2CV3A

Crystal structure of porcine pancreatic elastase complexed with a macroclyclic peptide inhibitor
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the complex of porcine pancreatic elastase with a trimacrocyclic peptide inhibitor FR901451
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Elastase 1
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2cv3A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2cv3A01
1C5WB 5HM2A 1JIMA 3A7YA 4OS5A 1EPTA 2ZF0H 5EXLA 1TB6H 1O3PB 4FUGA 3MMGA 4B76A 2Y81A 1UO6A 1P3CA 3Q3XA 4D76A 1LVMA 4DW2U 4E7RG 1UCYE 1NU7B 2B8OH 3LGWA 2GMTC 3RXCA 2B5TB 1VJ9U 1EKBB 1O2IA 3RXMA 1ZZZA 4IN2A 3UNQA 3LGYA 1SGFA 4CR9A 4ZH8A 2AS9A 2OINA 2CV3A 1C1SA 1LHFH 1A3BH 1L4ZA 3BEIB 4GPGA 4ABDA 5EU8A 3F9HA 5BPEA 3D49H 1A0JA 1L2EA 1C4V2 2VIPA 1WU1A 2J34A 1HV7A 4JYVH 1C9TA 1L1GA 2JKHA 1AWFH 1ZGVA 1SVPA 2ZHFH 3QZQA 1ELBA 4FU8A 4ABIA 1FPCH 4U2WA 2ZDKA 1D3PB 2BD2A 2STAE 1SGNE 1A5HA 4AGJA 3LPRA 3BG8A 3U8TH 1SOZA 1SR5C 1PPHE 1NT1A 1FIZA 1C5NH 2SNWA 3GY8A 1SMFE 1MUEB 3BF6H 2GZ9A 1BRUP 1Y3UA 1Y59T 2NWNA 4X8TH 1ZR0A 4NIVA 1WQSA 5HM9A 2HALA 1GHXH 1TE0A 3RMNH 2WPMS 2Z9GA 1GBLA 1MD8A 4AB8A 2PKSC 3QTVH 3LIWA 1V2OT 3AAUA 1O2HA 2UUYA 3PO1B 1IQNA 4WWYA 5L2YH 1ZPCA 1GI2A 1TNKA 1C9PA 3M7TA 2FESH 1TQ0B 1AUJA 1QCPA 2G51A 3KHVA 2VIVA 4BTUB 3O8BA 1L0ZA 1Z1IA 1TX8A 1G3EA 2WYJA 3ODFA 2H9TH 1GJ7B 2AGIX 2ODQA 3ZZCA 4H4FA 2BM2A 2A0QB 1W8BH 3VXFH 1TPSA 1G30B 2PUQH 3SO3A 5JYIA 1AB9B 1AIXH 4J1YA 3ZVCA 1QJ7B 3RXSA 3RXQA 8KME2 2HPPH 1P3EA 1O2VA 3D65E 3GYLB 1NFYA 1LHEH 4AOQA 2F9BH 4FXGH 3R0FA 5T3HA 3EA7A 3PLKA 1TPAE 1DM4B 3DT0H 2BX3A 5DP9A 3TGIE 2OC0A 4FUEA 1T8NA 1GBAA 2SFAA 1BBRE 5A8ZA 1AZZA 3SN8A 6GCHG 4WH8A 1NRRH 4NA7A 3RXBA 3TLOA 1BTHH 1C1UH 1MBMA 1LQEA 1UK4A 5GPIB 4ISIH 1UVOA 3RMLH 2DE9A 1BITA 4MTBA 3BEUA 3NPSA 4NA8A 5IDKA 2C8XB 2BDIA 5CE1A 3EAJA 1OP2A 2NU2E 2BTCE 1T31A 1TX7A 1Y3VA 4THNH 1W7XH 5A0CA 5L2ZH 3BTEE 3S9BA 2HNTC 1GI9B 4CRBA 2AGGX 1XUGA 1DWDH 1S84A 