1NESE

Structure of the product complex of acetyl-ala-pro-ala with porcine pancreatic elastase at 1.65 angstroms resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
b'VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE
publication title Structure of the product complex of acetyl-Ala-Pro-Ala with porcine pancreatic elastase at 1.65 A resolution.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 59
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1995-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1nesE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1nesE01
3L33A 2NWNA 5AVDA 4WVPE 2BDHA 1GL1A 1K1NA 4BOHA 1E38B 1ZSKA 4YM9A 2Y81A 4XBBA 5DP7A 1V2QT 5FXLA 2D2DA 3O8CA 3SNEA 2QA9E 2QV1A 2BZ6H 1QBNA 1TIOA 3RXBA 2FYRA 4XOJA 2UWOA 4NIWA 3ZVEA 1RRKA 5C5OA 4AZ2B 4GUXA 3FP6E 2IPHA 2AH4X 2ZP0H 2VJ1A 4TY7A 5EODA 4K60A 1XUJA 2ILNA 3M5OA 2PR3A 2M5TA 1K1PA 4R8TB 4Y0ZE 1TA6A 3S9CA 2Z3DA 3O8RA 3Q3YA 2OC8A 2C4FH 1DY8A 1TBQH 3AAVA 2Z3CA 1ZTLA 3M5NA 2J2UA 3QUMP 1W2KH 5FX6A 3MH4A 5E0HA 1BMLA 1KIGH 1GJCB 1C2HA 2ULLA 4ISNA 2A4QA 2OUAA 1SQOA 1UTKA 1NFUA 3IITA 1BRAA 4LK4A 4Y7AA 3JZ1B 1C2LA 4A1XA 5FAHA 1XUHA 3GISB 2ZECA 3U1JB 1AN1E 2QXHA 1NRPH 1P8VC 4RSPA 4BAMB 1EAXA 2TGAA 2FLBH 4B1TA 1O34A 2A7CA 2GV6A 3BTGE 1CGIE 1P2NA 1S0RA 4RN6A 1PQ8A 4AB9A 1QURH 4MLFB 1O2PA 3PWBA 3DUXH 3P8FA 1BCUH 4H6SB 2CMYA 4IMQA 1VITH 1T8MA 1TFXA 3GOVB 1YGCH 1CQQA 5EXLA 1E34B 2Z94A 1QJ7B 1Y8TA 1QL7A 2FTLE 3A7WA 3KHVA 1OYTH 1QRXA 1O3KA 1ELCA 1F5RA 1Y5BT 5DP4A 5F8ZA 2R3YA 2G5VA 1ELAA 1HPGA 2BD4A 1GVLA 3MWIU 1ESBA 1Z1JA 1IQMA 2W7SA 1MTNC 1O2LA 3GCNA 1E0FD 4Y7BA 1NM6A 2GKVE 1KXBA 1GMHG 1UVTH 2HNTF 1MZDA 5BPEA 4IC6A 1A0HB 1C5UA 4YOJA 1BUIA 4PROA 3ESTA 2ZF0H 1GBAA 3VXFH 1KXDA 2ZDKA 3IWMA 3LPRA 4ZKSU 4Y79A 2R2MB 1O3EA 3RXKA 1UCYE 1FY1A 3KEEA 1C5ZB 1EX3A 5HXFA 1XUGA 1O3CA 4K1SA 1W0YH 3KQEA 5LH8A 2C90B 1UTQA 4CH8B 4NSVA 3GY8A 1Z71A 5FPSA 2C8YB 2P16A 4AX9H 3TJNA 3UIRA 4FVBA 1ZLRA 1C2DA 8LPRA 2OQ5A 1GBIA 3GY2A 2OINA 1THSH 4FU7A 3HKIB 1T7CA 1EB1H 2JETC 1O2TA 1O3JA 1Z8JB 3TGIE 4TPYA 4BAHB 1ESAA 1QQUA 3BTKE 2XC0A 1G2LA 1S83A 2VGCC 1VJ9U 2XCFA 1F0TA 2Y7XA 2FXRA 1HAIH 1XVOA 2PGQB 4E06H 1MKWK 3UNRA 1QY6A 4NA7A 3ZZ8A 3SGAE 4ZAEA 3SNBA 2Q1JA 3OX7U 5CE1A 3VGCC 1NY22 2DE8A 3K6YA 5TCAA 1AO5A 1V2LT 1P12E 3GCTG 2FOAA 3SNDA 5JPMH 3MFJA 1B5GH 1DM4B 1UJ1A 1BRBE 1HJAB 1AWFH 2FPZA 1WYKA 4YT7H 2FS8A 3TLOA 2TIOA 1O2SA 3TU7H 2UWLA 1W13U 3RC5A 1TONA 2C93B 2VVUA 1CBWC 1O3OA 1ACBE 3ATWA 2GZ7A 4TYDA 1BQYA 5SGAE 1IQIA 2H9TH 1GI9B 1QIXB 3M36A 5FPYA 1GCTC 4NWKA 3A8BA 1ABJH 3E6PH 5F03A 3R0FA 2EI6A 2ZZUH 1UVSH 3VFEA 1CHGA 2DUCA 1CVWH 1ELVA 5EU8A 1B7XB 3BV9B 2BTCE 2PHBA 2HPQH 1P57B 2BLWA 1VGCC 1P2MA 4FUBA 3QK1A 3BIUH 4UFEH 3BG8A 2ZDLA 1GMDF 1UVPA 1O35A 3SV6A 1AFEH 4JZEH 3RXJA 1EATA 1RJXB 1YBWA 1S6FA 1MQ6A 1P3EA 1LMWB 4K2YA 1DANH 2HOBA 2G52A 2Z6BD 1V2MT 1G30B 2Z9JA 3ENSB 1HGTH 2J38A 3QGNB 2SGQE 2ZU1A 1NRQH 1MKXK 3U8TH 1PFXC 3SV8A 1A0LA 2GT7A 3UNSA 3KNXA 1O5FH 1CO7E 1CSOE 2K1QA 3BTFE 3AVZA 4NA9H 1MTWA 2H5DA 3M3TA 1FIZA 4X1SU 3SU1A 2RDLA 5AFYH 4DGJA 2PTCE 4AG2A 1C1TA 4ESTE 5C20A 3I78A 2ZHDA 1QRZA 1BJUA 2JH6D 4X1NU 5J4SA 3LGIA 2SGAA 1G36A 1ABIH 3ITIA 3HK6B 1MAYA 2STAE 1LVMA 1ZRBA 2J34A 1MD7A 2BZAA 3GDSA 3TGJE 1FLEE 4Y71A 1SPJA 1TA2A 1EOLA 4LZ4B 1GGDC 1C1SA 1GHAF 1PPFE 2FYQA 5T6FA 3GY5A 1F0RA 1Z6JH 3A7VA 3Q77A 1O5DH 1BTZA 1HBTH 2Z9LA 1PPBH 1F92A 3PTBA 2OCVB 2VH6A 4NZQA 4Y10E 1NPMA 1SB1H 4X2WA 3RXRA 1HCGA 1MH0A 5EXMA 1C2FA 5DPAA 2Z9GA 1SVPA 2BY5X 1WV7H 3MH5A 1WTHD 4K3JA 2CF9H 3U8OH 1ZTJA 1D3DB 2WPHS 4X2YA 2JKHA 2RCEA 1GDUA 1SGRE 3MNBA 5H4IB 1S85A 5GCHF 3HPTB 2STBE 1BMNH 2H5CA 4U30A 4TWWA 3A84A 5C67A 1BTUA 2ZEBA 4INKA 1O30A 2VWNA 3T26A 4Y0YE 1CA0C 3D49H 4DOQA 1QL8A 1DXWA 2PLXA 3AW0A 4ISHH 2GDDA 4KTUA 1KLTA 3TH4H 3VEQB 1O0DH 1V2JT 4IBLH 2XC5A 2Y82A 1TQ0B 3GY6A 1YPKH 3QX5H 2PUXB 2A4OA 2XBVA 2ZPRA 1VR1H 4HFPB 1AE8H 1C5NH 1H9LB 1S0QA 1ZHMA 1SGNE 1WUNH 3F9HA 2A0QB 4Z6AH 1SFIA 1A46H 1WQSA 2BMGB 2AYWA 5EOKA 3F68H 2ANKH 1QB1A 1DVAH 1TGTA 3NZIA 1ZHPA 1DLKB 1D3TB 4NSYA 2A4RA 2GDEH 2W5EA 5GWZA 1RIWB 2V6NA 2R9PA 1U6QA 1ELTA 1KTSB 4K8BA 1SI5H 1NZQH 4X1PU 1SGIB 8KME2 4VGCB 1ZPBA 1P01A 2CGAA 2FO9A 4RKOB 1C2KA 2BVRH 1M9UA 1K22H 4OS5A 4MNWA 4IMZA 1DUEA 1ANDA 2GZ9A 2TGDA 1KY9A 3VB5A 3SN8A 3KQBA 3A82A 1O3LA 2LPRA 3E0NB 1QGFA 3MU4A 1MBMA 1NC6A 4KP0A 2FOEA 1T8LA 2P3UB 2ZU3A 1TNGA 1C1WH 1AU8A 1P2JA 4J1YA 3ZZ3A 2QGRA 1HAYB 2I6SA 3AW1A 2Z9KA 1LKBA 1BHXB 1YPMH 1IQNA 4X0WU 2KAIB 1C5RA 4HI3A 1EQ9A 1O3GA 1P09A 1N1LA 2D1JA 1FJSA 2IN2A 1O3PB 3LONA 2J94A 2D26C 5A0CA 1DE7H 2CHAB 1BBRK 4NA8A 3EQ0H 4AFQA 1IAUA 2SNVA 1AZ8A 1FN6A 1IQLA 1NFYA 2QCYA 3A7YA 1LHDH 1P2KA 3LOXA 3M7TA 3MU8A 1G3CA 1FDPA 2ZU2A 3RU4T 2WPJS 1DX5M 1FPHH 3A7ZA 3S7KB 3BTHE 1AGJA 2XTTB 4AGJA 2G51A 1Y5AT 3VB3A 1GL0E 3SI4H 1XX9A 3P17H 3RXSA 1WTGH 2C8ZB 2H1UA 2OC7A 1C5QA 4GPGA 2OP9A 2HRVA 3OTJE 1C5MD 3P70B 3E90B 2ALVA 1PPHE 1W0ZU 1KLJH 1YPJH 3SI3H 4ABEA 4A5TS 2XXLA 1GHAG 2BXUH 5AHGH 1TX7A 4YOIA 2QXIA 3CP7A 1TBZH 2A45B 2HNTC 3LC3A 1ZGIA 4BNRA 1QB6A 3A81A 4JYTA 1IOEA 2PV9B 1GMHF 1TGSZ 5DP3A 