V3OH 2EI6A 1GGDB 1Y3WA 4I33A 3I29A 2J94A 4MNXA 1D3QB 1XM1A 2WPIS 1BMMH 5JYIA 5EXNA 1UK3A 2CGAA 2F9UA 3SU5A 5C5NA 5E8EH 1C2EA 1DS2E 1O2MA 2K1QA 1O3CA 1WTGH 5DP9A 4E05H 2VJ1A 4MNWA 2ANKH 4BAMB 1O2KA 4O97A 1B5GH 4PROA 4CRFA 4KTSA 3CS7A 3I77A 1UHBA 2FPZA 2ZDAH 2VVVA 1C9PA 1GJ7B 4IC5A 2R3UA 1GBAA 3O8DA 3P70B 1SB1H 3RXHA 2FI5E 3F1SB 4UFGH 1SGTA 5GCHG 1HDTH 3I78A 1LKAA 2A31A 9LPRA 2FLRH 3SUDA 2M5TA 1O2TA 2R9PA 1Y3UA 1BBRK 3RXIA 1O2RA 1FUJA 1C2DA 1Y3VA 4AYYB 1DX5M 5EQSA 1G3DA 2BDBA 2ZDNA 3FZDA 2FP7B 1XVMA 2BLWA 1TPPA 1GI9B 3TGIE 1LVMA 1SGNE 2QF3A 3P8FA 3RU4D 1SQOA 3W94A 1P2JA 1FPCH 5FPYA 1ZHMA 2R2WU 3A86A 1D3TB 1ABIH 3T62A 4NWLA 3TITA 4TWWA 5EG4A 1AD8H 1CE5A 1YP9A 2H9HA 2VIDA 1DPOA 4GUXA 2WV5A 2BVXH 1EZUC 1MAXA 1NRPH 2SFAA 3CS0A 1P2KA 4RKJB 4OS7A 9ESTA 1PQ7A 2PKAA 1OWEA 1RTKA 5A8YA 2VH0A 1C5PA 1W10U 1GBIA 1S81A 1AE8H 1EP6A 1G2LA 3LOXA 3M5LA 2QXGA 2A4QA 2GZ9A 4Y6DA 4ABFA 3UNRA 3JZ2B 1GI4A 4XE4A 4ZKSU 3A7YA 2BDIA 1GHBF 3SI4H 1YBWA 1MQ5A 3SOSA 1TQ7B 2EI8A 1IQJA 2CXVA 5DPAA 2IN2A 4AX9H 1YM0A 4AB9A 1KDQB 4CBNA 4DVAU 2GX4A 3A7XA 1GJAB 4I8LA 1SHYA 3LJJA 1BRUP 1XUIA 1C5OH 1S6FA 2ZC9H 1SSXA 1GI5A 4NA8A 3ZZ6A 5IDKA 1BJUA 1MTSA 4HTCH 1FIZA 3MO3A 1FONA 4D8NA 1F5KU 3EGKH 1NN6A 2AERH 2ZCHP 1QRZA 3BTHE 2THFB 5J4SA 4IC6A 2V3HH 1KLJH 1P01A 2ZGBH 3N7OA 5TJXA 4ABEA 2OC8A 1O2JA 1ZRKA 2Y80A 1KTSB 4INHA 1LDTT 1K1NA 1TMBH 3BTFE 4BAHB 1AZ8A 2BYAX 1EPTC 3FP6E 5GCHF 3FZZA 2FX4A 3HPTB 1HNEE 2D1JA 1VGCB 1C1SA 1OOKB 2GTBA 1ZHRA 2PHBA 2FX6A 1GVKB 5ABWA 2V6NA 3MYWA 3R3GB 1IQFA 1NS3A 3BTTE 2SGFE 3TLOA 3RU4T 1PPGE 2ANMH 4Q7ZA 3P17H 1H9HE 2Q6FA 4CR9A 3UY9A 5E0JA 3ZVCA 2G52A 3SBKA 2IPHA 2HWLB 3LT3A 2Z3DA 2DE8A 3SNDA 1VJAU 3PMBB 3S9CA 2C4FH 2GP9B 1XVOA 2CHAC 1L0ZA 1VITH 1OWDA 1BTPA 1TNLA 4X1SU 3QZQA 3RLWH 1Z8IB 2PTNA 3VB3A 1GHWH 3DA9B 2BB4A 2P94A 5J4QA 8ESTE 5A09A 3MH4A 3TJVA 3BN9A 1W2KH 4IN1A 1H9LB 3RMOH 2AH4X 5FX5A 3VXFH 3MU0A 3M7TA 3U8TH 1FZZA 1EP5A 3RXCA 2NU0E 5FHTA 1H8IH 1NC6A 1NESE 1TNJA 5DP5A 1NTPA 1SMFE 1OXGA 1XUFA 4X8SH 1O2NA 6GCHG 1EKBB 2OXSA 1A5HA 1BMNH 1O3BA 5A2MH 1LQEA 3BTGE 2XBXA 4DOQA 2ZTXA 2AGGX 5JB9S 4H6TA 4Y7BA 1TMUH 5EXLA 4BXWA 1C2FA 3K2UA 1L1GA 4ZROA 5BPEA 1OKXA 1EPTB 1AZZA 2BLQA 3BG4C 2FOCA 2H6MA 2SGDE 2PFEA 2FOMB 1KIGH 2WINI 2LPRA 7ESTE 2Z9KA 5HM9A 2OC0A 2PGBB 1OWIA 2P3UB 3A81A 4INLA 3UWIA 3DT0H 1O3PB 2G81E 4JCNA 2FOAA 1C1PA 1FLEE 4JZ1A 1LVBA 1VCWA 5ETXA 1NU9A 5T6FA 1O0DH 2A4GA 1GBKA 1O34A 3MFJA 2BVRH 3E3TA 1C5UA 2GV7A 1O2GH 2W3KA 1GHVH 1GVLA 1S83A 3BTEE 3ZZ4A 3BSQA 2VIWA 2Z3EA 4IBLH 1KYNA 1P04A 2ZQ1A 2WPJS 2FWWA 4DJZB 1UCYE 1FY5A 2VU8E 4WXIA 1SVPA 2ZDLA 4Y7AA 1DWEH 1JXPA 1C1TA 1EB2A 1IHTH 1F92A 3H7OA 1THSH 4RSPA 1BA8B 1HAYB 1HGTH 4FUEA 4DIHH 5FCKA 1O3OA 2RCEA 3URCA 1UTLM 1EASA 1O3LA 4BXSA 3E0NB 2WPKS 1NPMA 2BHGA 4OGXA 1ZLRA 3BG8A 1ELCA 1DWDH 1K1IA 1KXCA 3GCTG 4R0IA 4X8TH 3ZZ7A 1GHXH 3QGJA 2UWOA 3T26A 1C9TA 1UVPA 1S82A 1O3EA 2B8OH 1QB6A 1IQHA 1AVXA 3OY6U 1CGJE 2F91A 1VZQH 4H4FA 1TGBA 1TFXA 3A8DA 4TY7A 4ZAEA 4JYUH 1AQ7A 2C90B 1GDUA 1A7SA 1Y3XA 2A7JA 3KN2A 3MH5A 1TABE 4ZH8A 2ZKSA 5T6GA 2YNAA 1ORFA 1MH0A 2ZFQH 3A7WA 2A2QH 1W8BH 1EAIA 4AFUA 1W7XH 1YF4A 3SNEA 2G4UA 2HRVA 3EE0B 2VWMA 4BTTB 1ZGIA 5K7RA 3GY7A 2ZGCA 6GCHF 2NU1E 1TNHA 3W95A 2JETC 2BTCE 4DCDA 1ETRH 1W0ZU 1W13U 2BDYA 2BXUH 1TA6A 1TOMH 2Y5FA 2Z94A 3KQEA 1A2CH 1PPCE 3RXEA 1LPKB 1WSSH 2W7UA 3KQCA 1ZSKA 2ZGHA 3T29A 2Q6GA 1AKSA 4TWYA 1AVGH 2HALA 4IS5A 3NUMA 1G3CA 1V2KT 2H5CA 2ODPA 2ZU2A 1V2MT 2O8LA 1BQYA 1GJ4H 4Q80A 3A88A 5DGJA 1ZSLA 1ZTLA 3HK6B 6LPRA 3FAOA 4NIYA 3GY5A 1C2IA 3RXPA 2GZ8A 1FJSA 2ZTZA 1NFXA 1MZDA 1E35B 1V2VT 3E90B 3T5FH 1ELAA 1ZJKA 1AWFH 1GMDG 1WBGB 3S9AA 1Y5BT 1P2OA 4CHAB 