2CV3A

Crystal structure of porcine pancreatic elastase complexed with a macroclyclic peptide inhibitor
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the complex of porcine pancreatic elastase with a trimacrocyclic peptide inhibitor FR901451
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Elastase 1
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2cv3A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2cv3A01
1CA0C 1O2XA 1ZPCA 4FUHA 4CH2B 5JYIA 3SUFA 1HBTH 1O2QA 5DGJA 1OKXA 4PROA 3I78A 1JMOH 4YOGA 4K2YA 4OS2A 1Y5UT 5FHTA 1CA8B 3S7KB 2ANYA 1O3HA 3MNCA 1LPZB 1N8OC 4M7GA 1NTPA 2F9UA 1FMGA 2A7JA 3BTME 1SFIA 1XVOA 3TH3H 2PHBA 1C5WB 1FUJA 2OTVA 2GZ9A 2KAIA 2O8UA 4YT7H 1H8IH 2AGEX 1FY8E 4RKOB 1GBMA 4ABIA 1NN6A 4LK4A 5GIBA 4JYUH 1DANH 2H2ZA 2FLBH 2VGCB 1WTGH 3BTHE 1E35B 5A8XA 1EJAA 1W14U 1O2MA 1S84A 2FOFA 1FJSA 1KXAA 1ZMNA 3A86A 4MTBA 2GCTC 2Z9LA 4B71A 3JZ1B 3EA8A 1TMUH 1Y3VA 3R0FA 1S83A 5EQRA 1MQ5A 1W2KH 1QB9A 5DK1A 2BD4A 5F6MA 3TGKE 1ETRH 2HNTC 1G3DA 4DVAU 1F0SA 2BDYA 4KKDA 1C5OH 3UY9A 1EJMA 4BAOB 2XC5A 1C5TA 3SJKA 3PM3A 1FLEE 3VB7A 1P10A 2BOHB 3SV9A 2GT7A 2ZHQH 4MPUA 1O3CA 1IHTH 2G81E 2ZU2A 1BTUA 1E37B 2BHGA 4BNRA 1RRKA 2ZDAH 4JK6A 4NFFA 1G36A 2A4OA 3BIVH 2ZTXA 1L1GA 1NT1A 4Q80A 3RC5A 3VGCC 4IW4E 4Y0YE 2ZGXH 2BDIA 1O2KA 2Y80A 1SOZA 2Y7XA 3RXLA 3VB5A 4DY7B 1XUHA 5LPRA 1THRH 3ODDA 1UTNA 1T4UH 3O8CA 1MQ6A 3DA9B 3LDXH 2FEQH 1KLIH 1TNJA 4K69A 2HWLB 4I8GA 1Z1JA 7LPRA 2ZFFH 2ZGJA 1F7ZA 1TGTA 2ZHWH 3A82A 3MO9A 1V2JT 1ZTKA 3GY5A 2XCFA 1A5HA 1O34A 4YT6H 2OBQA 5DP9A 1YLDA 2OUAA 1YGCH 1HAGE 1DPOA 2Y6TA 4CRBA 1BHXB 5JPMH 2A4QA 4GAWA 4ZHAA 4A7IB 1GMDF 3R3GB 4U32A 5IYTA 3SQHE 1TE0A 3K9XB 3TH4H 1Z8IB 1BMAA 2Y81A 1SLXB 3SU1A 3SV8A 4CRGA 3ELAH 1MCTA 2ODPA 1XUJA 2P95A 3IWMA 1T32A 4VGCB 4Y8XA 1AU8A 1O2VA 1O3KA 1H9IE 5IDKA 1BTXA 1ZHMA 3BTGE 4AFZA 3KGPA 2ZGBH 4JZIA 1QRWA 3EAJA 1GMCF 2C8YB 1K2I1 3OTJE 2EI7A 1TX8A 1J16A 2AMPA 3SUEA 4D8NA 2HRVA 1MKWK 2SFAA 3NZIA 4BXWA 2W7SA 1P2MA 1NRRH 2BYAX 4WH6A 5JBCS 2BLOA 2LNCA 1EZUC 2OC7A 2QF0A 2AMQA 1O5BB 1TNHA 2B5TB 2O8MA 2VH6A 4D9RA 4R0IA 4I33A 2A7HA 2F9NA 1EOLA 1DUAA 1FNIA 2W7UA 2SGQE 3RXAA 1IQEA 1O2PA 2FI5E 2ZC9H 1WQVH 3OYPA 4OS4A 1EB1H 3MU1A 5TCCA 1SHYA 5JBBS 5GXPA 2XW9A 1G3BA 1TNIA 2ILNA 1CGHA 5C1YA 3RLWH 1GMDG 1L4DA 2BB4A 1Y3YA 3S0NA 1C4V2 3U8TH 3HATH 2A4GA 1WCZA 3BTDE 5L30H 4A1TA 1EAXA 1FY1A 3M5NA 1BQYA 1T8NA 2R3YA 4ISNA 5FPSA 2XYAA 1IQLA 1DX5M 1SMFE 7GCHF 4NIYA 3ATLA 1NM6A 3OY5U 3LGYA 1P3CA 3MYWA 3BEFB 1N8OB 2I6SA 3MH6A 4B2AA 1EP6A 1HAVB 2BM2A 3P95A 1FN8A 3UUZA 2ZF0H 3TGJE 1ORFA 2AFQB 1K1OA 2VIDA 4NZLA 1LHGH 3RMOH 1AKSA 3L6PA 1C1PA 1XMNB 2GV6A 4FU7A 2QXGA 4NIWA 4INKA 1J9CH 1C2MA 3BTWE 1G3EA 4NA9H 4Y71A 3H7OA 2WYJA 2FX4A 3QZRA 1CQQA 6ESTA 1GBCA 2UUYA 1O33A 1P04A 4XBBA 1GDUA 1GVLA 1AVWA 3NPSA 3RXBA 4U01A 4ZHLU 1H9LB 4I31A 2ZCLP 1MBQA 1K1MA 1QHRB 1SSXA 1BDAA 2XWAA 3UWJH 1C1SA 3EA7A 1P57B 1QGFA 3QGNB 1MBMA 1IAUA 1K1LA 3PO1B 3SJOA 4E06H 3H5CB 2EA3A 1A46H 3U69H 1S5SA 1ZYOA 2ZDKA 3BTEE 1TNKA 1AB9C 4A6LA 1P2OA 1EASA 1IQFA 4TYDA 4MG3A 2ANWA 3D49H 1DDJA 1UVUH 4OGYA 3U8RH 2A7CA 2GGVB 2PKSB 5AFYH 2BD5A 1VITF 1O3DA 2ODQA 3KEEA 1LPKB 1OS8A 1Z8JB 1MKWH 2QN5T 3SU3A 4I7YH 3SBKA 1ANEA 3GY3A 1PPEE 1AWHB 2WPHS 4Y10E 2W5EA 2PTCE 3KCGH 5ESTE 3RXJA 2QA9E 1DWEH 5I25A 2VWMA 2FWWA 2VWNA 1UJ1A 2BD9A 2ZPSA 1QL8A 3VXEH 1EQ9A 3V7TA 1OYQA 1Z6EA 2HNTF 1YC0A 3E0NB 1ESBA 2Z3CA 3GCNA 1ELDE 5E2PA 4FVDA 4OS7A 1E36B 4ABBA 5GCHG 1TABE 1D6WA 2VIOA 2NU2E 2ZZUH 3URDA 1GJBB 4X2YA 1W0YH 4OS5A 3KQEA 1RS0A 1HV7A 2OC0A 1ZTJA 2BY9X 1GHVH 3F9GA 1MZAA 1A0JA 3A8DA 2ZDLA 1TWXB 4DGJA 4QT8C 4CRAA 1Y8TA 3ZZCA 1W0ZU 1S82A 2JETC 2W3KA 4UDWH 2G4TA 1CU1A 5FBEA 1ZR0A 2G55A 1EXFA 1UTJA 4RKJB 5JDUB 3TJVA 1F2SE 2G52A 4Y11E 5EPNA 1GHBG 1BRUP 1XUKA 2A5KA 2XC0A 3NCLA 1C2GA 3VGCB 1JOUB 1C9PA 1W7XH 1QURH 2GT8A 2H1UA 1O5GH 4ABFA 2FDAA 1WUNH 4Y8YA 4BOHA 5B6OA 1ZPZA 3E6PH 4X2XA 1N6XA 1DXPA 1LKBA 5DP8A 3T25A 1A5IA 3ZVAA 4MLFB 1J17T 2BZ6H 8GCHG 3A7WA 2BDCA 4YO9A 3HK3B 1ZHPA 3MO6A 4OGXA 1QFKH 2THFB 1W12U 2GX4A 1MTSA 4GPGA 3PMHB 1TPOA 1LVOA 2OBOA 3A7ZA 1YCPK 4OS6A 3UNRA 4AZ2B 2BLWA 4K1TA 1DWBH 4Y0ZE 3ZZ8A 4LZ4B 4ZHMU 1SGCA 2GKVE 1QJ6B 1C5NH 1O2TA 2FMJA 1FPHH 3UNQA 5C5NA 1O38A 1CA0B 1JXPA 1TB6H 1NESE 1C2IA 1O3FA 2ZU5A 2BVRH 3TGIE 4R8TB 4KTCA 5H4IB 2PUQH 3RXSA 1DXWA 2FODA 5DP4A 1F5KU 1BZXE 5EXMA 3M3VA 2GCHF 2XTTB 1O3AA 1A5GH 1O2LA 4MNXA 1C1MA 1GBIA 1SGTA 2Z3DA 4B73A 1EATA 1EUFA 1TIOA 2V3HH 3E91A 1PPGE 1CO7E 3K6ZA 3KQDA 4ISIH 5A8YA 2AEIH 1O2OA 4FUFA 2PW8H 5GPIB 1P2QA 1DUEA 1C1TA 3HK6B 1NRNH 2JH6D 1U6QA 3HGNA 4FUGA 1AHTH 3MWIU 5AFZH 2B7DH 1DS2E 1O2WA 4BAHB 2BDHA 7KMEH 1QR3E 4JYVH 1C5UA 1SHHB 1HXEH 1HAHH 2WPKS 1SC8U 4ZKSU 1SG8B 1FV9A 1HGTH 4D7GA 1P03A 1HJ9A 2XBWA 2SNWA 4CH8B 1TX7A 3T62A 2OD3B 1O36A 1LCYA 1C5RA 1GG6C 1MU6B 3RU4D 1O3IA 1GL0E 2RDLA 4DIHH 2ZGCA 2TBSA 1BT7A 3B23B 2BXUH 3TNSA 1O3MA 3PLKA 5E0GA 1MCVA 2ZGHA 4MVNA 4CRCA 1C4Y2 1S0RA 2FIRH 2CF9H 1CHGA 1TBZH 4WY3A 3C27B 2NU3E 2H9EH 3ATIA 1ARCA 1LVMA 1GBLA 3A8AA 4ISOA 2B8OH 3SV6A 3VB3A 2ZG0H 2P16A 3SHCH 4AOQA 