1NESE

Structure of the product complex of acetyl-ala-pro-ala with porcine pancreatic elastase at 1.65 angstroms resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ELASTASE
publication title Structure of the product complex of acetyl-Ala-Pro-Ala with porcine pancreatic elastase at 1.65 A resolution.
pubmed doi rcsb
total genus 59
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1995-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1nesE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1nesE01
1P9SA 2A5KA 2B8OH 1TRMA 5HM2A 1FIWA 1J16A 2P3UB 3RXRA 1YGCH 4ISHH 1Y3WA 1HAPH 1GMCF 2RA3A 1MTSA 3FAOA 1MTNB 2F3CE 1HRTH 1CBWB 1TNIA 1WQVH 2SGDE 2JH6D 2Y82A 4TPYA 1TALA 3K9XB 2A2XH 1TNGA 4TWWA 1TYNA 2G52A 1J9CH 2GD4B 3URDA 2KAIB 3BTHE 3P8GA 4TY6A 1FNIA 3SBKA 2LPRA 4TPIZ 1K28D 2CMYA 4JK5A 4KELA 3NZIA 5C5NA 3SW2B 3MHWU 2GCHF 5C1XA 4VGCB 1XUJA 2F91A 4AORA 3SU1A 4IGDA 2YNBA 4ABIA 1TOCB 2Y7ZA 1FY5A 2W7SA 6GCHG 1QY6A 2STAE 2ZFPH 3V7TA 1A46H 1V2UT 1O2XA 1HCGA 1AZ8A 1D9IA 2Q6GA 1BCUH 1SGQE 5GDSH 1LQEA 3G01A 1JXPA 2Y5HA 2BDGA 1BOQA 1HJ8A 3BTTE 5E0HA 1RS0A 1ZPBA 1H1BA 5LH8A 3ZVDA 2CGAA 4DOQA 1A0HB 2BQ7B 1E38B 3M5OA 4YOIA 1T4UH 3BG4C 3GCTG 1AN1E 3VB5A 2Z3EA 1SHYA 1Q3XA 1L4ZA 1HIAB 3RXCA 1BA8B 3S9AA 1XUFA 1MKWH 1ANEA 1NFYA 2Z3CA 1A5HA 2BD2A 3SGAE 5DPAA 1AY6H 3U9AH 3RMNH 1YP9A 1SC8U 1GBHA 2ZZUH 2PKSC 3E91A 4H6SB 2GMTB 1P9UA 1LKBA 3RXBA 2THFB 1GJAB 1C2KA 2CXVA 3TK6A 1GDNA 2FOHA 2HALA 1DLEA 1MMJN 2F9OA 1E34B 3HATH 3M7TA 4MNYA 1CT2E 1EPTA 1G2MA 3TJUA 1BJVA 1PPZA 2GTBA 3RM0H 2V3OH 2HNTC 5FCKA 1C5OH 2ZU2A 3P8FA 7ESTE 1Z8GA 3BSQA 4B74A 3QUMP 4GLYA 3I78A 1BTUA 1C5YB 1H9HE 4K8YA 1TBZH 1MBQA 4X6MA 3RXFA 3E0NB 1NRQH 1BRCE 3MNCA 3JZ2B 3STIA 1HJAC 1GBMA 4MPWA 1GHBF 3T2NA 1SB1H 4CREA 1TNHA 5ABWA 3ZZ5A 4B2BA 4NSYA 2VIDA 1WV7H 1TPSA 2A7CA 2PHBA 1WU1A 3VB4A 1GI4A 1X7AC 1RTLA 1C2LA 1BHXF 4A5TS 5GPIB 3ZZ7A 4DJZB 4XBDA 3E6PH 1LVYA 5T6GA 3RC4A 1FY3A 1WAYB 1O5DH 2G4TA 2ZGHA 2ODYB 1QL7A 4KTUA 3MH6A 3FFGA 3DUXH 1O3JA 2W7UA 2Z9IA 5DKMA 1SGDE 2F9BH 1O5GH 1BRUP 4JZDH 1KXDA 4ABJA 4CR9A 3I77A 5K7RA 1O3GA 2PTCE 1GBEA 3FP8E 1OWHA 4XE4A 2CHAB 1TFXA 1O2JA 5C1UA 2Y81A 1L1GA 4LZ1H 1ZRKA 2ZU5A 3E0PB 2FODA 5AFZH 3M5NA 1FZZA 2TGPZ 3A89A 1DICA 3P8OA 2STBE 4BAMB 1C2EA 2PR3A 4Y8ZA 1BTZA 1DUAA 4YT6H 5LPFA 4NIXA 2HWLB 4JYTA 1C1WH 1GHYH 2J92A 2Z9LA 3HGNA 2SGEE 1TRNA 1GBFA 3ENSB 4IMZA 1A7SA 4AZ2B 4D9RA 4DIIH 5J4QA 4OS7A 1G37A 3M5LA 1V2KT 3SJ9A 3BTQE 3LGVA 1JWTA 1P3CA 1Z7KA 5AFYH 3GDVA 1GCTC 4YLUA 1GDUA 1ELVA 4X6PA 1PPEE 4XDEA 5FCRA 1ANCA 2ZDKA 2ZHWH 2ZP0H 5FPSA 1HAVB 4Q7YA 5FBEA 5EG4A 1P57B 4AFQA 3BF6H 1DDJA 1CGHA 1MD7A 1AKSB 2JETC 1AVWA 4NWLA 1ZTKA 1UCYK 5LPRA 3QTOH 2QIQA 4TY7A 1Y3VA 4CRFA 1OSSA 3QK1A 1THSH 2BD3A 2D8WA 4ZH8A 1ABIH 4YTAA 1NN6A 2VWNA 3NPSA 5A0AE 1H8IH 3T27A 1ZPCA 1S0RA 1TX7A 2FX4A 2OUAA 1UHBB 1CSOE 3BTEE 1F5LA 4HI3A 1SGRE 4E7RG 1IAUA 2ZPQA 3V12A 5DK1A 4SGAE 1UK4A 2PW8H 2OCVB 4A7IB 3ATLA 4ABFA 1RTFB 1OWJA 1DITH 4ZHAA 4INHA 4I8KA 1PYTD 1C2GA 1ZTJA 5DP5A 1K1PA 2A2QH 1QURH 4U30A 4NA8A 4CHAC 1HB0B 1TABE 3KGPA 3UPEA 3BTGE 1P09A 2ZTYA 3SU2A 3UR6A 2H5CA 2FOGA 4FUIA 2P59A 2XBVA 1P01A 1UTLM 2ZDAH 2SNVA 3A82A 4A92A 3NWUA 4RKJB 4DCDA 1ELFA 2WPJS 2XYAA 5G4BA 1O37A 4THNH 7GCHF 1W12U 2FXRA 1P12E 1CGJE 2OINA 4A6LA 1YPGH 4KGAA 2Y80A 1E35B 2H2ZA 3AAVA 5ESTE 1F5KU 2VWOA 3A7WA 1HUTH 1GBKA 1BMLA 3GISB 5ESBA 1EP5A 4AG2A 2J94A 4I8LA 4ZKNU 1HGTH 2BB4A 3KN2A 1VITF 3GY8A 1HAZB 1SGTA 4I32A 3DD2H 3MI4A 1QR3E 3ZVEA 1QHRB 1A5IA 4Y0ZE 3SUEA 4FVDA 4BOHA 2IPHA 1AVGH 2HNTF 3MFJA 1Y3XA 3Q3XA 2D26C 1IQHA 2QAAA 1O2GH 4E05H 3FP7E 4FUFA 4I8GA 4D7GA 3OY5U 1QJ1B 4NIWA 3UY9A 2BX4A 2BD7A 1KXBA 1SOZA 2FM2A 3PB1E 1OP0A 2FOFA 4XSKU 2FTLE 5C2ZA 1V2WT 1ETRH 1JOUB 2BHGA 1AE5A 1AWHB 1ESAA 4HGCA 3P92A 1GWAA 1P2NA 2AFQB 1SFQB 3BIUH 2PGBB 4ISNA 1Z8IB 3RMLH 1P06A 2BY9X 5I25A 1L1NA 2P8OB 4GCHF 3HGPA 2ZPSA 3RUOA 2F9UA 2BX3A 2GKVE 2G55A 1MUEB 3NXPA 3TU7H 2BQ6B 2WPMS 1DSUA 1C2IA 2OTVA 2OC7A 1O3AA 4ZXYH 1S6FA 1O2YA 3A84A 2ILNA 1F0SA 4ZXXH 1GHXH 1TX6A 4F49A 2GDEH 1ID5H 3OTJE 3TH3H 5A0CA 1NZQH 1P11E 4MTBA 5HM9A 3DFJA 2XXLA 1EZXC 5HMAA 3LDXH 1DWEH 3SV2H 1F5RA 1V2MT 3TNTA 2QGRA 5E8EH 1O5EH 2WPHS 1AB9B 1GBCA 2A4QA 1RIWC 1AFQC 1TPOA 1EPTB 1ABJH 4WWYA 9LPRA 3HKIB 3ZYDA 2FI4E 4BTUB 3RXQA 1C1NA 1PQ7A 3WY8A 1GPZA 1QGFA 2AMPA 5EPNA 2C8YB 3PV4A 1MZAA 1AWFH 3A86A 1GJ5H 1GMHF 4A1XA 1DUEA 4X8TH 3S69A 3U1IB 5DP9A 5JB8S 1BBRH 5TCCA 3D65E 1LPZB 1SFIA 1IQMA 2EEKA 4WMDA 4DIHH 3QN7A 4WF8A 1BTXA 2ASUB 2AEIH 4NZQA 2ODPA 2AGIX 4Q7XA 1LHFH 8GCHG 1QBVH 4AFUA 3VB6A 1O2ZA 4D7FA 3ITIA 3PMAB 1IQFA 1C1QA 2BDBA 1QL8A 5EQQA 4BTIB 2FZZA 3SN8A 1SLWB 4FUJA 1PPFE 1O2LA 1UCYE 1C2JA 2ZHEH 1SLUB 1F92A 3A8DA 1W0YH 4Z0KA 1IOEA 2AIQA 1K1IA 1IQEA 2JKHA 1EOLA 1S6HA 1QRZA 2GX4A 1EASA 5H4IB 2GT7A 3PTNA 1BHXB 4CH2B 5HYOA 4IS5A 5EQSA 3TITA 3TLOA 3QGNB 4RKOB 1ZJKA 3VGCB 4OS6A 4FUDA 4X8UH 2WV5A 4BANB 3BTKE 1V2LT 5GIBA 5FPYA 1GBDA 2IOTA 3M3TA 1EAWA 3NUMA 1HLTH 2G51A 3PYHA 4KP0A 2FOCA 3LGYA 1MU8B 2AMQA 1QNJA 4NCYA 1V2TT 1L1JA 3ODDA 1VZQH 3E8LA 1AKSA 1DFPA 2ANKH 2Z94A 5E0GA 1O3LA 