1CBWB 2OINA 1T8OA 3QGNB 5T6DA 2TBSA 3PYHA 6ESTA 1K22H 1TPOA 1A61H 5F8ZA 3RXBA 2UWLA 2PWXA 4IGDA 1DANH 2G8TA 1N6YA 1CU1A 3AAVA 2FI3E 5LPRA 1BDAA 3MNXA 3EA9A 2TGTA 4NZQA 3GCTF 1QL9A 1PPHE 1BTXA 5GXPA 2GZ7A 5EW1H 1GI7B 3PWBA 1FNIA 2PV9B 1EB1H 3ZZCA 1C1WH 1C5YB 1TNGA 2JETB 2ZFFH 4IMQA 1FAKH 3RXGA 3CENA 1G36A 1P57B 3G01A 2WYJA 1THRH 2JH6D 2ZHFH 1SGPE 4AGKA 4RKOB 1KY9A 1IAUA 1MTWA 1C2MA 3NWUA 3E8LA 1HV7A 1GI0A 1GMCG 1OYTH 4YM9A 4NIVA 1BHXF 4IMZA 5DKMA 3RXLA 1YPMH 1NROH 1YPGH 4HZHA 1N8OC 3ZZ9A 5HMAA 1BMAA 5C5OA 1T31A 2QGRA 2ZPQA 2F9OA 1AVWA 1SFQB 2FOGA 1SPJA 4B2AA 5BRRE 1GWAA 3BEUA 2BY8X 3RXVA 1MKXK 4NFEA 3ODFA 3TPIZ 3RC5A 2GGVB 1ZR0A 4RN6A 3KF2A 1KXFA 2G4TA 5C3NA 2SGQE 1GJ9B 4K69A 1HIAA 3AAUA 3GY2A 1S0QA 2BVSH 1O5GH 4NSVA 2WPHS 1L4DA 3MHWU 3DUXH 1C5RA 1DDJA 3P8GA 3NKKA 3SUEA 1C5XB 1NU7B 3SN8A 3UOUA 1K2I1 1E0FD 3ZZ3A 2GV6A 1HB0B 4FVBA 3VGCB 2BQ6B 1EATA 2H5DA 4AGJA 1IHSH 2A32A 2G51A 2Z7FE 1TYNA 1GMDF 1P2QA 3GCNA 1N1LA 3BIVH 5LGOA 1DICA 3E6PH 3PO1C 5C1XA 2FIRH 4YT6H 5DP7A 1AFEH
chains in the Genus database with same CATH superfamily
1DT2A 1ZRBA 3JZ1B 1MBQA 1TGSZ 3BEFB 1Y8TA 3RXDA 4X8UH 1DY9A 1NRSH 2Y81A 4MVNA 1PYTD 1TRMA 1ZGVA 1XUGA 1XUKA 1LVYA 1JMOH 3A82A 8LPRA 1BBRH 2FYQA 4F49A 1DVAH 3A7ZA 3RM2H 4A92A 1QJ7B 4K8BA 1N8OB 1K1PA 3BIUH 3DFJA 5AFYH 3PV5A 2J97A 1HPGA 4Y79A 1BRBE 3RMMH 3SJ8A 1V2JT 1HAPH 1BT7A 3RDZA 3UQOA 3OYPA 3D65E 1AIXH 5EODA 1KSNA 4X2WA 1W0YH 3URDA 2W7SA 2R0KA 3KCGH 4FVDA 2GVFA 1GBMA 5A0BA 4DGJA 1VITG 4KP0A 1QY6A 5C67A 1C2JA 7GCHG 1FY8E 1P2MA 1GMCF 2KCPA 3P6ZB 1GBLA 5L2YH 5A0CA 1W3CA 1COWD 4AZ2B 4FUJA 4Y10E 4LK4A 4X6PA 3EQ0H 4JYVH 1GHZA 1O5AB 2GDDA 2WV4A 2BXTH 1C4Y2 1QA0A 3OSYA 1P9UA 2O8UA 4KELA 1JRTA 1HJAB 5DO4H 3Q3XA 4IW4E 2G55A 1KLTA 1XUHA 3DD2H 2ZECA 3TK5A 2KCYA 3SNAA 2A4RA 2CMYA 1F0SA 1DY8A 2A7HA 2ZP0H 1WUNH 4FUCA 3ODDA 4YOGA 2ZNKH 1HYLA 3DHKH 1T8LA 3QDZB 4D9QA 5I46H 4X2YA 1X7AC 1ID5H 1JOUB 1JWTA 1HAGE 4LOYH 4AFSA 2YMSD 3EYDA 2AHME 1OP2A 1WTHD 1DSTA 4X6OA 2FTMA 1BRCE 2IPQX 4K60A 1V2RT 1A46H 4D7FA 1O3IA 3UREA 3NZIA 3F9FA 2GMTC 3S69A 3RXFA 4ACAA 3F68H 4AFZA 3PLKA 2QXIA 1FN6A 4OS1A 3RXSA 3GY8A 4I7YH 5JBBS 2OQ5A 1G30B 4K1TA 1DWBH 1SG8B 2OC1A 4F48B 1UVSH 1BIOA 3KQDA 3ZVDA 1AKSB 3QUMP 4BAOB 4X0WU 3SJOA 3V7TA 3ZVEA 4ISHH 1OX1A 1PQ5A 3IITA 1ZSJA 3D23A 1GJ5H 1AB9C 2P3TB 1UTQA 4MNYA 5JB8S 4FU8A 4CRGA 1O30A 1AFQC 3K65B 4Y8ZA 1RTLA 3NPSA 3TNSA 2FMJA 4ZKOU 3MU5A 1M9UA 3RM0H 5FAHA 1QQUA 1Z1IA 1WAYB 4YXWD 3MNBA 1Y5UT 3BF6H 3U8OH 1W11U 4GAWA 2FOFA 2XNIA 3A87A 3DFLA 2F4LA 3Q3YA 4O3UA 4CBOA 2UUJB 1ETSH 1KXEA 5G4BA 3F9GA 1GI6A 2ALPA 1F0UA 1UCYK 3FP8E 3ITIA 1YYY1 1ANEA 2QF5A 4MNVA 5GWZA 3ZVAA 1QHRB 4ABDA 3LGIA 1TMTH 3ESTA 1VITF 4I8GA 2BX3A 3K9XB 7GCHF 1PFXC 1LKBA 1ZJDA 2BY7X 1Z6JH 3B8JA 3L3TA 2A0QB 7KMEH 3A8AA 2NU2E 1O39A 4LZ1H 1JIMA 1HRTH 1XMNB 5HYOA 1GJCB 4BAKB 1D3PB 4BNRA 1AI8H 2QXJA 1G3BA 3SHAH 1HXFH 1YLCA 2A5IA 3Q3KA 3SNBA 1O3KA 1ANDA 1Q31A 2CF9H 2IJOB 1SOZA 2HNTF 1HAZB 4CRBA 1W12U 3UPEA 4UDWH 4JZDH 4ABHA 1J8AA 5JBCS 2B5TB 1MKWH 2XNDD 5EOKA 5E0HA 3SNCA 1J16A 1FY1A 1BCUH 2VH6A 3K6YA 3NXPA 5CHBA 4Y71A 2ALVA 2P16A 4MPVA 3UOPA 1CT4E 2B9LA 3OAAD 3PV4A 1P12E 2H2ZA 5F6MA 2OCVB 1Z7KA 3UTUH 1OWKA 5CHAC 1ZPBA 1YPJH 1SLUB 1AB9B 4AORA 1CVWH 3GY4A 4TY6A 3BTME 4Y8YA 1C2HA 1TE0A 4AN7A 2ZFSA 1AFQB 1EQ9A 3STIA 5HKKD 2O8TA 3ZZ5A 2OTVA 2UUYA 5FBEA 5EPNA 1ACBE 5ESBA 4I32A 5EGMA 1SGCA 3RXAA 3TH2H 2JH5D 5TCAA 1HAVA 5F8TA 1SGRE 1O2WA 1PQ8A 1TOCB 2Z9IA 4AG1A 2AIPA 1D4PB 1ESTA 2WPMS 3Q77A 3LPRA 1OP8A 1O5DH 4X1QU 4B2CA 3SUFA 3LGYA 4X1RU 1W0JD 3SU6A 2GD4B 3T2NA 3H5CB 3AW0A 1SBWA 2LP6A 1GBTA 1QGFA 2ZQ2A 2ZDVH 4LZ4B 2Y5HA 2AGEX 2Y82A 4HFPB 4AC9A 1O37A 