1NESE

Structure of the product complex of acetyl-ala-pro-ala with porcine pancreatic elastase at 1.65 angstroms resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the product complex of acetyl-Ala-Pro-Ala with porcine pancreatic elastase at 1.65 A resolution.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ELASTASE
total genus 59
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1995-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1nesE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1nesE01
2XTTB 3SUFA 1SHHB 1QNJA 1O3CA 1ZSLA 2BMGB 3VB5A 1FPCH 1IOEA 1ZGVA 2ZHEH 1Z71A 1TABE 3MU5A 1AU8A 1SL3A 1TGTA 4OS7A 1G2LA 1UJ1A 3SV6A 1DLKB 2B7DH 1EJNA 4CRAA 3B9FH 1SGFA 2TGTA 2NWNA 3RXKA 4I33A 3URDA 4DY7B 2FXRA 4FUFA 1IQFA 1GBBA 3LH3A 1AY6H 1DWBH 1UO6A 1TOCB 3E6PH 3RDZA 1TNIA 2A2XH 2OINA 1OWIA 1PPZA 4IGDA 4NFEA 1Z6JH 3VFEA 3QUMP 4BOHA 2FOEA 1JRSA 2PSYA 2J9NA 2ULLA 1P2KA 3LPRA 2OLGA 1V2RT 3DT0H 5FBEA 2CMYA 2F9UA 3TJNA 2A45B 1D6WA 1D3DB 1YPEH 1AE5A 1VJAU 3KIDU 2DE8A 4E7RG 1H9LB 1Y3XA 3QWCH 1GJ7B 3ZV8A 1EOLA 3GY3A 3V7TA 1G37A 1C1RA 1XVOA 1ZPZA 1Y3VA 4UONA 3LIWA 1BOQA 6GCHF 4Y8ZA 1FQ3A 1VCQA 2O8UA 1AI8H 1HPGA 2CGAA 4A7IB 1K28D 1ZR0A 1KLTA 4ZH8A 1AD8H 3TPIZ 2R2MB 3KQCA 3MNXA 1Y5AT 2XWBI 3D62A 3TGKE 4MPVA 3SNBA 1SOTA 3RXRA 5PTPA 1L0ZA 1O33A 1W13U 4CRBA 2EI7A 3B23B 1G2MA 1B0EA 1RTFB 3UTUH 4CRFA 1XXFA 5GPIB 1IQLA 1PJPA 2NU4E 1INCA 2AIPA 4JK5A 1TPPA 1BMAA 2FM2A 3MU8A 1ESBA 2HPPH 1MZDA 4XBBA 1GHYH 1ID5H 2SGAA 1S82A 3M3VA 1O30A 3MH5A 3UFAA 4J2YB 2OP9A 2RA0A 4KTSA 3MU1A 1LKBA 3T26A 5JBAS 3AAVA 4UDWH 1P3CA 3SU6A 4AFQA 1LCYA 1ETSH 5HYOA 1K1PA 1SOZA 2AYWA 3P8OA 1A46H 3TNTA 3QZRA 4MPUA 2HRVA 4A1XA 4X8VH 2WPJS 1QURH 1O3JA 1NRRH 2FIRH 3KQDA 3M7TA 1GBMA 5F03A 1Z8JB 1AIXH 2RDLA 2AEIH 4GVUA 3KF2A 3ZVCA 4Y11E 1V2OT 1Y8TA 1QL9A 3TIUA 2YOLA 3U98H 2PUQH 4RKJB 4LZ4B 1A4WH 3PLKA 2TRMA 5JPMH 3MI4A 2WPHS 2FOBA 1ANCA 1TWXB 1Q2WA 1FMGA 4ISHH 3NWUA 4YOJA 2CF9H 3PROA 4Y71A 2ZGHA 1C2DA 1O2MA 2W5EA 2GMTC 1Y3WA 1GDQA 1KIGH 1Z1IA 2SNVA 6ESTA 1SGCA 5ABWA 5GWZA 2GCHG 2BZAA 2Z7FE 1MAXA 1DSTA 4O9VA 2D2DA 5EODA 4Q7XA 2BLVA 1OS8A 5DO4H 1E37B 1G3EA 1NRNH 2AERH 1MTUA 4XBDA 4IN2A 1AB9C 1NU9A 1H1BA 4WXIA 1WV7H 3T27A 1BTYA 1T4VH 2ZIQH 4ZHLU 1EZXC 4AORA 4GCHF 2VVUA 1QQUA 2GCTB 4FVDA 5L30H 1JOUB 3S0NA 2BYAX 2Z3CA 4U30A 1GHBF 1MTWA 1OWJA 1O5AB 1NTPA 1HXEH 1MBMA 3BTWE 2ZEBA 3ZZCA 4Q7YA 5JBBS 1SBWA 2ZFTA 2VIPA 3PLBA 1P10A 1O35A 4YOIA 1VJ9U 4I8KA 2ZQ1A 1YPMH 3M35A 1NRPH 4X2YA 3QGNB 1GJCB 3P8FA 1HJ8A 4NWKA 1OWDA 4K60A 2ZPQA 3RP2A 4FUCA 1P3EA 1ETTH 1RIWC 1BDAA 1IHTH 4CBOA 1ZJDA 1MKXK 4Y79A 4AN7A 2FTLE 4XDEA 5ETXA 2OTVA 4TWWA 1DVAH 1OWHA 5EXNA 4D9RA 3SNDA 1H9IE 1HAOH 2R0LA 2QV1A 2ZCHP 4FU8A 2ZFSA 3UNRA 1PPGE 1YM0A 4GSOA 4F4OC 3SV8A 3W94A 5K7RA 4ZKOU 1LVOA 1A3EH 3BTTE 3GCHB 3RXUA 4ZKSU 3M5LA 1TONA 4Q80A 5JBCS 2PHBA 1EJMA 2AMPA 3V3MA 1V2MT 1IQJA 1JIMA 3ZYEA 1E36B 1O0DH 2OQ5A 1AUTC 2G81E 1TBZH 1EPTB 3UQVA 2GKVE 1G3DA 1GJDB 2PW8H 1DXPA 1LO6A 3SJKA 3RXGA 1V2TT 1NFUA 1CA0C 3TK6A 4K8YA 3SU3A 1PQAA 3KCGH 3TVJB 5IYTA 2GP9B 1NT1A 2A4RA 1GI9B 3ZVFA 4B73A 1HDTH 2ZG0H 2GVFA 1AZ8A 3LGWA 1BT7A 2C8XB 3LKWA 2B0FA 2V6NA 1P06A 1VITG 4U32A 3UIRA 3AAUA 2PFEA 1A0HB 1Y5BT 2JH6D 1ZHPA 4BXWA 4CBNA 1DXWA 3MOCA 4I7YH 5HMAA 1DWEH 1UVUH 5B6OA 3U9AH 1W11U 1NRSH 3UPEA 1HAVB 1L1GA 1FV9A 3O8CA 2QY0B 3IG6B 5C1UA 4BAMB 3NCLA 2KAIA 3TU7H 3A7TA 4AFUA 2AFQB 2GZ8A 4MNYA 2KAIB 2G5VA 1HAXB 2BY7X 1DITH 4NA7A 3RXTA 5F8ZA 3VPKA 1Z8GA 1QQ4A 2J95A 3M7UA 3V13A 4AGJA 1LVMA 2GTBA 3TJOA 8ESTE 1K1IA 5A09A 2GMTB 4B1TA 2ZDKA 1QR3E 2NU3E 1QTFA 2ZWLH 4ESTE 3SU1A 1ELVA 4GPGA 1KTSB 1P2MA 3SJOA 3SQEE 2BD9A 5EXMA 3E16B 5EPYA 4YTAA 2O8TA 5A8XA 2XC4A 1ZHMA 2IPHA 1S81A 3BEUA 1V2VT 2UWPA 3GICB 3RXJA 1Y59T 5GCHG 2XBXA 4X6NA 4AFSA 1RGQA 2G52A 5EU8A 5DG6A 4JZDH 2PKSC 4DIHH 1X7AC 1G9IE 1GMCG 1GJ8B 3EGKH 1C1WH 3GCNA 2XCNA 2PGQB 1N6XA 2OC7A 1MH0A 2WYJA 1GJ9B 1YC0A 1TRNA 4Y0ZE 1O5DH 1WQSA 4YOGA 1TA6A 2RG3A 2Z9JA 3E91A 2ZU1A 3ATLA 2VWLA 1CGIE 1HIAB 1JIRA 1G36A 1EAIA 1ZTKA 2H5CA 3NZIA 3P70B 2EEKA 1OXGA 1ZTJA 5A8YA 1DSUA 2P94A 2H9TH 4WH8A 3TK9A 2H9HA 6GCHG 1RXPA 1GCTC 3ZVBA 1WQVH 1WYKA 2XYAA 4IMQA 1C5XB 2J94A 2PSXA 2ZQ2A 4Y6DA 2D26C 3FP6E 1ZMLA 3E0PB 4Y8XA 5FAHA 1MD8A 1MAYA 3RXFA 3F9GA 3MTYA 1O2YA 4A5TS 2P8OB 1CU1A 3OY6U 4IC5A 4THNH 2XC5A 1TFXA 1TNHA 1XUIA 3PWCA 6CHAB 1C5VA 3H5CB 1O5BB 3RU4E 2W7UA 1NFWA 1QL8A 2Y6TA 5J4SA 4NFFA 1N8OB 2PUXB 1BA8B 1YP9A 1ZRBA 1S6FA 3CS0A 1PPBH 1GHXH 1DPOA 4CRCA 1OX1A 3QX5H 4NA8A 1YPGH 2BX3A 3DFLA 3P95A 3ESTA 5DP7A 1F0UA 3GDSA 1K21H 1ELFA 1HUTH 1Y3UA 1O2WA 1BRCE 1PYTC 1KLJH 1QJ1B 1SPJA 5FPYA 1SGNE 4D9QA 4FUIA 1GBFA 1C5YB 1T8NA 1E35B 1Z8IB 2A7CA 2HNTC 3SUGA 1SGEE 2ZU2A 3D23A 3ZZ4A 1C1TA 2ANYA 4Y7BA 4JZFH 2BB4A 4Z6AH 2VIOA 1IQKA 3NXPA 1UTQA 1J15A 4FU9A 1L4ZA 3ZZ7A 1GBDA 2Q6DA 1L4DA 1GBEA 2FMJA 1FN6A 5CHAC 2ODQA 3TH3H 1OP8A 2Z3DA 2WV5A 4RKOB 1W12U 3RM0H 4TPIZ 1GJ5H 1GCTB 2PR3A 2TGAA 2ESTE 1ANEA 1O38A 1T8OA 1BBRK 4NIXA 1DUEA 1LQDB 3QTVH 2FI3E 1AB9B 2FX6A 1C1OA 1O3LA 3EA8A 1CBWB 2FLRH 3S7HB 4ABJA 3U1JB 3OSYA 1XM1A 4MTBA 4FUGA 