1S82A 1UVTH 2BYAX 3ZZBA 1DX5M 1OOKB 1ELGA 2XC5A 1JBUH 5F8TA 1GMDF 3PMBB 4UD9H 2B5TB 2HVXA 2VWLA 2XWBI 3ZVGA 1BMMH 2J34A 3EA9A 1UHBA 1ZSLA 4IMQA 1TGTA 4MDSA 3KNXA 1TQ0B 1O31A 1O3MA 3A85A 1P10A 1LDTT 3SU5A 2A5AA 3GY6A 2XC4A 5L6NH 2ANWA 1QB6A 3STJA 1XKBC 1GI2A 2SGFE 3UWIA 3FVFB 3QZRA 3SU3A 3MYWA 4NIYA 1C1UH 2G81E 2BDAA 2JH5D 1LHDH 1AMHA 2ZTZA 3V13A 1BB0B 1IQKA 2O9QA 3VPKA 2Z7FE 4E7NA 3E1XB 2AYWA 8KME2 1KY9A 1OYQA 2TIOA 3CP7A 2FOAA 4JCNA 1D6RA 1GMCG 1D3PB 1G9IE 2GP9B 2QV1A 2EA3A 4INLA 1T8LA 1NM6A 3S9BA 3R3GB 4CRGA 1D4PB 4RSPA 2QY0B 1NO9H 2A4OA 3F6UH 2ZDNA 1SHHB 1P03A 3LPRA 4JYUH 4FUGA 2WYJA 1GVKB 4GSOA 1SGCA 1A61H 3OY6U 3A7XA 2A7HA 2BLWA 5JBTA 1O5CB 4LXBH 3DHKH 3EE0B 2UWOA 4GHTA 3MU0A 3GY3A 1BRAA 3GCOA 4DURA 1BBRK 2GCHG 3RXLA 2BY8X 4LOYH 3RXTA 4Y79A 1DPOA 3ZV9A 1WOFA 1O33A 2GGVB 1SI5H 2VVVA 1TGCA 1DY9A 2OD3B 5IDKA 1GI3A 1H9LB 3KQCA 1T31A 1TONA 3AVZA 1S5SA 4TYDA 3KL6A 4U32A 3RC5A 3ZZ4A 1YPLH 3BG4B 5C67A 2VIOA 1DXPA 4BAQB 1ZJDA 3SO3A 1GL0E 1C9TA 4K1TA 1O2SA 5FX5A 4GHQA 2J95A 4ISLA 4UFDH 2M5TA 1XUGA 1NS3A 4UE7H 5LPEA 1AGJA 3UOPA 3ZZCA 1C1VH 3ZV8A 3HPTB 2R0KA 3A7TA 2PKSB 4KTSA 4CRDA 3O8DA 1GJ4H 2K1QA 4Y10E 2HPPH 4AYVB 2UUFB 3RLWH 1IHTH 1UCYH 3TK9A 3BEFB 1DVAH 2Q1JA 1YYY1 1ACBE 1QTFA 4NGAH 1WTHD 1GHWH 2GV7A 1A4WH 2V6NA 2ZWLH 1QCPA 1RGQA 4FU7A 1O3IA 1KXFA 1DM4B 3GY7A 4IBLH 1Z1JA 1FY1A 2QC2A 1UTJA 2SNWA 4AN7A 5F6MA 1C1MA 1TBQH 1KIGH 2C90B 2AGEX 1HJAB 5EXNA 9ESTA 5EW2H 1XXDA 1YF4A 3A88A 3LGWA 4MLFB 4U01A 3SGBE 3M7UA 2FMJA 2RDLA 2OBQA 1TA6A 5GCHF 2Z3DA 2BD9A 1AE8H 1GHBG 1V2PT 1ZHMA 1JMOH 2C8XB 4ZKRU 1QL9A 3MNXA 1C1RA 1O39A 2FP7B 2HLCA 2R3UA 3A87A 3TPIZ 1AD8H 3PWCA 1LHGH 1NU7B 1GBIA 2Z9GA 1OP2A 3HK3B 4NA7A 5FAHA 1QA0A 1MAYA 2Y5GA 2J38A 3D23A 2H9EH 2ZECA 3UWJH 1OPHB 3SNCA 1P2OA 2F9NA 3KIDU 3V3MA 1S83A 1EZSC 3BG8A 4CR5A 2TGDA 1S84A 3SV8A 1SG8B 1BIOA 2A31A 1FXYA 3K6YA 1H9IE 3ZZ6A 1T8NA 1C5TA 2AGGX 3BEIB 1ZRBA 2P16A 1NPMA 1LVOA 2GVFA 1GI8B 3H5CB 1INCA 1KDQA 1TWXB 1Q2WA 5EODA 4AG1A 7KMEH 1Y8TA 3PROA 1YPEH 1K22H 1ZLRA 1C1OA 5FX6A 1C1PA 4AFZA 3QWCH 4ZHMU 1GCTB 2QYIA 2JH0D 3B23B 3BTME 2H5DA 2PUXB 1W7XH 3M3SA 2H1UA 1ARCA 1QJ7B 1O2KA 1EP6A 3MH4A 4AFSA 1ELAA 1ELDE 1W11U 3RMMH 4CRAA 1F0UA 2C93B 2JETB 3TVJB 1E37B 3UTUH 1XM1A 2PSXA 1DWDH 1GHVH 3D49H 1CQQA 4ESTE 1C2MA 1AQ7A 3U98H 1O3HA 2FI3E 3ESTA 1SL3A 4CH8B 4O3TA 3E90B 3RXKA 3UOUA 1V2JT 1S81A 3HKJB 1YKTA 1UO6A 4JZIA 1KYNA 3Q3KA 1FPCH 2A4RA 3ZZ3A 1O0DH 1THRH 5CMXH 1MU6B 4J1YA 1MQ6A 2XBYA 1TMTH 1T32A 3W94A 1E36B 5F8XA 2WPIS 1O3KA 2Q6FA 4O9VA 1V2ST 4UEHH 2ALPA 1OX1A 3LGIA 1OWKA 4X1QU 4OGYA 5JB9S 1BBRE 2ZU1A 4OS2A 1QFKH 3VB7A 1ZTLA 5GXPA 1F7ZA 1WQSA 2QXIA 4CHAB 2BOKA 3PMHB 1F0RA 3QDZB 3PO1C 4Y71A 1O3FA 1Z8RA 3KQBA 1JRTA 3SJKA 1UVSH 1TBRH 4WMFA 1MQ5A 1LTOA 4JZ1A 4MG3A 2ESTE 2PUQH 2TPIZ 2OXSA 1O36A 3SGQE 1C4Y2 3RLYH 1QB1A 3SJIA 3LONA 1IQJA 4X8SH 1B0EA 1SQTA 3SV9A 3Q3YA 1DY8A 5JBBS 2FPZA 1G3CA 2QXHA 3SV6A 1ANBA 5ETXA 4NA9H 5DP3A 1AHTH 1N6XA 3P95A 1EJMA 3VB3A 2HPQH 3BEUA 1P0SH 2BMGB 4AB9A 1W14U 3BTWE 4CRCA 5FPTA 4UONA 3VXFH 1GGDC 1P3EA 2PFEA 3M36A 1U6QA 1FDPA 2BLVA 1VITG 2TGAA 1ORFA 1C1TA 1YCPK 4LK4A 1UVPA 3FP6E 4Y0YE 1LHEH 3T25A 4B75A 4Y8XA 2ZFTA 1GJCB 1SGFG 3EA7A 3ELAH 3F9FA 4BTTB 5GWZA 4XOJA 2BD4A 1UTNA 1AVXA 3UUZA 1NTPA 2C8WB 1CHOF 1O2UA 4AYYB 4X2VA 3H7OA 2RG3A 1K1MA 2HOBA 3RXPA 1LVBA 2ZGXH 4IC6A 5LGOA 1PQ8A 2G4UA 1C5QA 2ZHDA 3IWMA 5GJ4B 1TGSZ 1PPHE 4X2WA 2VIQA 1CO7E 2BDIA 3PLKA 5T6DA 2GV6A 5AVDA 2PTNA 3RXUA 3PTBA 3LH3A 1GBBA 2ULLA 2VIWA 1DWCH 1C5VA 1GHAF 2AERH 1TGBA 3QTVH 4PROA 4QT8C 5C1YA 4ABEA 1MCVA 1PPBH 4DVAU 2VB0A 1SSXA 4IC5A 4BAKB 2Z9KA 4X1RU 1AIXH 1GI0A 1WBGB 3QGJA 2SGAA 1VJAU 4KKDA 2AH4X 1HNEE 2BLOA 3L33A 4M7GA 1ELCA 2VJ1A 4K3JA 5DP4A 3U1JB 1RIWB 2OC8A 2OP9A 1AFQB 1FMGA 1EATA 3GCHC 4HTCH 2WYGA 3FZDA 1EAXA 2BD8A 1C5SA 2QA9E 3SNDA 1PFXC 4X2XA 3TJNA 1GI6A 1ZYOA 1Z71A 3U69H 1UTPA 5E0JA 5EPYA 4ASHA 1EQ9A 4D76A 2W5EA 2GDDA 1XMNB 1GVLA 1HV7A 3SNAA 2A5IA 1BRBE 1MKXH 1O38A 3AW0A 1BTHH 3ZZ8A 5A2MH 4B2AA 3LT3A 1HFDA 2BQWB 4SGBE 1N6YA 4ABBA 3H7TA 1GI9B 1A0JA 1WUNH 2P3TB 4JMYA 1XXFA 1VCPA 1B5GH 1YPHC 3LU9B 1GI1A 3AASA 1EAIA 1EB2A 3A8CA 4DGJA 3Q76A 4UDWH 4MNWA 3RXGA 1TRYA 4UFEH 1EKBB 1W3CA 3O8BA 1TB6H 2P3FH 5CHAC 1DS2E 4YO9A 2BVXH 1TA2A 1E0FD 2BDHA 4WY3A 2WINI 2CF8H 2W26A 2O8UA 2FESH 4I8JA 5DG6A 4I33A 3K6ZA 3SQHE 1GBTA 2ZCHP 1K1LA 1P2JA 3CS0A 3ZZAA 3KF2A 1CGIE 1RTKA 1O3EA 1UTOA 1V2RT 1TX8A 3A7ZA 3OX7U 1BMAA 1NFUA 2D2DA 1Y3YA 2ZDVH 4I8HA 4BAOB 1CU1A 2J4IA 3GY5A 4ISIH 3EYDA 1ZR0A 1NROH 2VINA 1Z8JB 5DP8A 6CHAC 1ESBA 3TNSA 2F9PA 2FTMA 2UWPA 1LPKB 2H9HA 1FLEE 2BDYA 1FN6A 2WUBA 4RN6A 1TNJA 2EC9H 1K21H 1ANDA 1KDQB 1TMBH 2ZGJA 3TGKE 3TK5A 1FQ3A 1C2DA 3RMOH 3F68H 1C4U2 1O30A 2ZGBH 4Q80A 2CV3A 1RJXB 3DA9B 4H42U 3MWIU 3CENA 1GJBB 2RA0A 3O8CA 2R3YA 3N7OA 1GBJA 4XBBA 2DE9A 1IQLA 2V35A 3S7KB 1O2PA 4CBNA 1UMAH 3OU0A 3MNSA 1FN8A 2H9TH 4NZLA 1P2QA 3HK6B 3PLPA 4A1VA 2Q6DA 1GMDG 2OC1A 4CBOA 2G00A 1TMUH 2ZC9H 3SUGA 1T7CA 1EX3A 3E16B 1AUJA 4JZFH 1J8AA 2TBSA 3P17H 2BD5A 1O2IA 2AIPA 2P95A 5DP6A 1SGNE 2BXTH 3EQ0H 4MNVA 4JK6A 4A1TA 1DLKB 