2CV3A

Crystal structure of porcine pancreatic elastase complexed with a macroclyclic peptide inhibitor
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Elastase 1
publication title Structure of the complex of porcine pancreatic elastase with a trimacrocyclic peptide inhibitor FR901451
pubmed doi rcsb
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2cv3A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2cv3A01
1C2HA 4KGAA 1F5LA 2BDIA 1P3EA 1ZSLA 4Y6DA 3A7TA 3ZZ9A 1CT4E 2PV9B 3GCHB 2ODYB 4FVBA 4TYDA 1NFYA 3RXSA 3BTGE 1DM4B 2ZFTA 3TU7H 1O2IA 4NIWA 4B73A 3NUMA 1SPJA 1BMNH 2I6QA 3RU4D 3SU6A 4X6MA 3C27B 2VWMA 2ZA5A 3QGJA 1ZJDA 2ZDMA 2AGGX 2GMTC 1F0TA 4Y7BA 4B2AA 2A7JA 2TGDA 5GCHG 3NKKA 1KTTB 3DA9B 2PTNA 3LC3A 2RG3A 3MNBA 2GD4B 3UY9A 3V0XA 1GDQA 5AHGH 1UMAH 1XXFA 1C1NA 3EE0B 1UO6A 3TGKE 2R3UA 1HYLA 3SNEA 1SC8U 4LOYH 4K1SA 5GJ4B 1C5XB 4Y11E 3T28A 2F3CE 4R0IA 2G4TA 2WV5A 3TJNA 1V2NT 3PROA 1SOZA 1C5WB 3SV8A 1O31A 4TWYA 4ZKNU 1O5FH 1O3KA 2VWLA 1MZAA 4XFQA 2Z7FE 2ZTZA 3SUDA 4YT6H 1QL9A 2ZHEH 2HPQH 3VFEA 4YLUA 3RXOA 2ZGBH 4OS1A 1O38A 2D2DA 1V2WT 1JIRA 1HLTH 1UTMA 1BJUA 4WY3A 2J4IA 2UWOA 4UD9H 3D23A 4H42U 4LZ4B 3LJJA 1MKXH 1P8VC 2OCVB 3KEEA 1C5TA 1AZ8A 1O2ZA 1OS8A 2ZDKA 1SQOA 1NU7B 1O2OA 1MTNC 4ZKSU 2QCYA 4D9RA 1W7GH 6GCHG 1NFUA 3SHCH 1C2GA 1FN8A 1FPCH 1C4V2 1JMOH 1HCGA 4YT7H 1AVWA 3TJUA 3T27A 4FUDA 2FOAA 2AIPA 4MG3A 4MNXA 5T3HA 3T5FH 1V2RT 3GCTG 3VB3A 1EJMA 2SGDE 3QO6A 2D26C 3A8DA 2H9TH 1P09A 2PKAB 2P94A 5JDUB 3P8GA 1FIWA 3VGCC 3KQBA 5T6GA 4AG2A 2Y5GA 1DY8A 2A7CA 3LONA 1ELBA 2G5VA 1S84A 3T26A 3MO9A 3VB7A 5JBBS 5TCAA 2BDYA 1IQKA 3UWIA 1HUTH 4X0WU 1GBFA 1C4Y2 1EOLA 4NA9H 1YCPH 3S69A 1PPCE 2UUJB 3BTWE 1TMBH 2ZU2A 2FDAA 4FUEA 5T6DA 1TRNA 3M5NA 2ZHDA 2BX4A 4D76A 2PWXA 4AYYB 1SLWB 3U98H 1GBJA 2H5CA 1EJNA 1UTPA 1P0SH 1O35A 3RXUA 1O0DH 1RFNA 1TRMA 4MPUA 2F9BH 4BNRA 2ZQ1A 4Q80A 4YTAA 2HOBA 1H4WA 1S6FA 4MTBA 1HXEH 4JK6A 1Z8GA 1V2VT 2A32A 2XXLA 5A2MH 1NPMA 4ZAEA 1GL1A 1O34A 2A5AA 3GY2A 1JRTA 1T32A 2BLVA 1AUJA 2ZZUH 3OX7U 3UREA 4YZUA 2WPIS 3SNDA 3ZVCA 1CSOE 5DG6A 5C5OA 1DLKB 3ODFA 4UEHH 3RXCA 1V2UT 3LGIA 1DY9A 1IAUA 2BXTH 1O37A 2PGQB 4AN7A 4CRCA 2QXJA 3RXPA 1HRTH 2B0FA 1YPHC 1SBWA 3RU4E 5FPTA 1EPTB 2P3UB 3SJKA 4JYVH 3RXFA 3M5MA 1FXYA 1GBCA 2VWNA 3K2UA 1G32B 4GVUA 3F68H 1W2KH 1C1RA 2VIOA 4K8BA 2GT8A 3RXAA 5GCHF 2GX4A 1UTLM 2KAIA 4NFFA 2RA3A 1TB6H 2ZU1A 2ZDLA 5BRRE 2FIRH 4O03A 1TX7A 1N6YA 1ACBE 1J17T 1FV9A 3PWBA 5L2ZH 1V2KT 1AKSB 4Y0YE 2GCTB 1XMNB 1G2LA 1EKBB 1SVPA 1GBTA 1O2JA 3AW1A 2AH4X 4ZKRU 3SI4H 5DP8A 2GZ8A 2BQWB 1GJ9B 2H1UA 4NIYA 3AW0A 1T7CA 4YLQH 1LHGH 1BDAA 3M3SA 4CRAA 3BIUH 1OP2A 3K65B 1NT1A 1BOQA 2QXHA 3KNXA 5EQQA 1O3HA 2WPHS 1XVOA 4WH6A 3ZZAA 7KMEH 3PYHA 1FUJA 5DKMA 4AFZA 1OP8A 1G2MA 4YOJA 1BIOA 5EXNA 1GCDA 4GCHF 2K1QA 4UE7H 2YNBA 2XCFA 3P8NA 4UFGH 1BRAA 1VITG 1RTLA 1O5EH 5DJ7A 4B74A 1TPPA 2Z9KA 1LHDH 1EP6A 1O2VA 3EA8A 1A0HB 3QZRA 5H4IB 4K8YA 3LGWA 2STAE 2THFB 1CGIE 1MQ6A 1A5GH 3PB1E 2XC5A 1C1QA 1B0EA 3BTHE 2DUCA 1C5UA 5JBCS 4WMDA 3ATMA 3F1SB 3R0FA 1O3AA 1T8NA 4IGDA 5GXPA 1MBMA 1ANCA 1AN1E 1YPKH 1MZDA 2BMGB 1LHCH 4DCDA 1GHBG 1T4UH 1CA0C 4O3TA 2WINI 3B23B 4AFUA 2V3OH 1QRXA 1AHTH 1FJSA 2BYAX 1HJ8A 3HGPA 1FMGA 3PMHB 1W11U 3SU2A 4DG4A 1K1LA 2FI4E 1LO6A 1XKAC 2GMTB 1SGRE 2BD2A 1O2QA 2GZ9A 5JBTA 1GBKA 2A31A 1TLDA 3UNQA 4B2BA 2H2ZA 2LNCA 1TWXB 4CRFA 1CGHA 1C5QA 3OY6U 5FPSA 2XW9A 4NG9H 4B71A 3HK3B 5J4SA 1BTPA 3MMGA 1TX6A 1C5ZB 1QIXB 5ESBA 1QA7A 4UFFH 2SGFE 1RGQA 1UVTH 1PQ7A 1C1MA 4IBLH 1O36A 4LXBH 2VH0A 3UUZA 1QL7A 3MNSA 3RXJA 2FXRA 1K21H 1SGNE 1XVMA 3MH4A 2VVUA 4A7IB 4NZLA 3TK6A 1TPSA 1T4VH 2Y82A 5E2OA 2FPZA 2WYGA 3WY8A 4BTIB 5EXMA 4ABJA 4ZXXH 2XNIA 3FP8E 1A3EH 1Z71A 1GG6C 4Y71A 2BD3A 1RIWC 1YBWA 2XCNA 2Z3EA 4ABFA 4CHAB 4ZUHA 4A1VA 5SGAE 1TONA 5HM9A 1ZPZA 1GJAB 2FOHA 2PKAA 4I8GA 4K5ZA 1TNLA 2OQUA 3CENA 4NA8A 2OBQA 2W7SA 2PUXB 1K1OA 1BA8B 2UWLA 3SJ9A 2XC4A 1GI7B 1GVLA 5EQSA 1MTNB 5F8ZA 1SHYA 3SUEA 2EEKA 1DS2E 2ZTXA 1ETRH 1W13U 4NZQA 6CHAC 1KXBA 2JH5D 1GI8B 1H8DH 4FUJA 2VIDA 2ZFQH 2J95A 3FAOA 1HJ9A 2FS8A 1HAIH 1THSH 1OPHB 2Y5HA 1O2GH 1H9HE 5LPEA 3BG4C 1Z6EA 1OYTH 4E05H 5FXLA 1SGEE 1HAOH 1C5NH 1HAGE 4RN6A 1O3GA 3SU3A 4AG1A 5EU8A 2BY5X 2Q6DA 4Q7ZA 2F83A 1ZSKA 4JYUH 4UFDH 3VGCB 1DWCH 2ASUB 3KIDU 1PQ5A 2ANWA 2PR3A 1ZTKA 4ISIH 2A4QA 4WJG2 3MU1A 1GHAF 3GY7A 1QFKH 2FS9A 1UK2A 1CQQA 3SV9A 1ZMNA 3F6UH 3MTYA 1O2UA 3E8LA 4X2XA 3U69H 3EA7A 5BPEA 1VJAU 4BXWA 1CBWC 2ZIQH 3M35A 4GLYA 1ETSH 2FTMA 3HKIB 2WPJS 5ETXA 2G55A 3LKWA 1UTJA 4B76A 4OS7A 3SGAE 3RXBA 5ABWA 1WYKA 1L4DA 1GI0A 4CR5A 1C4U2 3EAJA 1QGFA 3RLWH 1BB0B 1QB1A 4U01A 1E36B 4X8SH 1L1GA 1KLJH 3ZZ8A 3FVFB 3T2NA 4YM9A 1YP9A 2Z6BD 4FXGH 3I77A 2FOFA 1MKWK 1P05A 4YOIA 2Q6FA 1IHTH 2Y7XA 4J2YB 2O8MA 2FOMB 3BTTE 3RXQA 1PYTC 3BTKE 2Y6TA 4I31A 1EPTA 1VITF 1O32A 3FFGA 4JMYA 1UK3A 3UNSA 1GVZA 4INLA 1MU8B 3EDXB 3HGNA 3RC5A 1Y59T 1CVWH 1X7AC 1C2DA 3ATIA 4MDSA 1EP5A 1YPEH 4AORA 2FYRA 1GJCB 2AIQA 1MTSA 3T62A 1OXGA 4X1SU 2FOBA 1A1RA 5EODA 1BTWA 1AKSA 5C3NA 1TPAE 3UQOA 1AVGH 1O2WA 1L4ZA 3O8CA 3Q77A 3RXTA 