3PM3A 5EOKA 3T62A 2BDIA 4IBLH 4Y76A 2OQUA 2A4OA 3SJ9A 2UWOA 3ATWA 3LJOA 3FP8E 1YGCH 3EE0B 4XE4A 4ISIH 1DT2A 1C5MD 3ODDA 2JETB 5HM9A 1TBQH 2A4QA 2ZA5A 2GX4A 1XUFA 6LPRA 2C3SA 2ZECA 4K69A 1YPJH 2ZTXA 4I31A 5A8ZA 2Y5FA 3F1SB 2FP7B 1MQ6A 4R8TB 1XUKA 2RCEA 3NKKA 1OYTH 4I8LA 1F0RA 4HGCA 4DJZB 4FUEA 4O97A 3SU5A 2W7SA 1FLEE 3ZZ9A 2V3OH 7KMEH 1Z8RA 1ZYOA 2OXSA 3R0FA 1C2IA 1FPHH 4JZIA 1S85A 3VB4A 2TBSA 1GBTA 1NESE 5E0GA 1GMDG 1KXBA 5DP9A 2WPLS 4CREA 1VGCC 2BQWB 1B5GH 1SFIA 2BD3A 3BEFB 1SHYA 1C1QA 1DICA 3RUOA 1AO5A 5L2YH 5E8EH 1GHWH 1GBIA 4ZHAA 1CA0B 3LGYA 3SW2B 2GCHF 2QXJA 1PPFE 1EQ9A 2GD4B 2FTMA 2QF0A 3GDUA 3QTOH 3H7OA 3UR9A 1GG6C 3A7ZA 3A86A 1XX9A 4MDSA 1O3PB 3SGBE 3WY8A 4ABBA 2VIWA 4A6LA 7GCHF 1AE8H 2O8LA 1BMMH 3RXHA 2ZDVH 1HAIH 4GHTA 5LPEA 1N8OC 2H6MA 2PTNA 1GWAA 1OSSA 1O39A 3LC3A 2BY9X 2F9BH 1OYQA 1P02A 1QA7A 1GMCF 1C2KA 1GPZA 1HV7A 2ZGJA 3Q76A 3T25A 3U8TH 3RXMA 1QIXB 2UUKB 2ZKSA 2SNWA 1GI5A 2BDAA 4AX9H 4X1RU 3GY4A 1IQIA 4NCYA 1HNEE 5T3HA 2A0QB 4NGAH 1AVXA 1GHZA 1LPZB 1A1RA 2BD7A 2ODPA 3RLYH 1O5CB 3SJIA 1XKBC 1FY3A 1XUJA 3BG4B 1ORFA 1RTKA 3TITA 1FONA 1JWTA 1NC6A 4MPXA 1P11E 1O3IA 1UTNA 3P92A 1XVMA 4FU7A 2LNCA 5AVDA 3GY6A 1P2IA 3A7VA 1K2I1 2ZCLP 1XUGA 1UCYK 1JBUH 2K1QA 1A5GH 2FDAA 4ISLA 1V6DA 2BDYA 1GVKB 1NFXA 2ZFQH 1ZPCA 3EDXB 4H42U 1FN8A 2ZDMA 5EGMA 5LPFA 3SGQE 1FY4A 1YKTA 1PQ5A 3RU4D 2XNIA 5F8XA 1RJXB 3MMGA 1J8AA 1UTLM 3HGPA 4K1EA 5EXLA 4DW2U 1VGCB 1W7GH 4X0WU 5T6FA 1SR5C 4IC6A 3UOPA 4E05H 5ESBA 1TE0A 1C9PA 3BTFE 2JETC 1C2JA 2AGEX 4LOYH 5F8TA 5F6MA 4UEHH 3FANA 2VWNA 1V2NT 1LQEA 1UTKA 3BTHE 2H1UA 1ARCA 2ZU3A 1G3CA 3MNBA 1C5ZB 2TGPZ 1ELTA 2AMQA 1O3GA 1K1OA 3CS7A 2ILNA 4AYYB 5GJ4B 1D9IA 1BITA 1F5RA 5FX6A 1W10U 1NS3A 1WCZA 5E2OA 3UUZA 3A89A 4JZEH 2OC0A 3BTQE 5IDKA 4WF8A 1GHAG 3MH7A 1AMHA 4WVPE 2D1JA 1GDNA 2F9OA 1W3CA 1BMLA 1FI8A 4XFQA 2SGDE 1BZXE 1FAXA 2GZ9A 4Q2KA 3P8GA 3S7KB 1P04A 4JK6A 3SV9A 3GY5A 2FOGA 2Y5HA 3SNAA 1CBWC 2J4IA 2ZU4A 1O2PA 1CVWH 2EA3A 1C4U2 1O3HA 4X6MA 1O2OA 2Y80A 3RXEA 3A81A 3FAOA 1GVZA 1HLTH 8GCHG 1ZSKA 2QIQA 3RU4T 1SLWB 2Z9GA 2PLXA 5AF9H 5JB8S 1TA2A 2BXUH 2R0KA 4TY6A 5GCHF 3V12A 3EAJA 2OCVB 1TLDA 1KYNA 3I77A 1TPOA 4ABFA 2FWWA 2GZ7A 3EA9A 4XBCA 5K0HA 4WH6A 2ZGXH 3UWIA 1UCYH 3GY7A 3M36A 1KDQA 2A1DB 1L2EA 1PQ8A 2F9PA 3P6ZB 4JYUH 4VGCB 2C8YB 1WTHD 8LPRA 4OS4A 1ELGA 8KME2 3MO9A 1TNKA 4GUXA 4WMEA 1NU7B 1THPB 2EC9H 4D8NA 1TIOA 2JKHA 3E0NB 2VWOA 1CSOE 1GBKA 1TRMA 1BRAA 1PPEE 5LPRA 1E38B 1TQ0B 3M5MA 1EASA 1GJ6A 1BMNH 1FAKH 4AG2A 4UFFH 1SSXA 1WAYB 4ABEA 1V2LT 1Y5UT 4O3TA 1DY8A 4X1SU 1C5RA 3MNCA 3RXPA 1B0FA 1D3TB 1ARBA 1F5KU 4IS5A 1MKWH 3SHAH 3C27B 1F0TA 2ZC9H 4JYTA 3LOXA 1DX5M 4WXVA 2BD5A 4ZROA 2CJIA 1O3MA 2HOBA 3KQBA 2XBYA 1DDJA 2XC0A 2UUFB 4K8BA 2R9PA 5C1YA 4LK4A 1DFPA 1C2MA 4YT7H 2Z6BD 1TGNA 5C67A 1FZZA 1YLCA 1D3QB 2BTCE 1HBTH 1WBGB 1AVGH 2M5TA 1ZSJA 3OX7U 3SJ8A 2BVSH 1J17T 1LHCH 1O36A 3SNCA 1O2RA 3DFJA 1GMDF 4UE7H 3BTEE 1QBNA 1V2KT 3FP7E 1HAHH 2GV7A 1QA0A 3BIVH 4I8HA 1AN1E 2A31A 3H7TA 2OD3B 2XCFA 3UNQA 2LPRA 2ZDNA 3QO6A 2F9NA 3SO3A 2A7JA 2Q1JA 4BAQB 8GCHF 1LVBA 2C4FH 2CF8H 3SU4A 7GCHG 3CENA 2OC1A 4GLYA 2BDCA 3PTNA 1T4UH 1YBWA 2VNTA 5G4BA 1WSSH 1QGFA 1P0SH 5DPAA 4FXGH 4GAWA 3VB6A 1A2CH 2C90B 3MHWU 4BTIB 2J34A 4K1SA 2QXHA 2QGRA 3SGAE 1A61H 4YM9A 3A8DA 2B5TB 1TMUH 1AHTH 3M5OA 5C5NA 2QN5T 1ABIH 5C5OA 3UOUA 3LGVA 1UTPA 1SQOA 4IN1A 7LPRA 1THRH 2BLQA 4FUDA 2P95A 3ZVAA 1HAYB 1RFNA 1ETRH 1BJUA 3SV7A 4WMFA 1CA8B 1GGDC 1P2QA 4Y8YA 1TX8A 3GISB 1O2GH 3NK8A 4X2WA 2STBE 1F0SA 2DUCA 3BTDE 2H9EH 2Z94A 5E2PA 1C5QA 2BQ7B 1C1NA 1HFDA 1C2GA 5DKMA 4H4FA 2VIQA 3RC6A 1OP2A 3RXDA 1ELAA 1NM6A 1QB9A 1EUFA 2I6SA 2P16A 3T2NA 2PV9B 1GBAA 2AGGX 1O3EA 3RLWH 2SFAA 3BEIB 4BTUB 3BF6H 2C8ZB 3M3TA 3E8LA 2F91A 2Z9KA 5DP8A 4B74A 2CHAC 4CR9A 3K2UA 4DT7B 1T32A 3ZV9A 1P57B 2ZGBH 4Y0YE 1EJAA 2NU1E 2XXLA 2Y5GA 2BVXH 2JH5D 3A7XA 4TPYA 1EB1H 3A85A 3A84A 2W3IA 5L6NH 2CV3A 3RXIA 1VCPA 3SN8A 1LDTT 3P8NA 3AASA 1GG6B 1MKWK 3A83A 4IW4E 1F2SE 2ZHDA 2FI5E 2H2ZA 3SORA 1C5SA 1SGFG 1A7SA 2P3TB 4U2WA 1RIWB 4OGXA 1V2UT 1GMHG 4ABGA 1ABJH 3LC5A 1O3AA 2CHAB 2WPMS 2ZFRH 3ATMA 1NO9H 1BHXB 5DP6A 3GOVB 1K1MA 1KLIH 2FS8A 1MTNB 2ZZUH 4RN6A 1LKAA 2ZHQH 2C93B 1UHBB 1AQ7A 4NWLA 1O3OA 3DUXH 1HJ9A 3QK1A 2BZ6H 5EQQA 1GI0A 5TJXA 3RC4A 3ZZ8A 1ELCA 3S69A 1RRKA 2FYRA 4DOQA 1DWDH 2F3CE 1HRTH 1Q31A 3O8DA 1FY5A 4Y7AA 4X1PU 9ESTA 2ZDLA 4H6TA 4O3UA 1UVTH 2V35A 4HZHA 3A7YA 2DE9A 1HCGA 1BHXF 1KXCA 5A0BA 1OP0A 1C2EA 4X2XA 4MVNA 4KP0A 1P09A 3SI3H 2PTCE 1EPTA 2QXIA 3LONA 1UHBA 4GCHG 3UY9A 1ESAA 2ZHWH 1H8DH 1UK3A 4BANB 3N7OA 1MUEB 2BY6X 1GI3A 1SC8U 3STJA 2QCYA 1GI2A 4BXSA 1O2IA 5C20A 1WTGH 2QYIA 2ANKH 2PKAB 4AYVB 1O2UA 3MH4A 3LH1A 2FPZA 1LMWB 1D4PB 1F92A 1EAWA 4B75A 3AVZA 1P2JA 2I6QA 5FX5A 1J16A 2VGCC 1NY22 1C4V2 4NIVA 1G3BA 4J1YA 1O37A 2BM2A 1SGIB 1ZJKA 4UFEH 4DGJA 2GT8A 2UWLA 5JYIA 2IN2A 3B8JA 1DLEA 4MG3A 1TPSA 1LHGH 4ZKRU 3RC5A 3EA7A 1O34A 2ANMH 2HPQH 1TB6H 3ELAH 1BRUP 1TNLA 2PKAA 2FI4E 4JMYA 1YPKH 2HGTH 1SGDE 1C1UH 2WINI 3MO3A 4SGBE 4LZ1H 1CQQA 5FCKA 1T7CA 3FZZA 4Q7ZA 4CR5A 3VB3A 2G8TA 2XW9A 4INHA 2GV6A 