3SI4H 3ZYEA 1C5UA 1FIZA 2J9NA 1XVOA 1FY4A 1WYKA 1W2KH 2VGCC 2GCTC 1W0ZU 2ODQA 3MOCA 1G3BA 1ZPZA 4GVUA 1D6WA 2XWAA 4Z6AH 2A7JA 1A1RA 3A7YA 3S0NA 2TRMA 1UK2A 5J4SA 1QRWA 4WXVA 3UREA 1C5WB 1EUFA 1KXCA 4OS5A 4GUXA 1O3BA 4Y76A 1P05A 3MH5A 1LVMA 2CN0H 3RDZA 2R2WU 3GOVB 2ZFQH 3RC6A 1TLDA 2R9PA 1CE5A 1CT0E 2P94A 4DG4A 2ZFFH 1O5FH 3TGJE 5A8XA 2QXGA 2XW9A 5AF9H 1Z6EA 3ATMA 1A3BH 1OP8A 4Y7AA 4O3UA 1C5PA 1MKXK 4YM9A 1LQDB 3GYMA 2NU2E 3LJOA 1HPGA 2XTTB 5E2PA 1BITA 5T3HA 2GT8A 3T5FH 3F9HA 1EOJA 1CVWH 4ISOA 1BTWA 1D3QB 1PYTC 1W13U 4FUEA 1IHSH 4WVPE 4WMEA 1K1JA 1O34A 4WJG2 3GCNA 5BRRE 2QF3A 1O3DA 1SGYE 3OYPA 1SBWA 2VNTA 1B7XB 1SR5C 1FONA 3BN9A 3QO6A 3VFEA 2BTCE 5I46H 3MTYA 4AOQA 1W10U 1SPJA 5SGAE 1KLJH 2J2UA 2XRCA 2Z9JA 2HGTH 2FOEA 2WPKS 4K2YA 1WTGH 3EGKH 2BY7X 1LMWB 1MAXA 1K1OA 2W3KA 1AZZA 3ATIA 4CRBA 1CT4E 5AHGH 1SOTA 1Y3UA 2FS9A 5EXLA 3NKKA 1GVZA 2A1DB 1XKAC 1C5NH 2ZQ1A 4X8VH 1CA0B 2ZF0H 2ZPRA 5EOKA 1AFEH 4NG9H 4ZUHA 2GZ9A 4YZUA 1K1NA 1JIRA 2G5NA 4MPVA 3PMJA 1SMFE 2OQUA 5F03A 2FX6A 3B9FH 5IYTA 1C5XB 3JZ1B 1GJ7B 5A0BA 2B0FA 4R0IA 2ALVA 1NU9A 1K2I1 1V6DA 3MU5A 1GBAA 4IW4E 2Y6TA 2FYRA 3M3VA 1O2VA 3KEEA 3AAUA 4I31A 2UUJB 4Q7ZA 4YOJA 1OWDA 1ELTA 1VR1H 3FANA 3RXEA 5FHTA 4MVNA 1MTWA 1CA0C 4KTCA 2NU4E 1MTNC 1OWIA 3K65B 4WXIA 1CBWC 2B7DH 1DANH 1G3DA 4JZEH 3RU4D 3RXDA 1TIOA 2BY5X 2BDCA 1ESTA 1HAYB 1YPJH 2UUKB 1O3CA 2CF9H 4WH6A 3GICB 1JIMA 4ZHLU 2B9LA 4X2YA 4B2CA 5HGGA 1AI8H 1GHZA 6GCHF 1QQ4A 4JYVH 1DWBH 2EI7A 4IN1A 4BXWA 1J17T 4YT7H 2OC0A 5A8ZA 1WCZA 4VGCC 1LKAA 1ZSKA 1C1SA 3MO9A 1YPKH 1A5GH 4AX9H 5GCHG 1HXFH 3CS7A 2DE8A 1LPGB 2RCEA 3PLBA 3RXHA 3LC5A 2FEQH 3A7VA 2HRVA 1SVPA 4MPXA 1MTUA 5L30H 3GCTF 1NRSH 2WUCA 5K0HA 1AU8A 4Q2KA 3M61U 1UTKA 2WV4A 1EZQA 1N1LA 2OQ5A 3LKWA 1SLXB 3LC3A 5EGMA 2VIVA 1NT1A 2NU1E 3A8AA 3T29A 3A83A 4XFQA 3ZZ9A 1G30B 2ZI2H 3SNBA 2QCYA 2ANMH 1BZXE 2I6QA 2GZ8A 2DUCA 1O2OA 3ATWA 4DT7B 1NC6A 1YCPH 5C5OA 3RXVA 1HAGE 3SZNA 3P70B 5BPEA 1NESE 3RXAA 1D3DB 1VGCB 2SGPE 2ZGCA 2FYQA 4GPGA 1GBLA 1OS8A 2GMTC 1DXWA 1V3XA 4R8TB 3TJOA 1O3PB 1H8DH 3UIRA 1L4DA 1O2RA 4ABHA 3KQEA 3MO6A 1UJ1A 1EJAA 4X6NA 3QX5H 1YLCA 4NSVA 4X6OA 3ZZDA 1VITH 4Y11E 3RP2A 2A45B 4UFFH 1SQOA 5EW1H 1RD3B 2PSYA 1J15A 1GI5A 2VWMA 3UNQA 3I29A 4DY7B 5C20A 4Y7BA 2H6MA 2VVUA 2ZFRH 3GYLB 2V3HH 3SJOA 3RXSA 1VGCC 2A32A 5DP7A 5F8ZA 3SU0A 3RXMA 1H4WA 1FAXA 4O97A 1ZMLA 1FAKH 2NU3E 1C4V2 2C8ZB 4D8NA 1GJDB 1G3EA 1C5MD 4LZ4B 1A3EH 1P02A 1ZGIA 2IN2A 2AMDA 1EJNA 3RU4T 4B1TA 3VXEH 1N8OB 1HAIH 2BZAA 1FUJA 1ZZZA 2FOBA 3KQDA 1PPCE 2XBXA 3AW1A 1C5ZB 3SORA 4I7YH 1KTTB 2PKAA 2D1JA 3EAJA 1GJ8B 2ZIQH 1B0FA 1BJUA 1Q31A 3RU4E 3PO1B 4UFGH 1GI7B 2ANYA 2FIRH 2W3IA 3MMGA 1QJ6B 1Y59T 1VCWA 3GY4A 3M7QA 1MZDA 3E3TA 2OLGA 1C2HA 1F0TA 2FS8A 4BXSA 1ZSJA 4AGJA 4IN2A 1N8OC 1TAWA 1DE7H 1FV9A 2CHAC 4WH8A 3MU1A 5A09A 1Y5BT 2PV9B 5DJ7A 2AS9A 5EXMA 2G8TA 1O2HA 2TGTA 4K5ZA 4X1NU 3Q00A 1OWEA 2QF0A 2ZQ2A 4FUBA 5CE1A 1G32B 1C9PA 1G2LA 2BVRH 3DFLA 5DGJA 3K2UA 5PTPA 3LH1A 1SGIB 1XUIA 2ZO3H 1O2QA 3A8BA 4ZROA 5E2OA 1GGDB 1O2TA 1YPHE 5L2ZH 5L2YH 2ZFSA 1SLVB 1GL1A 3O8RA 1LO6A 4U2WA 1FJSA 1G36A 3R0FA 1MKWK 3M35A 1TOMH 1P8VC 2VH0A 3SQEE 2F83A 1FPHH 1P2IA 1AO5A 3IITA 4FU8A 1S0QA 3UQVA 1O3OA 2FLBH 7GCHG 4ABGA 3OSYA 4MNXA 4AB8A 2IJOB 1HAHH 2G5VA 1IQGA 2Y5FA 1Z1IA 2XC0A 3LGTA 3RM2H 1CA8B 2FO9A 1A0LA 1ETTH 1UTMA 4H4FA 1DSTA 4ABDA 1DT2A 5JBAS 1QQUA 2BVSH 1T4VH 1CHOG 2FLRH 1LHCH 5FBIA 1O3NA 3IG6B 3SUDA 1NY22 1W8BH 2XCFA 1LCYA 3L6PA 3BTDE 1OKXA 1TQ7B 3F9GA 3GDUA 1AUTC 4ABAA 2ZTXA 5TCAA 1O5AB 2KAIA 1C5RA 1QBNA 2ZCLP 1XUHA 3SV7A 1TPPA 1QB9A 1NRNH 1O32A 4AGKA 2ZHFH 2C4FH 1GHAG 3GCHB 3ZVFA 3BIVH 2P93A 3TH2H 1YBWA 4YOGA 1TGNA 4FUCA 1MD8A 1PJPA 2OBOA 1YPMH 2XCNA 4ZKSU 1KTSB 1K9OE 4GCHG 3MU8A 2UWLA 1HJ9A 3ZVBA 3S9CA 1BQYA 2QXJA 1V2OT 3L3TA 4H6TA 1GDQA 3SI3H 3QLPH 2VH6A 1KXAA 1PQAA 1M9UA 2V0BA 1XUKA 4OGXA 1T8MA 1L2EA 3NK8A 1ZMNA 1O2MA 1NFWA 3SJ8A 3W95A 1SGFA 1HIAA 1A2CH 1GG6B 2BY6X 3A81A 1TNKA 4INKA 6ESTA 4YESB 2XBWA 7LPRA 2I6SA 2NWNA 5CHAB 4FXGH 3FZZA 1MH0A 3NCLA 3U8RH 4NWKA 2FDAA 1HYLA 1BDAA 1P2KA 4ZAEA 1UK3A 1ETSH 3UQOA 2Z6BD 1L0ZA 4YLQH 8ESTE 4TWYA 2O8WA 4HFPB 4K1SA 1O5BB 2BXUH 1WSSH 3M5MA 1EAUA 1GMHG 1HDTH 5T6FA 2QN5T 4ZMAH 3UFAA 2ZDLA 3M37A 5EU8A 3PM3A 1IQNA 1GG6C 1PPGE 1ZMJA 2FOMB 3BTFE 1HXEH 1FI8A 4BAHB 1ARBA 1BUIA 2ZG0H 3UR9A 1XX9A 2VVCA 3TH4H 2P8OC 5TJXA 1HBTH 6CHAB 3V0XA 4K1EA 4DW2U 3QZQA 1V2QT 2O8LA 1P2MA 2O8MA 3SNEA 3URCA 4BNRA 1ZOMA 3RXIA 1KLTA 3VEQB 2UUYA 1Z6JH 2A4GA 1MTVA 2ZDMA 1KLIH 3UNRA 4O03A 3Q77A 1HAXB 1QBOA 5A8YA 1NFXA 3B8JA 3MH7A 1UVOA 3ZVCA 4MQAA 4K8BA 1TE0A 1EB1H 3MU4A 3P6ZB 3LJJA 4E06H 1AB9C 4B76A 1BTYA 1EPTC 1NRRH 1IQIA 1XVMA 1KXEA 3C27B 3T26A 4FUHA 2ZU4A 2NU0E 1BTPA 3ZVAA 1TPAE 2GZ7A 2XNIA 3S7HB 8GCHF 3TIUA 3SUFA 1YM0A 1QRXA 1JRSA 2ZU3A 5JPMH 1W7GH 1YLDA 1C2FA 3F1SB 2WPLS 1V2NT 1SGEE 2VGCB 2BOHB 3ODFA 3LGUA 3KCGH 5FXLA 2GCTB 3EA8A 2O8TA 1GCDA 4D9QA 1RXPA 1EXFA 1RFNA 3SOSA 3T62A 3U8TH 3D62A 5C3NA 3MO3A 2CJIA 1Y5AT 4K69A 2A0QB 4MPUA 1DOJA 1V2VT 3BV9B 4NFFA 4Y8YA 1PQ5A 1O2NA 1Y5UT 5DO4H 2ZCKP 4K60A 2PKAB 1C5LH 4Y6DA 1SGPE 3UNSA 1F2SE 1KSNA 2PWXA 1UTQA 2FI5E 1HAVA 5EQRA 1ELBA 3GY2A 2YNAA 2Y7XA 4HZHA 1BT7A 1MCTA 1NRPH 1THPB 1O35A 4J2YB 4F4OC 3SHAH 4OS4A 1D3TB 4X1SU 4ZKOU 3TJVA 2SFAA 2BM2A 3MNBA 4FU9A 3VGCC 1VCQA 5JDUB 1OXGA 3ATKA 3T28A 3GDSA 2R0LA 3SU6A 3TGIE 4B73A 1ZHPA 2F9VA 1EZUC 2VIPA 1ZGVA 2ZNKH 1S85A 2LNCA 8LPRA 2C3SA 1VJ9U 3DT0H 4X1PU 4B71A 4GAWA 1ZHRA 3SHCH 3RXJA 2BZ6H 1CHGA 1BMNH 2YOLA 4NFEA 2PGQB 2HNTE 2EI8A 2ZEBA 2SGQE 1YCPM 3LIWA 1ELEE 1FY8E 2BLQA 1RRKA 2VU8E 4NIVA 3C1KA 2FWWA 4OS1A 1GJ9B 1O2WA 3KHVA 4XBCA 4X0WU 1SQAA 1TNLA 1YC0A 2ZKSA 5JYIA 1T8OA 4FVBA 2ZA5A 2R2MB 3U8OH 5HXFA 1HAOH 3EDXB 3PWBA 6LPRA 1GJ6A 3SU4A 1J14A 5B6OA 2EI6A 2PLXA 1OYTH 3P8NA 3RXOA 3LOXA 1QIXB 1QA7A 1UVUH 1P04A 3F9EA 2ZHQH 3A80A 1MBMA 5JBCS