1CGJE 3QTVH 2SNVA 2ZEBA 3RUOA 1XX9A 2PKSC 2ZWLH 5A8ZA 5EW1H 1OP8A 3MNXA 3QUMP 4HTCH 4DOQA 1O3OA 1PFXC 1TGSZ 1QNJA 4A1XA 1BTPA 1FIZA 4CHAB 1A2CH 3BTTE 3BG4B 3HPTB 1AZZA 4Y76A 1TONA 2PKAA 3O8BA 3A8CA 1JRSA 3SNAA 3RXRA 5GDSH 4K3JA 4IS5A 2F3CE 5DP6A 1C1UH 3TIUA 1SGDE 1H8DH 1V2VT 4BTIB 1J8AA 1CVWH 1KIGH 3S69A 1B0EA 1L2EA 1HNEE 3QZQA 1Z8GA 1AN1E 3RM2H 5C2ZA 4JZEH 1Q31A 2CV3A 3GYLB 2FOMB 3SZNA 1C5ZB 1O5DH 3H7TA 2J9NA 1ABIH 2IOTA 1F0TA 5JB9S 2C90B 1FI8A 3A89A 1DY8A 4NCYA 1GJ9B 2BD8A 3GY2A 3HKIB 3TK9A 2PFEA 1BRBE 2Y5FA 1SGRE 1UVTH 4AYVB 1AB9B 4NG9H 3GY7A 3TH2H 3MNSA 2XBXA 3VXFH 1YP9A 5SGAE 2Z3EA 2AMDA 1N1LA 2PLXA 1ACBE 2YNAA 3GOVB 3RP2A 4JMYA 3E90B 3V13A 3M36A 3DHKH 4CHAC 3LGWA 2GVFA 1KXFA 4Y7BA 8KME2 3V12A 2BDGA 4XOJA 3ODFA 1HAPH 2ZHEH 1SLVB 1BCUH 3SUDA 1MD8A 2XBYA 1QRXA 3Q00A 3ZVEA 1N6YA 4THNH 1UHBA 1VGCB 4IBLH 4ESTE 5T3HA 2K1QA 2BQ6B 3RXEA 3QN7A 4DURA 3MU5A 3ZZ9A 1SQOA 4ISHH 4RN6A 1VCPA 2BD3A 4I8LA 1PQ5A 3SOSA 2BX4A 3PV4A 3SQEE 1TPPA 3QGJA 2UWLA 2FTMA 5EU8A 2BD7A 3NXPA 5HM2A 1W13U 1AD8H 4K8YA 2AGGX 1T8MA 3RXGA 3BEUA 1AFQC 3ZVCA 2EI6A 2GV7A 5HM9A 3F68H 4B75A 1G2MA 4TWWA 2BD2A 3F9EA 5C1UA 1WU1A 2ZFRH 4AB9A 2GMTB 1ZMJA 3BTFE 1BTWA 3T28A 1S85A 4O3TA 1ETSH 1RGQA 1TMBH 1AWFH 1LHCH 2JETB 5DJ7A 1MTNB 3ZYEA 3MH7A 1P11E 3L33A 1TFXA 4GHQA 2W3IA 4AG2A 1GCTB 1NRPH 4NSYA 3ZV8A 3QTOH 3PTNA 1PYTC 5F03A 1SVPA 3SHAH 1SI5H 1SGYE 1F5RA 1EKBB 3EA9A 1MKXK 2AH4X 1D6RA 5T6DA 2J95A 1W11U 5AVDA 3LJOA 2BDBA 5C20A 1TOMH 4K8BA 2GTBA 4ZMAH 2H9TH 4ABJA 1YPGH 1MH0A 1ZZZA 1Y5BT 5A09A 1XUFA 2ASUB 2V6NA 3SO3A 3LPRA 1NFYA 3RXDA 1GDQA 1WAYB 2WV4A 1HFDA 1GBHA 2UWOA 1GJCB 4HFPB 1YPMH 1YF4A 4NWLA 4H4FA 2BY5X 1GI6A 1NFWA 2OQ5A 4BTTB 1C2LA 1VGCC 1D3TB 3RLYH 3ATWA 2VH0A 3P17H 3ZZ3A 2KAIB 4MDSA 1VR1H 2G8TA 3A8BA 3K6YA 3GY8A 2O8WA 2ZQ2A 5F8TA 1MAYA 2TRMA 1GBKA 2OQUA 3KL6A 1SR5C 2OINA 4HZHA 3U9AH 4IC6A 2ZIQH 2O8TA 4FUBA 2F9OA 4IN1A 2YNBA 2A31A 3LH3A 1UTQA 4H6SB 1P2NA 2R2WU 4X6PA 3EQ0H 5HXFA 2HPQH 4INLA 3TPIZ 2HALA 2A4RA 3SGBE 1W10U 4H42U 4D76A 1L1NA 2LPRA 4KELA 1H1BA 1OYTH 2ZI2H 5JB8S 1C4U2 1QBOA 2ZCHP 3BV9B 1AO5A 4JYTA 1OWIA 3GICB 5CHAC 3RXUA 1QIXB 2FXRA 1GI8B 3SU0A 2ZDVH 4XFQA 1KDQB 1T4VH 1OSSA 2O9QA 1QB6A 3S7HB 2SGDE 2FLRH 4DJZB 1HYLA 2XRCA 3GCTF 4ABHA 1GDNA 1IQNA 1O2NA 1QY6A 1QL7A 4AX9H 2ZPQA 1OOKB 1GJ8B 1KTTB 1L0ZA 3RXTA 1O3NA 1D3QB 3MU0A 3ZZBA 4AG1A 1A3BH 2J38A 4VGCC 3VEQB 1V2KT 2DE8A 4XE4A 1GGDB 1C2FA 1TNLA 4ZROA 3UREA 4U30A 2ZHFH 3QX5H 2BY7X 2TPIZ 4KTSA 4X1RU 2R0KA 1DLKB 1EPTB 1P05A 1O5EH 5EPYA 5F8ZA 5TJXA 1NRQH 3MH5A 2AIPA 1RXPA 1GI0A 5DKMA 3ZZAA 1DITH 1TYNA 5FBIA 1AY6H 1O2UA 2FOCA 2J92A 3F1SB 1JIRA 5CHAB 1AGJA 3UR9A 2H5CA 1V2MT 4MPVA 3SGQE 4I8JA 3Q76A 2QYIA 4BAMB 4Y8ZA 2Q6DA 3BSQA 1PPZA 1P8VC 1CHOF 3F9FA 1IOEA 1GWAA 4YLQH 2CHAC 4AGJA 1KY9A 1XVMA 1TGNA 2ZU4A 4NA7A 3ENSB 1SOTA 1WOFA 1XUGA 1KTSB 1GJ7B 1O2JA 2BTCE 2NU0E 5AF9H 2ZU1A 1YPHC 1DWCH 2VU8E 1W8BH 4IC5A 2IN2A 3E8LA 1V2LT 3BG8A 1O5AB 1UK3A 2QXIA 2WUBA 1F92A 2SGFE 3TU7H 3GY6A 4CR5A 3PWBA 3PLPA 3C1KA 5EXLA 5T6FA 4BAKB 4CBOA 4MPWA 2C8WB 2BDAA 4FXGH 4U2WA 3O8RA 1UHBB 2HNTE 3B9FH 2Z9JA 3EGKH 6LPRA 3SUGA 1PQ7A 1QQUA 1ZJDA 3BTKE 1GBAA 1QJ7B 4X2VA 1FQ3A 3RXMA 4X8UH 4GVUA 1H9HE 5CE1A 1D4PB 4MNVA 3ZVFA 4YESB 1ANBA 2FOGA 3JZ2B 3AASA 1PPCE 1P09A 3PROA 1DE7H 2ZFSA 2QC2A 1O2ZA 5JBTA 1HAIH 1V2TT 2BXTH 1EAUA 3GDVA 1T8OA 4X2WA 1AFQB 2VWOA 4Q7ZA 3RXHA 1NU7B 3RC6A 6GCHG 2C3SA 2H5DA 4ZKNU 1OWKA 1FY4A 1NRSH 1AKSB 1QA7A 1B0FA 4WJG2 4IN2A 3GYMA 2QAAA 2VVCA 1UTMA 3LIWA 3SI4H 1X7AC 1UTPA 3RMLH 2Y7ZA 5LPFA 3M5LA 2ZECA 3M7QA 2QF3A 5E2OA 1Y3UA 4UFFH 1TNGA 4GSOA 1NY22 2R3UA 3M37A 1T31A 1ZJKA 1C2HA 1RD3B 1HCGA 2Z9KA 2V35A 1ZOMA 3UTUH 3UQOA 1C5QA 1KXEA 3M35A 1A4WH 1LKAA 3SNDA 1PYTD 1FAKH 3ZYDA 1SLUB 4B2CA 2A5AA 5FCKA 4DG4A 2BZAA 1LVYA 2HOBA 4UONA 1O3PB 1CBWC 1O3BA 2Q1JA 1K1PA 1DFPA 1FXYA 2PSXA 1LHFH 1K1JA 2OC1A 2CJIA 2PGQB 3P70B 1AFEH 1QJ1B 1T7CA 3P8OA 1C1OA 1E0FD 1FDPA 5J4SA 1WQSA 1L1JA 1O31A 3ATMA 2OCVB 4CR9A 2VJ1A 3SNEA 5JBAS 5DP7A 8GCHF 1XKBC 1TGCA 3GY4A 4YOJA 2ZDNA 1C2JA 2FOEA 1EZXC 2P3TB 1P9SA 3FANA 1Z7KA 1YPEH 2SGEE 1L4ZA 2P59A 4ABAA 2HPPH 3W95A 5LGOA 3SJ9A 5C67A 4X6NA 1KLTA 1GHZA 5EOKA 1HIAB 4O9VA 1LHDH 4NWKA 5EG4A 4I32A 3SNCA 3B8JA 1SGIB 4Z0KA 5GWZA 1UK2A 2WPMS 2TGAA 2FZZA 1CT0E 4TPYA 1GHBF 4DCDA 4K1EA 4ASHA 1DLEA 1GMHG 2GCHG 1ZGIA 4AFQA 2ANMH 4NIXA 1DOJA 2Y5GA 9LPRA 3K2UA 4YM9A 1CBWB 3PYHA 4X6OA 5I46H 2GD4B 1HLTH 2FOAA 2XCNA 3KF2A 2ZTZA 1ZHRA 5F8XA 3SJIA 1GJ4H 2FI4E 1RIWB 3KIDU 3ZZ6A 4LZ1H 1NC6A 1PPFE 3OSYA 3F9HA 2J34A 4CBNA 3GDSA 1IHSH 2ZDMA 4YZUA 4NGAH 1VCWA 3TK5A 3GCHB 4X1QU 2W26A 4ZAEA 2TGPZ 1INCA 1AI8H 1GBBA 4YOIA 3S9BA 3P6ZB 1E34B 1UVOA 1GI7B 1GCDA 2QIQA 1FZZA 3UQVA 4X8TH 1GHAF 1S6FA 4CRDA 3S9CA 1MD7A 1GMCG 3M5OA 2GDDA 1XXFA 4ZUHA 1UCYE 3ZVDA 1EZSC 5L6NH 3KNXA 5BPEA 4JZDH 3LGVA 1O3GA 1Z8RA 1V2ST 1NFXA 3DFJA 4YLUA 2Z6BD 2ESTE 2GMTC 4TY7A 1C9TA 1V2QT 2VVVA 2HVXA 6CHAC 1LO6A 1A0HB 2OC8A 4F4OC 1F0UA 4WMDA 4WXVA 3V3MA 1GI3A 1O30A 1EX3A 3L3TA 4TY6A 1OWHA 1RTKA 5ETXA 4O03A 1P02A 1JWTA 2J2UA 1SGFG 5T6GA 2TIOA 4X8VH 3IG6B 1UTLM 