1UCYE 4K5ZA 4AB8A 1AWFH 3PV4A 3GCTF 3QZQA 4CRDA 1QB6A 3STIA 3AW1A 3A80A 1BIOA 5EPNA 5EQSA 1IQHA 1FY8E 1GJBB 3KQEA 1BTXA 5C3NA 5TCCA 1BUIA 5BPEA 1BTHH 3K9XB 3KGPA 3W95A 2H5DA 1LHFH 4FUJA 1CT4E 1SFQB 1VZQH 3VGCC 4X2VA 2OC8A 1YPHE 1IAUA 3G01A 3PO1C 3TNSA 4X6OA 1FJSA 3ZZ3A 1CO7E 1MCVA 1EX3A 1PQ7A 1QBOA 2WUCA 3UR6A 4INKA 3QGJA 4E7NA 1P9SA 1GJ4H 2ALVA 1V2JT 4Y10E 2QF3A 3GY2A 1MKXH 5AFZH 1ELEE 3NPSA 1TMTH 2YNAA 1K22H 3E1XB 2R3UA 1KSNA 1JMOH 3MFJA 2A5AA 2FO9A 4I32A 3KNXA 3RXBA 3LT3A 1FIZA 1AFQC 1C5LH 4KKDA 1G30B 1EXFA 2VJ1A 1EP5A 5LGOA 3D65E 1YCPM 2P59A 1YCPK 2OBOA 4UFDH 2G55A 1CHGA 1C2HA 4KTUA 1BQYA 3VEQB 1GI6A 4JCNA 4XOJA 1SI5H 2BDBA 4KELA 3KEEA 2GGVB 2FOCA 3MH6A 4ZKNU 4UFGH 1VCWA 2BD4A 2ASUB 5A0CA 4I8GA 4ABDA 3TGJE 2OUAA 1AKSB 4E06H 1MMJN 5ESTE 1GI7B 4MPWA 4X8SH 3RMLH 3RXQA 3I29A 3TGIE 4D7FA 4B2AA 1D6RA 3ZZ6A 1GBHA 1OKXA 1C1VH 1SLXB 4AB9A 1L1JA 1C5WB 1A0LA 3TLOA 3SQHE 3U8OH 1TRYA 2BHGA 1EZSC 1QCPA 3E90B 5FPSA 3HK3B 3MU4A 4CHAC 3T5FH 1QFKH 2FYQA 2ZP0H 1O5FH 2VINA 1YYY1 5HGGA 2VB0A 1GVLA 3RXLA 4DG4A 3L6PA 1AVWA 2G5NA 3M5NA 1HIAA 1MBQA 3OYPA 2A5KA 3HKIB 2EI6A 4D76A 1KXFA 2HVXA 1O2VA 4CHAB 2F83A 3I78A 4HTCH 3VXFH 5GXPA 3O8RA 4WJG2 1CT0E 1DANH 1ZPBA 2XBWA 2J92A 2QAAA 2YNBA 3UQOA 5CE1A 1TBRH 5AFYH 1UMAH 3E3TA 1SMFE 3ZVGA 4FVBA 3A87A 2AS9A 2WUBA 1O2ZA 2PGBB 3UWJH 1QBVH 2C8WB 2IOTA 1CHOF 1W0YH 1DUAA 2J2UA 1O3DA 1DS2E 1FY1A 3RMMH 4TY7A 1SGRE 1O5GH 1EB2A 3SUEA 1AUJA 3ZZBA 2ZTYA 3MYWA 2P3FH 1QRWA 2ALPA 3ZVDA 1FUJA 1QL7A 2BLOA 4I8JA 3VGCB 2QA9E 4QT8C 5E0HA 1PYTD 1GBCA 3HPTB 4NSVA 1K9OE 2NU0E 1LVYA 1GBLA 1C1SA 4KGAA 1AKSA 4KTCA 5TCAA 4ISNA 3TJUA 4PROA 1QJ7B 5CHAB 1AWHB 1U6QA 5HXFA 2ZHFH 4ZAEA 2RA3A 7ESTE 1MU8B 4K3JA 1MTNC 1D3PB 5DGJA 3SV2H 4INLA 4RSPA 1K1LA 3SI4H 3QDZB 1CE5A 3RXAA 3BV9B 1C2LA 4DIIH 1LHDH 1ACBE 2P8OC 1NPMA 1W2KH 3A8CA 2ZNKH 2UUYA 3GDVA 2ZTZA 1HAZB 1TALA 2BOHB 1OWKA 1P2OA 2W26A 3QLPH 2XWAA 5T6DA 3PTBA 2SGFE 2P3UB 4WY3A 1GI1A 4YESB 3SU0A 3BG8A 2G51A 4O03A 5EQRA 2AIQA 3HGNA 3O8BA 4NZLA 3BIUH 3F6UH 2ANWA 4DURA 1TPAE 2TIOA 4YO9A 5EG4A 2ZGCA 5DP5A 2SGQE 4AZ2B 3JZ2B 1ELDE 1P8VC 1YPHC 3GYLB 2BDHA 1UVSH 1GBJA 3IITA 1IQNA 1J14A 3VB7A 4CH8B 1TOMH 5JBTA 1S83A 4A92A 4B76A 4OGYA 1O3KA 2ZPSA 4LXBH 4BTTB 3AW0A 5I25A 2VH6A 3GY8A 3F68H 4NIWA 1ZRKA 2ZF0H 1BB0B 2G4TA 2PWXA 3LU9B 1MD7A 3MU0A 2GCTC 2ZO3H 3RXVA 2QC2A 4MNVA 4B71A 3U69H 1C4Y2 2ZFFH 1ZHRA 1KXEA 2WPKS 5JB9S 1BCUH 1ANDA 1NRQH 4Z0KA 4UD9H 1SGPE 1MTVA 4YLQH 1O5EH 3BTKE 4YT6H 4BAOB 1TGSZ 1F5LA 3LJJA 3TH2H 3T29A 3ZZAA 2STAE 1O3FA 1WUNH 3HKJB 4NSYA 5A0AE 3PMAB 1THSH 2VGCB 4CRGA 3Q3XA 3EQ0H 1A5IA 1E34B 1GI4A 2O8MA 3OY5U 4NG9H 1HB0B 5SGAE 3A82A 2W3KA 3SNEA 1MCTA 3GCOA 1NZQH 5L2ZH 2PKSB 3C1KA 1NFYA 2Y7ZA 1JRTA 1IQMA 1W0ZU 4ISOA 2TGDA 1GHAF 1TNGA 2D8WA 3FFGA 1FNIA 4X1QU 1EP6A 1QHRB 4AFZA 1N1LA 1TGBA 4MLFB 1SLVB 1EZQA 3OTJE 1P03A 2FOFA 1YLDA 2GT7A 3M37A 2CXVA 2FOAA 4MQAA 5GDSH 5LH8A 1RD3B 3F9FA 1LTOA 3L3TA 1TMBH 1V2WT 4OS5A 1ZZZA 1HAGE 2THFB 3L33A 3S9CA 1A5HA 2VU8E 3GCTG 1SG8B 1ZTLA 3KN2A 1O2TA 3ATKA 1GL0E 4FUHA 1T31A 4OS1A 3U1IB 1J9CH 1Z1JA 1O2NA 3CP7A 5T6GA 1S5SA 5FHTA 3TJVA 3ZZ5A 3ITIA 2UUJB 3PLPA 3D49H 3RM2H 1EPTC 2B9LA 1MZAA 1BBRE 1SGQE 5CMXH 4K2YA 1E0FD 1XKAC 1BTWA 1SQAA 4ABIA 3GCHC 1EATA 1C2FA 5C2ZA 1PPCE 1ZMJA 2ZDAH 2BY8X 1QJ6B 3PO1B 1BTUA 3JZ1B 3BG4C 1GI8B 4H6SB 4OS6A 2AGIX 4JYVH 4ABAA 6CHAC 1RS0A 2BVRH 2ZPRA 1C5TA 3ZYDA 1CHOG 1AFQB 2QXGA 3Q00A 4R0IA 3M3SA 1P9UA 2A5IA 2HWLB 4MNWA 3RXCA 4ASHA 1ZOMA 3HATH 1SGTA 4SGAE 3FVFB 2A32A 1SLUB 3SHCH 3RXOA 1TYNA 4ZXXH 1C5PA 2JH0D 1UVOA 1C5UA 2O9QA 3KL6A 3S9BA 1VR1H 4NA9H 1P12E 2BLWA 4X8UH 4DCDA 1ELBA 2P93A 5DP4A 3A8BA 2ZFPH 1YPLH 3A88A 1O3BA 1AGJA 1EZUC 1V2ST 1W8BH 4BAHB 3NUMA 4X1NU 1ESTA 4DVAU 3F9HA 2VVVA 1SVPA 1UK2A 1KY9A 3PYHA 2XRCA 1BTZA 5FXLA 1K1NA 5E0JA 3P17H 1GL1A 3BSQA 4GHQA 3PWBA 1Y3YA 3A8AA 1C1PA 2FESH 2B8OH 1HAPH 2EI8A 3LGIA 3URCA 1ZMNA 4IMZA 1A0JA 1FIWA 5H4IB 2Y7XA 5AHGH 3LDXH 1DOJA 3TK5A 1G32B 4ABHA 3HK6B 4NZQA 1TX6A 1DY9A 2HLCA 3FZDA 3RMNH 2R3YA 4MNXA 1IHSH 3ENSB 1GHBG 1TAWA 1LPGB 2Z9IA 2VH0A 3PMBB 2FOHA 1WU1A 4K1TA 2NU2E 4X6PA 3KHVA 2SGEE 3ODFA 1W7XH 4TYDA 2ODYB 1ZLRA 3ZZDA 2HNTF 2VVCA 9LPRA 1OOKB 1CT2E 3BTGE 1HAVA 1PFXC 3PMHB 2VWMA 3RMOH 5EW2H 1H4WA 2A7HA 2V0BA 1FDPA 1JXPA 1K1JA 2WV4A 3SU2A 1AZZA 1NROH 1O3NA 1QRZA 2Z3EA 1VITH 1UTJA 3MWIU 3MNSA 1F7ZA 3Q77A 1O2SA 1TX7A 3K6ZA 2R2WU 2VIVA 5GIBA 1T8LA 1BBRH 1QY6A 1YCPH 1BJVA 2VIDA 5FCRA 1YF4A 1Z7KA 1O2KA 1Z6EA 2Y82A 1GDUA 1SB1H 1KDQB 4HI3A 1V2QT 1UVPA 3F9EA 1MQ5A 2HALA 2A2QH 1W14U 3LGUA 1VITF 2G00A 1GMHF 1GJAB 4HFPB 4U01A 3UREA 2Y81A 1KTTB 3GYMA 1Q3XA 4WWYA 3S9AA 2J38A 2TPIZ 1O32A 4YZUA 2BX4A 2FODA 1TNJA 5EW1H 2GDEH 1C5OH 1HJAB 1OWEA 1NN6A 1GCDA 1KXAA 3IWMA 3QN7A 1WOFA 1IQGA 4CH2B 1MU6B 1C5NH 2AMDA 4VGCC 1O2JA 1ZGIA 3Q3KA 3M7QA 1BTPA 1P2NA 1EKBB 3RXSA 2BD2A 1IQEA 5FPTA 2ZI2H 1UTOA 4X8TH 1OPHB 1A3BH 1ANBA 1UTMA 2ZCKP 1N6YA 1DE7H 3EYDA 1S0RA 4BAKB 1HXFH 2WPIS 1C1MA 4D7GA 1O2XA 2FZZA 1TQ7B 4A1VA 1XXDA 2OBQA 1TGCA 1HJAC 4OS2A 4YLUA 2BY5X 1H8IH 4AG1A 1EAXA 2BQ6B 1XUHA 4NIYA 1SQTA 1LPKB 5BRRE 3V0XA 4ZXYH 2BOKA 2BXTH 1P01A 1DWCH 4TWYA 3TH4H 2FEQH 1S0QA 1O31A 2O8WA 1FXYA 2A4GA 1B7XB 1DM4B 1P05A 3Q3YA 2FS9A 2Q6FA 1HGTH 3SUDA 3U8RH 1M9UA 4BNRA 3SOSA 4B2BA 1V3XA 1EOJA 5DK1A 4JZ1A 1CGHA 1GGDB 1MTSA 2G4UA 3DA9B 2F9VA 3DD2H 2XBVA 1UK4A 4B2CA 2ZU5A 1T8MA 2FX4A 2IJOB 5JDUB 3SZNA 4F49A 3BTME 1O2QA 1O2LA 2Q6GA 4AOQA 3UNSA 2HNTE 3ZVEA 2WYGA 2GDDA 2SGPE 3A7WA 3LGTA 1KXDA 1GHVH 1BRBE 1C9TA 4ZHMU 3PB1E 1EAUA 1PPHE 4XSKU 3ATIA 4ZMAH 5A2MH 1AFEH 1HYLA 5DJ7A 1SGYE 4ZUHA 1S84A 2CN0H 1QRXA 3MO6A 3OU0A 3PMJA 1O2HA 4AGKA 2BDGA 2BD8A 3R3GB 3SBKA 5FBIA 1S6HA 3VXEH 1CGJE 5C1XA 3K65B 3K6YA 5J4QA 1L1NA 3DHKH 2AH4X 1H9HE 1RTLA 5HM2A 3T28A 1XMNB 1V2PT 4M7GA 5I46H 3BN9A 2FLBH 3M61U 4A1TA 2FOMB 2Z9LA 5DP3A 1LHEH 1QB1A 2V3HH 4FUBA 4WMDA
