4DVAU

The crystal structure of human urokinase-type plasminogen activator catalytic domain
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Urokinase-type plasminogen activator
publication title Rezymogenation of active urokinase induced by an inhibitory antibody
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4dvaU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4dvaU01
3QTVH 1BHXB 2VH0A 2ZA5A 1LQEA 1O3LA 4WJG2 2ZDMA 5K0HA 2F9UA 1ELBA 1EAIA 1DY8A 1HGTH 2WV5A 1SFIA 1NPMA 3S7HB 1C4V2 3SUEA 2HVXA 2GZ7A 1GDNA 4DT7B 3TGKE 3B9FH 3V0XA 1MKXH 3TGIE 1CGIE 1P12E 2M5TA 4B1TA 1DFPA 2ZPQA 3ZYDA 2P93A 3KGPA 5T3HA 1XUIA 4IW4E 1C5TA 3IG6B 3TVJB 1ZSJA 3BTFE 3HK3B 3NXPA 1G3CA 4FU7A 1DWEH 1LVMA 1GPZA 4DG4A 2Z3DA 1V2KT 3NKKA 1V2OT 1TONA 2PLXA 5C20A 1S85A 4FUHA 1MBQA 4CH2B 2J4IA 1BTHH 1G30B 2XTTB 2C8ZB 2Q6FA 2C8XB 2ANYA 1PPFE 3QX5H 4FVDA 3O8DA 1V2QT 1SGRE 2STBE 3RM0H 3ZVEA 1F5LA 4H4FA 1GI7B 1C1UH 2VIWA 2ULLA 3L33A 2ANKH 1GBDA 3CS0A 6LPRA 1WAYB 1O2ZA 3FZZA 4K1SA 3A7TA 2VWNA 4YZUA 3S0NA 2QV1A 1QIXB 3PLPA 1V2VT 1K1JA 4K5ZA 1MUEB 2G5NA 4IMZA 4BXWA 1SOTA 3ZZCA 2GDDA 3M3SA 1PPEE 1SG8B 4Y8ZA 5E0JA 3P92A 2FIRH 3STIA 2J9NA 2FOAA 3PROA 4DCDA 3SNCA 1DWDH 2XW9A 3B23B 5FPSA 3SI3H 4B2BA 1TX8A 1O3HA 1C2HA 2FESH 4B2CA 4DJZB 2O8MA 2H9TH 2TPIZ 3HGPA 3AAUA 1LMWB 1FZZA 2GGVB 3B8JA 1OYTH 3MWIU 3QTOH 1J15A 3L6PA 3GDVA 1IQKA 4TPYA 2R2MB 3PLBA 1SHYA 1FJSA 4BOHA 3E0NB 4CRBA 3T26A 2BD4A 2G81E 4LK4A 5EQSA 4X1SU 4Z6AH 2IPHA 4A92A 4DW2U 3PMHB 1ELCA 3KIDU 3A82A 1EASA 1KLTA 3KEEA 1EAUA 3A7XA 3N7OA 1DITH 1QURH 2PW8H 2WYGA 2SGFE 1EKBB 3O8RA 3RC5A 2ZFSA 3SBKA 1QBOA 1GBEA 3T25A 4ABIA 4LXBH 5A8YA 1GMHG 1FY3A 1T8OA 1YPKH 2A0QB 1F0RA 3BEFB 3LH1A 1ELFA 1TALA 4ZROA 1O3JA 2VIDA 3MU8A 1TIOA 3HKIB 5FXLA 3LU9B 2A4OA 5DO4H 1GBMA 1TWXB 1BTWA 3UQVA 2VH6A 1FY1A 3KCGH 2OLGA 1UK3A 2ILNA 3I77A 1O2UA 2GCHF 1T8MA 4Y10E 1HAVA 4RKJB 1ZR0A 4DOQA 1DANH 1N1LA 1ZPCA 1THRH 5GCHF 5DPAA 2BD7A 3UNQA 1L1JA 2FOHA 2F9BH 3GYLB 2UUYA 1MD7A 4I32A 4YLUA 1V2LT 5JB9S 1MU6B 5DGJA 1GWAA 2BD5A 2BDYA 2LPRA 3RXVA 3TNSA 2B7DH 2GX4A 1EP6A 4OGXA 3U98H 2Z3CA 1VCWA 5HM2A 2A5IA 1YPEH 3LGUA 1FV9A 3PO1C 3P95A 1AFQC 1B7XB 4ABJA 1J14A 1UVSH 5EG4A 4Y0ZE 2PGQB 3SU5A 1SSXA 8KME2 5E0HA 2VIQA 2V3OH 4A1VA 1W11U 2NU4E 4OS4A 4AFZA 1VITF 4H42U 1ESAA 2EI7A 1CU1A 1ZMLA 2BLWA 2PR3A 2ZDNA 3RDZA 3F9GA 1GHXH 1W12U 2PWXA 3BTGE 4AFSA 4Z0KA 1CBWB 4B71A 2Y80A 5F8ZA 1C1PA 1O2RA 4KP0A 4JYVH 2RA3A 1D9IA 3A84A 5BRRE 1PYTC 1B5GH 2FOEA 2ALVA 1C5XB 1DLEA 2JH5D 1MTUA 2XCFA 1H4WA 6ESTA 2EC9H 4WXIA 3UY9A 1HV7A 1BRBE 2V3HH 3TPIZ 1QL9A 2ASUB 2F91A 2O8LA 2ZDVH 2ZPRA 3M61U 1Z6EA 3VFEA 2CGAA 1P09A 1K28D 5SGAE 1ZHPA 4GLYA 2R3UA 1OWIA 2PUXB 1SVPA 4OS6A 2G8TA 1C9TA 1SGFA 3A81A 3VEQB 2XBWA 1O5FH 2EI8A 1N6XA 1THPB 1T32A 1S0RA 1VR1H 1AN1E 1UTPA 1DSTA 3E1XB 1TMBH 1C5ZB 4BTTB 4I8GA 1O5CB 2QGRA 1DUEA 1TBQH 1CT4E 1AGJA 4KELA 1P3CA 2BD2A 2AEIH 3FAOA 1GGDC 1HLTH 1GI5A 3SU1A 4I8HA 1E35B 3U8OH 3TNTA 1HJAB 2HNTF 3E8LA 1G3DA 2R0KA 5HMAA 3GOVB 2BB4A 2BDHA 2VVUA 3RMOH 2ZCHP 5GIBA 3DFLA 1MTNC 2FOFA 1FY4A 3M7TA 4AG2A 1C2IA 3Q3XA 2ZKSA 2B0FA 3SI4H 3GCTF 3PMBB 2ZO3H 4QT8C 1CHGA 2G52A 3LONA 1SMFE 1RIWB 2HALA 1TNHA 3ATMA 4X1RU 2J94A 1ZSLA 1FXYA 4D7FA 1XUJA 1FI8A 3R3GB 4A7IB 2ZC9H 5DP6A 1TRYA 1IQIA 2DUCA 1UHBB 3M5MA 1C2GA 1TLDA 1HYLA 1KSNA 2TBSA 2ZU2A 5T6GA 3RC4A 5C1UA 2FOGA 2PSXA 1TBRH 1GVZA 1QA0A 2WINI 1EZUC 1ZLRA 3RU4T 4YTAA 2BZAA 1Z7KA 2SGDE 2R2WU 4BAOB 3GCHC 3Q76A 3V3MA 1F0TA 3EDXB 2CN0H 1NO9H 3TJOA 1K1IA 2PKSB 2DE9A 1W0YH 2PUQH 1NFWA 1XUFA 1V3XA 1BIOA 5GPIB 4XBDA 1AVWA 2ODPA 1O2PA 2HPQH 3ZZ8A 3V7TA 4AB9A 4E7RG 2ZHWH 2BX3A 1C5QA 2NU2E 5GXPA 2AGIX 2QYIA 1PQ7A 1VGCC 2ZGXH 1BTPA 1ZMJA 1Y3WA 3UQOA 1AMHA 1F2SE 1C1SA 4K60A 1SHHB 1AZZA 2KAIB 2I6QA 1GHAG 2XC0A 5A09A 1CQQA 1D3DB 3RLWH 1MZDA 3GISB 5E0GA 3ZYEA 4INKA 1CGJE 3RXQA 2H1UA 2GVFA 5L2ZH 1TE0A 3D65E 3ZZ4A 1AU8A 1OS8A 1P2MA 1WQVH 1ZMNA 2W3IA 4GPGA 1AHTH 1VJ9U 4ZUHA 4MPXA 3M3VA 2WPIS 5IYTA 1H8DH 2FXRA 2OINA 1ABJH 2GZ8A 3E91A 1ID5H 2OBQA 1TGTA 3MU5A 1HIAB 3P8GA 2V0BA 4J2YB 1AE8H 2PGBB 2XC5A 3EA7A 4D9QA 1BHXF 1AQ7A 1GVLA 1ZGIA 1T8NA 5A0CA 2ZPSA 4JZIA 1SB1H 2AFQB 1ZRKA 2DE8A 2ZNKH 4XFQA 1O37A 4KTSA 2ZFQH 3JZ2B 3GY3A 4HZHA 1LHGH 2A5KA 5AFYH 1VITH 3ZVGA 4B75A 1O35A 1GMCG 1RTFB 4UFEH 3MO9A 2J95A 3FP7E 2ZQ2A 5TCCA 4D76A 4FUCA 1P57B 1L1NA 1IQHA 3ZZ5A 2THFB 2ZU5A 1UVTH 3A8AA 3QUMP 3S7KB 4WH6A 1O3FA 1SGEE 3TU7H 5DP8A 1WTGH 1FONA 2Q1JA 1HAYB 3Q77A 3PMAB 2CMYA 9ESTA 4RKOB 2QCYA 1S83A 5K7RA 5C67A 1BRCE 1NS3A 3CP7A 5PTPA 2VU8E 1P2KA 3V13A 6CHAC 1C5UA 1INCA 2QY0B 1QJ7B 1LHDH 1GMHF 1NESE 1AB9B 1C2FA 5FCKA 1ZRBA 2FM2A 4AYVB 4TPIZ 1SOZA 2BQ6B 2FYRA 5JBCS 2VWMA 1LVBA 2BXTH 1NFYA 5F8TA 1MTVA 2SNWA 1GCTC 1BT7A 1XMNB 4AFUA 5CMXH 3PYHA 2OCVB 4NGAH 5H4IB 2PTNA 2TRMA 3I29A 2HRVA 3RMLH 1A4WH 1UHBA 3EA8A 2ZTZA 1CHOG 4O9VA 2GT7A 1ZTLA 2A31A 5FBEA 5EGMA 4HFPB 4AX9H 2ZWLH 3BSQA 1TGNA 2C4FH 1EJAA 1EUFA 1YCPK 4GVUA 4NIVA 1NROH 4ABAA 1FLEE 3UOPA 1TPPA 4CRDA 3SV9A 3IWMA 4K1TA 5C5OA 2CXVA 3SQEE 2HWLB 1O3MA 3MNCA 1UCYH 4INLA 2GKVE 1MH0A 3M37A 3ELAH 