chains in the Genus database with same CATH superfamily
1P9SA 2A5KA 2B8OH 1TRMA 5HM2A 1FIWA 1J16A 2P3UB 4RT1A 1YGCH 3RXRA 4ISHH 1Y3WA 1HAPH 1GMCF 2RA3A 1MTSA 3FAOA 1MTNB 2F3CE 3F2GA 1HRTH 1CBWB 1TNIA 1WQVH 2SGDE 2JH6D 2Y82A 4TPYA 1TALA 3K9XB 2A2XH 1TNGA 4TWWA 1TYNA 2G52A 1J9CH 2GD4B 3URDA 2KAIB 3BTHE 3P8GA 4TY6A 1FNIA 3SBKA 2LPRA 4TPIZ 1K28D 2CMYA 4JK5A 4KELA 3NZIA 5C5NA 3SW2B 3MHWU 2GCHF 5C1XA 3KQ5A 4VGCB 1XUJA 2F91A 4AORA 3SU1A 4IGDA 2YNBA 4ABIA 1TOCB 2Y7ZA 1FY5A 2W7SA 6GCHG 1QY6A 2STAE 2ZFPH 3V7TA 1A46H 1V2UT 1O2XA 1HCGA 1AZ8A 1D9IA 2Q6GA 1BCUH 1SGQE 5GDSH 5HKKD 1LQEA 3G01A 1JXPA 2Y5HA 2BDGA 1BOQA 1HJ8A 3BTTE 5E0HA 1RS0A 1ZPBA 1H1BA 2XNDD 5LH8A 3ZVDA 2CGAA 4DOQA 1A0HB 2BQ7B 1E38B 3M5OA 4YOIA 4HG6A 1T4UH 3BG4C 3GCTG 1AN1E 3VB5A 2Z3EA 1SHYA 1Q3XA 1L4ZA 1HIAB 3RXCA 1BA8B 3SYJA 3S9AA 1XUFA 1MKWH 1ANEA 1NFYA 3KYFA 4M9FA 2Z3CA 1A5HA 2BD2A 3SGAE 5DPAA 1AY6H 3U9AH 3RMNH 1YP9A 1SC8U 1GBHA 2ZZUH 2PKSC 3E91A 4H6SB 2GMTB 1P9UA 1LKBA 3RXBA 2THFB 1GJAB 1C2KA 2CXVA 3TK6A 1GDNA 2FOHA 2HALA 1DLEA 1MMJN 2F9OA 1E34B 3HATH 3M7TA 4MNYA 1CT2E 2WSSD 1EPTA 1G2MA 3TJUA 1BJVA 1PPZA 2GTBA 4DT4A 3PRDA 3RM0H 2V3OH 2HNTC 5FCKA 1C5OH 2ZU2A 3P8FA 7ESTE 1Z8GA 3BSQA 4B74A 3QUMP 4GLYA 3I78A 1BTUA 1C5YB 1H9HE 4K8YA 1TBZH 1MBQA 2RDEA 4X6MA 3RXFA 3E0NB 1NRQH 1BRCE 3MNCA 3JZ2B 3STIA 2WPDD 1HJAC 1GBMA 4MPWA 1GHBF 3T2NA 1SB1H 4CREA 1TNHA 5ABWA 3WW7A 4B6FA 3ZZ5A 4B2BA 4NSYA 2VIDA 1WV7H 1TPSA 2A7CA 2PHBA 1WU1A 3VB4A 1GI4A 1X7AC 1RTLA 1C2LA 1BHXF 4A5TS 5GPIB 3ZZ7A 5EJZA 4DJZB 4XBDA 3E6PH 1LVYA 5T6GA 3RC4A 1FY3A 1WAYB 1O5DH 2G4TA 2ZGHA 2ODYB 1QL7A 4KTUA 3MH6A 3FFGA 3DUXH 1O3JA 2W7UA 2Z9IA 5DKMA 1SGDE 2F9BH 1O5GH 1BRUP 4JZDH 1KXDA 4ABJA 4CR9A 1W0KD 5C94A 3I77A 5K7RA 1O3GA 2PTCE 1GBEA 3FP8E 1OWHA 4XE4A 2CHAB 3UB0A 1TFXA 1O2JA 5C1UA 2Y81A 1L1GA 4LZ1H 1ZRKA 2ZU5A 3E0PB 2FODA 5AFZH 3M5NA 1FZZA 2TGPZ 3A89A 1DICA 3P8OA 2STBE 4BAMB 1C2EA 2PR3A 4Y8ZA 1BTZA 1DUAA 4YT6H 5LPFA 4NIXA 2HWLB 4JYTA 1C1WH 1GHYH 2J92A 2Z9LA 3HGNA 2SGEE 1TRNA 1GBFA 3ENSB 4IMZA 1A7SA 4AZ2B 4D9RA 4DIIH 5J4QA 4OS7A 1G37A 3H09A 4Q4LA 3M5LA 1V2KT 3SJ9A 3BTQE 3LGVA 1JWTA 1P3CA 1Z7KA 5AFYH 3GDVA 5C17A 1GCTC 4YLUA 1GDUA 1ELVA 4X6PA 1PPEE 4XDEA 5FCRA 1ANCA 2ZDKA 2ZHWH 2ZP0H 5FPSA 1HAVB 4Q7YA 5FBEA 5IK2D 5EG4A 1P57B 4AFQA 3BF6H 1DDJA 3N7DA 1CGHA 1MD7A 1AKSB 2JETC 1AVWA 4NWLA 1ZTKA 1UCYK 5LPRA 3QTOH 2QIQA 1H8HD 4TY7A 1Y3VA 1UW7A 4CRFA 1OSSA 3QK1A 1THSH 2BD3A 2D8WA 4ZH8A 1ABIH 4YTAA 1NN6A 2VWNA 3NPSA 5A0AE 1H8IH 3T27A 1ZPCA 1S0RA 1TX7A 2FX4A 2OUAA 1UHBB 1CSOE 3BTEE 1F5LA 4HI3A 3W1EA 1SGRE 4E7RG 2V3MA 1IAUA 2ZPQA 3PV5A 3V12A 5DK1A 4SGAE 1UK4A 2PW8H 2OCVB 4A7IB 3ATLA 4ABFA 1RTFB 1OWJA 1DITH 4ZHAA 4INHA 4I8KA 1PYTD 1C2GA 1ZTJA 5DP5A 1K1PA 2W6JD 2A2QH 2KCPA 1QURH 4U30A 4NA8A 4CHAC 1HB0B 1TABE 3KGPA 5EJ1A 3UPEA 3BTGE 1P09A 2ZTYA 3SU2A 3OEED 3UR6A 2H5CA 2FOGA 1FX0B 4FUIA 2P59A 2XBVA 1P01A 1UTLM 2ZDAH 5GNDA 2SNVA 3A82A 4A92A 3NWUA 4RKJB 4DCDA 1ELFA 2WPJS 2XYAA 5G4BA 1O37A 4THNH 7GCHF 1W12U 2FXRA 1P12E 1CGJE 2OINA 4A6LA 1YPGH 4KGAA 2Y80A 1E35B 2H2ZA 3AAVA 5ESTE 1F5KU 2VWOA 3A7WA 1HUTH 1GBKA 1BMLA 3GISB 5ESBA 1EP5A 4AG2A 2J94A 4I8LA 4ZKNU 1HGTH 2BB4A 3KN2A 1VITF 3GY8A 1HAZB 1SGTA 4I32A 5KGOA 3DD2H 3MI4A 1QR3E 3ZVEA 1QHRB 1A5IA 4B6EA 4Y0ZE 3SUEA 4FVDA 4BOHA 2IPHA 1AVGH 2HNTF 3MFJA 1Y3XA 3Q3XA 2D26C 1IQHA 2QAAA 1O2GH 4E05H 3FP7E 4FUFA 4I8GA 4D7GA 3OY5U 2HLDD 1QJ1B 2OK5A 4NIWA 3UY9A 2BX4A 5EJLA 2BD7A 1KXBA 1SOZA 2FM2A 3PB1E 4P00A 3U28C 1OP0A 2FOFA 4XSKU 2FTLE 5C2ZA 1V2WT 1ETRH 1JOUB 2BHGA 1AE5A 1AWHB 1ESAA 4HGCA 3P92A 1GWAA 1P2NA 2AFQB 1SFQB 2QF5A 2JIZD 3BIUH 1VKYA 2PGBB 4ISNA 1Z8IB 3RMLH 1P06A 2BY9X 5I25A 1L1NA 2P8OB 4GCHF 3HGPA 2ZPSA 3RUOA 2F9UA 1W0JD 2BX3A 2G55A 2GKVE 1MUEB 3EE7A 3NXPA 3TU7H 2BQ6B 2WPMS 1DSUA 1C2IA 2OTVA 2OC7A 1O3AA 4ZXYH 1S6FA 1O2YA 2KZ4A 3A84A 2ILNA 1F0SA 4ZXXH 1GHXH 1TX6A 4F49A 2GDEH 1ID5H 3OTJE 3TH3H 5A0CA 1NZQH 1P11E 4MTBA 5HM9A 3DFJA 2XXLA 1EZXC 5HMAA 3LDXH 4F55A 1DWEH 3SV2H 1F5RA 1V2MT 3TNTA 2QGRA 5E8EH 1O5EH 3KYGA 2WPHS 1AB9B 1GBCA 2A4QA 1RIWC 1AFQC 1TPOA 1EPTB 1ABJH 4WWYA 9LPRA 3HKIB 3ZYDA 2FI4E 4BTUB 3RXQA 1C1NA 1PQ7A 3WY8A 1GPZA 1QGFA 2AMPA 5EPNA 2C8YB 3PV4A 1MZAA 1AWFH 3A86A 1GJ5H 1GMHF 3GS9A 4A1XA 1DUEA 4X8TH 3S69A 3U1IB 5DP9A 5JB8S 1BBRH 5TCCA 3D65E 1LPZB 1SFIA 1IQMA 2EEKA 4WMDA 4DIHH 2JJ1D 3QN7A 