2CV3A

Crystal structure of porcine pancreatic elastase complexed with a macroclyclic peptide inhibitor
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the complex of porcine pancreatic elastase with a trimacrocyclic peptide inhibitor FR901451
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Elastase 1
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2cv3A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2cv3A01
2ZFRH 1L2EA 3V12A 3ATKA 1SPJA 4AORA 1IHTH 2FLRH 2P59A 1TGBA 1YP9A 1C9PA 1DFPA 5EQRA 1GI4A 1NY22 4LK4A 4NCYA 1B7XB 1AKSA 4MPUA 1BIOA 3MH7A 4JCNA 4Q7XA 5FBIA 5DP9A 5FAHA 3ENSB 2IOTA 3RLWH 3U1IB 1QJ7B 3UQVA 1WV7H 3HPTB 1O5DH 1T31A 3S7KB 1H8DH 1CGJE 3GDVA 1QTFA 4B73A 2G00A 2QN5T 4ZXYH 1KDQB 1FXYA 4IC6A 6CHAB 3E3TA 4WY3A 5I46H 1ZSJA 1O37A 5DK1A 3EGKH 3RU4E 1S5SA 4YM9A 2BLVA 4TYDA 1C2JA 2J94A 3AAUA 1O2OA 4MPWA 1F2SE 1AE8H 1BTUA 1GI7B 3ZV8A 1GJBB 3A7YA 2OC7A 3EAJA 2CGAA 1UMAH 2PLXA 2R2WU 1FY8E 1SGFG 3GY5A 2RDLA 3KHVA 3RMOH 2TGPZ 5FXLA 5GDSH 3K2UA 5E0GA 4R0IA 4WXIA 1XXFA 1T8LA 2BOHB 3U8RH 3AW1A 4BAMB 2XBXA 1ZHPA 1MD7A 3MHWU 1FAXA 4J1YA 5DKMA 1NFXA 2AS9A 2G4TA 2BDAA 4IGDA 1LO6A 1VITH 1CHGA 2D8WA 2ZDNA 2GKVE 4CBNA 3HK3B 1GI1A 1P04A 2BY9X 1TX7A 1DSUA 4KTCA 1GMHF 5TCAA 1TNGA 4LOYH 4X8UH 2ODQA 3SJKA 1C1SA 1K2I1 3P8FA 2Q6GA 2ZU3A 3SOSA 1ZMLA 3A88A 2UUKB 1FI8A 4X1RU 3L6PA 1BITA 1DY9A 2SGPE 1C5MD 4Y11E 3U98H 2XYAA 2FOHA 1T8NA 3MO3A 2HNTF 5L30H 1OYTH 1KIGH 2AIQA 1NO9H 2ASUB 1SR5C 3A8DA 3PB1E 1CA8B 4RKJB 1KXDA 3Q3XA 1EJMA 1MAXA 2HGTH 4GPGA 3P8GA 3UR9A 4NG9H 3ZZ9A 2BQ6B 4KTUA 2W7UA 1A7SA 2QCYA 3MNSA 4ZXXH 2NU0E 1HJAB 2FS8A 1V2UT 1ZYOA 1SGQE 2IJOB 5A0AE 2AMDA 1XKAC 2QXIA 2VGCC 2WUBA 2XC0A 2UWPA 7GCHG 1O2HA 1GHXH 4ZROA 1W0YH 1XX9A 4I8LA 4U2WA 1F0UA 1TNKA 1ELGA 1DLEA 1T8MA 1ZPZA 1QB6A 2ZGXH 2B5TB 2QC2A 2ALPA 4LZ4B 2ZFSA 3UTUH 1HLTH 4WH6A 2FLBH 5C2ZA 1ZHRA 2QAAA 1VGCC 5EXNA 2A31A 2YNBA 4GAWA 1C5UA 1DUAA 1DSTA 3GY3A 2Y7ZA 1VCPA 2CF9H 5C67A 1BRAA 3SV2H 4X6OA 3UOPA 3UUZA 1GBDA 1C2KA 5LPFA 3SU5A 1V2ST 1QCPA 4UE7H 4DW2U 8GCHG 1UCYE 5J4QA 1C1PA 1BMMH 3GCNA 2QIQA 2GZ9A 1DXPA 1ZTLA 4FUBA 2FOBA 1EP5A 2BD8A 1TGCA 2KAIB 2EC9H 1A5HA 5HM2A 2ZHEH 2BYAX 1XUIA 1ETTH 1FUJA 3NWUA 1UVUH 3ZZ8A 1V2RT 3QDZB 3GYMA 5DG6A 3GY2A 1IOEA 3MO9A 4AYVB 4GHTA 3Q77A 1ORFA 1HJAC 4AGJA 2VWLA 4KELA 1ID5H 2RA0A 4H4FA 3A86A 2XW9A 2Z9KA 1BHXF 3TLOA 5LH8A 5C1UA 5EPYA 4DOQA 1UTPA 1LTOA 1VJAU 5AF9H 2ZEBA 1YKTA 3MMGA 1JOUB 1RXPA 1HYLA 1SQTA 2ZFPH 5EPNA 4Y79A 4ESTE 4RSPA 1DWEH 4GVUA 3K6YA 3A82A 3QLPH 1YYY1 2ZU2A 1TIOA 1V2OT 3EYDA 2FPZA 1FY4A 3MU4A 1NS3A 1O3IA 3RC6A 1YPHC 3BTGE 4YT7H 1O30A 1GCDA 1LVOA 1EOJA 1SOZA 4ZHAA 2BY7X 1EJNA 1GI0A 4B2BA 3SQEE 1YPEH 3BEIB 1LHGH 4NWLA 4U30A 1EPTB 4GCHF 2F9PA 1Z1JA 2FDAA 5ESTE 2ZGHA 1MTNC 4DIHH 1D4PB 2FMJA 2PKAA 3T5FH 1TALA 1NU7B 4MDSA 3PROA 4JZFH 1MU8B 1ESBA 2O8WA 4UD9H 3RXKA 3W94A 1P57B 1GBLA 1ZRKA 3E16B 1EJAA 1TAWA 1PFXC 1EX3A 4B76A 1O2VA 1XUKA 5A8XA 1N6XA 4O03A 2WV5A 1HBTH 2A7CA 3ODFA 2STBE 3F6UH 3SZNA 5E0JA 1P11E 3U9AH 2VJ1A 1D3TB 1OWKA 2ESTE 1EP6A 2ILNA 2WPMS 5CHAB 1LHCH 5AVDA 3UWJH 2FESH 4ABGA 5T6FA 3ZYDA 2XRCA 1JWTA 3M3VA 2BLOA 1HAXB 1PPZA 3SGBE 3FANA 3TK6A 2XBYA 4Y8XA 1MMJN 1MKWH 2ZTZA 1O5AB 1OWIA 1C5VA 3A8CA 2GTBA 2ZGBH 3OYPA 3SV6A 1F0TA 1GL1A 2PTNA 3KCGH 1D9IA 1AB9B 1TRYA 1C5SA 2O8MA 1HAVA 1BBRK 1OX1A 3QK1A 2H5DA 2GT8A 2BVXH 1CA0B 1RGQA 4CRCA 1SLVB 3B23B 1LPKB 1NM6A 1A3EH 4TPIZ 4Z6AH 3BTKE 3FP6E 3K65B 1KDQA 2ZHDA 2Z9GA 1ESTA 7KMEH 4SGBE 2ZO3H 6CHAC 3BTFE 1HUTH 1PQ7A 3LJJA 3P17H 1AMHA 1EASA 2ZQ2A 4MTBA 1T4UH 2BDBA 1O36A 2SGFE 2CN0H 1TA6A 1A5IA 3TH2H 1SGNE 1FQ3A 4KKDA 2JETB 1MKXH 1NRPH 1C5TA 1DOJA 3HGNA 3STJA 1SGDE 2HLCA 1GBEA 3B8JA 2VB0A 1O3DA 2SNWA 5EOKA 4FVDA 1XXDA 3V3MA 1XKBC 1AFQC 2Y6TA 3D49H 4ABAA 1LVMA 1Y5UT 2FODA 2PV9B 4AB8A 1O2YA 4BTUB 1ETRH 3PM3A 1O38A 1MD8A 1Z6EA 1FPHH 1LVBA 2BQ7B 4R8TB 1AE5A 1YM0A 4MNYA 2ODPA 3LDXH 2P3UB 5EXLA 2P93A 1ELBA 2ULLA 1BA8B 1FMGA 2BHGA 1QR3E 3VB6A 2WV4A 1P3EA 5DP5A 4F4OC 2FP7B 2PFEA 1BDAA 1CT0E 1GJAB 2G5NA 5GCHG 1C5NH 2V0BA 3CP7A 5DGJA 1W12U 1QRZA 4FU9A 4INKA 3QWCH 1CBWC 1HGTH 4BANB 1CSOE 3ZZBA 3VXEH 5FPTA 4D8NA 1DUEA 4ISNA 1MAYA 1WQSA 1GBTA 3KGPA 3ATWA 3FAOA 4I8JA 1BBRH 1SGEE 1RIWC 1TRNA 4J2YB 1C1NA 2QF3A 3TGKE 1UTLM 1OSSA 1W11U 4ABEA 3GICB 2JH5D 1ELTA 1E35B 1O3CA 3F9FA 3M37A 5F03A 2H1UA 5CMXH 1P03A 1QB9A 1SLUB 1ZSLA 3TGJE 3OTJE 1QJ1B 1DITH 4HGCA 1UVPA 1AO5A 1WQVH 4K8BA 3SORA 1EUFA 4DGJA 1IQLA 1ZGIA 3U8TH 2HOBA 3A7WA 1J16A 1P2JA 1F0SA 1MTNB 1FN6A 3TK9A 1QBNA 3OX7U 2BY5X 1QQUA 1IQNA 3D65E 1RRKA 2GMTC 3VEQB 1NC6A 2OCVB 1K9OE 1IQHA 3QGNB 3PO1B 4RKOB 1D3QB 2AIPA 2BDYA 4HFPB 1BB0B 1W2KH 1C9TA 3SI3H 3V0XA 1O2IA 2O9QA 1GG6C 2TPIZ 2UUJB 1GJ7B 2FO9A 2JH0D 3D62A 1GI5A 2BDIA 2BOKA 1UCYH 3BTQE 2W3KA 1NZQH 3URCA 1TX6A 1V2QT 1O5EH 1MTSA 3ZZAA 1W3CA 2A2XH 4DY7B 3SHCH 2BQWB 3SUDA 4Y76A 1IQKA 4YLUA 4ZKNU 1LDTT 1OWDA 1AWHB 4HTCH 1A4WH 1O3PB 2P8OB 3URDA 1MCTA 1GHZA 4E7NA 2ZP0H 3T26A 2F9BH 1OPHB 1ESAA 1L4DA 1BZXE 3M5NA 4X6MA 5E0HA 2G4UA 3GY8A 4XDEA 2GT7A 1YF4A 2BVSH 1S85A 2ZPQA 1C5XB 4I8KA 4UEHH 1AGJA 