1SGDE 5FCRA 2A1DB 4IC6A 2SFAA 3OYPA 3SNAA 1MQ6A 2ZU3A 3D23A 1PPZA 3GY7A 1G2MA 1QJ1B 1WOFA 3SHCH 2KAIA 1Y3XA 1CT0E 1C5NH 3BTDE 1RGQA 1Y5AT 1TX6A 2A32A 3QZQA 1BTUA 6GCHG 1BQYA 8GCHG 1Y8TA 1HAZB 3MHWU 1GBFA 3UREA 1TNGA 3UUZA 3SNBA 5EXNA 8LPRA 3MU4A 3ODFA 3PO1B 5FX6A 5DP5A 1AFQB 3SORA 1MCVA 3TGJE 1YP9A 4UFDH 2F9OA 3U8RH 3DHKH 3GCNA 2BDBA 1DS2E 1TABE 1S6HA 3SV8A 3LGTA 4K2YA 1F0UA 1K22H 3LDXH 1HIAA 5DJ7A 1S82A 1EB2A 4MQAA 1G32B 1A3BH 2O8TA 4CR9A 2AS9A 3S9AA 2ZFFH 4OGYA 1GL1A 1TMUH 2A7JA 2K1QA 1P8VC 3TH2H 1O2OA 1O2MA 3VGCB 3ZV8A 3ZVAA 4ZHLU 4JZFH 4UFGH 2FO9A 4JZEH 5ABWA 3VB3A 2CHAC 3V12A 1SGTA 3ZVCA 2BY5X 1GJ9B 3EGKH 1HAGE 1O2VA 1D3PB 1P9UA 2Y7ZA 1F7ZA 3W95A 1UVUH 2HGTH 1PQAA 1OP2A 4FUJA 1OWEA 1C1MA 3Q3KA 1GG6B 3QDZB 2BY8X 1GBKA 4JZDH 1V2JT 1MD8A 4AFQA 2BLQA 1AI8H 1BTZA 2XYAA 1PPHE 2FI3E 1FNIA 1O3KA 4B73A 1GJBB 1AE5A 1ZOMA 2A4QA 2RG3A 1H9IE 2GMTC 1DM4B 2R3YA 2ZGJA 1WU1A 1B0EA 4Y8YA 1LKAA 1NTPA 4Y0YE 3KQDA 3RXRA 5FHTA 4Y11E 4X2XA 2G5VA 2QC2A 2Z6BD 1ESTA 1SGCA 1ANBA 3EQ0H 1GGDB 1W3CA 1Z71A 1PPGE 1QQ4A 1RTKA 3RLYH 2FPZA 4GCHG 4CHAB 4OS1A 3SV6A 3PMJA 3LOXA 3BN9A 1OX1A 1UK2A 1MTNB 2P94A 1C1TA 1D6WA 1DUAA 1UK4A 3A7WA 4F49A 1QA7A 4ZMAH 3NK8A 1DWCH 1GHBG 4YOIA 4Q80A 4YLQH 4UEHH 4ZH8A 2GV7A 1MTSA 4MTBA 2BZ6H 1ZYOA 3SNEA 1L4ZA 2ZU4A 2NU3E 1TRMA 1AB9C 4E06H 1VZQH 5DG6A 1GMDG 1P2JA 1QL8A 3FZDA 1ELDE 1KXFA 5EW2H 4NIWA 3CS7A 2W5EA 1GJDB 2YOLA 4O03A 1IQNA 4MLFB 3RUOA 3QK1A 2BXUH 3TH4H 2P59A 2OTVA 1MQ5A 4J1YA 3A89A 5DP7A 3O8CA 1S0QA 2NWNA 2UUJB 4MNYA 4YO9A 1GHAF 1PQ5A 1HB0B 1FY5A 1DX5M 5EPYA 2RA0A 4R8TB 1HBTH 1FY8E 3GCHB 3ZVBA 3DA9B 2VINA 2OXSA 3GY4A 1OWDA 3SHAH 1JMOH 1Y3UA 3FP8E 4JZ1A 5GWZA 1TAWA 1O2GH 1O34A 2BVSH 2H6MA 4U2WA 2J34A 5CE1A 4AB8A 1Z1IA 1QY6A 1SQOA 4X6NA 1O3IA 1FAKH 3RXOA 1ZPBA 1GVKB 2A2QH 1OP8A 5DP3A 1HAXB 1VGCB 3SU0A 1LCYA 1E37B 2CF9H 2WPHS 2FX4A 1AWFH 2H9EH 1IOEA 2ZGBH 2AMDA 3TLOA 1SGFG 3SUFA 2OC7A 3SQHE 3UIRA 1JXPA 2XXLA 2C90B 4I31A 2Y5GA 3T28A 4TWWA 3MO6A 1FMGA 1Z1JA 1AO5A 5IDKA 1A5IA 4O3UA 2PSYA 7LPRA 3HPTB 1QR3E 1O3NA 3MNXA 5A0AE 3BTEE 3SO3A 1AUTC 1DE7H 1GMCF 1LVOA 1QRZA 1LPGB 1TOCB 3QLPH 3MH6A 1QTFA 1YLCA 3ITIA 2QXJA 4X8TH 4FUBA 3VB6A 1W14U 5CHAC 4WWYA 3OY5U 1SLXB 3T5FH 2GTBA 1A2CH 1G36A 2ZHFH 4XBCA 2ZHQH 4BAKB 4ZKOU 1UJ1A 1BDAA 2YNAA 3SU3A 1O2LA 1P01A 3SGBE 3NUMA 3BTWE 3UTUH 1UCYK 1SLVB 7KMEH 3SU2A 1IHTH 3BTME 1CA0B 3GICB 2FP7B 3U1JB 1UTNA 2B5TB 2F83A 3BG8A 3U8TH 3RMMH 1Y5BT 4Q7ZA 3ZZAA 3F9EA 2P8OC 1BRAA 1W13U 4X2WA 3VGCC 3K9XB 2SGPE 4X8VH 1IQJA 1K1OA 4GSOA 3ZZ7A 2BMGB 3OU0A 3KN2A 5L2YH 4WMDA 1YCPH 1GI0A 5TJXA 4LZ1H 3OY6U 1ELTA 3I78A 2W3KA 2FODA 3RXTA 5DP4A 1KLIH 2A4RA 1JRSA 1QQUA 2G4TA 3LKWA 1MAXA 2RDLA 2VWLA 2OC1A 1P3EA 4CRCA 4ABFA 1GG6C 1CHOF 3K6ZA 1MAYA 5I46H 1C5LH 1YF4A 2WV4A 3OSYA 1SR5C 3MNBA 4ZKNU 2OQUA 1BB0B 3VPKA 6CHAB 3MNSA 1CGHA 3GY6A 1O2JA 1F92A 1LPKB 4D9RA 4XE4A 3SOSA 1O3GA 1W7XH 4CRAA 5F6MA 3SN8A 2EI6A 1TB6H 2BM2A 4MPUA 1LDTT 1GCTB 1QB1A 5ESTE 2BD9A 1ACBE 4YT7H 1C1WH 4YOGA 3T62A 4AGJA 1BZXE 4AZ2B 2PV9B 2WPJS 1OPHB 1HFDA 1YPMH 1W7GH 1AY6H 2ZFRH 1VCPA 3O8BA 3DT0H 1GL0E 1THSH 1KDQB 4CHAC 1DXPA 1WSSH 2PKAB 1TA6A 1P06A 2Z9KA 1NRNH 3QGJA 4NIYA 1EXFA 5TCAA 3STJA 1GBLA 4JK5A 1BJUA 5JBBS 1H8IH 3A8DA 1MBMA 2NU0E 5JBAS 3ATWA 6GCHF 1QFKH 4XOJA 4H6SB 1NRRH 8GCHF 5GDSH 1SFQB 1QRXA 3DD2H 1F5KU 1PPBH 1V2WT 2SNVA 4CBOA 3U1IB 3QZRA 3BEUA 2D8WA 1SC8U 1SBWA 2BTCE 4THNH 1ZSKA 3VB4A 1EX3A 4K1EA 2WUBA 1YPGH 3UR9A 2HNTE 1MZAA 2BX4A 5AFZH 2UWOA 1JWTA 2OC8A 3HATH 2IJOB 2BYAX 2J38A 1UTQA 1BA8B 3LC5A 1BMMH 4CH8B 3RXMA 4O3TA 3A7ZA 3E3TA 1UCYE 2OP9A 3F1SB 3SJ9A 2J92A 1HRTH 3NPSA 4CBNA 1BMNH 1GJ8B 1Z8IB 1KXDA 2BDIA 2BY9X 2ANMH 1IQLA 1HUTH 3KNXA 1YCPM 1O2HA 4NA8A 2SGEE 1QGFA 3RXSA 1FQ3A 4NFEA 1LKBA 3SV2H 3K6YA 4ISLA 3RXHA 4B2AA 1WCZA 5AHGH 4TYDA 4NSYA 3SJIA 3ZV9A 4I8LA 4A1TA 1V2UT 5AVDA 1O36A 1AVXA 2CHAB 1LHFH 2Q6DA 3M5NA 4I8KA 1XUHA 3UR6A 4TY7A 1P9SA 2D1JA 4I7YH 2ESTE 2ZGHA 4I8JA 1EP5A 1TFXA 5FPYA 2ZGCA 1O3CA 2FLRH 1TOMH 1D6RA 1SI5H 1UTOA 3ZZ3A 4BANB 4GCHF 1JOUB 4ZHAA 2PTCE 1DLKB 1WBGB 1ZJKA 3EA9A 3A83A 1GI6A 1C2KA 2JETC 3GYMA 3A88A 1GHBF 2C8YB 1CA0C 3SV7A 3A86A 3BTKE 1ORFA 2G55A 2ZHDA 2GMTB 1C5PA 1C5OH 2TGDA 3SW2B 4DURA 2TGTA 2VIOA 1D3QB 4IMQA 1GMDF 3T29A 3PLKA 4ABGA 2C8WB 1EZXC 1MKWK 5EXLA 1DXWA 1YPLH 3A7VA 1RTLA 2QXIA 3PV4A 4WMEA 1GDQA 1FDPA 2GCTC 3E16B 1DT2A 1XXFA 2ZHEH 5LH8A 1KDQA 2ODYB 1P04A 1QB6A 2PKAA 1CO7E 4Y79A 5EW1H 1F5RA 3AW0A 5GJ4B 4X6PA 4MNXA 3BTTE 1QL7A 4MG3A 4Q2KA 3Q00A 4YESB 1BITA 1GBTA 1J9CH 2STAE 5EQRA 1Q31A 1PFXC 2W7SA 1H9HE 2BD3A 1O3AA 2BQWB 4Q7YA 2AGEX 1S81A 2AIQA 4WH8A 1ZHRA 3PWCA 3QN7A 3ZZDA 4Y8XA 2P16A 1O31A 4XBBA 1EOLA 4U32A 3MYWA 4BAMB 5F8XA 4X2VA 2ZECA 3D49H 4HGCA 4WY3A 4ZKSU 1O2YA 4MPVA 2RCEA 1GJCB 1TPAE 2SGQE 1OKXA 2BQ7B 1LTOA 3LJJA 3PB1E 1QNJA 3RMNH 4CRFA 2H5CA 2Y82A 2Z9LA 1HNEE 4JK6A 1C1OA 1GJ5H 1L4DA 1YLDA 1TPOA 2QXGA 7GCHG 4INHA 4MDSA 1BMAA 1KY9A 2P3FH 2UWPA 3FP6E 2D2DA 3MFJA 4NA9H 2ZU1A 1SLUB 2IN2A 3GDUA 1O3OA 2VVCA 4F4OC 1GBIA 4ISHH 1HDTH 2BOHB 1JRTA 2Y6TA 2FZZA 2C93B 3ZVFA 1XVMA 4H6TA 3RXLA 