1GHBF 1HGTH 1O2SA 1SR5C 1P57B 5GPIB 4WMFA 2SFAA 3SV7A 4ZHMU 3SHAH 3ATWA 3GCNA 2IPHA 1YM0A 4BAOB 2UUYA 1Q31A 1W0YH 3P8OA 4FVDA 2H5DA 4Y8YA 2BY6X 1NO9H 2AERH 3KGPA 3EGKH 3M7UA 3RXGA 1K1JA 1P02A 4HTCH 2SGQE 2B9LA 1O3LA 1D4PB 2PHBA 1Y5AT 1XUJA 1QJ6B 2SGPE 1Q3XA 3M5LA 1F2SE 3ENSB 2FI5E 2OLGA 3SO3A 1HAXB 3RXDA 3SUGA 3U8TH 3UFAA 1JRSA 3DT0H 2P8OC 2G5NA 3DFJA 1O3IA 1TGBA 1HNEE 1ARBA 2CF9H 5CE1A 4CBNA 2BDAA 3QDZB 1H9IE 3GCOA 3DD2H 2PLXA 2J34A 4XBBA 4OGXA 2GV6A 4X1QU 1IQEA 1E37B 1GI1A 1QNJA 1O3DA 2PFEA 1ANDA 2A4GA 2ZCHP 1VGCC 1KYNA 3HK6B 2A0QB 1O3NA 2A45B 1YGCH 2C3SA 1DE7H 4Y79A 1F7ZA 4X8VH 3V3MA 1KTSB 1Y3VA 2QV1A 3TJOA 4CH2B 3D62A 1NTPA 1INCA 1A4WH 2HGTH 4X6PA 3KHVA 3MH5A 1ELVA 3A88A 5JB8S 2QY0B 1MU6B 1IQFA 1BT7A 5EGMA 3BG8A 4MPWA 1VCQA 1PPEE 4AGKA 5K0HA 2O8TA 2XRCA 2G00A 5FPYA 1TNHA 3LGYA 5I46H 4RSPA 1DT2A 1ZRKA 3OYPA 3ZZ7A 5EPYA 3NZIA 1Y3YA 3A7WA 3SQHE 2FOEA 2XC0A 3D65E 1A61H 1NESE 2RCEA 3GY3A 5F6MA 3BTDE 1KLIH 1J8AA 1CA0B 5DP4A 4GCHG 2ZFFH 3TNSA 4K60A 1GHWH 2A1DB 3RMMH 1LVYA 3QN7A 5E0HA 4ASHA 4ZMAH 4WH8A 2JH6D 1LQEA 2FODA 1XM1A 3UOUA 1IOEA 1YYY1 1O3EA 2ZDVH 1TABE 2CMYA 1UVUH 4H6SB 4X1PU 5A8XA 1FY4A 5FAHA 1DITH 1QB6A 1MKXK 4X8UH 2ZU5A 1OYQA 1DX5M 1ZMLA 4FU8A 2BQ7B 1QA0A 3BEIB 2CHAC 1PPHE 5T6FA 2ZGXH 4IMQA 3TJVA 4ISNA 3Q3YA 4OS6A 4KELA 5L2YH 1YPLH 1KDQB 2NWNA 3ATKA 4Y8ZA 2QF3A 3E16B 3T29A 3GYMA 3RMNH 1BQYA 4NA7A 2GCHG 2QYIA 3OY5U 1HAVB 3UWJH 3MI4A 1BHXF 1C2LA 3S9AA 3K6ZA 1K1MA 2CXVA 3BTFE 1GG6B 3M5OA 3UTUH 5EG4A 1GJ6A 1Z8JB 2IJOB 2F9NA 1ELFA 2TGTA 1ESTA 3RMLH 1UTNA 3E0PB 1VCWA 2ILNA 3MNXA 5FBEA 1BBRH 2BLQA 3SGBE 2EI7A 1JBUH 1K1PA 1WCZA 1YCPK 2F9OA 2R0LA 1ZGVA 8GCHF 1HJAB 1ZSJA 3VB6A 4AYVB 3EA9A 1Z1IA 5LPRA 1AIXH 1SI5H 1BRUP 4JZFH 2EI6A 1GBEA 1LKBA 2DE9A 2G52A 6CHAB 1ESAA 1BTZA 3ZVBA 2BD4A 1T8MA 2D8WA 1G3CA 1HIAB 1TFXA 4Q7YA 5A09A 1AWHB 2VGCC 1AD8H 1O33A 2ZO3H 1ELGA 1SOTA 2P3TB 3A7XA 3BG4B 1GVKB 3ZVEA 5GWZA 3A85A 4M7GA 1UHBA 3Q76A 1XUFA 1QBVH 1PPBH 1TQ7B 1NZQH 4INKA 5HXFA 3RM2H 2OC0A 3QX5H 2J9NA 1H8IH 1ZGIA 4ABEA 2ZP0H 1ELEE 1CBWB 3BN9A 4CH8B 2FM2A 1ZJKA 3H7TA 1SGQE 4X2YA 2VH6A 3A86A 1MD8A 1UTQA 3Q3XA 3W95A 1LPKB 5FX5A 3I29A 3SV2H 4Y76A 2C93B 3E6PH 4BAMB 3LT3A 4TPYA 1BJVA 3VXEH 4B1TA 1C1PA 2AMDA 3S0NA 3MYWA 5J4QA 1DWBH 3OTJE 1GI5A 1P2OA 2J92A 2FTLE 1GGDC 1J15A 3D49H 2O8LA 1XX9A 1C1WH 3W94A 4BTTB 1LTOA 5K7RA 2FOGA 3A87A 1BHXB 3E1XB 1C1OA 1TNKA 3LH3A 3L33A 3SNCA 1O2MA 2CV3A 4NFEA 1GHAG 5L30H 1GJ4H 1F0SA 1C5PA 1BTHH 4WWYA 3E91A 1M9UA 1EXFA 1ETTH 5CHAB 1ELDE 1OWJA 2A4OA 4Y0ZE 1O5AB 2W3KA 1C5LH 4ABIA 2BVSH 3M7TA 1P10A 2WUCA 1AUTC 4MNYA 1TA2A 1FIZA 3QTOH 4DJZB 1CU1A 2STBE 3H7OA 5PTPA 3SORA 1VJ9U 1SFIA 1ANBA 1TALA 1FY5A 4CRGA 1UCYH 1TGSZ 1GI9B 3GCHC 4I8HA 1OWKA 3FZZA 1WTGH 2BX3A 1EZQA 3RM0H 4BANB 4NCYA 8LPRA 1WTHD 1SLUB 1OSSA 2BLOA 1EX3A 1O5BB 1GBLA 3KQDA 1GCTB 3AAVA 1WAYB 3S9BA 1FN6A 1S0QA 4BOHA 4FUFA 3U8RH 1CT2E 5A8ZA 2B5TB 4DW2U 4A1XA 3RXKA 2C90B 1XUHA 3A8AA 3QUMP 4DVAU 3B8JA 3AVZA 3PV4A 1DWDH 1GI4A 1GI6A 1QURH 4D7GA 5EPNA 1NFWA 4SGBE 4FUIA 1QTFA 1Y3UA 1IQIA 3IITA 2XBVA 2OC1A 2BY8X 2AGEX 3ZZCA 4NWLA 4K2YA 2WUBA 4IN2A 1PPGE 4Z0KA 4TY6A 1OP0A 3PM3A 1O2TA 1TRYA 3AASA 4IS5A 3ZV9A 2FO9A 2GCHF 2UUFB 1TPOA 4DIIH 3QK1A 4K69A 2HNTE 5TJXA 4A1TA 1GBBA 5FBIA 1RTKA 4RKOB 2I6SA 1H9LB 2SNWA 2Z9GA 1W3CA 2A5KA 4ZXYH 3F9GA 1P11E 1LHFH 3QTVH 1ZLRA 5E8EH 2JKHA 1AVXA 1LHEH 2FLBH 2HVXA 1T8LA 3TGIE 1UVPA 4NSVA 1SGCA 3S7HB 1GBIA 3A80A 5LGOA 3MH6A 1FQ3A 1GJ8B 4FU7A 3NK8A 1KXFA 2H9EH 4KP0A 1MCVA 3ZZBA 1AMHA 1SLXB 2PUQH 1TX8A 1SMFE 2UUKB 1ZHMA 1VITH 3RU4T 1DOJA 1S85A 3HATH 1HXFH 1E0FD 1DUEA 1CGJE 1MTUA 2JETC 1AB9C 2HLCA 3ELAH 1IQMA 2BM2A 1GI3A 5A8YA 2FEQH 1LVMA 3BTME 1DVAH 1F5RA 1GBMA 1BTXA 2BZ6H 4ISLA 2PKSC 3VB4A 2G8TA 1KDQA 1ORFA 2M5TA 1SGDE 5DO4H 1G3EA 1GBHA 4X1NU 3U8OH 1RXPA 1AY6H 3B9FH 4FU9A 1JIMA 2Z3DA 2ODQA 1HAVA 1JXPA 1ZPCA 2VU8E 1GJBB 3MO6A 1V2ST 3LIWA 4JZEH 3OSYA 3UNRA 4E7RG 1XUIA 1EUFA 2OUAA 1O3JA 3TK9A 1LQDB 2CHAB 1GPZA 1C1VH 4BAQB 2BZAA 1BZXE 1HDTH 2R9PA 3GISB 3RMOH 1OWHA 2AGIX 1KXAA 1UTKA 4ZKOU 5B6OA 1GDNA 1MCTA 9LPRA 1MUEB 1GI2A 2XTTB 2WV4A 1D6RA 3IWMA 3A7YA 5C1UA 1FPHH 3LU9B 1MAYA 1Z6JH 2Q1JA 1P9UA 1HIAA 3LGTA 4RKJB 1L0ZA 3ITIA 1V6DA 1J16A 1GHVH 1O3PB 1PFXC 3KN2A 1T31A 3SJIA 2W5EA 1Z7KA 2HRVA 2GVFA 4AFSA 1UVSH 2AYWA 4IW4E 4I7YH 2FMJA 1AFEH 3BF6H 3SQEE 1HV7A 3A7VA 1BTYA 3ZZ5A 2VIPA 2FX4A 5F03A 1TBRH 1P04A 1UHBB 1QRWA 4MPVA 1UK4A 1CO7E 3RDZA 3PWCA 1THPB 4X6OA 2BD7A 2AMPA 4AB9A 4D7FA 4LZ1H 2BHGA 2BDCA 1O2YA 2Y80A 1YKTA 2SGAA 2HPPH 1S82A 3OU0A 4GAWA 4E06H 2QA9E 1OOKB 2NU0E 2TGPZ 2BTCE 1ABIH 1GWAA 1WQSA 1WSSH 2A5IA 1P2IA 1EASA 2Y7ZA 3PMJA 1BMMH 4A6LA 1C2FA 1EZSC 4WVPE 2V3HH 1O2NA 1K9OE 2DE8A 2W26A 3ODDA 1N1LA 4ZROA 1D3TB 4U32A 1K22H 1C5RA 3ZZDA 2IN2A 1O5GH 1G36A 4ZH8A 1QQ4A 4IMZA 3STIA 1B0FA 4OS2A 2CN0H 1SGFG 4NWKA 3ZZ3A 1OKXA 2OC8A 1VR1H 4JCNA 4U30A 8GCHG 1LKAA 4CR9A 1G37A 2XYAA 2FI3E 3SW2B 2FOCA 4GUXA 3U1IB 4BAHB 1V2QT 1TBZH 2A4RA 1NRRH 3UQVA 1YPJH 1GHZA 3RXLA 1AE8H 1FNIA 3QZQA 3M61U 1FY1A 1NM6A 1O5DH 3E3TA 1SGFA 3VPKA 1DUAA 2ULLA 4YO9A 2F9PA 5DP3A 