1XXFA 2AEIH 2ZDKA 2PSYA 5B6OA 2WZQA 2GDEH 1GDNA 3UIRA 1EAWA 4JZEH 3SV7A 3RMLH 4Y8XA 1MKWK 1TNKA 1TPSA 4CREA 4P00A 3HKIB 1ELDE 1MU8B 1DE7H 1RJXB 1P0SH 1ELTA 1F0RA 1P09A 4ABIA 1LQDB 4BOHA 1CA8B 3RXOA 3A8CA 2KCAA 4BAQB 3HGPA 1EZQA 1O3HA 4FUFA 2BDGA 2ILNA 4NG9H 1O32A 5CHAB 2R3YA 1MD8A 2C8ZB 4Q7XA 4YOIA 4BANB 3ZZDA 3KL6A 4KTCA 2XC0A 4XRNA 1W14U 3PMJA 5DN6D 1LHFH 2BZAA 1A5GH 4CRAA 4MPWA 1QQ4A 2AS9A 1BB0B 4X1PU 2WUBA 1T32A 1DUAA 3TJNA 1GL1A 3B9FH 1RXPA 2QY0B 2XWAA 3V3MA 2VINA 2G5NA 1HUTH 3DCLA 4UE7H 3SU1A 3KQ5A 1INCA 1UJ1A 1ARCA 2OBQA 2A2XH 1C1NA 2CHAB 3SJIA 3UUZA 1L4ZA 3L6PA 1QB1A 1FMGA 2Y5GA 6CHAC 1O2XA 3SV2H 5F03A 5I25A 1NZQH 2SGAA 3TK6A 1IOEA 2P8OC 5JDUB 5FL7D 2ZPRA 1EFRD 1IQEA 1D6WA 1EOJA 2L74A 3MQKC 3LDXH 1N6XA 3TVJB 1E37B 5L6NH 2HGTH 2HOBA 2XBVA 1UHBB 4VGCC 2SNVA 1BTHH 3V0XA 4GVUA 4ISNA 2ZDMA 3TNTA 2ZU3A 1E1QD 1NRRH 4ZHAA 1GBBA 2RDEA 5KGOA 1V2LT 1TALA 1IQGA 1K9OE 1HLTH 2FESH 2I6QA 1DWCH 4KTUA 4UONA 2OQUA 2FS9A 3VXEH 1GBCA 1QCPA 1YPLH 2VIOA 3EDXB 5C2ZA 1L1NA 1NFUA 3GYLB 3EA7A 1BZXE 1C1OA 1SKYE 2ZF0H 1ELFA 1C4V2 1TWXB 5GDSH 1FX0B 4F4OC 1MAYA 1ZOMA 4Y76A 3BG4B 4FU9A 5GJ4B 1TPAE 3AW1A 2BD2A 4GHQA 3NRLA 1A4WH 1O2UA 3FFGA 2KZ4A 3F2FA 2P3FH 5GNDA 3O8CA 2DUCA 2BOKA 3ENSB 1AU8A 4UFDH 3PLPA 2OP9A 2QF0A 1G32B 1QB9A 1NRQH 1O3GA 2Y7XA 2C3SA 4UEHH 2CV3A 1QJ6B 1V2QT 2OBOA 2PKSC 1GCTC 3QTVH 4FUGA 1TRYA 1EUFA 2AMDA 1VR1H 2PKAB 2TGDA 4JZFH 4K1EA 1IQKA 3LKWA 3SUGA 1XUJA 1O5FH 1Z8GA 2BD7A 1FDPA 4NZLA 4ZXXH 2Y6TA 3SU3A 2TGPZ 6CHAB 4AB8A 1MCTA 4GSOA 4ZHLU 2P8OB 1MKXH 3LGWA 3GCHC 3PLBA 2ZU1A 4ZKNU 2V35A 4H6SB 1TLDA 3FANA 5DP4A 4DG4A 4QT8C 3U8RH 1AUTC 1BJVA 2D8WA 3V12A 1O5EH 1QURH 3TH3H 1KXDA 1QNJA 4FOUC 2ZGXH 4OS4A 1O2ZA 3VB7A 1GBJA 3GICB 1PJPA 5DP3A 4XOJA 1H9IE 3MNCA 4O03A 2FI4E 2Z9JA 4ABBA 5AFZH 1O33A 1V2ST 3M7QA 1TGNA 2HPQH 2JJ2D 2ZG0H 3VB5A 4D9RA 1EZXC 1MQ6A 4O3TA 4CRCA 4THNH 2PTCE 3LIWA 1GG6C 4X2XA 4I8HA 4NSYA 1YPKH 2BY9X 1GBFA 1PQAA 2F9NA 3GY6A 3H7TA 2BY5X 2XOKD 3GYMA 4MPXA 1GI3A 1P11E 1RIWC 3MU8A 2Q1JA 2A5AA 4Z0KA 3WW7A 3UFAA 1B7XB 1IQMA 2J9NA 1D6RA 1AWHB 4WH6A 1WU1A 4K2YA 1O2HA 3RC6A 3P92A 1O2LA 3TIUA 3QO6A 4B73A 1OSSA 3A7VA 3SZEA 1TX7A 1QL8A 1FN8A 1DXWA 1KDQA 1YCPK 3RU4E 2FM2A 1MD7A 1DM4B 1IQNA 3MO6A 3ZV8A 4ASUD 1S5SA 2PKSB 1GCTB 3K6ZA 3PWCA 4GPGA 1PPZA 4NIXA 3PTBA 1ZTJA 1O5CB 3ZZBA 4DW2U 1HAVB 1JIRA 5EXMA 1G2MA 1UTKA 4WVPE 1RFNA 1GMHG 1GJ6A 1LHCH 2FO9A 4NIWA 4K5ZA 3FOAA 1THPB 1UMAH 2GKVE 3KGPA 3O8BA 2BDHA 3SV8A 3SQEE 1OP0A 2OK5A 3GCHB 2OUAA 2C8WB 2QYIA 5A8ZA 2J98A 1U6QA 1MTVA 2J38A 2XWBI 3ZZAA 2ZGJA 4ACBA 1MABB 3S7HB 3V13A 2B0FA 2W5EA 1DOJA 2FEQH 4XBCA 3C1KA 4IN2A 1J14A 1GDQA 3HK3B 2AIQA 4ASHA 2FOEA 5EJZA 1EX3A 1S84A 2PSXA 3WY8A 5JBAS 1K1JA 3UR9A 2G00A 5A8XA 1J9CH 2JH0D 2C8YB 1H8ED 2QXHA 1TRNA 2QN5T 4XBDA 1H8HD 3OTPA 1F5LA 2QV1A 3LGTA 2WYGA 1G37A 3TH4H 1Y5AT 4X1NU 4OS6A 2TIOA 1GI2A 3VFEA 2G5VA 3KQBA 4Q2KA 1MBMA 3F9HA 2AMPA 3RLYH 5C1UA 1BTZA 1UK2A 2TGAA 1MUEB 1SQTA 2ZIQH 3IG6B 3LH3A 1HBTH 3RXQA 5FX6A 1LVOA 4MG3A 1OWHA 1GL0E 2QC2A 4MDSA 1Q2WA 4M9FA 1A0LA 2BD5A 2NU3E 3CNRA 1GBHA 3CP7A 3QN7A 2FODA 2F9VA 4B74A 4DY7B 4SGBE 1QA7A 1XKBC 1F7ZA 5E2OA 1IQIA 2A4OA 4B71A 2ZHWH 1RRKA 2QA9E 3PRDA 2BQWB 5E0GA 1AHTH 1C1QA 1T8NA 3MOCA 2J4IA 1YC0A 2RG3A 2A1DB 3F0OA 1ZPZA 3E16B 2VIPA 3SV6A 1V2UT 2CN0H 1HAOH 2Z6BD 3UNSA 5C17A 1UVTH 5DP6A 4MQAA 1BTWA 1EPTA 7LPRA 2WHXA 1ETTH 4TYDA 1LHEH 4ABGA 4FU7A 1NM6A 1V3XA 1BHXB 1Z8RA 1WOFA 1LTOA 1QBNA 1F2SE 1GMHF 1CA0C 2D2DA 1NFWA 1WYKA 1P10A 2PGQB 5CE1A 4A7IB 3R0FA 4Q4LA 2PUQH 2PW8H 4ZXYH 2QE7D 1WQVH 1SGYE 2XC4A 1UCYH 1A0JA 2FDAA 2SGPE 1OS8A 1GI8B 4U2WA 3SU2A 3E1XB 4DT4A 1L1JA 1DLEA 1C4U2 1C5NH 1SGDE 4D76A 1ELVA 