3SJOA 1SSXA 1OS8A 5EW1H 2FLRH 4F4OC 2EI7A 1GI4A 4DG4A 3HKIB 4CRGA 4CRAA 1V2ST 2D26C 1PJPA 2SGDE 1SLWB 1HUTH 2EC9H 2I6QA 4DGJA 1LQDB 2BY6X 2ZDVH 1AFEH 1XMNB 3NCLA 1NFXA 1UHBA 5JBBS 8GCHG 3BIUH 4OS6A 3HGNA 4NZLA 5DPAA 3TJNA 4U30A 3E3TA 1DY8A 4NSVA 4ZKRU 3OY6U 2Z9JA 1OWKA 4AZ2B 1KXFA 2ZGHA 3D23A 4BXSA 2FOCA 1SGRE 5E8EH 1ESBA 2ZNKH 1O5DH 3MNCA 4ZUHA 1AO5A 2EI8A 1IOEA 1H4WA 1SLVB 1NPMA 3PLBA 4YESB 2Y5GA 2HNTF 2QV1A 2AMQA 2FS9A 1OPHB 3FAOA 3IG6B 1GVZA 2BDBA 3SV8A 4NIXA 2ZFPH 1TPOA 3SI3H 1NRNH 1WQVH 4X6OA 1QB9A 4Y71A 1C1MA 1LCYA 4CREA 1GBEA 1FXYA 1IHSH 3T26A 4Z0KA 7GCHG 1M9UA 3OSYA 3SU2A 7ESTE 1C1WH 1G2MA 2H5DA 4Q80A 3SJIA 4ABGA 3GCHB 1C5RA 5AFZH 3TGJE 4AG1A 1TX6A 2Z3CA 1MMJN 3E0PB 4FU7A 3A8AA 1V2RT 1LDTT 2H9EH 2R3YA 1H8IH 1XXFA 3PROA 4LZ1H 5L6NH 4WF8A 2ZG0H 3BSQA 1Y3WA 1HAOH 1TAWA 4X2YA 4MNYA 4ABHA 2ZI2H 1P0SH 3S7HB 4I8KA 2QAAA 2C90B 5JDUB 1O2NA 4GAWA 2P8OC 3GCTF 4BXWA 1GJCB 4B75A 3S7KB 1O38A 1PYTD 1TA6A 3SHCH 1GI1A 1YLCA 1O2YA 1BMNH 2P3UB 2CHAC 1GHYH 1HBTH 2C8YB 4U01A 1HJ9A 2YOLA 4Q7YA 1P2KA 7GCHF 1WOFA 2ASUB 4IGDA 1K1MA 2G8TA 2W5EA 4WY3A 3GYMA 1TMUH 1T4UH 1S6HA 2YNAA 1P9SA 1HNEE 2ALPA 1LMWB 2V3OH 3PO1C 4MNXA 5HXFA 1NRSH 1UHBB 4BAOB 1HAVB 1O3AA 2ZEBA 5E0HA 1ELDE 2J95A 1GBHA 2TIOA 3M3VA 3BTHE 1MU6B 1EXFA 4QT8C 3TH4H 2TGPZ 4R0IA 1TMTH 4RKJB 3SOSA 2VH6A 1B5GH 1FPHH 4LK4A 1HAHH 2CMYA 3MI4A 1A7SA 3E6PH 1AN1E 1SGDE 1MTUA 1MZDA 2ZPRA 1AU8A 2PV9B 3L33A 2QC2A 1FMGA 3JZ2B 1C5VA 4MPXA 1NU9A 3ZYDA 3QUMP 3S9CA 1LHDH 8GCHF 2W3KA 4A7IB 1SGQE 2ZU5A 2BQWB 1O3BA 2BD8A 2DUCA 2XYAA 2WUCA 1GCDA 1DXPA 1WSSH 2C4FH 3LU9B 2ZKSA 3KNXA 2ZDLA 1LVOA 4AX9H 1BIOA 4ZAEA 1IQJA 1AE5A 2F9PA 1RTLA 3ATIA 1A3EH 1G3DA 2BZAA 1O34A 1MKWH 2XCNA 4NWKA 3TK5A 1MTSA 3UOPA 2ZP0H 1C4U2 4K2YA 1A1RA 3F6UH 3M35A 1B0FA 2QXJA 1G9IE 4DCDA 4DY7B 5C67A 2EA3A 3RDZA 1GJBB 3P95A 1OOKB 5FX6A 1TMBH 1DWBH 2BD3A 3PTBA 1FN6A 1YBWA 3UNSA 3MO9A 1D3QB 3S9AA 3SV9A 4D9QA 2OBQA 1GBTA 3OY5U 2XC0A 1GJ6A 1BQYA 1DSTA 1OWJA 5HGGA 2AIQA 