1WTHD 1YLCA 3PMAB 5ESBA 3ZZDA 1UK4A 1YM0A 3ATKA 2XWBI 1D3DB 2WINI 4HGCA 2JH5D 1DICA 2D26C 1THSH 1XUIA 1RTFB 3KHVA 2CN0H 2C8ZB 3T26A 4NIVA 1KXDA 4K1SA 1C5MD 4FU9A 3TJNA 1HAOH 3LGUA 4I8KA 1TBRH 5AHGH 6CHAB 2DUCA 1CSOE 1UMAH 1BRAA 1Q3XA 1V2PT 1XKAC 1ESAA 1IQGA 1O37A 1CE5A 2AGIX 3O8DA 1OWJA 1LPGB 3LJJA 2ODYB 3M7UA 3BEIB 4IMZA 3OX7U 8LPRA 3FP6E 1QL9A 4TPIZ 4F49A 3LT3A 1O39A 2FTLE 4UFGH 1GMHF 2ZFPH 1OX1A 3T5FH 4H6TA 3M7TA 3FP8E 1QCPA 2BVSH 2JH0D 3N7OA 3HGPA 1C5SA 5E0JA 2GCTB 1LMWB 1IQMA 3WY8A 1G37A 1A3EH 5EQSA 1VJ9U 1SPJA 4FUEA 3URCA 1NZQH 1BMNH 1YPLH 3M3TA 2VGCC 2Y5HA 3GDUA 4ZXXH 5GJ4B 3SV2H 3P92A 3U8OH 3UNSA 4AGKA 1V3XA 2JKHA 2STBE 1GBDA 5EXNA 2PSYA 1V6DA 1ELCA 1GGDC 1O5FH 1LQDB 1O35A 5C1XA 1ARBA 4NA8A 3LGTA 1Z71A 3LC3A 3NKKA 1TRNA 3A88A 1ZSJA 3PWCA 1HDTH 1TX6A 1BOQA 2BLVA 1O2IA 2WPJS 1FIWA 1P0SH 1YCPH 3EYDA 3SI3H 3LONA 1ZTLA 5L2YH 3M3SA 2WV5A 2ALVA 2SGAA 1GJAB 4IGDA 4RSPA 1ELVA 1S81A 3A7YA 3E16B 1EAWA 4DT7B 1HPGA 5A0CA 1AVXA 1IQHA 2G00A 5DP5A 3VB4A 4WXIA 5HMAA 2BMGB 4ZKRU 1P2IA 1F0RA 1DSUA 1BJVA 1BB0B 4ABEA 3BTQE 1P2KA 2C93B 2XC4A 1WV7H 4CREA 3ZZ5A 1UO6A 3MMGA 3NWUA 4GLYA 3PMBB 2BQ7B 1FAXA 3PMJA 1JBUH 5C5OA 1O3LA 2PWXA 1Y3XA 3RDZA 5DPAA 2HLCA 1J14A 1EPTC 1BTHH 5FX6A 1K22H 1MZDA 4X0WU 1ANDA 5FXLA 4BAQB 2VIVA 1BHXF 2ZNKH 3OY6U 3TNTA 4J1YA 1RIWC 3MNBA 2ZKSA 1G2LA 5E0HA 1NS3A 7ESTE 1V2NT 2Z9GA 1K1NA 1NPMA 2ZU3A 3SGAE 1ID5H 4WVPE 8ESTE 1GI1A 2FYQA 5DP3A 1HB0B 4ABGA 1M9UA 4FUIA 3IITA 2ZFTA 2TGTA 4LXBH 1YPJH 1P9UA 1G3CA 3AW1A 1GL1A 2Z7FE 1RJXB 3D62A 3AVZA 4FUDA 2RCEA 1TRMA 3OU0A 1GHXH 3VB6A 4Y79A 1ELFA 3AW0A 4ZXYH 2AIQA 1WBGB 1AE5A 1G30B 5LH8A 2FP7B 5FPYA 4Q7YA 2ZHDA 1TPSA 3D23A 3ESTA 2CGAA 4SGAE 3MU4A 4AORA 2VINA 3KQBA 1KYNA 2A2XH 2ZFQH 4INHA 5FPTA 3PLBA 4X1NU 1JRTA 1FY3A 1SGQE 1BA8B 1C5VA 1GBEA 1P01A 1K28D 1O32A 2Q6GA 2ZPRA 3A87A 3MOCA 1SL3A 3GCOA 4ABDA 3UOPA 2BY8X 4MNWA 1Z6JH 1C1WH 1HJAB 4UFDH 1C2DA 2VIQA 1TOCB 4WMEA 4UD9H 1ZSLA 1BIOA 3SNBA 4MPXA 1AQ7A 5LPEA 4KGAA 3RC4A 1HAVA 3SN8A 1IQIA 2FOHA 1MTUA 1SFQB 1QB1A 1BMLA 3QO6A 1Y5AT 2NU1E 4Q2KA 3FFGA 5HGGA 2FO9A 3RMMH 4YTAA 2PGBB 1C1VH 5L2ZH 2WYGA 1PQAA 3T29A 2P8OB 1EP5A 3NUMA 5TCAA 2F83A 1YCPM 2FESH 1MTWA 4E7NA 4X6MA 1LQEA 1AUJA 1B7XB 3CENA 1K9OE 4MNYA 5EODA 2O8LA 1UTOA 5K7RA 4FUCA 4X8SH 1VITG 1BTZA 4NFEA 1K1IA 2BLQA 1EPTA 1NO9H 1PPBH 1V2RT 5J4QA 3A85A 3RXKA 3U98H 1A0LA 2XBVA 1VJAU 3Q3XA 4KP0A 4Q7XA 3K65B 2C4FH 2IJOB 2ZTYA 1BMMH 2FYRA 3A7VA 4KTUA 1MTVA 2FS8A 1YYY1 1XM1A 4B74A 2F91A 4TWYA 2D1JA 1K21H 1EAIA 3TJOA 1TQ0B 2A45B 1SGPE 1TQ7B 2CHAB 1ABJH 2AYWA 3DD2H 1ELEE 2BVXH 3FVFB 1HAXB 1TMTH 1DVAH 3P8FA 3A83A 1GHYH 1WSSH 2BQWB 1KDQA 4A5TS 1CGIE 3PO1C 3I29A 3TLOA 4DW2U 2NU4E 1C1QA 1C5LH 4E7RG 1BJUA 2PTNA 1NU9A 2FPZA 3LH1A 3P8NA 2P3UB 5FAHA 4D7FA 2A2QH 1GBTA 1QBNA 3Q3YA 3RXPA 2ANKH 1CHOG 2Z94A 5FX5A 1ZLRA 1P06A 1ZGVA 4NSVA 3U1IB 1SBWA 1GPZA 1YKTA 1OXGA 4GCHF 1D3PB 4J2YB 4FVBA 1FY5A 1O3EA 2UWPA 2TGDA 1BUIA 2CXVA 2IPHA 1DSTA 3PB1E 3GCHC 1YPHE 2OLGA 3QDZB 1DY9A 2C8XB 1S6HA 2BOKA 4E05H 1VCQA 1BBRK 2AS9A 3QWCH 2XXLA 1NROH 1O2RA 2RA0A 5EW2H 3GISB 3RXOA 3RXQA 1AIXH 1Y59T 2VWLA 2GP9B 1NFUA 3VPKA 1GBFA 2QCYA 2B9LA 2GDEH 3UPEA 3VFEA 1AE8H 1GCTC 3BIUH 3KN2A 2ZA5A 3M5MA 1YPKH 1LHEH 1UVPA 3NK8A 1ZRBA 1MTNC 1S0QA 3FAOA 1AVGH 1QBVH 3GCTG 1H4WA 2J94A 3STJA 4ZH8A 1HXFH 1PJPA 2PV9B 1O2YA 3E0PB 2CMYA 4B2BA 1THPB 4XSKU 1DT2A 2ULLA 3BG4C 1KXCA 4SGBE 1KXBA 2PUXB 1BTYA 3SU5A 2PR3A 3PTBA 5BRRE 1O2HA 1SLWB 4CRFA 2I6QA 3MI4A 1HAZB 3SW2B 2QY0B 3UR6A 2WPLS 1F5LA 3V0XA 2ZP0H 2Y82A 2G5VA 1MUEB 1IQKA 3RU4E 1V2WT 1HIAA 1GJ5H 3D65E 5EQQA 3MFJA 2P93A 5DG6A 3SORA 3ZZ7A 1O2SA 1OWEA 2VIPA 1FONA 1EOJA 2D8WA 2F9BH 3M61U 2A1DB 2HGTH 1OP2A 1A61H 1SQTA 2A5IA 2G51A 4AN7A 4UFEH 2M5TA 1GI5A 2VNTA 5GCHF 3QLPH 3HKJB 1DWDH 1TAWA 1MMJN 1Z1IA 3DT0H 1SGEE 4BXSA 3FZZA 2WUCA 1DM4B 1GG6B 3TVJB 3QK1A 1V2UT 1Q2WA 3LKWA 1ELTA 1O5CB 3A84A 3RXCA 2XNIA 1VITH 2P3FH 5E8EH 2SGPE 5K0HA 1QA0A 2FX6A 3ITIA 1C5YB 3RM0H 3DFLA 3ZV9A 4WF8A 4WH8A 1QRZA 2QGRA 1KSNA 5PTPA 5EGMA 1C5PA 1AZ8A 1SQAA 2OXSA 1D9IA 2H6MA 2QXJA 1P3EA 2ZQ1A 3T27A 5A2MH 1GHWH 1T8LA 1SGNE 1ZMLA 2AERH 1TALA 2UUFB 2J4IA 2FM2A 1OP0A 1MAXA 3LC5A 2VVUA 3AAVA 1C1NA 4JZFH 1J15A 5FCRA 1UCYK 4AFUA 1TA6A 5HYOA 1EZQA 1UCYH 1ZSKA 1FPCH 1BRCE 3AAUA 2CF8H 2VB0A 4Y6DA 3SV7A 4XBCA 2R0LA 1RFNA 5CMXH 2V0BA 1GJ6A 1CT4E 3KQCA 3UIRA 1C2EA 3LU9B 1P12E 1ETTH 5G4BA 3P8GA 2ZO3H 1ESTA 1LDTT 4NZQA 2RA3A 1Y3WA 3LOXA 1TLDA 4X1SU 2WPIS 4UE7H 1V2OT 5ABWA 4Z6AH 2P8OC 4MQAA 1SB1H 1MKXH 2EC9H 1MU8B 3EDXB 4O97A 3W94A 1RTLA 3A7TA 4A92A 2FS9A 4IMQA 1AUTC 1G9IE 2D2DA 3EE0B 1E38B 2A32A 3U1JB 1ELAA 2BX3A 2G5NA 1A7SA 3I77A 3UOUA 1UVSH 4FU8A 3RXVA 1TBQH 2F9VA 2EI8A 1KLJH 4Y7AA 1EJNA 3ZZ4A 4UEHH 2PKAB 3RXIA 3LGIA 2EEKA 3TJUA 5C3NA 3TK6A 1JIMA 1GVKB 1W7GH 2R2MB 2B0FA 7GCHG 4GUXA 1O3JA 1GHAG 2ZCKP 9ESTA 2FI3E 1EB2A 4K60A 3FZDA 2VIWA 1GJDB 2OP9A 4LOYH 2G4UA 4K5ZA 4FUJA 2FOBA 2YOLA 1C2KA 1ZPBA 1G32B 5A0BA 4ISLA 1HUTH 3A81A 1GI2A 1PPHE 3T2NA 1CT2E 4AFSA 3MTYA 3Q77A 1C5XB 2RG3A 4A1VA 1ZRKA 4GHTA 3ZVBA 1GI4A 1YBWA 3E1XB 2NWNA 1O2GH 3CS7A 4XBDA 3S9AA 4B76A 2F9PA 3MO3A 3G01A 1GI9B 2Q6FA 1ELBA 1QTFA 4B1TA 3DUXH 1WYKA 2UUJB 1FN6A 2GZ7A 1TGBA 3MHWU 3MH4A 6GCHF 1IQJA 3RMNH 4WWYA 3BF6H 1ELGA 3SJ8A 1TA2A 2DE9A 1HJAC 3SU6A 2QXHA 1OWDA 1VZQH 4JCNA 2GZ8A 4BANB 3A80A 4AYYB 2R9PA 2A0QB 1BITA 2QV1A 1XXDA 1BBRE 4O3UA 1LVBA 2STAE 2V3OH 3FP7E 3MU8A 4JZ1A 4ZKOU 3CS0A 1AMHA 3SU4A 1GBJA 1SGFA 1OPHB 1LTOA 1UTKA 4OS1A 3BN9A 4GCHG 1TPAE 3TITA 3F6UH 4I8HA 1O0DH 3E3TA 3Q3KA 3ZVGA 2P94A 5A0AE 1ANCA 4HI3A 2Z9IA 3RU4T 4WMFA 5DO4H 2H9HA 1A1RA 1P2JA 3UFAA 4D9QA 1GVZA 1HJ8A 3UWIA 1B5GH 4XDEA 4BTUB 3CP7A 4AB8A 1HAYB 1W3CA 3A7XA 4DIIH 2UUKB 2BY6X 1QQ4A 2ALPA 3RXFA 3STIA 1PQ8A 1C1RA 4X1PU 1BBRH 1HRTH 4JK5A 3SU2A 1TRYA