3ATIA 1MUEB 4B2BA 2FM2A 1G3BA 3ODFA 3SQHE 4F49A 1YLCA 2GGVB 4AG1A 3S9AA 3C27B 3V0XA 1KDQB 4TWYA 7GCHF 4B2AA 5L6NH 3RXTA 2G8TA 1EP6A 1YP9A 1LHCH 1GJ9B 4GSOA 1MCVA 1UHBB 1Y59T 3PM3A 5K0HA 4B73A 1OYQA 1HIAA 2CN0H 3KQDA 3HGPA 1XXFA 3T2NA 1J16A 1TMTH 3MNCA 3SUFA 2O8LA 3KIDU 4Y8XA 1EAIA 1S81A 3RMNH 2C3SA 1AFQC 5CHAC 4JYUH 4XBDA 2B5TB 4KKDA 2B9LA 5EPNA 1SQAA 5DP8A 4NFFA 3P92A 5F8TA 1UCYH 3RXCA 3F9GA 3GICB 3M7UA 3QZRA 1OOKB 2PSYA 3SW2B 4X6MA 2VIWA 3UPEA 1P0SH 2FS9A 1C5SA 3UNQA 2AIPA 1MU8B 3BTTE 3URDA 3EGKH 5T6DA 4YZUA 1K1LA 3ZZCA 5A0BA 1FZZA 2JH0D 3B23B 4H6TA 3BTME 2BYAX 2PTNA 4UD9H 3GDUA 2BDIA 3QGJA 3GCTF 4AN7A 9ESTA 4FUJA 1C2GA 3SU2A 1BB0B 3TVJB 4I31A 3S69A 4FUHA 2BY7X 3SHAH 2ZTXA 3LGWA 1GI3A 1RTKA 1RD3B 5GDSH 4CHAB 1TNJA 4MPWA 2R2WU 1H9HE 4OS2A 2ZKSA 3S0NA 1WSSH 3AAUA 3UWIA 4NIYA 1EP5A 3KCGH 3GCOA 2R3UA 4CBOA 2GZ8A 4IW4E 3KN2A 4DURA 3U8RH 2BM2A 4X8UH 4BAOB 2RA3A 3VB6A 1BA8B 2Y80A 3O8BA 5EQRA 1K1JA 3C1KA 2F83A 1G32B 5E2PA 3BEIB 2WPIS 2AEIH 5GPIB 4Y8ZA 2ASUB 2VU8E 4BTIB 4CRDA 2GMTC 2QYIA 4NCYA 1C5LH 5C1XA 3EA7A 2Y6TA 1FAKH 2Q6FA 1ZMNA 2BX3A 2P93A 1GBHA 1W8BH 3KQCA 2FLRH 1F2SE 1H8DH 2BQ7B 3A85A 4IN1A 4LOYH 4HGCA 3SU5A 2O8UA 6GCHF 3PO1C 2WYJA 4X2VA 2QIQA 1SL3A 2QY0B 2Q6GA 1PYTD 1HXEH 4ABHA 1C1NA 2FX6A 1DY9A 2NU2E 1C4U2 1KLIH 1OX1A 5DP9A 4ZKNU 4ABGA 1C5WB 2QF0A 3RUOA 2Y5HA 3SORA 1W14U 2W3IA 1FY5A 5GIBA 1P2QA 1LHFH 1D6RA 4JK6A 2C8XB 3FP8E 2WV5A 1GHVH 2TGTA 2A5IA 4JCNA 4X6NA 1MD8A 2CF8H 4FXGH 4IC5A 2UUYA 1Q2WA 2OTVA 2OBQA 3S9BA 2BDCA 1UMAH 2SGPE 4NFEA 3I77A 1DWCH 1GI8B 4JZIA 3W94A 1C5YB 2BY8X 2QC2A 2HALA 2ZQ1A 4ASHA 7KMEH 1V2OT 2G4TA 3SBKA 2Q6DA 1UTNA 3SV2H 4GLYA 3VPKA 3QN7A 3M35A 1C1UH 3NPSA 1LTOA 1BTPA 4QT8C 1O5GH 1KXAA 4JZDH 3K65B 2AIQA 3LIWA 7GCHG 2FOMB 5JDUB 3RM0H 1OWKA 2VIVA 3D65E 4BXSA 3Q00A 1GJDB 4D9QA 1ZYOA 3BTEE 1GBDA 2Y5FA 3F9EA 1IQFA 1GI2A 1GJ8B 4I8LA 3RMLH 3RC6A 1A3EH 2BD8A 1GBFA 4B74A 4MPVA 3PMBB 2QXGA 4M7GA 1THRH 1CGJE 2W3KA 1C9TA 2VIQA 3ZZ9A 1H4WA 1NRNH 2F9PA 2A5KA 2UWPA 3ZVDA 7ESTE 3LGYA 3HKJB 1NESE 1QNJA 4ZH8A 1L1GA 1MAXA 4WWYA 1TRYA 1A3BH 1O2ZA 3M7QA 5A8YA 3BSQA 3VXEH 5IDKA 1DDJA 1IQJA 1P02A 1TRNA 1OWJA 1GBKA 3SJOA 2BDYA 3A8AA 1CT4E 2G5NA 3ZVCA 5F8XA 3RXHA 1GJBB 3E0PB 3ZZ5A 1TQ7B 4Q7YA 1UTMA 3JZ2B 6CHAC 4AFSA 3PLPA 4Y11E 3T25A 1ZRKA 3UREA 2G55A 4CR9A 4KTSA 1TB6H 4D9RA 3LDXH 1O5BB 1SR5C 1KSNA 3UQOA 3RXGA 3OY6U 5ETXA 1O3BA 2ZPQA 3M3VA 2YNAA 2XBWA 4WH8A 2BY9X 2R0LA 2FOCA 1GI0A 1G9IE 3ODDA 1OS8A 4ABIA 2XBYA 3TNSA 1W11U 1NFWA 1FY4A 4BAKB 2HWLB 1A0JA 1Y3VA 4INLA 3A83A 3ZV9A 1BMMH 5EXNA 4CREA 1Z6EA 5LGOA 3F1SB 4K1TA 3LKWA 1LQEA 4JMYA 4ABFA 4Q2KA 4ZXXH 3CS0A 1QA0A 3ATLA 1W3CA 1ORFA 4INHA 1KYNA 1ZHRA 3RC4A 2GTBA 2V0BA 1IQGA 2OLGA 3E1XB 1A4WH 1C1VH 3TH3H 1SLWB 2RA0A 3TJVA 1V2VT 1GJAB 5ESBA 1RTFB 1Y3UA 3STJA 1SGYE 5FPTA 1BZXE 2TGPZ 1HAZB 1K21H 4UFFH 2PFEA 2FI3E 2XW9A 4HZHA 4ISOA 4XFQA 3RMMH 1P11E 1K1IA 1O2QA 1HXFH 1MTUA 1PQ5A 1V2KT 2ZIQH 4OS1A 2OC0A 1GG6C 1DWBH 1YPHE 4KGAA 6GCHG 1Y5UT 3MHWU 1VCPA 1HAPH 4YLQH 2AGGX 1MBQA 1AKSA 1F0UA 4X2XA 1G3DA 3MOCA 1AB9C 1RFNA 3BEUA 4A1TA 1CHOG 1O2YA 4RKJB 1NS3A 3SOSA 1C4V2 3T28A 1IHTH 5T3HA 1L4DA 4DIIH 5DGJA 1W7GH 2OD3B 2WINI 1PPGE 2FIRH 2JETB 4FUDA 1L1NA 1V2ST 2R0KA 3UY9A 1GI7B 2FX4A 4CRCA 2BD9A 3MI4A 1O2GH 1BBRE 1FXYA 3QWCH 1VZQH 2G00A 1OWDA 1V2RT 1PQAA 2P3TB 1DLEA 1HYLA 1V2PT 2VGCB 3RDZA 4E05H 4D8NA 1O5AB 1O2VA 2A31A 4H42U 2EA3A 1F7ZA 2GP9B 2YOLA 1IQKA 1ELGA 2OC1A 3EDXB 1A5HA 2PW8H 3RXVA 3GCHC 8ESTE 3BIVH 3VGCB 1QB9A 3UUZA 1HV7A 1JBUH 2FOFA 1W10U 3CS7A 1C5TA 3LJOA 1TX6A 1V2TT 3ATMA 2ESTE 3FFGA 2ZTYA 1O33A 2ODYB 4FUGA 1DSUA 2EEKA 4IN2A 1T8NA 2UUFB 1P04A 4AORA 1ZSLA 5ABWA 1LVBA 4NIVA 3A88A 1AWHB 3HK3B 1ETRH 1HJ8A 3N7OA 3PMJA 1BTYA 1UCYK 2PKAA 1KTTB 2NU4E 3ZVAA 1CBWB 2Y5GA 1DITH 1Z8RA 1YF4A 1ZJKA 4I8GA 1FV9A 4CRBA 1GJ6A 1GCTB 4X8VH 1J14A 3TIUA 3FZDA 1TLDA 3B8JA 5ESTE 1JXPA 1O2IA 5HGGA 2O8TA 1FONA 2H2ZA 3LH1A 1BJVA 4FUIA 1ID5H 3Q3XA 1V6DA 4OGXA 1VCQA 4Q80A 1VGCB 5AFZH 3NUMA 2BVSH 5DJ7A 1O5EH 1CE5A 2FOGA 3PLKA 2EC9H 1DT2A 1C1OA 3QZQA 4CRFA 3V13A 1PPEE 1WU1A 3RP2A 4DW2U 5HMAA 1SGTA 1GHZA 2BD5A 2WUBA 1SGCA 1CT0E 1BRUP 1D4PB 1P03A 3OU0A 4Q7ZA 6LPRA 1EKBB 2VWOA 3TJOA 1S82A 1X7AC 1O2OA 2BXTH 1SHYA 1XUIA 4O3UA 4ZROA 4ISIH 5EW1H 3M5MA 1SBWA 1SHHB 2GCTC 2ZFFH 3PMAB 2VVVA 1BDAA 1GVZA 1K28D 2P8OC 2FODA 1N8OC 4AFZA 2UUJB 1SOTA 3A89A 3KF2A 1XM1A 3MNXA 4FVDA 3PWCA 4SGBE 2QAAA 1XUFA 3MH7A 1H8IH 2JH5D 1SGFG 4KELA 4HTCH 4O03A 2B8OH 3I29A 1Y3YA 4B2CA 1GGDB 4NZLA 1W12U 5E0GA 3PROA 5G4BA 4ABDA 4ZKRU 1H9IE 2F3CE 1XMNB 3NXPA 2BDAA 1XUKA 3E16B 2G4UA 5C3NA 5C1YA 1GDNA 1O39A 3QO6A 3V7TA 4ZHMU 3PB1E 5LPRA 1BITA 3B9FH 1VITF 2BOHB 1ETSH 4I32A 1A1RA 1QHRB 3ZZ6A 1ARBA 1OP0A 4UONA 1MKWH 2P59A 1EZXC 1ESTA 3D23A 2GD4B 2RG3A 3SQEE 1P05A 3FZZA 3EAJA 2ZTZA 3MU5A 1FUJA 3TK5A 3TITA 3H7TA 3UR6A 2NU0E 5DP6A 2BD7A 3BTQE 1EXFA 3LGTA 4ZKOU 2XC4A 2FEQH 1EAUA 1OWEA 1EPTC 5A09A 2F91A 1AHTH 3L3TA 1THPB 2AMQA 3LU9B 4O9VA 3RXQA 3STIA 4JK5A 1T32A 3UWJH 4B76A 2ZU5A 4BTTB 2WPKS 1WQVH 5DG6A 1IQEA 3MO9A 5E2OA 5I46H 3RU4D 1UTJA 2SFAA 1WCZA 4WF8A 2VINA 1OWIA 