1GBDA 2ODQA 4AYVB 4ZHMU 1SI5H 3M5OA 1ELBA 3LC3A 1CHOG 1O2IA 3GISB 1YKTA 3PO1B 4YO9A 3F9EA 3A7TA 3M35A 3OEHD 4YTAA 1KXAA 1P2IA 1FY4A 3RUOA 1V6DA 1O2VA 1EAXA 1BTUA 5LH8A 1DFPA 1YLDA 1CQQA 3E91A 1MMJN 3SORA 2ASUB 3SQHE 4F55A 1KXBA 4XSKU 1VCPA 1ANBA 2STBE 2A45B 2AGIX 1ZYOA 1TX8A 1D9IA 1O2YA 1O3MA 1LMWB 2ZZUH 4GHTA 4OS2A 4U01A 5FXLA 3ZVBA 3RXMA 2O9QA 3E0PB 2YOLA 3UNQA 1BOQA 1C1VH 4BTIB 4LXBH 4UD9H 4Z6AH 2UUFB 2ZFRH 3Q00A 4TPIZ 4B75A 5FCRA 4WXVA 3ATLA 2K0QA 2P95A 2YMSC 3RC4A 2K8IA 4K3JA 4D7GA 1DITH 5JPMH 1MU6B 2BD8A 3SYJA 2JKHA 1FY3A 2XXLA 3A8BA 1CA0B 3GS9A 1C2GA 1MTUA 5HIYA 2BLOA 1ZMLA 3FVFB 1VGCC 4I31A 1UTNA 2I6SA 3GCOA 1QTFA 3OX7U 1A0HB 1OPHB 2F3CE 2TPIZ 1LHDH 1CT2E 2BY6X 4KGAA 5EPYA 4HGCA 1RGQA 2F83A 4FETA 2AFQB 2ESTE 5LPEA 1ZMJA 5KEDA 5EJ1A 5DJ7A 4WF8A 4WH8A 1J15A 5B6LA 1GCDA 2BDAA 5A0AE 1BUIA 5GPIB 2H9TH 1A3EH 3A83A 2AYWA 1TA2A 2BOHB 1ANCA 2GMTB 3GDSA 2ZEBA 2DE9A 1K1LA 2ZHEH 1QR3E 4E7NA 2BD9A 3GOVB 1C5ZB 1CHGA 1SGFA 3S7KB 1QRXA 1ZPCA 1GJBB 1XKAC 1CHOF 4TSFD 1NRNH 2ULLA 3SV9A 1GPZA 2XCFA 3HATH 2BLVA 4JK5A 2FOHA 4CR5A 2O8WA 2UUKB 3ZIAD 1HFDA 1A5IA 1RS0A 1WV7H 1C1MA 2ZFPH 1TBQH 4YLUA 3A85A 3KEEA 4ISLA 3N7DA 1MTNC 2VNTA 4CH8B 3FP7E 3RXUA 2HNTC 1O2OA 1TONA 3M3TA 2ANWA 3F6UH 3MU1A 4RT1A 1SGFG 3D49H 1NT1A 4K8YA 1AMHA 3QWCH 2ZHQH 4MPUA 2VVCA 1HIAB 3TJOA 5T3HA 1HCGA 2J95A 1RTFB 5SGAE 1V2PT 4ISIH 1QIXB 1C5LH 1V2NT 2Y7ZA 2V0BA 1GVZA 3ZVGA 5DP8A 5F8XA 4B6FA 2FLBH 4TPYA 2NU4E 4DT7B 5C1YA 2VWLA 2FXRA 1AO5A 3U28C 3U98H 1ELEE 1Q3XA 4P02A 3SJKA 1OYQA 3M3SA 3ZYEA 2WSSD 3RMNH 3AVZA 5FBIA 5HM2A 1GHYH 4B1TA 1CGHA 1L2EA 3HGNA 1EJMA 5FPTA 1A1RA 2GCHG 1RD3B 1TB6H 3P95A 2ZFTA 4NA9H 3SZNA 5EQRA 1VJ9U 1TGCA 4XDEA 1P02A 1LO6A 3M61U 3MH6A 2FS8A 1K21H 3P8OA 4SGAE 1C5SA 1C5MD 2XW9A 1YPEH 1QZ8A 5HGGA 3U9AH 1AY6H 2QAAA 4A1XA 3QK1A 1ESAA 4ZCNA 4ABJA 2H9EH 5L30H 3U69H 1ABJH 4X6MA 1SGQE 3ATWA 3D62A 2FOBA 1SGIB 3Q76A 2ZWLH 4XFQA 1FIWA 5ESTE 4Y11E 3RXTA 4FUBA 4ZUHA 2CF8H 1WXRA 4I8JA 3TGKE 1YPHC 4Q7YA 3LJOA 2HLCA 1BBRE 4O9VA 1SFIA 1MTNB 3LU9B 4A6LA 1C5VA 4U32A 2OC7A 5JBTA 4NCYA 2HVYB 1F5RA 2ZO3H 4AOQA 4WMEA 4U30A 1KTTB 2Z3CA 4MTBA 2F9PA 3BTQE 3UB0A 3PMAB 2XBWA 2PLXA 3MI4A 3VB4A 2ZCKP 1CGIE 2PP6A 1TBRH 4AG2A 3SI3H 2QCYA 1C5TA 1UTJA 2J2UA 1CSOE 1Y3YA 2W26A 3UAIC 2HVXA 1TNIA 4NWKA 2KAIA 1JBUH 3SHCH 3T28A 1T4VH 1O3NA 1T7CA 1SC8U 3MTYA 1S6HA 1UTOA 1V2OT 2ZTYA 1P05A 2BD3A 1JRSA 1XX9A 1SR5C 1B0FA 1GHAG 2A5KA 2XRCA 8GCHG 1XXDA 3M5NA 1P03A 2ZU4A 1SGEE 5AF9H 4M7GA 4NA7A 2OD3B 1S85A 2AMQA 1EZSC 2VVUA 2ZU5A 2ZPSA 2XC5A 1TQ0B 1K28D 1FPHH 1CT0E 2EA3A 3KIDU 3MU4A 2BMGB 5EW2H 1NO9H 5LPFA 3M3VA 2O8MA 3ATKA 1C2KA 4NFFA 1GJ8B 1D3DB 4XBBA 3SGBE 5AVDA 1K1MA 2BX4A 1UO6A 1YY3A 2RA0A 4ZMAH 3UQVA 1Z6EA 4B6EA 3U1JB 3UWJH 4MLFB 4A1VA 2EEKA 1AN1E 3QLPH 3ATMA 3M7UA 3BEIB 2GT7A 4DURA 2PUXB 2XYAA 4CHAC 2SGEE 4Y0YE 1O3FA 1H1BA 2FYRA 2GCHF 3OEED 1CBWC 1O35A 4NGAH 1FXYA 1QJ1B 4CH2B 2WV9A 4B2BA 2VIQA 3DSGA 4Y0ZE 3PM3A 1MCVA 2XTTB 3VPKA 2VWOA 5GIBA 4TT3D 3QZRA 2A7CA 2H1UA 3MO9A 4JYTA 1PPEE 1TAWA 2L6OA 1P06A 1MZAA 1YCPH 3TGJE 4WWYA 1SHHB 1VCQA 4X8VH 1S0RA 3DSOA 1H4WA 2BM2A 4FUIA 4AFQA 4CRDA 5IYTA 3SGQE 4X2VA 2Z9LA 1P3CA 1QFKH 3ZZ8A 4WJG2 2VB0A 2CJIA 3QX5H 4JK6A 1DXPA 2YNBA 3GDUA 1ZHPA 5FPSA 1HXEH 2ZCLP 1HAHH 2W6ID 1ZTKA 1C1UH 3SO3A 1O36A 3A80A 4JMYA 4VGCB 3SU0A 1SLVB 1VKYA 2VBCA 3ZVFA 3VB6A 3SJ9A 3UR6A 1EJAA 5IK2D 1H8DH 2GCTC 4GCHG 5EJLA 3BTDE 3SU4A 4OM9A 4ABAA 4J1YA 1LPGB 3S9BA 1S6LA 2VGCC 3P8NA 1LHGH 2EI7A 2R2MB 2Z9GA 4JZIA 1B0EA 3MWIU 1SOTA 1SL3A 3T25A 3MMGA 4I86A 1EOLA 1GHAF 1E34B 1UK4A 3RP2A 8GCHF 3KNXA 2W3IA 1K1OA 1ZMNA 2XCNA 4WMDA 1ARBA 1FAXA 2R0LA 1HJ8A 2PR3A 4KKDA 1EJNA 1P2NA 1Z1JA 