chains in the Genus database with same CATH superfamily
2XTTB 3SUFA 1SHHB 1QNJA 1O3CA 1ZSLA 2BMGB 5DSFA 3VB5A 4AC9A 1FPCH 1IOEA 1ZGVA 2ZHEH 1Z71A 1TABE 3MU5A 1AU8A 2WHXA 1SL3A 1TGTA 4OS7A 1G2LA 1UJ1A 3SV6A 1DLKB 2B7DH 1EJNA 4CRAA 3B9FH 1SGFA 2TGTA 2NWNA 3RXKA 4I33A 3URDA 4DY7B 2FXRA 4FUFA 1IQFA 1GBBA 3LH3A 1AY6H 1DWBH 1UO6A 3DSOA 1TOCB 3E6PH 3RDZA 1TNIA 2A2XH 2OINA 1OWIA 1PPZA 4IGDA 4NFEA 1Z6JH 3VFEA 3QUMP 4BOHA 2FOEA 1JRSA 2PSYA 2J9NA 2ULLA 1P2KA 3LPRA 2OLGA 1V2RT 3DT0H 5FBEA 2CMYA 2F9UA 4I86A 3TJNA 2A45B 1D6WA 1D3DB 1YPEH 1AE5A 1VJAU 3KIDU 2DE8A 4E7RG 1H9LB 1Y3XA 3QWCH 1GJ7B 3ZV8A 1EOLA 3GY3A 3V7TA 1G37A 1C1RA 1XVOA 1ZPZA 4TT3D 1Y3VA 4UONA 3LIWA 1BOQA 2IPQX 6GCHF 4Y8ZA 1FQ3A 4RI0A 1VCQA 2O8UA 1AI8H 1HPGA 2CGAA 2EY4C 4A7IB 1K28D 1ZR0A 1KLTA 4ZH8A 1AD8H 3TPIZ 2R2MB 3KQCA 3MNXA 1Y5AT 2XWBI 3D62A 3TGKE 4MPVA 3SNBA 1SOTA 3RXRA 5PTPA 1L0ZA 5F53A 1O33A 1W13U 4CRBA 2EI7A 3B23B 1G2MA 1B0EA 1RTFB 3UTUH 3F3BA 4CRFA 1XXFA 5GPIB 1IQLA 1PJPA 2NU4E 1INCA 2AIPA 4JK5A 1TPPA 1BMAA 2FM2A 3MU8A 1ESBA 2HPPH 1MZDA 4FOUC 1GHYH 4XBBA 1ID5H 2SGAA 3AK5A 1S82A 3M3VA 1O30A 3MH5A 3UFAA 4J2YB 2OP9A 2RA0A 4KTSA 3MU1A 1LKBA 3T26A 5JBAS 3AAVA 4UDWH 1P3CA 3SU6A 4AFQA 1LCYA 1ETSH 5HYOA 1K1PA 1SOZA 2AYWA 3F2HA 3GS9A 3P8OA 1A46H 3TNTA 3QZRA 4MPUA 2HRVA 4A1XA 4X8VH 2WPJS 1QURH 1O3JA 3DSGA 1NRRH 2FIRH 3KQDA 3M7TA 1GBMA 5F03A 1Z8JB 1AIXH 2RDLA 2AEIH 4GVUA 3KF2A 3ZVCA 4Y11E 1V2OT 1Y8TA 1QL9A 3TIUA 2YOLA 3KYFA 3U98H 2PUQH 4RKJB 4LZ4B 1A4WH 3PLKA 2TRMA 5JPMH 3MI4A 3UB0A 2WPHS 2FOBA 1ANCA 1TWXB 1Q2WA 1FMGA 4ISHH 3NWUA 4YOJA 2CF9H 3PROA 4Y71A 2K0QA 2ZGHA 1C2DA 1O2MA 2RFKC 2W5EA 2GMTC 1Y3WA 1GDQA 1KIGH 1Z1IA 2SNVA 6ESTA 1SGCA 5ABWA 5GWZA 2GCHG 2BZAA 2Z7FE 1MAXA 1DSTA 4O9VA 2D2DA 5EODA 4Q7XA 2BLVA 1OS8A 5DO4H 1E37B 1G3EA 1NRNH 2AERH 1MTUA 4XBDA 4IN2A 1AB9C 1NU9A 1H1BA 4WXIA 1WV7H 3T27A 1BTYA 1T4VH 2ZIQH 4ZHLU 1EZXC 4AORA 4GCHF 2VVUA 3MQKC 1QQUA 2GCTB 4FVDA 5L30H 1JOUB 3S0NA 2BYAX 2Z3CA 4U30A 1GHBF 1MTWA 1OWJA 1O5AB 1NTPA 1HXEH 1MBMA 3BTWE 2ZEBA 3ZZCA 4Q7YA 5JBBS 1SBWA 2ZFTA 2VIPA 3PLBA 1P10A 2JJ2D 1O35A 4YOIA 1VJ9U 2KCYA 4I8KA 2ZQ1A 1YPMH 3M35A 1NRPH 4X2YA 3QGNB 1GJCB 3P8FA 1HJ8A 4NWKA 1OWDA 4K60A 2ZPQA 3RP2A 4FUCA 2WPDD 2QF4A 1P3EA 1ETTH 1RIWC 1BDAA 1IHTH 4CBOA 1ZJDA 1MKXK 4Y79A 4AN7A 2FTLE 4XDEA 5ETXA 2OTVA 4TWWA 1DVAH 1OWHA 5EXNA 4D9RA 3SNDA 1H9IE 1HAOH 2R0LA 2QV1A 2ZCHP 4FU8A 2ZFSA 3UNRA 1PPGE 1YM0A 4GSOA 4F4OC 3SV8A 3W94A 5K7RA 4ZKOU 1LVOA 1A3EH 3BTTE 3GCHB 3RXUA 4ZKSU 3M5LA 1TONA 4Q80A 5JBCS 2PHBA 1EJMA 2AMPA 3V3MA 1V2MT 1IQJA 1JIMA 3ZYEA 1E36B 1O0DH 2OQ5A 1AUTC 2G81E 1TBZH 1EPTB 3UQVA 2GKVE 1G3DA 1GJDB 2PW8H 3W1EA 1DXPA 1LO6A 4FETA 3SJKA 3RXGA 1V2TT 1NFUA 1CA0C 3TK6A 4K8YA 3SU3A 1PQAA 3KCGH 3TVJB 5IYTA 2GP9B 1NT1A 2A4RA 1GI9B 3ZVFA 4B73A 1HDTH 2ZG0H 2GVFA 1AZ8A 3LGWA 1BT7A 2C8XB 3LKWA 2B0FA 2K8IA 1P06A 2V6NA 1VITG 4U32A 3UIRA 3AAUA 2PFEA 1A0HB 1Y5BT 2JH6D 1ZHPA 4BXWA 4CBNA 1DXWA 3MOCA 4I7YH 5HMAA 1DWEH 1UVUH 5B6OA 1E1QD 3U9AH 1W11U 1NRSH 4F55A 3UPEA 1HAVB 5C0TA 1L1GA 1FV9A 3O8CA 2QY0B 3IG6B 5C1UA 4BAMB 3NCLA 2KAIA 3TU7H 3A7TA 3F2FA 4AFUA 2AFQB 2GZ8A 4MNYA 3FN8A 2KAIB 2G5VA 1HAXB 2BY7X 1DITH 4NA7A 3RXTA 5F8ZA 3VPKA 1Z8GA 1QQ4A 2J95A 3M7UA 3V13A 4AGJA 1LVMA 2GTBA 3TJOA 8ESTE 1K1IA 5A09A 2GMTB 4B1TA 2ZDKA 1WXRA 1QR3E 2NU3E 1QTFA 2ZWLH 4ESTE 3SU1A 1ELVA 4GPGA 1KTSB 1P2MA 3SJOA 3SQEE 2BD9A 5EXMA 3E16B 5EPYA 4YTAA 2O8TA 5A8XA 2XC4A 1ZHMA 2IPHA 1S81A 3BEUA 4RT1A 1V2VT 2UWPA 3GICB 3RXJA 1Y59T 5GCHG 2XBXA 4X6NA 4AFSA 1RGQA 2G52A 5EU8A 2KCAA 4OM9A 5DG6A 4JZDH 2PKSC 4DIHH 1X7AC 1G9IE 1GMCG 1GJ8B 3EGKH 1C1WH 3GCNA 2XCNA 2PGQB 1N6XA 2OC7A 1MH0A 2WYJA 1GJ9B 1YC0A 1TRNA 4Y0ZE 1NBME 1O5DH 1WQSA 4YOGA 1TA6A 2VBCA 2RG3A 2Z9JA 3E91A 2ZU1A 3ATLA 2VWLA 1CGIE 1HIAB 1JIRA 1G36A 1EAIA 1ZTKA 2H5CA 3NZIA 3P70B 2EEKA 1OXGA 1ZTJA 5A8YA 1DSUA 2P94A 3WW7A 2H9TH 4WH8A 3TK9A 2H9HA 6GCHG 1RXPA 1GCTC 3ZVBA 1WQVH 1WYKA 2XYAA 4IMQA 1C5XB 2J94A 2PSXA 2ZQ2A 4Y6DA 2D26C 3FP6E 1ZMLA 3E0PB 4Y8XA 5FAHA 1MD8A 1MAYA 3RXFA 3F9GA 3MTYA 1O2YA 4A5TS 2P8OB 1CU1A 3OY6U 4IC5A 4THNH 2XC5A 1TFXA 1TNHA 1XUIA 3PWCA 6CHAB 1C5VA 3H5CB 3UAIC 1O5BB 3RU4E 2W7UA 1NFWA 1QL8A 2Y6TA 5J4SA 4NFFA 1N8OB 2PUXB 1BA8B 1YP9A 1ZRBA 1S6FA 3CS0A 1PPBH 1GHXH 1DPOA 4CRCA 1OX1A 3QX5H 4NA8A 1YPGH 2BX3A 3DFLA 3P95A 3ESTA 5DP7A 1F0UA 3GDSA 1K21H 