5EG4A 1T8OA 2AGEX 2BD2A 1HAHH 1N6YA 1NRSH 1HB0B 5A8ZA 1SLXB 1SLUB 2XWBI 1TMBH 2ZFQH 2AMDA 1UVUH 1TGNA 1BOQA 5HM9A 4MNYA 1RGQA 3K9XB 1T4UH 3TK6A 4CHAC 1QR3E 8GCHF 1KDQA 3MO6A 1AD8H 1JRTA 1BTXA 5JBTA 1TWXB 3ZZAA 4NIXA 4OS7A 1O2KA 1D6WA 1SG8B 1DFPA 1OWHA 1TNLA 5GJ4B 2A1DB 2CV3A 1QJ1B 2A5AA 2QN5T 1JWTA 1C5PA 4BAQB 1H1BA 4E7RG 1FNIA 1MKXH 3QLPH 2XRCA 5PTPA 5HM2A 1NT1A 2TPIZ 2ANYA 4ZMAH 1GPZA 4YO9A 1B0FA 3LH3A 2PKSB 1UK3A 1GHYH 3L6PA 2VH0A 1HAVA 3SNAA 1EPTA 2V3OH 1F5KU 1JIMA 4X8SH 2XNIA 5C2ZA 5K7RA 1BHXF 4LZ1H 1GHBG 1V2UT 2XYAA 3T5FH 3BG4B 3SU3A 2PWXA 2FI4E 1D3PB 1UK2A 4A1VA 5EQSA 5JYIA 5DK1A 1V3XA 2ZGJA 3AASA 1EOJA 1JIRA 1K1OA 1VJAU 4FU9A 2BDGA 2ZCKP 1S6HA 3RXOA 4ABJA 3G01A 4D7GA 3ZZ4A 2W7UA 4MNVA 1HIAB 4UE7H 4JZFH 4Z0KA 3A7XA 1FN8A 4OGYA 3UOPA 3ZYEA 3HATH 4X8TH 1LKAA 4GHTA 2BLOA 5J4QA 4CRAA 4XSKU 1AVGH 3P95A 1GI6A 2V3HH 4DY7B 4B71A 4WMDA 1O5CB 1QL9A 2GX4A 2ALPA 3TH2H 1GBTA 3F6UH 4OS4A 1YPLH 1OP2A 2ZHFH 3RXAA 4BXWA 1FIWA 1O3NA 1QJ6B 1FMGA 3NKKA 3A86A 4U2WA 1DSTA 1B0EA 2TBSA 4IS5A 1YCPH 1ELEE 1FAXA 1AVXA 3R3GB 4J2YB 2IJOB 4ISLA 2ZG0H 2DE9A 1E35B 3DD2H 1TNHA 4K5ZA 1AIXH 1CT2E 3E3TA 5A8XA 2BB4A 3EE0B 5LPEA 5A0AE 4DIHH 1EJNA 1VITG 3RLWH 4Y6DA 1A61H 1D3QB 4WXIA 1GHWH 2F9OA 3PYHA 4GVUA 1GBMA 1HUTH 1FY8E 1AY6H 5JB8S 1HLTH 1O2MA 1WBGB 2BD3A 1TOCB 3TGKE 1A7SA 1ELDE 1GBEA 1MQ5A 2BY6X 2XCNA 1BRCE 1Y3WA 1T31A 2G81E 2H6MA 3V12A 3RLYH 1HNEE 1AUTC 4ZHAA 2WV4A 2VWLA 1ANBA 4I33A 1C1PA 4WJG2 2J4IA 2XWAA 3ZZDA 1CHOF 4NG9H 1CU1A 1SSXA 1P2IA 5T6GA 2VVCA 3SV7A 5C5NA 3SJIA 4DVAU 4MQAA 4YT6H 1AFQB 5CHAB 1XXDA 2A4GA 3PLBA 1HFDA 3SUGA 1TNIA 1GMCG 1F0SA 1OSSA 1C2EA 4AB8A 5L2ZH 1ZGVA 2CJIA 3SJKA 4Q7XA 2NU1E 5L30H 1SGFA 3F9FA 3OYPA 1LHEH 9LPRA 3MTYA 1AE5A 1TNKA 1KXEA 1MZAA 1TOMH 4YTAA 2ZFRH 1HJAC 1TRMA 2FP7B 2FTMA 4WMFA 3M5LA 1BT7A 3T27A 1SFQB 4I8JA 8GCHG 1AZZA 2TRMA 3M3SA 2GCHF 2VNTA 1J9CH 1JMOH 1TPAE 4BTUB 3V3MA 1C1QA 1EJMA 1C1MA 2ZFPH 1QBVH 3BTWE 1MTSA 5TCCA 4TPIZ 1UO6A 3ZVFA 2FMJA 2ODQA 2P94A 1BBRH 4LXBH 4U01A 4H4FA 3W95A 1LO6A 5C1UA 4FUEA 1ZJDA 4WY3A 1G2MA 2F9VA 1TPOA 1F5LA 3S7HB 4UDWH 1LPZB 4YESB 4KTCA 1KXCA 1ZMJA 3UOUA 1LPKB 4O97A 1TMUH 2WUCA 1P06A 4MPXA 2ZDVH 4YLUA 2FI5E 3SV9A 1C2IA 1S5SA 1NN6A 2GMTB 3UTUH 4BANB 1TYNA 1DS2E 2XBXA 3RXFA 3M61U 4X6OA 4ABAA 1NFXA 3RXIA 2HGTH 4CRGA 2ZU4A 1O2JA 1PQ7A 3TPIZ 3TJUA 6ESTA 4CR5A 2ZHEH 3ELAH 1LVYA 4GCHG 3EA9A 1Q31A 2PGBB 3NWUA 3PO1B 2A7HA 4X1QU 2PSXA 3UFAA 3URCA 2THFB 3SUEA 1HDTH 4MVNA 3DA9B 1ZPZA 2QXJA 4A7IB 1V2WT 3GY7A 1GJ7B 1HAOH 5HYOA 3FANA 3KL6A 1XVMA 3P6ZB 3ZZ7A 2Z3EA 2ZGHA 1UTPA 2OQUA 4U32A 2P3FH 1E36B 1D9IA 3SO3A 3RXMA 3D62A 3SJ8A 3A80A 3SUDA 1EUFA 2ZDMA 1TAWA 5CMXH 1SQTA 1O3AA 3SU0A 1GBCA 3MU0A 4DG4A 1MTNB 2O9QA 1GVKB 2ZHWH 3SGQE 3K2UA 1P2OA 5I25A 1FQ3A 5DP5A 3FAOA 2AS9A 1DPOA 1GJ4H 1YPHC 1INCA 2BLQA 1LQDB 3MO3A 3P8OA 4DCDA 1OP8A 2VB0A 1DICA 2ZPSA 3DFLA 2F9BH 1Z8GA 2H9EH 4UFGH 1UTOA 1ARCA 2ZGBH 3MYWA 1EZQA 5IYTA 1TX8A 2ZCHP 5AF9H 1GHXH 1MTVA 3NCLA 2BHGA 2ZDAH 2I6QA 1RXPA 1C5XB 3SU4A 3QTOH 5FBEA 4ZHLU 2H9HA 3RXPA 4A92A 1XKBC 2QF3A 1FY3A 1OKXA 1UVOA 1AQ7A 2J92A 1T4VH 1O38A 4D76A 3RMOH 2WPMS 3HGNA 1O3FA 1PPCE 4MPUA 1YLDA 4JZ1A 1HJ9A 1SC8U 4I8KA 3U9AH 2F9UA 1GI4A 3ZV8A 1YPGH 1VCWA 1L0ZA 1G3EA 1A5IA 1O32A 1YPEH 4ZUHA 1SLVB 1NO9H 3ATKA 1HAGE 1LVOA 5FX5A 6CHAB 4GHQA 2AERH 2FOBA 1AKSB 4WMEA 4D7FA 2LNCA 1SGDE 1Z7KA 2HLCA 5FCKA 2GCHG 2BOKA 3LGUA 1J17T 3ZZBA 1GCDA 2A7JA 5DO4H 1RIWC 3KGPA 1IHSH 4I8HA 3VB7A 1AMHA 1ANEA 5DKMA 1L2EA 3MU1A 4VGCC 1GI1A 1HAXB 3IG6B 1QBOA 1GBBA 3ZVBA 2A32A 4AGKA 1MCTA 1K9OE 2J9NA 4SGAE 1SOZA 1DWDH 4XBCA 1A5GH 4YOGA 2SNWA 1O31A 1IQHA 2OXSA 1LDTT 1QCPA 3A8DA 1EASA 1ZTKA 2ZO3H 4X1RU 2D8WA 4ZXYH 3T62A 2GV7A 2ZQ2A 4OS6A 5JB9S 4CBNA 3U69H 2HPPH 3GYMA 1GJ5H 2ZWLH 2C8WB 3P8GA 1KXFA 3MH6A 4UFDH 1Y3XA 1O3HA 3LJJA 3FP7E 2SGEE 1LPGB 2ZGXH 1NROH 1QRWA 2BQ6B 1GHBF 5LPFA 2SGFE 2BQWB 1AVWA 2ANWA 1NRRH 3NK8A 1SGEE 1NTPA 4K69A 2CHAC 1GDQA 4O3TA 1EB2A 2PKAB 4FUFA 2FZZA 3BEFB 2Z7FE 1G37A 4X6PA 1EAWA 1GG6B 5EQQA 1DXPA 1K2I1 1YCPK 5EPYA 4MNXA 1S84A 4FUCA 3VB4A 3LGVA 3O8DA 3GY4A 3WY8A 4IGDA 4DJZB 1TGBA 3M37A 4MG3A 1C2MA 1TGCA 4XDEA 3E8LA 1AB9B 3UR9A 1C2JA 1MMJN 1C5VA 1ELFA 2NU3E 3QDZB 2GVFA 2P95A 4XE4A 4R0IA 3SU6A 3K6ZA 1AUJA 2WPLS 2ZHQH 3MMGA 1GBJA 1J8AA 3TNTA 3U98H 2ZGCA 2UUKB 1DOJA 4E7NA 1YCPM 2V35A 1O37A 3SGBE 3A7TA 1GI5A 1CA8B 2AMPA 3H7OA 3OSYA 1CGHA 1P3CA 1O36A 3RU4E 1A2CH 1ZZZA 3SZNA 3GCHB 2J95A 1O3IA 3EYDA 2B0FA 1P9UA 3P8NA 5BRRE 1O2HA 2FWWA 1ETTH 4AYVB 2VIPA 1C4Y2 2GT8A 1ZSJA 1TPSA 3MNSA 2KAIA 3Q3KA 2PUQH 3LT3A 1V2NT 3PMHB 5FHTA 3T29A 4F4OC 3PTNA 3SHCH 1ZOMA 2PKSC 1BTWA 2BX4A 3RXUA 1W7XH 4K8YA 1C1RA 2Y7ZA 1YYY1 5B6OA 2AGIX 1SGQE 4WXVA 3TK9A 1FPCH 3BG4C 4DT7B 2F9NA 4TY6A 3GY3A 1GMDG 3U1IB 1BTHH 3DHKH 1CA0B 2ANMH 1C9PA 3SJ9A 3QTVH 5JBCS 5F6MA 2A2XH 2ZFTA 5FBIA 7LPRA 4CH2B 1L1JA 2CXVA 3DT0H 3FVFB 3A87A 1GMCF 2ZFSA 1GBLA 1Q3XA 4MTBA 1JOUB 1NU7B 1QQ4A 2EI7A 1K1MA 2VIDA 3RM2H 2WYGA 3BN9A 2ZDNA 3EA8A 1O2RA 3Q76A 3GYLB 1O2WA 3A8CA 1UK4A 3RXEA 5GXPA 3DFJA 4NGAH 1UTLM 1TPPA 5FCRA 2B7DH 1QTFA 4WH6A 2GCTB 4THNH 1ANCA 1OXGA 2EI8A 