3FANA 1FI8A 4KTUA 2Q6GA 2R3YA 3TPIZ 4UFEH 7GCHF 1AZZA 1Y3XA 1GGDB 3A81A 5GIBA 3EQ0H 3RXRA 1N6XA 2ZGJA 3TH2H 3MU5A 2SGEE 2YOLA 3ZYDA 1DXPA 4ZHAA 2ALVA 1TBQH 3LGUA 4FUHA 1S5SA 1ANEA 1EQ9A 4OGYA 3MOCA 1SGTA 2C8ZB 4DT7B 1NROH 3BIVH 3K9XB 1DPOA 2ZPRA 1P2KA 1S83A 2J38A 3P6ZB 2ZDAH 1GL0E 2ZECA 2BDHA 3GYLB 1RD3B 2YNAA 2BVRH 4AFQA 3MH7A 1O3MA 2O8UA 1DICA 3VEQB 2OTVA 1OWEA 1C2EA 3HKJB 3UR6A 9ESTA 3QWCH 4O9VA 4A92A 3ZZ4A 3P8FA 1EOJA 1MMJN 5DK1A 4AX9H 2R2WU 4Z6AH 2PSXA 3E0NB 1ZZZA 5C5NA 3I78A 1C2KA 1SHHB 3O8BA 4HI3A 1V2LT 4QT8C 5F8TA 1E38B 1GMCF 1QBNA 8KME2 3PTBA 2PGBB 2CGAA 2Z9IA 2XBXA 5AFYH 1WOFA 3FZDA 2GDDA 1E35B 1MQ5A 4XE4A 4CRBA 1ZYOA 1O2XA 3LPRA 3ZVDA 1A3BH 2UWPA 2Z9LA 5JB9S 1P01A 2XBWA 2ZF0H 5HGGA 3S9CA 1XKBC 2G81E 1QQUA 4I8JA 2WPKS 1SSXA 1V2TT 2V0BA 1SFQB 1AFQC 2ZEBA 3SU1A 3LDXH 1P2QA 1IQJA 4NIXA 4DY7B 4K1TA 2ZHWH 1XXDA 1F5KU 3BTEE 3EYDA 1Y8TA 4ZHLU 1HAZB 2FZZA 1IQLA 2ANYA 4ABBA 3UOPA 1LMWB 2R0KA 1EB1H 1GBAA 1N8OC 3TGJE 4DGJA 2TBSA 1LVOA 4ISHH 1FLEE 3ESTA 4WXIA 1G3BA 2EC9H 1YLCA 2VJ1A 2AFQB 2C4FH 5E0GA 3JZ2B 3STJA 5A0AE 5LPFA 3SNBA 1W14U 1O2RA 4CHAC 4JK5A 1GJDB 3Q3KA 2Y5FA 5ESTE 2CF8H 5TCCA 2AMQA 1PQAA 1EAIA 3A89A 1P2MA 3KF2A 1J9CH 2NU2E 3O8RA 4VGCC 2ZCLP 3ATLA 1ZHRA 1W10U 3SU0A 5EW2H 3V13A 5HYOA 1LPGB 1MAXA 1F92A 1PJPA 3URCA 2P3FH 1JOUB 4FUCA 3SU4A 5I25A 1NRNH 3NCLA 1BMLA 1ID5H 2ZFRH 2ZGHA 3ZYEA 1AI8H 3BTQE 4NGAH 3ZZ6A 1C2IA 2PTCE 1G3DA 2GTBA 1AGJA 1UJ1A 2JETB 2VWOA 1AB9B 3PLKA 1P9SA 1HBTH 1LPZB 3H5CB 3PMBB 2FX6A 5L6NH 4D9QA 3RC6A 1P2JA 1NFXA 1TGCA 2EI8A 1YLDA 4JZIA 5DP7A 3S7KB 6LPRA 1GDUA 2P16A 3GDSA 1RIWB 2PKSB 3TK5A 2NU1E 4H6TA 1C2MA 3SN8A 3RXIA 2ALPA 2TIOA 1WQVH 2GZ7A 1A0JA 1ESBA 2ZHQH 1OX1A 1SGYE 4PROA 1K2I1 4OS5A 1TA6A 1SG8B 3P17H 1Z8IB 4AB8A 3G01A 3RXMA 1Y5BT 1AO5A 2Z9JA 1A5HA 1ELTA 3TIUA 1W8BH 1BBRE 1AQ7A 3CS0A 3L6PA 1C5MD 1RRKA 5A0BA 4H4FA 2OBOA 1BBRK 2ZGCA 2BDBA 3HPTB 4WF8A 2ZKSA 3TH4H 1Y3WA 1MH0A 1A0LA 1V2JT 4I8LA 3PLBA 3A84A 1TOCB 1NY22 5C1XA 2Z3CA 3VB5A 1TMTH 1O2HA 1T8OA 3DUXH 1O2LA 3E90B 4AOQA 2J94A 1ELAA 1FZZA 1RS0A 1H1BA 1HFDA 3NWUA 3SZNA 1DFPA 1UTOA 3KL6A 1TNJA 8ESTE 2V35A 3LGVA 2OINA 2H6MA 4OS4A 4KTCA 3M37A 2O8WA 3CP7A 3BV9B 1EJAA 2WPMS 3TLOA 3IG6B 1J14A 2ZU4A 2ZFSA 4XBCA 2O9QA 3PO1C 2ZI2H 3VXFH 1P3CA 1FAKH 2VINA 3FP6E 3M3TA 1THRH 1ZMJA 5IDKA 3BSQA 1MTWA 5F8XA 1D3QB 1ARCA 4GHTA 1C5YB 1SB1H 3T25A 1KXDA 2ANMH 5FHTA 3RP2A 3SV6A 1W7XH 2OXSA 2ESTE 2QGRA 1YPMH 1YPGH 1SGIB 2RA0A 2ZPQA 1QHRB 5FCKA 1EB2A 1Z1JA 2QXIA 4E7NA 3MU4A 4TWWA 3GY5A 1U6QA 4WMEA 1DSTA 3MFJA 4AGJA 2F9VA 4ABGA 1ZHPA 5DPAA 5EQRA 4X1RU 1DLEA 3GICB 1CHOG 5C20A 3UIRA 1O3FA 2FWWA 2QF0A 1ZR0A 1EZXC 1V2OT 4BTUB 1GJ7B 3NPSA 1OWDA 1D9IA 2HNTC 4MVNA 1ELCA 1CA8B 3QLPH 2ZPSA 3N7OA 1YF4A 2ZHFH 1V2MT 2VVVA 1FONA 3AAUA 1BITA 4JZDH 1LCYA 2Y81A 3KQEA 1L1JA 1D3PB 2BXUH 3ZV8A 4B75A 4MPXA 1DXWA 3SOSA 4TY7A 2G51A 5AVDA 1TAWA 4CREA 3MNCA 2W7UA 1AE5A 1W12U 2FYQA 5G4BA 1TMUH 4I8KA 1WUNH 4O97A 1QR3E 2BD8A 1S81A 4IC5A 1UCYE 2FLRH 1NRSH 2ZFPH 3U9AH 3A82A 3MU0A 1UCYK 1NU9A 4LK4A 1QBOA 1TGTA 5AFZH 3RUOA 1O2PA 3A83A 3DHKH 4JZ1A 1GHXH 2BY7X 2NU4E 4X8TH 4FUGA 2ZG0H 4ISOA 1YPHE 1O5CB 4Q7XA 1F0UA 1FY8E 2QXGA 1HAYB 2EA3A 1HB0B 1TIOA 1WV7H 1ABJH 4Q2KA 2VB0A 1YC0A 4ESTE 6GCHF 4BXSA 2P8OB 4SGAE 4KKDA 4JYTA 2C8XB 1ZRBA 5AF9H 1SL3A 1P12E 3SU5A 2A7HA 2V6NA 3GCTF 1HAHH 3M36A 2H9HA 1MTVA 2QAAA 2ZWLH 3TVJB 1IQHA 1W0ZU 2BY9X 2CJIA 1TE0A 3P92A 3UPEA 1F0RA 3JZ1B 3KCGH 1VGCB 7GCHG 1GMHG 5IYTA 2ZTYA 7LPRA 1EZUC 4IC6A 1O3CA 2FESH 3PMAB 5DP6A 4D8NA 2BOKA 2LPRA 1Y5UT 2B8OH 2A2QH 1FY3A 1TOMH 1BTUA 5DP5A 5EOKA 5EXLA 2P59A 4DOQA 3P95A 3C1KA 1P2NA 4DURA 1FAXA 3FP7E 4HFPB 1IQGA 3CS7A 1GMDG 5C1YA 4MLFB 2TPIZ 3GY8A 2HALA 5LH8A 1KXEA 2P93A 5JBAS 2AEIH 1CHGA 1NS3A 2ZNKH 4NSYA 1B5GH 5HM2A 1DSUA 2W3IA 4A5TS 2JH0D 4UONA 3TH3H 3F9EA 3RXVA 1QRZA 5FCRA 2ZDNA 1EAUA 4F4OC 1Z8RA 2AS9A 7ESTE 1AFQB 2B7DH 2ZC9H 4CRDA 2XBYA 3Q00A 3A8CA 3O8DA 3GY6A 6ESTA 2XWBI 1CT0E 4BAKB 1PYTD 3GDUA 2VIVA 4NIVA 4HGCA 4Y10E 1JWTA 5A0CA 2C8YB 1TQ0B 1N8OB 4F49A 1A2CH 1KY9A 3PLPA 1D6WA 1RTFB 1GMCG 3M7QA 5E0JA 3R3GB 3RC4A 3ZVGA 2GV7A 1S0RA 4J1YA 1QB9A 3ZVAA 4UDWH 1BRCE 1GBDA 2GT7A 1NRQH 1ZTJA 1C1TA 5C2ZA 2A2XH 1DDJA 4B2CA 1MBQA 4X6NA 2PW8H 1CE5A 2BLWA 4WXVA 2OQ5A 1FDPA 1NC6A 3A8BA 4VGCB 4THNH 1GJ5H 3NXPA 4MNWA 1A46H 1O2KA 3RXHA 5JPMH 2BOHB 1C1SA 1D3DB 4INHA 4KTSA 2QC2A 3A7ZA 2ZU3A 1HJAC 2IOTA 2ZCKP 1C2JA 1MD7A 3SI3H 2BVXH 1GHYH 3MU8A 2GGVB 3GOVB 4XBDA 2BD9A 1TGNA 1ZOMA 1L1NA 3U1JB 1EAWA 2BQ6B 1CHOF 3L3TA 4ABHA 1DWEH 3V12A 1C5VA 3ZVFA 3TITA 2OD3B 4AZ2B 1K28D 2VIQA 4U2WA 1RJXB 1TNGA 2R2MB 1HPGA 1LDTT 1O39A 1G30B 1O3BA 1P03A 5FX6A 4I32A 3SUFA 1QL8A 1S6HA 3SJOA 5GDSH 2BB4A 2VIWA 1A5IA 3MO3A 1VCPA 1EAXA 2HNTF 4YOGA 3GY4A 1BCUH 1IHSH 4TPIZ 5JYIA 3F9HA 4IN1A 5C67A 5EW1H 4XOJA 1SLVB 1WU1A 1BRBE 3RXEA 3URDA 1SQTA 1TYNA 1C1UH 3SGQE 4GPGA 2OC7A 2TRMA 3BEUA 4FUBA 3SBKA 1UVOA 1EPTC 1YCPM 3DFLA 2TGAA 2P95A 2D1JA 1EATA 1MKWH 1V2PT 1NN6A 3LOXA 3TNTA 1C5OH 1XUGA 2HWLB 1C9TA 4O3UA 3LJOA 2VGCB 1TNIA 2GP9B 1BUIA 3KQCA 3M3VA 2NU3E 4XSKU 1L2EA 4MQAA 2G4UA 2BDGA 1SQAA 2F91A 3SNAA 2GDEH 4R8TB 1PPZA 1QY6A 4ABDA 1QJ7B 2GCTC 1DANH 1ZTLA 1Q2WA 3K6YA 1G9IE 4DIHH 3RLYH 1AU8A 2WPLS 2ODPA 1AWFH 2Z94A 5CHAC 2WYJA 3PO1B 1E34B 2VNTA 5DP9A 1K1IA 2VVCA 2XWAA 3GDVA 4I33A 2J2UA 1QJ1B 4Y7AA 1BMAA 4Y8XA 1P06A 1WBGB 2OP9A 3MWIU 1IQNA 4ABAA 3SJ8A 1C5SA 3F9FA 3P70B 4CBOA 3MHWU 1V3XA 5DGJA 1OWIA 4GHQA 2KAIB 4YESB 1ZPBA 4MNVA 3V7TA 2ZQ2A 2QIQA 3LH1A 1B7XB 1GMHF 2PSYA 2BD5A 1O30A 1QCPA 4X2VA 1A7SA 1HAPH 1XUKA 4K1EA 2C8WB 2F9UA 1LVBA 1VZQH 2RDLA 1GCTC 1KXCA 3BEFB 1PQ8A 3PTNA 2GKVE 4K3JA 1SGPE 1K1NA 5HMAA 1GMDF 2QN5T 1KIGH 3QGNB 1KSNA 1NRPH 5E2PA 1PPFE 5CMXH 4HZHA 1KLTA 2SNVA 4X2WA 1C9PA 3LC5A 2ANKH 4GSOA 4XDEA 3UR9A 1O3OA 2FP7B