5EGMA 5EQSA 3LKWA 2B8OH 3BTTE 2Z3CA 2H9HA 1AZZA 1TNJA 2DE8A 2Z7FE 4K3JA 3CENA 1GMDG 1O0DH 1Z71A 3O8DA 4OGYA 1SOTA 4CH2B 1ACBE 4BAKB 8LPRA 4OS6A 1IQIA 1IQFA 3E6PH 3P8NA 2XCNA 5IDKA 1P12E 2YOLA 1TMTH 1B0FA 4CREA 3D23A 3BF6H 4B2CA 2ZECA 3ZZCA 1GBMA 1P01A 1AHTH 1YPHE 2H5CA 2A7HA 4IW4E 1RTKA 2VVVA 1MKXK 2WPKS 1O2TA 3FP8E 4JZDH 1E37B 3SU3A 1O2SA 5GIBA 1ZSKA 5A8YA 1AVWA 1L0ZA 4WMFA 3GCOA 1W10U 3M36A 1C1OA 3BN9A 2F9VA 4ABIA 1T7CA 4Y7BA 1VJ9U 1WU1A 2ZFFH 2TGTA 2ZI2H 1TOMH 2VGCB 2VINA 4K1SA 2BMGB 2PUXB 2VIOA 1T4VH 1TPPA 2VIDA 1A46H 3S9BA 1MZDA 1C4U2 5EU8A 1ELVA 5HGGA 1ARCA 5A0CA 3MU8A 1OWEA 1OP0A 3LC3A 1W7XH 2ZPSA 4K5ZA 1BHXB 1EZQA 4K2YA 1OYQA 1H9LB 2FXRA 1JRSA 3SBKA 1UK4A 2BTCE 5GXPA 1XVMA 4GLYA 2Y7XA 4K1TA 1SL3A 5E2PA 2FS9A 1WBGB 1PPFE 1NRRH 2IN2A 3SNCA 1HAOH 2ZF0H 1HPGA 1NN6A 1GHAG 2FYQA 2Z3EA 1GHYH 1G3BA 1F7ZA 1YBWA 3A7XA 3U8OH 2Q6FA 3ZZ3A 1KXAA 5EW2H 2B7DH 4NWKA 1LHFH 1G3CA 2BD9A 5C20A 1ANBA 1MTWA 1MZAA 4MLFB 1C5WB 1MQ6A 3SJOA 1PPHE 1CGHA 3MI4A 5BRRE 1PPCE 3S0NA 4X1PU 4OS2A 1ANEA 2HNTC 3LJOA 1GBKA 4FU8A 3SI4H 3I78A 2BLWA 4BXSA 1W8BH 3F1SB 5I25A 1ARBA 1PQ8A 1AKSB 2BZ6H 3L33A 1O2XA 2SGDE 3ATMA 3R0FA 3LT3A 1SGPE 1C1RA 3OY6U 4DIIH 2AMQA 1DXWA 2G81E 3ZVEA 2SNVA 4ZKOU 1OP2A 4KTSA 3EA8A 4AG2A 3Q3KA 4UFGH 2GX4A 3TPIZ 1TPAE 1Y3UA 1KLJH 2JKHA 4WMDA 1SGRE 3QZRA 1OS8A 3Q00A 2CV3A 4CRGA 1NROH 1RJXB 4Y10E 3MU5A 1QNJA 3UPEA 2RCEA 5L2ZH 3BG8A 4XBDA 4MPVA 1GJ5H 1EAWA 1XMNB 3RU4T 2WPJS 2XNIA 3VB7A 1Z8GA 1GBBA 3E91A 5FX6A 1AUJA 1DX5M 2A5KA 1ZZZA 1GMHG 2ALVA 4U01A 3T25A 1MU6B 7LPRA 4UFFH 4OGXA 1HAZB 3NZIA 4HI3A 1AFEH 4B74A 1AU8A 1LHEH 1G2LA 2QY0B 1RTFB 1VZQH 1KTSB 2JH6D 5A8ZA 1CHOG 2FX4A 1KTTB 3SNDA 2GCTC 3HKJB 2G5VA 1O3EA 3SUEA 2PTCE 1GPZA 3F68H 2AEIH 2ZFQH 4IMQA 3RXFA 1V2JT 6ESTA 3VB5A 1ZGVA 5K7RA 3N7OA 1H9HE 4E06H 4TWWA 3RUOA 1ANCA 2OC0A 2RG3A 3M5MA 1B0EA 1SB1H 1BMAA 4AFSA 1O2UA 4A1VA 1EB1H 1Y3YA 3ZZDA 1S81A 3QTVH 1HAIH 2OTVA 3HK6B 1KY9A 3PLKA 4JMYA 1A0HB 5T6GA 2H6MA 1Y5BT 3SU2A 5C5NA 4XBCA 1GBFA 2WYGA 3BIVH 4LXBH 5LGOA 1ZTKA 1NRQH 1AZ8A 3GYLB 4MNVA 1GHBF 1C2GA 2F91A 4X2YA 4YOIA 1FLEE 3GCTF 5FBEA 4NSVA 1SVPA 3PMHB 2SGAA 3M61U 3DD2H 5FX5A 3M5OA 3MWIU 4FUHA 3RXRA 3E90B 6LPRA 2ZHFH 2EI7A 2OC1A 2NU3E 2ZQ1A 3M3TA 4I31A 4FUDA 3MFJA 4MNWA 4IBLH 2KAIA 2QA9E 4QT8C 1FN8A 1FZZA 2A32A 3QGJA 1V2VT 5FHTA 2CHAC 1VCQA 4FUIA 1AY6H 3BIUH 1H8IH 1DWCH 3BTDE 1Y5AT 1TBZH 3DT0H 4ISIH 5G4BA 1INCA 1QL9A 3VGCB 1C1TA 2ZIQH 3WY8A 1O2ZA 4Q7ZA 4JYTA 5B6OA 2ZCHP 1HFDA 2GV6A 3TJVA 4DURA 2VWMA 4OS7A 2VIQA 1G3DA 3KF2A 2P3FH 1DM4B 1DS2E 3P8OA 1X7AC 5JB8S 2PUQH 3SGAE 3MOCA 2DUCA 1XVOA 1HV7A 1Q2WA 2FIRH 2V35A 4B2AA 1BTPA 3GDUA 3ZVBA 1NESE 2C93B 1TNLA 1C5ZB 3SNBA 3SJ8A 1O3OA 3PWCA 3OY5U 1LHDH 1ELEE 2FOCA 4IMZA 2CJIA 3P95A 1VITF 4KP0A 1UO6A 1TLDA 1IQJA 1GCTC 3PTBA 1O5BB 1XUFA 2BDHA 1GGDB 2FTMA 3MYWA 3RXMA 3A85A 2QXHA 1FPCH 1GI8B 1UVOA 4ZH8A 4AOQA 2O8TA 3NUMA 1EAIA 2BY8X 2FYRA 3P70B 3BEUA 1J9CH 3TJNA 1S82A 8ESTE 3OSYA 2ODYB 1WOFA 4VGCC 2VNTA 3DHKH 1O2PA 4YZUA 2P95A 2WINI 1GHWH 5JYIA 1GHAF 3KQBA 5GPIB 2H9TH 1LQEA 1VGCB 2AFQB 1GDQA 1NFWA 1QB1A 4O97A 1GJCB 4NGAH 1O35A 1LMWB 2R9PA 1MH0A 2VIWA 2ZDKA 1EPTA 1AB9C 1ZJDA 3MU0A 4YESB 5ETXA 2WUCA 1O5CB 1SMFE 2NU2E 7GCHF 1GCTB 5GWZA 1DVAH 2AH4X 4YTAA 5C1XA 4X2WA 1O3AA 1SFQB 2FOAA 1AIXH 3SUGA 4VGCB 1P8VC 2AERH 3UFAA 2C3SA 1ELDE 2V3OH 3RM2H 2BY6X 1UTOA 4Z0KA 2R0KA 4FUEA 1PJPA 1CT4E 2STAE 2GCHG 3RMNH 4X0WU 4JK5A 4INHA 2PKSC 1GI6A 5DP6A 2Z94A 3KQEA 2W5EA 4FUCA 4PROA 1TWXB 4GHQA 1SGYE 1HCGA 2VIPA 4B75A 4MQAA 3ZVFA 3NCLA 1TGNA 4IS5A 2BX3A 1EZUC 2FWWA 1PPEE 3HGPA 3RXUA 4GSOA 1TA2A 1WTHD 1Y3WA 2D2DA 2HPQH 5T3HA 3MH6A 1AI8H 1SLWB 1ZPBA 2F3CE 2XBVA 4X6PA 1J15A 1QA7A 4JYVH 4X8SH 2B9LA 2GGVB 5F8ZA 1G2MA 1HJ9A 4X1NU 3MTYA 1C2IA 1DLKB 1L1JA 2GZ8A 2ZWLH 2HNTE 4LZ1H 4ABDA 1O2NA 1OWJA 1YPMH 3IWMA 4BAQB 4AG1A 1BJUA 1SBWA 1RFNA 3E1XB 1S6HA 5GJ4B 2TGDA 3SU6A 1NTPA 1TNIA 4JK6A 1F5KU 2CXVA 1N1LA 3RXSA 4Y8ZA 5LPRA 1HAVB 2ZCLP 3S9CA 2ANKH 4YT6H 1TONA 3M7QA 4Q7YA 1EKBB 3TNSA 3P92A 3OU0A 1GDNA 1UK3A 2BDGA 2GD4B 3LGIA 1O2MA 3RXTA 1W13U 2QGRA 2F9UA 4UFDH 1MCVA 5TJXA 2ZC9H 1CQQA 1GVKB 1O5FH 1QFKH 1Y3VA 1HAPH 1HIAA 1T8OA 4FXGH 3SO3A 3I29A 1SQAA 1SLXB 5JBCS 5ESBA 4YO9A 2PGBB 3DFLA 3RXDA 2C8ZB 1GJ6A 5K0HA 3F9HA 3TU7H 2F83A 3UY9A 2W26A 1UTQA 2ZDMA 3JZ1B 1SGTA 1GI2A 5LPEA 1MKWK 1P2QA 4A7IB 1UVTH 2GZ7A 2VU8E 1C2DA 1BQYA 3GCTG 4TWYA 1EZSC 1D3PB 1O2KA 1WTGH 1UVSH 3QZQA 2BD5A 2RA3A 5ABWA 3T29A 2V6NA 2Z9IA 1YGCH 4NIVA 1W14U 4X2VA 2EEKA 1DY8A 2VH6A 1CT2E 4YOGA 4BAOB 1Q3XA 3BTHE 1BTXA 4DG4A 2ZFTA 4O9VA 1B5GH 1GJ4H 4MG3A 2D1JA 2DE9A 3STIA 1C2FA 4Y6DA 3ZZ7A 4X2XA 1CA0C 3AASA 4DT7B 4CHAB 3LH1A 1C1QA 1OXGA 1H1BA 3RXGA 4OS4A 1GJDB 4H42U 4D7GA 3RXHA 4NIWA 4BAHB 5A2MH 3A8AA 4JZ1A 2IPHA 1OP8A 1YCPH 1C5OH 1PPGE 1S0RA 1QURH 2BD3A 1SI5H 1AWFH 1GBHA 3M35A 1HIAB 2ZDAH 4NIYA 1WUNH 1O31A 5A0BA 2XTTB 2ANMH 4CRBA 1EXFA 4CRFA 5DJ7A 2VWOA 6GCHF 2PSXA 3MH5A 1C5RA 1P3CA 5E2OA 4NFEA 2FOFA 1H4WA 4X1SU 4X8VH 2JETC 3ZZ5A 3L3TA 2FOMB 1TOCB 3PWBA 1A3BH 1FONA 4WVPE 1GDUA 2TIOA 2SFAA 1PYTC 1D3DB 2A7JA 3QN7A 