3S0NA 3LH1A 4Z1MD 1O31A 1P8VC 8KME2 1QBVH 3BV9B 3LGVA 2P93A 2IOTA 4ISOA 5F53A 1Z71A 2F9BH 1AE5A 1TX6A 1IQLA 3QTOH 1T4UH 4YOJA 3VGCC 1BRAA 3A84A 3EA8A 2OLGA 1TIOA 3PROA 5EQQA 1CO7E 4R8TB 3H09A 1UTMA 1W7GH 3ELAH 1DUEA 4UFEH 1UVUH 4A1TA 2WUCA 1WCZA 4A5TS 3L33A 3TJUA 1A3BH 1GJDB 1O3JA 2B7DH 4YESB 4UFFH 5EU8A 1DSUA 1BTYA 1WQSA 4ESTE 1V2TT 3TU7H 2UWPA 5TCCA 5DK1A 1G3EA 1TBZH 2NWNA 4ZKRU 1FI8A 3VEQB 3HKJB 3B23B 2J92A 1V2WT 3BTWE 5L2ZH 1UTPA 2RA3A 1E36B 1SQAA 1FV9A 1BMLA 2GCTB 1O2PA 4FUHA 3OTJE 2V3MA 1HAXB 4K1SA 3ZYDA 1C1RA 1O3AA 1SLXB 4I8KA 2VGCB 2D26C 1O2SA 2QIQA 2EQNA 1QL7A 2BD4A 4YT7H 4GLYA 3PMHB 3GY3A 3MNSA 1OWJA 1YGCH 2FTLE 3LC5A 5CMXH 1GG6B 3KYFA 2P59A 1GGDC 1G9IE 2HNTE 2GT8A 1DLKB 1O3DA 1F0TA 1PPFE 3AASA 3ZV9A 1Z8JB 5C20A 1RIWB 1ESBA 1P3EA 3EAJA 4E7RG 4E06H 1FQ3A 1ZZZA 1HAIH 4GCHF 1T8MA 3RXRA 1NFYA 4X6NA 2BDCA 3O8RA 4DIIH 5PTPA 3SW2B 2ANYA 2J34A 1J17T 2C93B 2ZHDA 1HJAC 3GDVA 3RXJA 5AHGH 4B76A 1C5QA 5E2PA 2HPPH 2V7QD 2STAE 3RXKA 1LPZB 2VIVA 1P9SA 5K0HA 3PB1E 3M5MA 1O5BB 2LNCA 4FUDA 2BQ7B 4WMFA 2SNWA 2BZ6H 5DG6A 1W0KD 1LCYA 3M37A 4HI3A 2TRMA 1HJ9A 5H4IB 4INKA 3C27B 1YCPM 3KHVA 1SLWB 2Q6DA 1QRWA 1AGJA 1AUJA 4FXGH 1SQRA 2EC9H 1E38B 1TGTA 3LGUA 4H42U 3U1IB 1EAUA 2ZI2H 1C2LA 3ATIA 2WPLS 2XBYA 2KAIB 3A89A 4YZUA 2FZZA 1QBOA 2VWNA 4OGYA 3PTNA 3LONA 3BTKE 1EXFA 3STJA 1BITA 1ELGA 3T27A 3OU0A 3M36A 1UVOA 1GBEA 1PYTC 2C8XB 4J2YB 2ZA5A 1O2QA 3IWMA 3TK9A 4WY3A 5HXFA 1C5WB 2KFWA 4BTUB 4YLQH 1GI1A 1NY22 2RDLA 2ODYB 3NCLA 1GHBG 3SGAE 3MH7A 1Y59T 4OS5A 1YPHE 3NK8A 1PPBH 3OY5U 1O38A 1KLIH 2V3OH 2EI6A 1GGDB 1Y3WA 4I33A 3I29A 2J94A 4MNXA 1D3QB 1XM1A 2WPIS 1BMMH 5JYIA 5EXNA 1UK3A 2CGAA 1WDIA 2F9UA 3SU5A 5C5NA 5E8EH 1C2EA 1DS2E 1O2MA 2K1QA 1O3CA 1WTGH 5DP9A 2WPDD 4E05H 2VJ1A 4MNWA 2ANKH 4BAMB 1O2KA 4O97A 1B5GH 4PROA 4CRFA 4KTSA 3CS7A 3I77A 1UHBA 2FPZA 2ZDAH 2VVVA 1C9PA 1GJ7B 4IC5A 2R3UA 1GBAA 3O8DA 3P70B 1SB1H 3RXHA 2FI5E 3F1SB 4UFGH 1SGTA 5GCHG 1HDTH 3I78A 1LKAA 2A31A 3F2GA 9LPRA 2FLRH 3SUDA 2M5TA 4Q63A 1O2TA 2R9PA 1Y3UA 1BBRK 3RXIA 5C0UA 1O2RA 1FUJA 1C2DA 1Y3VA 4AYYB 1DX5M 5EQSA 1G3DA 2BDBA 2ZDNA 3FZDA 2FP7B 1XVMA 2BLWA 1TPPA 1GI9B 3TGIE 1LVMA 2HLDD 1SGNE 2QF3A 3P8FA 3RU4D 1SQOA 1UW7A 3W94A 1P2JA 1FPCH 5FPYA 1ZHMA 2R2WU 3A86A 1D3TB 1ABIH 3T62A 4NWLA 3TITA 4TWWA 5EG4A 1AD8H 1CE5A 1YP9A 2H9HA 2VIDA 1DPOA 4GUXA 2WV5A 2BVXH 1EZUC 1MAXA 1NRPH 2SFAA 3CS0A 1NBME 1P2KA 4RKJB 4OS7A 1E79D 9ESTA 1PQ7A 2PKAA 1OWEA 1RTKA 5A8YA 2VH0A 1C5PA 1W10U 1GBIA 1S81A 1AE8H 1EP6A 1G2LA 3LOXA 2W6JD 3M5LA 2QXGA 2A4QA 2GZ9A 4Y6DA 4ABFA 3UNRA 3JZ2B 1GI4A 4XE4A 4ZKSU 3A7YA 2BDIA 1GHBF 3SI4H 1YBWA 1MQ5A 3F0PA 3SOSA 4XD7D 1TQ7B 2EI8A 1IQJA 2CXVA 5DPAA 2IN2A 4AX9H 1YM0A 4AB9A 1KDQB 4CBNA 4DVAU 2GX4A 3A7XA 1GJAB 4I8LA 1SHYA 3LJJA 1BRUP 1XUIA 1C5OH 1S6FA 2ZC9H 1SSXA 1GI5A 4NA8A 3ZZ6A 5IDKA 1BJUA 1MTSA 4HTCH 1FIZA 3MO3A 2JDID 1FONA 4D8NA 1F5KU 3EGKH 1NN6A 2AERH 2ZCHP 1QRZA 3BTHE 2YMSB 2THFB 5J4SA 4IC6A 2V3HH 1KLJH 1P01A 2ZGBH 3N7OA 5TJXA 4ABEA 2J98B 2OC8A 1O2JA 1ZRKA 2Y80A 1KTSB 4INHA 1LDTT 1K1NA 1TMBH 3BTFE 4BAHB 1AZ8A 2BYAX 1EPTC 3FP6E 5GCHF 3FZZA 2FX4A 3HPTB 1HNEE 2D1JA 1VGCB 1C1SA 1OOKB 1E1RD 2GTBA 1ZHRA 2PHBA 2FX6A 1GVKB 5ABWA 2V6NA 3MYWA 3R3GB 1IQFA 1NS3A 3BTTE 2SGFE 1OHHD 3TLOA 3RU4T 1PPGE 2ANMH 4Q7ZA 3P17H 1H9HE 2Q6FA 2QF4A 4CR9A 3UY9A 5E0JA 3FN8A 3ZVCA 2G52A 3SBKA 2IPHA 2HWLB 3LT3A 2Z3DA 2DE8A 3SNDA 1VJAU 2RFKC 3PMBB 3S9CA 2C4FH 2GP9B 1XVOA 2CHAC 3FKSD 1L0ZA 1VITH 1OWDA 1BTPA 1TNLA 4X1SU 3QZQA 3RLWH 1Z8IB 2KX4A 2PTNA 3VB3A 1GHWH 3DA9B 2BB4A 2P94A 4RT0A 5J4QA 8ESTE 5A09A 3MH4A 3TJVA 3BN9A 1W2KH 2GJGA 4IN1A 1H9LB 3RMOH 2AH4X 5FX5A 3VXFH 3MU0A 3M7TA 3U8TH 1FZZA 1EP5A 3RXCA 