1ELFA 1HUTH 1Y3UA 1O2WA 1BRCE 1PYTC 1KLJH 1QJ1B 1SPJA 5FPYA 1SGNE 4D9QA 4FUIA 1GBFA 1C5YB 1T8NA 1E35B 1Z8IB 2A7CA 2HNTC 3SUGA 1SGEE 2ZU2A 3D23A 3ZZ4A 1C1TA 2ANYA 4Y7BA 4JZFH 2BB4A 4Z6AH 2VIOA 1IQKA 3NXPA 1UTQA 1J15A 4FU9A 1L4ZA 3ZZ7A 1GBDA 2Q6DA 1L4DA 1GBEA 2FMJA 1FN6A 5CHAC 2ODQA 3TH3H 1OP8A 2Z3DA 2WV5A 4RKOB 1W12U 3RM0H 4TPIZ 1GJ5H 1GCTB 2PR3A 2TGAA 2ESTE 1ANEA 2KCOA 1O38A 1T8OA 1BBRK 4NIXA 1DUEA 1LQDB 3QTVH 2FI3E 1AB9B 2FX6A 1C1OA 5KGOA 1O3LA 3EA8A 1CBWB 2FLRH 3S7HB 4ABJA 1QZ8A 3U1JB 3OSYA 1XM1A 4MTBA 5C17A 4FUGA 1SQRA 3PM3A 5EOKA 3T62A 2BDIA 4IBLH 4Y76A 2OQUA 2A4OA 3SJ9A 2UWOA 3OEHD 3ATWA 3LJOA 3FP8E 1YGCH 3EE0B 4XE4A 1EFRD 4ISIH 1DT2A 1C5MD 3ODDA 2JETB 5HM9A 1TBQH 2A4QA 2ZA5A 2GX4A 1XUFA 6LPRA 2C3SA 2ZECA 4K69A 1YPJH 2ZTXA 4I31A 5A8ZA 2Y5FA 3F1SB 2FP7B 1MQ6A 4R8TB 5HIYA 1XUKA 2RCEA 3NKKA 1OYTH 4I8LA 1F0RA 4HGCA 4DJZB 4DT4A 4FUEA 4O97A 3SU5A 2W7SA 1FLEE 3ZZ9A 2V3OH 7KMEH 1Z8RA 1ZYOA 2OXSA 3R0FA 1C2IA 1FPHH 4JZIA 1S85A 3VB4A 2TBSA 1GBTA 5EJZA 1NESE 5E0GA 1GMDG 1KXBA 5DP9A 2WPLS 4CREA 1VGCC 2BQWB 1B5GH 1SFIA 2BD3A 2L6OA 3BEFB 1SHYA 1C1QA 1DICA 3RUOA 1AO5A 5L2YH 5E8EH 1GHWH 1GBIA 4ZHAA 1CA0B 3LGYA 3SW2B 2GCHF 2QXJA 1PPFE 1EQ9A 2GD4B 2FTMA 2QF0A 3GDUA 3QTOH 3H7OA 3UR9A 1GG6C 3A7ZA 3A86A 1XX9A 4MDSA 1O3PB 3SGBE 3WY8A 4ABBA 4XRNA 2VIWA 4A6LA 7GCHF 1AE8H 2O8LA 1BMMH 3RXHA 2ZDVH 1HAIH 4GHTA 5LPEA 1N8OC 2H6MA 2PTNA 1GWAA 1OSSA 1O39A 3LC3A 2BY9X 2F9BH 3PRDA 1OYQA 1P02A 1QA7A 1GMCF 1C2KA 1GPZA 1HV7A 2ZGJA 3Q76A 3T25A 3U8TH 3RXMA 1QIXB 2UUKB 3EE7A 2ZKSA 2SNWA 1GI5A 2BDAA 4AX9H 4X1RU 3GY4A 3SYJA 1IQIA 4NCYA 1HNEE 5T3HA 2A0QB 4NGAH 1AVXA 1GHZA 1LPZB 1A1RA 2BD7A 2ODPA 3RLYH 1O5CB 3SJIA 1XKBC 1FY3A 1XUJA 3BG4B 1ORFA 1RTKA 3TITA 1FONA 1JWTA 1NC6A 4MPXA 1P11E 1O3IA 1UTNA 3P92A 1XVMA 4FU7A 2LNCA 5AVDA 3GY6A 1P2IA 3A7VA 1K2I1 2ZCLP 1XUGA 1UCYK 1JBUH 2K1QA 1A5GH 2FDAA 4ISLA 1V6DA 2BDYA 1GVKB 1NFXA 2ZFQH 4B6EA 1ZPCA 3EDXB 4H42U 1FN8A 2ZDMA 5EGMA 5LPFA 3SGQE 1FY4A 1YKTA 1PQ5A 3RU4D 2XNIA 5F8XA 1RJXB 3MMGA 5IK2D 1J8AA 1UTLM 3HGPA 4K1EA 5EXLA 4DW2U 1VGCB 1W7GH 4X0WU 5T6FA 1WDIA 1SR5C 4IC6A 3UOPA 4E05H 2KM0A 5ESBA 1TE0A 1C9PA 4TSFD 3BTFE 2JETC 1C2JA 2AGEX 4LOYH 5F8TA 5F6MA 4UEHH 3FANA 2VWNA 1V2NT 1LQEA 1UTKA 3BTHE 2H1UA 1ARCA 3WWBA 2ZU3A 1G3CA 3MNBA 1C5ZB 2TGPZ 1ELTA 2AMQA 1O3GA 1K1OA 3CS7A 2ILNA 4AYYB 5GJ4B 1D9IA 1BITA 1F5RA 3N7EA 5FX6A 1W10U 1NS3A 1WCZA 5E2OA 3UUZA 3A89A 4JZEH 2OC0A 3BTQE 5IDKA 4WF8A 3H09A 1GHAG 3MH7A 1AMHA 4WVPE 2D1JA 1GDNA 2F9OA 1W3CA 1BMLA 1FI8A 4XFQA 2SGDE 1BZXE 1FAXA 2GZ9A 4Q2KA 3P8GA 3S7KB 1P04A 4JK6A 3SV9A 3GY5A 2FOGA 2Y5HA 3SNAA 1CBWC 2J4IA 2ZU4A 1O2PA 1CVWH 2EA3A 1C4U2 1O3HA 4X6MA 1O2OA 2Y80A 3RXEA 3A81A 3FAOA 1GVZA 1HLTH 8GCHG 1ZSKA 2QIQA 3RU4T 1SLWB 2Z9GA 2PLXA 5AF9H 5JB8S 1TA2A 2BXUH 2R0KA 4TY6A 5GCHF 3V12A 3EAJA 2OCVB 1TLDA 1KYNA 3I77A 1TPOA 4ABFA 2FWWA 2F43B 2GZ7A 4XD7D 2L74A 3EA9A 4XBCA 5K0HA 4WH6A 2ZGXH 3UWIA 1UCYH 3GY7A 3M36A 1KDQA 2A1DB 1L2EA 1PQ8A 2CK3D 2F9PA 3P6ZB 4JYUH 4VGCB 2C8YB 1WTHD 8LPRA 4OS4A 1ELGA 8KME2 3MO9A 2QF5A 5C94A 1TNKA 3OEED 4GUXA 4WMEA 1NU7B 1THPB 2EC9H 4D8NA 1TIOA 2JKHA 3E0NB 2VWOA 1CSOE 1GBKA 1TRMA 1BRAA 1PPEE 5LPRA 1E38B 1TQ0B 3M5MA 1EASA 1GJ6A 1BMNH 1FAKH 4AG2A 3FOAA 4UFFH 1SSXA 1WAYB 4ABEA 3NRLA 1V2LT 1Y5UT 4O3TA 1DY8A 4X1SU 1C5RA 3MNCA 3RXPA 1B0FA 1D3TB 1ARBA 1F5KU 4IS5A 1MKWH 3SHAH 3SZEA 3C27B 1F0TA 2ZC9H 4JYTA 3LOXA 1DX5M 4WXVA 2BD5A 4ZROA 2CJIA 1O3MA 2HOBA 3KQBA 2XBYA 1DDJA 2XC0A 2UUFB 4K8BA 2R9PA 5C1YA 4LK4A 1DFPA 1C2MA 4YT7H 2Z6BD 1TGNA 5C67A 1FZZA 3F0PA 3N7DA 1E79D 4B6FA 3DCLA 1YLCA 1D3QB 2BTCE 1HBTH 1WBGB 1AVGH 2M5TA 1ZSJA 3OX7U 3SJ8A 2BVSH 2EQNA 1J17T 1LHCH 1O36A 3SNCA 1O2RA 3DFJA 1GMDF 4UE7H 3FKSD 3BTEE 1QBNA 1V2KT 3FP7E 1HAHH 2GV7A 1QA0A 2V3MA 3BIVH 4I8HA 5KEDA 1AN1E 2A31A 3VG8A 3H7TA 2OD3B 2XCFA 3UNQA 2LPRA 2ZDNA 3QO6A 2F9NA 3SO3A 2A7JA 2Q1JA 4BAQB 4Z1MD 8GCHF 1LVBA 2C4FH 2CF8H 2PP6A 3SU4A 7GCHG 5CHBA 3CENA 3PRBA 2OC1A 3DSPA 4GLYA 2BDCA 1FX0B 3PTNA 1BMFD 1T4UH 1YBWA 2VNTA 5G4BA 1WSSH 1QGFA 1P0SH 2GJGA 4FXGH 2V7QD 4GAWA 5DPAA 3VB6A 1A2CH 2C90B 3MHWU 4BTIB 2J34A 4K1SA 2QXHA 2QGRA 3SGAE 1A61H 4YM9A 3A8DA 2B5TB 1TMUH 1AHTH 3M5OA 5C5NA 2QN5T 1ABIH 5C5OA 1VKYA 3UOUA 3LGVA 1UTPA 1SQOA 4IN1A 7LPRA 1THRH 2BLQA 4FUDA 2P95A 3ZVAA 1HAYB 1RFNA 1ETRH 1K0HA 1BJUA 3SV7A 4WMFA 1CA8B 1GGDC 1P2QA 4Y8YA 1TX8A 3GISB 1O2GH 3NK8A 4X2WA 2STBE 1F0SA 2KR7A 2DUCA 3BTDE 2H9EH 2Z94A 5E2PA 4YXWD 1C5QA 2BQ7B 2YMSC 1C1NA 1HFDA 1C2GA 5DKMA 4H4FA 2VIQA 3RC6A 1OP2A 3RXDA 1ELAA 1NM6A 1QB9A 1EUFA 2I6SA 2P16A 3T2NA 2PV9B 1GBAA 2AGGX 1O3EA 3RLWH 2SFAA 2LELA 3BEIB 4BTUB 3BF6H 2C8ZB 3M3TA 3E8LA 2F91A 2Z9KA 5DP8A 4B74A 1W0KD 2CHAC 5HIZA 4CR9A 3K2UA 4DT7B 1T32A 3ZV9A 1P57B 2ZGBH 4Y0YE 1EJAA 2NU1E 2XXLA 2Y5GA 2BVXH 2JH5D 3A7XA 4TPYA 1EB1H 3A85A 3A84A 2W3IA 5L6NH 2CV3A 3RXIA 1VCPA 3SN8A 1LDTT 3P8NA 3AASA 1GG6B 1MKWK 3A83A 4IW4E 1F2SE 2ZHDA 1H8ED 2FI5E 2H2ZA 3SORA 1C5SA 1SGFG 1A7SA 2P3TB 4U2WA 1RIWB 4OGXA 1V2UT 1GMHG 4ABGA 1ABJH 2JDID 3LC5A 1O3AA 2CHAB 2WPMS 2ZFRH 3ATMA 1NO9H 1BHXB 5DP6A 3GOVB 1K1MA 1KLIH 4P00A 2FS8A 1MTNB 