5F6MA 1NFUA 5EG4A 1TGTA 1BMLA 1C5YB 3RMMH 3PLBA 1KXFA 3RC5A 4Y71A 5EODA 4OS5A 1YLDA 1TABE 3E8LA 1GG6B 1D6RA 1FNIA 4AFQA 3QTOH 3RXEA 2FX6A 2P8OC 5F8TA 1E34B 1AVXA 3GDSA 2G51A 1K1MA 3A89A 3T62A 3SN8A 3TNTA 1QBOA 2A4OA 9LPRA 3LC5A 1ETSH 1OKXA 2A45B 3UWIA 4ABHA 2LNCA 3SU4A 3RXIA 4MVNA 1KYNA 2ZGJA 3VB3A 3TITA 3CS0A 2Z3DA 3RDZA 1ZLRA 4F49A 4Q2KA 1GI3A 1GVLA 2R3UA 1BRBE 1HAYB 1THSH 4TY6A 3RXJA 1CE5A 2BM2A 2FZZA 4NIXA 3SNEA 3MO6A 3PMAB 2CHAB 1QRWA 2PR3A 1QL8A 1IQMA 2BX4A 1HAGE 4XE4A 1Z8RA 1O3LA 1THPB 5T6DA 2GVFA 3RXCA 1CHOF 4UDWH 1QA0A 1O3JA 1NU9A 3ZZ4A 3RLYH 5CHAC 1JRTA 2AGGX 1FDPA 1TX8A 2G52A 2ZZUH 2WPLS 1LQDB 1O3NA 1LKBA 2ZU1A 1BTHH 3SV8A 3TJOA 2B0FA 1BRUP 3ZVGA 1F5RA 1ZJKA 1AD8H 1XM1A 5FPSA 1TE0A 2ZDVH 1FY3A 1TQ0B 2R3YA 3RU4D 1UK2A 1V2KT 2UWLA 1C2EA 1FY1A 2PWXA 4AFUA 1P2KA 1V2WT 2OBOA 2XXLA 2A4QA 1UCYK 5FCKA 3DUXH 2XWBI 4FUJA 1EAUA 1S84A 1V2PT 2PKAB 2EI6A 1F5LA 4B1TA 1Z8IB 1A5GH 4ABJA 4KGAA 1E0FD 1V3XA 3SNAA 2GCTB 1GWAA 3M3SA 3RXAA 1C1WH 1G30B 2Y80A 3LU9B 4NFFA 2J9NA 1O2JA 1BT7A 3BG4C 2CF8H 3RXVA 4ZAEA 3ITIA 2J38A 3P6ZB 3VPKA 4I32A 2P16A 2ZNKH 4K1EA 2AGIX 3GCHC 4SGAE 2R0LA 3JZ2B 4BTTB 4I8GA 3A80A 1FV9A 4AB9A 3TGIE 1GBIA 3LOXA 3SU0A 3I77A 3KIDU 4RN6A 1EZXC 1FY5A 4ZKRU 1D6WA 1Y3XA 1YPKH 3KL6A 2GDDA 1IHSH 1SFIA 1CVWH 4X1QU 2J95A 2FOGA 5DPAA 2H2ZA 4ZUHA 3KQDA 2M5TA 3MNBA 4ZHMU 4D9RA 2BLQA 1P2OA 1K1JA 3RXLA 1QGFA 2GCHF 1ZMJA 1LPGB 2NU4E 5JDUB 1HXFH 2WYJA 5EQQA 4ISLA 3BTME 1V2NT 2O8UA 3ZZ6A 1UTJA 3EA7A 4AN7A 3HKIB 3UNSA 4ZHLU 1GI9B 4H6TA 5DP3A 2Q1JA 2ZU5A 2OINA 4I8HA 4K69A 1LCYA 1QJ6B 2SGEE 4IN2A 3C27B 2TGAA 1IQEA 2ZHWH 3BTWE 1HXEH 1DWBH 5FPYA 4CR9A 2J92A 1O2WA 1Z6JH 3LGUA 2TBSA 4ABFA 5JB9S 1GVZA 1GMCG 1FIWA 2ZG0H 2V3HH 3FZDA 3FVFB 4OS1A 4M7GA 2A4RA 1EB2A 5PTPA 4D9QA 3E0PB 2ANYA 3M7TA 1GJ8B 2H9EH 2FI4E 4GCHG 1NRSH 1P06A 5A09A 4WF8A 2GDEH 1BJVA 1C2LA 3DA9B 2O8LA 5HYOA 4ASHA 3EDXB 3KEEA 3PO1C 3M7UA 2PW8H 1L1NA 1KLTA 3O8BA 1YPJH 2BB4A 2R2MB 4I7YH 1J8AA 3A7VA 1A2CH 1RIWB 4A92A 3AVZA 2BD7A 1VCWA 2ZHQH 4YLQH 1V6DA 2FEQH 1KXBA 1QY6A 5BPEA 2TRMA 3LIWA 2VVUA 5JPMH 2Y5FA 3ODDA 3EQ0H 3SW2B 1O33A 1A0LA 2Y81A 1EOLA 1HRTH 1HNEE 1Z7KA 1DWDH 2ZTYA 4CBOA 2GV7A 1SGCA 3CS7A 4A1TA 4O3UA 3GY6A 2C4FH 3TIUA 1O2GH 4ABBA 1Y8TA 3LPRA 3S7HB 3SQHE 1V2TT 7ESTE 3PMBB 4DCDA 1L4ZA 2EA3A 1O3MA 1G32B 2AGEX 2XWAA 2AMPA 1GHBG 1AQ7A 2FI5E 1FIZA 1KSNA 4CHAC 1WYKA 3KQCA 3AAVA 4X6NA 2BD2A 3FP7E 2VVCA 3SU1A 3T27A 1XUJA 3ZYEA 5C5OA 2I6QA 2A2QH 1K21H 2FI3E 8KME2 4MPXA 1BCUH 1JIMA 3O8CA 1ABIH 1TFXA 1ABJH 1O3FA 1N8OC 1JIRA 1K1NA 1LKAA 4FU7A 5F8XA 1NPMA 1DDJA 1TMBH 1O2LA 2J2UA 1P2MA 1T32A 1C1UH 4NZQA 5GCHF 2BZAA 1TNHA 2Z9LA 1SC8U 3RXQA 4FUGA 2J4IA 3GY4A 1A1RA 5TCCA 2A5AA 3LGVA 3NXPA 3U69H 1RD3B 1YPLH 1C1VH 2OQUA 4FVBA 3W95A 1QQ4A 1RS0A 3A84A 1HAHH 3RP2A 2A1DB 1P02A 4AYYB 1SGFA 3RC4A 3BG4B 1F0RA 2THFB 3T28A 3TH3H 3R3GB 4JZIA 4HZHA 1A61H 3O8RA 1N6YA 1SSXA 1YCPK 2FOEA 2ZDLA 2QXGA 1BUIA 1CO7E 4BNRA 3UNRA 1C5QA 4DVAU 1C4V2 1AN1E 2BXUH 1BRCE 3ELAH 4BTIB 1LPZB 1TBRH 2GP9B 3K9XB 1TBQH 3NKKA 4D76A 2WPHS 1QBVH 5SGAE 3TH4H 4XBBA 2BD4A 4WH8A 3GY7A 1AUTC 4JZEH 1O5GH 1SHYA 1SQOA 1UHBA 4CRDA 4U32A 9ESTA 1MBMA 3LONA 4UFEH 2NU1E 2NWNA 4X8TH 3KNXA 1O3GA 1UTNA 5FCRA 2A4GA 3UNQA 1P2IA 3E0NB 3UR6A 1RTLA 4Y0ZE 1BBRE 1DANH 8GCHF 5E8EH 1QL7A 2PHBA 1ZOMA 1ZRBA 2Q6DA 1C4Y2 3A7TA 1UHBB 1TQ7B 4AX9H 3RMLH 5HM9A 1O2QA 1Z1IA 1Z8JB 1HDTH 1C1MA 2A5IA 2C8XB 1ZHMA 3RM0H 1K1IA 5CE1A 1G3EA 2W7SA 3U1JB 2VWNA 3TK5A 4BXWA 2J34A 4Y8YA 2Z6BD 3A87A 1UTMA 2BXTH 1TYNA 4ISHH 1YPGH 3H7TA 3VB4A 1FAKH 1GJ9B 1THRH 4WWYA 4H6SB 2OP9A 3UIRA 1P0SH 2ANWA 5C1YA 1S6FA 2UUYA 4CH8B 2HWLB 2G55A 2PSYA 1GMDF 3A81A 1SHHB 1G37A 3ZVCA 2XC4A 1LVYA 3IITA 1V2LT 4DJZB 1L1GA 1MTUA 5HXFA 4Y0YE 1P9UA 3VXFH 4E7RG 1MQ5A 5DP7A 6GCHG 5AFZH 2ZCKP 2P94A 1PQAA 1QIXB 1YCPM 4BOHA 2C8YB 1MUEB 3IG6B 1ELCA 2ZKSA 1AFQB 4NZLA 2XC5A 2HALA 1TRMA 1KXEA 2ZTXA 1P10A 4INLA 3A83A 1Y59T 2PKSB 1C5PA 3LGYA 4IN1A 3B9FH 1DPOA 1O34A 1CGIE 1CBWB 1VR1H 3RXOA 1JMOH 1MTVA 4JYUH 2QYIA 1P09A 1GBAA 3MNXA 1H9IE 3NPSA 4MNXA 3H7OA 2C8WB 2F9NA 1TPSA 1KLIH 2BVRH 3QX5H 1TB6H 3AW0A 4XOJA 5DP4A 3VFEA 1IAUA 1GBJA 3GOVB 2QF0A 3KN2A 2UUFB 2ZPRA 1NRNH 3BEFB 2C90B 3T2NA 2ZU4A 3GCHB 5JBAS 2HVXA 3QUMP 3V13A 5JBTA 1DICA 1WAYB 3H5CB 4WMEA 3Q3YA 1A0JA 2XCFA 2OQ5A 1MBQA 4WXVA 1WCZA 1O32A 1P05A 1N8OB 3S69A 2FM2A 5EW1H 2Y82A 2VH0A 1GL0E 1C2MA 3QO6A 4A6LA 3PLPA 3FFGA 1EATA 2VIVA 2OUAA 1P2NA 1BMNH 2A0QB 1OWHA 3ATLA 2G8TA 4IC5A 4TY7A 1ZMNA 5J4SA 4NA9H 2SGQE 1GGDC 1UTKA 3ESTA 1K1PA 4THNH 1C2HA 1NFYA 5EXMA 4Y7AA 3DFJA 1QHRB 3LGTA 1BOQA 1ELFA 1QRXA 2Y5GA 1J17T 4E05H 4K8YA 4CR5A 5L6NH 1O39A 1O3HA 4A1XA 3A8BA 4ZKSU 1V2MT 1U6QA 3A7ZA 3V7TA 1M9UA 3LGWA 1IQGA 1UJ1A 5JBBS 4ZMAH 2UWOA 1G36A 2GMTB 3ZVAA 4B71A 4AGKA 5DO4H 1K1LA 1GMCF 2Y5HA 3SHAH 4TPYA 4NSYA 4AFZA 1BTYA 4WJG2 1ZPCA 1W0ZU 1SG8B 1O2RA 1K22H 3SV9A 1S83A 2HPPH 5AFYH 1K1OA 1S0QA 3C1KA 5HMAA 2I6SA 5IYTA 3MNCA 2FTLE 3NK8A 4XSKU 1ZR0A 1FJSA 1J14A 2ZA5A 3SGQE 5DP8A 1O3BA 3ATIA 1PPBH 2OBQA 3Q76A 4YOJA 1JXPA 1TPOA 2HRVA 2OC8A 1PYTD 1EQ9A 1C5LH 4AZ2B 3PTNA 1ELAA 3HATH 2YNAA 3PMJA 3RXPA 1K28D 5L2YH 5H4IB 3SJ9A 2K1QA 1ZTJA 1OOKB 1GBCA 3LH3A 1YC0A 1DT2A 4UONA 3GISB 3UQOA 1E36B 1AVGH 4CRAA 1E38B 1O3KA 3BSQA 3FZZA 3SV7A 2OD3B 1P9SA 4K60A 2XBWA 3VGCC 3S9AA 1XUHA 2AYWA 2Z9JA 3EE0B 3F9EA 3MH4A 1NT1A 2D26C 2F9OA 1SGIB 1HB0B 1G9IE 2QV1A 3ZV9A 4NA8A 1JBUH 4A5TS 4GUXA 2W3IA 2OXSA 4FUFA 1KXCA 3PYHA 1CU1A 1EPTC 2QXJA 3BTEE 3K6ZA 3RXBA 3G01A 3TJUA 2WPIS 1BTZA 3UOUA 3F9GA 1W7GH 1F92A 1YLCA 3EA9A 2LPRA 1HJ8A 1TMUH 1BTWA 3PV4A 1WSSH 2EI8A 5C3NA 4O3TA 4I33A 1EAXA 1ANDA 2PGQB 2BDCA 3UREA 1DE7H 1PQ5A 3SUFA 3M5LA 3ZVDA 1Q31A 4NA7A 2OLGA 4Q80A 1GHVH 3SJIA 4D7FA 1XUGA 5AHGH 2ZGCA 3MU1A 2CMYA 1TGSZ 4XFQA 4ISOA 1VITG 2P3TB 3BV9B 3TVJB