2NU0E 5FHTA 1H8IH 1NC6A 1NESE 1TNJA 5DP5A 1NTPA 1SMFE 1OXGA 1XUFA 4X8SH 1O2NA 6GCHG 1EKBB 2OXSA 1A5HA 1BMNH 1O3BA 5A2MH 1LQEA 3BTGE 2XBXA 4DOQA 5EIYA 2ZTXA 2AGGX 5JB9S 4H6TA 4Y7BA 1TMUH 5EXLA 4BXWA 1C2FA 3K2UA 1L1GA 4ZROA 5BPEA 1OKXA 1EPTB 1AZZA 2BLQA 3BG4C 3OFND 2FOCA 2H6MA 3AK5A 2SGDE 2PFEA 2FOMB 1KIGH 2WINI 2LPRA 7ESTE 2LELA 2Z9KA 5HM9A 2OC0A 2PGBB 1OWIA 2P3UB 3A81A 4INLA 3UWIA 2KR7A 1O3PB 3DT0H 2G81E 4JCNA 2FOAA 1C1PA 1FLEE 4JZ1A 5HIZA 1LVBA 1VCWA 5ETXA 3FO8D 1NU9A 5T6FA 1O0DH 2A4GA 1GBKA 1O34A 3MFJA 2BVRH 3E3TA 1C5UA 2GV7A 1O2GH 2W3KA 1GHVH 1GVLA 1S83A 3BTEE 3ZZ4A 2KCOA 3BSQA 2VIWA 2Z3EA 4IBLH 1KYNA 1P04A 2ZQ1A 2WPJS 5C0TA 2FWWA 4DJZB 1UCYE 1FY5A 2VU8E 4WXIA 1SVPA 2ZDLA 4Y7AA 1DWEH 1JXPA 1C1TA 1EB2A 1IHTH 1F92A 3H7OA 1THSH 4RSPA 1BA8B 1HAYB 1HGTH 4FUEA 4DIHH 5FCKA 1O3OA 2RCEA 3URCA 1UTLM 1EASA 1O3LA 4BXSA 3E0NB 2WPKS 1NPMA 2BHGA 4OGXA 1ZLRA 3BG8A 1ELCA 4RI0A 1DWDH 1K1IA 1KXCA 3GCTG 4R0IA 4X8TH 3ZZ7A 3WWBA 1NBMD 4HG6A 3WWFA 1GHXH 3QGJA 2UWOA 3T26A 1YWUA 1C9TA 1UVPA 1S82A 1O3EA 2B8OH 1QB6A 1IQHA 1AVXA 3OY6U 1CGJE 2F91A 1VZQH 2J5UA 4H4FA 1TGBA 1TFXA 3A8DA 4TY7A 4ZAEA 4JYUH 2KM0A 1AQ7A 2C90B 1GDUA 1A7SA 1Y3XA 2A7JA 3KN2A 3MH5A 1TABE 4ZH8A 2ZKSA 5T6GA 2YNAA 3KYGA 1ORFA 1MH0A 2ZFQH 3A7WA 2A2QH 1W8BH 1EAIA 4AFUA 1W7XH 1YF4A 3PRBA 3SNEA 2G4UA 2HRVA 3EE0B 2VWMA 4BTTB 1ZGIA 5K7RA 3GY7A 2JIZD 2ZGCA 6GCHF 2NU1E 1TNHA 3W95A 2JETC 3DSPA 2BTCE 4DCDA 1ETRH 1W0ZU 1W13U 2BDYA 2BXUH 1TA6A 1TOMH 2Y5FA 2Z94A 3KQEA 1A2CH 1PPCE 3RXEA 1LPKB 1WSSH 2W7UA 3KQCA 1ZSKA 2ZGHA 3T29A 2Q6GA 1AKSA 4TWYA 5KECA 1AVGH 2HALA 4IS5A 3NUMA 1G3CA 1V2KT 3N7EA 2H5CA 2ODPA 2ZU2A 1V2MT 2O8LA 1BQYA 1GJ4H 4Q80A 3N99A 3A88A 5DGJA 1ZSLA 1ZTLA 3HK6B 1BMFD 6LPRA 3FAOA 4NIYA 3GY5A 1C2IA 3RXPA 2GZ8A 1FJSA 2ZTZA 1NFXA 1MZDA 1E35B 1V2VT 3E90B 3T5FH 1ELAA 1ZJKA 1AWFH 1GMDG 1WBGB 2IJD1 3S9AA 1Y5BT 1P2OA 4CHAB 3F3BA 1CBWB 2OINA 1T8OA 3QGNB 5T6DA 2TBSA 3PYHA 6ESTA 1K22H 1TPOA 1A61H 5F8ZA 3RXBA 2UWLA 2PWXA 4IGDA 1DANH 2G8TA 1N6YA 1CU1A 3AAVA 2FI3E 5LPRA 1BDAA 2M2AA 3MNXA 3EA9A 2TGTA 4NZQA 3GCTF 1QL9A 1PPHE 1BTXA 5GXPA 2GZ7A 5EW1H 1GI7B 3PWBA 1FNIA 2PV9B 1EB1H 3ZZCA 1C1WH 5C94A 1C5YB 1TNGA 2JETB 2ZFFH 4IMQA 1FAKH 2EY4C 3RXGA 3CENA 1G36A 1P57B 3G01A 3VG8A 2WYJA 1THRH 2JH6D 2ZHFH 1SGPE 4AGKA 4RKOB 1KY9A 1IAUA 1MTWA 1C2MA 3NWUA 3E8LA 1HV7A 1GI0A 1GMCG 1OYTH 4YM9A 4NIVA 1BHXF 4IMZA 5DKMA 3RXLA 1YPMH 1NROH 1YPGH 4HZHA 1N8OC 3ZZ9A 5HMAA 1BMAA 5C5OA 1T31A 2QGRA 2ZPQA 2F9OA 1AVWA 1SFQB 2FOGA 1SPJA 4B2AA 5BRRE 1YLNA 1GWAA 3BEUA 2BY8X 3RXVA 1MKXK 4NFEA 3ODFA 3TPIZ 3RC5A 2GGVB 5DSFA 1ZR0A 4RN6A 3KF2A 1KXFA 2G4TA 5C3NA 2SGQE 1GJ9B 4K69A 1HIAA 3AAUA 3GY2A 1S0QA 3F2HA 2BVSH 1O5GH 4NSVA 2WPHS 5CDFE 1L4DA 3MHWU 3PV2A 3DUXH 1C5RA 1DDJA 3P8GA 3NKKA 3SUEA 1C5XB 1NU7B 3SN8A 3UOUA 1K2I1 1E0FD 3W1EA 2GV6A 3ZZ3A 1HB0B 3OE7D 2F43B 4FVBA 3VGCB 2BQ6B 1EATA 2H5DA 4AGJA 1IHSH 2A32A 2G51A 2JJ1D 2Z7FE 1TYNA 2CK3D 1GMDF 1P2QA 3GCNA 1N1LA 3BIVH 1K0HA 5LGOA 1DICA 1KMHB 3E6PH 3PO1C 5C1XA 2FIRH 4YT6H 5T1VA 5DP7A 3EE7A 1AFEH
chains in the Genus database with same CATH topology
1DT2A 1ZRBA 3JZ1B 1MBQA 1TGSZ 3BEFB 1Y8TA 3RXDA 4X8UH 1DY9A 1NRSH 2Y81A 4MVNA 1PYTD 1TRMA 1ZGVA 1XUGA 1XUKA 1LVYA 1JMOH 3A82A 8LPRA 1BBRH 2FYQA 4F49A 1DVAH 3A7ZA 3RM2H 4A92A 1QJ7B 4K8BA 1N8OB 1K1PA 3BIUH 3DFJA 5AFYH 1HPGA 4Y79A 1BRBE 3RMMH 3SJ8A 1V2JT 1HAPH 1BT7A 3RDZA 3UQOA 3OYPA 3D65E 1AIXH 5EODA 1KSNA 4X2WA 1W0YH 3URDA 2W7SA 2R0KA 3KCGH 4FVDA 2GVFA 1GBMA 5A0BA 4DGJA 1VITG 4KP0A 1QY6A 5C67A 1C2JA 7GCHG 1FY8E 1P2MA 1GMCF 3P6ZB 1GBLA 5L2YH 5A0CA 1W3CA 4AZ2B 4FUJA 4Y10E 4LK4A 4X6PA 3EQ0H 4JYVH 1GHZA 1O5AB 2GDDA 2WV4A 2BXTH 1C4Y2 1QA0A 