2XRCA 4YOIA 1PPEE 2HOBA 5C1UA 2QA9E 1J16A 2ZFFH 1ELEE 1FN8A 1W2KH 2IPHA 2OUAA 1NRQH 3D62A 1BT7A 2A4RA 2ZCKP 1GBDA 3SUDA 1UTPA 4Q7XA 1EPTC 3P8OA 3LONA 1OWHA 1PPCE 3V0XA 2ANYA 3RXOA 1BHXF 3LOXA 3MYWA 3KQDA 1EZSC 2BVSH 1GI3A 2FOFA 1INCA 1ZMJA 3A82A 4K1SA 3GY4A 3RMOH 3E90B 1MTVA 3AW0A 1P2IA 1FY4A 3S0NA 1QURH 3I29A 1EZXC 1RFNA 2Z6BD 1MD7A 1WUNH 2EI6A 4DOQA 1ZSKA 1TNLA 1CHOF 1DVAH 5F8XA 2ZGCA 1BTYA 5GDSH 4JCNA 2CF9H 1VCPA 1O2WA 2CF8H 3A88A 1O3JA 3KGPA 4NSYA 5EPYA 1Z8IB 1UVUH 1D6RA 1CBWB 2FOHA 2GCHF 5FPTA 5EXNA 4INHA 1JRSA 1CU1A 1WCZA 2ZPSA 1MTWA 4B71A 3SNAA 1A2CH 1PQ5A 1H9LB 2BQ7B 1ZOMA 1GBMA 1G32B 2VIOA 2ZDAH 4JMYA 5FX5A 4A92A 5I25A 1C1RA 4CHAC 2OD3B 1DT2A 3BEFB 3Q3YA 1H1BA 1LKBA 1T4VH 3UIRA 5FPSA 3U8RH 2HRVA 2PLXA 1HAIH 1KIGH 4VGCB 1TWXB 1YPHE 1P9UA 3RXDA 4ABEA 1TOMH 3EGKH 2A5KA 1JXPA 3TH2H 1SQTA 1AD8H 1UTJA 3GDUA 1AUTC 2QY0B 1F0SA 1RIWB 4ISHH 3GY2A 1EP5A 1ID5H 1JOUB 1B0EA 1O3IA 2QF3A 3BTFE 3SU3A 3T27A 4A5TS 1ARBA 1P8VC 2FOGA 3TIUA 4AFQA 1VR1H 3C1KA 2BB4A 1MU8B 2J2UA 4FU9A 3UNRA 1GHWH 3URCA 4Y0ZE 4DJZB 1PPBH 3ODDA 1O2RA 3PLPA 1EJAA 1MKXK 4FUBA 5GIBA 2VVVA 2UWOA 1AB9C 5G4BA 1QFKH 1GI6A 4UFDH 3H7OA 1VGCC 3A87A 1S0RA 1SFIA 2BD5A 1TGSZ 1TNJA 8ESTE 3QWCH 3VFEA 3K2UA 3ZVEA 2HVXA 1FY5A 1BBRK 1GG6C 4BAKB 4GUXA 3PMJA 3SV2H 4A1VA 2ZFQH 4ISNA 4BNRA 2A5AA 4WVPE 2PSYA 3QTOH 2RG3A 1W10U 1S5SA 1K28D 1O5AB 2G5NA 1ZTKA 4GCHG 2FI5E 2O8MA 2BLOA 2BVRH 2BD4A 4K1EA 4X6PA 4FUJA 1Z8RA 2FDAA 1K21H 1O3FA 1ZMLA 1T8LA 1MAYA 1SLUB 3A89A 2D1JA 1TYNA 5DJ7A 3RP2A 4K69A 1TQ7B 1LPZB 1V2WT 1O31A 2XC4A 2ANKH 2ZDMA 1F5KU 5GCHG 3LGUA 2BHGA 2SGEE 1GHVH 3TITA 2ZHWH 4OGXA 2B9LA 1BA8B 3UPEA 1U6QA 1P2OA 2R0KA 1J14A 2PR3A 1N8OC 4HGCA 1WTHD 3GCOA 3SHAH 1JMOH 1XX9A 1DX5M 1BMLA 2TBSA 2WPKS 3N7OA 1Y3XA 1CA0B 1EZUC 1J17T 3CS0A 4K8YA 5FCRA 1O2GH 1PQ7A 3OU0A 1NFWA 2ZTYA 1GI5A 1ORFA 3BTQE 4MG3A 1SGPE 2OBOA 2AYWA 1O2KA 4I33A 1GMDG 5HYOA 1PPFE 2A7CA 1GI8B 2RA3A 4OS1A 2FIRH 1ZHPA 1O3MA 2GT7A 1FI8A 1Q2WA 1C5MD 