chains in the Genus database with same CATH superfamily
1C2HA 4KGAA 1F5LA 2BDIA 1P3EA 1ZSLA 4Y6DA 3A7TA 3ZZ9A 1CT4E 2PV9B 3GCHB 2ODYB 4FVBA 4TYDA 1NFYA 3RXSA 3BTGE 1DM4B 2ZFTA 3TU7H 1O2IA 4NIWA 4B73A 4OM9A 3PV5A 3NUMA 1SPJA 1BMNH 2I6QA 3RU4D 3SU6A 4X6MA 3C27B 2VWMA 2ZA5A 3QGJA 1ZJDA 2ZDMA 3OE7D 2AGGX 2GMTC 1F0TA 4Y7BA 4B2AA 2A7JA 2TGDA 5GCHG 3NKKA 1KTTB 3DA9B 2PTNA 3LC3A 4XRNA 2RG3A 3MNBA 2GD4B 3UY9A 3V0XA 1GDQA 5AHGH 1UMAH 1XXFA 1C1NA 3EE0B 1UO6A 3TGKE 2R3UA 1HYLA 3SNEA 2LELA 1SC8U 4LOYH 4K1SA 5GJ4B 1C5XB 4Y11E 3T28A 2F3CE 4R0IA 2G4TA 2WV5A 3TJNA 1V2NT 3PROA 1SOZA 1C5WB 3SV8A 1O31A 4TWYA 4ZKNU 1O5FH 1O3KA 2VWLA 1MZAA 4XFQA 2Z7FE 2ZTZA 3SUDA 4YT6H 1QL9A 2ZHEH 5KEDA 2HPQH 3VFEA 4YLUA 3N99A 2ZGBH 4OS1A 3RXOA 1O38A 2D2DA 1V2WT 1JIRA 1HLTH 1UTMA 1BJUA 4WY3A 4DT4A 2J4IA 2QF4A 2UWOA 4UD9H 3D23A 4H42U 3U28C 4LZ4B 3LJJA 1MKXH 1P8VC 2OCVB 3KEEA 1C5TA 1AZ8A 1O2ZA 1OS8A 2ZDKA 1KMHB 1SQOA 1NU7B 1O2OA 1MTNC 4ZKSU 2QCYA 4D9RA 1W7GH 6GCHG 1NFUA 3SHCH 1C2GA 1FN8A 1FPCH 1C4V2 1JMOH 1HCGA 4YT7H 1AVWA 3TJUA 3T27A 4FUDA 2FOAA 2AIPA 4MG3A 4MNXA 5T3HA 3T5FH 3DSPA 1V2RT 3GCTG 3VB3A 1EJMA 1H8HD 2SGDE 3QO6A 2D26C 3A8DA 2H9TH 1P09A 2PKAB 2P94A 3FN8A 5JDUB 3P8GA 3WWFA 1FIWA 3VGCC 3KQBA 5T6GA 4AG2A 2Y5GA 1DY8A 3WWBA 2A7CA 3LONA 1ELBA 2G5VA 1S84A 3T26A 3F0OA 3MO9A 3VB7A 5JBBS 5TCAA 2BDYA 1IQKA 3UWIA 1HUTH 4X0WU 1GBFA 1C4Y2 1EOLA 4NA9H 3AK5A 1YCPH 3S69A 1PPCE 2UUJB 3BTWE 1TMBH 2ZU2A 2FDAA 4FUEA 5T6DA 1TRNA 3M5NA 2ZHDA 2BX4A 4D76A 2PWXA 4AYYB 1SLWB 3U98H 1GBJA 2H5CA 1EJNA 1UTPA 1P0SH 1O35A 3RXUA 1O0DH 1RFNA 1TRMA 5HIYA 4MPUA 2F9BH 4BNRA 2ZQ1A 2WHXA 4Q80A 4YTAA 2HOBA 1H4WA 1S6FA 4MTBA 1HXEH 3ZIAD 4JK6A 1Z8GA 1V2VT 2A32A 2XXLA 5A2MH 1NPMA 4ZAEA 1GL1A 1O34A 2A5AA 3GY2A 1JRTA 1T32A 2BLVA 1AUJA 2ZZUH 3OX7U 3UREA 4YZUA 2WPIS 3SNDA 3ZVCA 5HKKD 1CSOE 5DG6A 5C5OA 1DLKB 3ODFA 4UEHH 2KCOA 3RXCA 1V2UT 3LGIA 1DY9A 2JJ2D 1IAUA 2BXTH 1O37A 2PGQB 4AN7A 4CRCA 2QXJA 3RXPA 1HRTH 2B0FA 1YPHC 1SBWA 3RU4E 5FPTA 1EPTB 2P3UB 3SJKA 4JYVH 4XD7D 3RXFA 3M5MA 1FXYA 1GBCA 2VWNA 3K2UA 1G32B 4GVUA 3F68H 1UW7A 1C1RA 1W2KH 2VIOA 4K8BA 2GT8A 3RXAA 5GCHF 2GX4A 1UTLM 2KAIA 4NFFA 2KFWA 2RA3A 1TB6H 2ZU1A 2ZDLA 4B6EA 5BRRE 2FIRH 4O03A 1TX7A 1N6YA 1ACBE 1J17T 1FV9A 3PWBA 5L2ZH 1V2KT 1AKSB 4Y0YE 2GCTB 1XMNB 1G2LA 1EKBB 2RDEA 1SVPA 1GBTA 1O2JA 3AW1A 2AH4X 4ZKRU 3SI4H 5DP8A 1E1QD 2GZ8A 2BQWB 1GJ9B 2CK3D 2H1UA 4NIYA 3AW0A 1T7CA 4YLQH 1LHGH 1BDAA 3M3SA 4CRAA 3BIUH 1OP2A 3K65B 1NT1A 1BOQA 2QXHA 3KNXA 5EQQA 3F2FA 1O3HA 2WPHS 1WXRA 1XVOA 4WH6A 3ZZAA 7KMEH 3PYHA 1FUJA 5DKMA 4AFZA 1OP8A 1G2MA 4YOJA 1BIOA 5EXNA 1GCDA 4GCHF 2K1QA 4UE7H 2YNBA 2XCFA 3P8NA 4UFGH 1BRAA 1VITG 1RTLA 1O5EH 5DJ7A 4B74A 1TPPA 2Z9KA 1LHDH 1EP6A 1O2VA 3EA8A 1A0HB 3QZRA 5H4IB 4K8YA 3LGWA 2STAE 2THFB 3KQ5A 1CGIE 1MQ6A 1A5GH 3PB1E 2XC5A 1C1QA 2L74A 1B0EA 3BTHE 2DUCA 1C5UA 3PRDA 5JBCS 4WMDA 3ATMA 3F1SB 3R0FA 1O3AA 1T8NA 4IGDA 5GXPA 1MBMA 1ANCA 1AN1E 1YPKH 1MZDA 2BMGB 1LHCH 4DCDA 1GHBG 1T4UH 2EY4C 1CA0C 4O3TA 2WINI 3B23B 4AFUA 2V3OH 1QRXA 1AHTH 2J98A 1FJSA 2BYAX 1HJ8A 3HGPA 1FMGA 3PMHB 1W11U 3SU2A 4DG4A 1NBMD 1K1LA 2FI4E 1LO6A 1XKAC 2GMTB 1SGRE 2BD2A 3F3BA 1O2QA 2GZ9A 5JBTA 1GBKA 2A31A 1TLDA 3UNQA 4B2BA 2H2ZA 2LNCA 1TWXB 4CRFA 1CGHA 1C5QA 3OY6U 5FPSA 2XW9A 4NG9H 4B71A 3HK3B 5J4SA 1BTPA 3MMGA 1TX6A 1C5ZB 1QIXB 5ESBA 1QA7A 4UFFH 2SGFE 1RGQA 1UVTH 5EJZA 3FKSD 1PQ7A 1C1MA 4IBLH 1O36A 4LXBH 2VH0A 3UUZA 1QL7A 3MNSA 3RXJA 2FXRA 1K21H 1SGNE 1XVMA 3MH4A 2VVUA 4A7IB 4NZLA 3TK6A 1TPSA 1T4VH 2Y82A 5E2OA 2FPZA 2WYGA 3WY8A 4BTIB 5EXMA 4ABJA 4ZXXH 2XNIA 3FP8E 1A3EH 1Z71A 1GG6C 4Y71A 2BD3A 1RIWC 1YBWA 2XCNA 3H09A 2Z3EA 4ABFA 4CHAB 4ZUHA 4A1VA 5SGAE 1TONA 5HM9A 1ZPZA 1GJAB 2FOHA 2PKAA 4I8GA 4K5ZA 1TNLA 2OQUA 3CENA 4NA8A 2OBQA 2W7SA 2PUXB 1K1OA 1BA8B 2UWLA 3SJ9A 2XC4A 1GI7B 1GVLA 5EQSA 1MTNB 3F2GA 5F8ZA 1SHYA 3SUEA 2EEKA 1DS2E 2ZTXA 1ETRH 1W13U 4NZQA 6CHAC 1KXBA 2JH5D 1GI8B 1H8DH 4FUJA 2VIDA 2ZFQH 2IJD1 2J95A 3FAOA 1HJ9A 2FS8A 2EQNA 1HAIH 1THSH 1OPHB 2Y5HA 1O2GH 1H9HE 5LPEA 3BG4C 1Z6EA 4RT1A 1OYTH 4E05H 5FXLA 1SGEE 1HAOH 1C5NH 1HAGE 4RN6A 1O3GA 3SU3A 4AG1A 5EU8A 4F48B 2BY5X 2Q6DA 4Q7ZA 2F83A 1ZSKA 4JYUH 4UFDH 3VGCB 1DWCH 2ASUB 3KIDU 1PQ5A 2ANWA 2PR3A 1ZTKA 4ISIH 2A4QA 4WJG2 3MU1A 1GHAF 3GY7A 1QFKH 2FS9A 1UK2A 1CQQA 3SV9A 1ZMNA 3F6UH 3MTYA 1O2UA 3E8LA 4X2XA 3U69H 3EA7A 5EJLA 5BPEA 1VJAU 4BXWA 1CBWC 2ZIQH 3M35A 