4WF8A 2ASUB 1BTXA 2AEIH 4NZQA 2ODPA 2AGIX 4Q7XA 1LHFH 8GCHG 1QBVH 4AFUA 3VB6A 1O2ZA 4D7FA 3ITIA 3PMAB 1IQFA 1C1QA 2BDBA 1QL8A 5EQQA 4BTIB 2FZZA 3SN8A 1WXRA 1SLWB 4XD7D 4FUJA 1PPFE 2L6OA 1O2LA 1UCYE 1C2JA 2ZHEH 1SLUB 1F92A 3A8DA 1W0YH 4Z0KA 3F3BA 1IOEA 2AIQA 3CNRA 1K1IA 3OFND 1IQEA 2JKHA 4Q63A 1EOLA 1S6HA 1QRZA 2GX4A 1EASA 5H4IB 2GT7A 3PTNA 1BHXB 4CH2B 5HYOA 4IS5A 5EQSA 3TITA 3TLOA 3QGNB 4RKOB 1ZJKA 3VGCB 4OS6A 4FUDA 4X8UH 2WV5A 4BANB 3BTKE 1V2LT 5GIBA 5FPYA 1GBDA 2IOTA 3M3TA 1EAWA 3F0PA 3NUMA 1HLTH 2G51A 3PYHA 4KP0A 2FOCA 3LGYA 1MU8B 2AMQA 1QNJA 4NCYA 1V2TT 1L1JA 3ODDA 1VZQH 3E8LA 1AKSA 1DFPA 2ANKH 2Z94A 5E0GA 1O3LA 1S82A 1UVTH 2BYAX 3ZZBA 1DX5M 1OOKB 1ELGA 2XC5A 1JBUH 5F8TA 1GMDF 1NBMD 3PMBB 4UD9H 2B5TB 2HVXA 2VWLA 2XWBI 3FKSD 3ZVGA 1BMMH 2J34A 3EA9A 1UHBA 1ZSLA 4IMQA 1TGTA 4MDSA 2IPQX 3KNXA 1TQ0B 1O31A 1O3MA 3A85A 1P10A 1LDTT 3SU5A 2A5AA 3GY6A 2XC4A 5L6NH 2ANWA 1QB6A 3STJA 1XKBC 1GI2A 2SGFE 3UWIA 3FVFB 3QZRA 3SU3A 3MYWA 4NIYA 1C1UH 2G81E 2RFKC 2BDAA 1K0HA 2JH5D 1LHDH 1AMHA 2ZTZA 3V13A 1BB0B 1IQKA 2O9QA 3VPKA 2Z7FE 4E7NA 3E1XB 1QZ8A 2AYWA 8KME2 1KY9A 1OYQA 2TIOA 3CP7A 2FOAA 4JCNA 1D6RA 1GMCG 1D3PB 1G9IE 2GP9B 2QV1A 2EA3A 4INLA 1T8LA 1NM6A 3S9BA 3R3GB 4CRGA 1D4PB 4RSPA 3VG8A 2QY0B 1NO9H 2A4OA 3F6UH 2ZDNA 1SHHB 1P03A 3LPRA 4JYUH 4FUGA 2WYJA 1GVKB 4GSOA 1SGCA 1A61H 3OY6U 3A7XA 2A7HA 2BLWA 2J97A 5JBTA 1O5CB 4LXBH 3DHKH 3EE0B 2UWOA 4GHTA 3MU0A 3GY3A 1BRAA 3GCOA 4DURA 1BBRK 2GCHG 3RXLA 2BY8X 4LOYH 3RXTA 4Y79A 1DPOA 3ZV9A 1WOFA 1O33A 2GGVB 1SI5H 2VVVA 1TGCA 1DY9A 2OD3B 5IDKA 1GI3A 3F0OA 1H9LB 3KQCA 1T31A 1TONA 3AVZA 1S5SA 4TYDA 3KL6A 4U32A 3RC5A 3ZZ4A 1YPLH 3BG4B 5C67A 2VIOA 1DXPA 4BAQB 1ZJDA 3SO3A 1GL0E 1C9TA 4K1TA 1O2SA 5FX5A 4GHQA 2J95A 4ISLA 4UFDH 2M5TA 1XUGA 1NS3A 4UE7H 5LPEA 1AGJA 3UOPA 3ZZCA 1C1VH 3ZV8A 3HPTB 2R0KA 3A7TA 2PKSB 4KTSA 4CRDA 3O8DA 1GJ4H 2K1QA 4Y10E 2HPPH 4AYVB 2UUFB 3RLWH 1IHTH 1UCYH 3TK9A 3BEFB 1DVAH 2Q1JA 4XRNA 1YYY1 1ACBE 1QTFA 4NGAH 1WTHD 1GHWH 2GV7A 1A4WH 2V6NA 2ZWLH 1QCPA 1RGQA 2AHME 4FU7A 1O3IA 1KXFA 1DM4B 3GY7A 4IBLH 1Z1JA 1FY1A 5HIYA 2QC2A 1UTJA 2SNWA 4AN7A 5F6MA 1C1MA 1TBQH 1KIGH 2C90B 2AGEX 1HJAB 5EXNA 9ESTA 5EW2H 1XXDA 1YF4A 3A88A 2J5UA 3LGWA 4MLFB 4U01A 3SGBE 3PV2A 3M7UA 2FMJA 2RDLA 2OBQA 1TA6A 5GCHF 5C0TA 2Z3DA 2BD9A 1AE8H 1GHBG 1V2PT 1ZHMA 1JMOH 2C8XB 3WWBA 4ZKRU 1QL9A 5B6LA 3MNXA 1C1RA 1O39A 2FP7B 2HLCA 2R3UA 3A87A 3TPIZ 1SQRA 1AD8H 3PWCA 1LHGH 1NU7B 1GBIA 2Z9GA 1OP2A 3HK3B 4NA7A 5FAHA 1QA0A 1MAYA 2Y5GA 2J38A 3D23A 2H9EH 2ZECA 3UWJH 1OPHB 3SNCA 1P2OA 2F9NA 3KIDU 3V3MA 1S83A 1EZSC 3BG8A 4CR5A 1S6LA 2TGDA 1S84A 3SV8A 1SG8B 5KEDA 1BIOA 2A31A 1FXYA 3K6YA 1H9IE 3SZEA 1T8NA 3ZZ6A 1C5TA 2AGGX 3BEIB 1ZRBA 2P16A 1NPMA 1LVOA 2GVFA 1GI8B 3H5CB 1INCA 1KDQA 1TWXB 1Q2WA 5EODA 4AG1A 7KMEH 1Y8TA 3PROA 1YPEH 1K22H 2VBCA 1ZLRA 1C1OA 5FX6A 1OHHD 1C1PA 4AFZA 3QWCH 4ZHMU 1GCTB 2QYIA 2JH0D 3B23B 3BTME 2H5DA 2PUXB 1W7XH 3M3SA 2H1UA 1ARCA 1QJ7B 1O2KA 1EP6A 3MH4A 4AFSA 1ELAA 1ELDE 1W11U 3RMMH 4CRAA 1F0UA 2C93B 2JETB 3TVJB 1E37B 3UTUH 1XM1A 2PSXA 2LELA 1DWDH 1GHVH 3D49H 1CQQA 4ESTE 1C2MA 1AQ7A 3U98H 1O3HA 2FI3E 3ESTA 1SL3A 4CH8B 4O3TA 3E90B 3RXKA 3UOUA 1V2JT 1S81A 3HKJB 1YKTA 1UO6A 4JZIA 1KYNA 3Q3KA 1FPCH 2A4RA 3ZZ3A 1O0DH 1THRH 5CMXH 1MU6B 4J1YA 1MQ6A 2XBYA 1TMTH 1T32A 3W94A 1E36B 5F8XA 2WPIS 1O3KA 2Q6FA 4O9VA 1V2ST 3NRLA 4UEHH 2ALPA 1OX1A 3LGIA 1OWKA 4X1QU 4OGYA 5JB9S 3F2FA 1BBRE 2ZU1A 4OS2A 1QFKH 3VB7A 1ZTLA 5GXPA 1F7ZA 4OM9A 1WQSA 2QXIA 4CHAB 2BOKA 2KFWA 3PMHB 1F0RA 3QDZB 3PO1C 4Y71A 1O3FA 1Z8RA 3KQBA 1JRTA 3SJKA 1UVSH 1TBRH 4WMFA 1MQ5A 1LTOA 4JZ1A 4MG3A 2ESTE 2PUQH 2TPIZ 2OXSA 1O36A 3SGQE 1C4Y2 3RLYH 1QB1A 3SJIA 3LONA 1IQJA 4X8SH 1B0EA 1SQTA 3SV9A 3Q3YA 1DY8A 5JBBS 2FPZA 1G3CA 3PRBA 2QXHA 3SV6A 1ANBA 5ETXA 4NA9H 5DP3A 1AHTH 1N6XA 3P95A 1EJMA 3VB3A 2HPQH 3BEUA 1P0SH 2BMGB 4AB9A 1W14U 3BTWE 4CRCA 5FPTA 2KM0A 3VXFH 1GGDC 1P3EA 2PFEA 3M36A 4UONA 1U6QA 4P02A 1FDPA 2BLVA 1VITG 2TGAA 1ORFA 1C1TA 1YCPK 4LK4A 1UVPA 3FP6E 4Y0YE 1LHEH 3T25A 4B75A 4Y8XA 2ZFTA 1GJCB 1SGFG 3EA7A 3ELAH 2EQNA 3F9FA 4BTTB 5GWZA 4XOJA 3UAIC 2BD4A 1UTNA 5CHBA 1AVXA 3UUZA 1NTPA 2C8WB 1CHOF 1O2UA 4AYYB 4X2VA 3H7OA 2RG3A 1K1MA 2HOBA 3RXPA 1LVBA 2ZGXH 4IC6A 2V7QD 5LGOA 1PQ8A 2G4UA 1C5QA 2ZHDA 3IWMA 5GJ4B 2YMSD 1TGSZ 2HVYB 1PPHE 4X2WA 2VIQA 1CO7E 2BDIA 3PLKA 5T6DA 2GV6A 5AVDA 2PTNA 3RXUA 3PTBA 3LH3A 1GBBA 4ASUD 2ULLA 2VIWA 1DWCH 1C5VA 1GHAF 2AERH 1TGBA 3QTVH 4PROA 4QT8C 5C1YA 4ABEA 1MCVA 1PPBH 4DVAU 2VB0A 1SSXA 4IC5A 4BAKB 2Z9KA 4X1RU 1AIXH 1GI0A 1WBGB 3QGJA 2SGAA 1VJAU 4KKDA 2AH4X 1HNEE 2BLOA 3L33A 4M7GA 1ELCA 2VJ1A 4K3JA 5DP4A 3U1JB 1RIWB 2OC8A 2OP9A 1AFQB 1FMGA 1EATA 1BMFD 3GCHC 4HTCH 2WYGA 3DSOA 3FZDA 1EAXA 2BD8A 1C5SA 2QA9E 3SNDA 1PFXC 4X2XA 3TJNA 1GI6A 5C0UA 1ZYOA 1Z71A 3U69H 1UTPA 5E0JA 5EPYA 4ASHA 1EQ9A 4D76A 2W5EA 2GDDA 1XMNB 1GVLA 1HV7A 3SNAA 2A5IA 1BRBE 1MKXH 1O38A 3AW0A 1BTHH 3ZZ8A 5A2MH 4B2AA 3LT3A 1YWUA 1HFDA 2BQWB 4SGBE 1N6YA 4ABBA 3H7TA 1GI9B 1A0JA 1WUNH 2P3TB 4JMYA 1XXFA 1VCPA 1B5GH 1YPHC 3LU9B 1GI1A 3AASA 1EAIA 1EB2A 3A8CA 4TSFD 4DGJA 3Q76A 