2ZZUH 4RN6A 1LKAA 2ZHQH 2C93B 1UHBB 1AQ7A 4NWLA 1O3OA 3DUXH 1HJ9A 3QK1A 2BZ6H 5EQQA 1GI0A 5TJXA 3RC4A 3ZZ8A 1ELCA 3S69A 1RRKA 2FYRA 4DOQA 1DWDH 2F3CE 1HRTH 1Q31A 3O8DA 1FY5A 4Y7AA 4X1PU 9ESTA 2ZDLA 4H6TA 5T1VA 4O3UA 1UVTH 2V35A 4HZHA 3A7YA 2DE9A 1HCGA 1BHXF 1KXCA 5A0BA 1OP0A 1C2EA 4X2XA 4MVNA 4KP0A 1P09A 3SI3H 2PTCE 1EPTA 2QXIA 3LONA 1UHBA 4GCHG 3UY9A 1ESAA 2ZHWH 1H8DH 1UK3A 4BANB 2LP6A 3N7OA 1MUEB 2BY6X 1GI3A 1YY3A 1SC8U 4ACAA 3STJA 2QCYA 1GI2A 4BXSA 1O2IA 5C20A 1WTGH 2QYIA 2ANKH 2PKAB 4AYVB 1O2UA 3MH4A 3LH1A 2FPZA 1LMWB 1D4PB 1F92A 1EAWA 4B75A 3AVZA 1P2JA 2I6QA 5FX5A 1J16A 2VGCC 1NY22 1C4V2 4NIVA 1G3BA 4J1YA 1O37A 2BM2A 1SGIB 1ZJKA 4UFEH 4DGJA 2GT8A 2UWLA 5JYIA 2IN2A 3B8JA 1DLEA 4MG3A 1TPSA 1LHGH 4ZKRU 3RC5A 5EIYA 3EA7A 1O34A 3KQ5A 2KX4A 2ANMH 2HPQH 1TB6H 3ELAH 1BRUP 3N99A 1TNLA 2PKAA 2FI4E 4JMYA 1YPKH 2HGTH 1SGDE 1C1UH 2WINI 3MO3A 4SGBE 4LZ1H 1CQQA 5FCKA 1T7CA 3FZZA 4Q7ZA 1W0JD 4CR5A 3VB3A 2G8TA 2XW9A 4INHA 2GV6A 1UCYE 4K5ZA 4AB8A 1AWFH 3PV4A 2F4LA 5DN6D 3GCTF 3QZQA 4CRDA 1QB6A 3STIA 3AW1A 3A80A 1BIOA 5EPNA 5EQSA 1IQHA 1FY8E 1GJBB 3KQEA 1BTXA 5C3NA 5TCCA 1BUIA 1NBMD 5BPEA 1BTHH 2QE7D 3K9XB 3KGPA 3W95A 2H5DA 1LHFH 4FUJA 1CT4E 1SFQB 1VZQH 3VGCC 4X2VA 2OC8A 1YPHE 1IAUA 3G01A 3PO1C 3TNSA 4X6OA 1FJSA 5EJLA 3ZZ3A 1CO7E 1MCVA 1EX3A 1PQ7A 1QBOA 1YLNA 2WUCA 3UR6A 4INKA 5KECA 3QGJA 4E7NA 1P9SA 1GJ4H 2ALVA 4ZCNA 1V2JT 4Y10E 2QF3A 3GY2A 1MKXH 5AFZH 1ELEE 3NPSA 4HG6A 1TMTH 2YNAA 1K22H 3E1XB 2R3UA 1KSNA 1JMOH 3MFJA 2A5AA 2FO9A 4I32A 3KNXA 3RXBA 3LT3A 1FIZA 1AFQC 1C5LH 4KKDA 1G30B 1EXFA 2VJ1A 1EP5A 5LGOA 2J98B 3D65E 1YCPM 2P59A 1YCPK 2OBOA 4UFDH 2G55A 2WZQA 1CHGA 1C2HA 4KTUA 1BQYA 5B6LA 3VEQB 1GI6A 4JCNA 4XOJA 1SI5H 3KYGA 2BDBA 4KELA 3KEEA 2GGVB 2KZ4A 2FOCA 3MH6A 4ZKNU 4UFGH 1VCWA 2BD4A 2ASUB 5A0CA 4I8GA 4ABDA 3TGJE 2OUAA 1AKSB 4E06H 1MMJN 5ESTE 1GI7B 4MPWA 4X8SH 4Q63A 3RMLH 3RXQA 3I29A 3TGIE 4D7FA 4B2AA 1D6RA 3ZZ6A 1GBHA 1OKXA 1C1VH 3ZIAD 1SLXB 4AB9A 1L1JA 1C5WB 1A0LA 3TLOA 3SQHE 3U8OH 1TRYA 2BHGA 1EZSC 2KFWA 1QCPA 3E90B 4P02A 5FPSA 3HK3B 3MU4A 4CHAC 3T5FH 1QFKH 2FYQA 2ZP0H 1O5FH 3PV2A 2VINA 1YYY1 5HGGA 2VB0A 1GVLA 3RXLA 4DG4A 2XNDD 3L6PA 1AVWA 2G5NA 3M5NA 1HIAA 1MBQA 3OYPA 2A5KA 3HKIB 2EI6A 4D76A 1KXFA 2HVXA 1O2VA 4CHAB 2F83A 3I78A 4HTCH 3VXFH 5GXPA 3O8RA 4WJG2 1CT0E 1DANH 3OFND 1ZPBA 2XBWA 2J92A 2QAAA 2YNBA 3UQOA 5CE1A 1TBRH 5AFYH 1UMAH 3E3TA 1SMFE 3ZVGA 4FVBA 3A87A 2AS9A 2WUBA 2IJD1 1KMHB 1O2ZA 2PGBB 3UWJH 1QBVH 2C8WB 2IOTA 1CHOF 1W0YH 1DUAA 2J2UA 1O3DA 1DS2E 1FY1A 3RMMH 4TY7A 1SGRE 1O5GH 1EB2A 3SUEA 1AUJA 3ZZBA 2ZTYA 3MYWA 2P3FH 1QRWA 2ALPA 3ZVDA 1FUJA 1QL7A 2BLOA 4I8JA 3VGCB 2QA9E 4QT8C 5E0HA 1PYTD 1GBCA 3HPTB 4NSVA 1K9OE 2NU0E 1LVYA 1GBLA 1C1SA 4KGAA 1AKSA 4KTCA 5TCAA 4ISNA 3TJUA 4PROA 1QJ7B 5CHAB 1AWHB 1U6QA 5HXFA 2ZHFH 4ZAEA 2RA3A 7ESTE 1MU8B 4K3JA 1MTNC 1D3PB 5DGJA 3SV2H 4INLA 4RSPA 1K1LA 3SI4H 3QDZB 1CE5A 3RXAA 3BV9B 1C2LA 2W6JD 4DIIH 1LHDH 1ACBE 2P8OC 1NPMA 1W2KH 3A8CA 2ZNKH 2UUYA 3GDVA 2ZTZA 1HAZB 1TALA 2BOHB 1OWKA 1P2OA 2W26A 3QLPH 2XWAA 5T6DA 3PTBA 2SGFE 2P3UB 4WY3A 1GI1A 4YESB 3SU0A 3BG8A 2G51A 4O03A 5EQRA 2AIQA 3HGNA 3O8BA 4NZLA 3BIUH 3F6UH 2ANWA 4DURA 1TPAE 2TIOA 4YO9A 5EG4A 2ZGCA 5DP5A 2SGQE 4AZ2B 3WWFA 3JZ2B 1ELDE 1P8VC 1YPHC 3GYLB 2BDHA 1UVSH 1GBJA 3IITA 1IQNA 1J14A 3VB7A 4CH8B 1TOMH 2OK5A 5JBTA 1S83A 4A92A 4B76A 4OGYA 1O3KA 2ZPSA 4LXBH 4BTTB 3AW0A 5I25A 2AHME 2VH6A 3GY8A 2WSSD 3F68H 1ZRKA 4NIWA 2ZF0H 1BB0B 2G4TA 2PWXA 3LU9B 1MD7A 3MU0A 2GCTC 2ZO3H 3RXVA 2QC2A 4MNVA 4B71A 3U69H 1C4Y2 2ZFFH 1ZHRA 1KXEA 2WPKS 5JB9S 1BCUH 1ANDA 1NRQH 4Z0KA 4UD9H 1SGPE 1MTVA 4YLQH 1O5EH 3BTKE 4YT6H 1YWUA 5EJ1A 4BAOB 1TGSZ 1F5LA 3LJJA 3TH2H 3T29A 3ZZAA 4Q4LA 2STAE 1O3FA 1WUNH 3HKJB 4NSYA 5A0AE 3PMAB 1THSH 2VGCB 4CRGA 3Q3XA 3EQ0H 1A5IA 1E34B 1GI4A 2O8MA 3OY5U 4NG9H 1HB0B 5SGAE 3A82A 2W3KA 3SNEA 1MCTA 3GCOA 1NZQH 5L2ZH 2PKSB 3C1KA 1NFYA 2Y7ZA 1JRTA 1IQMA 1W0ZU 4ISOA 2TGDA 1GHAF 1TNGA 2D8WA 3FFGA 1FNIA 4X1QU 1EP6A 1QHRB 4AFZA 1N1LA 1TGBA 4MLFB 3OE7D 1SLVB 1EZQA 3OTJE 1P03A 2FOFA 1YLDA 2GT7A 2KCPA 2CXVA 2FOAA 3M37A 4MQAA 5GDSH 5LH8A 1RD3B 3F9FA 2J5UA 5CDFE 1LTOA 3L3TA 1TMBH 1V2WT 4OS5A 1ZZZA 1HAGE 1MABB 2THFB 3L33A 5GNDA 3S9CA 1A5HA 2VU8E 3GCTG 1SG8B 1ZTLA 3KN2A 1O2TA 3ATKA 1GL0E 4FUHA 1T31A 4OS1A 3U1IB 1J9CH 1Z1JA 1O2NA 3CP7A 5T6GA 1S5SA 5FHTA 3TJVA 3ZZ5A 3ITIA 2UUJB 3PLPA 3D49H 3RM2H 1EPTC 2B9LA 1MZAA 3U28C 4ASUD 1BBRE 1SGQE 5CMXH 4K2YA 1E0FD 1XKAC 1BTWA 1SQAA 4ABIA 3GCHC 1EATA 1C2FA 1E1RD 1PPCE 1ZMJA 5C2ZA 2ZDAH 2BY8X 1QJ6B 3PO1B 1BTUA 3JZ1B 3BG4C 1GI8B 4H6SB 4OS6A 2AGIX 4JYVH 4ABAA 6CHAC 1RS0A 2BVRH 2ZPRA 1C5TA 3ZYDA 1CHOG 1AFQB 2QXGA 3Q00A 4R0IA 3M3SA 1P9UA 2A5IA 2HWLB 3F0OA 4MNWA 3RXCA 4ASHA 1ZOMA 3F2GA 3HATH 1SGTA 3FO8D 4SGAE 3FVFB 2A32A 4RT0A 1SLUB 3SHCH 3RXOA 1TYNA 4ZXXH 1C5PA 2JH0D 1UVOA 1C5UA 2O9QA 2WV9A 3KL6A 3S9BA 1VR1H 4NA9H 1P12E 2BLWA 4X8UH 4DCDA 1ELBA 2P93A 5DP4A 3A8BA 2ZFPH 1YPLH 3A88A 1O3BA 1AGJA 1EZUC 1V2ST 1W8BH 4BAHB 3NUMA 4X1NU 1ESTA 4DVAU 2YMSD 3F9HA 2VVVA 1SVPA 1UK2A 1KY9A 2YMSB 2XRCA 3PYHA 1BTZA 5FXLA 1K1NA 5E0JA 3P17H 1GL1A 