4GLYA 1ETSH 2FTMA 3HKIB 2WPJS 5ETXA 2G55A 3LKWA 1UTJA 4B76A 4OS7A 3SGAE 3RXBA 5ABWA 1WYKA 1L4DA 1GI0A 4CR5A 1C4U2 3EAJA 1QGFA 3RLWH 1BB0B 1QB1A 4U01A 1E36B 4X8SH 1L1GA 1KLJH 2J97A 3ZZ8A 3FVFB 3T2NA 4YM9A 1YP9A 2Z6BD 2YMSC 4FXGH 3I77A 2FOFA 1MKWK 1P05A 3DSOA 4YOIA 2Q6FA 1IHTH 2Y7XA 4J2YB 2O8MA 2FOMB 3BTTE 3RXQA 1PYTC 3BTKE 2Y6TA 4I31A 1EPTA 1VITF 1O32A 3FFGA 4JMYA 1UK3A 3UNSA 1GVZA 4INLA 1MU8B 3EDXB 4AC9A 3HGNA 3RC5A 1Y59T 1CVWH 1X7AC 1C2DA 1BMFD 3ATIA 4MDSA 1EP5A 1YPEH 4AORA 2FYRA 1GJCB 2AIQA 1MTSA 3T62A 1OXGA 4X1SU 2FOBA 1A1RA 5EODA 1BTWA 1AKSA 5C3NA 1TPAE 3UQOA 1AVGH 1O2WA 1L4ZA 3O8CA 3Q77A 2XNDD 3RXTA 1GHBF 1HGTH 1O2SA 1SR5C 1P57B 5GPIB 4WMFA 2SFAA 1NBME 2WZQA 3SV7A 4ZHMU 3SHAH 3ATWA 3GCNA 2IPHA 1YM0A 4BAOB 2UUYA 1Q31A 1W0YH 3P8OA 4FVDA 2H5DA 2RFKC 4Y8YA 2BY6X 1NO9H 2AERH 3KGPA 3EGKH 2WV9A 3M7UA 3RXGA 1K1JA 1P02A 5B6LA 4HTCH 2SGQE 2B9LA 1O3LA 1D4PB 2PHBA 1Y5AT 1XUJA 1QJ6B 2SGPE 3SYJA 1Q3XA 3M5LA 1F2SE 3ENSB 2FI5E 2OLGA 3SO3A 1HAXB 3RXDA 3SUGA 3U8TH 3UFAA 1JRSA 3DT0H 2P8OC 2G5NA 3DFJA 1O3IA 1TGBA 1HNEE 1ARBA 2CF9H 5CE1A 4CBNA 2BDAA 5DSFA 3QDZB 1H9IE 3GCOA 3DD2H 2PLXA 2J34A 4XBBA 4OGXA 2GV6A 4X1QU 1IQEA 1E37B 1GI1A 1QNJA 1O3DA 2PFEA 1ANDA 2A4GA 2ZCHP 1VGCC 1KYNA 3HK6B 2A0QB 1O3NA 2A45B 1YGCH 2C3SA 1DE7H 4Y79A 1F7ZA 4X8VH 5KGOA 3V3MA 1KTSB 1Y3VA 2QV1A 3TJOA 4CH2B 3D62A 1NTPA 1INCA 1A4WH 2HGTH 4X6PA 3OFND 3KHVA 3MH5A 1ELVA 3A88A 5JB8S 2QY0B 1MU6B 1IQFA 2J98B 1BT7A 2K0QA 5EGMA 3BG8A 4MPWA 1VCQA 1PPEE 4AGKA 5K0HA 2O8TA 2XRCA 2G00A 5FPYA 1TNHA 3LGYA 5I46H 4RSPA 1DT2A 1ZRKA 3OYPA 3ZZ7A 5EPYA 3NZIA 1Y3YA 3A7WA 3SQHE 2FOEA 2XC0A 3D65E 1A61H 1NESE 2RCEA 3GY3A 5F6MA 3BTDE 1KLIH 1J8AA 1CA0B 5DP4A 4GCHG 2ZFFH 3TNSA 4K60A 1GHWH 2A1DB 3RMMH 1LVYA 3QN7A 5E0HA 4ASHA 4ZMAH 4WH8A 2JH6D 1LQEA 2FODA 1XM1A 3UOUA 1IOEA 1YYY1 1O3EA 2ZDVH 1TABE 3OEHD 2CMYA 1UVUH 4H6SB 4X1PU 5A8XA 1FY4A 5FAHA 1DITH 1QB6A 1MKXK 4X8UH 2ZU5A 1OYQA 1DX5M 1MABB 1ZMLA 2BQ7B 4FU8A 1QA0A 3BEIB 2CHAC 1PPHE 5T6FA 2ZGXH 4IMQA 3TJVA 4ISNA 3Q3YA 4OS6A 4KELA 5L2YH 1YPLH 1KDQB 2NWNA 3ATKA 4Y8ZA 2QF3A 3E16B 3T29A 3GYMA 3RMNH 1BQYA 4NA7A 2GCHG 2QYIA 3OY5U 1HAVB 3UWJH 3MI4A 2KCPA 1BHXF 1C2LA 3S9AA 1SKYE 1K1MA 3K6ZA 2CXVA 2KZ4A 3BTFE 4M9FA 1GG6B 3M5OA 3UTUH 5EG4A 1GJ6A 1Z8JB 2IJOB 2F9NA 2KCAA 1ELFA 2V7QD 2TGTA 1ESTA 3RMLH 1UTNA 3E0PB 3N7EA 1VCWA 2ILNA 3MNXA 5FBEA 1BBRH 2BLQA 3SGBE 2EI7A 1JBUH 1K1PA 1WCZA 1YCPK 2F9OA 2R0LA 1ZGVA 8GCHF 1HJAB 1ZSJA 3VB6A 4AYVB 3EA9A 1Z1IA 5LPRA 1AIXH 1SI5H 1BRUP 4F55A 4JZFH 2EI6A 1GBEA 1LKBA 1SQRA 2DE9A 2G52A 6CHAB 1ESAA 1BTZA 3ZVBA 2BD4A 1T8MA 2D8WA 1G3CA 1HIAB 1TFXA 4Q7YA 4RI0A 5A09A 1AWHB 2VGCC 1AD8H 1O33A 2ZO3H 1ELGA 1SOTA 2P3TB 3A7XA 3BG4B 1GVKB 3ZVEA 2WSSD 3A85A 5GWZA 4M7GA 1UHBA 3Q76A 1XUFA 1QBVH 1PPBH 1TQ7B 1NZQH 4INKA 5HXFA 3RM2H 2OC0A 3QX5H 2J9NA 1H8IH 1ZGIA 3UB0A 4ABEA 2ZP0H 1ELEE 1CBWB 3BN9A 4CH8B 2FM2A 1ZJKA 3H7TA 1SGQE 4X2YA 2LP6A 4ACAA 2JIZD 2VH6A 3A86A 1MD8A 1UTQA 3Q3XA 3W95A 1LPKB 5FX5A 3I29A 3SV2H 4Y76A 4FOUC 2C93B 3E6PH 4BAMB 3LT3A 4TPYA 1BJVA 5C17A 3VXEH 4B1TA 1C1PA 2AMDA 3S0NA 3MYWA 5C0UA 5J4QA 1DWBH 3OTJE 1GI5A 1P2OA 2J92A 2FTLE 2YMSB 1GGDC 1J15A 3D49H 2O8LA 1XX9A 1C1WH 3W94A 4BTTB 1LTOA 5K7RA 2FOGA 3A87A 1BHXB 3E1XB 1C1OA 1TNKA 3LH3A 3L33A 3SNCA 4P02A 1O2MA 2CV3A 4NFEA 1GHAG 5L30H 1GJ4H 5T1VA 1F0SA 1C5PA 1BTHH 4WWYA 3E91A 1M9UA 1EXFA 1ETTH 5CHAB 1ELDE 1OWJA 2A4OA 4Y0ZE 1O5AB 2W3KA 1C5LH 4ABIA 2BVSH 3M7TA 1P10A 2WUCA 1AUTC 4MNYA 1TA2A 1FIZA 3QTOH 4DJZB 1CU1A 1VKYA 2STBE 3H7OA 5PTPA 3SORA 1VJ9U 1SFIA 1ANBA 1TALA 1FY5A 4CRGA 1UCYH 1TGSZ 1GI9B 3GCHC 4I8HA 1OWKA 5F53A 3FZZA 1WTGH 2BX3A 1EZQA 3RM0H 4BANB 4NCYA 8LPRA 1WTHD 1SLUB 1OSSA 2BLOA 1EX3A 1O5BB 1GBLA 3KQDA 1GCTB 3AAVA 1WAYB 3S9BA 1FN6A 1S0QA 4BOHA 4FUFA 3U8RH 1CT2E 2GJGA 5A8ZA 2B5TB 4DW2U 4A1XA 3RXKA 2C90B 1XUHA 3A8AA 3QUMP 4DVAU 3B8JA 3AVZA 3PV4A 1DWDH 1GI4A 1GI6A 1QURH 4D7GA 5EPNA 1NFWA 4SGBE 4FUIA 1QTFA 1Y3UA 1EFRD 1IQIA 3IITA 3WW7A 2XBVA 2OC1A 2BY8X 2AGEX 3ZZCA 4NWLA 4K2YA 2WUBA 4IN2A 1PPGE 4Z0KA 4TY6A 3F2HA 1OP0A 3PM3A 1O2TA 1TRYA 3AASA 4IS5A 2XOKD 3ZV9A 2FO9A 2GCHF 2UUFB 1TPOA 4DIIH 5GNDA 3QK1A 4K69A 2HNTE 5TJXA 4A1TA 4ZCNA 1GBBA 5FBIA 1RTKA 4RKOB 2I6SA 1H9LB 2SNWA 2Z9GA 1W3CA 2A5KA 4ZXYH 3F9GA 1P11E 1LHFH 3QTVH 1ZLRA 5E8EH 2JKHA 1AVXA 1LHEH 2FLBH 2HVXA 1T8LA 3TGIE 1UVPA 4NSVA 1SGCA 3S7HB 1GBIA 3A80A 5LGOA 3MH6A 1FQ3A 1GJ8B 4FU7A 3NK8A 1KXFA 2H9EH 4KP0A 1MCVA 1QZ8A 3ZZBA 1AMHA 1FX0B 1SLXB 1TX8A 2PUQH 1SMFE 2UUKB 1ZHMA 1VITH 3RU4T 1DOJA 1S85A 3HATH 1HXFH 1E0FD 1DUEA 1CGJE 1MTUA 2JETC 1AB9C 2HLCA 3ELAH 1IQMA 2BM2A 2JDID 1GI3A 5A8YA 2FEQH 1LVMA 3BTME 1DVAH 1F5RA 1GBMA 1BTXA 4FETA 2BZ6H 4ISLA 2PKSC 3VB4A 2G8TA 1KDQA 1ORFA 2M5TA 1SGDE 5DO4H 1G3EA 1GBHA 4X1NU 3U8OH 1RXPA 1AY6H 3B9FH 4FU9A 1JIMA 2Z3DA 2ODQA 1HAVA 1JXPA 1ZPCA 2VU8E 1GJBB 3MO6A 1V2ST 3LIWA 4JZEH 3OSYA 5FL7D 3UNRA 4E7RG 1XUIA 1EUFA 4YXWD 2OUAA 1O3JA 3TK9A 1LQDB 2CHAB 1GPZA 1C1VH 4BAQB 2BZAA 1BZXE 1HDTH 2AHME 2R9PA 3GISB 3RMOH 1OWHA 2AGIX 1KXAA 1UTKA 4ZKOU 5B6OA 1GDNA 1MCTA 9LPRA 1MUEB 1GI2A 2XTTB 2WV4A 2F43B 