4UDWH 4MNWA 3RXGA 1TRYA 4UFEH 1EKBB 1W3CA 3O8BA 1TB6H 2P3FH 5CHAC 1DS2E 4YO9A 2BVXH 1TA2A 1E0FD 2BDHA 4WY3A 2WINI 2CF8H 2W26A 2O8UA 2FESH 4I8JA 3DSGA 5DG6A 4I33A 3K6ZA 3SQHE 1GBTA 2ZCHP 1K1LA 1P2JA 3CS0A 3ZZAA 3KF2A 1CGIE 1RTKA 1O3EA 1UTOA 1V2RT 1TX8A 3A7ZA 3OX7U 1BMAA 1NFUA 2D2DA 1Y3YA 2ZDVH 4I8HA 4BAOB 1CU1A 2J4IA 3GY5A 4ISIH 3EYDA 1ZR0A 1NROH 2VINA 1Z8JB 5DP8A 6CHAC 1ESBA 3TNSA 2F9PA 2FTMA 2UWPA 1LPKB 2H9HA 1FLEE 2BDYA 2KX4A 1FN6A 2WUBA 4RN6A 1TNJA 2EC9H 1K21H 1ANDA 1KDQB 1TMBH 2ZGJA 3TGKE 3TK5A 1FQ3A 1C2DA 3RMOH 3F68H 1C4U2 2F4LA 1O30A 2ZGBH 4Q80A 2CV3A 1RJXB 3DA9B 3OE7D 4H42U 3MWIU 3CENA 1GJBB 2RA0A 3O8CA 5DN6D 2R3YA 3N7OA 1GBJA 4RT0A 4XBBA 2DE9A 1IQLA 2V35A 3S7KB 1O2PA 4CBNA 1UMAH 3OU0A 3MNSA 1FN8A 2H9TH 4NZLA 1P2QA 3HK6B 3PLPA 4A1VA 2Q6DA 1GMDG 2OC1A 4CBOA 2G00A 3FO8D 1TMUH 2ZC9H 3SUGA 1T7CA 1EX3A 3E16B 3OTPA 1AUJA 4JZFH 1J8AA 2TBSA 3P17H 3AK5A 2BD5A 1O2IA 4ACAA 2AIPA 2P95A 5DP6A 1SGNE 2BXTH 3EQ0H 4MNVA 4JK6A 4A1TA 1DLKB 3SI4H 3ZYEA 5DSFA 1C5UA 1FIZA 2J9NA 1XVOA 1FY4A 1WYKA 1W2KH 2VGCC 2GCTC 1W0ZU 2ODQA 3MOCA 1G3BA 1ZPZA 4GVUA 1D6WA 2XWAA 4Z6AH 2A7JA 1A1RA 3A7YA 3S0NA 2TRMA 1UK2A 5J4SA 1QRWA 4WXVA 3UREA 1C5WB 1EUFA 1KXCA 3OEHD 4OS5A 4GUXA 1O3BA 4Y76A 1P05A 3MH5A 4I86A 1LVMA 2CN0H 3RDZA 2R2WU 3GOVB 2ZFQH 3RC6A 1TLDA 2R9PA 1CE5A 1CT0E 2P94A 4DG4A 2ZFFH 1O5FH 3TGJE 5A8XA 2QXGA 2XW9A 5AF9H 1Z6EA 3ATMA 1A3BH 1OP8A 4Y7AA 4O3UA 1C5PA 1MKXK 4YM9A 4F48B 1LQDB 2KCAA 3GYMA 2NU2E 3LJOA 1HPGA 2XTTB 5E2PA 1BITA 5T3HA 2GT8A 3T5FH 3F9HA 1EOJA 1CVWH 4ISOA 1BTWA 1D3QB 1PYTC 1W13U 4FUEA 1IHSH 4WVPE 4WMEA 1K1JA 1O34A 4WJG2 3GCNA 5BRRE 2QF3A 3FOAA 1O3DA 1SGYE 2J98A 3OYPA 1SBWA 2VNTA 1B7XB 1SR5C 1FONA 3BN9A 3QO6A 3VFEA 2BTCE 5I46H 3F2HA 3MTYA 4AOQA 3N99A 1W10U 1SPJA 5SGAE 1KLJH 2J2UA 2XRCA 2Z9JA 2HGTH 2FOEA 2WPKS 4K2YA 1WTGH 3EGKH 2BY7X 1LMWB 1MAXA 1K1OA 2W3KA 1AZZA 3ATIA 4CRBA 5HIZA 1CT4E 5AHGH 1SOTA 1Y3UA 2FS9A 5EXLA 3NKKA 1GVZA 2A1DB 1XKAC 1C5NH 2ZQ1A 4X8VH 1CA0B 2ZF0H 1MABB 2ZPRA 5EOKA 1AFEH 4NG9H 4ZUHA 2GZ9A 4YZUA 1K1NA 1JIRA 2G5NA 4MPVA 3PMJA 1SMFE 2OQUA 5F03A 2FX6A 3B9FH 5IYTA 1C5XB 3JZ1B 1GJ7B 5A0BA 2B0FA 4R0IA 2ALVA 1NU9A 1K2I1 1V6DA 3MU5A 1GBAA 4IW4E 2YMSC 2Y6TA 2FYRA 3M3VA 1O2VA 3KEEA 1H8ED 3AAUA 4I31A 2UUJB 4Q7ZA 4YOJA 1OWDA 1ELTA 1VR1H 3FANA 3RXEA 5FHTA 4MVNA 1MTWA 1CA0C 4KTCA 2NU4E 1MTNC 1OWIA 3K65B 4WXIA 1CBWC 2B7DH 1DANH 1G3DA 4JZEH 3RU4D 3RXDA 1TIOA 2BY5X 2BDCA 1ESTA 1HAYB 1YPJH 2UUKB 1O3CA 2CF9H 4WH6A 3GICB 1JIMA 4ZHLU 2B9LA 4X2YA 4B2CA 5HGGA 1AI8H 1GHZA 1NBME 4RI0A 6GCHF 2K0QA 1QQ4A 4JYVH 1DWBH 2EI7A 4IN1A 4BXWA 1J17T 4YT7H 2OC0A 5A8ZA 1WCZA 4VGCC 3ZIAD 1LKAA 1ZSKA 1C1SA 3MO9A 1YPKH 2GJGA 1A5GH 4AX9H 4FOUC 5GCHG 1HXFH 3CS7A 2DE8A 1LPGB 1COWD 2KCYA 2W6ID 4ACBA 2RCEA 3PLBA 3RXHA 3LC5A 2FEQH 3A7VA 2HRVA 1SVPA 4MPXA 1MTUA 5L30H 3GCTF 1NRSH 2WUCA 5K0HA 1AU8A 4Q2KA 3M61U 1UTKA 2WV4A 1EZQA 1N1LA 2OQ5A 3LKWA 1SLXB 3LC3A 5EGMA 2VIVA 1NT1A 2NU1E 3A8AA 3T29A 4YXWD 3A83A 4XFQA 3ZZ9A 1G30B 2ZI2H 3SNBA 2QCYA 2ANMH 1BZXE 2I6QA 2GZ8A 2DUCA 1O2OA 3ATWA 4DT7B 1NC6A 1YCPH 5C5OA 3RXVA 1HAGE 3SZNA 3P70B 5BPEA 1NESE 3RXAA 1D3DB 1VGCB 2SGPE 2ZGCA 2XOKD 2FYQA 4GPGA 2QF4A 1GBLA 1OS8A 2GMTC 4AC9A 1DXWA 1V3XA 4R8TB 3TJOA 1O3PB 1H8DH 2F43B 1KMHB 3UIRA 1L4DA 1O2RA 4ABHA 3KQEA 3MO6A 1UJ1A 1EJAA 4X6NA 3QX5H 1YLCA 4NSVA 4X6OA 5F53A 3ZZDA 1VITH 4Y11E 3RP2A 2A45B 4UFFH 1SQOA 5EW1H 1RD3B 2PSYA 1J15A 1GI5A 2VWMA 3UNQA 3I29A 4DY7B 5C20A 4Y7BA 2H6MA 2VVUA 2ZFRH 3GYLB 2V3HH 3SJOA 3RXSA 1VGCC 2A32A 5DP7A 5F8ZA 3SU0A 3RXMA 1H4WA 1FAXA 4O97A 1ZMLA 1FAKH 2NU3E 1C4V2 2C8ZB 4D8NA 1GJDB 1G3EA 1C5MD 4LZ4B 1A3EH 1P02A 1ZGIA 2IN2A 2AMDA 1EJNA 3RU4T 4B1TA 3VXEH 1N8OB 1HAIH 2BZAA 1FUJA 1ZZZA 2FOBA 3KQDA 1PPCE 2XBXA 3AW1A 1C5ZB 3SORA 4I7YH 1KTTB 2PKAA 2D1JA 3EAJA 1GJ8B 2ZIQH 1B0FA 1BJUA 1Q31A 3RU4E 3PO1B 4UFGH 1GI7B 2ANYA 2FIRH 2W3IA 4TT3D 3MMGA 1QJ6B 1Y59T 1VCWA 2CK3D 3GY4A 3M7QA 1MZDA 3E3TA 2OLGA 1C2HA 1F0TA 2FS8A 4BXSA 1ZSJA 4AGJA 4IN2A 1N8OC 1TAWA 1DE7H 1FV9A 2CHAC 2L74A 4WH8A 3MU1A 5A09A 1Y5BT 2PV9B 5DJ7A 2AS9A 5EXMA 2G8TA 1O2HA 2TGTA 4K5ZA 4X1NU 3Q00A 1OWEA 2QF0A 2ZQ2A 4FUBA 5CE1A 1G32B 1C9PA 1G2LA 2BVRH 3DFLA 5DGJA 3K2UA 5PTPA 3LH1A 1SGIB 1XUIA 2ZO3H 1O2QA 1YY3A 2JJ2D 3A8BA 4ZROA 5E2OA 1GGDB 1O2TA 1YPHE 5L2ZH 5L2YH 2ZFSA 1SLVB 2WV9A 1GL1A 3O8RA 1LO6A 4U2WA 1FJSA 1G36A 3R0FA 1MKWK 3M35A 1TOMH 1P8VC 2VH0A 3SQEE 2F83A 1FPHH 1P2IA 1AO5A 3IITA 4FU8A 1S0QA 3UQVA 1O3OA 2FLBH 2QE7D 7GCHG 4ABGA 3OSYA 4MNXA 4AB8A 2IJOB 1HAHH 2G5VA 1E1QD 1IQGA 2Y5FA 1Z1IA 2XC0A 3LGTA 3RM2H 1CA8B 2FO9A 2J98B 1A0LA 1ETTH 1UTMA 4H4FA 1DSTA 4ABDA 1DT2A 5JBAS 1QQUA 2BVSH 1T4VH 1CHOG 2FLRH 1LHCH 5FBIA 1O3NA 3IG6B 3SUDA 1NY22 1W8BH 2XCFA 1LCYA 3L6PA 3BTDE 1OKXA 1YLNA 1TQ7B 3F9GA 3GDUA 4Z1MD 1AUTC 4ABAA 2ZTXA 4FETA 5TCAA 1O5AB 2KAIA 1C5RA 1QBNA 2ZCLP 1XUHA 3SV7A 5KECA 2WHXA 1TPPA 3OAAD 1QB9A 1NRNH 1O32A 4AGKA 1SKYE 2ZHFH 2C4FH 1GHAG 3GCHB 3ZVFA 3BIVH 2P93A 3TH2H 1YBWA 4YOGA 1TGNA 4FUCA 1MD8A 1PJPA 2OBOA 1YPMH 2XCNA 4ZKSU 1KTSB 1K9OE 4GCHG 3MU8A 2UWLA 1HJ9A 3ZVBA 3S9CA 1BQYA 2KCOA 2QXJA 1V2OT 3L3TA 4H6TA 