1ELBA 1UHBA 1RS0A 1TE0A 2P8OB 2FDAA 1O2UA 1N8OB 4K1EA 4JYVH 1GWAA 1BIOA 1J15A 1HRTH 1N6XA 1QA7A 1EZUC 1LHGH 2VWMA 1O2XA 4MDSA 3UQVA 3PV4A 1O3DA 2ZNKH 4UEHH 2HVXA 3LC5A 5JBAS 1ZR0A 4AYYB 5A2MH 1XKAC 1DWEH 1YKTA 2ZC9H 2O8MA 1Z1IA 1OPHB 3BTDE 1DUAA 2HNTE 5EGMA 3SNCA 3RXDA 5L2YH 2Z9IA 2W26A 2SGDE 3GDVA 3E91A 2O8WA 4I7YH 5GCHG 1PJPA 2FOHA 3BF6H 5E0JA 3ZVGA 1TBRH 1MU6B 1PPZA 5TJXA 1SGPE 5EW2H 3H5CB 1WAYB 1Z8IB 1YC0A 4GCHF 5E8EH 5JBBS 1BMAA 4Y76A 4ABBA 1RTLA 2OBOA 1O3MA 1JRSA 1PYTC 1E37B 1TALA 2ZA5A 1LCYA 1L4ZA 1TABE 4FU8A 1EJAA 2IOTA 1WOFA 2AFQB 1HAVB 3OY5U 1EPTB 2YNBA 4A6LA 4AFUA 2VIOA 2ZI2H 1SMFE 1P10A 2BVXH 4Y8YA 1QFKH 1EZSC 2BLVA 3CENA 3ZYDA 3RXLA 2ZCLP 1NU9A 1YM0A 1P9SA 2FESH 4GAWA 1ZPCA 2BDBA 1FI8A 4AOQA 1ZMLA 1AI8H 4NWLA 1O2NA 2ODPA 4B75A 2A2QH 1C5OH
chains in the Genus database with same CATH superfamily
3L33A 2NWNA 3FO8D 5AVDA 4WVPE 2BDHA 1GL1A 1K1NA 4BOHA 1E38B 1ZSKA 4YM9A 2Y81A 4XBBA 5DP7A 1V2QT 5FXLA 2D2DA 2XOKD 3O8CA 3SNEA 2QA9E 2QV1A 2BZ6H 1QBNA 1TIOA 3RXBA 1FX0B 2FYRA 4XOJA 2UWOA 4NIWA 3ZVEA 1RRKA 5C5OA 4AZ2B 4GUXA 3FP6E 2IPHA 2AH4X 2ZP0H 2VJ1A 4TY7A 5EODA 4K60A 5DN6D 1XUJA 2ILNA 3M5OA 2PR3A 2M5TA 1K1PA 4R8TB 4Y0ZE 1TA6A 3S9CA 2Z3DA 3O8RA 3Q3YA 2OC8A 2C4FH 1DY8A 1TBQH 3FKSD 3AAVA 2Z3CA 1ZTLA 3M5NA 2J2UA 3QUMP 1W2KH 5FX6A 3MH4A 1W0KD 5E0HA 1BMLA 1KIGH 1GJCB 1C2HA 2ULLA 4ISNA 2A4QA 2OUAA 1SQOA 1UTKA 1NFUA 3IITA 1BRAA 4LK4A 4Y7AA 3JZ1B 1C2LA 4A1XA 5FAHA 1XUHA 3GISB 2ZECA 3U1JB 1AN1E 2QXHA 1NRPH 1P8VC 4RSPA 4BAMB 1EAXA 2TGAA 2FLBH 4B1TA 1O34A 2A7CA 2GV6A 3BTGE 1CGIE 1P2NA 1S0RA 4RN6A 1PQ8A 4AB9A 1QURH 4MLFB 1O2PA 3PWBA 3DUXH 3P8FA 1BCUH 4H6SB 2CMYA 4IMQA 1VITH 1T8MA 1TFXA 3GOVB 1YGCH 1CQQA 5EXLA 1E34B 3H09A 2EY4C 2Z94A 1QJ7B 1Y8TA 1QL7A 2FTLE 3A7WA 3KHVA 1OYTH 1QRXA 1O3KA 1ELCA 1F5RA 1Y5BT 5DP4A 5F8ZA 2R3YA 2G5VA 1ELAA 1HPGA 2BD4A 1GVLA 3MWIU 1ESBA 3SZEA 1Z1JA 2RFKC 1IQMA 2W7SA 1MTNC 1O2LA 3GCNA 1E0FD 4Y7BA 1NM6A 2GKVE 1KXBA 1GMHG 1UVTH 2HNTF 1MZDA 5BPEA 4IC6A 1A0HB 1C5UA 4YOJA 1BUIA 4PROA 3ESTA 2ZF0H 1GBAA 3VXFH 1KXDA 2ZDKA 3IWMA 3LPRA 4ZKSU 4Y79A 2R2MB 1O3EA 3GS9A 3RXKA 1UCYE 1FY1A 3KEEA 1C5ZB 1EX3A 5HXFA 1XUGA 5C0UA 1O3CA 4K1SA 1W0YH 3KQEA 5LH8A 2C90B 1UTQA 4CH8B 4NSVA 3GY8A 1Z71A 5FPSA 2C8YB 2P16A 4AX9H 3TJNA 3UAIC 3UIRA 4FVBA 1ZLRA 1C2DA 8LPRA 2OQ5A 1GBIA 3GY2A 2OINA 1THSH 4FU7A 3HKIB 1T7CA 2KZ4A 1EB1H 2JETC 1O2TA 1O3JA 1Z8JB 3TGIE 4TPYA 4BAHB 2F4LA 1ESAA 1QQUA 3BTKE 2XC0A 1G2LA 1S83A 2VGCC 1VJ9U 2XCFA 1F0TA 2Y7XA 2FXRA 1HAIH 1XVOA 2PGQB 4E06H 1MKWK 3UNRA 1QY6A 4NA7A 3ZZ8A 3SGAE 4ZAEA 3SNBA 2Q1JA 3OX7U 5CE1A 3VGCC 1NY22 2DE8A 3K6YA 5TCAA 1AO5A 1V2LT 1P12E 3GCTG 2FOAA 3SNDA 5JPMH 3MFJA 1VKYA 1B5GH 1DM4B 1UJ1A 1BRBE 1HJAB 1AWFH 2FPZA 1WYKA 4YT7H 2FS8A 3TLOA 2TIOA 1O2SA 3TU7H 2UWLA 1W13U 3RC5A 1TONA 2C93B 2VVUA 1E79D 2M2AA 1CBWC 1O3OA 1ACBE 3ATWA 2GZ7A 4TYDA 1BQYA 5SGAE 1IQIA 2H9TH 1GI9B 1QIXB 3M36A 5FPYA 1GCTC 4NWKA 3A8BA 1ABJH 3E6PH 5F03A 3R0FA 2EI6A 2ZZUH 1UVSH 3VFEA 1CHGA 2DUCA 1CVWH 1ELVA 5EU8A 1B7XB 3BV9B 2XNDD 2BTCE 2PHBA 2HPQH 1P57B 2BLWA 1VGCC 1P2MA 4FUBA 3QK1A 3BIUH 4UFEH 3BG8A 2ZDLA 4FETA 1GMDF 1UVPA 1O35A 3SV6A 1AFEH 4JZEH 3RXJA 1EATA 1RJXB 1YBWA 1S6FA 2HLDD 1MQ6A 1P3EA 1LMWB 4K2YA 1DANH 2HOBA 2G52A 2Z6BD 1V2MT 1G30B 2Z9JA 3ENSB 1HGTH 2J38A 3QGNB 1COWD 2SGQE 2ZU1A 1NRQH 1MKXK 3U8TH 1PFXC 3SV8A 1A0LA 2GT7A 2WSSD 3UNSA 3KNXA 1O5FH 1CO7E 1CSOE 2K1QA 3BTFE 3AVZA 4NA9H 1MTWA 2H5DA 3M3TA 1FIZA 4X1SU 3SU1A 2RDLA 5AFYH 4DGJA 2PTCE 4FOUC 4AG2A 1C1TA 4ESTE 5C20A 3I78A 2ZHDA 1QRZA 1BJUA 2JH6D 4X1NU 5J4SA 3LGIA 2JJ1D 2SGAA 1G36A 1ABIH 3ITIA 3HK6B 1MAYA 4RT0A 2STAE 1LVMA 1ZRBA 2J34A 1MD7A 2BZAA 3GDSA 3TGJE 1FLEE 4Y71A 1SPJA 1TA2A 1EOLA 4LZ4B 1GGDC 1C1SA 3OAAD 1GHAF 1PPFE 2FYQA 5T6FA 3GY5A 1F0RA 1Z6JH 3A7VA 3Q77A 3F0OA 1O5DH 1BTZA 1HBTH 2Z9LA 1PPBH 1F92A 3PTBA 2OCVB 2VH6A 4NZQA 4Y10E 1NPMA 1SB1H 4X2WA 3RXRA 1HCGA 1MH0A 5EXMA 1C2FA 3N99A 5DPAA 2Z9GA 3OEED 1SVPA 2BY5X 1WV7H 3MH5A 1WTHD 4K3JA 2CF9H 3U8OH 1ZTJA 1D3DB 2WPHS 4X2YA 2JKHA 2RCEA 1GDUA 1SGRE 3MNBA 5H4IB 1S85A 5GCHF 3HPTB 2STBE 1BMNH 2H5CA 4U30A 4TWWA 3A84A 5C67A 1BTUA 2ZEBA 4INKA 1O30A 2VWNA 3T26A 4Y0YE 1CA0C 3D49H 4DOQA 1QL8A 1DXWA 2PLXA 5IK2D 3AW0A 4ISHH 2GDDA 4KTUA 1KLTA 3TH4H 3VEQB 4HG6A 1O0DH 1V2JT 4IBLH 2XC5A 2Y82A 1TQ0B 3F0PA 3GY6A 5EJ1A 1YPKH 3QX5H 2PUXB 2A4OA 2XBVA 2ZPRA 1VR1H 4HFPB 1AE8H 1C5NH 1H9LB 1S0QA 1ZHMA 1SGNE 1WUNH 3F9HA 2A0QB 4Z6AH 1SFIA 1A46H 3SYJA 1WQSA 2BMGB 2AYWA 5EOKA 3F68H 2ANKH 1QB1A 1DVAH 1TGTA 3NZIA 1ZHPA 1DLKB 1D3TB 4NSYA 2A4RA 2GDEH 2W5EA 5GWZA 1RIWB 2V6NA 2R9PA 1U6QA 1ELTA 1KTSB 5C0TA 2KM0A 1SI5H 4K8BA 1NZQH 4X1PU 1SGIB 8KME2 4VGCB 1ZPBA 5KGOA 1P01A 2CGAA 2FO9A 3F3BA 4RKOB 1C2KA 1W0JD 1M9UA 1K22H 2BVRH 4OS5A 4MNWA 4IMZA 1DUEA 1ANDA 2GZ9A 2TGDA 1KY9A 3VB5A 3SN8A 3KQBA 3A82A 1O3LA 2LPRA 3E0NB 1QGFA 3MU4A 1MBMA 1NC6A 4KP0A 2FOEA 1T8LA 2P3UB 2ZU3A 1TNGA 1C1WH 1AU8A 1P2JA 4J1YA 3ZZ3A 2QGRA 1HAYB 2I6SA 3AW1A 2Z9KA 1LKBA 1BHXB 1YPMH 1IQNA 4X0WU 2KAIB 2RDEA 1C5RA 4HI3A 1EQ9A 1O3GA 1P09A 1N1LA 2D1JA 4Q4LA 1FJSA 2IN2A 1O3PB 3LONA 2J94A 2D26C 4OM9A 1DE7H 2CHAB 