4TT3D 1D6RA 3IWMA 3A7YA 5C1UA 1FPHH 3LU9B 1MAYA 1Z6JH 2Q1JA 1P9UA 1HIAA 3LGTA 4RKJB 1L0ZA 3ITIA 1V6DA 1J16A 1GHVH 1O3PB 1PFXC 3KN2A 1T31A 3SJIA 2W5EA 1Z7KA 2HRVA 2GVFA 4AFSA 1UVSH 2AYWA 4IW4E 4I7YH 4P00A 2FMJA 1AFEH 3BF6H 3SQEE 1HV7A 3A7VA 3OEED 1BTYA 3ZZ5A 3DCLA 1W0KD 2VIPA 2FX4A 5F03A 1TBRH 3FO8D 1P04A 1UHBB 1QRWA 4MPVA 1UK4A 1CO7E 3RDZA 3PWCA 1THPB 4X6OA 2BD7A 2AMPA 4AB9A 4D7FA 4LZ1H 2BHGA 2BDCA 1O2YA 1YY3A 2Y80A 1YKTA 2SGAA 2HPPH 1S82A 3OU0A 4GAWA 5IK2D 4E06H 2QA9E 1OOKB 2NU0E 2TGPZ 2BTCE 1ABIH 1GWAA 1WQSA 1WSSH 2A5IA 1P2IA 1EASA 2Y7ZA 3PMJA 1BMMH 4A6LA 1C2FA 1EZSC 4WVPE 2V3HH 1O2NA 1K9OE 2DE8A 2W26A 3ODDA 1N1LA 4ZROA 1D3TB 4U32A 1K22H 1C5RA 2HLDD 3ZZDA 2IN2A 1O5GH 1G36A 4ZH8A 1QQ4A 4IMZA 3STIA 1B0FA 2L6OA 4OS2A 2CN0H 1SGFG 4NWKA 3ZZ3A 1OKXA 2OC8A 1VR1H 4JCNA 4U30A 8GCHG 1LKAA 4CR9A 1G37A 2XYAA 2FI3E 3SW2B 2FOCA 4GUXA 3U1IB 5EIYA 4BAHB 1V2QT 1TBZH 2A4RA 1NRRH 3UQVA 1YPJH 1GHZA 3RXLA 1AE8H 1FNIA 3QZQA 3M61U 1FY1A 1NM6A 1O5DH 3E3TA 1SGFA 3VPKA 1DUAA 5CDFE 2ULLA 4YO9A 2F9PA 5DP3A 3FANA 1FI8A 4KTUA 2Q6GA 2R3YA 3TPIZ 4UFEH 7GCHF 1AZZA 1Y3XA 1GGDB 3A81A 5GIBA 3EQ0H 3RXRA 1N6XA 2ZGJA 3TH2H 3MU5A 2SGEE 2YOLA 3ZYDA 1DXPA 4ZHAA 2ALVA 1TBQH 3LGUA 4FUHA 1S5SA 3CNRA 1ANEA 1EQ9A 4OGYA 4B6FA 3MOCA 1SGTA 2C8ZB 4DT7B 1NROH 3BIVH 3K9XB 1DPOA 2ZPRA 1P2KA 1S83A 2J38A 3P6ZB 2ZDAH 1GL0E 2ZECA 2BDHA 3GYLB 1RD3B 2YNAA 2BVRH 4AFQA 3MH7A 1O3MA 2O8UA 4ASUD 5DN6D 1DICA 3VEQB 2OTVA 1OWEA 1C2EA 5EJ1A 3HKJB 3UR6A 9ESTA 3QWCH 4O9VA 4A92A 3ZZ4A 5HIZA 3P8FA 2K8IA 1EOJA 4HG6A 1MMJN 5DK1A 4AX9H 2R2WU 4Z6AH 3KYFA 2PSXA 3E0NB 1ZZZA 5C5NA 3I78A 1C2KA 1SHHB 3O8BA 4HI3A 1V2LT 4QT8C 5F8TA 1E38B 1GMCF 1QBNA 8KME2 3PTBA 2PGBB 2CGAA 2Z9IA 2XBXA 5AFYH 1WOFA 3FZDA 2GDDA 1E35B 1MQ5A 4XE4A 2KCYA 4CRBA 1ZYOA 1O2XA 3LPRA 3ZVDA 1A3BH 2UWPA 2Z9LA 5JB9S 1P01A 2XBWA 2ZF0H 5HGGA 3S9CA 1XKBC 3N7DA 2G81E 1QQUA 4I8JA 2WPKS 1SSXA 1V2TT 2V0BA 1SFQB 1AFQC 2ZEBA 3SU1A 4Z1MD 3LDXH 1P2QA 1IQJA 4NIXA 4DY7B 4K1TA 2ZHWH 1XXDA 1F5KU 3BTEE 3EYDA 2M2AA 1Y8TA 4ZHLU 1HAZB 5KECA 2FZZA 1IQLA 2ANYA 4ABBA 3UOPA 1LMWB 2R0KA 1EB1H 1GBAA 1N8OC 3TGJE 4DGJA 2TBSA 1LVOA 4ISHH 3NRLA 1FLEE 3ESTA 4WXIA 1G3BA 2EC9H 1YLCA 2VJ1A 2AFQB 2C4FH 5E0GA 3JZ2B 3STJA 5A0AE 5LPFA 3SNBA 1W14U 4I86A 1O2RA 4CHAC 4JK5A 1GJDB 3Q3KA 2Y5FA 5ESTE 2CF8H 5TCCA 2AMQA 1PQAA 1EAIA 3A89A 1P2MA 3KF2A 1J9CH 2NU2E 3VG8A 4VGCC 3O8RA 2ZCLP 3ATLA 1ZHRA 1W10U 3SU0A 5EW2H 3V13A 5HYOA 1LPGB 1MAXA 1F92A 1COWD 1PJPA 3URCA 2P3FH 1JOUB 4FUCA 3SU4A 5I25A 1NRNH 3NCLA 1BMLA 1ID5H 2ZFRH 2ZGHA 3ZYEA 1AI8H 2KX4A 3BTQE 4NGAH 3ZZ6A 1C2IA 2PTCE 1G3DA 2GTBA 1AGJA 1UJ1A 2JETB 2VWOA 1AB9B 3PLKA 1P9SA 1HBTH 1LPZB 3H5CB 3PMBB 2FX6A 5L6NH 4D9QA 3RC6A 1P2JA 1NFXA 1TGCA 2EI8A 1YLDA 4JZIA 5DP7A 3S7KB 6LPRA 1GDUA 2P16A 3GDSA 1RIWB 2PKSB 2KR7A 2NU1E 4H6TA 3TK5A 1C2MA 3SN8A 3RXIA 2ALPA 2TIOA 1WQVH 2GZ7A 1A0JA 1ESBA 2ZHQH 1OX1A 1SGYE 4PROA 1K2I1 4OS5A 1TA6A 1SG8B 3P17H 1Z8IB 4AB8A 3G01A 3RXMA 1Y5BT 1AO5A 2Z9JA 2PP6A 1A5HA 1ELTA 3TIUA 1W8BH 1BBRE 2J5UA 1AQ7A 3CS0A 3L6PA 1C5MD 1RRKA 5A0BA 4H4FA 2OBOA 1BBRK 2ZGCA 2BDBA 3HPTB 4WF8A 2ZKSA 3TH4H 1Y3WA 1MH0A 1A0LA 1V2JT 4I8LA 3PLBA 3A84A 1TOCB 1NY22 5C1XA 2Z3CA 3VB5A 1TMTH 1O2HA 4RT0A 1T8OA 3DUXH 1O2LA 3E90B 4AOQA 2J94A 1ELAA 1FZZA 5C94A 4TSFD 1RS0A 1H1BA 1HFDA 3NWUA 3PV2A 1DFPA 3SZNA 1UTOA 3GS9A 3KL6A 1TNJA 8ESTE 2V35A 3LGVA 2OINA 2H6MA 4OS4A 4KTCA 3M37A 2O8WA 3CP7A 3BV9B 1EJAA 2WPMS 3TLOA 3IG6B 1J14A 2ZU4A 2ZFSA 4XBCA 2O9QA 3PO1C 2ZI2H 3VXFH 1P3CA 1FAKH 2VINA 3FP6E 3M3TA 1THRH 1ZMJA 5IDKA 3BSQA 1MTWA 5F8XA 1D3QB 1ARCA 4GHTA 1C5YB 1SB1H 3T25A 1KXDA 2ANMH 5FHTA 3RP2A 3SV6A 5CHBA 1W7XH 2OXSA 2ESTE 2QGRA 1YPMH 3OAAD 1YPGH 1SGIB 5C0TA 2RA0A 2W6JD 2WPDD 1QHRB 2ZPQA 5FCKA 1EB2A 1Z1JA 2QXIA 4E7NA 3MU4A 4TWWA 3GY5A 1U6QA 4WMEA 1DSTA 3MFJA 3UAIC 2F9VA 4ABGA 4AGJA 1ZHPA 5DPAA 5EQRA 4X1RU 1DLEA 3GICB 1CHOG 5C20A 3UIRA 1OHHD 1O3FA 2FWWA 2QF0A 1ZR0A 2IPQX 1EZXC 1V2OT 4BTUB 1GJ7B 3NPSA 1OWDA 1D9IA 2HNTC 4MVNA 1ELCA 1CA8B 3QLPH 2ZPSA 3N7OA 1YF4A 2ZHFH 1V2MT 2VVVA 1FONA 3AAUA 1BITA 4JZDH 1LCYA 2JJ1D 2Y81A 3KQEA 1L1JA 1D3PB 2BXUH 3ZV8A 4B75A 4MPXA 1DXWA 3SOSA 4TY7A 2G51A 5AVDA 1TAWA 4CREA 3MNCA 2W7UA 1AE5A 1W12U 2FYQA 5G4BA 1TMUH 4I8KA 1WUNH 4O97A 1QR3E 2BD8A 1S81A 4IC5A 3EE7A 4ACBA 2W6ID 1UCYE 2FLRH 1NRSH 2ZFPH 3U9AH 2VBCA 3A82A 3MU0A 1UCYK 1NU9A 4LK4A 1QBOA 2V3MA 1TGTA 5AFZH 3RUOA 1O2PA 3A83A 3DHKH 4JZ1A 1GHXH 2BY7X 2NU4E 4X8TH 4FUGA 2HVYB 2ZG0H 4ISOA 1YPHE 2KM0A 1O5CB 4Q7XA 1F0UA 1FY8E 2QXGA 1HAYB 2EA3A 1HB0B 1TIOA 1WV7H 1ABJH 4Q2KA 2VB0A 1YC0A 4ESTE 6GCHF 4BXSA 2P8OB 4SGAE 4KKDA 1S6LA 4JYTA 2C8XB 1ZRBA 5AF9H 1SL3A 1YLNA 1E79D 1P12E 3SU5A 2A7HA 2V6NA 3GCTF 1HAHH 3M36A 2H9HA 1MTVA 2QAAA 2QE7D 2ZWLH 1IQHA 1W0ZU 2BY9X 2CJIA 3TVJB 1TE0A 3P92A 3UPEA 1F0RA 3JZ1B 3KCGH 1VGCB 7GCHG 1GMHG 5IYTA 2ZTYA 7LPRA 1EZUC 4IC6A 1O3CA 2FESH 3PMAB 5DP6A 4D8NA 2BOKA 1WDIA 3PRBA 2LPRA 1Y5UT 2B8OH 2A2QH 1FY3A 1TOMH 1BTUA 5DP5A 5EOKA 5EXLA 2P59A 4DOQA 3P95A 3C1KA 1P2NA 4DURA 1FAXA 3FP7E 4HFPB 1IQGA 3CS7A 1GMDG 5C1YA 4MLFB 2TPIZ 3GY8A 2HALA 5LH8A 1KXEA 2P93A 