2AMDA 1C2DA 2GZ8A 1OP0A 2OQUA 1Q3XA 3SGAE 2GDEH 1P02A 1HLTH 1HFDA 2BDYA 3RXRA 5LPFA 1ZMNA 3UTUH 2PHBA 3SU1A 3KL6A 1ANDA 4KELA 1C2GA 2FS8A 4RN6A 4FVBA 3MH4A 3BN9A 3UOUA 3ZZ6A 1NZQH 1AVGH 1CT2E 1XKBC 1Y5UT 2STBE 4X1NU 3WY8A 1QL7A 1ZPZA 1O37A 1QTFA 2I6SA 3U98H 1V2NT 3MNBA 4SGBE 3KF2A 4R8TB 1TRMA 4UFFH 3P17H 2ILNA 4ISOA 4KTCA 3QO6A 2FM2A 1NS3A 2D2DA 4X1RU 1K22H 1ELAA 1EX3A 1CT0E 1DPOA 1OXGA 2O8LA 3MTYA 1QRXA 5AHGH 1LKAA 1ABJH 3UR6A 1O3OA 1Z6EA 1ELGA 1A0HB 1GBKA 2TGDA 1ESTA 1ANCA 3M7QA 2XBXA 3A83A 2UUKB 3ATLA 2H6MA 3FP6E 3OYPA 1N6XA 3HATH 3KEEA 3LJOA 1EQ9A 1V3XA 4GHTA 2HWLB 3AASA 3EA9A 1O2PA 2XXLA 4I8LA 4B2AA 1PFXC 2XCFA 1UTQA 3QX5H 4X6MA 4K5ZA 4IMQA 3GCHC 1QR3E 1DDJA 2Z94A 7KMEH 4UD9H 2SGAA 3W94A 4NG9H 1PQAA 2Z9IA 1HAXB 4KP0A 2QIQA 2BZ6H 2RDLA 1QHRB 2ZGBH 3ENSB 3ZYEA 4AYYB 1P01A 1QY6A 1BTPA 1HXFH 1XM1A 2ZQ1A 4YOGA 2TPIZ 1AKSA 1UVSH 3R3GB 2A32A 1XKAC 5SGAE 4AFZA 3DUXH 3TGKE 2FOEA 1T32A 3RU4D 1TLDA 3SNBA 3SNCA 3EYDA 1HAVA 1XXDA 2XWAA 1HDTH 1YPLH 4UFEH 4X1PU 1UTKA 2BD7A 4F49A 5EQSA 3TNTA 4Y7BA 4SGAE 4NFEA 1BMMH 1RGQA 3QGNB 1TBZH 4FUCA 2K1QA 5C1XA 2FXRA 2VGCC 3BTWE 1V2PT 2J4IA 2OC7A 3EE0B 1AE8H 1VITG 2BDGA 3ZVFA 5FHTA 2ZU2A 2ZQ2A 1E34B 1GDNA 2FYRA 2ZHEH 1YGCH 2GTBA 2GDDA 1H9IE 2TRMA 2WV5A 2B0FA 5EPNA 2HPQH 2QYIA 4Y7AA 5ESBA 4X2VA 5DP3A 1C2EA 4ZHMU 2PGBB 5EW2H 5J4QA 1WBGB 4K60A 4NGAH 3SNDA 1QBOA 2A2QH 1MTNC 1HAGE 2FWWA 2LNCA 2PKAB 1D3DB 1DS2E 4X8VH 3SU4A 5A2MH 2G81E 2PKAA 1SLXB 4FUHA 1SGYE 1W13U 1GMHG 2Y5HA 2WPIS 2Y7ZA 1C5YB 3FVFB 3LDXH 3FP7E 1ZRKA 2FTLE 2NU0E 5E2OA 3U9AH 4IC6A 1SC8U 3A7ZA 3Q3KA 1WAYB 3DA9B 4AN7A 4O3TA 3NWUA 1D9IA 3GDSA 5A0AE 2Z3EA 3M61U 3W95A 2GT8A 2QCYA 4K1TA 1SFQB 2WV4A 3GDVA 4Y8ZA 2BY9X 2KAIB 1VGCB 1TRNA 2VINA 2PTCE 4TY6A 4KTSA 3SGQE 3SGBE 4WH6A 3ATKA 4XFQA 3V3MA 2BDHA 1J8AA 5C5NA 5I46H 1K1IA 1O33A 3L6PA 2O9QA 2W26A 1ANBA 1F2SE 1BHXB 2BY7X 2ZIQH 1BMAA 3SU6A 1V2TT 1SGIB 2FMJA 4K3JA 1IAUA 1HCGA 1W14U 1IQLA 2XBYA 1O2OA 3UR9A 4Y8XA 1BDAA 1UK3A 3P70B 