3TJUA 4YT6H 3LGWA 3W94A 3RXPA 1P2NA 3ATKA 1Q2WA 4MNVA 1NM6A 1GJ7B 4NG9H 1HAOH 4SGBE 3E0PB 1ELAA 3TH3H 3ESTA 1SGPE 1AKSB 5JDUB 4NCYA 1WYKA 2ZCKP 1PPCE 3ATIA 3S9CA 4FUGA 2JH6D 2WPMS 4GUXA 1OSSA 1RD3B 1KXCA 2BVXH 1D4PB 2FS9A 5J4SA 1U6QA 3M35A 3MU0A 1MCTA 2EEKA 2AGGX 1O5EH 1EQ9A 1QRWA 5CHAB 1ANDA 1JIRA 2FTLE 2XWBI 3C27B 4FU9A 1H9LB 4NZQA 2QA9E 4NFFA 5C5NA 1O3DA 4AYYB 2ZCLP 1A5HA 1FIZA 1BBRK 3HKJB 4VGCB 4X1NU 1TGCA 1EJMA 3SNDA 3D62A 3RXEA 3CENA 2OC0A 1GI2A 2A2XH 1ZTJA 4U01A 1HAHH 1NN6A 1TRNA 4NWLA 4NZLA 4OS5A 3M5OA 5DKMA 5EU8A 1GI1A 2SGAA 3UOUA 2XC4A 1Z8JB 4Y7AA 1O5BB 2P8OB 1C4U2 4R0IA 2ZDLA 3FFGA 5B6OA 2BDCA 1OWJA 2O8UA 3F68H 1PQ8A 1NY22 1G3BA 4MNWA 2Y81A 1FPHH 4ZXYH 1V2MT 5C1YA 2UWLA 3AASA 4YOJA 1HCGA 1XVOA 2R9PA 4Y76A 1YM0A 5ESBA 5HGGA 2FOBA 1RRKA 1JBUH 1N8OB 4MPWA 2BD8A 1K9OE 2FLBH 1ELGA 2W7UA 2FX6A 4FU8A 2BDAA 3R0FA 1CE5A 1AWHB 1SGNE 2ODQA 1UTLM 2A45B 1L0ZA 3SUGA 1EB1H 4UONA 1YPJH 1TGBA 1HPGA 1O2QA 1OP0A 1YBWA 4HI3A 3ATLA 3QGNB 3VB5A 4DVAU 2ZFTA 3TK6A 4NWKA 1K1NA 1EZQA 1O5DH 3VXEH 2IOTA 2WPLS 1KXAA 2ZG0H 3FVFB 1G3EA 1ZTKA 2C3SA 1GJ4H 1WV7H 1ABIH 4Y7BA 4AGKA 1C1NA 1UO6A 2ZP0H 4RN6A 4TWYA 4PROA 2V35A 2P95A 5EODA 4AORA 4DY7B 2Y5FA 3BTQE 4A1XA 4UFFH 1YYY1 1IQEA 2UUFB 1K1LA 1FN6A 2AMQA 2Z9JA 4NIXA 1O5GH 2OBOA 3H7TA 2VGCB 3P8OA 4TY6A 3JZ1B 3BTHE 5L6NH 1QJ6B 1OYQA 3SGQE 1SQTA 5EPNA 1T31A 1A5GH 4M7GA 1WTHD 2HNTC 1O3EA 1NZQH 4FUDA 3T2NA 3M36A 2ZQ1A 4UE7H 1B0FA 1N6YA 1O5AB 4FUFA 2ZZUH 1RXPA 2TGPZ 2D26C 1LPZB 2FI5E 1AKSA 4X2YA 1P2IA 1NU9A 2VIPA 3GY8A 1KYNA 1GI9B 1AUJA 2BDGA 4FUIA 4ABHA 2O9QA 1BOQA 3RC6A 1IAUA 5F03A 3LGVA 1QB9A 3GDSA 3RXIA 1O2XA 5ETXA 3SU6A 1V6DA 4ABBA 1EJNA 2AH4X 4XDEA 3A7YA 2F9PA 1BBRE 5E2PA 1KIGH 5C3NA 1XKBC 1PJPA 3MU1A 1GHWH 1P03A 1Z8RA 5EXMA 1TQ0B 2H9HA 5A8ZA 1V2RT 1GJ6A 3LJOA 1V2TT 1E38B 1IQGA 1L2EA 4B76A 3KQCA 1DWBH 4X8SH 1G37A 4D7GA 5FX5A 2ZTYA 3TJVA 1MKWH 4Y6DA 4A6LA 1GBAA 1O30A 1P02A 1O2SA 4WMFA 1QCPA 3LGIA 1QBVH 2VIVA 3SUDA 3DUXH 1M9UA 2Y5HA 4JCNA 4NA7A 5JPMH 4X1QU 4X6OA 1HJ9A 2F9VA 3H7OA 5E8EH 1A0JA 1EPTB 3LT3A 1AD8H 2OQ5A 5I25A 1ZHMA 2Z9IA 1H1BA 1LHCH 3MH5A 4JYTA 1VCQA 4VGCC 3SJOA 4BXSA 2JETB 2P3TB 3A8CA 1ARCA 4FXGH 3PTBA 2R0LA 4ZXXH 3RXAA 1UVPA 3URCA 1SGQE 5FBIA 2XWAA 5BPEA 3RXBA 1E34B 1ELVA 2BOKA 1GBHA 1BMLA 1C5SA 4JMYA 3P8NA 4FUEA 1P2QA 4XSKU 1E36B 4AOQA 1HJ8A 1A3EH 1XUGA 3Q3YA 4SGAE 1ETTH 1A0HB 1TNLA 4GHTA 3OTJE 3RXDA 3ZZBA 2XNIA 3IITA 1BTXA 2AIPA 1FPCH 1P05A 2VB0A 1W8BH 2GCTB 1TGSZ 4BNRA 2QF0A 1YPHE 1HXFH 1GI3A 2GD4B 4IN2A 3TITA 4AG1A 1TBZH 3K65B 4BTUB 5LPFA 4X0WU 1DSUA 1FAXA 1N8OC 1OWHA 2WPKS 3DFJA 3RP2A 1NC6A 3OX7U 3MH7A 1GHVH 1RJXB 4UDWH 2TIOA 3RXKA 1A7SA 2I6SA 1NRPH 2VJ1A 2H5DA 3L3TA 1O2KA 1EZSC 1GHYH 1KTTB 5HM9A 1TYNA 3VB7A 7GCHF 2B8OH 3RU4D 3SZNA 2CF8H 1V2NT 4BTIB 1GHZA 1SGIB 2JH0D 1GI4A 1C2MA 4B74A 3SU4A 1DICA 3G01A 3LPRA 3T27A 2LNCA 2UUKB 5DK1A 1V2ST 3BG4B 4LOYH 1S84A 1TNKA 2FOCA 1LHEH 4FVBA 4CRGA 3F9FA 1T4UH 3KQBA 4MVNA 4CR5A 1K1PA 2O8WA 2ANWA 5AF9H 3K2UA 2VGCC 3BF6H 2AYWA 3LH3A 4Y71A 3TJNA 2OD3B 1YC0A 1BBRH 4X6MA 1KLJH 1MKXK 1P0SH 3PM3A 3BEIB 3BV9B 2CJIA 1HXEH 2WYJA 1C4Y2 1DPOA 1O2IA 3SJ8A 2A5AA 1O39A 4NSVA 2XBXA 1G9IE 1YGCH 5G4BA 2BY7X 2H2ZA 3UPEA 1ZZZA 3U69H 1PYTD 1O2TA 3RXCA 3S69A 1S6FA 3M5LA 5HXFA 3AW1A 2GT8A 2AERH 3KQEA 3LGYA 1C2EA 2FS8A 3LC3A 3F6UH 2Q6GA 1ELEE 3RXGA 2BLVA 5A0BA 5E2OA 3UNSA 1SQAA 2GZ9A 4ZKRU 4DGJA 2YNBA 1NU7B 3A87A 4DIIH 1NRSH 4AN7A 1VJAU 3UWJH 1Y59T 4O97A 1TA2A 1UTKA 2J2UA 3MOCA 3AAVA 2ZIQH 5J4QA 5LPEA 3QWCH 2G4UA 2QN5T 4BAQB 1SL3A 4U30A 1EPTA 1GCDA 3A8BA 3MH4A 2A7CA 3P8FA 4ABEA 1ARBA 1SLWB 5T6FA 1DVAH 3M3TA 4IS5A 1G2LA 1DDJA 1UTMA 3WY8A 1TPSA 1DOJA 1O3PB 4WF8A 1A0LA 4ABDA 1BRUP 1XKAC 2VVVA 2VWOA 2Z7FE 1OOKB 1OXGA 2FYQA 7ESTE 1K1MA 3P17H 1C5YB 3LIWA 1SPJA 2A4GA 3SJKA 1QBNA 8ESTE 3BIUH 4K8YA 2HLCA 2CV3A 4CREA 1ETRH 1C2DA 2WUCA 1HAIH 1LO6A 3RXFA 2ALPA 3EYDA 1C5MD 2VNTA 2GDEH 2PFEA 4GAWA 1ZGVA 1HAPH 3C1KA 1EPTC 1C5VA 1RS0A 2ZF0H 1QHRB 4A5TS 3BIVH 5C1XA 1NFUA 1C2JA 5JYIA 1FIWA 3M7UA 5EQQA 4ISIH 3ZVDA 5L30H 3M7QA 2FTMA 3RU4E 1X7AC 2G00A 2XRCA 1TNJA 1GI8B 4KKDA 4ZHMU 4KTCA 1GBJA 1Y3VA 2GCHG 4OS7A 4BAHB 1BCUH 5JB8S 1FN8A 3P6ZB 1SGYE 1T4VH 3P70B 1ZPZA 2ZDAH 1TMTH 4E05H 5LPRA 1Q3XA 1MMJN 5GCHG 1O38A 1K21H 1L1GA 4IGDA 1C2LA 1C5RA 3KL6A 1GJAB 3MMGA 1W10U 2XBVA 1MU8B 2FOMB 1K2I1 1UMAH 3KF2A 1T7CA 2PHBA 1CBWC 4HTCH 1BUIA 2BVRH 3ENSB 1EOJA 3RM2H 1C5WB 5C2ZA 5FAHA 2Z9GA 1LQDB 3S9BA 1BJVA 2V6NA 4E7NA 1AFEH 2QIQA 3NCLA 3E90B 1O2WA 3H5CB 5T6DA 2EA3A 1A46H 1EAWA 1Y3YA 3GY2A 4K8BA 1TNIA 1VITG 3HK6B 1KXBA 3F9HA 3SGAE 1IQMA 3AVZA 4IBLH 4JYUH 2A7HA 4X1PU 3ODDA 1BTYA 2GP9B 5EOKA 1W2KH 2ZTXA 1ANEA 1P10A 3EE0B 3MTYA 1FUJA 1IQFA 1J8AA 4ISOA 2HOBA 2HPPH 1NFXA 1O0DH 4ISNA 1O33A 1C9PA 5A8XA 3BG4C 1WUNH 1O2NA 1C1QA 3URDA 3A80A 1EAXA 5FPTA 1KXEA 1AZ8A 3ZZ9A 2FI4E 1J16A 1O32A 4ZAEA 2BY6X 3KHVA 1XM1A 2FMJA 1P2OA 1XXDA 3RXUA 1F0SA 1MTWA 4RSPA 1AIXH 1OWKA 2Y7XA 4X8UH 1HJAC 1C1RA 1GBBA 2Z3EA 3TIUA 1LVYA 1TX7A 3NZIA 3RXJA 3MO3A 4UD9H 2ZEBA 1NT1A 1JIMA 3QO6A 2JKHA 1XX9A 4WXVA 1V2PT 2FDAA 1NRQH 3A85A 2GV6A 3EAJA 3GCOA 1ANCA 9LPRA 3U9AH 3GY5A 1CT2E 1AVGH 4OS2A 1ZJDA 4KTUA 1RIWC 2QF3A 2W26A 4D8NA 2P3UB 2NU1E 4IN1A 3PWBA 2G51A 4K3JA 2F3CE 4LZ4B 1A61H 3UFAA 1CSOE 2FWWA 1T8LA 4KGAA 3PTNA 1RFNA 2F9NA 4IC5A 1CVWH 3TK5A 5A2MH 3UWIA 3VXFH 1O3BA 2QAAA 1UTJA 1J17T 2AMPA 1CA8B 1KTSB 1TQ7B 1W0ZU 1S5SA 2ZFPH 4WVPE 2XBYA 2Z94A 3GCTG 4I33A 4DIHH 3NWUA 1E0FD 2PKSC 2ZDKA 1P11E 1GDUA 3TK9A 4YM9A 4ASHA 2TGAA 2ZI2H 5JBTA 1XUKA 1DY9A 5LGOA 1Y5UT 3E6PH 3HGNA 1Z6JH 2BLOA 5DP9A 1C1VH 5HYOA 2XCNA 2FEQH 1Z8GA 1ETSH 1EATA 3ZZ6A 1IHSH 1GBCA 4Q7XA 1UVOA 3UNRA 1YPHC 2B9LA 3FANA 3MI4A 1D3TB 4GHQA 1HAVB 2BHGA 4K69A 4ESTE 2OUAA 1YKTA 1ESBA 1A1RA 2QXHA 1WQSA