3BSQA 4GHQA 3PWBA 1Y3YA 3A8AA 1C1PA 2FESH 2B8OH 1HAPH 2EI8A 3LGIA 3URCA 1ZMNA 4IMZA 1A0JA 1FIWA 5H4IB 2Y7XA 5AHGH 3LDXH 1DOJA 3TK5A 1G32B 4ABHA 2J98A 3HK6B 4NZQA 1TX6A 1DY9A 2HLCA 3OTPA 3FZDA 3RMNH 2R3YA 4MNXA 1IHSH 3ENSB 1GHBG 1TAWA 1LPGB 2Z9IA 2VH0A 2RDEA 3PMBB 2FOHA 1WU1A 4K1TA 2NU2E 4X6PA 3KHVA 2SGEE 3ODFA 4ACBA 1W7XH 4TYDA 2ODYB 1ZLRA 3ZZDA 5C0UA 2HNTF 2VVCA 9LPRA 1OOKB 1CT2E 3BTGE 1HAVA 1UW7A 1PFXC 3PMHB 2VWMA 3RMOH 5EW2H 1H4WA 2A7HA 2V0BA 1FDPA 1JXPA 4F48B 1K1JA 2WV4A 3SU2A 1AZZA 1NROH 1O3NA 1QRZA 2HVYB 2Z3EA 1VITH 1UTJA 3MWIU 3MNSA 1F7ZA 3Q77A 1O2SA 1TX7A 3K6ZA 2R2WU 2VIVA 5GIBA 1T8LA 1BBRH 1QY6A 1YCPH 1BJVA 2VIDA 2XOKD 1YF4A 1Z7KA 5FCRA 1O2KA 1Z6EA 2Y82A 1GDUA 1SB1H 1COWD 1KDQB 4HI3A 1V2QT 1UVPA 3F9EA 1MQ5A 2HALA 2A2QH 1W14U 3LGUA 1VITF 2G00A 1GMHF 1GJAB 4HFPB 4U01A 3UREA 2Y81A 1KTTB 3GYMA 1Q3XA 4WWYA 3S9AA 2J38A 2TPIZ 1H8HD 1O32A 4YZUA 2BX4A 2FODA 1TNJA 5EW1H 2GDEH 1C5OH 1HJAB 1OWEA 1NN6A 1GCDA 1KXAA 3IWMA 3QN7A 1WOFA 1IQGA 4CH2B 1OHHD 1MU6B 1C5NH 2AMDA 4VGCC 1O2JA 1ZGIA 3Q3KA 3M7QA 1BTPA 1P2NA 1S6LA 1EKBB 3RXSA 2BD2A 1IQEA 5FPTA 2ZI2H 1UTOA 4X8TH 5FL7D 1OPHB 1A3BH 1ANBA 1UTMA 2ZCKP 1N6YA 1DE7H 3EYDA 1S0RA 4BAKB 1HXFH 2WPIS 1C1MA 4D7GA 2M2AA 3PV5A 1O2XA 2FZZA 1TQ7B 4A1VA 1XXDA 2OBQA 1TGCA 1HJAC 4OS2A 4YLUA 2BY5X 5HKKD 1H8IH 4AG1A 1EAXA 2BQ6B 1XUHA 4NIYA 1SQTA 1LPKB 5BRRE 3V0XA 4ZXYH 2BOKA 2BXTH 1P01A 3OAAD 1DWCH 4TWYA 3TH4H 2FEQH 1S0QA 1O31A 2O8WA 1FXYA 2A4GA 1B7XB 1DM4B 1P05A 3Q3YA 2FS9A 2JIZD 2Q6FA 1HGTH 3SUDA 3U8RH 1M9UA 4BNRA 3SOSA 4B2BA 1V3XA 1EOJA 5DK1A 4JZ1A 1CGHA 1GGDB 1MTSA 2G4UA 3DA9B 2F9VA 3DD2H 2XBVA 1UK4A 4B2CA 2ZU5A 1T8MA 2FX4A 2IJOB 5JDUB 3SZNA 2W6ID 4F49A 3BTME 1O2QA 1O2LA 2Q6GA 4AOQA 2JJ1D 3UNSA 2HNTE 3ZVEA 2WYGA 2GDDA 2SGPE 3A7WA 3LGTA 1KXDA 1GHVH 1BRBE 1C9TA 4ZHMU 3PB1E 1EAUA 1PPHE 4XSKU 3ATIA 4ZMAH 5A2MH 1AFEH 1HYLA 5DJ7A 1SGYE 4ZUHA 1S84A 2CN0H 1QRXA 3MO6A 3OU0A 3PMJA 1O2HA 4AGKA 2BDGA 2BD8A 3R3GB 3SBKA 5FBIA 4M9FA 1S6HA 3VXEH 1CGJE 5C1XA 2HLDD 3K65B 3K6YA 5J4QA 1L1NA 3DHKH 2AH4X 1H9HE 1RTLA 5HM2A 3T28A 1XMNB 1V2PT 4M7GA 5I46H 3BN9A 2FLBH 3M61U 4A1TA 1SKYE 2FOMB 2Z9LA 5DP3A 1LHEH 1QB1A 3CNRA 2V3HH 4FUBA 2J97A 4WMDA
chains in the Genus database with same CATH topology
2XTTB 3SUFA 1SHHB 1QNJA 1O3CA 1ZSLA 2BMGB 3VB5A 1FPCH 1IOEA 1ZGVA 2ZHEH 1Z71A 1TABE 3MU5A 1AU8A 1SL3A 1TGTA 4OS7A 1G2LA 1UJ1A 3SV6A 1DLKB 2B7DH 1EJNA 4CRAA 3B9FH 1SGFA 2TGTA 2NWNA 3RXKA 4I33A 3URDA 4DY7B 2FXRA 4FUFA 1IQFA 1GBBA 3LH3A 1AY6H 1DWBH 1UO6A 1TOCB 3E6PH 3RDZA 1TNIA 2A2XH 2OINA 1OWIA 1PPZA 4IGDA 4NFEA 1Z6JH 3VFEA 3QUMP 4BOHA 2FOEA 1JRSA 2PSYA 2J9NA 2ULLA 1P2KA 3LPRA 2OLGA 1V2RT 3DT0H 5FBEA 2CMYA 2F9UA 3TJNA 2A45B 1D6WA 1D3DB 1YPEH 1AE5A 1VJAU 3KIDU 2DE8A 4E7RG 1H9LB 1Y3XA 3QWCH 1GJ7B 3ZV8A 1EOLA 3GY3A 3V7TA 1G37A 1C1RA 1XVOA 1ZPZA 1Y3VA 4UONA 3LIWA 1BOQA 6GCHF 4Y8ZA 1FQ3A 1VCQA 2O8UA 1AI8H 1HPGA 2CGAA 4A7IB 1K28D 1ZR0A 1KLTA 4ZH8A 1AD8H 3TPIZ 2R2MB 3KQCA 3MNXA 1Y5AT 2XWBI 3D62A 3TGKE 4MPVA 3SNBA 1SOTA 3RXRA 5PTPA 1L0ZA 1O33A 1W13U 4CRBA 2EI7A 3B23B 1G2MA 1B0EA 1RTFB 3UTUH 4CRFA 1XXFA 5GPIB 1IQLA 1PJPA 2NU4E 1INCA 2AIPA 4JK5A 1TPPA 1BMAA 2FM2A 3MU8A 1ESBA 2HPPH 1MZDA 4XBBA 1GHYH 1ID5H 2SGAA 1S82A 3M3VA 1O30A 3MH5A 3UFAA 4J2YB 2OP9A 2RA0A 4KTSA 3MU1A 1LKBA 3T26A 5JBAS 3AAVA 4UDWH 1P3CA 3SU6A 4AFQA 1LCYA 1ETSH 5HYOA 1K1PA 1SOZA 2AYWA 3P8OA 1A46H 3TNTA 3QZRA 4MPUA 2HRVA 4A1XA 4X8VH 2WPJS 1QURH 1O3JA 1NRRH 2FIRH 3KQDA 3M7TA 1GBMA 5F03A 1Z8JB 1AIXH 2RDLA 2AEIH 4GVUA 3KF2A 3ZVCA 4Y11E 1V2OT 1Y8TA 1QL9A 3TIUA 2YOLA 3U98H 2PUQH 4RKJB 4LZ4B 1A4WH 3PLKA 2TRMA 5JPMH 3MI4A 2WPHS 2FOBA 1ANCA 1TWXB 1Q2WA 1FMGA 4ISHH 3NWUA 4YOJA 2CF9H 3PROA 4Y71A 2ZGHA 1C2DA 1O2MA 2W5EA 2GMTC 1Y3WA 1GDQA 1KIGH 1Z1IA 2SNVA 6ESTA 1SGCA 5ABWA 5GWZA 2GCHG 2BZAA 2Z7FE 1MAXA 1DSTA 4O9VA 2D2DA 5EODA 4Q7XA 2BLVA 1OS8A 5DO4H 1E37B 1G3EA 1NRNH 2AERH 1MTUA 4XBDA 4IN2A 1AB9C 1NU9A 1H1BA 4WXIA 1WV7H 3T27A 1BTYA 1T4VH 2ZIQH 4ZHLU 1EZXC 4AORA 4GCHF 2VVUA 1QQUA 2GCTB 4FVDA 5L30H 1JOUB 3S0NA 2BYAX 2Z3CA 4U30A 1GHBF 1MTWA 1OWJA 1O5AB 1NTPA 1HXEH 1MBMA 3BTWE 2ZEBA 3ZZCA 4Q7YA 5JBBS 1SBWA 2ZFTA 2VIPA 3PLBA 1P10A 1O35A 4YOIA 1VJ9U 4I8KA 2ZQ1A 1YPMH 3M35A 1NRPH 4X2YA 3QGNB 1GJCB 3P8FA 1HJ8A 4NWKA 1OWDA 4K60A 2ZPQA 3RP2A 4FUCA 1P3EA 1ETTH 1RIWC 1BDAA 1IHTH 4CBOA 1ZJDA 1MKXK 4Y79A 4AN7A 2FTLE 4XDEA 5ETXA 2OTVA 4TWWA 1DVAH 1OWHA 5EXNA 4D9RA 3SNDA 1H9IE 1HAOH 2R0LA 2QV1A 2ZCHP 4FU8A 2ZFSA 3UNRA 1PPGE 1YM0A 4GSOA 4F4OC 3SV8A 3W94A 5K7RA 4ZKOU 1LVOA 1A3EH 3BTTE 3GCHB 3RXUA 4ZKSU 3M5LA 1TONA 4Q80A 5JBCS 2PHBA 1EJMA 2AMPA 3V3MA 1V2MT 1IQJA 1JIMA 3ZYEA 1E36B 1O0DH 2OQ5A 1AUTC 2G81E 1TBZH 1EPTB 3UQVA 2GKVE 1G3DA 1GJDB 2PW8H 1DXPA 1LO6A 3SJKA 3RXGA 1V2TT 1NFUA 1CA0C 3TK6A 4K8YA 3SU3A 1PQAA 3KCGH 3TVJB 5IYTA 2GP9B 1NT1A 2A4RA 1GI9B 3ZVFA 4B73A 1HDTH 2ZG0H 2GVFA 1AZ8A 3LGWA 1BT7A 2C8XB 3LKWA 2B0FA 2V6NA 1P06A 1VITG 4U32A 3UIRA 3AAUA 2PFEA 1A0HB 1Y5BT 2JH6D 1ZHPA 4BXWA 4CBNA 1DXWA 3MOCA 4I7YH 5HMAA 1DWEH 1UVUH 5B6OA 3U9AH 1W11U 1NRSH 3UPEA 1HAVB 1L1GA 1FV9A 3O8CA 2QY0B 3IG6B 5C1UA 4BAMB 3NCLA 