4WXIA 1ELFA 2FOMB 1ZGIA 3QGJA 1LPKB 1LHCH 1BBRH 4AFUA 3MH5A 3HPTB 3LGVA 1C2MA 1GGDC 2OC8A 1T8OA 5TCAA 1MH0A 5FPYA 2ZU4A 2VWOA 3G01A 1PYTC 5IYTA 5JBAS 1AMHA 2JETB 3ZZ3A 3MFJA 3MNXA 4LXBH 1C5OH 1C1VH 2CXVA 1FZZA 1UCYH 2GKVE 1O35A 1FLEE 3SU0A 1G37A 4ZKSU 3O8RA 1DXWA 2GVFA 2QN5T 4Y79A 1HAPH 4MPVA 1GDUA 3B9FH 1O30A 1MCTA 5DP5A 5H4IB 4YOJA 3UY9A 2TGTA 2ZDNA 1FUJA 4YT7H 4O3UA 2FEQH 1NO9H 1SPJA 1ANEA 1TNIA 2GCTC 3A7WA 1SBWA 3BTDE 4JZDH 7LPRA 4Y76A 1HAYB 1GVKB 2JETC 1YPJH 1FJSA 2UWPA 4O03A 1UCYK 1TALA 3F9EA 1V2JT 2JH5D 1HIAA 3MNSA 1NM6A 3KQBA 1QNJA 3MU0A 1J15A 1MZAA 1E36B 1GJ8B 4IW4E 2EEKA 1HJAC 5CHAB 1P2MA 1CGIE 4MVNA 1W7GH 4TYDA 1GCTB 2W3IA 1EZQA 5DKMA 1O36A 1W11U 2BVXH 5F03A 3FFGA 2BLQA 1K9OE 3LH3A 4JK5A 1UTMA 3B23B 2ODPA 3RXHA 4FUFA 5DG6A 1UTOA 1FY1A 1YPMH 1CVWH 1ETRH 2P59A 1TA2A 3RLWH 1KDQA 2P16A 4TY7A 3UWJH 5L30H 1C5XB 3BTGE 3AW1A 1EOJA 1NC6A 3KQEA 2GZ7A 3V12A 4WMFA 4ABFA 1THRH 3ZZDA 1T8MA 4GLYA 1TONA 1GHAG 5GJ4B 3SQEE 1AFQC 3BV9B 1W12U 1ELTA 1P06A 2SGFE 4MPWA 2BDAA 1DFPA 2RCEA 4E06H 4CRFA 2P95A 2BYAX 2QGRA 4BTIB 1XUJA 1G2LA 2ZTZA 1QB6A 2DE8A 3TU7H 3PWCA 1TPPA 3QZRA 4X2XA 1MAXA 2V35A 4D9RA 1MCVA 2C8ZB 3A84A 3P6ZB 4Y11E 1BCUH 5F8ZA 3ATWA 1NY22 3RLYH 4ZKNU 1OYTH 1DUAA 1FAXA 2QF0A 1QL8A 1QRWA 2QXIA 1GMDF 1LVYA 3MHWU 3VB3A 4AFSA 2P8OB 3TPIZ 2ZCHP 4WMEA 3ZVDA 2G55A 2V0BA 1F92A 2PUXB 1KXDA 4H6TA 4IC5A 2VU8E 1GCTC 3STJA 2A4GA 1V2MT 1YM0A 3GY6A 3RC6A 3NUMA 3ITIA 1IQGA 3SJ9A 1V2UT 1WV7H 4RSPA 2M5TA 2W7SA 3VXEH 2ZZUH 3DFLA 1PPGE 1V2LT 3VB7A 3RC5A 2FX6A 1MBQA 3LGTA 1HRTH 2AFQB 1H8DH 2B7DH 1DWCH 5LPEA 1O5CB 1ZHMA 2Y7XA 1P2JA 2Z9KA 3MU8A 1F0UA 4K8BA 6LPRA 3FZDA 1RJXB 4X1SU 4U32A 1LTOA 2BMGB 1K1LA 1RD3B 1AVWA 2OLGA 3LKWA 1A5GH 5AF9H 2QXHA 5FXLA 2FOBA 2C3SA 1AVXA 2G4UA 4CHAB 5GXPA 3RXPA 1FDPA 2SNVA 1O2XA 4E05H 1KY9A 2XBWA 4UEHH 1IQIA 1IQKA 1ZSJA 1RXPA 4YLQH 2G00A 1T7CA 1RTKA 4OS4A 2GMTB 2P3TB 2G4TA 3Q77A 5J4SA 4B1TA 2P3FH 1C5PA 4HI3A 3ESTA 1YP9A 3PYHA 4FUDA 2VIWA 3A86A 