chains in the Genus database with same CATH superfamily
3QTVH 1BHXB 2VH0A 2ZA5A 3KYFA 4ASUD 1LQEA 3WWFA 1O3LA 4WJG2 2ZDMA 5K0HA 2F9UA 2WZQA 1ELBA 1EAIA 1DY8A 1HGTH 2WV5A 1SFIA 1NPMA 3S7HB 1C4V2 3SUEA 2HVXA 2GZ7A 1GDNA 4DT7B 3TGKE 3B9FH 2KCAA 3V0XA 1MKXH 3TGIE 1CGIE 1P12E 2M5TA 4B1TA 1DFPA 2ZPQA 3ZYDA 2P93A 3KGPA 5T3HA 3KYGA 1XUIA 2JJ1D 1C5TA 3IG6B 4IW4E 3TVJB 1ZSJA 3BTFE 3HK3B 3NXPA 1G3CA 4FU7A 1DWEH 1LVMA 1GPZA 4DG4A 3N7DA 2Z3DA 1V2KT 3NKKA 1V2OT 1TONA 2PLXA 5C20A 1S85A 4FUHA 1MBQA 4CH2B 2J4IA 1BTHH 1G30B 2XTTB 2C8ZB 2Q6FA 2C8XB 2ANYA 1PPFE 3QX5H 4FVDA 3O8DA 1V2QT 1SGRE 2STBE 3RM0H 3ZVEA 1F5LA 4H4FA 1GI7B 1C1UH 2JIZD 2VIWA 2ULLA 3L33A 2ANKH 1GBDA 3CS0A 6LPRA 1WAYB 1O2ZA 3FZZA 4K1SA 3A7TA 2VWNA 4YZUA 3S0NA 2QV1A 1QIXB 2L74A 3W1EA 3PLPA 1V2VT 1K1JA 4K5ZA 1MUEB 2G5NA 4IMZA 4BXWA 1SOTA 3ZZCA 2GDDA 3M3SA 1PPEE 1SG8B 4Y8ZA 5E0JA 3P92A 2FIRH 3STIA 2J9NA 2FOAA 3PROA 4DCDA 3SNCA 1DWDH 2XW9A 3B23B 5FPSA 3SI3H 4B2BA 1TX8A 1O3HA 1C2HA 2FESH 4B2CA 4DJZB 2O8MA 2H9TH 2TPIZ 3HGPA 3AAUA 1LMWB 1FZZA 2GGVB 3B8JA 1OYTH 3MWIU 3QTOH 1J15A 3L6PA 3GDVA 1IQKA 4TPYA 2R2MB 1E79D 4RT1A 3PLBA 1SHYA 1FJSA 4BOHA 3E0NB 4CRBA 3T26A 2BD4A 2G81E 4LK4A 5EQSA 4X1SU 4Z6AH 2IPHA 4A92A 4DW2U 3PMHB 1ELCA 2XOKD 3KIDU 3A82A 1EASA 3SYJA 2OK5A 1KLTA 3KEEA 1EAUA 3A7XA 3N7OA 1DITH 1QURH 2PW8H 2WYGA 2SGFE 1EKBB 3O8RA 3RC5A 2ZFSA 3SBKA 1QBOA 3PRDA 1GBEA 3T25A 4ABIA 4LXBH 5A8YA 1GMHG 1FY3A 1T8OA 1YPKH 2LELA 2A0QB 1F0RA 3BEFB 2K8IA 3LH1A 1ELFA 1TALA 4ZROA 1O3JA 2VIDA 3MU8A 1TIOA 3HKIB 5FXLA 3LU9B 2A4OA 5DO4H 1GBMA 1TWXB 1BTWA 3UQVA 2VH6A 1FY1A 3KCGH 2OLGA 1UK3A 2ILNA 3I77A 1O2UA 2QF5A 2GCHF 1T8MA 4Y10E 1HAVA 5CDFE 4RKJB 1ZR0A 4DOQA 1DANH 1N1LA 5HIZA 1ZPCA 1THRH 5GCHF 5DPAA 2BD7A 3UNQA 1L1JA 2FOHA 2F9BH 3GYLB 2UUYA 1MD7A 4I32A 4YLUA 1V2LT 5JB9S 1MU6B 5DGJA 1GWAA 2BD5A 2BDYA 2LPRA 3RXVA 3TNSA 2B7DH 2GX4A 1EP6A 4OGXA 3U98H 2Z3CA 1VCWA 5HM2A 2A5IA 1YPEH 3LGUA 1FV9A 3PO1C 3P95A 1AFQC 1B7XB 4ABJA 1J14A 1UVSH 5EG4A 4Y0ZE 2PGQB 3SU5A 1SSXA 8KME2 5E0HA 2VIQA 2V3OH 4A1VA 1W11U 2NU4E 4OS4A 4AFZA 1VITF 4H42U 1ESAA 2EI7A 1CU1A 1ZMLA 2BLWA 4ACAA 2PR3A 2ZDNA 3RDZA 3F9GA 2L6OA 1GHXH 1W12U 2PWXA 3BTGE 4AFSA 4Z0KA 1CBWB 4B71A 2Y80A 5F8ZA 1C1PA 1O2RA 4KP0A 4JYVH 2RA3A 1D9IA 1E1RD 3A84A 5BRRE 1PYTC 1B5GH 2FOEA 2ALVA 1C5XB 1DLEA 2JH5D 1MTUA 2XCFA 5C0TA 1H4WA 6ESTA 2EC9H 4WXIA 3UY9A 1HV7A 1BRBE 2V3HH 2YMSD 3TPIZ 1QL9A 2ASUB 2F91A 2O8LA 2ZDVH 2ZPRA 3M61U 1Z6EA 3VFEA 2CGAA 1P09A 1K28D 5SGAE 1ZHPA 4GLYA 2R3UA 1OWIA 2PUXB 1SVPA 4OS6A 2G8TA 1C9TA 1SGFA 3A81A 3VEQB 2XBWA 1O5FH 2EI8A 1N6XA 1THPB 1T32A 1S0RA 1VR1H 1AN1E 1UTPA 1DSTA 3E1XB 1TMBH 1C5ZB 4BTTB 4I8GA 1O5CB 2QGRA 1DUEA 1TBQH 1CT4E 1AGJA 4KELA 1P3CA 2BD2A 2AEIH 3FAOA 1GGDC 1HLTH 1GI5A 4Q4LA 3SU1A 4I8HA 1E35B 3U8OH 3TNTA 2XNDD 1HJAB 2HNTF 3E8LA 1G3DA 2R0KA 5HMAA 3GOVB 2BB4A 2BDHA 2VVUA 3RMOH 2ZCHP 5GIBA 5HKKD 3DFLA 1MTNC 2FOFA 1FY4A 2J5UA 3M7TA 4AG2A 1C2IA 3Q3XA 2ZKSA 2B0FA 3SI4H 3GCTF 4B6FA 3PMBB 2ZO3H 4QT8C 1WXRA 1CHGA 2G52A 3LONA 1SMFE 1RIWB 2HALA 1TNHA 3ATMA 4X1RU 2J94A 1ZSLA 1FXYA 4D7FA 1XUJA 1FI8A 3R3GB 3DSPA 4A7IB 2ZC9H 5DP6A 1TRYA 1IQIA 2DUCA 1UHBB 3M5MA 1C2GA 1TLDA 1HYLA 1KSNA 2TBSA 2ZU2A 5T6GA 3RC4A 5C1UA 2FOGA 2PSXA 1TBRH 1GVZA 1QA0A 2WINI 1EZUC 1ZLRA 3RU4T 4YTAA 2BZAA 1Z7KA 2SGDE 2R2WU 4BAOB 1BMFD 3GCHC 3Q76A 3V3MA 1F0TA 3EDXB 2CN0H 1NO9H 3TJOA 1K1IA 2KFWA 2PKSB 2DE9A 1W0YH 2PUQH 1NFWA 1XUFA 1V3XA 1BIOA 5GPIB 4XBDA 1AVWA 2ODPA 1O2PA 2HPQH 3ZZ8A 3V7TA 4AB9A 4E7RG 2ZHWH 2BX3A 1C5QA 2NU2E 5GXPA 2AGIX 3KQ5A 2QYIA 1PQ7A 2QE7D 1VGCC 2ZGXH 1BTPA 1ZMJA 1Y3WA 3UQOA 1AMHA 1F2SE 1C1SA 4K60A 1SHHB 1AZZA 2KAIB 2I6QA 1GHAG 2XC0A 5A09A 1CQQA 1D3DB 3RLWH 1MZDA 3GISB 5E0GA 3ZYEA 4INKA 1CGJE 3RXQA 2H1UA 2GVFA 5L2ZH 1TE0A 3D65E 3ZZ4A 1AU8A 1OS8A 1P2MA 1WQVH 1ZMNA 2W3IA 4GPGA 1AHTH 1VJ9U 4ZUHA 4MPXA 3M3VA 2WPIS 5IYTA 1H8DH 2IPQX 2FXRA 2OINA 1ABJH 1WDIA 2GZ8A 3E91A 1ID5H 2OBQA 1TGTA 3MU5A 1HIAB 3P8GA 2V0BA 3DSOA 4J2YB 1AE8H 2PGBB 2XC5A 3EA7A 5CHBA 1BHXF 4D9QA 1AQ7A 1GVLA 1ZGIA 1T8NA 5A0CA 2ZPSA 4JZIA 1SB1H 2AFQB 1ZRKA 2DE8A 2ZNKH 4XFQA 1O37A 4KTSA 2ZFQH 3JZ2B 3GY3A 1FX0B 4HZHA 1LHGH 2A5KA 5AFYH 1VITH 3ZVGA 4B75A 1O35A 1GMCG 1RTFB 4UFEH 3MO9A 2J95A 3FP7E 3OEHD 2ZQ2A 5TCCA 4D76A 4FUCA 1P57B 2J98B 1L1NA 1IQHA 2J97A 3ZZ5A 2THFB 2ZU5A 1UVTH 3A8AA 3QUMP 3S7KB 4WH6A 1O3FA 2WPDD 3DCLA 1SGEE 3TU7H 5DP8A 1WTGH 1FONA 2Q1JA 