3OSYA 1P9UA 2O8UA 4KELA 1JRTA 1HJAB 5DO4H 3Q3XA 4IW4E 2G55A 1KLTA 1XUHA 3DD2H 2ZECA 3TK5A 3SNAA 2A4RA 2CMYA 1F0SA 1DY8A 2A7HA 2ZP0H 1WUNH 4FUCA 3ODDA 4YOGA 2ZNKH 1HYLA 3DHKH 1T8LA 3QDZB 4D9QA 5I46H 4X2YA 1X7AC 1ID5H 1JOUB 1JWTA 1HAGE 4LOYH 4AFSA 3EYDA 1OP2A 1WTHD 1DSTA 4X6OA 2FTMA 1BRCE 4K60A 1V2RT 1A46H 4D7FA 1O3IA 3UREA 3NZIA 3F9FA 2GMTC 3S69A 3RXFA 3F68H 4AFZA 3PLKA 2QXIA 1FN6A 4OS1A 3RXSA 3GY8A 4I7YH 5JBBS 2OQ5A 1G30B 4K1TA 1DWBH 1SG8B 2OC1A 1UVSH 1BIOA 3KQDA 3ZVDA 1AKSB 3QUMP 4BAOB 4X0WU 3SJOA 3V7TA 3ZVEA 4ISHH 1OX1A 1PQ5A 3IITA 1ZSJA 3D23A 1GJ5H 1AB9C 2P3TB 1UTQA 4MNYA 5JB8S 4FU8A 4CRGA 1O30A 1AFQC 3K65B 4Y8ZA 1RTLA 3NPSA 3TNSA 2FMJA 4ZKOU 3MU5A 1M9UA 3RM0H 5FAHA 1QQUA 1Z1IA 1WAYB 3MNBA 1Y5UT 3BF6H 3U8OH 1W11U 4GAWA 2FOFA 2XNIA 3A87A 3DFLA 3Q3YA 4O3UA 4CBOA 2UUJB 1ETSH 1KXEA 5G4BA 3F9GA 1GI6A 2ALPA 1F0UA 1UCYK 3FP8E 3ITIA 1YYY1 1ANEA 4MNVA 5GWZA 3ZVAA 1QHRB 4ABDA 3LGIA 1TMTH 3ESTA 1VITF 4I8GA 2BX3A 3K9XB 7GCHF 1PFXC 1LKBA 1ZJDA 2BY7X 1Z6JH 3B8JA 3L3TA 2A0QB 7KMEH 3A8AA 2NU2E 1O39A 4LZ1H 1JIMA 1HRTH 1XMNB 5HYOA 1GJCB 4BAKB 1D3PB 4BNRA 1AI8H 2QXJA 1G3BA 3SHAH 1HXFH 1YLCA 2A5IA 3Q3KA 3SNBA 1O3KA 1ANDA 1Q31A 2CF9H 2IJOB 1SOZA 2HNTF 1HAZB 4CRBA 1W12U 3UPEA 4UDWH 4JZDH 4ABHA 1J8AA 5JBCS 2B5TB 1MKWH 5EOKA 5E0HA 3SNCA 1J16A 1FY1A 1BCUH 2VH6A 3K6YA 3NXPA 4Y71A 2ALVA 2P16A 4MPVA 3UOPA 1CT4E 2B9LA 3PV4A 1P12E 2H2ZA 5F6MA 2OCVB 1Z7KA 3UTUH 1OWKA 5CHAC 1ZPBA 1YPJH 1SLUB 1AB9B 4AORA 1CVWH 3GY4A 4TY6A 3BTME 4Y8YA 1C2HA 1TE0A 4AN7A 2ZFSA 1AFQB 1EQ9A 3STIA 2O8TA 3ZZ5A 2OTVA 2UUYA 5FBEA 5EPNA 1ACBE 5ESBA 4I32A 5EGMA 1SGCA 3RXAA 3TH2H 2JH5D 5TCAA 1HAVA 5F8TA 1SGRE 1O2WA 1PQ8A 1TOCB 2Z9IA 4AG1A 2AIPA 1D4PB 1ESTA 2WPMS 3Q77A 3LPRA 1OP8A 1O5DH 4X1QU 4B2CA 3SUFA 3LGYA 4X1RU 3T2NA 3SU6A 2GD4B 3H5CB 3AW0A 1SBWA 1GBTA 1QGFA 2ZQ2A 2ZDVH 4LZ4B 2Y5HA 2AGEX 2Y82A 4HFPB 1O37A 1XXFA 2AEIH 2ZDKA 2PSYA 5B6OA 2GDEH 1GDNA 3UIRA 1EAWA 4JZEH 3SV7A 3RMLH 4Y8XA 1MKWK 1TNKA 1TPSA 4CREA 3HKIB 1ELDE 1MU8B 1DE7H 1RJXB 1P0SH 1ELTA 1F0RA 1P09A 4ABIA 1LQDB 4BOHA 1CA8B 3RXOA 3A8CA 4BAQB 3HGPA 1EZQA 1O3HA 4FUFA 2BDGA 2ILNA 4NG9H 1O32A 5CHAB 2R3YA 1MD8A 2C8ZB 4Q7XA 4YOIA 4BANB 3ZZDA 3KL6A 4KTCA 2XC0A 1W14U 3PMJA 1LHFH 2BZAA 1A5GH 4CRAA 4MPWA 1QQ4A 2AS9A 1BB0B 4X1PU 2WUBA 1T32A 1DUAA 3TJNA 1GL1A 3B9FH 1RXPA 2QY0B 2XWAA 3V3MA 2VINA 2G5NA 1HUTH 4UE7H 3SU1A 1INCA 1UJ1A 1ARCA 2OBQA 2A2XH 1C1NA 2CHAB 3SJIA 3UUZA 1L4ZA 3L6PA 1QB1A 1FMGA 2Y5GA 6CHAC 1O2XA 3SV2H 5F03A 5I25A 1NZQH 2SGAA 3TK6A 1IOEA 2P8OC 5JDUB 2ZPRA 1EOJA 1IQEA 1D6WA 3LDXH 1N6XA 3TVJB 1E37B 5L6NH 2HGTH 2HOBA 2XBVA 1UHBB 4VGCC 2SNVA 1BTHH 3V0XA 4GVUA 4ISNA 2ZDMA 3TNTA 2ZU3A 1NRRH 4ZHAA 1GBBA 1V2LT 1TALA 1IQGA 1K9OE 1HLTH 2FESH 2I6QA 1DWCH 4KTUA 4UONA 2OQUA 2FS9A 3VXEH 1GBCA 1QCPA 1YPLH 2VIOA 3EDXB 5C2ZA 1L1NA 1NFUA 3GYLB 3EA7A 1BZXE 1C1OA 2ZF0H 1ELFA 1C4V2 1TWXB 5GDSH 4F4OC 1MAYA 1ZOMA 4Y76A 3BG4B 4FU9A 5GJ4B 1TPAE 3AW1A 2BD2A 4GHQA 1A4WH 1O2UA 3FFGA 2P3FH 3O8CA 2DUCA 2BOKA 3ENSB 1AU8A 4UFDH 3PLPA 2OP9A 2QF0A 1G32B 1QB9A 1NRQH 1O3GA 2Y7XA 2C3SA 4UEHH 2CV3A 1QJ6B 1V2QT 2OBOA 2PKSC 1GCTC 3QTVH 4FUGA 1TRYA 1EUFA 2AMDA 1VR1H 2PKAB 2TGDA 4JZFH 4K1EA 1IQKA 3LKWA 3SUGA 1XUJA 1O5FH 1Z8GA 2BD7A 1FDPA 4NZLA 4ZXXH 2Y6TA 3SU3A 2TGPZ 6CHAB 4AB8A 1MCTA 4GSOA 4ZHLU 2P8OB 1MKXH 3LGWA 3GCHC 3PLBA 2ZU1A 4ZKNU 2V35A 4H6SB 1TLDA 3FANA 5DP4A 4DG4A 4QT8C 3U8RH 1AUTC 1BJVA 2D8WA 3V12A 1O5EH 1QURH 3TH3H 1KXDA 1QNJA 2ZGXH 4OS4A 1O2ZA 3VB7A 1GBJA 3GICB 1PJPA 5DP3A 4XOJA 1H9IE 3MNCA 4O03A 2FI4E 2Z9JA 4ABBA 5AFZH 1O33A 1V2ST 3M7QA 1TGNA 2HPQH 2ZG0H 3VB5A 4D9RA 1EZXC 1MQ6A 4O3TA 4CRCA 4THNH 2PTCE 3LIWA 1GG6C 4X2XA 4I8HA 4NSYA 1YPKH 