1GDQA 3SI3H 3QLPH 2VH6A 1KXAA 1PQAA 1M9UA 2V0BA 1XUKA 4OGXA 1T8MA 1L2EA 3NK8A 1ZMNA 1O2MA 1NFWA 3SJ8A 3W95A 1SGFA 1HIAA 1A2CH 1GG6B 2BY6X 3A81A 1TNKA 4INKA 6ESTA 4YESB 2XBWA 7LPRA 2I6SA 2NWNA 5CHAB 4FXGH 3FZZA 1MH0A 3NCLA 3U8RH 4NWKA 2FDAA 1HYLA 1BDAA 1P2KA 4ZAEA 1UK3A 5T1VA 1ETSH 3UQOA 2Z6BD 1L0ZA 4YLQH 8ESTE 4TWYA 2O8WA 4HFPB 4K1SA 1O5BB 3MQKC 2BXUH 1WSSH 3M5MA 1EAUA 1GMHG 1HDTH 5T6FA 2QN5T 4ZMAH 3UFAA 2ZDLA 3M37A 5EU8A 3PM3A 1IQNA 1GG6C 1PPGE 1ZMJA 2FOMB 3BTFE 1HXEH 1FI8A 4BAHB 1ARBA 1BUIA 2ZG0H 3UR9A 1XX9A 2VVCA 3TH4H 2P8OC 5TJXA 1HBTH 6CHAB 3V0XA 4K1EA 4DW2U 3QZQA 1V2QT 1E1RD 2O8LA 1P2MA 2O8MA 3SNEA 3URCA 4BNRA 1ZOMA 3RXIA 1KLTA 3VEQB 2UUYA 1Z6JH 2A4GA 1MTVA 2ZDMA 1KLIH 3UNRA 4O03A 3Q77A 1HAXB 3DCLA 1QBOA 5A8YA 1NFXA 3B8JA 2JDID 3MH7A 1UVOA 3ZVCA 4MQAA 4K8BA 1TE0A 1EB1H 3MU4A 3P6ZB 3LJJA 4E06H 1AB9C 4B76A 1BTYA 1EPTC 1NRRH 5EIYA 1IQIA 1XVMA 1KXEA 3C27B 3T26A 4FUHA 2ZU4A 2NU0E 1BTPA 3ZVAA 1TPAE 2GZ7A 2IJD1 2XNIA 1EFRD 3S7HB 1WDIA 3WWFA 8GCHF 2K8IA 3TIUA 3SUFA 1YM0A 1QRXA 1JRSA 2ZU3A 5JPMH 1W7GH 1YLDA 1C2FA 3F1SB 2WPLS 1V2NT 1SGEE 2VGCB 2BOHB 3ODFA 3LGUA 3KCGH 5FXLA 2GCTB 2PP6A 3EA8A 2O8TA 1GCDA 4D9QA 1RXPA 1EXFA 1RFNA 3SOSA 3T62A 3U8TH 3D62A 5C3NA 3MO3A 2CJIA 1Y5AT 4K69A 2A0QB 4MPUA 1DOJA 1V2VT 3BV9B 4NFFA 4Y8YA 1PQ5A 1O2NA 1Y5UT 5DO4H 2ZCKP 4K60A 2PKAB 1C5LH 2EY4C 4Y6DA 1SGPE 3UNSA 1F2SE 1KSNA 2PWXA 2LP6A 1UTQA 2FI5E 1HAVA 5EQRA 1ELBA 3GY2A 5CDFE 2YNAA 2Y7XA 4HZHA 1BT7A 1MCTA 1NRPH 1THPB 1O35A 4J2YB 4F4OC 3SHAH 4OS4A 1D3TB 4X1SU 4ZKOU 3TJVA 2SFAA 2BM2A 3MNBA 2KR7A 4FU9A 3VGCC 1VCQA 3N7EA 5JDUB 1OXGA 3ATKA 3T28A 3GDSA 2R0LA 3SU6A 5FL7D 3TGIE 1E79D 4B73A 1ZHPA 2F9VA 1EZUC 2VIPA 1ZGVA 2ZNKH 1S85A 2LNCA 8LPRA 2C3SA 1VJ9U 3DT0H 4X1PU 4B71A 4GAWA 1ZHRA 3SHCH 3RXJA 2BZ6H 1CHGA 4ZCNA 1BMNH 2YOLA 4NFEA 2PGQB 2HNTE 2EI8A 2ZEBA 2SGQE 2WZQA 1YCPM 3LIWA 1ELEE 1FY8E 2BLQA 1RRKA 2VU8E 4NIVA 2M2AA 3C1KA 2FWWA 4OS1A 1GJ9B 1O2WA 3KHVA 4XBCA 4X0WU 1SQAA 1TNLA 1YC0A 2ZKSA 5JYIA 1T8OA 4FVBA 2ZA5A 2R2MB 3U8OH 5HXFA 3DSPA 1HAOH 3EDXB 3PWBA 3FN8A 6LPRA 1GJ6A 3SU4A 1J14A 5B6OA 2EI6A 2PLXA 1OYTH 3P8NA 3RXOA 3LOXA 1QIXB 2YMSB 1QA7A 1UVUH 1P04A 3F9EA 2ZHQH 3A80A 1MBMA 5JBCS
chains in the Genus database with same CATH topology
1P9SA 2A5KA 2B8OH 1TRMA 5HM2A 1FIWA 1J16A 2P3UB 3RXRA 1YGCH 4ISHH 1Y3WA 1HAPH 1GMCF 2RA3A 1MTSA 3FAOA 1MTNB 2F3CE 1HRTH 1CBWB 1TNIA 1WQVH 2SGDE 2JH6D 2Y82A 4TPYA 1TALA 3K9XB 2A2XH 1TNGA 4TWWA 1TYNA 2G52A 1J9CH 2GD4B 3URDA 2KAIB 3BTHE 3P8GA 4TY6A 1FNIA 3SBKA 2LPRA 4TPIZ 1K28D 2CMYA 4JK5A 4KELA 3NZIA 5C5NA 3SW2B 3MHWU 2GCHF 5C1XA 4VGCB 1XUJA 2F91A 4AORA 3SU1A 4IGDA 2YNBA 4ABIA 1TOCB 2Y7ZA 1FY5A 2W7SA 6GCHG 1QY6A 2STAE 2ZFPH 3V7TA 1A46H 1V2UT 1O2XA 1HCGA 1AZ8A 1D9IA 2Q6GA 1BCUH 1SGQE 5GDSH 1LQEA 3G01A 1JXPA 2Y5HA 2BDGA 1BOQA 1HJ8A 3BTTE 5E0HA 1RS0A 1ZPBA 1H1BA 5LH8A 3ZVDA 2CGAA 4DOQA 1A0HB 2BQ7B 1E38B 3M5OA 4YOIA 1T4UH 3BG4C 3GCTG 1AN1E 3VB5A 2Z3EA 1SHYA 1Q3XA 1L4ZA 1HIAB 3RXCA 1BA8B 3S9AA 1XUFA 1MKWH 1ANEA 1NFYA 2Z3CA 1A5HA 2BD2A 3SGAE 5DPAA 1AY6H 3U9AH 3RMNH 1YP9A 1SC8U 1GBHA 2ZZUH 2PKSC 3E91A 4H6SB 2GMTB 1P9UA 1LKBA 3RXBA 2THFB 1GJAB 1C2KA 2CXVA 3TK6A 1GDNA 2FOHA 2HALA 1DLEA 1MMJN 2F9OA 1E34B 3HATH 3M7TA 4MNYA 1CT2E 1EPTA 1G2MA 3TJUA 1BJVA 1PPZA 2GTBA 3RM0H 2V3OH 2HNTC 5FCKA 1C5OH 2ZU2A 3P8FA 7ESTE 1Z8GA 3BSQA 4B74A 3QUMP 4GLYA 3I78A 1BTUA 1C5YB 1H9HE 4K8YA 1TBZH 1MBQA 4X6MA 3RXFA 3E0NB 1NRQH 1BRCE 3MNCA 3JZ2B 3STIA 1HJAC 1GBMA 4MPWA 1GHBF 3T2NA 1SB1H 4CREA 1TNHA 5ABWA 3ZZ5A 4B2BA 4NSYA 2VIDA 1WV7H 1TPSA 2A7CA 2PHBA 1WU1A 3VB4A 1GI4A 1X7AC 1RTLA 1C2LA 1BHXF 4A5TS 5GPIB 3ZZ7A 4DJZB 4XBDA 3E6PH 1LVYA 5T6GA 3RC4A 1FY3A 1WAYB 1O5DH 2G4TA 2ZGHA 2ODYB 1QL7A 4KTUA 3MH6A 3FFGA 3DUXH 1O3JA 2W7UA 2Z9IA 5DKMA 1SGDE 2F9BH 1O5GH 1BRUP 4JZDH 1KXDA 4ABJA 4CR9A 3I77A 5K7RA 1O3GA 2PTCE 1GBEA 3FP8E 1OWHA 4XE4A 2CHAB 1TFXA 1O2JA 5C1UA 2Y81A 1L1GA 4LZ1H 1ZRKA 2ZU5A 3E0PB 2FODA 5AFZH 3M5NA 1FZZA 2TGPZ 3A89A 1DICA 3P8OA 2STBE 4BAMB 1C2EA 2PR3A 4Y8ZA 1BTZA 1DUAA 4YT6H 5LPFA 4NIXA 2HWLB 4JYTA 1C1WH 1GHYH 2J92A 2Z9LA 3HGNA 2SGEE 1TRNA 1GBFA 3ENSB 4IMZA 1A7SA 4AZ2B 4D9RA 4DIIH 5J4QA 4OS7A 1G37A 3M5LA 1V2KT 3SJ9A 3BTQE 3LGVA 1JWTA 1P3CA 1Z7KA 5AFYH 3GDVA 1GCTC 4YLUA 1GDUA 1ELVA 4X6PA 1PPEE 4XDEA 5FCRA 1ANCA 2ZDKA 2ZHWH 2ZP0H 5FPSA 1HAVB 4Q7YA 5FBEA 5EG4A 1P57B 4AFQA 3BF6H 1DDJA 1CGHA 1MD7A 1AKSB 2JETC 1AVWA 4NWLA 1ZTKA 1UCYK 5LPRA 3QTOH 2QIQA 4TY7A 1Y3VA 4CRFA 1OSSA 3QK1A 1THSH 2BD3A 2D8WA 4ZH8A 1ABIH 4YTAA 1NN6A 2VWNA 3NPSA 5A0AE 1H8IH 3T27A 1ZPCA 1S0RA 1TX7A 2FX4A 2OUAA 1UHBB 1CSOE 3BTEE 1F5LA 4HI3A 1SGRE 4E7RG 1IAUA 2ZPQA 3V12A 5DK1A 4SGAE 1UK4A 2PW8H 2OCVB 4A7IB 3ATLA 4ABFA 1RTFB 1OWJA 1DITH 4ZHAA 4INHA 4I8KA 1PYTD 1C2GA 1ZTJA 5DP5A 1K1PA 2A2QH 1QURH 4U30A 4NA8A 4CHAC 1HB0B 1TABE 3KGPA 3UPEA 3BTGE 1P09A 2ZTYA 3SU2A 3UR6A 2H5CA 2FOGA 4FUIA 2P59A 2XBVA 1P01A 1UTLM 2ZDAH 2SNVA 3A82A 4A92A 3NWUA 4RKJB 4DCDA 1ELFA 2WPJS 2XYAA 5G4BA 1O37A 4THNH 7GCHF 1W12U 2FXRA 1P12E 1CGJE 2OINA 4A6LA 1YPGH 4KGAA 2Y80A 1E35B 2H2ZA 3AAVA 5ESTE 1F5KU 2VWOA 3A7WA 1HUTH 1GBKA 1BMLA 