1HAYB 3Q77A 3PMAB 2CMYA 9ESTA 4RKOB 2QCYA 1S83A 5K7RA 5C67A 1BRCE 1NS3A 3CP7A 5PTPA 2VU8E 1P2KA 3N7EA 4XRNA 3V13A 6CHAC 1C5UA 1INCA 2QY0B 1QJ7B 1LHDH 3F0OA 1GMHF 1NESE 1AB9B 1C2FA 5FCKA 1ZRBA 2FM2A 4AYVB 4TPIZ 1SOZA 2BQ6B 2FYRA 2V7QD 5JBCS 2VWMA 1LVBA 2BXTH 1NFYA 5F8TA 1MTVA 2SNWA 1GCTC 1BT7A 1XMNB 4AFUA 4I86A 5CMXH 3PYHA 2OCVB 4NGAH 5H4IB 2PTNA 2TRMA 3I29A 2HRVA 3RMLH 1A4WH 1UHBA 3EA8A 2ZTZA 5C17A 1CHOG 4O9VA 2GT7A 1ZTLA 2A31A 5FBEA 5EGMA 4HFPB 4AX9H 2ZWLH 3BSQA 1TGNA 2C4FH 1EJAA 1EUFA 1YCPK 4F48B 4GVUA 4NIVA 1NROH 4ABAA 1FLEE 3UOPA 1TPPA 4CRDA 3SV9A 3IWMA 4K1TA 5C5OA 2CXVA 3SQEE 2HWLB 1O3MA 3MNCA 1UCYH 4INLA 2GKVE 1MH0A 3M37A 3ELAH 1SGDE 5FCRA 2A1DB 4IC6A 2SFAA 3OYPA 3SNAA 1MQ6A 2ZU3A 3D23A 1PPZA 3GY7A 1G2MA 1QJ1B 1WOFA 3F0PA 3SHCH 2KAIA 1EFRD 1Y3XA 1CT0E 1C5NH 3BTDE 1RGQA 2KCOA 2PP6A 1Y5AT 1TX6A 2A32A 3QZQA 1BTUA 6GCHG 1BQYA 4TT3D 4RI0A 8GCHG 1Y8TA 1HAZB 1W0KD 3MHWU 1GBFA 3UREA 1TNGA 3UUZA 3SNBA 5EXNA 8LPRA 3MU4A 3ODFA 3PO1B 5FX6A 3FO8D 5DP5A 1AFQB 3SORA 1MCVA 3TGJE 1YP9A 4UFDH 2F9OA 3U8RH 3DHKH 3GCNA 2BDBA 1DS2E 1TABE 1S6HA 3SV8A 3LGTA 4K2YA 3FN8A 1F0UA 1K22H 3LDXH 1HIAA 5DJ7A 1S82A 3OFND 1EB2A 4MQAA 1G32B 1A3BH 2O8TA 4CR9A 2AS9A 3S9AA 2ZFFH 4OGYA 1GL1A 2HVYB 1TMUH 2A7JA 2K1QA 1P8VC 3TH2H 1OHHD 1O2OA 1O2MA 3VGCB 3ZV8A 3ZVAA 4ZHLU 4JZFH 4UFGH 2FO9A 1SKYE 4JZEH 5ABWA 3VB3A 2CHAC 3V12A 1SGTA 3ZVCA 2BY5X 1GJ9B 3EGKH 4P02A 1HAGE 1O2VA 1D3PB 1P9UA 2J98A 4F55A 2Y7ZA 1F7ZA 3W95A 1UVUH 2HGTH 1PQAA 1OP2A 4FUJA 1OWEA 1C1MA 3Q3KA 1GG6B 3QDZB 1K0HA 2BY8X 1GBKA 4B6EA 4JZDH 1V2JT 5KGOA 1MD8A 4AFQA 2BLQA 1AI8H 1BTZA 2XYAA 1PPHE 3SZEA 3EE7A 2FI3E 1FNIA 1O3KA 4B73A 1GJBB 1AE5A 1ZOMA 2A4QA 2RG3A 1H9IE 2GMTC 1DM4B 2R3YA 1VKYA 2ZGJA 1WU1A 1B0EA 4Y8YA 1LKAA 1NTPA 4Y0YE 3KQDA 3RXRA 5FHTA 4Y11E 4X2XA 2G5VA 2QC2A 2Z6BD 1ESTA 1SGCA 1ANBA 3EQ0H 1GGDB 1W3CA 1Z71A 1PPGE 1QQ4A 1RTKA 3RLYH 5FL7D 2FPZA 4GCHG 4CHAB 4OS1A 3SV6A 3PMJA 4FETA 3LOXA 3BN9A 1OX1A 1UK2A 1MTNB 1C1TA 1D6WA 1DUAA 1UK4A 2P94A 3A7WA 4F49A 1QA7A 3PV5A 4ZMAH 3NK8A 1DWCH 1GHBG 4YOIA 4Q80A 4YLQH 4UEHH 4ZH8A 2GV7A 1MTSA 4MTBA 2BZ6H 1ZYOA 3SNEA 1L4ZA 2ZU4A 2NU3E 1TRMA 1AB9C 4E06H 1VZQH 5DG6A 1GMDG 1P2JA 1QL8A 3FZDA 1ELDE 1KXFA 1YY3A 4NIWA 5EW2H 3CS7A 2W5EA 1GJDB 2YOLA 4O03A 1IQNA 4MLFB 3RUOA 3QK1A 2BXUH 4P00A 5GNDA 3TH4H 2P59A 2OTVA 1MQ5A 4J1YA 3A89A 5DP7A 3O8CA 1S0QA 2NWNA 2UUJB 4MNYA 4YO9A 1GHAF 1PQ5A 1HB0B 1FY5A 1DX5M 5EPYA 2RA0A 4R8TB 1HBTH 1FY8E 3GCHB 3ZVBA 3DA9B 2VINA 2OXSA 3GY4A 1OWDA 3SHAH 1JMOH 1Y3UA 3FP8E 4JZ1A 5GWZA 1TAWA 1O2GH 1O34A 2BVSH 2H6MA 4U2WA 2J34A 5CE1A 4AB8A 1Z1IA 1QY6A 2QF4A 4ZCNA 1SQOA 4X6NA 1O3IA 1FAKH 3RXOA 1ZPBA 1GVKB 2A2QH 1OP8A 5DP3A 1HAXB 1VGCB 3SU0A 1LCYA 1E37B 2CF9H 2WPHS 2FX4A 1AWFH 1SQRA 2H9EH 1IOEA 2ZGBH 2YMSC 2AMDA 3TLOA 3PRBA 1SGFG 3SUFA 2OC7A 2RFKC 3FOAA 3SQHE 3UIRA 1JXPA 2XXLA 2C90B 4I31A 5EJ1A 2Y5GA 3T28A 4TWWA 3MO6A 1FMGA 1Z1JA 1AO5A 5IDKA 1A5IA 4O3UA 2PSYA 5C94A 7LPRA 3HPTB 1QR3E 1O3NA 3MNXA 5A0AE 3BTEE 3SO3A 1AUTC 1DE7H 1GMCF 1LVOA 1QRZA 1LPGB 1TOCB 3QLPH 3MH6A 1QTFA 1YLCA 3ITIA 2QXJA 4X8TH 4FUBA 3VB6A 1W14U 5CHAC 4WWYA 3OY5U 1SLXB 5DN6D 3T5FH 2GTBA 1A2CH 1G36A 2ZHFH 4XBCA 2ZHQH 4BAKB 4ZKOU 1UJ1A 1BDAA 2YNAA 3SU3A 1O2LA 1P01A 3SGBE 3NUMA 3BTWE 3UTUH 1UCYK 1SLVB 7KMEH 3SU2A 1IHTH 3BTME 1CA0B 3GICB 5EIYA 2FP7B 3U1JB 1UTNA 2B5TB 2F83A 3BG8A 3U8TH 3RMMH 1Y5BT 4Q7ZA 3ZZAA 3F9EA 2P8OC 1BRAA 1W13U 4X2WA 3VGCC 3K9XB 2SGPE 4X8VH 1IQJA 1K1OA 4GSOA 3ZZ7A 2BMGB 3OU0A 3KN2A 5L2YH 4WMDA 1YCPH 1GI0A 3U28C 5TJXA 4LZ1H 3OY6U 1ELTA 3I78A 2W3KA 2FODA 3RXTA 5DP4A 1KLIH 2A4RA 1JRSA 1QQUA 2G4TA 3LKWA 1MAXA 2RDLA 2VWLA 2OC1A 1P3EA 3OAAD 4CRCA 4ABFA 1GG6C 1CHOF 3K6ZA 1MAYA 5I46H 1C5LH 1YF4A 2WV4A 3OSYA 1SR5C 3MNBA 4ZKNU 2OQUA 1BB0B 3VPKA 6CHAB 3DSGA 1CGHA 3GY6A 3MNSA 1O2JA 1F92A 1LPKB 4D9RA 4XE4A 3SOSA 1O3GA 1W7XH 4CRAA 5F6MA 3SN8A 2EI6A 1TB6H 2BM2A 4MPUA 1LDTT 1GCTB 1QB1A 5ESTE 2BD9A 1ACBE 4YT7H 1C1WH 4YOGA 3T62A 4AGJA 1BZXE 4AZ2B 2PV9B 2WPJS 1OPHB 2EY4C 1HFDA 1YPMH 1W7GH 1AY6H 2ZFRH 5EJZA 1VCPA 3O8BA 3DT0H 1GL0E 1THSH 1KDQB 4CHAC 1DXPA 1WSSH 2PKAB 1COWD 1TA6A 1P06A 2Z9KA 1NRNH 3QGJA 4NIYA 1EXFA 5TCAA 3STJA 1GBLA 4JK5A 1BJUA 5JBBS 1H8IH 3A8DA 1MBMA 2NU0E 5JBAS 3ATWA 2AHME 6GCHF 1QFKH 4XOJA 4H6SB 1NRRH 8GCHF 5GDSH 1SFQB 1QRXA 3DD2H 1F5KU 1PPBH 1V2WT 2JJ2D 2SNVA 3AK5A 4CBOA 3U1IB 3QZRA 3BEUA 2D8WA 3F2FA 1SC8U 1SBWA 2BTCE 4THNH 1ZSKA 3VB4A 1EX3A 4K1EA 2WUBA 2KCYA 1YPGH 3UR9A 2HNTE 1NBMD 1MZAA 2BX4A 5AFZH 2UWOA 1JWTA 3OTPA 2OC8A 3HATH 2IJOB 2BYAX 2J38A 1UTQA 1BA8B 3LC5A 1BMMH 4CH8B 3RXMA 4O3TA 3A7ZA 3E3TA 1UCYE 2OP9A 3F1SB 5HIYA 3SJ9A 2J92A 1HRTH 3NPSA 4CBNA 1BMNH 1GJ8B 1Z8IB 1KXDA 2KCPA 2BDIA 2BY9X 2ANMH 1IQLA 1HUTH 3KNXA 1YCPM 1O2HA 4NA8A 2SGEE 1QGFA 3RXSA 1FQ3A 4NFEA 1LKBA 3SV2H 3K6YA 4ISLA 3RXHA 4B2AA 1WCZA 5AHGH 4TYDA 4NSYA 3SJIA 3ZV9A 4I8LA 4A1TA 1V2UT 5AVDA 1O36A 1AVXA 2CHAB 1LHFH 2Q6DA 3M5NA 4I8KA 1XUHA 3UR6A 4TY7A 1P9SA 2D1JA 4I7YH 2ESTE 2ZGHA 4I8JA 1EP5A 1TFXA 5FPYA 2ZGCA 1O3CA 2FLRH 1TOMH 1D6RA 1SI5H 1UTOA 3ZZ3A 4BANB 4GCHF 1JOUB 4ZHAA 2PTCE 1DLKB 1WBGB 