chains in the Genus database with same CATH superfamily
1CA0C 1O2XA 1ZPCA 4FUHA 4CH2B 2EQNA 5JYIA 3SUFA 1HBTH 1O2QA 5DGJA 1OKXA 4PROA 3I78A 1JMOH 4YOGA 2EY4C 4K2YA 4OS2A 1Y5UT 5FHTA 1CA8B 3S7KB 2ANYA 1O3HA 3MNCA 1LPZB 1N8OC 4M7GA 1NTPA 2F9UA 1FMGA 2A7JA 3BTME 3W1EA 1SFIA 1XVOA 3TH3H 2PHBA 1C5WB 1FUJA 2OTVA 2GZ9A 2KAIA 2O8UA 4YT7H 1H8IH 2AGEX 1FY8E 4Q4LA 4RKOB 1GBMA 4ABIA 1NN6A 4LK4A 5GIBA 4JYUH 1DANH 2H2ZA 2FLBH 2VGCB 1WTGH 3BTHE 4FOUC 1E35B 5A8XA 4AC9A 1EJAA 1W14U 2WV9A 1O2MA 1S84A 2FOFA 1FJSA 1KXAA 1ZMNA 3A86A 4MTBA 2GCTC 2Z9LA 4B71A 3JZ1B 3EA8A 3WWFA 1TMUH 1Y3VA 3R0FA 1S83A 5EQRA 1MQ5A 1W2KH 1QB9A 5DK1A 2BD4A 5F6MA 3TGKE 1ETRH 2HNTC 1G3DA 4DVAU 1F0SA 2BDYA 4KKDA 1C5OH 3UY9A 1EJMA 4BAOB 2XC5A 1C5TA 3SJKA 3PM3A 1FLEE 3VB7A 1P10A 2BOHB 3SV9A 2GT7A 2ZHQH 4MPUA 1O3CA 1IHTH 2G81E 2ZU2A 1BTUA 1E37B 2BHGA 4BNRA 1RRKA 2ZDAH 4JK6A 4NFFA 1G36A 5EIYA 2A4OA 5EJLA 3BIVH 2ZTXA 1L1GA 1NT1A 3MQKC 1E1RD 4Q80A 3RC5A 3VGCC 4IW4E 3OEED 4Y0YE 2ZGXH 2BDIA 1O2KA 2Y80A 1SOZA 2Y7XA 3RXLA 3VB5A 4DY7B 1XUHA 5LPRA 1THRH 3ODDA 1UTNA 2V3MA 1T4UH 3O8CA 1MQ6A 3UAIC 3DA9B 3LDXH 2FEQH 1KLIH 1TNJA 4K69A 2HWLB 4I8GA 1Z1JA 7LPRA 2ZFFH 2ZGJA 1F7ZA 1TGTA 2ZHWH 3A82A 3MO9A 1V2JT 1ZTKA 3GY5A 2XCFA 1A5HA 1O34A 4YT6H 2OBQA 5DP9A 1YLDA 2OUAA 1YGCH 1HAGE 1DPOA 2Y6TA 4CRBA 1BHXB 5JPMH 2A4QA 4GAWA 4ZHAA 4A7IB 1GMDF 2YMSC 3R3GB 4U32A 5IYTA 3SQHE 1TE0A 3K9XB 3TH4H 5B6LA 1Z8IB 1BMAA 2Y81A 1SLXB 3SU1A 3SV8A 4CRGA 3ELAH 1MCTA 2ODPA 1XUJA 2P95A 3IWMA 1T32A 4VGCB 4Y8XA 1AU8A 1O2VA 1O3KA 1H9IE 5IDKA 1BTXA 1ZHMA 3BTGE 4AFZA 3KGPA 2ZGBH 4JZIA 1QRWA 3EAJA 1GMCF 2C8YB 1K2I1 3OTJE 2EI7A 1TX8A 1J16A 2AMPA 3SUEA 4D8NA 2HRVA 1MKWK 2SFAA 3NZIA 4BXWA 2W7SA 1P2MA 1NRRH 2BYAX 4WH6A 5JBCS 3F0OA 2BLOA 2LNCA 1EZUC 2OC7A 5C94A 2QF0A 2AMQA 1O5BB 1TNHA 2B5TB 2O8MA 2VH6A 4D9RA 4R0IA 4I33A 2A7HA 2F9NA 1EOLA 1DUAA 1FNIA 2W7UA 2SGQE 3RXAA 1IQEA 1O2PA 2FI5E 2ZC9H 1WQVH 1SKYE 3OYPA 4OS4A 1EB1H 1WXRA 3MU1A 5TCCA 1SHYA 5JBBS 5GXPA 2XW9A 1G3BA 1TNIA 2ILNA 1CGHA 5C1YA 3RLWH 1GMDG 1L4DA 2BB4A 1Y3YA 3S0NA 1C4V2 3U8TH 3HATH 2A4GA 1WCZA 3BTDE 5L30H 4A1TA 1EAXA 1FY1A 3M5NA 1BQYA 1T8NA 2R3YA 4ISNA 5FPSA 2XYAA 1IQLA 1DX5M 1SMFE 7GCHF 4NIYA 2KCAA 3ATLA 1NM6A 3OY5U 2KCYA 3LGYA 1P3CA 3MYWA 3BEFB 1N8OB 2I6SA 3MH6A 4B2AA 1EP6A 1HAVB 2BM2A 3FN8A 3P95A 1FN8A 3UUZA 2ZF0H 3TGJE 1ORFA 2AFQB 1K1OA 2VIDA 4NZLA 1LHGH 3RMOH 1AKSA 3L6PA 1C1PA 1XMNB 2GV6A 4FU7A 2QXGA 4NIWA 4INKA 1J9CH 1C2MA 3BTWE 3ZIAD 1G3EA 4NA9H 4Y71A 3H7OA 2WYJA 2FX4A 3QZRA 1CQQA 6ESTA 1GBCA 2UUYA 1O33A 1P04A 4XBBA 1GDUA 4DT4A 1GVLA 1AVWA 3NPSA 3RXBA 4U01A 4ZHLU 1H9LB 4I31A 2ZCLP 1MBQA 1K1MA 1QHRB 1SSXA 1BDAA 2XWAA 3UWJH 1C1SA 3EA7A 1P57B 1QGFA 3QGNB 1MBMA 1IAUA 5CDFE 5IK2D 1K1LA 2J98B 3PO1B 1W0JD 3SJOA 3H5CB 4E06H 2EA3A 1A46H 3U69H 1S5SA 1ZYOA 2ZDKA 3BTEE 1TNKA 1AB9C 4A6LA 1P2OA 1EASA 3PRDA 1IQFA 4TYDA 4MG3A 4B6EA 2ANWA 3D49H 1DDJA 1UVUH 4OGYA 3U8RH 2A7CA 2GGVB 2PKSB 5AFYH 2BD5A 1VITF 1O3DA 2ODQA 3KEEA 1LPKB 1OS8A 1Z8JB 1MKWH 2QN5T 3SU3A 4I7YH 3SBKA 1ANEA 3GY3A 1PPEE 1AWHB 2WPHS 4Y10E 2W5EA 4Q63A 2PTCE 3KCGH 5ESTE 3RXJA 2QA9E 1DWEH 5I25A 5T1VA 2VWMA 2FWWA 2VWNA 1UJ1A 2BD9A 2ZPSA 1QL8A 3VXEH 1EQ9A 3V7TA 1OYQA 1Z6EA 2HNTF 1YC0A 3E0NB 1ESBA 2Z3CA 3GCNA 1ELDE 4RT0A 5E2PA 4FVDA 4OS7A 1E36B 4ABBA 5GCHG 1TABE 1D6WA 2VIOA 2NU2E 2ZZUH 3URDA 1GJBB 4X2YA 1W0YH 4OS5A 3KQEA 3SYJA 1RS0A 1HV7A 2OC0A 1ZTJA 2BY9X 1GHVH 3F9GA 1MZAA 1A0JA 3A8DA 2ZDLA 1TWXB 4DGJA 4QT8C 4CRAA 1Y8TA 3ZZCA 1W0ZU 1S82A 2JETC 2W3KA 4UDWH 2G4TA 5DSFA 1CU1A 5FBEA 1ZR0A 2G55A 1EXFA 1UTJA 4RKJB 5JDUB 3TJVA 1F2SE 2G52A 4Y11E 5EPNA 1GHBG 1BRUP 1XUKA 2A5KA 2XC0A 3NCLA 1C2GA 5GNDA 3VGCB 1JOUB 1C9PA 1W7XH 1QURH 2GT8A 2H1UA 1O5GH 4ABFA 2FDAA 1WUNH 4Y8YA 4BOHA 5B6OA 1ZPZA 3E6PH 4X2XA 1N6XA 1DXPA 1LKBA 5DP8A 3T25A 1A5IA 3ZVAA 4MLFB 1J17T 2BZ6H 8GCHG 3A7WA 2BDCA 4YO9A 3HK3B 1ZHPA 3MO6A 4OGXA 1QFKH 2THFB 1W12U 2GX4A 1MTSA 4GPGA 3PMHB 1TPOA 4TSFD 2WPDD 1LVOA 2OBOA 3A7ZA 1YCPK 4OS6A 3UNRA 4AZ2B 1S6LA 5DN6D 2BLWA 4K1TA 1DWBH 4Y0ZE 3ZZ8A 4LZ4B 4ZHMU 1SGCA 2GKVE 2IPQX 1QJ6B 1C5NH 1O2TA 2FMJA 1FPHH 3UNQA 5C5NA 1O38A 1CA0B 1JXPA 3F2FA 1TB6H 1NESE 2WHXA 1C2IA 1O3FA 1W0KD 2ZU5A 2BVRH 3TGIE 4R8TB 4KTCA 5H4IB 2PUQH 3RXSA 1DXWA 2FODA 5DP4A 1F5KU 1BZXE 5EXMA 3M3VA 2GCHF 2XTTB 1O3AA 1A5GH 1O2LA 4MNXA 1C1MA 1GBIA 1SGTA 2Z3DA 4B73A 1EATA 1EUFA 1TIOA 2V3HH 3E91A 1PPGE 1CO7E 