1O5FH 1THSH 1ZJKA 1HYLA 5E2PA 2XTTB 3PTNA 1SI5H 4JYTA 1F5RA 2WPJS 2ZTXA 3HKJB 1C2FA 4HFPB 4XE4A 4X6NA 3MH6A 1O2UA 2HGTH 3FANA 4AG2A 1GL1A 1FV9A 1GHBG 3RMMH 3MOCA 1DY9A 1TOCB 1UTNA 3QN7A 2LPRA 2J9NA 3PV4A 3RXKA 1ARCA 4WMDA 3VB4A 2ZCLP 4I8HA 3RUOA 2A7HA 3A8BA 1V2KT 1BZXE 2A31A 1E38B 1FQ3A 1JBUH 1AHTH 2IOTA 1EAUA 2AIPA 1GJ5H 3M3TA 3QK1A 3RM0H 1O2MA 3ZZ4A 1THPB 5FAHA 4CBOA 5E0JA 5T6DA 1CA0C 3TJVA 1E0FD 2QXGA 3SQHE 1UVPA 1ZLRA 1CO7E 1E37B 3DD2H 3KCGH 4DVAU 3Q76A 4Q7ZA 2ZC9H 3V13A 1FIWA 1Z8GA 1FAKH 1AI8H 3KQCA 1GBBA 1P09A 1XUHA 3MU1A 2J38A 3ZZ9A 2PKSB 3STIA 2CN0H 1DICA 2FLBH 1ABIH 2XW9A 2O8TA 1P12E 4MNWA 2R2WU 2ZFSA 1O5BB 2OTVA 1BRBE 1DANH 1QJ1B 1LHGH 1TGBA 3RXTA 1G3BA 4Y0YE 1HJAB 2H9HA 1Z1JA 3DHKH 2BLWA 4Y6DA 1UJ1A 1GMCG 3BTTE 3PM3A 4O97A 4UONA 4NFFA 4X1QU 3BTKE 1QL9A 3RXAA 4MNVA 2FOAA 4ABBA 1BRAA 4B2BA 1HGTH 1ELCA 4BANB 2GD4B 1C5TA 2C8WB 1C1QA 4B73A 2ANWA 3P8FA 1O3GA 3AVZA 2PTNA 2BDCA 3TVJB 3LT3A 2Y5FA 2PSXA 1BJUA 1GHAF 1DITH 1KLTA 3MH7A 1S0QA 3GCNA 1GMHF 2ZHDA 2VGCB 3BG4C 3SJ8A 4I32A 3OTJE 3HK3B 3E0NB 1O39A 5C20A 1KSNA 4XDEA 2ESTE 2A4QA 2RA0A 4I8JA 4INKA 5AFYH 1EASA 3HK6B 4BAHB 1DOJA 1P10A 3H7TA 1D3TB 1S6FA 2F3CE 3LC5A 3OX7U 4JZFH 4IBLH 3RC4A 1TGCA 2IN2A 1ZRBA 4JK6A 1O2SA 5JB8S 1CQQA 1HB0B 1W0ZU 2J94A 2NU3E 1Y8TA 1LPGB 1QRZA 4NZQA 1YPGH 2ODYB 1Z6JH 3T5FH 3TJUA 2CHAB 1BUIA 1RRKA 2VIQA 1XUIA 2VWLA 2PFEA 1DLKB 1NRPH 2HNTE 5DGJA 4MLFB 5FBIA 4AB9A 4I31A 4INLA 1TABE 5C1YA 3SUEA 2BY5X 2TGAA 1C5SA 1YC0A 1YYY1 4X8SH 3T28A 1DE7H 3VB5A 1EAXA 1PQ8A 4O9VA 4GHQA 1IHTH 1KTTB 3RU4E 2A4OA 1P57B 1QJ6B 4IS5A 1EUFA 3FZZA 4BOHA 4OS7A 1AGJA 2ALVA 1PPZA 5FBEA 3KIDU 2KAIA 8LPRA 1CGHA 4NCYA 1P11E 4FVDA 1AFQB 4GVUA 1EATA 2WPLS 4I7YH 3ZZ7A 1BRCE 1L4DA 1ELVA 1BTXA 1QBVH 2BX4A 1LVBA 2ZFRH 1C5UA 1WYKA 3BTME 2Q1JA 4NIWA 2ZA5A 3K6YA 4PROA 3URDA 4ZXXH 2AGEX 2AERH 1O3NA 4KGAA 4BAQB 4AGKA 4LOYH 3V7TA 3C27B 3VPKA 2VH0A 4H6SB 4FUIA 1VCQA 2AMPA 1CHGA 2Y6TA 1A61H 1N1LA 3U69H 1VZQH 2V3HH 3VGCC 