1ZJKA 3EA9A 3A83A 1GI6A 1C2KA 2JETC 3GYMA 3A88A 1GHBF 2C8YB 1CA0C 3SV7A 3A86A 3BTKE 1ORFA 2G55A 2ZHDA 2GMTB 1C5PA 1C5OH 2TGDA 3SW2B 3CNRA 4DURA 2TGTA 2VIOA 1D3QB 4IMQA 1GMDF 3T29A 3PLKA 4ABGA 2C8WB 1EZXC 1MKWK 5EXLA 1DXWA 1YPLH 3A7VA 1RTLA 2QXIA 3PV4A 4WMEA 1GDQA 1FDPA 2GCTC 3E16B 1DT2A 1XXFA 1S6LA 2ZHEH 5LH8A 1KDQA 2ODYB 1P04A 1QB6A 2PKAA 1CO7E 2WHXA 4Y79A 5EW1H 1F5RA 3AW0A 5GJ4B 4X6PA 4MNXA 3BTTE 1QL7A 4MG3A 4Q2KA 3Q00A 4YESB 2IJD1 1BITA 1GBTA 1J9CH 2STAE 5EQRA 1Q31A 1PFXC 2W7SA 1H9HE 2BD3A 1O3AA 2BQWB 4Q7YA 2AGEX 1S81A 2AIQA 4WH8A 1ZHRA 3PWCA 3QN7A 3ZZDA 4Y8XA 2P16A 1O31A 4XBBA 1EOLA 4U32A 3MYWA 4BAMB 5F8XA 4X2VA 3H09A 2ZECA 3D49H 4HGCA 1NBME 4WY3A 4ZKSU 1O2YA 4MPVA 2RCEA 1GJCB 1TPAE 2SGQE 1OKXA 2BQ7B 1LTOA 3LJJA 3PB1E 1QNJA 3RMNH 4CRFA 2H5CA 2Y82A 2Z9LA 1HNEE 4JK6A 1C1OA 1GJ5H 1L4DA 1YLDA 1TPOA 4YXWD 2QXGA 7GCHG 4INHA 4MDSA 1BMAA 1KY9A 2P3FH 2UWPA 3FP6E 2D2DA 3MFJA 4NA9H 2ZU1A 1SLUB 2IN2A 3GDUA 1O3OA 2VVCA 4F4OC 1GBIA 4ISHH 1HDTH 2BOHB 1JRTA 2Y6TA 2FZZA 2C93B 3ZVFA 1XVMA 4H6TA 3RXLA 3TJUA 4YT6H 3LGWA 3W94A 2W6ID 3RXPA 1P2NA 3ATKA 1Q2WA 4MNVA 1NM6A 1UW7A 1GJ7B 4NG9H 1HAOH 4SGBE 3E0PB 1ELAA 3TH3H 2YMSB 3ESTA 1SGPE 1AKSB 5JDUB 3VG8A 4NCYA 1WYKA 2ZCKP 1PPCE 3ATIA 3S9CA 4FUGA 2JH6D 2WPMS 4GUXA 1OSSA 1RD3B 1KXCA 2BVXH 1D4PB 2FS9A 5J4SA 1U6QA 3M35A 3MU0A 1MCTA 1YWUA 2EEKA 3PV2A 2AGGX 1O5EH 1EQ9A 1QRWA 5CHAB 1ANDA 1JIRA 2FTLE 2EQNA 2F43B 2XWBI 3C27B 4FU9A 1H9LB 4NZQA 2QA9E 4NFFA 5C5NA 2V3MA 1O3DA 4AYYB 2ZCLP 1A5HA 1FIZA 1BBRK 3HKJB 4VGCB 4X1NU 1TGCA 1EJMA 3SNDA 3D62A 3RXEA 3CENA 2OC0A 1GI2A 2A2XH 1ZTJA 4U01A 1HAHH 1NN6A 1TRNA 4NWLA 4NZLA 4OS5A 2RDEA 3M5OA 5DKMA 5EU8A 1GI1A 2SGAA 3UOUA 2XC4A 1Z8JB 4Y7AA 1O5BB 4AC9A 2P8OB 1C4U2 4R0IA 2ZDLA 3FFGA 5B6OA 2BDCA 1OWJA 2O8UA 3F68H 1PQ8A 1NY22 1G3BA 4MNWA 2Y81A 1FPHH 4ZXYH 1V2MT 5C1YA 1KMHB 2UWLA 3AASA 4YOJA 1HCGA 1XVOA 2R9PA 4Y76A 1YM0A 5ESBA 5HGGA 2FOBA 1RRKA 1JBUH 1N8OB 4MPWA 2BD8A 1K9OE 2FLBH 1ELGA 2W7UA 2FX6A 4FU8A 2BDAA 3R0FA 1CE5A 1AWHB 1SGNE 2ODQA 1UTLM 2A45B 1L0ZA 3SUGA 1EB1H 4UONA 1YPJH 1TGBA 1HPGA 1O2QA 1OP0A 2HLDD 3GS9A 1YBWA 4HI3A 3ATLA 3QGNB 3VB5A 4DVAU 2ZFTA 3F3BA 3TK6A 4NWKA 1K1NA 1EZQA 1O5DH 3VXEH 2IOTA 2WPLS 1KXAA 2ZG0H 3FVFB 1G3EA 1ZTKA 2C3SA 1GJ4H 1WV7H 1ABIH 4Y7BA 4AGKA 1C1NA 1UO6A 2ZP0H 4RN6A 4TWYA 4PROA 2V35A 2P95A 5EODA 4AORA 4DY7B 2Y5FA 3BTQE 4A1XA 4UFFH 1YYY1 1IQEA 2UUFB 1K1LA 1FN6A 2AMQA 2Z9JA 4NIXA 1O5GH 2OBOA 3H7TA 2VBCA 2VGCB 3P8OA 4TY6A 3JZ1B 3BTHE 5L6NH 1QJ6B 1OYQA 3SGQE 1SQTA 5EPNA 2KX4A 1T31A 1A5GH 4M7GA 1WTHD 2HNTC 1O3EA 1NZQH 4FUDA 3T2NA 3M36A 2ZQ1A 4UE7H 1B0FA 1N6YA 1O5AB 4FUFA 2ZZUH 1RXPA 2TGPZ 2D26C 1LPZB 2FI5E 1AKSA 4X2YA 1P2IA 1NU9A 2VIPA 3GY8A 1KYNA 1GI9B 1AUJA 2BDGA 4FUIA 4ABHA 2O9QA 1BOQA 3RC6A 1IAUA 5F03A 3LGVA 1QB9A 3GDSA 3RXIA 1O2XA 5ETXA 3SU6A 1V6DA 4ABBA 1EJNA 2AH4X 2M2AA 4XDEA 2KR7A 3A7YA 2F9PA 1BBRE 5E2PA 1KIGH 5C3NA 1XKBC 1PJPA 3MU1A 1GHWH 1P03A 1QZ8A 1Z8RA 5F53A 5EXMA 1TQ0B 2H9HA 5A8ZA 1V2RT 1GJ6A 3LJOA 1V2TT 1E38B 1IQGA 1L2EA 4B76A 3KQCA 1DWBH 4X8SH 1G37A 4D7GA 5FX5A 2ZTYA 3TJVA 1MKWH 4Y6DA 3N99A 4A6LA 1GBAA 1O30A 1P02A 1O2SA 4WMFA 1QCPA 3LGIA 1QBVH 2VIVA 3SUDA 3DUXH 1M9UA 2Y5HA 4JCNA 4NA7A 5JPMH 4X1QU 4X6OA 4FOUC 1HJ9A 2F9VA 3H7OA 5E8EH 1A0JA 1EPTB 3LT3A 1AD8H 3F2GA 2OQ5A 5I25A 1ZHMA 2Z9IA 1H1BA 1LHCH 3MH5A 4JYTA 1VCQA 4VGCC 3SJOA 4BXSA 2JETB 2P3TB 3A8CA 1ARCA 4FXGH 3PTBA 2R0LA 4ZXXH 4TSFD 1UVPA 3RXAA 3URCA 1SGQE 5FBIA 2XWAA 5BPEA 3RXBA 1E34B 1ELVA 2BOKA 1GBHA 1BMLA 1C5SA 4JMYA 5KECA 3P8NA 4FUEA 1P2QA 4XSKU 1E36B 4AOQA 1HJ8A 1A3EH 1XUGA 3OE7D 3Q3YA 4SGAE 1ETTH 5DSFA 3UAIC 1A0HB 1TNLA 4GHTA 3OTJE 3RXDA 3ZZBA 2XNIA 3IITA 1BTXA 2AIPA 1FPCH 1P05A 2VB0A 1W8BH 2GCTB 1TGSZ 4BNRA 2QF0A 2WV9A 1YPHE 1HXFH 1GI3A 2GD4B 4IN2A 3TITA 4AG1A 1TBZH 3K65B 4BTUB 5LPFA 4X0WU 1DSUA 1FAXA 1N8OC 1OWHA 2WPKS 3DFJA 3RP2A 1NC6A 3OX7U 3MH7A 1GHVH 1RJXB 1YLNA 4UDWH 2TIOA 3RXKA 1A7SA 2I6SA 1NRPH 2VJ1A 2H5DA 3L3TA 1O2KA 1EZSC 1GHYH 1KTTB 5HM9A 1TYNA 3VB7A 7GCHF 2B8OH 3RU4D 3SZNA 2CF8H 1V2NT 4BTIB 1GHZA 1SGIB 2JH0D 1GI4A 1C2MA 4B74A 3SU4A 1DICA 3G01A 3LPRA 3T27A 2LNCA 2UUKB 3F2HA 1H8HD 5DK1A 1V2ST 3BG4B 4LOYH 1S84A 1TNKA 2FOCA 1LHEH 4FVBA 4CRGA 3F9FA 1T4UH 4RT0A 3KQBA 4MVNA 4CR5A 1K1PA 2O8WA 2ANWA 5AF9H 3K2UA 2VGCC 3BF6H 2AYWA 3LH3A 4Y71A 3TJNA 2OD3B 1YC0A 1BBRH 4X6MA 1KLJH 1MKXK 1P0SH 3PM3A 3BEIB 3BV9B 2CJIA 1HXEH 1H8ED 2WYJA 1C4Y2 1DPOA 1O2IA 3SJ8A 1E1QD 4ACBA 2A5AA 1O39A 4NSVA 2XBXA 4OM9A 1G9IE 1YGCH 5G4BA 2BY7X 2H2ZA 3UPEA 1ZZZA 3U69H 1PYTD 2CK3D 1O2TA 3RXCA 3NRLA 1S6FA 3S69A 3M5LA 5HXFA 5KEDA 3AW1A 2GT8A 2AERH 3KQEA 3LGYA 1C2EA 2FS8A 3LC3A 3F6UH 2Q6GA 1ELEE 3RXGA 2BLVA 5A0BA 5E2OA 3UNSA 1SQAA 2GZ9A 4ZKRU 4DGJA 2YNBA 1NU7B 2F4LA 3A87A 4DIIH 1NRSH 4AN7A 1VJAU 3UWJH 1Y59T 4O97A 1TA2A 1UTKA 2J2UA 3MOCA 3AAVA 2ZIQH 5J4QA 5LPEA 3QWCH 2G4UA 2QN5T 4BAQB 1SL3A 4U30A 4XD7D 1EPTA 1GCDA 3A8BA 3MH4A 2A7CA 3P8FA 4ABEA 1ARBA 1SLWB 5T6FA 1DVAH 3M3TA 4IS5A 2GJGA 1G2LA 1DDJA 1UTMA 3WY8A 1TPSA 1DOJA 1O3PB 4WF8A 1A0LA 4ABDA 1BRUP 1XKAC 2VVVA 2VWOA 2Z7FE 1OOKB 1OXGA 