3K6ZA 2VBCA 3KQDA 4ISIH 5A8YA 2AEIH 1O2OA 4FUFA 2PW8H 5GPIB 1P2QA 1DUEA 1C1TA 3HK6B 1BMFD 1NRNH 2JH6D 1U6QA 3HGNA 4FUGA 1AHTH 3MWIU 5AFZH 2B7DH 1DS2E 1O2WA 3OFND 4BAHB 2BDHA 7KMEH 1QR3E 4JYVH 1C5UA 1SHHB 1HXEH 1HAHH 2WPKS 1SC8U 4ZKSU 1SG8B 1FV9A 1HGTH 4D7GA 1P03A 1HJ9A 2XBWA 2SNWA 4CH8B 4YXWD 1TX7A 3GS9A 3T62A 2OD3B 1O36A 1LCYA 5C0UA 1C5RA 1GG6C 1MU6B 3RU4D 1O3IA 1GL0E 2RDLA 4DIHH 2ZGCA 4RI0A 3H09A 2TBSA 1BT7A 3B23B 2BXUH 3TNSA 1O3MA 3PLKA 5E0GA 1MCVA 2ZGHA 2K0QA 4MVNA 4CRCA 1C4Y2 1S0RA 2FIRH 2J5UA 2CF9H 1CHGA 1TBZH 4WY3A 3C27B 2NU3E 2H9EH 1FX0B 3ATIA 1ARCA 1LVMA 1GBLA 2QF4A 3A8AA 4ISOA 2B8OH 3SV6A 3VB3A 2ZG0H 2P16A 3SHCH 4AOQA 1CGJE 3QTVH 2SNVA 2ZEBA 3RUOA 1XX9A 2PKSC 2ZWLH 5HIYA 5A8ZA 1OP8A 5EW1H 3MNXA 3QUMP 4HTCH 4DOQA 1O3OA 1PFXC 3N99A 1TGSZ 1QNJA 4A1XA 2JDID 1BTPA 1SQRA 1FIZA 4CHAB 3SZEA 1A2CH 3BTTE 1UW7A 3BG4B 3HPTB 1AZZA 4Y76A 1TONA 2PKAA 3O8BA 3A8CA 1JRSA 3KYGA 3SNAA 3RXRA 5GDSH 1YY3A 4K3JA 4IS5A 2F3CE 5DP6A 1C1UH 3TIUA 1SGDE 1H8DH 1V2VT 4BTIB 5KGOA 1J8AA 1CVWH 1KIGH 3S69A 3DSPA 1B0EA 2OK5A 1L2EA 1HNEE 3QZQA 3AK5A 1Z8GA 1AN1E 3RM2H 5C2ZA 4JZEH 1Q31A 2CV3A 3GYLB 2FOMB 3SZNA 1C5ZB 1O5DH 3H7TA 2J9NA 1ABIH 2LP6A 2IOTA 1F0TA 5JB9S 2C90B 1FI8A 3A89A 1DY8A 4NCYA 1GJ9B 2BD8A 3GY2A 3HKIB 3TK9A 2PFEA 1BRBE 2Y5FA 1SGRE 1UVTH 4AYVB 1AB9B 4NG9H 3GY7A 3TH2H 3MNSA 2XBXA 3VXFH 1YP9A 5SGAE 2Z3EA 2AMDA 1N1LA 2PLXA 4P00A 1ACBE 2QE7D 2YNAA 3GOVB 3RP2A 4JMYA 3E90B 3V13A 3M36A 3DHKH 4CHAC 3LGWA 2GVFA 3VG8A 1KXFA 2IJD1 4Y7BA 8KME2 3V12A 2BDGA 4RT1A 4XOJA 3ODFA 1HAPH 2ZHEH 1SLVB 1BCUH 3SUDA 1MD8A 2XBYA 1QRXA 3Q00A 3ZVEA 1N6YA 4THNH 1UHBA 1VGCB 1EFRD 4IBLH 4ESTE 5T3HA 2K1QA 5C0TA 2BQ6B 3RXEA 3QN7A 4DURA 3MU5A 3ZZ9A 1SQOA 4ISHH 4RN6A 1VCPA 2BD3A 4I8LA 1PQ5A 3SOSA 2BX4A 2QF5A 3PV4A 3SQEE 1TPPA 3QGJA 2UWLA 2FTMA 5EU8A 2BD7A 3NXPA 5HM2A 1W13U 1AD8H 4K8YA 2AGGX 1T8MA 3RXGA 3BEUA 1AFQC 3ZVCA 2EI6A 2GV7A 5HM9A 3F68H 4B75A 1G2MA 4TWWA 2BD2A 3F9EA 5C1UA 1WU1A 2ZFRH 4AB9A 2GMTB 1ZMJA 3BTFE 1BTWA 3T28A 1S85A 4O3TA 1ETSH 1RGQA 1TMBH 1AWFH 1LHCH 2JETB 5DJ7A 1MTNB 3ZYEA 3MH7A 1P11E 3L33A 1TFXA 5HKKD 4GHQA 2W3IA 2AHME 4AG2A 1GCTB 1NRPH 4NSYA 3ZV8A 4ZCNA 3QTOH 3PTNA 1PYTC 5F03A 1SVPA 3SHAH 1SI5H 1SGYE 1F5RA 1EKBB 3EA9A 1MKXK 2AH4X 1D6RA 5T6DA 2J95A 1W11U 5AVDA 3LJOA 2BDBA 5C20A 1TOMH 4K8BA 2GTBA 4ZMAH 2H9TH 4ABJA 1YPGH 1MH0A 1ZZZA 1Y5BT 5A09A 1XUFA 2ASUB 2V6NA 3SO3A 4XRNA 3LPRA 1NFYA 3RXDA 1GDQA 1WAYB 2WV4A 1HFDA 1GBHA 2UWOA 1GJCB 4HFPB 1YPMH 4ACBA 1YF4A 4NWLA 4H4FA 2BY5X 1GI6A 1NFWA 2OQ5A 4BTTB 1C2LA 1VGCC 1D3TB 2F43B 3RLYH 3ATWA 2VH0A 3P17H 3ZZ3A 2KAIB 4MDSA 1VR1H 2G8TA 3A8BA 3K6YA 3GY8A 2O8WA 2ZQ2A 3N7EA 5F8TA 1MAYA 2TRMA 1GBKA 2OQUA 3KL6A 1SR5C 2OINA 4HZHA 2RFKC 3U9AH 4IC6A 2ZIQH 2O8TA 4FUBA 2F9OA 4IN1A 2YNBA 2A31A 3LH3A 1UTQA 4H6SB 1P2NA 2R2WU 4X6PA 3EQ0H 5HXFA 2HPQH 4INLA 3TPIZ 2HALA 2A4RA 3SGBE 1W10U 4H42U 3FO8D 4D76A 1L1NA 2LPRA 4KELA 1H1BA 1OYTH 2ZI2H 5JB8S 1C4U2 1QBOA 2ZCHP 3BV9B 1AO5A 4JYTA 1OWIA 3GICB 5CHAC 3RXUA 1QIXB 2FXRA 1GI8B 1H8ED 3SU0A 2ZDVH 4XFQA 1KDQB 1T4VH 1OSSA 2O9QA 1QB6A 3S7HB 2SGDE 2FLRH 4DJZB 3DSOA 1HYLA 2XRCA 3GCTF 4ABHA 2XOKD 1GDNA 1IQNA 1O2NA 1QY6A 1QL7A 4AX9H 3F3BA 2ZPQA 1OOKB 1GJ8B 1KTTB 1L0ZA 3RXTA 1O3NA 1D3QB 3MU0A 3ZZBA 4AG1A 1A3BH 2J38A 4VGCC 3VEQB 1V2KT 2DE8A 4XE4A 1GGDB 1C2FA 1TNLA 4ZROA 3UREA 4U30A 2ZHFH 3QX5H 2BY7X 2TPIZ 4KTSA 2KZ4A 4X1RU 2R0KA 1DLKB 1EPTB 1P05A 1O5EH 5EPYA 5F8ZA 5TJXA 1NRQH 3MH5A 2AIPA 1RXPA 1GI0A 5DKMA 3ZZAA 1DITH 1TYNA 5FBIA 1AY6H 1O2UA 2FOCA 2J92A 3F1SB 1JIRA 5CHAB 1AGJA 3UR9A 2H5CA 1V2MT 4MPVA 3SGQE 4I8JA 3Q76A 2QYIA 4BAMB 4Y8ZA 2Q6DA 3BSQA 1PPZA 1P8VC 1CHOF 3F9FA 1IOEA 5KEDA 1GWAA 4YLQH 2CHAC 4AGJA 1KY9A 1XVMA 1TGNA 2ZU4A 4NA7A 3ENSB 1SOTA 1WOFA 1XUGA 1KTSB 1GJ7B 1O2JA 4FETA 2BTCE 2NU0E 5AF9H 2ZU1A 1YPHC 1DWCH 2VU8E 1W8BH 4IC5A 2IN2A 3E8LA 1V2LT 3BG8A 1O5AB 2QXIA 1UK3A 2WUBA 1F92A 2SGFE 3TU7H 3GY6A 4CR5A 3PWBA 3PLPA 3C1KA 5EXLA 5T6FA 4BAKB 4CBOA 4MPWA 2C8WB 2BDAA 4F55A 4FXGH 4U2WA 3O8RA 1UHBB 2HNTE 3B9FH 2Z9JA 3EGKH 6LPRA 3SUGA 1PQ7A 1QQUA 1ZJDA 3BTKE 1GBAA 1QJ7B 4X2VA 1FQ3A 3RXMA 4X8UH 4GVUA 1H9HE 5CE1A 1D4PB 4MNVA 3ZVFA 4YESB 1ANBA 2FOGA 2GJGA 3JZ2B 4ACAA 3AASA 1PPCE 1P09A 3PROA 2JJ2D 3PRBA 1DE7H 2ZFSA 2QC2A 1O2ZA 5JBTA 1HAIH 1V2TT 2BXTH 1EAUA 3GDVA 2L74A 1T8OA 4X2WA 1AFQB 2KCOA 2VWOA 2KR7A 4Q7ZA 3RXHA 1NU7B 3RC6A 6GCHG 2C3SA 2H5DA 4ZKNU 1OWKA 1FY4A 1NRSH 1AKSB 1QA7A 1B0FA 4WJG2 3N7DA 3GYMA 4IN2A 2QAAA 2VVCA 1UTMA 3LIWA 3SI4H 1X7AC 1UTPA 3RMLH 2Y7ZA 5LPFA 3M5LA 2ZECA 3M7QA 2QF3A 5E2OA 1Y3UA 4UFFH 1TNGA 4GSOA 1NY22 2R3UA 3M37A 1T31A 1ZJKA 1C2HA 1RD3B 1HCGA 2Z9KA 2V35A 1ZOMA 4HG6A 3UTUH 3UQOA 1C5QA 3F0PA 1KXEA 3M35A 1A4WH 1LKAA 3SNDA 1PYTD 1FAKH 3ZYDA 1SLUB 4B2CA 2A5AA 5FCKA 4DG4A 2BZAA 1LVYA 2HOBA 4UONA 1O3PB 1CBWC 1O3BA 2Q1JA 1K1PA 1DFPA 1FXYA 2PSXA 1LHFH 1K1JA 1YWUA 2OC1A 2CJIA 2PGQB 3P70B 4I86A 1AFEH 1QJ1B 1T7CA 3U28C 3P8OA 1C1OA 1E0FD 1FDPA 5J4SA 1WQSA 1L1JA 1O31A 3ATMA 2OCVB 4CR9A 2VJ1A 3SNEA 5JBAS 5DP7A 8GCHF 1XKBC 1TGCA 3GY4A 4YOJA 2ZDNA 1C2JA 2FOEA 1EZXC 2P3TB 1P9SA 3FANA 1Z7KA 1YPEH 