5JBAS 2AEIH 1CHGA 1NS3A 2ZNKH 4NSYA 1B5GH 5HM2A 1DSUA 2W3IA 4A5TS 2JH0D 4UONA 3TH3H 3F9EA 3RXVA 3MQKC 1QRZA 5FCRA 2ZDNA 1EAUA 4Q63A 4F4OC 1Z8RA 2YMSD 2AS9A 7ESTE 1AFQB 2B7DH 2ZC9H 4CRDA 2XBYA 3Q00A 3A8CA 3O8DA 3GY6A 6ESTA 2XWBI 1CT0E 4BAKB 1PYTD 3GDUA 2VIVA 4NIVA 4HGCA 4Y10E 1JWTA 5A0CA 2C8YB 1TQ0B 1N8OB 4F49A 1A2CH 1KY9A 3PLPA 1D6WA 1RTFB 1GMCG 3M7QA 5E0JA 3R3GB 3RC4A 3ZVGA 2GV7A 1S0RA 4J1YA 1QB9A 3ZVAA 3KYGA 4UDWH 1BRCE 1GBDA 2GT7A 1NRQH 1ZTJA 1C1TA 5C2ZA 2A2XH 1DDJA 4B2CA 1MBQA 3F0PA 4X6NA 2PW8H 1CE5A 2BLWA 4WXVA 2OQ5A 1FDPA 1NC6A 3A8BA 4VGCB 4THNH 1GJ5H 3NXPA 4MNWA 1A46H 1O2KA 3RXHA 5JPMH 2BOHB 1C1SA 1D3DB 4INHA 4Q4LA 4KTSA 2QC2A 3A7ZA 2ZU3A 1HJAC 2IOTA 2ZCKP 3FOAA 3OTPA 1C2JA 1MD7A 3SI3H 2BVXH 1GHYH 3MU8A 2GGVB 3GOVB 4XBDA 2BD9A 1TGNA 1ZOMA 1L1NA 3U1JB 1EAWA 2BQ6B 1W0JD 1CHOF 1E1RD 3L3TA 4ABHA 1DWEH 3V12A 3SZEA 1C5VA 3ZVFA 3TITA 2OD3B 4AZ2B 1K28D 2VIQA 4U2WA 1RJXB 1TNGA 2R2MB 2OK5A 1HPGA 1LDTT 1O39A 1G30B 1O3BA 1P03A 5FX6A 4I32A 3SUFA 1QL8A 1S6HA 3SJOA 5GDSH 2BB4A 3DSGA 2VIWA 1A5IA 3MO3A 1VCPA 1EAXA 2HNTF 4YOGA 3GY4A 1BCUH 1IHSH 4TPIZ 5JYIA 3F9HA 4IN1A 5C67A 5EW1H 4XOJA 1SLVB 1WU1A 1BRBE 3RXEA 3URDA 1SQTA 1TYNA 1K0HA 1C1UH 3SGQE 4GPGA 2OC7A 2TRMA 3BEUA 4FUBA 3SBKA 1UVOA 2QF5A 1EPTC 1YCPM 3DFLA 2TGAA 2P95A 2D1JA 1EATA 1MKWH 1V2PT 1NN6A 3LOXA 3TNTA 1C5OH 1XUGA 2HWLB 1C9TA 4O3UA 1YWUA 2VGCB 3LJOA 1TNIA 2GP9B 1BUIA 3KQCA 3M3VA 2NU3E 4XSKU 1L2EA 4MQAA 2G4UA 2BDGA 1SQAA 2F91A 3SNAA 2GDEH 4R8TB 1PPZA 1QY6A 4ABDA 1QJ7B 2GCTC 1DANH 1H8ED 1ZTLA 1Q2WA 3K6YA 1G9IE 4DIHH 3RLYH 1AU8A 2WPLS 2ODPA 1AWFH 2Z94A 5CHAC 2WYJA 3PO1B 1E34B 2VNTA 5DP9A 1K1IA 2VVCA 2XWAA 3GDVA 4I33A 2J2UA 1QJ1B 4Y7AA 1BMAA 4Y8XA 1P06A 1WBGB 2OP9A 3MWIU 1IQNA 4ABAA 3SJ8A 1C5SA 3F9FA 3P70B 4CBOA 3MHWU 1V3XA 5DGJA 1OWIA 4GHQA 2KAIB 4YESB 1ZPBA 4MNVA 3V7TA 2ZQ2A 2QIQA 3LH1A 1B7XB 1GMHF 2PSYA 2BD5A 1O30A 1QCPA 2F4LA 4X2VA 1A7SA 1HAPH 1XUKA 4K1EA 2C8WB 2F9UA 1LVBA 1VZQH 2RDLA 1GCTC 1KXCA 3BEFB 1PQ8A 3PTNA 2GKVE 4K3JA 1SGPE 1K1NA 5HMAA 1GMDF 2QN5T 1KIGH 3QGNB 1KSNA 1NRPH 5E2PA 1PPFE 5CMXH 4HZHA 1KLTA 2SNVA 4X2WA 1C9PA 3LC5A 3W1EA 2ANKH 4GSOA 4XDEA 3UR9A 1O3OA 2FP7B
chains in the Genus database with same CATH topology
1C2HA 4KGAA 1F5LA 2BDIA 1P3EA 1ZSLA 4Y6DA 3A7TA 3ZZ9A 1CT4E 2PV9B 3GCHB 2ODYB 4FVBA 4TYDA 1NFYA 3RXSA 3BTGE 1DM4B 2ZFTA 3TU7H 1O2IA 4NIWA 4B73A 3NUMA 1SPJA 1BMNH 2I6QA 3RU4D 3SU6A 4X6MA 3C27B 2VWMA 2ZA5A 3QGJA 1ZJDA 2ZDMA 2AGGX 2GMTC 1F0TA 4Y7BA 4B2AA 2A7JA 2TGDA 5GCHG 3NKKA 1KTTB 3DA9B 2PTNA 3LC3A 2RG3A 3MNBA 2GD4B 3UY9A 3V0XA 1GDQA 5AHGH 1UMAH 1XXFA 1C1NA 3EE0B 1UO6A 3TGKE 2R3UA 1HYLA 3SNEA 1SC8U 4LOYH 4K1SA 5GJ4B 1C5XB 4Y11E 3T28A 2F3CE 4R0IA 2G4TA 2WV5A 3TJNA 1V2NT 3PROA 1SOZA 1C5WB 3SV8A 1O31A 4TWYA 4ZKNU 1O5FH 1O3KA 2VWLA 1MZAA 4XFQA 2Z7FE 2ZTZA 3SUDA 4YT6H 1QL9A 2ZHEH 2HPQH 3VFEA 4YLUA 3RXOA 2ZGBH 4OS1A 1O38A 2D2DA 1V2WT 1JIRA 1HLTH 1UTMA 1BJUA 4WY3A 2J4IA 2UWOA 4UD9H 3D23A 4H42U 4LZ4B 3LJJA 1MKXH 1P8VC 2OCVB 3KEEA 1C5TA 1AZ8A 1O2ZA 1OS8A 2ZDKA 1SQOA 1NU7B 1O2OA 1MTNC 4ZKSU 2QCYA 4D9RA 1W7GH 6GCHG 1NFUA 3SHCH 1C2GA 1FN8A 1FPCH 1C4V2 1JMOH 1HCGA 4YT7H 1AVWA 3TJUA 3T27A 4FUDA 2FOAA 2AIPA 4MG3A 4MNXA 5T3HA 3T5FH 1V2RT 3GCTG 3VB3A 1EJMA 2SGDE 3QO6A 2D26C 3A8DA 2H9TH 1P09A 2PKAB 2P94A 5JDUB 3P8GA 1FIWA 3VGCC 3KQBA 5T6GA 4AG2A 2Y5GA 1DY8A 2A7CA 3LONA 1ELBA 2G5VA 1S84A 3T26A 3MO9A 3VB7A 5JBBS 5TCAA 2BDYA 1IQKA 3UWIA 1HUTH 4X0WU 1GBFA 1C4Y2 1EOLA 4NA9H 1YCPH 3S69A 1PPCE 2UUJB 3BTWE 1TMBH 2ZU2A 2FDAA 4FUEA 5T6DA 1TRNA 3M5NA 2ZHDA 2BX4A 4D76A 2PWXA 4AYYB 1SLWB 3U98H 1GBJA 2H5CA 1EJNA 1UTPA 1P0SH 1O35A 3RXUA 1O0DH 1RFNA 1TRMA 4MPUA 2F9BH 4BNRA 2ZQ1A 4Q80A 4YTAA 2HOBA 1H4WA 1S6FA 4MTBA 1HXEH 4JK6A 1Z8GA 1V2VT 2A32A 2XXLA 5A2MH 1NPMA 4ZAEA 1GL1A 1O34A 2A5AA 3GY2A 1JRTA 1T32A 2BLVA 1AUJA 2ZZUH 3OX7U 3UREA 4YZUA 2WPIS 3SNDA 3ZVCA 1CSOE 5DG6A 5C5OA 1DLKB 3ODFA 4UEHH 3RXCA 1V2UT 3LGIA 1DY9A 1IAUA 2BXTH 1O37A 2PGQB 4AN7A 4CRCA 2QXJA 3RXPA 1HRTH 2B0FA 1YPHC 1SBWA 3RU4E 5FPTA 1EPTB 2P3UB 3SJKA 4JYVH 3RXFA 3M5MA 1FXYA 1GBCA 2VWNA 3K2UA 1G32B 4GVUA 3F68H 1W2KH 1C1RA 2VIOA 4K8BA 2GT8A 3RXAA 5GCHF 2GX4A 1UTLM 2KAIA 4NFFA 2RA3A 1TB6H 2ZU1A 2ZDLA 5BRRE 2FIRH 4O03A 1TX7A 1N6YA 1ACBE 1J17T 1FV9A 3PWBA 5L2ZH 1V2KT 1AKSB 4Y0YE 2GCTB 1XMNB 1G2LA 1EKBB 1SVPA 1GBTA 1O2JA 3AW1A 2AH4X 4ZKRU 3SI4H 5DP8A 2GZ8A 2BQWB 1GJ9B 2H1UA 4NIYA 3AW0A 1T7CA 4YLQH 1LHGH 1BDAA 3M3SA 4CRAA 3BIUH 1OP2A 3K65B 1NT1A 1BOQA 2QXHA 3KNXA 5EQQA 1O3HA 2WPHS 1XVOA 4WH6A 3ZZAA 7KMEH 3PYHA 1FUJA 5DKMA 4AFZA 1OP8A 1G2MA 4YOJA 1BIOA 5EXNA 1GCDA 4GCHF 2K1QA 4UE7H 2YNBA 2XCFA 3P8NA 4UFGH 1BRAA 1VITG 1RTLA 1O5EH 5DJ7A 4B74A 1TPPA 2Z9KA 1LHDH 1EP6A 1O2VA 3EA8A 1A0HB 3QZRA 5H4IB 4K8YA 3LGWA 2STAE 2THFB 1CGIE 1MQ6A 1A5GH 3PB1E 2XC5A 1C1QA 1B0EA 3BTHE 2DUCA 1C5UA 5JBCS 4WMDA 3ATMA 3F1SB 3R0FA 1O3AA 1T8NA 4IGDA 5GXPA 1MBMA 1ANCA 1AN1E 1YPKH 1MZDA 2BMGB 1LHCH 4DCDA 1GHBG 1T4UH 1CA0C 4O3TA 2WINI 3B23B 4AFUA 2V3OH 1QRXA 1AHTH 1FJSA 2BYAX 1HJ8A 3HGPA 1FMGA 3PMHB 1W11U 3SU2A 4DG4A 1K1LA 2FI4E 1LO6A 1XKAC 2GMTB 1SGRE 