2FYQA 7ESTE 1K1MA 3P17H 1C5YB 3LIWA 1SPJA 2A4GA 2W6JD 1QBNA 3SJKA 8ESTE 3BIUH 4K8YA 2HLCA 2CV3A 4CREA 1ETRH 1C2DA 2WUCA 1HAIH 1LO6A 3RXFA 2ALPA 2KZ4A 3EYDA 1C5MD 3FKSD 2VNTA 2GDEH 2PFEA 4GAWA 1ZGVA 1HAPH 3C1KA 1EPTC 1C5VA 1RS0A 2ZF0H 1QHRB 4A5TS 3BIVH 5C1XA 1NFUA 1C2JA 5JYIA 1FIWA 3M7UA 5EQQA 4ISIH 3ZVDA 3UB0A 5L30H 3M7QA 5T1VA 2FTMA 3RU4E 1X7AC 2G00A 2XRCA 1TNJA 1GI8B 4KKDA 4ZHMU 4KTCA 1GBJA 1Y3VA 2GCHG 4OS7A 4BAHB 1BCUH 5JB8S 1FN8A 3P6ZB 1SGYE 1T4VH 3P70B 1ZPZA 3MQKC 2ZDAH 1TMTH 4E05H 5LPRA 1Q3XA 1MMJN 5GCHG 1O38A 1K21H 1L1GA 4IGDA 5EJLA 1C2LA 1C5RA 3KL6A 1GJAB 3MMGA 1W10U 2XBVA 1MU8B 2FOMB 1K2I1 1UMAH 3KF2A 1T7CA 2PHBA 1CBWC 4HTCH 1BUIA 2BVRH 3ENSB 1EOJA 3RM2H 1C5WB 5C2ZA 5FAHA 2Z9GA 1LQDB 3S9BA 1BJVA 2V6NA 4E7NA 5B6LA 1AFEH 2QIQA 3NCLA 3E90B 1O2WA 3H5CB 4M9FA 5T6DA 2EA3A 1A46H 1EAWA 1Y3YA 3GY2A 4K8BA 1TNIA 1VITG 3HK6B 5C0UA 1KXBA 3F9HA 3SGAE 1IQMA 3AVZA 4IBLH 4JYUH 2A7HA 4X1PU 3ODDA 1BTYA 2GP9B 5EOKA 2LP6A 1W2KH 2ZTXA 1ANEA 1P10A 3EE0B 3MTYA 1FUJA 1IQFA 1J8AA 4ISOA 2HOBA 2HPPH 1NFXA 1O0DH 4ISNA 1O33A 1C9PA 5A8XA 3BG4C 1WUNH 2KM0A 1O2NA 1C1QA 3URDA 3A80A 1EAXA 5FPTA 5IK2D 1KXEA 1AZ8A 3ZZ9A 2FI4E 1J16A 1O32A 4ZAEA 2BY6X 3KHVA 1XM1A 2FMJA 1P2OA 1XXDA 3RXUA 1F0SA 1MTWA 4RSPA 1AIXH 2WSSD 1OWKA 2Y7XA 4X8UH 1HJAC 1C1RA 1GBBA 2Z3EA 3TIUA 1LVYA 1TX7A 3NZIA 3RXJA 3MO3A 4UD9H 2ZEBA 1NT1A 1JIMA 3QO6A 2JKHA 1XX9A 4WXVA 1V2PT 2FDAA 1NRQH 3A85A 2GV6A 3EAJA 3GCOA 3WWBA 1ANCA 9LPRA 3U9AH 3GY5A 1CT2E 1AVGH 4OS2A 1ZJDA 4KTUA 1RIWC 2QF3A 2W26A 4D8NA 2P3UB 2NU1E 4IN1A 3PWBA 2G51A 4K3JA 2F3CE 4LZ4B 1A61H 3UFAA 1CSOE 2FWWA 1T8LA 4KGAA 3PTNA 1RFNA 2F9NA 4IC5A 1CVWH 3TK5A 5A2MH 3UWIA 3VXFH 1O3BA 2QAAA 1UTJA 2K0QA 1J17T 4Z1MD 1MABB 2AMPA 1CA8B 1KTSB 1TQ7B 1W0ZU 1S5SA 1W0JD 2ZFPH 4WVPE 2XBYA 3WW7A 2Z94A 3GCTG 4I33A 4DIHH 3NWUA 1E0FD 2PKSC 2ZDKA 1P11E 1GDUA 3TK9A 4YM9A 4ASHA 2TGAA 4DT4A 2ZI2H 5JBTA 1XUKA 1DY9A 4Q63A 5LGOA 1Y5UT 3E6PH 2JDID 3HGNA 1Z6JH 2BLOA 5DP9A 3ZIAD 1C1VH 5HYOA 2XCNA 2FEQH 1Z8GA 1ETSH 1EATA 3ZZ6A 1IHSH 1GBCA 4Q7XA 1UVOA 3UNRA 1YPHC 2B9LA 3FANA 3MI4A 1D3TB 4GHQA 1HAVB 2BHGA 4HG6A 4K69A 4ESTE 2OUAA 1YKTA 1ESBA 1A1RA 3OEED 2QXHA 1WQSA
chains in the Genus database with same CATH topology
3QTVH 1BHXB 2VH0A 2ZA5A 1LQEA 1O3LA 4WJG2 2ZDMA 5K0HA 2F9UA 1ELBA 1EAIA 1DY8A 1HGTH 2WV5A 1SFIA 1NPMA 3S7HB 1C4V2 3SUEA 2HVXA 2GZ7A 1GDNA 4DT7B 3TGKE 3B9FH 3V0XA 1MKXH 3TGIE 1CGIE 1P12E 2M5TA 4B1TA 1DFPA 2ZPQA 3ZYDA 2P93A 3KGPA 5T3HA 1XUIA 4IW4E 1C5TA 3IG6B 3TVJB 1ZSJA 3BTFE 3HK3B 3NXPA 1G3CA 4FU7A 1DWEH 1LVMA 1GPZA 4DG4A 2Z3DA 1V2KT 3NKKA 1V2OT 1TONA 2PLXA 5C20A 1S85A 4FUHA 1MBQA 4CH2B 2J4IA 1BTHH 1G30B 2XTTB 2C8ZB 2Q6FA 2C8XB 2ANYA 1PPFE 3QX5H 4FVDA 3O8DA 1V2QT 1SGRE 2STBE 3RM0H 3ZVEA 1F5LA 4H4FA 1GI7B 1C1UH 2VIWA 2ULLA 3L33A 2ANKH 1GBDA 3CS0A 6LPRA 1WAYB 1O2ZA 3FZZA 4K1SA 3A7TA 2VWNA 4YZUA 3S0NA 2QV1A 1QIXB 3PLPA 1V2VT 1K1JA 4K5ZA 1MUEB 2G5NA 4IMZA 4BXWA 1SOTA 3ZZCA 2GDDA 3M3SA 1PPEE 1SG8B 4Y8ZA 5E0JA 3P92A 2FIRH 3STIA 2J9NA 2FOAA 3PROA 4DCDA 3SNCA 1DWDH 2XW9A 3B23B 5FPSA 3SI3H 4B2BA 1TX8A 1O3HA 1C2HA 2FESH 4B2CA 4DJZB 2O8MA 2H9TH 2TPIZ 3HGPA 3AAUA 1LMWB 1FZZA 2GGVB 3B8JA 1OYTH 3MWIU 3QTOH 1J15A 3L6PA 3GDVA 1IQKA 4TPYA 2R2MB 3PLBA 1SHYA 1FJSA 4BOHA 3E0NB 4CRBA 3T26A 2BD4A 2G81E 4LK4A 5EQSA 4X1SU 4Z6AH 2IPHA 4A92A 4DW2U 3PMHB 1ELCA 3KIDU 3A82A 1EASA 1KLTA 3KEEA 1EAUA 3A7XA 3N7OA 1DITH 1QURH 2PW8H 2WYGA 2SGFE 1EKBB 3O8RA 3RC5A 2ZFSA 3SBKA 1QBOA 1GBEA 3T25A 4ABIA 4LXBH 5A8YA 1GMHG 1FY3A 1T8OA 1YPKH 2A0QB 1F0RA 3BEFB 3LH1A 1ELFA 1TALA 4ZROA 1O3JA 2VIDA 3MU8A 1TIOA 3HKIB 5FXLA 3LU9B 2A4OA 5DO4H 1GBMA 1TWXB 1BTWA 3UQVA 2VH6A 1FY1A 3KCGH 2OLGA 1UK3A 2ILNA 3I77A 1O2UA 2GCHF 1T8MA 4Y10E 1HAVA 4RKJB 1ZR0A 4DOQA 1DANH 1N1LA 1ZPCA 1THRH 5GCHF 5DPAA 2BD7A 3UNQA 1L1JA 2FOHA 2F9BH 3GYLB 2UUYA 1MD7A 4I32A 4YLUA 1V2LT 5JB9S 1MU6B 5DGJA 1GWAA 2BD5A 2BDYA 2LPRA 3RXVA 3TNSA 2B7DH 2GX4A 1EP6A 4OGXA 3U98H 2Z3CA 1VCWA 5HM2A 2A5IA 1YPEH 3LGUA 1FV9A 3PO1C 3P95A 1AFQC 1B7XB 4ABJA 1J14A 1UVSH 5EG4A 4Y0ZE 2PGQB 3SU5A 1SSXA 8KME2 5E0HA 2VIQA 2V3OH 4A1VA 1W11U 2NU4E 4OS4A 4AFZA 1VITF 4H42U 1ESAA 2EI7A 1CU1A 1ZMLA 2BLWA 2PR3A 2ZDNA 3RDZA 3F9GA 1GHXH 1W12U 2PWXA 3BTGE 4AFSA 4Z0KA 1CBWB 4B71A 2Y80A 5F8ZA 1C1PA 1O2RA 4KP0A 4JYVH 2RA3A 1D9IA 3A84A 5BRRE 1PYTC 1B5GH 2FOEA 2ALVA 1C5XB 1DLEA 2JH5D 1MTUA 2XCFA 1H4WA 6ESTA 2EC9H 4WXIA 3UY9A 1HV7A 1BRBE 2V3HH 3TPIZ 1QL9A 2ASUB 2F91A 2O8LA 2ZDVH 2ZPRA 3M61U 1Z6EA 3VFEA 2CGAA 1P09A 1K28D 5SGAE 1ZHPA 4GLYA 2R3UA 1OWIA 2PUXB 1SVPA 4OS6A 2G8TA 1C9TA 1SGFA 3A81A 3VEQB 2XBWA 1O5FH 2EI8A 1N6XA 1THPB 1T32A 1S0RA 1VR1H 1AN1E 1UTPA 1DSTA 3E1XB 1TMBH 1C5ZB 4BTTB 4I8GA 1O5CB 2QGRA 1DUEA 1TBQH 1CT4E 1AGJA 4KELA 1P3CA 2BD2A 2AEIH 3FAOA 1GGDC 1HLTH 1GI5A 3SU1A 4I8HA 1E35B 3U8OH 3TNTA 1HJAB 2HNTF 3E8LA 1G3DA 2R0KA 5HMAA 3GOVB 2BB4A 2BDHA 2VVUA 3RMOH 2ZCHP 5GIBA 3DFLA 1MTNC 2FOFA 1FY4A 3M7TA 4AG2A 1C2IA 3Q3XA 2ZKSA 2B0FA 3SI4H 3GCTF 3PMBB 2ZO3H 4QT8C 1CHGA 2G52A 3LONA 1SMFE 1RIWB 2HALA 1TNHA 3ATMA 4X1RU 2J94A 1ZSLA 1FXYA 4D7FA 1XUJA 1FI8A 