1BBRK 4NA8A 3EQ0H 4AFQA 1IAUA 2SNVA 1AZ8A 1FN6A 1IQLA 1NFYA 2QCYA 3F2GA 3A7YA 1LHDH 1P2KA 3LOXA 3M7TA 3MU8A 1G3CA 1FDPA 2ZU2A 3RU4T 2WPJS 1DX5M 1FPHH 3A7ZA 3S7KB 3BTHE 1AGJA 2XTTB 2JIZD 4AGJA 2G51A 1Y5AT 3VB3A 4XRNA 1GL0E 3SI4H 1XX9A 3P17H 3RXSA 1WTGH 2C8ZB 2H1UA 2OC7A 1C5QA 4GPGA 4TT3D 2OP9A 2HRVA 3OTJE 1C5MD 3P70B 3E90B 2ALVA 1PPHE 1W0ZU 1KLJH 1YPJH 3SI3H 4ABEA 4A5TS 2XXLA 1GHAG 2BXUH 5AHGH 1TX7A 4YOIA 2QXIA 3CP7A 3U28C 1TBZH 2A45B 2HNTC 3LC3A 1ZGIA 4BNRA 1QB6A 3A81A 4JYTA 1IOEA 2PV9B 1GMHF 1TGSZ 5DP3A 2KX4A 3ATIA 1MUEB 4B2BA 2FM2A 1G3BA 3ODFA 3SQHE 4F49A 1YLCA 2GGVB 4AG1A 3S9AA 3C27B 3V0XA 1KDQB 4TWYA 7GCHF 4B2AA 5L6NH 3RXTA 3KQ5A 4B6EA 2G8TA 1EP6A 1YP9A 1LHCH 1GJ9B 4GSOA 1MCVA 1UHBB 1Y59T 3PM3A 1UW7A 5K0HA 4B73A 1OYQA 1HIAA 2CN0H 3KQDA 3HGPA 1XXFA 3T2NA 1J16A 1TMTH 4ASUD 3WWFA 3MNCA 3SUFA 2O8LA 3KIDU 4Y8XA 2JDID 1EAIA 1S81A 3RMNH 2C3SA 1E1QD 1AFQC 5CHAC 4JYUH 4XBDA 2B5TB 4KKDA 2B9LA 5EPNA 1SQAA 5DP8A 4NFFA 3P92A 5F8TA 1UCYH 3RXCA 3F9GA 3GICB 3M7UA 3QZRA 2J5UA 1OOKB 2PSYA 3SW2B 4X6MA 2VIWA 3UPEA 1P0SH 2FS9A 1C5SA 3UNQA 2AIPA 1MU8B 3BTTE 3URDA 3EGKH 5T6DA 4YZUA 1K1LA 3ZZCA 5A0BA 1FZZA 2JH0D 3B23B 4H6TA 3BTME 2BYAX 2PTNA 4UD9H 3GDUA 2BDIA 3QGJA 3GCTF 4AN7A 9ESTA 4FUJA 1C2GA 3SU2A 1BB0B 3TVJB 4I31A 3S69A 4FUHA 2BY7X 3SHAH 2ZTXA 3LGWA 1GI3A 1RTKA 1RD3B 5GDSH 4CHAB 1TNJA 4MPWA 2R2WU 1H9HE 4OS2A 2ZKSA 3S0NA 1WSSH 3AAUA 3UWIA 4NIYA 1EP5A 3KCGH 3GCOA 2R3UA 4CBOA 4F48B 2GZ8A 5CHBA 4IW4E 3KN2A 4DURA 3U8RH 2BM2A 4X8UH 4BAOB 2RA3A 3VB6A 1BA8B 2Y80A 3O8BA 5EQRA 1K1JA 3C1KA 2F83A 1G32B 5E2PA 3BEIB 4B6FA 2WPIS 2AEIH 5GPIB 4Y8ZA 2ASUB 2VU8E 4BTIB 4CRDA 2GMTC 2QYIA 4NCYA 1C5LH 5C1XA 3EA7A 2Y6TA 1FAKH 2Q6FA 1ZMNA 2BX3A 2P93A 1GBHA 1W8BH 2KCAA 3KQCA 2FLRH 4M9FA 1F2SE 1H8DH 2BQ7B 3A85A 4IN1A 4LOYH 3N7DA 4HGCA 3SU5A 2O8UA 6GCHF 3PO1C 2WYJA 3DSOA 4X2VA 2QIQA 1SL3A 2QY0B 2Q6GA 1PYTD 1HXEH 4AC9A 4ABHA 1C1NA 2FX6A 1DY9A 2NU2E 1C4U2 1KLIH 2VBCA 1OX1A 5DP9A 4ZKNU 4ABGA 1C5WB 2QF0A 3RUOA 2Y5HA 3SORA 1W14U 2W3IA 1FY5A 5GIBA 1P2QA 1LHFH 1D6RA 4JK6A 2C8XB 3FP8E 2WV5A 1GHVH 2TGTA 2A5IA 4JCNA 4X6NA 1MD8A 2CF8H 4FXGH 4IC5A 2UUYA 3WWBA 1Q2WA 2OTVA 2OBQA 3S9BA 2BDCA 1UMAH 2SGPE 3KYGA 3I77A 4NFEA 1DWCH 1GI8B 5CDFE 4JZIA 3W94A 1C5YB 2BY8X 2QC2A 2HALA 2ZQ1A 4ASHA 7KMEH 1V2OT 2G4TA 3SBKA 3FOAA 2Q6DA 1UTNA 2L74A 3SV2H 2WHXA 4GLYA 3VPKA 3QN7A 3M35A 1C1UH 3NPSA 1LTOA 1BTPA 3MQKC 4QT8C 1O5GH 1KXAA 4JZDH 3K65B 2AIQA 3LIWA 7GCHG 2FOMB 5JDUB 5A0CA 4F55A 3RM0H 1H8HD 1OWKA 2VIVA 3D65E 4BXSA 3Q00A 1GJDB 4D9QA 1ZYOA 3BTEE 1GBDA 2Y5FA 3F9EA 1IQFA 1GI2A 1GJ8B 4I8LA 3RMLH 3RC6A 2V3MA 1A3EH 4ZCNA 2BD8A 1GBFA 4B74A 4MPVA 3PMBB 2QXGA 4M7GA 1THRH 1CGJE 3OTPA 2W3KA 1C9TA 2VIQA 3ZZ9A 1H4WA 1NRNH 2F9PA 5KEDA 2A5KA 2UWPA 3ZVDA 7ESTE 3LGYA 3HKJB 1NESE 1QNJA 4ZH8A 1L1GA 1MAXA 4WWYA 1TRYA 1A3BH 1O2ZA 3M7QA 2WV9A 5A8YA 3BSQA 3VXEH 5IDKA 1DDJA 1IQJA 1P02A 1TRNA 1OWJA 1GBKA 3SJOA 2BDYA 3A8AA 1CT4E 2G5NA 3ZVCA 5F8XA 3RXHA 1GJBB 3E0PB 3ZZ5A 1TQ7B 4Q7YA 1UTMA 3JZ2B 6CHAC 4AFSA 3PLPA 4Y11E 3T25A 1ZRKA 3UREA 2G55A 4CR9A 4KTSA 1TB6H 4D9RA 3LDXH 1O5BB 1SR5C 1KSNA 3UQOA 3RXGA 3OY6U 5ETXA 1O3BA 2ZPQA 3M3VA 2YNAA 3F2FA 2XBWA 3PV2A 3PV5A 4WH8A 2BY9X 2R0LA 2FOCA 1GI0A 1G9IE 1YWUA 3ODDA 1OS8A 4ABIA 1SKYE 2XBYA 3TNSA 1W11U 1NFWA 1FY4A 4BAKB 2HWLB 1A0JA 1Y3VA 4INLA 3A83A 3ZV9A 1BMMH 5EXNA 3ZIAD 4CREA 1Z6EA 5LGOA 3F1SB 4K1TA 3LKWA 1LQEA 4JMYA 4ABFA 4Q2KA 4ZXXH 3CS0A 1QA0A 3ATLA 1W3CA 1ORFA 4INHA 1KYNA 1ZHRA 3RC4A 2GTBA 2V0BA 1IQGA 2OLGA 3E1XB 1A4WH 1C1VH 3TH3H 1SLWB 2RA0A 3TJVA 1V2VT 1GJAB 5ESBA 3NRLA 1RTFB 1Y3UA 3STJA 1SGYE 5FPTA 1BZXE 2TGPZ 1HAZB 1K21H 4UFFH 2PFEA 2FI3E 2XW9A 4HZHA 4ISOA 1E1RD 4XFQA 3RMMH 1P11E 1K1IA 1O2QA 1HXFH 1MTUA 1PQ5A 1V2KT 2ZIQH 4OS1A 2OC0A 1WDIA 1GG6C 1DWBH 1YPHE 4KGAA 6GCHG 1Y5UT 3MHWU 4DT4A 1VCPA 5HIYA 1HAPH 4YLQH 2AGGX 1MBQA 1AKSA 1F0UA 4X2XA 1G3DA 3MOCA 1AB9C 1RFNA 3BEUA 4A1TA 1CHOG 1O2YA 3DCLA 4RKJB 1NS3A 3SOSA 1C4V2 3T28A 1IHTH 5T3HA 1L4DA 4DIIH 5DGJA 1W7GH 2OD3B 2WINI 1PPGE 2FIRH 2JETB 4FUDA 1L1NA 1V2ST 2R0KA 3UY9A 1GI7B 2FX4A 4CRCA 2BD9A 3MI4A 1O2GH 1BBRE 1FXYA 3QWCH 1VZQH 2G00A 1OWDA 1V2RT 1PQAA 1DLEA 1V2PT 1HYLA 2P3TB 2VGCB 1H8ED 3RDZA 4E05H 4D8NA 2JJ2D 1O5AB 1O2VA 2A31A 4H42U 3N7EA 2EA3A 1F7ZA 2GP9B 2YOLA 1IQKA 1ELGA 2OC1A 3EDXB 1A5HA 2PW8H 3RXVA 3GCHC 8ESTE 3BIVH 3VGCB 1QB9A 3UUZA 5EJLA 1HV7A 1JBUH 2FOFA 1W10U 3CS7A 1C5TA 3LJOA 1TX6A 1V2TT 3ATMA 2ESTE 3FFGA 2ZTYA 1O33A 1NBMD 2ODYB 4FUGA 1DSUA 2EEKA 4IN2A 5C17A 1T8NA 2UUFB 1P04A 4AORA 1ZSLA 5ABWA 1LVBA 4NIVA 3A88A 1AWHB 3HK3B 1ETRH 1HJ8A 3N7OA 2PP6A 3PMJA 1BTYA 1UCYK 2PKAA 1KTTB 2NU4E 3ZVAA 1CBWB 2Y5GA 1DITH 1Z8RA 1YF4A 1ZJKA 4I8GA 1FV9A 4CRBA 1GJ6A 1GCTB 4X8VH 1J14A 3TIUA 3FZDA 1TLDA 2V7QD 3B8JA 5ESTE 1JXPA 1O2IA 5HGGA 2O8TA 1FONA 2H2ZA 3LH1A 1BJVA 4FUIA 1ID5H 3Q3XA 4RT1A 1V6DA 4OGXA 1VCQA 4Q80A 1VGCB 5AFZH 3NUMA 2BVSH 5DJ7A 1O5EH 1CE5A 2FOGA 3PLKA 2EC9H 1DT2A 1C1OA 3QZQA 4CRFA 3V13A 1PPEE 1WU1A 3RP2A 4DW2U 5HMAA 1SGTA 1GHZA 2BD5A 2WUBA 1SGCA 1CT0E 1BRUP 1D4PB 1P03A 3OU0A 4Q7ZA 6LPRA 1EKBB 2VWOA 3TJOA 1S82A 1X7AC 1O2OA 2BXTH 