chains in the Genus database with same CATH superfamily
2ZFRH 1L2EA 3V12A 3ATKA 1SPJA 4AORA 1IHTH 2FLRH 2P59A 1TGBA 1YP9A 1C9PA 1DFPA 5EQRA 1GI4A 1NY22 4LK4A 4NCYA 1B7XB 1AKSA 4RI0A 5CHBA 4MPUA 1BIOA 3MH7A 4JCNA 4Q7XA 5FBIA 5DP9A 2M2AA 5FAHA 3ENSB 2IOTA 3RLWH 3U1IB 1QJ7B 3UQVA 1WV7H 3HPTB 1O5DH 1T31A 3S7KB 1H8DH 1CGJE 3GDVA 1QTFA 4B73A 2G00A 2QN5T 4ZXYH 1KDQB 1FXYA 4IC6A 6CHAB 3E3TA 4WY3A 5I46H 1ZSJA 1O37A 5DK1A 3EGKH 3RU4E 2KCYA 1S5SA 4YM9A 2BLVA 2L74A 4TYDA 1C2JA 2J94A 3AAUA 1O2OA 4MPWA 1F2SE 1AE8H 1BTUA 1GI7B 3ZV8A 1GJBB 3A7YA 2OC7A 3EAJA 2CGAA 1UMAH 2PLXA 2R2WU 1FY8E 1SGFG 3GY5A 3H09A 2RDLA 3KHVA 3RMOH 2TGPZ 5FXLA 5GDSH 5FL7D 3K2UA 3F0PA 5E0GA 4R0IA 4WXIA 1XXFA 1T8LA 2BOHB 3U8RH 3AW1A 4BAMB 2XBXA 1ZHPA 1MD7A 3MHWU 1FAXA 4J1YA 5DKMA 1NFXA 2AS9A 2G4TA 2BDAA 4IGDA 1LO6A 1VITH 1CHGA 2D8WA 2ZDNA 2GKVE 4CBNA 3HK3B 1GI1A 1P04A 4ACAA 2BY9X 2WHXA 1TX7A 2K0QA 1DSUA 4KTCA 1GMHF 5TCAA 1TNGA 4LOYH 4X8UH 2ODQA 3SJKA 1C1SA 1K2I1 3P8FA 2Q6GA 4Z1MD 2ZU3A 3SOSA 1ZMLA 3A88A 2UUKB 1FI8A 4X1RU 3L6PA 1BITA 1DY9A 2SGPE 1C5MD 4Y11E 3U98H 2XYAA 2FOHA 1T8NA 3MO3A 3OTPA 2HNTF 5L30H 1OYTH 1KIGH 2AIQA 1NO9H 2ASUB 1SR5C 3A8DA 3PB1E 1CA8B 4RKJB 1KXDA 3Q3XA 1EJMA 1MAXA 2HGTH 4GPGA 1WDIA 3KQ5A 3P8GA 3UR9A 4NG9H 3ZZ9A 2BQ6B 1H8HD 4KTUA 2W7UA 1A7SA 2QCYA 3MNSA 4ZXXH 5KECA 2NU0E 1HJAB 2FS8A 1V2UT 1ZYOA 1SGQE 2IJOB 4TSFD 5A0AE 2AMDA 1XKAC 2QXIA 2VGCC 2WUBA 2V7QD 2XC0A 2UWPA 7GCHG 1O2HA 1GHXH 4ZROA 1W0YH 1XX9A 4I8LA 4U2WA 1F0UA 2J98A 1TNKA 1ELGA 1DLEA 1FX0B 1T8MA 1ZPZA 1QB6A 2ZGXH 2B5TB 2QC2A 2ALPA 4LZ4B 2ZFSA 3UTUH 1HLTH 4WH6A 2FLBH 5C2ZA 1ZHRA 2QAAA 1VGCC 5EXNA 2A31A 2YNBA 4GAWA 1C5UA 1DUAA 1DSTA 3GY3A 2Y7ZA 1VCPA 2CF9H 5C67A 1BRAA 3SV2H 4X6OA 3UOPA 3UUZA 1GBDA 1C2KA 5LPFA 5KEDA 3SU5A 1V2ST 1QCPA 4UE7H 4DW2U 8GCHG 1UCYE 5J4QA 1C1PA 4F55A 1BMMH 3GCNA 2QIQA 2GZ9A 1DXPA 1ZTLA 4FUBA 2FOBA 1EP5A 2BD8A 1TGCA 2KAIB 2EC9H 1A5HA 5HM2A 2ZHEH 2BYAX 1XUIA 1ETTH 1FUJA 4B6FA 3NWUA 1UVUH 3ZZ8A 1V2RT 3QDZB 3GYMA 5DG6A 3GY2A 5C0TA 5C17A 1IOEA 3MO9A 4AYVB 4GHTA 3Q77A 1ORFA 1HJAC 4AGJA 2VWLA 4KELA 1ID5H 2RA0A 4H4FA 3A86A 2XW9A 2Z9KA 1BHXF 3TLOA 5LH8A 5C1UA 5EPYA 4DOQA 1UTPA 1LTOA 1VJAU 5AF9H 2ZEBA 1YKTA 3MMGA 1JOUB 1RXPA 1HYLA 1SQTA 2ZFPH 5EPNA 4Y79A 4ESTE 4RSPA 1DWEH 4GVUA 3K6YA 3A82A 3QLPH 1YYY1 2ZU2A 1TIOA 1V2OT 3EYDA 2FPZA 4XRNA 2RFKC 1FY4A 3MU4A 1NS3A 1O3IA 3RC6A 1YPHC 3BTGE 4YT7H 1O30A 1GCDA 1LVOA 1EOJA 1SOZA 4ZHAA 2BY7X 1EJNA 1GI0A 1K0HA 4B2BA 3SQEE 1YPEH 2HVYB 3BEIB 1LHGH 4NWLA 4U30A 3OEED 1EPTB 4GCHF 2F9PA 1Z1JA 2FDAA 5ESTE 2ZGHA 1MTNC 4DIHH 1D4PB 2FMJA 2PKAA 3T5FH 1TALA 1NU7B 4MDSA 3PROA 4JZFH 1MU8B 1ESBA 2O8WA 4UD9H 3RXKA 3W94A 1P57B 1GBLA 1ZRKA 3E16B 1EJAA 1TAWA 1PFXC 1EX3A 4B76A 1O2VA 3N7DA 3W1EA 1XUKA 4DT4A 5A8XA 2QF4A 1N6XA 4O03A 2WV5A 1HBTH 2A7CA 3ODFA 2STBE 3F6UH 3SZNA 5E0JA 1P11E 3U9AH 2VJ1A 1D3TB 1OWKA 2ESTE 1EP6A 2ILNA 2WPMS 5CHAB 1LHCH 5AVDA 3UWJH 2FESH 4ABGA 5T6FA 3ZYDA 2XRCA 1JWTA 3M3VA 2BLOA 1HAXB 1PPZA 3SGBE 3FANA 3TK6A 2XBYA 4Y8XA 1MMJN 1MKWH 2ZTZA 1O5AB 5EJZA 3WW7A 1OWIA 1C5VA 3A8CA 2GTBA 2ZGBH 3OYPA 3SV6A 3OAAD 1F0TA 1GL1A 2PTNA 3KCGH 1D9IA 3DSGA 1AB9B 1TRYA 1H8ED 1C5SA 2O8MA 1HAVA 1BBRK 1OX1A 3QK1A 2H5DA 2GT8A 2BVXH 1CA0B 1RGQA 3KYGA 4CRCA 1SLVB 3B23B 1LPKB 4Q63A 1NM6A 4FOUC 1A3EH 4TPIZ 4Z6AH 3BTKE 3FP6E 3K65B 1KDQA 2ZHDA 2Z9GA 1ESTA 1E1RD 4SGBE 7KMEH 2ZO3H 1OHHD 3BTFE 6CHAC 1HUTH 1PQ7A 3LJJA 3P17H 1AMHA 1EASA 2ZQ2A 4MTBA 1T4UH 2BDBA 1O36A 2SGFE 2CN0H 1TA6A 1A5IA 3TH2H 1SGNE 1FQ3A 4KKDA 2JETB 1MKXH 1NRPH 1C5TA 1DOJA 3HGNA 3STJA 1SGDE 2HLCA 1GBEA 3B8JA 2VB0A 1O3DA 2SNWA 5EOKA 4FVDA 1XXDA 3V3MA 4FETA 1XKBC 1AFQC 2Y6TA 3D49H 4ABAA 5HIYA 1LVMA 1Y5UT 1W0KD 2FODA 2PV9B 1O2YA 4AB8A 5GNDA 4BTUB 1ETRH 3PM3A 1O38A 1MD8A 1Z6EA 1FPHH 1LVBA 2BQ7B 4R8TB 1AE5A 1YM0A 4MNYA 2ODPA 3LDXH 2P3UB 5EXLA 2P93A 1ELBA 2ULLA 1BA8B 1FMGA 2BHGA 1QR3E 3VB6A 2WV4A 1P3EA 5DP5A 2EY4C 4F4OC 2FP7B 2PFEA 1BDAA 1CT0E 1GJAB 2G5NA 5GCHG 1C5NH 2V0BA 3CP7A 5DGJA 1W12U 1QRZA 4FU9A 4INKA 3QWCH 1CBWC 1HGTH 4BANB 1CSOE 3ZZBA 3VXEH 5FPTA 4D8NA 1DUEA 2AHME 4ISNA 1MAYA 1WQSA 1GBTA 3KGPA 3ATWA 3FAOA 4I8JA 1BBRH 1SGEE 1RIWC 1TRNA 4J2YB 1C1NA 2QF3A 3TGKE 1UTLM 1OSSA 1W11U 4ABEA 3GICB 2JH5D 1ELTA 1SKYE 2LP6A 1E35B 1O3CA 3F9FA 3M37A 5F03A 2H1UA 5CMXH 1P03A 1QB9A 1SLUB 1ZSLA 3TGJE 3OTJE 1QJ1B 4RT1A 1DITH 4HGCA 1UVPA 1AO5A 1WQVH 4K8BA 3SORA 1EUFA 