2BY9X 1GBFA 1PQAA 2F9NA 3GY6A 3H7TA 2BY5X 3GYMA 4MPXA 1GI3A 1P11E 1RIWC 3MU8A 2Q1JA 2A5AA 4Z0KA 3UFAA 1B7XB 1IQMA 2J9NA 1D6RA 1AWHB 4WH6A 1WU1A 4K2YA 1O2HA 3RC6A 3P92A 1O2LA 3TIUA 3QO6A 4B73A 1OSSA 3A7VA 1TX7A 1QL8A 1FN8A 1DXWA 1KDQA 1YCPK 3RU4E 2FM2A 1MD7A 1DM4B 1IQNA 3MO6A 3ZV8A 1S5SA 2PKSB 1GCTB 3K6ZA 3PWCA 4GPGA 1PPZA 4NIXA 3PTBA 1ZTJA 1O5CB 3ZZBA 4DW2U 1HAVB 1JIRA 5EXMA 1G2MA 1UTKA 4WVPE 1RFNA 1GMHG 1GJ6A 1LHCH 2FO9A 4NIWA 4K5ZA 1THPB 1UMAH 2GKVE 3KGPA 3O8BA 2BDHA 3SV8A 3SQEE 1OP0A 3GCHB 2OUAA 2C8WB 2QYIA 5A8ZA 1U6QA 1MTVA 2J38A 2XWBI 3ZZAA 2ZGJA 3S7HB 3V13A 2B0FA 2W5EA 1DOJA 2FEQH 4XBCA 3C1KA 4IN2A 1J14A 1GDQA 3HK3B 2AIQA 4ASHA 2FOEA 1EX3A 1S84A 2PSXA 3WY8A 5JBAS 1K1JA 3UR9A 2G00A 5A8XA 1J9CH 2JH0D 2C8YB 2QXHA 1TRNA 2QN5T 4XBDA 1F5LA 2QV1A 3LGTA 2WYGA 1G37A 3TH4H 1Y5AT 4X1NU 4OS6A 2TIOA 1GI2A 3VFEA 2G5VA 3KQBA 4Q2KA 1MBMA 3F9HA 2AMPA 3RLYH 5C1UA 1BTZA 1UK2A 2TGAA 1MUEB 1SQTA 2ZIQH 3IG6B 3LH3A 1HBTH 3RXQA 5FX6A 1LVOA 4MG3A 1OWHA 1GL0E 2QC2A 4MDSA 1Q2WA 1A0LA 2BD5A 2NU3E 1GBHA 3CP7A 3QN7A 2FODA 2F9VA 4B74A 4DY7B 4SGBE 1QA7A 1XKBC 1F7ZA 5E2OA 1IQIA 2A4OA 4B71A 2ZHWH 1RRKA 2QA9E 2BQWB 5E0GA 1AHTH 1C1QA 1T8NA 3MOCA 2J4IA 1YC0A 2RG3A 2A1DB 1ZPZA 3E16B 2VIPA 3SV6A 1V2UT 2CN0H 1HAOH 2Z6BD 3UNSA 1UVTH 5DP6A 4MQAA 1BTWA 1EPTA 7LPRA 1ETTH 4TYDA 1LHEH 4ABGA 4FU7A 1NM6A 1V3XA 1BHXB 1Z8RA 1WOFA 1LTOA 1QBNA 1F2SE 1GMHF 1CA0C 2D2DA 1NFWA 1WYKA 1P10A 2PGQB 5CE1A 4A7IB 3R0FA 2PUQH 2PW8H 4ZXYH 1WQVH 1SGYE 2XC4A 1UCYH 1A0JA 2FDAA 2SGPE 1OS8A 1GI8B 4U2WA 3SU2A 3E1XB 1L1JA 1DLEA 1C4U2 1C5NH 1SGDE 4D76A 1ELVA 1GBDA 2ODQA 4AYVB 4ZHMU 1SI5H 3M5OA 1ELBA 3LC3A 1CHOG 1O2IA 3GISB 1YKTA 3PO1B 4YO9A 3F9EA 3A7TA 3M35A 4YTAA 1KXAA 1P2IA 1FY4A 3RUOA 1V6DA 1O2VA 1EAXA 1BTUA 5LH8A 1DFPA 1YLDA 1CQQA 3E91A 1MMJN 3SORA 2ASUB 3SQHE 1KXBA 4XSKU 1VCPA 1ANBA 2STBE 2A45B 2AGIX 1TX8A 1D9IA 1O3MA 1O2YA 1ZYOA 1LMWB 2ZZUH 4GHTA 4OS2A 4U01A 5FXLA 3ZVBA 3RXMA 2O9QA 3E0PB 2YOLA 3UNQA 1BOQA 1C1VH 4BTIB 4LXBH 4UD9H 4Z6AH 2UUFB 2ZFRH 3Q00A 4TPIZ 4B75A 5FCRA 4WXVA 3ATLA 2P95A 3RC4A 4K3JA 4D7GA 1DITH 5JPMH 1MU6B 2BD8A 2JKHA 1FY3A 2XXLA 3A8BA 1CA0B 1C2GA 1MTUA 2BLOA 1ZMLA 3FVFB 1VGCC 4I31A 1UTNA 2I6SA 3GCOA 1QTFA 3OX7U 1A0HB 1OPHB 2F3CE 2TPIZ 1LHDH 1CT2E 2BY6X 4KGAA 5EPYA 4HGCA 1RGQA 2F83A 2AFQB 2ESTE 5LPEA 1ZMJA 5DJ7A 4WF8A 4WH8A 1J15A 1GCDA 2BDAA 5A0AE 1BUIA 5GPIB 2H9TH 1A3EH 3A83A 2AYWA 1TA2A 2BOHB 1ANCA 2GMTB 3GDSA 2ZEBA 2DE9A 1K1LA 2ZHEH 1QR3E 4E7NA 2BD9A 3GOVB 1C5ZB 1CHGA 1SGFA 3S7KB 1QRXA 1ZPCA 1GJBB 1XKAC 1CHOF 1NRNH 2ULLA 3SV9A 1GPZA 2XCFA 3HATH 2BLVA 4JK5A 2FOHA 4CR5A 2O8WA 2UUKB 1HFDA 1A5IA 1RS0A 1WV7H 1C1MA 2ZFPH 1TBQH 4YLUA 3A85A 3KEEA 4ISLA 1MTNC 2VNTA 4CH8B 3FP7E 3RXUA 2HNTC 1O2OA 1TONA 3M3TA 2ANWA 3F6UH 3MU1A 1SGFG 3D49H 1NT1A 4K8YA 1AMHA 3QWCH 2ZHQH 4MPUA 2VVCA 1HIAB 3TJOA 5T3HA 1HCGA 2J95A 1RTFB 5SGAE 1V2PT 4ISIH 1QIXB 1C5LH 1V2NT 2Y7ZA 2V0BA 1GVZA 3ZVGA 5DP8A 5F8XA 2FLBH 4TPYA 2NU4E 4DT7B 5C1YA 2VWLA 2FXRA 1AO5A 3U98H 1ELEE 1Q3XA 3SJKA 1OYQA 3M3SA 3ZYEA 3RMNH 3AVZA 5FBIA 5HM2A 1GHYH 4B1TA 1CGHA 1L2EA 3HGNA 1EJMA 5FPTA 1A1RA 2GCHG 1RD3B 1TB6H 3P95A 2ZFTA 4NA9H 3SZNA 5EQRA 1VJ9U 1TGCA 4XDEA 1P02A 1LO6A 3M61U 3MH6A 2FS8A 1K21H 3P8OA 4SGAE 1C5SA 1C5MD 2XW9A 1YPEH 3U9AH 5HGGA 1AY6H 2QAAA 4A1XA 3QK1A 1ESAA 4ABJA 2H9EH 5L30H 3U69H 1ABJH 4X6MA 1SGQE 3ATWA 3D62A 2FOBA 1SGIB 3Q76A 2ZWLH 4XFQA 1FIWA 5ESTE 4Y11E 3RXTA 4FUBA 4ZUHA 2CF8H 4I8JA 3TGKE 1YPHC 4Q7YA 3LJOA 2HLCA 1BBRE 4O9VA 1SFIA 1MTNB 3LU9B 4A6LA 1C5VA 4U32A 2OC7A 5JBTA 4NCYA 1F5RA 2ZO3H 4AOQA 4WMEA 4U30A 1KTTB 2Z3CA 4MTBA 2F9PA 3BTQE 3PMAB 2XBWA 2PLXA 3MI4A 3VB4A 2ZCKP 1CGIE 1TBRH 4AG2A 3SI3H 2QCYA 1C