1SHYA 1XUIA 4O3UA 4ZROA 4ISIH 5EW1H 3M5MA 1SBWA 1SHHB 2GCTC 2J98A 2ZFFH 3PMAB 2VVVA 1BDAA 1GVZA 3UB0A 1K28D 2P8OC 2FODA 1N8OC 4AFZA 2UUJB 1SOTA 3A89A 3KF2A 1XM1A 3MNXA 4FVDA 3PWCA 4SGBE 2QAAA 1XUFA 2QF4A 2KFWA 3MH7A 1H8IH 1SQRA 2JH5D 1SGFG 4KELA 4HTCH 4O03A 2B8OH 3I29A 1Y3YA 4B2CA 1GGDB 4NZLA 1W12U 5E0GA 3PROA 5G4BA 4ABDA 4ZKRU 1H9IE 2F3CE 1XMNB 3NXPA 2BDAA 1XUKA 3E16B 2G4UA 5C3NA 5C1YA 1GDNA 1O39A 3QO6A 3V7TA 4ZHMU 3PB1E 5LPRA 1BITA 3B9FH 1VITF 2BOHB 1ETSH 4I32A 1A1RA 1QHRB 2WPDD 3ZZ6A 1ARBA 1OP0A 4UONA 1MKWH 2P59A 1EZXC 1ESTA 3D23A 2YMSC 2GD4B 2RG3A 3SQEE 1P05A 3FZZA 3EAJA 2ZTZA 3MU5A 1FUJA 3TK5A 3TITA 3H7TA 3UR6A 5FL7D 3PRDA 2NU0E 5DP6A 2BD7A 3BTQE 1EXFA 3LGTA 4ZKOU 2XC4A 2FEQH 1EAUA 1OWEA 1EPTC 5A09A 2F91A 1AHTH 3L3TA 1THPB 2AMQA 3LU9B 4O9VA 3RXQA 3STIA 4JK5A 1T32A 3UWJH 4B76A 2ZU5A 4BTTB 2WPKS 1WQVH 5DG6A 1IQEA 3MO9A 5E2OA 5I46H 3RU4D 1UTJA 2SFAA 1WCZA 3DSPA 2VINA 4WF8A 1OWIA 5EG4A 1T8OA 2AGEX 2BD2A 1HAHH 1N6YA 1NRSH 1HB0B 5A8ZA 1SLXB 1SLUB 2XWBI 1TMBH 2ZFQH 2AMDA 1UVUH 1TGNA 1BOQA 5HM9A 4MNYA 1RGQA 3K9XB 1T4UH 3TK6A 4CHAC 1QR3E 8GCHF 1KDQA 3MO6A 1AD8H 1JRTA 1BTXA 5JBTA 1TWXB 3ZZAA 4NIXA 4OS7A 1O2KA 1D6WA 1SG8B 1DFPA 1OWHA 1TNLA 5GJ4B 2A1DB 2CV3A 1QJ1B 2A5AA 2QN5T 1JWTA 1C5PA 4BAQB 1H1BA 4E7RG 1FNIA 1MKXH 3QLPH 2XRCA 5PTPA 5HM2A 1NT1A 2TPIZ 2ANYA 4ZMAH 1GPZA 4YO9A 1B0FA 3LH3A 2PKSB 1UK3A 1GHYH 3L6PA 2VH0A 1HAVA 3SNAA 1EPTA 2V3OH 1F5KU 1JIMA 4X8SH 2XNIA 5C2ZA 5K7RA 1BHXF 4LZ1H 1GHBG 1V2UT 2XYAA 2CK3D 4TSFD 3T5FH 3BG4B 2YMSD 3SU3A 2PWXA 2FI4E 5T1VA 1D3PB 1UK2A 4A1VA 5EQSA 5JYIA 5DK1A 1V3XA 2ZGJA 3AASA 4Z1MD 1EOJA 1JIRA 1K1OA 1VJAU 4FU9A 2BDGA 2ZCKP 1S6HA 3RXOA 4ABJA 3G01A 4D7GA 3ZZ4A 2W7UA 4MNVA 1HIAB 4UE7H 4JZFH 4Z0KA 3A7XA 1FN8A 4OGYA 3UOPA 3ZYEA 3HATH 4X8TH 1LKAA 4GHTA 2BLOA 5J4QA 4CRAA 4XSKU 1AVGH 3P95A 1GI6A 2V3HH 4DY7B 4B71A 4WMDA 1O5CB 1QL9A 2GX4A 3EE7A 2ALPA 3TH2H 1GBTA 3F6UH 4OS4A 1YPLH 1OP2A 2ZHFH 3RXAA 4BXWA 1FIWA 1O3NA 1QJ6B 1FMGA 3NKKA 3A86A 4U2WA 1DSTA 1B0EA 1YLNA 2TBSA 4IS5A 1YCPH 1ELEE 1FAXA 1AVXA 4P02A 3R3GB 4J2YB 2IJOB 4ISLA 2ZG0H 2DE9A 1E35B 3DD2H 1TNHA 4K5ZA 1AIXH 1CT2E 3E3TA 5A8XA 2BB4A 3EE0B 5LPEA 5A0AE 4DIHH 1EJNA 1VITG 3RLWH 4Y6DA 1A61H 1D3QB 4WXIA 1GHWH 2F9OA 2LP6A 3PYHA 4GVUA 1GBMA 1HUTH 1FY8E 1AY6H 5JB8S 1HLTH 1O2MA 1WBGB 2BD3A 1TOCB 3TGKE 1A7SA 1ELDE 1GBEA 1MQ5A 2BY6X 2XCNA 3F2HA 1BRCE 1Y3WA 1T31A 2G81E 2H6MA 3V12A 3RLYH 1HNEE 1AUTC 4ZHAA 2WV4A 2VWLA 1ANBA 4I33A 1C1PA 4WJG2 2J4IA 2XWAA 3ZZDA 1CHOF 4NG9H 1CU1A 1SSXA 1P2IA 5DSFA 5T6GA 2VVCA 3SV7A 5C5NA 3SJIA 4DVAU 4MQAA 4YT6H 1AFQB 5CHAB 1XXDA 2A4GA 3PLBA 5HIZA 1HFDA 5EJZA 2OK5A 3SUGA 1TNIA 1GMCG 1F0SA 1OSSA 1C2EA 4RI0A 4AB8A 5L2ZH 1ZGVA 2CJIA 3SJKA 4Q7XA 2NU1E 5L30H 1SGFA 3F9FA 3OYPA 1LHEH 9LPRA 3MTYA 1AE5A 1TNKA 3OE7D 1KXEA 1MZAA 1TOMH 4YTAA 2ZFRH 1HJAC 1TRMA 2FP7B 2FTMA 4WMFA 3M5LA 1BT7A 3T27A 1SFQB 2LELA 4I8JA 8GCHG 1AZZA 2TRMA 3M3SA 2GCHF 2VNTA 1J9CH 1JMOH 1TPAE 4BTUB 3V3MA 1C1QA 1EJMA 1C1MA 2ZFPH 1QBVH 3BTWE 1MTSA 5TCCA 4TPIZ 5F53A 1UO6A 3ZVFA 2FMJA 2ODQA 2P94A 1BBRH 4LXBH 4U01A 4H4FA 3W95A 1LO6A 5C1UA 4FUEA 1ZJDA 4WY3A 1G2MA 2F9VA 1TPOA 1F5LA 3S7HB 4UDWH 1LPZB 4YESB 4KTCA 1KXCA 1ZMJA 3UOUA 1LPKB 4O97A 1TMUH 2WUCA 1P06A 4MPXA 2KR7A 2ZDVH 4YLUA 2FI5E 3SV9A 1C2IA 1S5SA 1NN6A 2GMTB 3UTUH 4BANB 1TYNA 1DS2E 2XBXA 3RXFA 3M61U 4X6OA 4ABAA 1NFXA 3RXIA 2HGTH 4CRGA 2ZU4A 1O2JA 1PQ7A 3TPIZ 3TJUA 6ESTA 4CR5A 2ZHEH 3ELAH 1LVYA 4GCHG 2HVYB 3EA9A 1Q31A 2PGBB 4I86A 3NWUA 3PO1B 2A7HA 4X1QU 2PSXA 3UFAA 3URCA 2THFB 3SUEA 1HDTH 4MVNA 3DA9B 1ZPZA 2QXJA 4A7IB 1V2WT 3GY7A 4P00A 1GJ7B 4ACBA 1HAOH 5HYOA 3FANA 3KL6A 1S6LA 1XVMA 3P6ZB 3ZZ7A 2Z3EA 2ZGHA 1UTPA 2OQUA 4U32A 2P3FH 1E36B 1D9IA 3SO3A 1YY3A 3RXMA 3D62A 1OHHD 3SJ8A 3A80A 3SUDA 1EUFA 2ZDMA 1TAWA 5CMXH 1SQTA 1O3AA 3SU0A 1GBCA 3MU0A 4DG4A 1MTNB 2O9QA 1GVKB 2ZHWH 3SGQE 2QE7D 3K2UA 1P2OA 5I25A 1FQ3A 5DP5A 3FAOA 2AS9A 1DPOA 1GJ4H 1YPHC 1INCA 2BLQA 1LQDB 3MO3A 3P8OA 4ACAA 4DCDA 1OP8A 2VB0A 1DICA 2ZPSA 3DFLA 2F9BH 1Z8GA 2H9EH 4UFGH 1UTOA 2AHME 1ARCA 3FN8A 2ZGBH 1WXRA 3MYWA 1EZQA 5IYTA 1TX8A 2ZCHP 2KCOA 1NBME 5AF9H 1GHXH 1MTVA 3NCLA 2BHGA 2ZDAH 2I6QA 1RXPA 1C5XB 2IPQX 3SU4A 3QTOH 5FBEA 4ZHLU 2H9HA 3RXPA 4A92A 4YXWD 1XKBC 2QF3A 1FY3A 1OKXA 2W6ID 1UVOA 1AQ7A 2J92A 1T4VH 1O38A 4D76A 3RMOH 2WPMS 3HGNA 1O3FA 1PPCE 3AK5A 4MPUA 1YLDA 4JZ1A 1HJ9A 1SC8U 4I8KA 3U9AH 2F9UA 3PRBA 1GI4A 3ZV8A 1YPGH 1KMHB 1VCWA 1L0ZA 1G3EA 1A5IA 1O32A 1YPEH 2W6JD 4ZUHA 1SLVB 1NO9H 3ATKA 1HAGE 1LVOA 5FX5A 6CHAB 4GHQA 2AERH 2FOBA 1AKSB 4WMEA 4D7FA 2LNCA 1SGDE 1Z7KA 2HLCA 5FCKA 2GCHG 2BOKA 3LGUA 1J17T 3ZZBA 1GCDA 2A7JA 5DO4H 1RIWC 3KGPA 3OEHD 1IHSH 4I8HA 3VB7A 1AMHA 1ANEA 5DKMA 1L2EA 3MU1A 4VGCC 1GI1A 1HAXB 3IG6B 1QBOA 1GBBA 3ZVBA 2A32A 4AGKA 1MCTA 1K9OE 2J9NA 4SGAE 1SOZA 1DWDH 4XBCA 1A5GH 4YOGA 2IJD1 2SNWA 1O31A 1IQHA 2OXSA 1LDTT 1QCPA 3A8DA 1EASA 1ZTKA 2ZO3H 4X1RU 2D8WA 4ZXYH 3T62A 2GV7A 2ZQ2A 4OS6A 5JB9S 4CBNA 3U69H 2HPPH 3GYMA 1GJ5H 2ZWLH 2C8WB 3P8GA 1KXFA 3MH6A 4UFDH 1Y3XA 1O3HA 3LJJA 1BMFD 3FP7E 2SGEE 1LPGB 2ZGXH 1NROH 1QRWA 2BQ6B 1GHBF 5LPFA 2SGFE 1EFRD 2BQWB 