4XBCA 2HLCA 4BAMB 3A8CA 1W0YH 4NA9H 2ULLA 1ZJDA 1GVLA 2H1UA 2UUJB 1A46H 2GX4A 4HZHA 3T2NA 3SV6A 3GOVB 4UE7H 4ASHA 2VNTA 2OXSA 2CJIA 2XBVA 1YLDA 1Y5AT 4MPUA 5A8YA 3RXEA 3DFJA 6CHAC 4VGCC 1Y5BT 1O2ZA 1BB0B 2BD9A 1SHYA 2FPZA 3RM2H 5DO4H 1SB1H 3QLPH 1C1PA 4DT7B 2FX4A 1YCPK 5JB9S 1SQAA 5HMAA 1XUFA 2ZPQA 2ZGJA 3M36A 3SZNA 3NK8A 5DP6A 1V2QT 1GMCF 3QDZB 1QA0A 5EXMA 1GBFA 4TPYA 1GWAA 5FCKA 1ETTH 2C93B 3T29A 1XUKA 1TBQH 2BOKA 3M5MA 1ZYOA 4WJG2 2VVUA 2BLVA 4JZIA 2WUBA 1P03A 1O5GH 1EP6A 1OSSA 2J92A 1VJAU 1BTZA 1TNGA 2A2XH 3NXPA 4TWWA 3HGPA 1MTNB 1GBCA 5DP8A 1NTPA 3F68H 3RXJA 3SUFA 4CRCA 2H2ZA 1OYQA 5B6OA 1OP8A 3MWIU 5E0GA 4A1TA 3ZZBA 2AH4X 4XBDA 1P2QA 2ZGXH 5CHAC 4ABJA 9LPRA 3A7XA 1A5IA 1VITH 1AQ7A 2WPHS 5GCHF 1RS0A 1C2LA 2A5IA 4I8GA 4X8UH 5TCCA 1K2I1 1QQ4A 1S82A 3PWBA 1SG8B 2ZECA 4A6LA 2AEIH 1K1PA 2FYQA 2OC1A 2CGAA 3CS7A 1G3CA 4MQAA 3TJOA 1Y3YA 2F9VA 4MDSA 5C5OA 4XSKU 3M5NA 3UFAA 1TNHA 4Y10E 2FI4E 1ZTLA 2VWNA 1S83A 2FODA 1O0DH 2GV7A 1X7AC 2THFB 2VWMA 3EQ0H 1GI0A 1H9HE 3ZVBA 1O3KA 5F8TA 2PWXA 1UVTH 4YZUA 1F5LA 1O3DA 5EOKA 1C2KA 1GL0E 1UTLM 1P2NA 2SGQE 2FI3E 4IMZA 4LZ4B 5C3NA 1EJNA 2Z3DA 4Y8YA 1GJ9B 2F9OA 3GICB 1AWHB 3SW2B 1QB1A 3ZV9A 3EDXB 1RTFB 1DUEA 1IQMA 2Y82A 1KXCA 1O3EA 3S69A 1TIOA 2GP9B 2G5VA 2YNBA 1NROH 5T6FA 3MO3A 2Z9LA 5EG4A 4NWLA 4DIHH 1C1TA 1GBIA 1IQHA 5TJXA 5ESTE 2F9UA 2GGVB 3AAVA 4CR5A 4X0WU 1QA7A 5EQRA 5CMXH 3O8DA 2BOHB 2BXTH 1IQEA 1D4PB 3SV7A 4CRDA 3A7TA 5JBCS 1HPGA 4Z6AH 2WINI 5LGOA 3Q00A 1MKWK 1Z7KA 5A09A 4AORA 3MO6A 2GCTB 1GDQA 3M37A 1FNIA 3LGIA 1MQ5A 4GSOA 1N6YA 4YM9A 3SORA 1BTWA 3NZIA 4CBNA 1D6WA 1EOLA 5EQQA 1UMAH 4B74A 3MU4A 1O5EH 3KN2A 1A4WH 2R3UA 5T6GA 3PB1E 4XBBA 4ISLA 1XVOA 1AZ8A 2O8UA 3M3SA 2XC5A 1TGNA 2H5CA 1C5ZB 1L1JA 1HJ8A 2A45B 3U1JB 1KLJH 1Q31A 4ZROA 3LH1A 4YLUA 3MU5A 1FONA 3E16B 5K0HA 1EJMA 1DWEH 4NIYA 4ZKOU 1C2JA 1IQFA 1QBNA 5JBTA 3GCTG 2O8WA 1BOQA 1GHZA 2Y80A 1S85A 2GCHG 3E91A 5AVDA 1S81A 4YTAA 1KXBA 1YF4A 2XNIA 1N8OB 1YPHC 3A8DA 2UUFB 