3R3GB 4A7IB 2ZC9H 5DP6A 1TRYA 1IQIA 2DUCA 1UHBB 3M5MA 1C2GA 1TLDA 1HYLA 1KSNA 2TBSA 2ZU2A 5T6GA 3RC4A 5C1UA 2FOGA 2PSXA 1TBRH 1GVZA 1QA0A 2WINI 1EZUC 1ZLRA 3RU4T 4YTAA 2BZAA 1Z7KA 2SGDE 2R2WU 4BAOB 3GCHC 3Q76A 3V3MA 1F0TA 3EDXB 2CN0H 1NO9H 3TJOA 1K1IA 2PKSB 2DE9A 1W0YH 2PUQH 1NFWA 1XUFA 1V3XA 1BIOA 5GPIB 4XBDA 1AVWA 2ODPA 1O2PA 2HPQH 3ZZ8A 3V7TA 4AB9A 4E7RG 2ZHWH 2BX3A 1C5QA 2NU2E 5GXPA 2AGIX 2QYIA 1PQ7A 1VGCC 2ZGXH 1BTPA 1ZMJA 1Y3WA 3UQOA 1AMHA 1F2SE 1C1SA 4K60A 1SHHB 1AZZA 2KAIB 2I6QA 1GHAG 2XC0A 5A09A 1CQQA 1D3DB 3RLWH 1MZDA 3GISB 5E0GA 3ZYEA 4INKA 1CGJE 3RXQA 2H1UA 2GVFA 5L2ZH 1TE0A 3D65E 3ZZ4A 1AU8A 1OS8A 1P2MA 1WQVH 1ZMNA 2W3IA 4GPGA 1AHTH 1VJ9U 4ZUHA 4MPXA 3M3VA 2WPIS 5IYTA 1H8DH 2FXRA 2OINA 1ABJH 2GZ8A 3E91A 1ID5H 2OBQA 1TGTA 3MU5A 1HIAB 3P8GA 2V0BA 4J2YB 1AE8H 2PGBB 2XC5A 3EA7A 4D9QA 1BHXF 1AQ7A 1GVLA 1ZGIA 1T8NA 5A0CA 2ZPSA 4JZIA 1SB1H 2AFQB 1ZRKA 2DE8A 2ZNKH 4XFQA 1O37A 4KTSA 2ZFQH 3JZ2B 3GY3A 4HZHA 1LHGH 2A5KA 5AFYH 1VITH 3ZVGA 4B75A 1O35A 1GMCG 1RTFB 4UFEH 3MO9A 2J95A 3FP7E 2ZQ2A 5TCCA 4D76A 4FUCA 1P57B 1L1NA 1IQHA 3ZZ5A 2THFB 2ZU5A 1UVTH 3A8AA 3QUMP 3S7KB 4WH6A 1O3FA 1SGEE 3TU7H 5DP8A 1WTGH 1FONA 2Q1JA 1HAYB 3Q77A 3PMAB 2CMYA 9ESTA 4RKOB 2QCYA 1S83A 5K7RA 5C67A 1BRCE 1NS3A 3CP7A 5PTPA 2VU8E 1P2KA 3V13A 6CHAC 1C5UA 1INCA 2QY0B 1QJ7B 1LHDH 1GMHF 1NESE 1AB9B 1C2FA 5FCKA 1ZRBA 2FM2A 4AYVB 4TPIZ 1SOZA 2BQ6B 2FYRA 5JBCS 2VWMA 1LVBA 2BXTH 1NFYA 5F8TA 1MTVA 2SNWA 1GCTC 1BT7A 1XMNB 4AFUA 5CMXH 3PYHA 2OCVB 4NGAH 5H4IB 2PTNA 2TRMA 3I29A 2HRVA 3RMLH 1A4WH 1UHBA 3EA8A 2ZTZA 1CHOG 4O9VA 2GT7A 1ZTLA 2A31A 5FBEA 5EGMA 4HFPB 4AX9H 2ZWLH 3BSQA 1TGNA 2C4FH 1EJAA 1EUFA 1YCPK 4GVUA 4NIVA 1NROH 4ABAA 1FLEE 3UOPA 1TPPA 4CRDA 3SV9A 3IWMA 4K1TA 5C5OA 2CXVA 3SQEE 2HWLB 1O3MA 3MNCA 1UCYH 4INLA 2GKVE 1MH0A 3M37A 3ELAH 1SGDE 5FCRA 2A1DB 4IC6A 2SFAA 3OYPA 3SNAA 1MQ6A 2ZU3A 3D23A 1PPZA 3GY7A 1G2MA 1QJ1B 1WOFA 3SHCH 2KAIA 1Y3XA 1CT0E 1C5NH 3BTDE 1RGQA 1Y5AT 1TX6A 2A32A 3QZQA 1BTUA 6GCHG 1BQYA 8GCHG 1Y8TA 1HAZB 3MHWU 1GBFA 3UREA 1TNGA 3UUZA 3SNBA 5EXNA 8LPRA 3MU4A 3ODFA 3PO1B 5FX6A 5DP5A 1AFQB 3SORA 1MCVA 3TGJE 1YP9A 4UFDH 2F9OA 3U8RH 3DHKH 3GCNA 2BDBA 1DS2E 1TABE 1S6HA 3SV8A 3LGTA 4K2YA 1F0UA 1K22H 3LDXH 1HIAA 5DJ7A 1S82A 1EB2A 4MQAA 1G32B 1A3BH 2O8TA 4CR9A 2AS9A 3S9AA 2ZFFH 4OGYA 1GL1A 1TMUH 2A7JA 2K1QA 1P8VC 3TH2H 1O2OA 1O2MA 3VGCB 3ZV8A 3ZVAA 4ZHLU 4JZFH 4UFGH 2FO9A 4JZEH 5ABWA 3VB3A 2CHAC 3V12A 1SGTA 3ZVCA 2BY5X 1GJ9B 3EGKH 1HAGE 1O2VA 1D3PB 1P9UA 2Y7ZA 1F7ZA 3W95A 1UVUH 2HGTH 1PQAA 1OP2A 4FUJA 1OWEA 1C1MA 3Q3KA 1GG6B 3QDZB 2BY8X 1GBKA 4JZDH 1V2JT 1MD8A 4AFQA 2BLQA 1AI8H 1BTZA 2XYAA 1PPHE 2FI3E 1FNIA 1O3KA 4B73A 1GJBB 1AE5A 1ZOMA 2A4QA 2RG3A 1H9IE 2GMTC 1DM4B 2R3YA 2ZGJA 1WU1A 1B0EA 4Y8YA 1LKAA 1NTPA 4Y0YE 3KQDA 3RXRA 5FHTA 4Y11E 4X2XA 2G5VA 2QC2A 2Z6BD 1ESTA 1SGCA 1ANBA 3EQ0H 1GGDB 1W3CA 1Z71A 1PPGE 1QQ4A 1RTKA 3RLYH 2FPZA 4GCHG 4CHAB 4OS1A 3SV6A 3PMJA 3LOXA 3BN9A 1OX1A 1UK2A 1MTNB 2P94A 1C1TA 1D6WA 1DUAA 1UK4A 3A7WA 4F49A 1QA7A 4ZMAH 3NK8A 1DWCH 1GHBG 4YOIA 4Q80A 4YLQH 4UEHH 4ZH8A 2GV7A 1MTSA 4MTBA 2BZ6H 1ZYOA 3SNEA 1L4ZA 2ZU4A 2NU3E 1TRMA 1AB9C 4E06H 1VZQH 5DG6A 1GMDG 1P2JA 1QL8A 3FZDA 1ELDE 1KXFA 5EW2H 4NIWA 3CS7A 2W5EA 1GJDB 2YOLA 4O03A 1IQNA 4MLFB 3RUOA 3QK1A 2BXUH 3TH4H 2P59A 2OTVA 1MQ5A 4J1YA 3A89A 5DP7A 3O8CA 1S0QA 2NWNA 2UUJB 4MNYA 4YO9A 1GHAF 1PQ5A 1HB0B 1FY5A 1DX5M 5EPYA 2RA0A 4R8TB 1HBTH 1FY8E 3GCHB 3ZVBA 3DA9B 2VINA 2OXSA 3GY4A 1OWDA 3SHAH 1JMOH 1Y3UA 3FP8E 4JZ1A 5GWZA 1TAWA 1O2GH 1O34A 2BVSH 2H6MA 4U2WA 2J34A 5CE1A 4AB8A 1Z1IA 1QY6A 1SQOA 4X6NA 1O3IA 1FAKH 3RXOA 1ZPBA 1GVKB 2A2QH 1OP8A 5DP3A 1HAXB 1VGCB 3SU0A 1LCYA 1E37B 2CF9H 2WPHS 2FX4A 1AWFH 2H9EH 1IOEA 2ZGBH 2AMDA 3TLOA 1SGFG 3SUFA 2OC7A 3SQHE 3UIRA 1JXPA 2XXLA 2C90B 4I31A 2Y5GA 3T28A 4TWWA 3MO6A 1FMGA 1Z1JA 1AO5A 5IDKA 1A5IA 4O3UA 2PSYA 7LPRA 3HPTB 1QR3E 1O3NA 3MNXA 5A0AE 3BTEE 3SO3A 1AUTC 1DE7H 1GMCF 1LVOA 1QRZA 1LPGB 1TOCB 3QLPH 3MH6A 1QTFA 1YLCA 3ITIA 2QXJA 4X8TH 4FUBA 3VB6A 1W14U 5CHAC 4WWYA 3OY5U 1SLXB 3T5FH 2GTBA 1A2CH 1G36A 2ZHFH 4XBCA 2ZHQH 4BAKB 4ZKOU 1UJ1A 1BDAA 2YNAA 3SU3A 1O2LA 1P01A 3SGBE 3NUMA 3BTWE 3UTUH 1UCYK 1SLVB 7KMEH 3SU2A 1IHTH 3BTME 1CA0B 3GICB 2FP7B 3U1JB 1UTNA 2B5TB 2F83A 3BG8A 3U8TH 3RMMH 1Y5BT 4Q7ZA 3ZZAA 3F9EA 2P8OC 1BRAA 1W13U 4X2WA 3VGCC 3K9XB 2SGPE 4X8VH 1IQJA 1K1OA 4GSOA 3ZZ7A 2BMGB 3OU0A 3KN2A 5L2YH 4WMDA 1YCPH 1GI0A 5TJXA 4LZ1H 3OY6U 1ELTA 3I78A 2W3KA 2FODA 3RXTA 5DP4A 1KLIH 2A4RA 1JRSA 1QQUA 2G4TA 3LKWA 1MAXA 2RDLA 2VWLA 2OC1A 1P3EA 4CRCA 4ABFA 1GG6C 1CHOF 3K6ZA 1MAYA 5I46H 1C5LH 1YF4A 2WV4A 3OSYA 1SR5C 3MNBA 4ZKNU 2OQUA 1BB0B 3VPKA 6CHAB 3MNSA 1CGHA 3GY6A 1O2JA 1F92A 1LPKB 4D9RA 4XE4A 3SOSA 1O3GA 1W7XH 4CRAA 5F6MA 3SN8A 2EI6A 1TB6H 2BM2A 4MPUA 1LDTT 1GCTB 1QB1A 5ESTE 2BD9A 1ACBE 4YT7H 1C1WH 4YOGA 3T62A 4AGJA 1BZXE 4AZ2B 2PV9B 2WPJS 1OPHB 1HFDA 1YPMH 1W7GH 1AY6H 2ZFRH 1VCPA 3O8BA 3DT0H 1GL0E 1THSH 1KDQB 4CHAC 1DXPA 1WSSH 2PKAB 1TA6A 1P06A 2Z9KA 1NRNH 3QGJA 4NIYA 1EXFA 5TCAA 3STJA 1GBLA 4JK5A 1BJUA 5JBBS 1H8IH 3A8DA 1MBMA 2NU0E