1AVWA 2ANWA 1NRRH 3NK8A 1SGEE 1NTPA 4K69A 2CHAC 1GDQA 4O3TA 1EB2A 2PKAB 4FUFA 2FZZA 3BEFB 2Z7FE 1G37A 4X6PA 1EAWA 1GG6B 5EQQA 1DXPA 1K2I1 1YCPK 5EPYA 4MNXA 1S84A 4FUCA 3VB4A 3LGVA 3O8DA 3GY4A 3WY8A 4IGDA 4DJZB 1TGBA 3M37A 5KECA 4MG3A 1C2MA 1TGCA 4XDEA 3E8LA 1AB9B 3VG8A 3UR9A 1C2JA 1MMJN 1C5VA 1ELFA 2NU3E 3QDZB 2GVFA 2P95A 4XE4A 4R0IA 3SU6A 3K6ZA 1AUJA 2WPLS 2ZHQH 3MMGA 1GBJA 1J8AA 3TNTA 3U98H 2ZGCA 2UUKB 1DOJA 4E7NA 1YCPM 2V35A 1O37A 3SGBE 3A7TA 1GI5A 1CA8B 2AMPA 3H7OA 2K8IA 3OSYA 1CGHA 2QF5A 1P3CA 1O36A 3RU4E 1A2CH 1ZZZA 3SZNA 3GCHB 2J95A 1O3IA 3EYDA 2B0FA 3W1EA 1P9UA 3P8NA 5BRRE 1O2HA 2FWWA 1ETTH 4AYVB 2VIPA 1C4Y2 2GT8A 1ZSJA 1TPSA 3MNSA 2J98B 2KAIA 3Q3KA 2PUQH 3LT3A 1V2NT 3PMHB 5FHTA 3T29A 4F4OC 3PTNA 3SHCH 1ZOMA 2PKSC 1BTWA 2BX4A 3RXUA 1W7XH 4K8YA 1C1RA 2Y7ZA 1YYY1 5B6OA 2AGIX 1SGQE 4WXVA 3TK9A 1FPCH 3BG4C 4DT7B 2F9NA 4TY6A 3GY3A 1GMDG 3U1IB 1BTHH 3DHKH 1CA0B 2ANMH 2K0QA 1C9PA 3SJ9A 3QTVH 5JBCS 5F6MA 2A2XH 2ZFTA 5FBIA 7LPRA 4CH2B 1L1JA 2CXVA 3DT0H 3FVFB 3A87A 1GMCF 2ZFSA 1GBLA 1Q3XA 4MTBA 1JOUB 1NU7B 1QQ4A 2EI7A 1K1MA 2VIDA 3RM2H 2WYGA 3BN9A 2ZDNA 3EA8A 1O2RA 3Q76A 3GYLB 1O2WA 3A8CA 1UK4A 3RXEA 5GXPA 3DFJA 4NGAH 1UTLM 1TPPA 5FCRA 2B7DH 3DSGA 1QTFA 5HKKD 4WH6A 2GCTB 4THNH 1ANCA 1OXGA 2EI8A 1ELBA 1UHBA 1RS0A 1TE0A 2P8OB 2FDAA 1O2UA 1N8OB 4K1EA 4JYVH 5EIYA 1GWAA 1BIOA 2F43B 1J15A 1HRTH 1N6XA 1QA7A 1EZUC 1LHGH 5C94A 2VWMA 2EQNA 1O2XA 4MDSA 3UQVA 3PV4A 1O3DA 2ZNKH 4UEHH 2HVXA 2KCPA 4Q63A 2J97A 3LC5A 1MABB 5JBAS 1ZR0A 4AYYB 5A2MH 1XKAC 1DWEH 1YKTA 2ZC9H 2WZQA 2O8MA 1Z1IA 1OPHB 3BTDE 1DUAA 2HNTE 5EGMA 3SNCA 3RXDA 5L2YH 2Z9IA 2W26A 2SGDE 3GDVA 2L6OA 3E91A 2O8WA 4I7YH 5GCHG 3CNRA 5B6LA 2GJGA 1PJPA 2FOHA 3WW7A 3BF6H 5E0JA 3ZVGA 1TBRH 1MU6B 1PPZA 5TJXA 1SGPE 5EW2H 3H5CB 2YMSB 1WAYB 1Z8IB 1YC0A 4GCHF 5E8EH 5JBBS 1BMAA 4Y76A 4ABBA 1RTLA 3OFND 2OBOA 1O3MA 1JRSA 1PYTC 4XD7D 1E37B 1TALA 2ZA5A 1LCYA 1L4ZA 1TABE 4FU8A 1EJAA 2IOTA 2KCYA 1K0HA 1QZ8A 1WOFA 2AFQB 3KYFA 1HAVB 3OY5U 1EPTB 2YNBA 4A6LA 4AFUA 2VIOA 2ZI2H 1SMFE 1P10A 2BVXH 4Y8YA 1QFKH 1EZSC 2BLVA 3CENA 3ZYDA 3RXLA 2ZCLP 1NU9A 1YM0A 1P9SA 2FESH 4GAWA 1ZPCA 2BDBA 1FI8A 4AOQA 1ZMLA 1AI8H 4NWLA 1O2NA 2ODPA 4B75A 5GNDA 2A2QH 1C5OH
chains in the Genus database with same CATH topology
3L33A 2NWNA 5AVDA 4WVPE 2BDHA 1GL1A 1K1NA 4BOHA 1E38B 1ZSKA 4YM9A 2Y81A 4XBBA 5DP7A 1V2QT 5FXLA 2D2DA 3O8CA 3SNEA 2QA9E 2QV1A 2BZ6H 1QBNA 1TIOA 3RXBA 2FYRA 4XOJA 2UWOA 4NIWA 3ZVEA 1RRKA 5C5OA 4AZ2B 4GUXA 3FP6E 2IPHA 2AH4X 2ZP0H 2VJ1A 4TY7A 5EODA 4K60A 1XUJA 2ILNA 3M5OA 2PR3A 2M5TA 1K1PA 4R8TB 4Y0ZE 1TA6A 3S9CA 2Z3DA 3O8RA 3Q3YA 2OC8A 2C4FH 1DY8A 1TBQH 3AAVA 2Z3CA 1ZTLA 3M5NA 2J2UA 3QUMP 1W2KH 5FX6A 3MH4A 5E0HA 1BMLA 1KIGH 1GJCB 1C2HA 2ULLA 4ISNA 2A4QA 2OUAA 1SQOA 1UTKA 1NFUA 3IITA 1BRAA 4LK4A 4Y7AA 3JZ1B 1C2LA 4A1XA 5FAHA 1XUHA 3GISB 2ZECA 3U1JB 1AN1E 2QXHA 1NRPH 1P8VC 4RSPA 4BAMB 1EAXA 2TGAA 2FLBH 4B1TA 1O34A 2A7CA 2GV6A 3BTGE 1CGIE 1P2NA 1S0RA 4RN6A 1PQ8A 4AB9A 1QURH 4MLFB 1O2PA 3PWBA 3DUXH 3P8FA 1BCUH 4H6SB 2CMYA 4IMQA 1VITH 1T8MA 1TFXA 3GOVB 1YGCH 1CQQA 5EXLA 1E34B 2Z94A 1QJ7B 1Y8TA 1QL7A 2FTLE 3A7WA 3KHVA 1OYTH 1QRXA 1O3KA 1ELCA 1F5RA 1Y5BT 5DP4A 5F8ZA 2R3YA 2G5VA 1ELAA 1HPGA 2BD4A 1GVLA 3MWIU 1ESBA 1Z1JA 1IQMA 2W7SA 1MTNC 1O2LA 3GCNA 1E0FD 4Y7BA 1NM6A 2GKVE 1KXBA 1GMHG 1UVTH 2HNTF 1MZDA 5BPEA 4IC6A 1A0HB 1C5UA 4YOJA 1BUIA 4PROA 3ESTA 2ZF0H 1GBAA 3VXFH 1KXDA 2ZDKA 3IWMA 3LPRA 4ZKSU 4Y79A 2R2MB 1O3EA 3RXKA 1UCYE 1FY1A 3KEEA 1C5ZB 1EX3A 5HXFA 1XUGA 1O3CA 4K1SA 1W0YH 3KQEA 5LH8A 2C90B 1UTQA 4CH8B 4NSVA 3GY8A 1Z71A 5FPSA 2C8YB 2P16A 4AX9H 3TJNA 3UIRA 4FVBA 1ZLRA 1C2DA 8LPRA 2OQ5A 1GBIA 3GY2A 2OINA 1THSH 4FU7A 3HKIB 1T7CA 1EB1H 2JETC 1O2TA 1O3JA 1Z8JB 3TGIE 4TPYA 4BAHB 1ESAA 1QQUA 3BTKE 2XC0A 1G2LA 1S83A 2VGCC 1VJ9U 2XCFA 1F0TA 2Y7XA 2FXRA 1HAIH 1XVOA 2PGQB 4E06H 1MKWK 3UNRA 1QY6A 4NA7A 3ZZ8A 3SGAE 4ZAEA 3SNBA 2Q1JA 3OX7U 5CE1A 3VGCC 1NY22 2DE8A 3K6YA 5TCAA 1AO5A 1V2LT 1P12E 3GCTG 2FOAA 3SNDA 5JPMH 3MFJA 1B5GH 1DM4B 1UJ1A 1BRBE 1HJAB 1AWFH 2FPZA 1WYKA 4YT7H 2FS8A 3TLOA 2TIOA 1O2SA 3TU7H 2UWLA 1W13U 3RC5A 1TONA 2C93B 2VVUA 1CBWC 1O3OA 1ACBE 3ATWA 2GZ7A 4TYDA 1BQYA 5SGAE 1IQIA 2H9TH 1GI9B 1QIXB 3M36A 5FPYA 1GCTC 4NWKA 3A8BA 1ABJH 3E6PH 5F03A 3R0FA 2EI6A 2ZZUH 1UVSH 3VFEA 1CHGA 2DUCA 1CVWH 1ELVA 5EU8A 1B7XB 3BV9B 2BTCE 2PHBA 2HPQH 1P57B 2BLWA 1VGCC 1P2MA 4FUBA 3QK1A 3BIUH 4UFEH 3BG8A 2ZDLA 1GMDF 1UVPA 1O35A 3SV6A 1AFEH 4JZEH 3RXJA 1EATA 1RJXB 1YBWA 1S6FA 1MQ6A 1P3EA 1LMWB 4K2YA 1DANH 2HOBA 2G52A 2Z6BD 1V2MT 1G30B 2Z9JA 3ENSB 1HGTH 2J38A 3QGNB 2SGQE 2ZU1A 1NRQH 1MKXK 3U8TH 1PFXC 3SV8A 1A0LA 2GT7A 3UNSA 3KNXA 1O5FH 1CO7E 1CSOE 2K1QA 3BTFE 3AVZA 4NA9H 1MTWA 2H5DA 3M3TA 1FIZA 4X1SU 3SU1A 2RDLA 5AFYH 4DGJA 2PTCE 4AG2A 1C1TA 4ESTE 5C20A 3I78A 2ZHDA 1QRZA 1BJUA 2JH6D 4X1NU 5J4SA 3LGIA 2SGAA 1G36A 1ABIH 3ITIA 3HK6B 1MAYA 2STAE 1LVMA 1ZRBA 2J34A 1MD7A 2BZAA 3GDSA 3TGJE 1FLEE 4Y71A 1SPJA 1TA2A 1EOLA 4LZ4B 1GGDC 1C1SA 1GHAF 1PPFE 2FYQA 5T6FA 3GY5A 1F0RA 1Z6JH 3A7VA 3Q77A 1O5DH 1BTZA 1HBTH 2Z9LA 1PPBH 1F92A 3PTBA 2OCVB 2VH6A 4NZQA 4Y10E 