1OHHD 2SGEE 1L4ZA 2P59A 4ABAA 2HPPH 3W95A 5LGOA 3SJ9A 3KYFA 5C67A 4X6NA 1KLTA 1GHZA 5EOKA 1HIAB 4O9VA 1LHDH 4NWKA 5EG4A 4I32A 3SNCA 3B8JA 1SGIB 4Z0KA 5GWZA 1UK2A 2WPMS 2TGAA 2FZZA 1CT0E 4TPYA 1GHBF 4DCDA 4K1EA 4ASHA 1DLEA 1GMHG 2XNDD 2GCHG 1ZGIA 4AFQA 2F4LA 2ANMH 4NIXA 1DOJA 2Y5GA 9LPRA 3K2UA 4YM9A 1CBWB 3PYHA 4X6OA 5I46H 2GD4B 1HLTH 2FOAA 2XCNA 3KF2A 2ZTZA 1ZHRA 5F8XA 3SJIA 1GJ4H 2FI4E 1RIWB 3KIDU 3ZZ6A 4LZ1H 1NC6A 1PPFE 3OSYA 3F9HA 2J34A 4CBNA 3GDSA 1IHSH 2ZDMA 4YZUA 4NGAH 1VCWA 3TK5A 3GCHB 4X1QU 2W26A 4ZAEA 2TGPZ 1INCA 1AI8H 1GBBA 4YOIA 3S9BA 3P6ZB 1E34B 1UVOA 1GI7B 1GCDA 2M2AA 2QIQA 1FZZA 3UQVA 4X8TH 1GHAF 1S6FA 4M9FA 4CRDA 3S9CA 1MD7A 1GMCG 3M5OA 2GDDA 1XXFA 4ZUHA 1UCYE 3ZVDA 1EZSC 4P02A 3KNXA 5BPEA 5L6NH 4JZDH 3LGVA 1O3GA 1Z8RA 1V2ST 1NFXA 3DFJA 4YLUA 2Z6BD 2ESTE 2GMTC 4TY7A 1C9TA 2W6JD 1V2QT 3OAAD 2VVVA 2HVXA 6CHAC 2L6OA 1LO6A 2WSSD 1A0HB 2YMSD 2OC8A 4F4OC 1F0UA 4WMDA 4WXVA 3V3MA 1GI3A 1O30A 3CNRA 1EX3A 3L3TA 4TY6A 1OWHA 1RTKA 5ETXA 4O03A 1P02A 1JWTA 2J2UA 1SGFG 5T6GA 4Z1MD 2TIOA 4X8VH 3IG6B 1UTLM 1WTHD 1YLCA 3PMAB 5ESBA 3ZZDA 1UK4A 1YM0A 3ATKA 2XWBI 1D3DB 2WINI 4HGCA 2JH5D 1DICA 2D26C 1THSH 1XUIA 1RTFB 3KHVA 2CN0H 2C8ZB 3T26A 4NIVA 1KXDA 4K1SA 1C5MD 4FU9A 3F2GA 3TJNA 1HAOH 3LGUA 4I8KA 1TBRH 5AHGH 6CHAB 2DUCA 1CSOE 1UMAH 1BRAA 1Q3XA 1V2PT 1XKAC 1NBME 1ESAA 1IQGA 1O37A 1CE5A 2AGIX 3O8DA 1OWJA 1LPGB 3LJJA 2ODYB 3M7UA 1H8HD 3BEIB 4IMZA 3OX7U 8LPRA 3FP6E 1QL9A 4TPIZ 4F49A 3LT3A 1O39A 2FTLE 4UFGH 1GMHF 2ZFPH 1OX1A 3T5FH 4H6TA 3M7TA 3FP8E 1QCPA 2BVSH 2JH0D 3N7OA 3HGPA 1C5SA 5E0JA 2GCTB 1LMWB 1IQMA 3WY8A 1G37A 1A3EH 5EQSA 1VJ9U 1SPJA 4FUEA 3URCA 1NZQH 1BMNH 1YPLH 3M3TA 3OTPA 2VGCC 2Y5HA 3GDUA 4ZXXH 5GJ4B 3SV2H 2WZQA 3P92A 3U8OH 3UNSA 4AGKA 1V3XA 2JKHA 2STBE 1GBDA 5EXNA 2PSYA 1V6DA 1ELCA 1GGDC 1O5FH 1MABB 1LQDB 1O35A 2CK3D 5C1XA 1ARBA 4NA8A 3LGTA 1Z71A 3LC3A 5HIZA 3NKKA 1TRNA 3A88A 1ZSJA 3PWCA 1HDTH 1TX6A 1BOQA 2BLVA 1O2IA 3OEHD 2WPJS 1FIWA 1P0SH 1YCPH 3EYDA 3SI3H 2KCPA 3LONA 1ZTLA 5L2YH 3M3SA 2WV5A 2ALVA 2SGAA 1GJAB 4IGDA 4RSPA 1ELVA 1S81A 3A7YA 3E16B 1EAWA 4DT7B 1HPGA 5A0CA 1AVXA 1IQHA 2G00A 5DP5A 3VB4A 4WXIA 5HMAA 2BMGB 4ZKRU 1P2IA 1F0RA 1DSUA 1BJVA 1BB0B 4ABEA 3BTQE 1P2KA 2C93B 2XC4A 1WV7H 4CREA 3ZZ5A 1UO6A 3MMGA 3NWUA 4GLYA 3PMBB 2BQ7B 1FAXA 3PMJA 1JBUH 5C5OA 1O3LA 2PWXA 1Y3XA 1E1QD 3RDZA 5DPAA 2HLCA 1J14A 1EPTC 1BTHH 5FX6A 1K22H 1MZDA 4X0WU 1ANDA 5FXLA 4BAQB 2VIVA 1BHXF 4OM9A 2ZNKH 2KM0A 3OY6U 3TNTA 4J1YA 1RIWC 3MNBA 2ZKSA 1G2LA 5E0HA 1NS3A 7ESTE 1V2NT 2Z9GA 1K1NA 1NPMA 2ZU3A 3SGAE 1ID5H 4WVPE 8ESTE 1GI1A 2FYQA 5DP3A 1HB0B 4ABGA 1M9UA 4FUIA 3IITA 2ZFTA 2TGTA 4LXBH 1YPJH 1P9UA 1G3CA 3AW1A 1GL1A 2Z7FE 1RJXB 3D62A 3AVZA 4FUDA 2RCEA 1TRMA 3OU0A 1GHXH 3VB6A 4Y79A 1ELFA 3AW0A 4ZXYH 2AIQA 1WBGB 1AE5A 1G30B 5LH8A 2FP7B 5FPYA 4Q7YA 2ZHDA 1TPSA 3PV5A 3D23A 3ESTA 2CGAA 4SGAE 2PP6A 3MU4A 4AORA 2LELA 2VINA 3KQBA 1KYNA 2A2XH 2ZFQH 4INHA 5FPTA 5EJ1A 3PLBA 2W6ID 4X1NU 1JRTA 1FY3A 1SGQE 1BA8B 1C5VA 1GBEA 1P01A 1K28D 1O32A 2Q6GA 2ZPRA 3A87A 3MOCA 1SL3A 3GCOA 4ABDA 3UOPA 2BY8X 4MNWA 1Z6JH 1C1WH 1HJAB 4UFDH 1C2DA 2VIQA 1TOCB 4WMEA 4UD9H 1ZSLA 5CHBA 1BIOA 3SNBA 4MPXA 1AQ7A 5LPEA 4KGAA 3RC4A 1HAVA 3SN8A 1IQIA 2FOHA 1MTUA 1SFQB 1QB1A 3WW7A 1BMLA 3QO6A 1Y5AT 2NU1E 4Q2KA 3FFGA 5HGGA 2FO9A 3RMMH 4YTAA 2PGBB 1C1VH 5L2ZH 2WYGA 1PQAA 3T29A 2P8OB 4F48B 1EP5A 3NUMA 5TCAA 2F83A 1YCPM 2FESH 1MTWA 4E7NA 4X6MA 1LQEA 1AUJA 1B7XB 3CENA 1K9OE 1NBMD 4MNYA 5EODA 2O8LA 1UTOA 3NRLA 5K7RA 4FUCA 4X8SH 1VITG 1BTZA 4NFEA 1K1IA 2BLQA 1EPTA 1NO9H 1PPBH 1V2RT 5J4QA 3A85A 3RXKA 3U98H 1A0LA 2XBVA 1VJAU 3Q3XA 4KP0A 4Q7XA 3K65B 2C4FH 2IJOB 2ZTYA 1BMMH 2FYRA 3A7VA 4KTUA 1MTVA 2FS8A 1YYY1 1XM1A 4B74A 2F91A 4TWYA 2D1JA 1K21H 4B6FA 1EAIA 3TJOA 1TQ0B 2A45B 1SGPE 1TQ7B 2CHAB 1ABJH 2AYWA 3DD2H 1ELEE 2BVXH 3FVFB 1HAXB 1TMTH 1DVAH 3P8FA 3A83A 4XD7D 1GHYH 1WSSH 2BQWB 1KDQA 4A5TS 1CGIE 3PO1C 3I29A 3TLOA 4DW2U 2NU4E 1C1QA 1C5LH 4E7RG 1BJUA 2PTNA 1NU9A 2FPZA 3LH1A 3P8NA 2P3UB 5FAHA 4D7FA 2A2QH 1GBTA 1QBNA 3Q3YA 3RXPA 2ANKH 1CHOG 2Z94A 5FX5A 1ZLRA 1P06A 1ZGVA 4NSVA 3U1IB 1SBWA 1GPZA 1YKTA 1OXGA 4GCHF 1D3PB 4J2YB 4FVBA 1FY5A 1O3EA 2UWPA 2TGDA 1BUIA 2CXVA 2IPHA 1DSTA 3PB1E 3GCHC 1YPHE 2OLGA 3QDZB 1DY9A 2C8XB 1S6HA 2BOKA 4E05H 1VCQA 1BBRK 2AS9A 3QWCH 2XXLA 1NROH 1O2RA 2RA0A 5EW2H 3GISB 2JJ1D 3RXOA 3RXQA 1AIXH 1Y59T 2VWLA 1KMHB 2GP9B 3DSGA 1NFUA 3VPKA 1GBFA 2QCYA 2K8IA 2B9LA 2GDEH 3UPEA 3VFEA 1AE8H 1GCTC 3BIUH 3KN2A 2ZA5A 3M5MA 1YPKH 1LHEH 5FL7D 1YLNA 1UVPA 3NK8A 1ZRBA 1MTNC 1S0QA 3FAOA 1AVGH 1QBVH 2YMSB 3GCTG 1H4WA 2J94A 3STJA 4ZH8A 1HXFH 1PJPA 2PV9B 1O2YA 3E0PB 2CMYA 4B2BA 1THPB 2HVYB 4XSKU 1DT2A 2ULLA 3BG4C 1KXCA 3F2HA 4SGBE 1KXBA 2PUXB 1BTYA 3SU5A 2PR3A 3PTBA 5BRRE 1O2HA 1SLWB 4CRFA 1VKYA 2I6QA 3MI4A 1HAZB 3SW2B 2QY0B 3UR6A 2WPLS 1F5LA 3V0XA 2ZP0H 2Y82A 2G5VA 1MUEB 1IQKA 3RU4E 1V2WT 1HIAA 1GJ5H 3D65E 5EQQA 3MFJA 2P93A 5DG6A 3SORA 3ZZ7A 1O2SA 1OWEA 2VIPA 1FONA 1EOJA 3FOAA 2D8WA 2F9BH 3M61U 2A1DB 2HGTH 1OP2A 2HLDD 1A61H 1SQTA 2A5IA 2G51A 4AN7A 4UFEH 2M5TA 1GI5A 2VNTA 5GCHF 3QLPH 