2BD2A 1O2QA 2GZ9A 5JBTA 1GBKA 2A31A 1TLDA 3UNQA 4B2BA 2H2ZA 2LNCA 1TWXB 4CRFA 1CGHA 1C5QA 3OY6U 5FPSA 2XW9A 4NG9H 4B71A 3HK3B 5J4SA 1BTPA 3MMGA 1TX6A 1C5ZB 1QIXB 5ESBA 1QA7A 4UFFH 2SGFE 1RGQA 1UVTH 1PQ7A 1C1MA 4IBLH 1O36A 4LXBH 2VH0A 3UUZA 1QL7A 3MNSA 3RXJA 2FXRA 1K21H 1SGNE 1XVMA 3MH4A 2VVUA 4A7IB 4NZLA 3TK6A 1TPSA 1T4VH 2Y82A 5E2OA 2FPZA 2WYGA 3WY8A 4BTIB 5EXMA 4ABJA 4ZXXH 2XNIA 3FP8E 1A3EH 1Z71A 1GG6C 4Y71A 2BD3A 1RIWC 1YBWA 2XCNA 2Z3EA 4ABFA 4CHAB 4ZUHA 4A1VA 5SGAE 1TONA 5HM9A 1ZPZA 1GJAB 2FOHA 2PKAA 4I8GA 4K5ZA 1TNLA 2OQUA 3CENA 4NA8A 2OBQA 2W7SA 2PUXB 1K1OA 1BA8B 2UWLA 3SJ9A 2XC4A 1GI7B 1GVLA 5EQSA 1MTNB 5F8ZA 1SHYA 3SUEA 2EEKA 1DS2E 2ZTXA 1ETRH 1W13U 4NZQA 6CHAC 1KXBA 2JH5D 1GI8B 1H8DH 4FUJA 2VIDA 2ZFQH 2J95A 3FAOA 1HJ9A 2FS8A 1HAIH 1THSH 1OPHB 2Y5HA 1O2GH 1H9HE 5LPEA 3BG4C 1Z6EA 1OYTH 4E05H 5FXLA 1SGEE 1HAOH 1C5NH 1HAGE 4RN6A 1O3GA 3SU3A 4AG1A 5EU8A 2BY5X 2Q6DA 4Q7ZA 2F83A 1ZSKA 4JYUH 4UFDH 3VGCB 1DWCH 2ASUB 3KIDU 1PQ5A 2ANWA 2PR3A 1ZTKA 4ISIH 2A4QA 4WJG2 3MU1A 1GHAF 3GY7A 1QFKH 2FS9A 1UK2A 1CQQA 3SV9A 1ZMNA 3F6UH 3MTYA 1O2UA 3E8LA 4X2XA 3U69H 3EA7A 5BPEA 1VJAU 4BXWA 1CBWC 2ZIQH 3M35A 4GLYA 1ETSH 2FTMA 3HKIB 2WPJS 5ETXA 2G55A 3LKWA 1UTJA 4B76A 4OS7A 3SGAE 3RXBA 5ABWA 1WYKA 1L4DA 1GI0A 4CR5A 1C4U2 3EAJA 1QGFA 3RLWH 1BB0B 1QB1A 4U01A 1E36B 4X8SH 1L1GA 1KLJH 3ZZ8A 3FVFB 3T2NA 4YM9A 1YP9A 2Z6BD 4FXGH 3I77A 2FOFA 1MKWK 1P05A 4YOIA 2Q6FA 1IHTH 2Y7XA 4J2YB 2O8MA 2FOMB 3BTTE 3RXQA 1PYTC 3BTKE 2Y6TA 4I31A 1EPTA 1VITF 1O32A 3FFGA 4JMYA 1UK3A 3UNSA 1GVZA 4INLA 1MU8B 3EDXB 3HGNA 3RC5A 1Y59T 1CVWH 1X7AC 1C2DA 3ATIA 4MDSA 1EP5A 1YPEH 4AORA 2FYRA 1GJCB 2AIQA 1MTSA 3T62A 1OXGA 4X1SU 2FOBA 1A1RA 5EODA 1BTWA 1AKSA 5C3NA 1TPAE 3UQOA 1AVGH 1O2WA 1L4ZA 3O8CA 3Q77A 3RXTA 1GHBF 1HGTH 1O2SA 1SR5C 1P57B 5GPIB 4WMFA 2SFAA 3SV7A 4ZHMU 3SHAH 3ATWA 3GCNA 2IPHA 1YM0A 4BAOB 2UUYA 1Q31A 1W0YH 3P8OA 4FVDA 2H5DA 4Y8YA 2BY6X 1NO9H 2AERH 3KGPA 3EGKH 3M7UA 3RXGA 1K1JA 1P02A 4HTCH 2SGQE 2B9LA 1O3LA 1D4PB 2PHBA 1Y5AT 1XUJA 1QJ6B 2SGPE 1Q3XA 3M5LA 1F2SE 3ENSB 2FI5E 2OLGA 3SO3A 1HAXB 3RXDA 3SUGA 3U8TH 3UFAA 1JRSA 3DT0H 2P8OC 2G5NA 3DFJA 1O3IA 1TGBA 1HNEE 1ARBA 2CF9H 5CE1A 4CBNA 2BDAA 3QDZB 1H9IE 3GCOA 3DD2H 2PLXA 2J34A 4XBBA 4OGXA 2GV6A 4X1QU 1IQEA 1E37B 1GI1A 1QNJA 1O3DA 2PFEA 1ANDA 2A4GA 2ZCHP 1VGCC 1KYNA 3HK6B 2A0QB 1O3NA 2A45B 1YGCH 2C3SA 1DE7H 4Y79A 1F7ZA 4X8VH 3V3MA 1KTSB 1Y3VA 2QV1A 3TJOA 4CH2B 3D62A 1NTPA 1INCA 1A4WH 2HGTH 4X6PA 3KHVA 3MH5A 1ELVA 3A88A 5JB8S 2QY0B 1MU6B 1IQFA 1BT7A 5EGMA 3BG8A 4MPWA 1VCQA 1PPEE 4AGKA 5K0HA 2O8TA 2XRCA 2G00A 5FPYA 1TNHA 3LGYA 5I46H 4RSPA 1DT2A 1ZRKA 3OYPA 3ZZ7A 5EPYA 3NZIA 1Y3YA 3A7WA 3SQHE 2FOEA 2XC0A 3D65E 1A61H 1NESE 2RCEA 3GY3A 5F6MA 3BTDE 1KLIH 1J8AA 1CA0B 5DP4A 4GCHG 2ZFFH 3TNSA 4K60A 1GHWH 2A1DB 3RMMH 1LVYA 3QN7A 5E0HA 4ASHA 4ZMAH 4WH8A 2JH6D 1LQEA 2FODA 1XM1A 3UOUA 1IOEA 1YYY1 1O3EA 2ZDVH 1TABE 2CMYA 1UVUH 4H6SB 4X1PU 5A8XA 1FY4A 5FAHA 1DITH 1QB6A 1MKXK 4X8UH 2ZU5A 1OYQA 1DX5M 1ZMLA 4FU8A 2BQ7B 1QA0A 3BEIB 2CHAC 1PPHE 5T6FA 2ZGXH 4IMQA 3TJVA 4ISNA 3Q3YA 4OS6A 4KELA 5L2YH 1YPLH 1KDQB 2NWNA 3ATKA 4Y8ZA 2QF3A 3E16B 3T29A 3GYMA 3RMNH 1BQYA 4NA7A 2GCHG 2QYIA 3OY5U 1HAVB 3UWJH 3MI4A 1BHXF 1C2LA 3S9AA 3K6ZA 1K1MA 2CXVA 3BTFE 1GG6B 3M5OA 3UTUH 5EG4A 1GJ6A 1Z8JB 2IJOB 2F9NA 1ELFA 2TGTA 1ESTA 3RMLH 1UTNA 3E0PB 1VCWA 2ILNA 3MNXA 5FBEA 1BBRH 2BLQA 3SGBE 2EI7A 1JBUH 1K1PA 1WCZA 1YCPK 2F9OA 2R0LA 1ZGVA 8GCHF 1HJAB 1ZSJA 3VB6A 4AYVB 3EA9A 1Z1IA 5LPRA 1AIXH 1SI5H 1BRUP 4JZFH 2EI6A 1GBEA 1LKBA 2DE9A 2G52A 6CHAB 1ESAA 1BTZA 3ZVBA 2BD4A 1T8MA 2D8WA 1G3CA 1HIAB 1TFXA 4Q7YA 5A09A 1AWHB 2VGCC 1AD8H 1O33A 2ZO3H 1ELGA 1SOTA 2P3TB 3A7XA 3BG4B 1GVKB 3ZVEA 5GWZA 3A85A 4M7GA 1UHBA 3Q76A 1XUFA 1QBVH 1PPBH 1TQ7B 1NZQH 4INKA 5HXFA 3RM2H 2OC0A 3QX5H 2J9NA 1H8IH 1ZGIA 4ABEA 2ZP0H 1ELEE 1CBWB 3BN9A 4CH8B 2FM2A 1ZJKA 3H7TA 1SGQE 4X2YA 2VH6A 3A86A 1MD8A 1UTQA 3Q3XA 3W95A 1LPKB 5FX5A 3I29A 3SV2H 4Y76A 2C93B 3E6PH 4BAMB 3LT3A 4TPYA 1BJVA 3VXEH 4B1TA 1C1PA 2AMDA 3S0NA 3MYWA 5J4QA 1DWBH 3OTJE 1GI5A 1P2OA 2J92A 2FTLE 1GGDC 1J15A 3D49H 2O8LA 1XX9A 1C1WH 3W94A 4BTTB 1LTOA 5K7RA 2FOGA 3A87A 1BHXB 3E1XB 1C1OA 1TNKA 3LH3A 3L33A 3SNCA 1O2MA 2CV3A 4NFEA 1GHAG 5L30H 1GJ4H 1F0SA 1C5PA 1BTHH 4WWYA 3E91A 1M9UA 1EXFA 1ETTH 5CHAB 1ELDE 1OWJA 2A4OA 4Y0ZE 1O5AB 2W3KA 1C5LH 4ABIA 2BVSH 3M7TA 1P10A 2WUCA 1AUTC 4MNYA 1TA2A 1FIZA 3QTOH 4DJZB 1CU1A 2STBE 3H7OA 5PTPA 3SORA 1VJ9U 1SFIA 1ANBA 1TALA 1FY5A 4CRGA 1UCYH 1TGSZ 1GI9B 3GCHC 4I8HA 1OWKA 3FZZA 1WTGH 2BX3A 1EZQA 3RM0H 4BANB 4NCYA 8LPRA 1WTHD 1SLUB 1OSSA 2BLOA 1EX3A 1O5BB 1GBLA 3KQDA 1GCTB 3AAVA 1WAYB 3S9BA 1FN6A 1S0QA 4BOHA 4FUFA 3U8RH 1CT2E 5A8ZA 2B5TB 4DW2U 4A1XA 3RXKA 2C90B 1XUHA 3A8AA 3QUMP 4DVAU 3B8JA 3AVZA 3PV4A 1DWDH 1GI4A 1GI6A 1QURH 4D7GA 5EPNA 1NFWA 4SGBE 4FUIA 1QTFA 1Y3UA 1IQIA 3IITA 2XBVA 2OC1A 2BY8X 2AGEX 3ZZCA 4NWLA 4K2YA 2WUBA 4IN2A 1PPGE 4Z0KA 4TY6A 1OP0A 3PM3A 1O2TA 1TRYA 3AASA 4IS5A 3ZV9A 2FO9A 2GCHF 2UUFB 1TPOA 4DIIH 3QK1A 4K69A 2HNTE 5TJXA 4A1TA 1GBBA 5FBIA 1RTKA 4RKOB 2I6SA 1H9LB 2SNWA 2Z9G