4DGJA 1IQLA 1ZGIA 3U8TH 2HOBA 3A7WA 1J16A 1P2JA 1F0SA 1MTNB 1FN6A 3TK9A 1QBNA 3OX7U 2BY5X 1QQUA 1IQNA 3D65E 1RRKA 2GMTC 3VEQB 1NC6A 2OCVB 1K9OE 1IQHA 3QGNB 3PO1B 4RKOB 1D3QB 2AIPA 2BDYA 4HFPB 1BB0B 1W2KH 1C9TA 3SI3H 3V0XA 1O2IA 2TPIZ 1GG6C 2O9QA 2UUJB 1GJ7B 2FO9A 2JH0D 3D62A 1GI5A 2BDIA 2BOKA 1UCYH 3BTQE 2W3KA 1NZQH 3URCA 1TX6A 1V2QT 1O5EH 1MTSA 3ZZAA 1W3CA 2A2XH 4DY7B 3SHCH 2BQWB 3SUDA 4Y76A 1IQKA 4YLUA 4ZKNU 1LDTT 1OWDA 2WPDD 1AWHB 4HTCH 3GS9A 1A4WH 1O3PB 2P8OB 3URDA 4I86A 4YXWD 1MCTA 1GHZA 2F4LA 4E7NA 2ZP0H 3T26A 2F9BH 1OPHB 1ESAA 1L4DA 1BZXE 3M5NA 1E1QD 4X6MA 5E0HA 2QE7D 2G4UA 5T1VA 3GY8A 4XDEA 2IPQX 2GT7A 1YF4A 2BVSH 1S85A 2ZPQA 1C5XB 4I8KA 4UEHH 1AGJA 5EGMA 3F2GA 5EQSA 3LKWA 4ZCNA 2B8OH 3BTTE 2Z3CA 2H9HA 1AZZA 1TNJA 2DE8A 2Z7FE 4K3JA 2KX4A 3CENA 1GMDG 1O0DH 1Z71A 3O8DA 4OGYA 1SOTA 4CH2B 1ACBE 4BAKB 8LPRA 4OS6A 1IQIA 1NBME 1IQFA 3E6PH 3P8NA 1VKYA 2XCNA 5IDKA 1P12E 2YOLA 1TMTH 1B0FA 4CREA 3D23A 3BF6H 4B2CA 2ZECA 3ZZCA 1GBMA 1P01A 1AHTH 1YPHE 2H5CA 2A7HA 4IW4E 1RTKA 2VVVA 1MKXK 2WPKS 1O2TA 3FP8E 4JZDH 1E37B 3SU3A 1O2SA 5GIBA 1ZSKA 5A8YA 1AVWA 1L0ZA 4WMFA 3GCOA 1W10U 3M36A 1C1OA 3BN9A 2F9VA 4ABIA 1T7CA 4Y7BA 3FN8A 1VJ9U 1WU1A 2ZFFH 2TGTA 2ZI2H 1TOMH 2VGCB 2VINA 2KZ4A 2BMGB 4K1SA 2PUXB 2VIOA 1T4VH 3N7EA 1TPPA 2VIDA 1A46H 3S9BA 1MZDA 1C4U2 5EU8A 1ELVA 5HGGA 1ARCA 5A0CA 3MU8A 1OWEA 1OP0A 3LC3A 3PV2A 1W7XH 2ZPSA 4K5ZA 1BHXB 1EZQA 4K2YA 1OYQA 1H9LB 2FXRA 1JRSA 3SBKA 1UK4A 2BTCE 5GXPA 1XVMA 4GLYA 2Y7XA 4K1TA 1SL3A 5E2PA 2FS9A 1WBGB 1PPFE 1NRRH 2IN2A 3SNCA 1HAOH 2ZF0H 1HPGA 1NN6A 4B6EA 1GHAG 2FYQA 2Z3EA 1GHYH 1G3BA 1F7ZA 1YBWA 3A7XA 3U8OH 2Q6FA 3ZZ3A 1KXAA 5EW2H 2B7DH 4NWKA 1LHFH 1G3CA 2BD9A 5C20A 1ANBA 1MTWA 1MZAA 4MLFB 1C5WB 1MQ6A 3SJOA 1PPHE 3ZIAD 1CGHA 3MI4A 5BRRE 4P02A 1PPCE 3S0NA 4X1PU 3PRBA 4OS2A 1ANEA 2HNTC 3LJOA 1GBKA 4FU8A 3SI4H 3I78A 2BLWA 4BXSA 1W8BH 3F1SB 5I25A 3DCLA 1ARBA 1PQ8A 1AKSB 2BZ6H 3L33A 1O2XA 1SQRA 2SGDE 3ATMA 3R0FA 3LT3A 1SGPE 1C1RA 3OY6U 4DIIH 2AMQA 1DXWA 2G81E 3ZVEA 2SNVA 4ZKOU 1S6LA 1OP2A 4KTSA 3EA8A 4AG2A 3Q3KA 4UFGH 2GX4A 3TPIZ 3UB0A 1TPAE 1Y3UA 4Q4LA 1KLJH 2JKHA 4WMDA 1SGRE 3QZRA 1OS8A 3Q00A 2CV3A 4CRGA 1NROH 1RJXB 4Y10E 3MU5A 1QNJA 3UPEA 2RCEA 5L2ZH 4F48B 3BG8A 4XBDA 4MPVA 1GJ5H 1EAWA 1XMNB 3RU4T 2WPJS 2XNIA 3VB7A 1Z8GA 1GBBA 3E91A 5FX6A 1AUJA 1DX5M 2A5KA 1ZZZA 1GMHG 2ALVA 4U01A 3T25A 1MU6B 7LPRA 4UFFH 4OGXA 1HAZB 3NZIA 2KFWA 4HI3A 2KCAA 1AFEH 4B74A 2L6OA 1AU8A 1LHEH 1G2LA 2QY0B 1RTFB 2XOKD 2W6JD 1VZQH 1KTSB 2JH6D 5A8ZA 1CHOG 2FX4A 1KTTB 3SNDA 2GCTC 3HKJB 2G5VA 1O3EA 3SUEA 3EE7A 2PTCE 5F53A 1GPZA 3F68H 2AEIH 2ZFQH 3FKSD 4IMQA 3RXFA 1V2JT 6ESTA 3VB5A 1ZGVA 5K7RA 3N7OA 1H9HE 4E06H 4TWWA 4OM9A 3RUOA 1ANCA 2OC0A 2RG3A 3M5MA 1B0EA 1SB1H 1BMAA 3DSPA 1O2UA 4AFSA 4A1VA 1EB1H 1Y3YA 3ZZDA 1S81A 3QTVH 1HAIH 2OTVA 3DSOA 1KY9A 3HK6B 3PLKA 4JMYA 1A0HB 5T6GA 2H6MA 1Y5BT 3SU2A 5C5NA 4XBCA 4RT0A 1GBFA 2WYGA 3BIVH 4LXBH 5LGOA 1ZTKA 1NRQH 1AZ8A 3GYLB 4MNVA 1GHBF 1C2GA 2F91A 4X2YA 4YOIA 1FLEE 3GCTF 5FBEA 4NSVA 1SVPA 3PMHB 2SGAA 3M61U 3DD2H 5FX5A 3M5OA 3MWIU 4FUHA 3RXRA 3E90B 6LPRA 2ZHFH 2EI7A 2OC1A 2NU3E 2ZQ1A 3M3TA 4I31A 4FUDA 3MFJA 4MNWA 4IBLH 2KAIA 2QA9E 4QT8C 1FN8A 1FZZA 2A32A 3QGJA 1V2VT 5FHTA 2CHAC 1VCQA 4FUIA 1AY6H 3BIUH 1H8IH 1DWCH 3BTDE 1Y5AT 1TBZH 3DT0H 4ISIH 5G4BA 1INCA 1QL9A 3VGCB 1C1TA 2ZIQH 2YMSC 3WY8A 1O2ZA 4Q7ZA 4JYTA 5B6OA 2ZCHP 1HFDA 2GV6A 3TJVA 4DURA 2VWMA 3OE7D 1YWUA 4OS7A 2VIQA 1G3DA 3KF2A 2P3FH 1DM4B 1DS2E 3P8OA 1X7AC 5JB8S 2PUQH 3SGAE 3MOCA 2DUCA 1XVOA 1HV7A 1Q2WA 2FIRH 2V35A 4B2AA 1BTPA 3GDUA 3ZVBA 1NESE 2C93B 1TNLA 1C5ZB 3SNBA 2J98B 3SJ8A 1O3OA 3PWCA 3OY5U 1LHDH 1ELEE 2FOCA 4IMZA 2CJIA 3P95A 1E79D 1VITF 4KP0A 1UO6A 1TLDA 1IQJA 1GCTC 3PTBA 1O5BB 1XUFA 2BDHA 1GGDB 2FTMA 3MYWA 3RXMA 3A85A 2QXHA 1FPCH 1GI8B 1UVOA 4ZH8A 4AOQA 2O8TA 3NUMA 2EQNA 1EAIA 2BY8X 2FYRA 3P70B 3BEUA 1J9CH 2KR7A 3TJNA 1S82A 8ESTE 3OSYA 2ODYB 1WOFA 4VGCC 2VNTA 3DHKH 1O2PA 4YZUA 2P95A 2WINI 1GHWH 5JYIA 1GHAF 3KQBA 5GPIB 2H9TH 1LQEA 1VGCB 2AFQB 1GDQA 1NFWA 1QB1A 4O97A 1GJCB 4NGAH 1O35A 1LMWB 2R9PA 1MH0A 2VIWA 2ZDKA 1EPTA 1AB9C 1ZJDA 3MU0A 4YESB 5ETXA 2WUCA 1O5CB 1SMFE 2JJ2D 2NU2E 1GCTB 7GCHF 5GWZA 1DVAH 2AH4X 4YTAA 5C1XA 4X2WA 1O3AA 1SFQB 2FOAA 1AIXH 3SUGA 4VGCB 1P8VC 2AERH 2WV9A 3UFAA 2C3SA 1ELDE 2V3OH 3RM2H 2BY6X 1UTOA 4Z0KA 2R0KA 4FUEA 1PJPA 1CT4E 2STAE 2GCHG 3PV5A 3RMNH 4X0WU 4JK5A 5EJ1A 4INHA 2PKSC 3FO8D 1GI6A 5DP6A 2Z94A 3KQEA 2W5EA 4FUCA 4PROA 3KYFA 5C94A 1TWXB 4GHQA 1SGYE 1HCGA 2VIPA 4B75A 4MQAA 3ZVFA 3NCLA 1TGNA 4IS5A 3N99A 2BX3A 1EZUC 2FWWA 1PPEE 3HGPA 3RXUA 5CDFE 4GSOA 1TA2A 1WTHD 1Y3WA 2D2DA 2HPQH 5T3HA 3MH6A 1AI8H 1SLWB 1ZPBA 2F3CE 2XBVA 4X6PA 1J15A 1QA7A 4JYVH 4X8SH 2B9LA 2GGVB 5F8ZA 1G2MA 1HJ9A 4X1NU 3MTYA 1C2IA 1DLKB 1L1JA 2GZ8A 2ZWLH 2HNTE 4LZ1H 4ABDA 1O2NA 1OWJA 1YPMH 3IWMA 4BAQB 4AG1A 1BJUA 5EIYA 1SBWA 1RFNA 3E1XB 1S6HA 5GJ4B 2TGDA 3SU6A 1NTPA 1TNIA 4JK6A 1F5KU 2CXVA 1N1LA 3RXSA 4Y8ZA 5LPRA 1HAVB 2ZCLP 3S9CA 2ANKH 4YT6H 1TONA 3M7QA 4Q7YA 1EKBB 3TNSA 3P92A 3OU0A 1GDNA 5EJLA 1UK3A 2BDGA 2GD4B 3LGIA 1O2MA 3RXTA 