2KAIA 3TU7H 3A7TA 4AFUA 2AFQB 2GZ8A 4MNYA 2KAIB 2G5VA 1HAXB 2BY7X 1DITH 4NA7A 3RXTA 5F8ZA 3VPKA 1Z8GA 1QQ4A 2J95A 3M7UA 3V13A 4AGJA 1LVMA 2GTBA 3TJOA 8ESTE 1K1IA 5A09A 2GMTB 4B1TA 2ZDKA 1QR3E 2NU3E 1QTFA 2ZWLH 4ESTE 3SU1A 1ELVA 4GPGA 1KTSB 1P2MA 3SJOA 3SQEE 2BD9A 5EXMA 3E16B 5EPYA 4YTAA 2O8TA 5A8XA 2XC4A 1ZHMA 2IPHA 1S81A 3BEUA 1V2VT 2UWPA 3GICB 3RXJA 1Y59T 5GCHG 2XBXA 4X6NA 4AFSA 1RGQA 2G52A 5EU8A 5DG6A 4JZDH 2PKSC 4DIHH 1X7AC 1G9IE 1GMCG 1GJ8B 3EGKH 1C1WH 3GCNA 2XCNA 2PGQB 1N6XA 2OC7A 1MH0A 2WYJA 1GJ9B 1YC0A 1TRNA 4Y0ZE 1O5DH 1WQSA 4YOGA 1TA6A 2RG3A 2Z9JA 3E91A 2ZU1A 3ATLA 2VWLA 1CGIE 1HIAB 1JIRA 1G36A 1EAIA 1ZTKA 2H5CA 3NZIA 3P70B 2EEKA 1OXGA 1ZTJA 5A8YA 1DSUA 2P94A 2H9TH 4WH8A 3TK9A 2H9HA 6GCHG 1RXPA 1GCTC 3ZVBA 1WQVH 1WYKA 2XYAA 4IMQA 1C5XB 2J94A 2PSXA 2ZQ2A 4Y6DA 2D26C 3FP6E 1ZMLA 3E0PB 4Y8XA 5FAHA 1MD8A 1MAYA 3RXFA 3F9GA 3MTYA 1O2YA 4A5TS 2P8OB 1CU1A 3OY6U 4IC5A 4THNH 2XC5A 1TFXA 1TNHA 1XUIA 3PWCA 6CHAB 1C5VA 3H5CB 1O5BB 3RU4E 2W7UA 1NFWA 1QL8A 2Y6TA 5J4SA 4NFFA 1N8OB 2PUXB 1BA8B 1YP9A 1ZRBA 1S6FA 3CS0A 1PPBH 1GHXH 1DPOA 4CRCA 1OX1A 3QX5H 4NA8A 1YPGH 2BX3A 3DFLA 3P95A 3ESTA 5DP7A 1F0UA 3GDSA 1K21H 1ELFA 1HUTH 1Y3UA 1O2WA 1BRCE 1PYTC 1KLJH 1QJ1B 1SPJA 5FPYA 1SGNE 4D9QA 4FUIA 1GBFA 1C5YB 1T8NA 1E35B 1Z8IB 2A7CA 2HNTC 3SUGA 1SGEE 2ZU2A 3D23A 3ZZ4A 1C1TA 2ANYA 4Y7BA 4JZFH 2BB4A 4Z6AH 2VIOA 1IQKA 3NXPA 1UTQA 1J15A 4FU9A 1L4ZA 3ZZ7A 1GBDA 2Q6DA 1L4DA 1GBEA 2FMJA 1FN6A 5CHAC 2ODQA 3TH3H 1OP8A 2Z3DA 2WV5A 4RKOB 1W12U 3RM0H 4TPIZ 1GJ5H 1GCTB 2PR3A 2TGAA 2ESTE 1ANEA 1O38A 1T8OA 1BBRK 4NIXA 1DUEA 1LQDB 3QTVH 2FI3E 1AB9B 2FX6A 1C1OA 1O3LA 3EA8A 1CBWB 2FLRH 3S7HB 4ABJA 3U1JB 3OSYA 1XM1A 4MTBA 4FUGA 3PM3A 5EOKA 3T62A 2BDIA 4IBLH 4Y76A 2OQUA 2A4OA 3SJ9A 2UWOA 3ATWA 3LJOA 3FP8E 1YGCH 3EE0B 4XE4A 4ISIH 1DT2A 1C5MD 3ODDA 2JETB 5HM9A 1TBQH 2A4QA 2ZA5A 2GX4A 1XUFA 6LPRA 2C3SA 2ZECA 4K69A 1YPJH 2ZTXA 4I31A 5A8ZA 2Y5FA 3F1SB 2FP7B 1MQ6A 4R8TB 1XUKA 2RCEA 3NKKA 1OYTH 4I8LA 1F0RA 4HGCA 4DJZB 4FUEA 4O97A 3SU5A 2W7SA 1FLEE 3ZZ9A 2V3OH 7KMEH 1Z8RA 1ZYOA 2OXSA 3R0FA 1C2IA 1FPHH 4JZIA 1S85A 3VB4A 2TBSA 1GBTA 1NESE 5E0GA 1GMDG 1KXBA 5DP9A 2WPLS 4CREA 1VGCC 2BQWB 1B5GH 1SFIA 2BD3A 3BEFB 1SHYA 1C1QA 1DICA 3RUOA 1AO5A 5L2YH 5E8EH 1GHWH 1GBIA 4ZHAA 1CA0B 3LGYA 3SW2B 2GCHF 2QXJA 1PPFE 1EQ9A 2GD4B 2FTMA 2QF0A 3GDUA 3QTOH 3H7OA 3UR9A 1GG6C 3A7ZA 3A86A 1XX9A 4MDSA 1O3PB 3SGBE 3WY8A 4ABBA 2VIWA 4A6LA 7GCHF 1AE8H 2O8LA 1BMMH 3RXHA 2ZDVH 1HAIH 4GHTA 5LPEA 1N8OC 2H6MA 2PTNA 1GWAA 1OSSA 1O39A 3LC3A 2BY9X 2F9BH 1OYQA 1P02A 1QA7A 1GMCF 1C2KA 1GPZA 1HV7A 2ZGJA 3Q76A 3T25A 3U8TH 3RXMA 1QIXB 2UUKB 2ZKSA 2SNWA 1GI5A 2BDAA 4AX9H 4X1RU 3GY4A 1IQIA 4NCYA 1HNEE 5T3HA 2A0QB 4NGAH 1AVXA 1GHZA 1LPZB 1A1RA 2BD7A 2ODPA 3RLYH 1O5CB 3SJIA 1XKBC 1FY3A 1XUJA 3BG4B 1ORFA 1RTKA 3TITA 1FONA 1JWTA 1NC6A 4MPXA 1P11E 1O3IA 1UTNA 3P92A 1XVMA 4FU7A 2LNCA 5AVDA 3GY6A 1P2IA 3A7VA 1K2I1 2ZCLP 1XUGA 1UCYK 1JBUH 2K1QA 1A5GH 2FDAA 4ISLA 1V6DA 2BDYA 1GVKB 1NFXA 2ZFQH 1ZPCA 3EDXB 4H42U 1FN8A 2ZDMA 5EGMA 5LPFA 3SGQE 1FY4A 1YKTA 1PQ5A 3RU4D 2XNIA 5F8XA 1RJXB 3MMGA 1J8AA 1UTLM 3HGPA 4K1EA 5EXLA 4DW2U 1VGCB 1W7GH 4X0WU 5T6FA 1SR5C 4IC6A 3UOPA 4E05H 5ESBA 1TE0A 1C9PA 3BTFE 2JETC 1C2JA 2AGEX 4LOYH 5F8TA 5F6MA 4UEHH 3FANA 2VWNA 1V2NT 1LQEA 1UTKA 3BTHE 2H1UA 1ARCA 2ZU3A 1G3CA 3MNBA 1C5ZB 2TGPZ 1ELTA 2AMQA 1O3GA 1K1OA 3CS7A 2ILNA 4AYYB 5GJ4B 1D9IA 1BITA 1F5RA 5FX6A 1W10U 1NS3A 1WCZA 5E2OA 3UUZA 3A89A 4JZEH 2OC0A 3BTQE 5IDKA 4WF8A 1GHAG 3MH7A 1AMHA 4WVPE 2D1JA 1GDNA 2F9OA 1W3CA 1BMLA 1FI8A 4XFQA 2SGDE 1BZXE 1FAXA 2GZ9A 4Q2KA 3P8GA 3S7KB 1P04A 4JK6A 3SV9A 3GY5A 2FOGA 2Y5HA 3SNAA 1CBWC 2J4IA 2ZU4A 1O2PA 1CVWH 2EA3A 1C4U2 1O3HA 4X6MA 1O2OA 2Y80A 3RXEA 3A81A 3FAOA 1GVZA 1HLTH 8GCHG 1ZSKA 2QIQA 3RU4T 1SLWB 2Z9GA 2PLXA 5AF9H 5JB8S 1TA2A 2BXUH 2R0KA 4TY6A 5GCHF 3V12A 3EAJA 2OCVB 1TLDA 1KYNA 3I77A 1TPOA 4ABFA 2FWWA 2GZ7A 3EA9A 4XBCA 5K0HA 4WH6A 2ZGXH 3UWIA 1UCYH 3GY7A 3M36A 1KDQA 2A1DB 1L2EA 1PQ8A 2F9PA 3P6ZB 4JYUH 4VGCB 2C8YB 1WTHD 8LPRA 4OS4A 1ELGA 8KME2 3MO9A 1TNKA 4GUXA 4WMEA 1NU7B 1THPB 2EC9H 4D8NA 1TIOA 2JKHA 3E0NB 2VWOA 1CSOE 1GBKA 1TRMA 1BRAA 1PPEE 5LPRA 1E38B 1TQ0B 3M5MA 1EASA 1GJ6A 1BMNH 1FAKH 4AG2A 4UFFH 1SSXA 1WAYB 4ABEA 1V2LT 1Y5UT 4O3TA 1DY8A 4X1SU 1C5RA 3MNCA 3RXPA 1B0FA 1D3TB 1ARBA 1F5KU 4IS5A 1MKWH 3SHAH 3C27B 1F0TA 2ZC9H 4JYTA 3LOXA 1DX5M 4WXVA 2BD5A 4ZROA 2CJIA 1O3MA 2HOBA 3KQBA 2XBYA 1DDJA 2XC0A 2UUFB 4K8BA 2R9PA 5C1YA 4LK4A 1DFPA 1C2MA 4YT7H 2Z6BD 1TGNA 5C67A 1FZZA 1YLCA 1D3QB 2BTCE 1HBTH 1WBGB 1AVGH 2M5TA 1ZSJA 3OX7U 3SJ8A 2BVSH 1J17T 1LHCH 1O36A 3SNCA 1O2RA 3DFJA 1GMDF 4UE7H 3BTEE 1QBNA 1V2KT 3FP7E 1HAHH 2GV7A 1QA0A 3BIVH 4I8HA 1AN1E 2A31A 3H7TA 2OD3B 2XCFA 3UNQA 2LPRA 2ZDNA 3QO6A 2F9NA 3SO3A 2A7JA 2Q1JA 4BAQB 8GCHF 1LVBA 2C4FH 2CF8H 3SU4A 7GCHG 3CENA 2OC1A 4GLYA 2BDCA 3PTNA 1T4UH 1YBWA 2VNTA 5G4BA 1WSSH 1QGFA 1P0SH 5DPAA 4FXGH 4GAWA 3VB6A 1A2CH 2C90B 3MHWU 4BTIB 2J34A 4K1SA 2QXHA 2QGRA 3SGAE 1A61H 4YM9A 3A8DA 2B5TB 1TMUH 1AHTH 3M5OA 5C5NA 2QN5T 1ABIH 5C5OA 3UOUA 3LGVA 1UTPA 1SQOA 4IN1A 7LPRA 1THRH