3HKJB 1DWDH 1TAWA 1MMJN 1Z1IA 3DT0H 1SGEE 4BXSA 3FZZA 2WUCA 1DM4B 1GG6B 3TVJB 3QK1A 1V2UT 1Q2WA 3LKWA 1ELTA 1O5CB 3A84A 3RXCA 2XNIA 1VITH 2P3FH 5E8EH 2SGPE 3WWBA 5K0HA 1QA0A 2FX6A 3ITIA 1C5YB 3RM0H 3DFLA 3ZV9A 4WF8A 4WH8A 1QRZA 2QGRA 1KSNA 5PTPA 5EGMA 1C5PA 1AZ8A 1SQAA 2OXSA 1D9IA 2H6MA 2QXJA 1P3EA 2ZQ1A 3EE7A 3T27A 5A2MH 1GHWH 1T8LA 4TT3D 1SGNE 1ZMLA 2AERH 1TALA 2UUFB 2J4IA 2FM2A 1OP0A 1MAXA 3LC5A 2VVUA 3AAVA 1C1NA 3PV2A 4JZFH 1J15A 5FCRA 1UCYK 4AFUA 1TA6A 5HYOA 1EZQA 1UCYH 1ZSKA 1FPCH 1BRCE 3AAUA 2CF8H 2VB0A 1QZ8A 4Y6DA 3SV7A 4XBCA 2R0LA 1RFNA 5CMXH 2V0BA 5KECA 1GJ6A 1CT4E 3KQ5A 3KQCA 3UIRA 1C2EA 3LU9B 1P12E 1ETTH 2RDEA 5G4BA 3P8GA 2ZO3H 1ESTA 1LDTT 4NZQA 2RA3A 1Y3WA 2J98A 3LOXA 1TLDA 4X1SU 2WPIS 4UE7H 1V2OT 5ABWA 4Z6AH 1WDIA 2P8OC 4MQAA 1SB1H 1MKXH 2EC9H 2KX4A 1MU8B 3EDXB 4O97A 3W94A 1RTLA 3A7TA 4A92A 2FS9A 4IMQA 1AUTC 1G9IE 2D2DA 3EE0B 1E38B 2A32A 3U1JB 1ELAA 2BX3A 2G5NA 1A7SA 3I77A 3UOUA 1UVSH 4FU8A 3RXVA 1TBQH 2F9VA 2EI8A 1KLJH 4Y7AA 1EJNA 3ZZ4A 4UEHH 2PKAB 3RXIA 3LGIA 2EEKA 3TJUA 5C3NA 3TK6A 1JIMA 1GVKB 1W7GH 2R2MB 2B0FA 7GCHG 4GUXA 1O3JA 1GHAG 2ZCKP 9ESTA 2FI3E 1K0HA 1EB2A 4ASUD 4K60A 3FZDA 2VIWA 1GJDB 2OP9A 4LOYH 2G4UA 4K5ZA 4FUJA 2FOBA 2YOLA 1C2KA 1ZPBA 1G32B 5A0BA 4ISLA 5EJZA 1HUTH 3A81A 1GI2A 1PPHE 3T2NA 1CT2E 4AFSA 3MTYA 3Q77A 1C5XB 2RG3A 4A1VA 1ZRKA 4GHTA 5F53A 2V7QD 3ZVBA 1GI4A 1YBWA 3E1XB 2NWNA 1O2GH 3CS7A 4XBDA 3S9AA 4B76A 2F9PA 3MO3A 3G01A 1GI9B 2Q6FA 1ELBA 1QTFA 4B1TA 3DUXH 1WYKA 2UUJB 1FN6A 2GZ7A 1TGBA 3UB0A 3MHWU 3MH4A 6GCHF 1IQJA 2KFWA 3RMNH 4WWYA 3BF6H 5C17A 1ELGA 3SJ8A 1TA2A 2DE9A 1HJAC 3SU6A 2QXHA 1OWDA 1VZQH 4JCNA 2GZ8A 2JIZD 4BANB 3A80A 4AYYB 2R9PA 1E79D 2A0QB 1BITA 2QV1A 1XXDA 1BBRE 4O3UA 1LVBA 2STAE 2V3OH 3FP7E 3MU8A 4JZ1A 3DCLA 3CS0A 4ZKOU 1AMHA 3SU4A 1GBJA 1SGFA 1OPHB 1LTOA 1UTKA 4OS1A 3BN9A 2J97A 3OE7D 4GCHG 1TPAE 3TITA 3F6UH 4I8HA 1O0DH 3E3TA 3Q3KA 3ZVGA 2P94A 5A0AE 1ANCA 4HI3A 2Z9IA 3RU4T 4WMFA 5DO4H 3FKSD 2H9HA 1A1RA 1P2JA 3UFAA 4D9QA 1GVZA 1HJ8A 3UWIA 1B5GH 4XDEA 4BTUB 3CP7A 4AB8A 1HAYB 1W3CA 3A7XA 4DIIH 2UUKB 2ALPA 2BY6X 1QQ4A 1COWD 3RXFA 3STIA 1PQ8A 1C1RA 4X1PU 1BBRH 1HRTH 4JK5A 3SU2A 1TRYA
chains in the Genus database with same CATH topology
1CA0C 1O2XA 1ZPCA 4FUHA 4CH2B 5JYIA 3SUFA 1HBTH 1O2QA 5DGJA 1OKXA 4PROA 3I78A 1JMOH 4YOGA 4K2YA 4OS2A 1Y5UT 5FHTA 1CA8B 3S7KB 2ANYA 1O3HA 3MNCA 1LPZB 1N8OC 4M7GA 1NTPA 2F9UA 1FMGA 2A7JA 3BTME 1SFIA 1XVOA 3TH3H 2PHBA 1C5WB 1FUJA 2OTVA 2GZ9A 2KAIA 2O8UA 4YT7H 1H8IH 2AGEX 1FY8E 4RKOB 1GBMA 4ABIA 1NN6A 4LK4A 5GIBA 4JYUH 1DANH 2H2ZA 2FLBH 2VGCB 1WTGH 3BTHE 1E35B 5A8XA 1EJAA 1W14U 1O2MA 1S84A 2FOFA 1FJSA 1KXAA 1ZMNA 3A86A 4MTBA 2GCTC 2Z9LA 4B71A 3JZ1B 3EA8A 1TMUH 1Y3VA 3R0FA 1S83A 5EQRA 1MQ5A 1W2KH 1QB9A 5DK1A 2BD4A 5F6MA 3TGKE 1ETRH 2HNTC 1G3DA 4DVAU 1F0SA 2BDYA 4KKDA 1C5OH 3UY9A 1EJMA 4BAOB 2XC5A 1C5TA 3SJKA 3PM3A 1FLEE 3VB7A 1P10A 2BOHB 3SV9A 2GT7A 2ZHQH 4MPUA 1O3CA 1IHTH 2G81E 2ZU2A 1BTUA 1E37B 2BHGA 4BNRA 1RRKA 2ZDAH 4JK6A 4NFFA 1G36A 2A4OA 3BIVH 2ZTXA 1L1GA 1NT1A 4Q80A 3RC5A 3VGCC 4IW4E 4Y0YE 2ZGXH 2BDIA 1O2KA 2Y80A 1SOZA 2Y7XA 3RXLA 3VB5A 4DY7B 1XUHA 5LPRA 1THRH 3ODDA 1UTNA 1T4UH 3O8CA 1MQ6A 3DA9B 3LDXH 2FEQH 1KLIH 1TNJA 4K69A 2HWLB 4I8GA 1Z1JA 7LPRA 2ZFFH 2ZGJA 1F7ZA 1TGTA 2ZHWH 3A82A 3MO9A 1V2JT 1ZTKA 3GY5A 2XCFA 1A5HA 1O34A 4YT6H 2OBQA 5DP9A 1YLDA 2OUAA 1YGCH 1HAGE 1DPOA 2Y6TA 4CRBA 1BHXB 5JPMH 2A4QA 4GAWA 4ZHAA 4A7IB 1GMDF 3R3GB 4U32A 5IYTA 3SQHE 1TE0A 3K9XB 3TH4H 1Z8IB 1BMAA 2Y81A 1SLXB 3SU1A 3SV8A 4CRGA 3ELAH 1MCTA 2ODPA 1XUJA 2P95A 3IWMA 1T32A 4VGCB 4Y8XA 1AU8A 1O2VA 1O3KA 1H9IE 5IDKA 1BTXA 1ZHMA 3BTGE 4AFZA 3KGPA 2ZGBH 4JZIA 1QRWA 3EAJA 1GMCF 2C8YB 1K2I1 3OTJE 2EI7A 1TX8A 1J16A 2AMPA 3SUEA 4D8NA 2HRVA 1MKWK 2SFAA 3NZIA 4BXWA 2W7SA 1P2MA 1NRRH 2BYAX 4WH6A 5JBCS 2BLOA 2LNCA 1EZUC 2OC7A 2QF0A 2AMQA 1O5BB 1TNHA 2B5TB 2O8MA 2VH6A 4D9RA 4R0IA 4I33A 2A7HA 2F9NA 1EOLA 1DUAA 1FNIA 2W7UA 2SGQE 3RXAA 1IQEA 1O2PA 2FI5E 2ZC9H 1WQVH 3OYPA 4OS4A 1EB1H 3MU1A 5TCCA 1SHYA 5JBBS 5GXPA 2XW9A 1G3BA 1TNIA 2ILNA 1CGHA 5C1YA 3RLWH 1GMDG 1L4DA 2BB4A 1Y3YA 3S0NA 1C4V2 3U8TH 3HATH 2A4GA 1WCZA 3BTDE 5L30H 4A1TA 1EAXA 1FY1A 3M5NA 1BQYA 1T8NA 2R3YA 4ISNA 5FPSA 2XYAA 1IQLA 1DX5M 1SMFE 7GCHF 4NIYA 3ATLA 1NM6A 3OY5U 3LGYA 1P3CA 3MYWA 3BEFB 1N8OB 2I6SA 3MH6A 4B2AA 1EP6A 1HAVB 2BM2A 3P95A 1FN8A 3UUZA 2ZF0H 3TGJE 1ORFA 2AFQB 1K1OA 2VIDA 4NZLA 1LHGH 3RMOH 1AKSA 3L6PA 1C1PA 1XMNB 2GV6A 4FU7A 2QXGA 4NIWA 4INKA 1J9CH 1C2MA 3BTWE 1G3EA 4NA9H 4Y71A 3H7OA 2WYJA 2FX4A 3QZRA 1CQQA 6ESTA 1GBCA 2UUYA 1O33A 1P04A 4XBBA 1GDUA 1GVLA 1AVWA 3NPSA 3RXBA 4U01A 4ZHLU 1H9LB 4I31A 2ZCLP 1MBQA 1K1MA 1QHRB 1SSXA 1BDAA 2XWAA 3UWJH 1C1SA 3EA7A 1P57B 1QGFA 3QGNB 1MBMA 1IAUA 1K1LA 3PO1B 3SJOA 4E06H 3H5CB 2EA3A 1A46H 3U69H 1S5SA 1ZYOA 2ZDKA 3BTEE 1TNKA 1AB9C 4A6LA 1P2OA 1EASA 1IQFA 4TYDA 4MG3A 2ANWA 3D49H 1DDJA 1UVUH 4OGYA 3U8RH 2A7CA 2GGVB 2PKSB 5AFYH 2BD5A 1VITF 1O3DA 2ODQA 3KEEA 1LPKB 1OS8A 1Z8JB 1MKWH 2QN5T 3SU3A 4I7YH 3SBKA 1ANEA 3GY3A 1PPEE 1AWHB 2WPHS 4Y10E 2W5EA 2PTCE 3KCGH 5ESTE 3RXJA 2QA9E 