1W13U 2QGRA 2XNDD 2F9UA 4UFDH 1MCVA 5TJXA 2ZC9H 1CQQA 1GVKB 1O5FH 1QFKH 1BMFD 1Y3VA 2JIZD 1HAPH 1HIAA 1T8OA 4FXGH 3SO3A 3I29A 1SQAA 1SLXB 5JBCS 5ESBA 4YO9A 2PGBB 3DFLA 3RXDA 2C8ZB 1GJ6A 5K0HA 3F9HA 3TU7H 2F83A 3UY9A 2W26A 1UTQA 2ZDMA 3JZ1B 1SGTA 1GI2A 5LPEA 1MKWK 1P2QA 4A7IB 1YLNA 1UVTH 2GZ7A 2VU8E 1C2DA 1BQYA 3GCTG 4TWYA 1EZSC 1D3PB 1O2KA 1WTGH 1UVSH 3QZQA 2BD5A 2RA3A 5ABWA 3T29A 2V6NA 2Z9IA 1YGCH 4NIVA 1W14U 4X2VA 2EEKA 1DY8A 2VH6A 1CT2E 4YOGA 4BAOB 1Q3XA 3BTHE 1BTXA 4DG4A 2ZFTA 4O9VA 1B5GH 1GJ4H 4MG3A 2D1JA 2DE9A 2RDEA 3STIA 1C2FA 4Y6DA 3ZZ7A 4X2XA 1CA0C 3AASA 4DT7B 4CHAB 3LH1A 1C1QA 1OXGA 1H1BA 3RXGA 4OS4A 1GJDB 4H42U 4D7GA 3RXHA 4NIWA 4BAHB 5A2MH 3A8AA 4JZ1A 2IPHA 1OP8A 1YCPH 1C5OH 1PPGE 1S0RA 1QURH 5DN6D 2BD3A 1SI5H 1AWFH 1GBHA 3M35A 1HIAB 2ZDAH 4NIYA 1WUNH 1O31A 5A0BA 2XTTB 2ANMH 4CRBA 1EXFA 4CRFA 5DJ7A 2VWOA 6GCHF 2PSXA 3MH5A 1C5RA 1P3CA 5E2OA 4NFEA 2FOFA 1H4WA 4X1SU 4X8VH 2JETC 3ZZ5A 3L3TA 2FOMB 1TOCB 3PWBA 1A3BH 2QF5A 1FONA 4WVPE 1GDUA 2TIOA 2SFAA 1PYTC 1D3DB 2A7JA 3QN7A 5F6MA 1NFUA 5EG4A 1TGTA 1BMLA 1C5YB 3RMMH 3PLBA 1KXFA 3RC5A 4Y71A 3F2HA 5EODA 4OS5A 1YLDA 1TABE 3E8LA 1GG6B 1D6RA 1FNIA 4AFQA 3QTOH 3RXEA 2FX6A 2P8OC 5F8TA 1E34B 1AVXA 3SYJA 3GDSA 2G51A 1K1MA 3A89A 3T62A 3SN8A 3TNTA 1QBOA 2A4OA 9LPRA 3LC5A 1ETSH 1OKXA 2A45B 3UWIA 4ABHA 2LNCA 3SU4A 3RXIA 4MVNA 1KYNA 2ZGJA 3VB3A 3TITA 3CS0A 2Z3DA 3RDZA 1ZLRA 4F49A 4Q2KA 1GI3A 1GVLA 2R3UA 1BRBE 1HAYB 1THSH 4TY6A 3WWFA 3RXJA 1CE5A 2BM2A 2FZZA 4NIXA 3SNEA 3MO6A 3PMAB 2CHAB 1QRWA 4AC9A 2PR3A 1QL8A 1IQMA 2BX4A 1HAGE 2JDID 4XE4A 1Z8RA 2PP6A 1O3LA 1THPB 5T6DA 2GVFA 3RXCA 1CHOF 4UDWH 1QA0A 1O3JA 1NU9A 3ZZ4A 3RLYH 5CHAC 1JRTA 2AGGX 1FDPA 1TX8A 2G52A 2ZZUH 2WPLS 1LQDB 1O3NA 1LKBA 2ZU1A 1BTHH 3SV8A 3TJOA 2B0FA 1BRUP 3ZVGA 3WWBA 1F5RA 1ZJKA 1AD8H 1XM1A 5KGOA 5FPSA 1TE0A 2ZDVH 1FY3A 1TQ0B 2R3YA 3RU4D 1UK2A 1V2KT 2UWLA 1C2EA 1FY1A 2PWXA 4AFUA 1P2KA 1V2WT 2OBOA 2XXLA 2A4QA 1UCYK 5FCKA 2J5UA 3DUXH 2XWBI 4FUJA 1EAUA 1S84A 1V2PT 2PKAB 2EI6A 1F5LA 4B1TA 1Z8IB 1A5GH 4ABJA 4KGAA 1E0FD 1V3XA 3SNAA 2GCTB 1GWAA 3M3SA 3RXAA 1C1WH 1G30B 2Y80A 3LU9B 4M9FA 4NFFA 2J9NA 1O2JA 1BT7A 3BG4C 2CF8H 3RXVA 4ZAEA 3ITIA 2J38A 3P6ZB 3VPKA 4I32A 2P16A 2ZNKH 4K1EA 2AGIX 3GCHC 4SGAE 2R0LA 3JZ2B 4BTTB 4I8GA 3A80A 1FV9A 4AB9A 5DSFA 3TGIE 1GBIA 2JJ1D 3LOXA 3SU0A 3I77A 3KIDU 4RN6A 1EZXC 1FY5A 4ZKRU 2K8IA 1D6WA 1Y3XA 1YPKH 3KL6A 4P00A 2GDDA 1IHSH 1SFIA 1CVWH 4X1QU 2J95A 2FOGA 5DPAA 2H2ZA 2VBCA 3KQDA 4ZUHA 2M5TA 3MNBA 4ZHMU 4D9RA 2BLQA 1P2OA 1K1JA 3RXLA 1QGFA 2GCHF 1ZMJA 1LPGB 2NU4E 5JDUB 1HXFH 2WYJA 5EQQA 4ISLA 3BTME 1V2NT 2O8UA 3ZZ6A 1UTJA 3EA7A 4AN7A 1MABB 3HKIB 3UNSA 4ZHLU 1GI9B 4H6TA 5DP3A 2Q1JA 2ZU5A 2OINA 4I8HA 4K69A 1LCYA 1QJ6B 2SGEE 4IN2A 3C27B 3NRLA 2TGAA 1IQEA 2ZHWH 3BTWE 1HXEH 1DWBH 5FPYA 4CR9A 2WSSD 2J92A 1O2WA 1Z6JH 3LGUA 5HIZA 2WZQA 2TBSA 4ABFA 5JB9S 1GVZA 1GMCG 1FIWA 2ZG0H 2V3HH 3FZDA 3FVFB 4OS1A 4M7GA 2A4RA 1EB2A 5PTPA 4D9QA 3E0PB 2ANYA 3M7TA 1GJ8B 2H9EH 2FI4E 4GCHG 1NRSH 1P06A 5A09A 4WF8A 2GDEH 1BJVA 1C2LA 3DA9B 2O8LA 5HYOA 1QZ8A 4ASHA 3EDXB 3KEEA 3PO1C 3M7UA 2PW8H 1L1NA 1KLTA 3O8BA 1YPJH 2BB4A 2R2MB 4I7YH 1J8AA 3A7VA 1A2CH 1RIWB 4A92A 3AVZA 2BD7A 1VCWA 2ZHQH 4YLQH 1V6DA 2FEQH 1KXBA 1QY6A 5BPEA 3F0OA 2TRMA 3LIWA 2VVUA 5JPMH 2Y5FA 3F3BA 3ODDA 3EQ0H 3SW2B 1O33A 2W6ID 1A0LA 2Y81A 1EOLA 1HRTH 1WXRA 1YY3A 1HNEE 1Z7KA 1DWDH 2ZTYA 4CBOA 2GV7A 1SGCA 3CS7A 4A1TA 2LELA 4O3UA 3GY6A 2C4FH 3TIUA 1O2GH 4ABBA 1Y8TA 3LPRA 3S7HB 3SQHE 1V2TT 7ESTE 3PMBB 1NBMD 2HLDD 4DCDA 1L4ZA 1EFRD 2EA3A 1O3MA 1G32B 2AGEX 2XWAA 2AMPA 1GHBG 1AQ7A 2FI5E 1FIZA 1KSNA 4CHAC 1WYKA 3KQCA 3AAVA 4X6NA 2BD2A 3FP7E 2VVCA 2KCOA 3SU1A 1XUJA 3T27A 3ZYEA 5C5OA 2I6QA 2A2QH 1K21H 2FI3E 8KME2 4MPXA 1BCUH 1JIMA 3O8CA 1ABIH 1TFXA 1ABJH 1O3FA 1N8OC 1JIRA 1K1NA 1LKAA 4FU7A 5F8XA 1NPMA 1DDJA 1TMBH 1O2LA 2J2UA 1P2MA 1T32A 1C1UH 4NZQA 5GCHF 2BZAA 1TNHA 2Z9LA 1SC8U 3RXQA 4FUGA 2J4IA 3GY4A 1A1RA 5TCCA 1UW7A 2A5AA 3LGVA 3NXPA 3FOAA 3U69H 1RD3B 1YPLH 1C1VH 2OQUA 4FVBA 3W95A 1QQ4A 1RS0A 3A84A 1HAHH 3RP2A 2A1DB 1P02A 4AYYB 1SGFA 3RC4A 3BG4B 2GJGA 1F0RA 2THFB 3T28A 3TH3H 3R3GB 4JZIA 4HZHA 1A61H 3O8RA 1N6YA 1SSXA 1YCPK 2FOEA 2ZDLA 2QXGA 1BUIA 1CO7E 4BNRA 3UNRA 1C5QA 4DVAU 1C4V2 5HKKD 4XD7D 1AN1E 2BXUH 1BRCE 2V3MA 3ELAH 2KCPA 4BTIB 1LPZB 1TBRH 4TT3D 2GP9B 3K9XB 1TBQH 3NKKA 4D76A 2WPHS 2YMSB 1QBVH 5SGAE 3TH4H 4XBBA 2BD4A 4WH8A 3GY7A 1AUTC 4JZEH 1O5GH 1SHYA 1SQOA 1UHBA 4CRDA 4U32A 9ESTA 1MBMA 3LONA 4UFEH 2NU1E 2NWNA 4X8TH 1KMHB 3KNXA 1O3GA 1UTNA 5FCRA 2A4GA 3UNQA 1P2IA 5C0UA 3E0NB 3UR6A 1RTLA 4Y0ZE 1BBRE 1DANH 8GCHF 5E8EH 1QL7A 2PHBA 1ZOMA 1ZRBA 2Q6DA 1C4Y2 3A7TA 1UHBB 1TQ7B 4AX9H 3RMLH 5HM9A 1O2QA 1Z1IA 1Z8JB 5B6LA 1HDTH 1C1MA 2A5IA 2C8XB 1ZHMA 3RM0H 1K1IA 5CE1A 2J97A 1G3EA 4ACBA 2W7SA 3U1JB 5IK2D 2VWNA 3TK5A 4BXWA 2J34A 4Y8YA 2Z6BD 3A87A 3OEHD 1UTMA 2BXTH 1TYNA 4ISHH 1YPGH 3H7TA 3VB4A 1FAKH 1GJ9B 1THRH 4WWYA 4H6SB 2OP9A 3UIRA 1P0SH 2ANWA 5C1YA 1S6FA 2UUYA 4CH8B 2HWLB 2G55A 2PSYA 1GMDF 3A81A 1SHHB 1G37A 3ZVCA 2XC4A 1LVYA 3IITA 1V2LT 4DJZB 1L1GA 1MTUA 5HXFA 