3GISB 5ESBA 1EP5A 4AG2A 2J94A 4I8LA 4ZKNU 1HGTH 2BB4A 3KN2A 1VITF 3GY8A 1HAZB 1SGTA 4I32A 3DD2H 3MI4A 1QR3E 3ZVEA 1QHRB 1A5IA 4Y0ZE 3SUEA 4FVDA 4BOHA 2IPHA 1AVGH 2HNTF 3MFJA 1Y3XA 3Q3XA 2D26C 1IQHA 2QAAA 1O2GH 4E05H 3FP7E 4FUFA 4I8GA 4D7GA 3OY5U 1QJ1B 4NIWA 3UY9A 2BX4A 2BD7A 1KXBA 1SOZA 2FM2A 3PB1E 1OP0A 2FOFA 4XSKU 2FTLE 5C2ZA 1V2WT 1ETRH 1JOUB 2BHGA 1AE5A 1AWHB 1ESAA 4HGCA 3P92A 1GWAA 1P2NA 2AFQB 1SFQB 3BIUH 2PGBB 4ISNA 1Z8IB 3RMLH 1P06A 2BY9X 5I25A 1L1NA 2P8OB 4GCHF 3HGPA 2ZPSA 3RUOA 2F9UA 2BX3A 2GKVE 2G55A 1MUEB 3NXPA 3TU7H 2BQ6B 2WPMS 1DSUA 1C2IA 2OTVA 2OC7A 1O3AA 4ZXYH 1S6FA 1O2YA 3A84A 2ILNA 1F0SA 4ZXXH 1GHXH 1TX6A 4F49A 2GDEH 1ID5H 3OTJE 3TH3H 5A0CA 1NZQH 1P11E 4MTBA 5HM9A 3DFJA 2XXLA 1EZXC 5HMAA 3LDXH 1DWEH 3SV2H 1F5RA 1V2MT 3TNTA 2QGRA 5E8EH 1O5EH 2WPHS 1AB9B 1GBCA 2A4QA 1RIWC 1AFQC 1TPOA 1EPTB 1ABJH 4WWYA 9LPRA 3HKIB 3ZYDA 2FI4E 4BTUB 3RXQA 1C1NA 1PQ7A 3WY8A 1GPZA 1QGFA 2AMPA 5EPNA 2C8YB 3PV4A 1MZAA 1AWFH 3A86A 1GJ5H 1GMHF 4A1XA 1DUEA 4X8TH 3S69A 3U1IB 5DP9A 5JB8S 1BBRH 5TCCA 3D65E 1LPZB 1SFIA 1IQMA 2EEKA 4WMDA 4DIHH 3QN7A 4WF8A 1BTXA 2ASUB 2AEIH 4NZQA 2ODPA 2AGIX 4Q7XA 1LHFH 8GCHG 1QBVH 4AFUA 3VB6A 1O2ZA 4D7FA 3ITIA 3PMAB 1IQFA 1C1QA 2BDBA 1QL8A 5EQQA 4BTIB 2FZZA 3SN8A 1SLWB 4FUJA 1PPFE 1O2LA 1UCYE 1C2JA 2ZHEH 1SLUB 1F92A 3A8DA 1W0YH 4Z0KA 1IOEA 2AIQA 1K1IA 1IQEA 2JKHA 1EOLA 1S6HA 1QRZA 2GX4A 1EASA 5H4IB 2GT7A 3PTNA 1BHXB 4CH2B 5HYOA 4IS5A 5EQSA 3TITA 3TLOA 3QGNB 4RKOB 1ZJKA 3VGCB 4OS6A 4FUDA 4X8UH 2WV5A 4BANB 3BTKE 1V2LT 5GIBA 5FPYA 1GBDA 2IOTA 3M3TA 1EAWA 3NUMA 1HLTH 2G51A 3PYHA 4KP0A 2FOCA 3LGYA 1MU8B 2AMQA 1QNJA 4NCYA 1V2TT 1L1JA 3ODDA 1VZQH 3E8LA 1AKSA 1DFPA 2ANKH 2Z94A 5E0GA 1O3LA 1S82A 1UVTH 2BYAX 3ZZBA 1DX5M 1OOKB 1ELGA 2XC5A 1JBUH 5F8TA 1GMDF 3PMBB 4UD9H 2B5TB 2HVXA 2VWLA 2XWBI 3ZVGA 1BMMH 2J34A 3EA9A 1UHBA 1ZSLA 4IMQA 1TGTA 4MDSA 3KNXA 1TQ0B 1O31A 1O3MA 3A85A 1P10A 1LDTT 3SU5A 2A5AA 3GY6A 2XC4A 5L6NH 2ANWA 1QB6A 3STJA 1XKBC 1GI2A 2SGFE 3UWIA 3FVFB 3QZRA 3SU3A 3MYWA 4NIYA 1C1UH 2G81E 2BDAA 2JH5D 1LHDH 1AMHA 2ZTZA 3V13A 1BB0B 1IQKA 2O9QA 3VPKA 2Z7FE 4E7NA 3E1XB 2AYWA 8KME2 1KY9A 1OYQA 2TIOA 3CP7A 2FOAA 4JCNA 1D6RA 1GMCG 1D3PB 1G9IE 2GP9B 2QV1A 2EA3A 4INLA 1T8LA 1NM6A 3S9BA 3R3GB 4CRGA 1D4PB 4RSPA 2QY0B 1NO9H 2A4OA 3F6UH 2ZDNA 1SHHB 1P03A 3LPRA 4JYUH 4FUGA 2WYJA 1GVKB 4GSOA 1SGCA 1A61H 3OY6U 3A7XA 2A7HA 2BLWA 5JBTA 1O5CB 4LXBH 3DHKH 3EE0B 2UWOA 4GHTA 3MU0A 3GY3A 1BRAA 3GCOA 4DURA 1BBRK 2GCHG 3RXLA 2BY8X 4LOYH 3RXTA 4Y79A 1DPOA 3ZV9A 1WOFA 1O33A 2GGVB 1SI5H 2VVVA 1TGCA 1DY9A 2OD3B 5IDKA 1GI3A 1H9LB 3KQCA 1T31A 1TONA 3AVZA 1S5SA 4TYDA 3KL6A 4U32A 3RC5A 3ZZ4A 1YPLH 3BG4B 5C67A 2VIOA 1DXPA 4BAQB 1ZJDA 3SO3A 1GL0E 1C9TA 4K1TA 1O2SA 5FX5A 4GHQA 2J95A 4ISLA 4UFDH 2M5TA 1XUGA 1NS3A 4UE7H 5LPEA 1AGJA 3UOPA 3ZZCA 1C1VH 3ZV8A 3HPTB 2R0KA 3A7TA 2PKSB 4KTSA 4CRDA 3O8DA 1GJ4H 2K1QA 4Y10E 2HPPH 4AYVB 2UUFB 3RLWH 1IHTH 1UCYH 3TK9A 3BEFB 1DVAH 2Q1JA 1YYY1 1ACBE 1QTFA 4NGAH 1WTHD 1GHWH 2GV7A 1A4WH 2V6NA 2ZWLH 1QCPA 1RGQA 4FU7A 1O3IA 1KXFA 1DM4B 3GY7A 4IBLH 1Z1JA 1FY1A 2QC2A 1UTJA 2SNWA 4AN7A 5F6MA 1C1MA 1TBQH 1KIGH 2C90B 2AGEX 1HJAB 5EXNA 9ESTA 5EW2H 1XXDA 1YF4A 3A88A 3LGWA 4MLFB 4U01A 3SGBE 3M7UA 2FMJA 2RDLA 2OBQA 1TA6A 5GCHF 2Z3DA 2BD9A 1AE8H 1GHBG 1V2PT 1ZHMA 1JMOH 2C8XB 4ZKRU 1QL9A 3MNXA 1C1RA 1O39A 2FP7B 2HLCA 2R3UA 3A87A 3TPIZ 1AD8H 3PWCA 1LHGH 1NU7B 1GBIA 2Z9GA 1OP2A 3HK3B 4NA7A 5FAHA 1QA0A 1MAYA 2Y5GA 2J38A 3D23A 2H9EH 2ZECA 3UWJH 1OPHB 3SNCA 1P2OA 2F9NA 3KIDU 3V3MA 1S83A 1EZSC 3BG8A 4CR5A 2TGDA 1S84A 3SV8A 1SG8B 1BIOA 2A31A 1FXYA 3K6YA 1H9IE 3ZZ6A 1T8NA 1C5TA 2AGGX 3BEIB 1ZRBA 2P16A 1NPMA 1LVOA 2GVFA 1GI8B 3H5CB 1INCA 1KDQA 1TWXB 1Q2WA 5EODA 4AG1A 7KMEH 1Y8TA 3PROA 1YPEH 1K22H 1ZLRA 1C1OA 5FX6A 1C1PA 4AFZA 3QWCH 4ZHMU 1GCTB 2QYIA 2JH0D 3B23B 3BTME 2H5DA 2PUXB 1W7XH 3M3SA 2H1UA 1ARCA 1QJ7B 1O2KA 1EP6A 3MH4A 4AFSA 1ELAA 1ELDE 1W11U 3RMMH 4CRAA 1F0UA 2C93B 2JETB 3TVJB 1E37B 3UTUH 1XM1A 2PSXA 1DWDH 1GHVH 3D49H 1CQQA 4ESTE 1C2MA 1AQ7A 3U98H 1O3HA 2FI3E 3ESTA 1SL3A 4CH8B 4O3TA 3E90B 3RXKA 3UOUA 1V2JT 1S81A 3HKJB 1YKTA 1UO6A 4JZIA 1KYNA 3Q3KA 1FPCH 2A4RA 3ZZ3A 1O0DH 1THRH 5CMXH 1MU6B 4J1YA 1MQ6A 2XBYA 1TMTH 1T32A 3W94A 1E36B 5F8XA 2WPIS 1O3KA 2Q6FA 4O9VA 1V2ST 4UEHH 2ALPA 1OX1A 3LGIA 1OWKA 4X1QU 4OGYA 5JB9S 1BBRE 2ZU1A 4OS2A 1QFKH 3VB7A 1ZTLA 5GXPA 1F7ZA 1WQSA 2QXIA 4CHAB 2BOKA 3PMHB 1F0RA 3QDZB 3PO1C 4Y71A 1O3FA 1Z8RA 3KQBA 1JRTA 3SJKA 1UVSH 1TBRH 4WMFA 1MQ5A 1LTOA 4JZ1A 4MG3A 2ESTE 2PUQH 2TPIZ 2OXSA 1O36A 3SGQE 1C4Y2 3RLYH 1QB1A 3SJIA 3LONA 1IQJA 4X8SH 1B0EA 1SQTA 3SV9A 3Q3YA 1DY8A 5JBBS 2FPZA 1G3CA 2QXHA 3SV6A 1ANBA 5ETXA 4NA9H 5DP3A 1AHTH 1N6XA 3P95A 1EJMA 3VB3A 2HPQH 3BEUA 1P0SH 2BMGB 4AB9A 1W14U 3BTWE 4CRCA 5FPTA 4UONA 3VXFH 1GGDC 1P3EA 2PFEA 3M36A 1U6QA 1FDPA 2BLVA 1VITG 2TGAA 1ORFA 1C1TA 1YCPK 4LK4A 1UVPA 3FP6E 4Y0YE 1LHEH 3T25A 4B75A 4Y8XA 2ZFTA 1GJCB 1SGFG 3EA7A 3ELAH 3F9FA 4BTTB 5GWZA 4XOJA 2BD4A 1UTNA 1AVXA 3UUZA 1NTPA 2C8WB 1CHOF 1O2UA 4AYYB 4X2VA 3H7OA 2RG3A 1K1MA 2HOBA 3RXPA 1LVBA 2ZGXH 4IC6A 5LGOA 1PQ8A 2G4UA