1NPMA 1SB1H 4X2WA 3RXRA 1HCGA 1MH0A 5EXMA 1C2FA 5DPAA 2Z9GA 1SVPA 2BY5X 1WV7H 3MH5A 1WTHD 4K3JA 2CF9H 3U8OH 1ZTJA 1D3DB 2WPHS 4X2YA 2JKHA 2RCEA 1GDUA 1SGRE 3MNBA 5H4IB 1S85A 5GCHF 3HPTB 2STBE 1BMNH 2H5CA 4U30A 4TWWA 3A84A 5C67A 1BTUA 2ZEBA 4INKA 1O30A 2VWNA 3T26A 4Y0YE 1CA0C 3D49H 4DOQA 1QL8A 1DXWA 2PLXA 3AW0A 4ISHH 2GDDA 4KTUA 1KLTA 3TH4H 3VEQB 1O0DH 1V2JT 4IBLH 2XC5A 2Y82A 1TQ0B 3GY6A 1YPKH 3QX5H 2PUXB 2A4OA 2XBVA 2ZPRA 1VR1H 4HFPB 1AE8H 1C5NH 1H9LB 1S0QA 1ZHMA 1SGNE 1WUNH 3F9HA 2A0QB 4Z6AH 1SFIA 1A46H 1WQSA 2BMGB 2AYWA 5EOKA 3F68H 2ANKH 1QB1A 1DVAH 1TGTA 3NZIA 1ZHPA 1DLKB 1D3TB 4NSYA 2A4RA 2GDEH 2W5EA 5GWZA 1RIWB 2V6NA 2R9PA 1U6QA 1ELTA 1KTSB 4K8BA 1SI5H 1NZQH 4X1PU 1SGIB 8KME2 4VGCB 1ZPBA 1P01A 2CGAA 2FO9A 4RKOB 1C2KA 2BVRH 1M9UA 1K22H 4OS5A 4MNWA 4IMZA 1DUEA 1ANDA 2GZ9A 2TGDA 1KY9A 3VB5A 3SN8A 3KQBA 3A82A 1O3LA 2LPRA 3E0NB 1QGFA 3MU4A 1MBMA 1NC6A 4KP0A 2FOEA 1T8LA 2P3UB 2ZU3A 1TNGA 1C1WH 1AU8A 1P2JA 4J1YA 3ZZ3A 2QGRA 1HAYB 2I6SA 3AW1A 2Z9KA 1LKBA 1BHXB 1YPMH 1IQNA 4X0WU 2KAIB 1C5RA 4HI3A 1EQ9A 1O3GA 1P09A 1N1LA 2D1JA 1FJSA 2IN2A 1O3PB 3LONA 2J94A 2D26C 5A0CA 1DE7H 2CHAB 1BBRK 4NA8A 3EQ0H 4AFQA 1IAUA 2SNVA 1AZ8A 1FN6A 1IQLA 1NFYA 2QCYA 3A7YA 1LHDH 1P2KA 3LOXA 3M7TA 3MU8A 1G3CA 1FDPA 2ZU2A 3RU4T 2WPJS 1DX5M 1FPHH 3A7ZA 3S7KB 3BTHE 1AGJA 2XTTB 4AGJA 2G51A 1Y5AT 3VB3A 1GL0E 3SI4H 1XX9A 3P17H 3RXSA 1WTGH 2C8ZB 2H1UA 2OC7A 1C5QA 4GPGA 2OP9A 2HRVA 3OTJE 1C5MD 3P70B 3E90B 2ALVA 1PPHE 1W0ZU 1KLJH 1YPJH 3SI3H 4ABEA 4A5TS 2XXLA 1GHAG 2BXUH 5AHGH 1TX7A 4YOIA 2QXIA 3CP7A 1TBZH 2A45B 2HNTC 3LC3A 1ZGIA 4BNRA 1QB6A 3A81A 4JYTA 1IOEA 2PV9B 1GMHF 1TGSZ 5DP3A 3ATIA 1MUEB 4B2BA 2FM2A 1G3BA 3ODFA 3SQHE 4F49A 1YLCA 2GGVB 4AG1A 3S9AA 3C27B 3V0XA 1KDQB 4TWYA 7GCHF 4B2AA 5L6NH 3RXTA 2G8TA 1EP6A 1YP9A 1LHCH 1GJ9B 4GSOA 1MCVA 1UHBB 1Y59T 3PM3A 5K0HA 4B73A 1OYQA 1HIAA 2CN0H 3KQDA 3HGPA 1XXFA 3T2NA 1J16A 1TMTH 3MNCA 3SUFA 2O8LA 3KIDU 4Y8XA 1EAIA 1S81A 3RMNH 2C3SA 1AFQC 5CHAC 4JYUH 4XBDA 2B5TB 4KKDA 2B9LA 5EPNA 1SQAA 5DP8A 4NFFA 3P92A 5F8TA 1UCYH 3RXCA 3F9GA 3GICB 3M7UA 3QZRA 1OOKB 2PSYA 3SW2B 4X6MA 2VIWA 3UPEA 1P0SH 2FS9A 1C5SA 3UNQA 2AIPA 1MU8B 3BTTE 3URDA 3EGKH 5T6DA 4YZUA 1K1LA 3ZZCA 5A0BA 1FZZA 2JH0D 3B23B 4H6TA 3BTME 2BYAX 2PTNA 4UD9H 3GDUA 2BDIA 3QGJA 3GCTF 4AN7A 9ESTA 4FUJA 1C2GA 3SU2A 1BB0B 3TVJB 4I31A 3S69A 4FUHA 2BY7X 3SHAH 2ZTXA 3LGWA 1GI3A 1RTKA 1RD3B 5GDSH 4CHAB 1TNJA 4MPWA 2R2WU 1H9HE 4OS2A 2ZKSA 3S0NA 1WSSH 3AAUA 3UWIA 4NIYA 1EP5A 3KCGH 3GCOA 2R3UA 4CBOA 2GZ8A 4IW4E 3KN2A 4DURA 3U8RH 2BM2A 4X8UH 4BAOB 2RA3A 3VB6A 1BA8B 2Y80A 3O8BA 5EQRA 1K1JA 3C1KA 2F83A 1G32B 5E2PA 3BEIB 2WPIS 2AEIH 5GPIB 4Y8ZA 2ASUB 2VU8E 4BTIB 4CRDA 2GMTC 2QYIA 4NCYA 1C5LH 5C1XA 3EA7A 2Y6TA 1FAKH 2Q6FA 1ZMNA 2BX3A 2P93A 1GBHA 1W8BH 3KQCA 2FLRH 1F2SE 1H8DH 2BQ7B 3A85A 4IN1A 4LOYH 4HGCA 3SU5A 2O8UA 6GCHF 3PO1C 2WYJA 4X2VA 2QIQA 1SL3A 2QY0B 2Q6GA 1PYTD 1HXEH 4ABHA 1C1NA 2FX6A 1DY9A 2NU2E 1C4U2 1KLIH 1OX1A 5DP9A 4ZKNU 4ABGA 1C5WB 2QF0A 3RUOA 2Y5HA 3SORA 1W14U 2W3IA 1FY5A 5GIBA 1P2QA 1LHFH 1D6RA 4JK6A 2C8XB 3FP8E 2WV5A 1GHVH 2TGTA 2A5IA 4JCNA 4X6NA 1MD8A 2CF8H 4FXGH 4IC5A 2UUYA 1Q2WA 2OTVA 2OBQA 3S9BA 2BDCA 1UMAH 2SGPE 4NFEA 3I77A 1DWCH 1GI8B 4JZIA 3W94A 1C5YB 2BY8X 2QC2A 2HALA 2ZQ1A 4ASHA 7KMEH 1V2OT 2G4TA 3SBKA 2Q6DA 1UTNA 3SV2H 4GLYA 3VPKA 3QN7A 3M35A 1C1UH 3NPSA 1LTOA 1BTPA 4QT8C 1O5GH 1KXAA 4JZDH 3K65B 2AIQA 3LIWA 7GCHG 2FOMB 5JDUB 3RM0H 1OWKA 2VIVA 3D65E 4BXSA 3Q00A 1GJDB 4D9QA 1ZYOA 3BTEE 1GBDA 2Y5FA 3F9EA 1IQFA 1GI2A 1GJ8B 4I8LA 3RMLH 3RC6A 1A3EH 2BD8A 1GBFA 4B74A 4MPVA 3PMBB 2QXGA 4M7GA 1THRH 1CGJE 2W3KA 1C9TA 2VIQA 3ZZ9A 1H4WA 1NRNH 2F9PA 2A5KA 2UWPA 3ZVDA 7ESTE 3LGYA 3HKJB 1NESE 1QNJA 4ZH8A 1L1GA 1MAXA 4WWYA 1TRYA 1A3BH 1O2ZA 3M7QA 5A8YA 3BSQA 3VXEH 5IDKA 1DDJA 1IQJA 1P02A 1TRNA 1OWJA 1GBKA 3SJOA 2BDYA 3A8AA 1CT4E 2G5NA 3ZVCA 5F8XA 3RXHA 1GJBB 3E0PB 3ZZ5A 1TQ7B 4Q7YA 1UTMA 3JZ2B 6CHAC 4AFSA 3PLPA 4Y11E 3T25A 1ZRKA 3UREA 2G55A 4CR9A 4KTSA 1TB6H 4D9RA 3LDXH 1O5BB 1SR5C 1KSNA 3UQOA 3RXGA 3OY6U 5ETXA 1O3BA 2ZPQA 3M3VA 2YNAA 2XBWA 4WH8A 2BY9X 2R0LA 2FOCA 1GI0A 1G9IE 3ODDA 1OS8A 4ABIA 2XBYA 3TNSA 1W11U 1NFWA 1FY4A 4BAKB 2HWLB 1A0JA 1Y3VA 4INLA 3A83A 3ZV9A 1BMMH 5EXNA 4CREA 1Z6EA 5LGOA 3F1SB 4K1TA 3LKWA 1LQEA 4JMYA 4ABFA 4Q2KA 4ZXXH 3CS0A 1QA0A 3ATLA 1W3CA 1ORFA 4INHA 1KYNA 1ZHRA 3RC4A 2GTBA 2V0BA 1IQGA 2OLGA 3E1XB 1A4WH 1C1VH 3TH3H 1SLWB 2RA0A 3TJVA 1V2VT 1GJAB 5ESBA 1RTFB 1Y3UA 3STJA 1SGYE 5FPTA 1BZXE 2TGPZ 1HAZB 1K21H 4UFFH 2PFEA 2FI3E 2XW9A 4HZHA 4ISOA 4XFQA 3RMMH 1P11E 1K1IA 1O2QA 1HXFH 1MTUA 1PQ5A 1V2KT 2ZIQH 4OS1A 2OC0A 1GG6C 1DWBH 1YPHE 4KGAA 6GCHG 1Y5UT 3MHWU 1VCPA 1HAPH 4YLQH 2AGGX 1MBQA 1AKSA 1F0UA 4X2XA 1G3DA 3MOCA 1AB9C 1RFNA 3BEUA 4A1TA 1CHOG 1O2YA 4RKJB 1NS3A 3SOSA 1C4V2 3T28A 1IHTH 5T3HA 1L4DA 4DIIH 5DGJA 1W7GH 2OD3B 2WINI 1PPGE 2FIRH 2JETB 4FUDA 1L1NA 1V2ST 2R0KA 3UY9A 1GI7B 2FX4A 4CRCA 2BD9A 3MI4A 1O2GH 1BBRE 1FXYA 3QWCH 1VZQH 2G00A 1OWDA 1V2RT 1PQAA 2P3TB 1DLEA 1HYLA 1V2PT 2VGCB 3RDZA 4E05H 4D8NA 1O5AB 1O2VA 2A31A 4H42U 2EA3A 1F7ZA 2GP9B 2YOLA 1IQKA 1ELGA 2OC1A