4Y0YE 1P9UA 3VXFH 4E7RG 1MQ5A 5DP7A 6GCHG 5AFZH 2ZCKP 2P94A 1PQAA 1QIXB 1YCPM 4BOHA 2C8YB 1MUEB 3IG6B 1ELCA 2ZKSA 2KM0A 1AFQB 4NZLA 2XC5A 2HALA 1TRMA 1KXEA 2ZTXA 1P10A 4INLA 3A83A 1Y59T 2PKSB 1C5PA 3LGYA 4IN1A 3B9FH 1DPOA 1O34A 1CGIE 1CBWB 1VR1H 3RXOA 1JMOH 1MTVA 4JYUH 2IJD1 2QYIA 1P09A 1GBAA 3MNXA 1H9IE 3NPSA 4MNXA 3H7OA 2C8WB 2F9NA 1TPSA 1KLIH 2BVRH 3QX5H 1TB6H 3AW0A 4XOJA 5DP4A 3VFEA 3SZEA 1IAUA 1GBJA 3GOVB 2QF0A 3KN2A 3VG8A 2UUFB 2ZPRA 1NRNH 3BEFB 2C90B 3T2NA 2ZU4A 3GCHB 5JBAS 2HVXA 3QUMP 3V13A 5JBTA 1DICA 1WAYB 3H5CB 4WMEA 3Q3YA 1A0JA 2XCFA 2OQ5A 1MBQA 4WXVA 1WCZA 1O32A 1P05A 1N8OB 3S69A 2FM2A 5EW1H 2Y82A 2VH0A 1GL0E 1C2MA 3QO6A 2F43B 4A6LA 3PLPA 3FFGA 1EATA 2VIVA 3OFND 2OUAA 1P2NA 1BMNH 2A0QB 1OWHA 3ATLA 2G8TA 4IC5A 4TY7A 1ZMNA 5J4SA 4NA9H 2SGQE 1GGDC 1UTKA 3ESTA 1K1PA 4THNH 1C2HA 1NFYA 5EXMA 4Y7AA 3DFJA 1QHRB 3LGTA 1BOQA 1ELFA 1QRXA 2Y5GA 1J17T 4E05H 4K8YA 4CR5A 5L6NH 1O39A 1O3HA 4A1XA 3A8BA 4ZKSU 1V2MT 1U6QA 3A7ZA 3V7TA 1M9UA 3LGWA 1IQGA 1UJ1A 5JBBS 4ZMAH 2UWOA 3F2FA 1G36A 2GMTB 3ZVAA 4B71A 4AGKA 5DO4H 1K1LA 1GMCF 2Y5HA 3SHAH 4TPYA 4NSYA 4AFZA 1BTYA 4WJG2 1ZPCA 1W0ZU 2OK5A 1SG8B 1O2RA 1K22H 3UAIC 3SV9A 1S83A 2HPPH 5AFYH 1K1OA 1S0QA 3C1KA 5HMAA 2I6SA 5IYTA 3MNCA 2FTLE 3NK8A 4XSKU 1ZR0A 1FJSA 1J14A 2ZA5A 3SGQE 5DP8A 1O3BA 3ATIA 1PPBH 2OBQA 3Q76A 4YOJA 1JXPA 1TPOA 2HRVA 4ASUD 2OC8A 1PYTD 1EQ9A 1C5LH 4AZ2B 3PTNA 1ELAA 3HATH 2YNAA 3PMJA 3RXPA 1K28D 5L2YH 5H4IB 3PRDA 3SJ9A 2K1QA 1ZTJA 1OOKB 1GBCA 3LH3A 1YC0A 1DT2A 3U28C 2YMSD 4UONA 3GISB 1COWD 3UQOA 1E36B 1AVGH 4CRAA 1E38B 1O3KA 3BSQA 3FZZA 3SV7A 2OD3B 1P9SA 4K60A 2XBWA 3VGCC 3S9AA 1XUHA 2AYWA 2Z9JA 3EE0B 3F9EA 2CK3D 3MH4A 1NT1A 2D26C 2F9OA 1SGIB 1HB0B 1G9IE 2QV1A 4HG6A 3ZV9A 4NA8A 1JBUH 4A5TS 3AK5A 4GUXA 2W3IA 3CNRA 2OXSA 4FUFA 1KXCA 3PYHA 1CU1A 1EPTC 2QXJA 3BTEE 3K6ZA 3RXBA 3G01A 3TJUA 2WPIS 1BTZA 3UOUA 3F9GA 1W7GH 1F92A 1YLCA 3EA9A 2LPRA 1HJ8A 1TMUH 1BTWA 3MQKC 3PV4A 1WSSH 2EI8A 5C3NA 4O3TA 4I33A 1EAXA 1ANDA 2PGQB 2BDCA 3UREA 1DE7H 1PQ5A 3SUFA 3M5LA 3ZVDA 1Q31A 4NA7A 2OLGA 4Q80A 1GHVH 3SJIA 4D7FA 1XUGA 5AHGH 2ZGCA 3MU1A 2CMYA 1TGSZ 4XFQA 4ISOA 1W0JD 1VITG 2P3TB 3BV9B 3TVJB
chains in the Genus database with same CATH topology
2ZFRH 1L2EA 3V12A 3ATKA 1SPJA 4AORA 1IHTH 2FLRH 2P59A 1TGBA 1YP9A 1C9PA 1DFPA 5EQRA 1GI4A 1NY22 4LK4A 4NCYA 1B7XB 1AKSA 4MPUA 1BIOA 3MH7A 4JCNA 4Q7XA 5FBIA 5DP9A 5FAHA 3ENSB 2IOTA 3RLWH 3U1IB 1QJ7B 3UQVA 1WV7H 3HPTB 1O5DH 1T31A 3S7KB 1H8DH 1CGJE 3GDVA 1QTFA 4B73A 2G00A 2QN5T 4ZXYH 1KDQB 1FXYA 4IC6A 6CHAB 3E3TA 4WY3A 5I46H 1ZSJA 1O37A 5DK1A 3EGKH 3RU4E 1S5SA 4YM9A 2BLVA 4TYDA 1C2JA 2J94A 3AAUA 1O2OA 4MPWA 1F2SE 1AE8H 1BTUA 1GI7B 3ZV8A 1GJBB 3A7YA 2OC7A 3EAJA 2CGAA 1UMAH 2PLXA 2R2WU 1FY8E 1SGFG 3GY5A 2RDLA 3KHVA 3RMOH 2TGPZ 5FXLA 5GDSH 3K2UA 5E0GA 4R0IA 4WXIA 1XXFA 1T8LA 2BOHB 3U8RH 3AW1A 4BAMB 2XBXA 1ZHPA 1MD7A 3MHWU 1FAXA 4J1YA 5DKMA 1NFXA 2AS9A 2G4TA 2BDAA 4IGDA 1LO6A 1VITH 1CHGA 2D8WA 2ZDNA 2GKVE 4CBNA 3HK3B 1GI1A 1P04A 2BY9X 1TX7A 1DSUA 4KTCA 1GMHF 5TCAA 1TNGA 4LOYH 4X8UH 2ODQA 3SJKA 1C1SA 1K2I1 3P8FA 2Q6GA 2ZU3A 3SOSA 1ZMLA 3A88A 2UUKB 1FI8A 4X1RU 3L6PA 1BITA 1DY9A 2SGPE 1C5MD 4Y11E 3U98H 2XYAA 2FOHA 1T8NA 3MO3A 2HNTF 5L30H 1OYTH 1KIGH 2AIQA 1NO9H 2ASUB 1SR5C 3A8DA 3PB1E 1CA8B 4RKJB 1KXDA 3Q3XA 1EJMA 1MAXA 2HGTH 4GPGA 3P8GA 3UR9A 4NG9H 3ZZ9A 2BQ6B 4KTUA 2W7UA 1A7SA 2QCYA 3MNSA 4ZXXH 2NU0E 1HJAB 2FS8A 1V2UT 1ZYOA 1SGQE 2IJOB 5A0AE 2AMDA 1XKAC 2QXIA 2VGCC 2WUBA 2XC0A 2UWPA 7GCHG 1O2HA 1GHXH 4ZROA 1W0YH 1XX9A 4I8LA 4U2WA 1F0UA 1TNKA 1ELGA 1DLEA 1T8MA 1ZPZA 1QB6A 2ZGXH 2B5TB 2QC2A 2ALPA 4LZ4B 2ZFSA 3UTUH 1HLTH 4WH6A 2FLBH 5C2ZA 1ZHRA 2QAAA 1VGCC 5EXNA 2A31A 2YNBA 4GAWA 1C5UA 1DUAA 1DSTA 3GY3A 2Y7ZA 1VCPA 2CF9H 5C67A 1BRAA 3SV2H 4X6OA 3UOPA 3UUZA 1GBDA 1C2KA 5LPFA 3SU5A 1V2ST 1QCPA 4UE7H 4DW2U 8GCHG 1UCYE 5J4QA 1C1PA 1BMMH 3GCNA 2QIQA 2GZ9A 1DXPA 1ZTLA 4FUBA 2FOBA 1EP5A 2BD8A 1TGCA 2KAIB 2EC9H 1A5HA 5HM2A 2ZHEH 2BYAX 1XUIA 1ETTH 1FUJA 3NWUA 1UVUH 3ZZ8A 1V2RT 3QDZB 3GYMA 5DG6A 3GY2A 1IOEA 3MO9A 4AYVB 4GHTA 3Q77A 1ORFA 1HJAC 4AGJA 2VWLA 4KELA 1ID5H 2RA0A 4H4FA 3A86A 2XW9A 2Z9KA 1BHXF 3TLOA 5LH8A 5C1UA 5EPYA 4DOQA 1UTPA 1LTOA 1VJAU 5AF9H 2ZEBA 1YKTA 3MMGA 1JOUB 1RXPA 1HYLA 1SQTA 2ZFPH 5EPNA 4Y79A 4ESTE 4RSPA 1DWEH 4GVUA 3K6YA 3A82A 3QLPH 1YYY1 2ZU2A 1TIOA 1V2OT 3EYDA 2FPZA 1FY4A 3MU4A 1NS3A 1O3IA 3RC6A 1YPHC 3BTGE 4YT7H 1O30A 1GCDA 1LVOA 1EOJA 1SOZA 4ZHAA 2BY7X 1EJNA 1GI0A 4B2BA 3SQEE 1YPEH 3BEIB 1LHGH 4NWLA 4U30A 1EPTB 4GCHF 2F9PA 1Z1JA 2FDAA 5ESTE 2ZGHA 1MTNC 4DIHH 1D4PB 2FMJA 2PKAA 3T5FH 1TALA 1NU7B 4MDSA 3PROA 4JZFH 1MU8B 1ESBA 2O8WA 4UD9H 3RXKA 3W94A 1P57B 1GBLA 1ZRKA 3E16B 1EJAA 1TAWA 1PFXC 1EX3A 4B76A 1O2VA 1XUKA 5A8XA 1N6XA 4O03A 2WV5A 1HBTH 2A7CA 3ODFA 2STBE 3F6UH 3SZNA 5E0JA 1P11E 3U9AH 2VJ1A 1D3TB 1OWKA 2ESTE 1EP6A 2ILNA 2WPMS 5CHAB 1LHCH 5AVDA 3UWJH 2FESH 4ABGA 5T6FA 3ZYDA 2XRCA 1JWTA 3M3VA 2BLOA 1HAXB 1PPZA 3SGBE 3FANA 3TK6A 2XBYA 4Y8XA 1MMJN 1MKWH 2ZTZA 1O5AB 1OWIA 1C5VA 3A8CA 2GTBA 2ZGBH 3OYPA 3SV6A 1F0TA 1GL1A 2PTNA 3KCGH 1D9IA 1AB9B 