1DWEH 5I25A 2VWMA 2FWWA 2VWNA 1UJ1A 2BD9A 2ZPSA 1QL8A 3VXEH 1EQ9A 3V7TA 1OYQA 1Z6EA 2HNTF 1YC0A 3E0NB 1ESBA 2Z3CA 3GCNA 1ELDE 5E2PA 4FVDA 4OS7A 1E36B 4ABBA 5GCHG 1TABE 1D6WA 2VIOA 2NU2E 2ZZUH 3URDA 1GJBB 4X2YA 1W0YH 4OS5A 3KQEA 1RS0A 1HV7A 2OC0A 1ZTJA 2BY9X 1GHVH 3F9GA 1MZAA 1A0JA 3A8DA 2ZDLA 1TWXB 4DGJA 4QT8C 4CRAA 1Y8TA 3ZZCA 1W0ZU 1S82A 2JETC 2W3KA 4UDWH 2G4TA 1CU1A 5FBEA 1ZR0A 2G55A 1EXFA 1UTJA 4RKJB 5JDUB 3TJVA 1F2SE 2G52A 4Y11E 5EPNA 1GHBG 1BRUP 1XUKA 2A5KA 2XC0A 3NCLA 1C2GA 3VGCB 1JOUB 1C9PA 1W7XH 1QURH 2GT8A 2H1UA 1O5GH 4ABFA 2FDAA 1WUNH 4Y8YA 4BOHA 5B6OA 1ZPZA 3E6PH 4X2XA 1N6XA 1DXPA 1LKBA 5DP8A 3T25A 1A5IA 3ZVAA 4MLFB 1J17T 2BZ6H 8GCHG 3A7WA 2BDCA 4YO9A 3HK3B 1ZHPA 3MO6A 4OGXA 1QFKH 2THFB 1W12U 2GX4A 1MTSA 4GPGA 3PMHB 1TPOA 1LVOA 2OBOA 3A7ZA 1YCPK 4OS6A 3UNRA 4AZ2B 2BLWA 4K1TA 1DWBH 4Y0ZE 3ZZ8A 4LZ4B 4ZHMU 1SGCA 2GKVE 1QJ6B 1C5NH 1O2TA 2FMJA 1FPHH 3UNQA 5C5NA 1O38A 1CA0B 1JXPA 1TB6H 1NESE 1C2IA 1O3FA 2ZU5A 2BVRH 3TGIE 4R8TB 4KTCA 5H4IB 2PUQH 3RXSA 1DXWA 2FODA 5DP4A 1F5KU 1BZXE 5EXMA 3M3VA 2GCHF 2XTTB 1O3AA 1A5GH 1O2LA 4MNXA 1C1MA 1GBIA 1SGTA 2Z3DA 4B73A 1EATA 1EUFA 1TIOA 2V3HH 3E91A 1PPGE 1CO7E 3K6ZA 3KQDA 4ISIH 5A8YA 2AEIH 1O2OA 4FUFA 2PW8H 5GPIB 1P2QA 1DUEA 1C1TA 3HK6B 1NRNH 2JH6D 1U6QA 3HGNA 4FUGA 1AHTH 3MWIU 5AFZH 2B7DH 1DS2E 1O2WA 4BAHB 2BDHA 7KMEH 1QR3E 4JYVH 1C5UA 1SHHB 1HXEH 1HAHH 2WPKS 1SC8U 4ZKSU 1SG8B 1FV9A 1HGTH 4D7GA 1P03A 1HJ9A 2XBWA 2SNWA 4CH8B 1TX7A 3T62A 2OD3B 1O36A 1LCYA 1C5RA 1GG6C 1MU6B 3RU4D 1O3IA 1GL0E 2RDLA 4DIHH 2ZGCA 2TBSA 1BT7A 3B23B 2BXUH 3TNSA 1O3MA 3PLKA 5E0GA 1MCVA 2ZGHA 4MVNA 4CRCA 1C4Y2 1S0RA 2FIRH 2CF9H 1CHGA 1TBZH 4WY3A 3C27B 2NU3E 2H9EH 3ATIA 1ARCA 1LVMA 1GBLA 3A8AA 4ISOA 2B8OH 3SV6A 3VB3A 2ZG0H 2P16A 3SHCH 4AOQA 1CGJE 3QTVH 2SNVA 2ZEBA 3RUOA 1XX9A 2PKSC 2ZWLH 5A8ZA 5EW1H 1OP8A 3MNXA 3QUMP 4HTCH 4DOQA 1O3OA 1PFXC 1TGSZ 1QNJA 4A1XA 1BTPA 1FIZA 4CHAB 1A2CH 3BTTE 3BG4B 3HPTB 1AZZA 4Y76A 1TONA 2PKAA 3O8BA 3A8CA 1JRSA 3SNAA 3RXRA 5GDSH 4K3JA 4IS5A 2F3CE 5DP6A 1C1UH 3TIUA 1SGDE 1H8DH 1V2VT 4BTIB 1J8AA 1CVWH 1KIGH 3S69A 1B0EA 1L2EA 1HNEE 3QZQA 1Z8GA 1AN1E 3RM2H 5C2ZA 4JZEH 1Q31A 2CV3A 3GYLB 2FOMB 3SZNA 1C5ZB 1O5DH 3H7TA 2J9NA 1ABIH 2IOTA 1F0TA 5JB9S 2C90B 1FI8A 3A89A 1DY8A 4NCYA 1GJ9B 2BD8A 3GY2A 3HKIB 3TK9A 2PFEA 1BRBE 2Y5FA 1SGRE 1UVTH 4AYVB 1AB9B 4NG9H 3GY7A 3TH2H 3MNSA 2XBXA 3VXFH 1YP9A 5SGAE 2Z3EA 2AMDA 1N1LA 2PLXA 1ACBE 2YNAA 3GOVB 3RP2A 4JMYA 3E90B 3V13A 3M36A 3DHKH 4CHAC 3LGWA 2GVFA 1KXFA 4Y7BA 8KME2 3V12A 2BDGA 4XOJA 3ODFA 1HAPH 2ZHEH 1SLVB 1BCUH 3SUDA 1MD8A 2XBYA 1QRXA 3Q00A 3ZVEA 1N6YA 4THNH 1UHBA 1VGCB 4IBLH 4ESTE 5T3HA 2K1QA 2BQ6B 3RXEA 3QN7A 4DURA 3MU5A 3ZZ9A 1SQOA 4ISHH 4RN6A 1VCPA 2BD3A 4I8LA 1PQ5A 3SOSA 2BX4A 3PV4A 3SQEE 1TPPA 3QGJA 2UWLA 2FTMA 5EU8A 2BD7A 3NXPA 5HM2A 1W13U 1AD8H 4K8YA 2AGGX 1T8MA 3RXGA 3BEUA 1AFQC 3ZVCA 2EI6A 2GV7A 5HM9A 3F68H 4B75A 1G2MA 4TWWA 2BD2A 3F9EA 5C1UA 1WU1A 2ZFRH 4AB9A 2GMTB 1ZMJA 3BTFE 1BTWA 3T28A 1S85A 4O3TA 1ETSH 1RGQA 1TMBH 1AWFH 1LHCH 2JETB 5DJ7A 1MTNB 3ZYEA 3MH7A 1P11E 3L33A 1TFXA 4GHQA 2W3IA 4AG2A 1GCTB 1NRPH 4NSYA 3ZV8A 3QTOH 3PTNA 1PYTC 5F03A 1SVPA 3SHAH 1SI5H 1SGYE 1F5RA 1EKBB 3EA9A 1MKXK 2AH4X 1D6RA 5T6DA 2J95A 1W11U 5AVDA 3LJOA 2BDBA 5C20A 1TOMH 4K8BA 2GTBA 4ZMAH 2H9TH 4ABJA 1YPGH 1MH0A 1ZZZA 1Y5BT 5A09A 1XUFA 2ASUB 2V6NA 3SO3A 3LPRA 1NFYA 3RXDA 1GDQA 1WAYB 2WV4A 1HFDA 1GBHA 2UWOA 1GJCB 4HFPB 1YPMH 1YF4A 4NWLA 4H4FA 2BY5X 1GI6A 1NFWA 2OQ5A 4BTTB 1C2LA 1VGCC 1D3TB 3RLYH 3ATWA 2VH0A 3P17H 3ZZ3A 2KAIB 4MDSA 1VR1H 2G8TA 3A8BA 3K6YA 3GY8A 2O8WA 2ZQ2A 5F8TA 1MAYA 2TRMA 1GBKA 2OQUA 3KL6A 1SR5C 2OINA 4HZHA 3U9AH 4IC6A 2ZIQH 2O8TA 4FUBA 2F9OA 4IN1A 2YNBA 2A31A 3LH3A 1UTQA 4H6SB 1P2NA 2R2WU 4X6PA 3EQ0H 5HXFA 2HPQH 4INLA 3TPIZ 2HALA 2A4RA 3SGBE 1W10U 4H42U 4D76A 1L1NA 2LPRA 4KELA 1H1BA 1OYTH 2ZI2H 5JB8S 1C4U2 1QBOA 2ZCHP 3BV9B 1AO5A 4JYTA 1OWIA 3GICB 5CHAC 3RXUA 1QIXB 2FXRA 1GI8B 3SU0A 2ZDVH 4XFQA 1KDQB 1T4VH 1OSSA 2O9QA 1QB6A 3S7HB 2SGDE 2FLRH 4DJZB 1HYLA 2XRCA 3GCTF 4ABHA 1GDNA 1IQNA 1O2NA 1QY6A 1QL7A 4AX9H 2ZPQA 1OOKB 1GJ8B 1KTTB 1L0ZA 3RXTA 1O3NA 1D3QB 3MU0A 3ZZBA 4AG1A 1A3BH 2J38A 4VGCC 3VEQB 1V2KT 2DE8A 4XE4A 1GGDB 1C2FA 1TNLA 4ZROA 3UREA 4U30A 2ZHFH 3QX5H 2BY7X 2TPIZ 4KTSA 4X1RU 2R0KA 1DLKB 1EPTB 1P05A 1O5EH 5EPYA 5F8ZA 5TJXA 1NRQH 3MH5A 2AIPA 1RXPA 1GI0A 5DKMA 3ZZAA 1DITH 1TYNA 5FBIA 1AY6H 1O2UA 2FOCA 2J92A 3F1SB 1JIRA 5CHAB 1AGJA 3UR9A 2H5CA 1V2MT 4MPVA 3SGQE 4I8JA 3Q76A 2QYIA 4BAMB 4Y8ZA 2Q6DA 3BSQA 1PPZA 1P8VC 1CHOF 3F9FA 1IOEA 1GWAA 4YLQH 2CHAC 4AGJA 1KY9A 1XVMA 1TGNA 2ZU4A 4NA7A 3ENSB 1SOTA 1WOFA 1XUGA 1KTSB 1GJ7B 1O2JA 2BTCE 2NU0E 5AF9H 2ZU1A 1YPHC 1DWCH 2VU8E 1W8BH 4IC5A 2IN2A 3E8LA 1V2LT 3BG8A 1O5AB 1UK3A 2QXIA 2WUBA 1F92A 2SGFE 3TU7H 3GY6A 4CR5A 3PWBA 3PLPA 3C1KA 5EXLA 5T6FA 4BAKB 4CBOA 4MPWA 2C8WB 2BDAA 4FXGH 4U2WA 3O8RA 1UHBB 2HNTE 3B9FH 2Z9JA 3EGKH 6LPRA 3SUGA 1PQ7A 1QQUA 1ZJDA 3BTKE 1GBAA 1QJ7B 4X2VA 1FQ3A 3RXMA 4X8UH 4GVUA 1H9HE 5CE1A 1D4PB 4MNVA 3ZVFA 4YESB 1ANBA 2FOGA 3JZ2B 3AASA 1PPCE 1P09A 3PROA 1DE7H 2ZFSA 2QC2A