1TRYA 1C5SA 2O8MA 1HAVA 1BBRK 1OX1A 3QK1A 2H5DA 2GT8A 2BVXH 1CA0B 1RGQA 4CRCA 1SLVB 3B23B 1LPKB 1NM6A 1A3EH 4TPIZ 4Z6AH 3BTKE 3FP6E 3K65B 1KDQA 2ZHDA 2Z9GA 1ESTA 7KMEH 4SGBE 2ZO3H 6CHAC 3BTFE 1HUTH 1PQ7A 3LJJA 3P17H 1AMHA 1EASA 2ZQ2A 4MTBA 1T4UH 2BDBA 1O36A 2SGFE 2CN0H 1TA6A 1A5IA 3TH2H 1SGNE 1FQ3A 4KKDA 2JETB 1MKXH 1NRPH 1C5TA 1DOJA 3HGNA 3STJA 1SGDE 2HLCA 1GBEA 3B8JA 2VB0A 1O3DA 2SNWA 5EOKA 4FVDA 1XXDA 3V3MA 1XKBC 1AFQC 2Y6TA 3D49H 4ABAA 1LVMA 1Y5UT 2FODA 2PV9B 4AB8A 1O2YA 4BTUB 1ETRH 3PM3A 1O38A 1MD8A 1Z6EA 1FPHH 1LVBA 2BQ7B 4R8TB 1AE5A 1YM0A 4MNYA 2ODPA 3LDXH 2P3UB 5EXLA 2P93A 1ELBA 2ULLA 1BA8B 1FMGA 2BHGA 1QR3E 3VB6A 2WV4A 1P3EA 5DP5A 4F4OC 2FP7B 2PFEA 1BDAA 1CT0E 1GJAB 2G5NA 5GCHG 1C5NH 2V0BA 3CP7A 5DGJA 1W12U 1QRZA 4FU9A 4INKA 3QWCH 1CBWC 1HGTH 4BANB 1CSOE 3ZZBA 3VXEH 5FPTA 4D8NA 1DUEA 4ISNA 1MAYA 1WQSA 1GBTA 3KGPA 3ATWA 3FAOA 4I8JA 1BBRH 1SGEE 1RIWC 1TRNA 4J2YB 1C1NA 2QF3A 3TGKE 1UTLM 1OSSA 1W11U 4ABEA 3GICB 2JH5D 1ELTA 1E35B 1O3CA 3F9FA 3M37A 5F03A 2H1UA 5CMXH 1P03A 1QB9A 1SLUB 1ZSLA 3TGJE 3OTJE 1QJ1B 1DITH 4HGCA 1UVPA 1AO5A 1WQVH 4K8BA 3SORA 1EUFA 4DGJA 1IQLA 1ZGIA 3U8TH 2HOBA 3A7WA 1J16A 1P2JA 1F0SA 1MTNB 1FN6A 3TK9A 1QBNA 3OX7U 2BY5X 1QQUA 1IQNA 3D65E 1RRKA 2GMTC 3VEQB 1NC6A 2OCVB 1K9OE 1IQHA 3QGNB 3PO1B 4RKOB 1D3QB 2AIPA 2BDYA 4HFPB 1BB0B 1W2KH 1C9TA 3SI3H 3V0XA 1O2IA 2O9QA 1GG6C 2TPIZ 2UUJB 1GJ7B 2FO9A 2JH0D 3D62A 1GI5A 2BDIA 2BOKA 1UCYH 3BTQE 2W3KA 1NZQH 3URCA 1TX6A 1V2QT 1O5EH 1MTSA 3ZZAA 1W3CA 2A2XH 4DY7B 3SHCH 2BQWB 3SUDA 4Y76A 1IQKA 4YLUA 4ZKNU 1LDTT 1OWDA 1AWHB 4HTCH 1A4WH 1O3PB 2P8OB 3URDA 1MCTA 1GHZA 4E7NA 2ZP0H 3T26A 2F9BH 1OPHB 1ESAA 1L4DA 1BZXE 3M5NA 4X6MA 5E0HA 2G4UA 3GY8A 4XDEA 2GT7A 1YF4A 2BVSH 1S85A 2ZPQA 1C5XB 4I8KA 4UEHH 1AGJA 5EGMA 5EQSA 3LKWA 2B8OH 3BTTE 2Z3CA 2H9HA 1AZZA 1TNJA 2DE8A 2Z7FE 4K3JA 3CENA 1GMDG 1O0DH 1Z71A 3O8DA 4OGYA 1SOTA 4CH2B 1ACBE 4BAKB 8LPRA 4OS6A 1IQIA 1IQFA 3E6PH 3P8NA 2XCNA 5IDKA 1P12E 2YOLA 1TMTH 1B0FA 4CREA 3D23A 3BF6H 4B2CA 2ZECA 3ZZCA 1GBMA 1P01A 1AHTH 1YPHE 2H5CA 2A7HA 4IW4E 1RTKA 2VVVA 1MKXK 2WPKS 1O2TA 3FP8E 4JZDH 1E37B 3SU3A 1O2SA 5GIBA 1ZSKA 5A8YA 1AVWA 1L0ZA 4WMFA 3GCOA 1W10U 3M36A 1C1OA 3BN9A 2F9VA 4ABIA 1T7CA 4Y7BA 1VJ9U 1WU1A 2ZFFH 2TGTA 2ZI2H 1TOMH 2VGCB 2VINA 4K1SA 2BMGB 2PUXB 2VIOA 1T4VH 1TPPA 2VIDA 1A46H 3S9BA 1MZDA 1C4U2 5EU8A 1ELVA 5HGGA 1ARCA 5A0CA 3MU8A 1OWEA 1OP0A 3LC3A 1W7XH 2ZPSA 4K5ZA 1BHXB 1EZQA 4K2YA 1OYQA 1H9LB 2FXRA 1JRSA 3SBKA 1UK4A 2BTCE 5GXPA 1XVMA 4GLYA 2Y7XA 4K1TA 1SL3A 5E2PA 2FS9A 1WBGB 1PPFE 1NRRH 2IN2A 3SNCA 1HAOH 2ZF0H 1HPGA 1NN6A 1GHAG 2FYQA 2Z3EA 1GHYH 1G3BA 1F7ZA 1YBWA 3A7XA 3U8OH 2Q6FA 3ZZ3A 1KXAA 5EW2H 2B7DH 4NWKA 1LHFH 1G3CA 2BD9A 5C20A 1ANBA 1MTWA 1MZAA 4MLFB 1C5WB 1MQ6A 3SJOA 1PPHE 1CGHA 3MI4A 5BRRE 1PPCE 3S0NA 4X1PU 4OS2A 1ANEA 2HNTC 3LJOA 1GBKA 4FU8A 3SI4H 3I78A 2BLWA 4BXSA 1W8BH 3F1SB 5I25A 1ARBA 1PQ8A 1AKSB 2BZ6H 3L33A 1O2XA 2SGDE 3ATMA 3R0FA 3LT3A 1SGPE 1C1RA 3OY6U 4DIIH 2AMQA 1DXWA 2G81E 3ZVEA 2SNVA 4ZKOU 1OP2A 4KTSA 3EA8A 4AG2A 3Q3KA 4UFGH 2GX4A 3TPIZ 1TPAE 1Y3UA 1KLJH 2JKHA 4WMDA 1SGRE 3QZRA 1OS8A 3Q00A 2CV3A 4CRGA 1NROH 1RJXB 4Y10E 3MU5A 1QNJA 3UPEA 2RCEA 5L2ZH 3BG8A 4XBDA 4MPVA 1GJ5H 1EAWA 1XMNB 3RU4T 2WPJS 2XNIA 3VB7A 1Z8GA 1GBBA 3E91A 5FX6A 1AUJA 1DX5M 2A5KA 1ZZZA 1GMHG 2ALVA 4U01A 3T25A 1MU6B 7LPRA 4UFFH 4OGXA 1HAZB 3NZIA 4HI3A 1AFEH 4B74A 1AU8A 1LHEH 1G2LA 2QY0B 1RTFB 1VZQH 1KTSB 2JH6D 5A8ZA 1CHOG 2FX4A 1KTTB 3SNDA 2GCTC 3HKJB 2G5VA 1O3EA 3SUEA 2PTCE 1GPZA 3F68H 2AEIH 2ZFQH 4IMQA 3RXFA 1V2JT 6ESTA 3VB5A 1ZGVA 5K7RA 3N7OA 1H9HE 4E06H 4TWWA 3RUOA 1ANCA 2OC0A 2RG3A 3M5MA 1B0EA 1SB1H 1BMAA 4AFSA 1O2UA 4A1VA 1EB1H 1Y3YA 3ZZDA 1S81A 3QTVH 1HAIH 2OTVA 3HK6B 1KY9A 3PLKA 4JMYA 1A0HB 5T6GA 2H6MA 1Y5BT 3SU2A 5C5NA 4XBCA 1GBFA 2WYGA 3BIVH 4LXBH 5LGOA 1ZTKA 1NRQH 1AZ8A 3GYLB 4MNVA 1GHBF 1C2GA 2F91A 4X2YA 4YOIA 1FLEE 3GCTF 5FBEA 4NSVA 1SVPA 3PMHB 2SGAA 3M61U 3DD2H 5FX5A 3M5OA 3MWIU 4FUHA 3RXRA 3E90B 6LPRA 2ZHFH 2EI7A 2OC1A 2NU3E 2ZQ1A 3M3TA 4I31A 4FUDA 3MFJA 4MNWA 4IBLH 2KAIA 2QA9E 4QT8C 1FN8A 1FZZA 2A32A 3QGJA 1V2VT 5FHTA 2CHAC 1VCQA 4FUIA 1AY6H 3BIUH 1H8IH 1DWCH 3BTDE 1Y5AT 1TBZH 3DT0H 4ISIH 5G4BA 1INCA 1QL9A 3VGCB 1C1TA 2ZIQH 3WY8A 1O2ZA 4Q7ZA 4JYTA 5B6OA 2ZCHP 1HFDA 2GV6A 3TJVA 4DURA 2VWMA 4OS7A 2VIQA 1G3DA 3KF2A 2P3FH 1DM4B 1DS2E 3P8OA 1X7AC 5JB8S 2PUQH 3SGAE 3MOCA 2DUCA 1XVOA 1HV7A 1Q2WA 2FIRH 2V35A 4B2AA 1BTPA 3GDUA 3ZVBA 1NESE 2C93B 1TNLA 1C5ZB 3SNBA 3SJ8A 1O3OA 3PWCA 3OY5U 1LHDH 1ELEE 2FOCA 4IMZA 2CJIA 3P95A 1VITF 4KP0A 1UO6A 1TLDA 1IQJA 1GCTC 3PTBA 1O5BB 1XUFA 2BDHA 1GGDB 2FTMA 3MYWA 3RXMA 3A85A 2QXHA 1FPCH 1GI8B 1UVOA 4ZH8A 4AOQA 2O8TA 3NUMA 1EAIA 2BY8X 2FYRA 3P70B 3BEUA 1J9CH 3TJNA 1S82A 8ESTE 3OSYA 2ODYB 1WOFA 4VGCC 2VNTA 3DHKH 1O2PA 4YZUA 2P95A 2WINI 1GHWH 5JYIA 1GHAF 3KQBA 5GPIB 2H9TH 1LQEA 1VGCB 2AFQB 1GDQA 1NFWA 1QB1A 4O97A 1GJCB 4NGAH 1O35A 1LMWB 2R9PA 1MH0A 2VIWA 2ZDKA 1EPTA 1AB9C 1ZJDA 3MU0A 4YESB 5ETXA 2WUCA 1O5CB 1SMFE 2NU2E 7GCHF 1GCTB 5GWZA 1DVAH 2AH4X 4YTAA 5C1XA 4X2WA 1O3AA 1SFQB 2FOAA 1AIXH 3SUGA