3P8GA 1VITF 3UREA 1TRYA 3M5LA 1MKXH 3K65B 3L3TA 3I78A 2F91A 2A1DB 1CA8B 3RXVA 1QIXB 3EA8A 1O2TA 1C1NA 1YKTA 3SUGA 1SGTA 1BJVA 3P8NA 1ACBE 4H42U 1QGFA 2XWBI 3T62A 2UWLA 1OWDA 1YCPH 5LH8A 2ZO3H 3O8CA 1B7XB 4ABAA 3GY7A 3A85A 2Q6FA 3SU5A 3ZVGA 4B2CA 1W3CA 1O2JA 1SQOA 2BXUH 2R2MB 1G36A 1C5LH 3A7VA 4TPIZ 2FTMA 2OQ5A 2Q6GA 3F1SB 1GGDB 3M5OA 1HAZB 1KTSB 1VCWA 4IN1A 4E7NA 2D8WA 1GPZA 4WXVA 1ZHRA 2JH0D 1GJAB 1JIRA 1GG6B 1SL3A 1YPEH 3PMAB 1SGFG 1EPTB 1LO6A 4OS2A 1TGTA 4RKOB 2FO9A 1SGEE 1P04A 1OWIA 2ANMH 3PMHB 1QQUA 5EODA 1ESAA 1HIAB 3VB6A 1DLEA 1O2QA 2Q6DA 1O3CA 3RU4T 5K7RA 1KYNA 5A0BA 1AKSB 5C2ZA 2FZZA 1YPKH 1P05A 3RXLA 1KXAA 6CHAB 5JPMH 2BY8X 4CH8B 2VJ1A 3ZVAA 1SGCA 3E8LA 5DP7A 1YCPM 4D8NA 3UUZA 3TNSA 2ZWLH 2R9PA 3BIVH 3NKKA 1FY3A 3U1IB 2W7UA 3IITA 5PTPA 1EAWA 3RXGA 2GV6A 2G52A 3CP7A 3RXUA 1K1OA 1ZSLA 2VIDA 5EGMA 1CSOE 1KXEA 3SNEA 1L1NA 1AY6H 2NU4E 1EB1H 1CBWC 1KDQB 1ETSH 3T25A 2P93A 2Z7FE 3ELAH 2F9NA 3UWIA 1K1JA 1JWTA 3A80A 2BQ6B 4X2WA 3E1XB 1CT4E 1UK2A 4M7GA 1O2LA 3GY3A 4DIIH 1F0RA 2PGQB 4ZXYH 1TFXA 1GBJA 6GCHF 1ZPBA 2F83A 1EAIA 2VVCA 3K6ZA 5A8XA 3M7UA 3VEQB 1C2HA 4Q2KA 2VB0A 1KLIH 4OGYA 1K1NA 3LJJA 3B8JA 3ZZAA 1SHHB 1FY8E 4J2YB 1CGJE 1GJ4H 3SI4H 3I77A 1C4Y2 4CH2B 1OX1A 1XVMA 1V2VT 3BG4B 3VGCB 1C1OA 1RIWC 2ZU3A 1J9CH 5LPRA 2IJOB 4BTTB 9ESTA 1TBRH 1GI7B 1C2IA 2OP9A 4AYVB 4ZHLU 4D7GA 1MQ6A 3SJKA 1NFUA 2ZU1A 5ETXA 4A1XA 1CHOG 4JZ1A 3F9GA 4D7FA 5GWZA 1SOTA 1BTUA 1HXEH 4KKDA 6ESTA 4DURA 4XOJA 4ZMAH 1ZTJA 4YT6H 1WTGH 2NU1E 3SBKA 2FP7B 3RXFA 3ZZ5A 1OKXA 3CENA 2ZFTA 5DK1A 1F7ZA 1NN6A 1V6DA 3FP8E 4TWYA 3GISB 1NESE 1CE5A 1OWEA 3PMBB 3TK9A 3H5CB 3U8OH 3UQOA 3TK6A 4ESTE 3K9XB 4UDWH 3LC3A 2JH6D 3A81A 1F0TA 3TH3H 2OCVB 1GHBF 1A0LA 2ZHQH 1E35B 2SGPE 3GY5A 3P92A 4YO9A 5ABWA 1C5QA 3ZZ8A 1Z71A 2PW8H 3F9FA 2R0LA 1DSUA 5F6MA 2V6NA 1Z8JB 1EB2A 4KTUA 4GCHF 4JYUH 2WYGA 1O32A 3UQVA 3ZV8A 1JRTA 4ZHAA 4JZEH 5DP4A 1O3LA 5BRRE 3IWMA 3ATMA 2A7JA 1GJDB 4UFGH 3RXIA 1O3HA 3JZ1B 2P94A 4HTCH
chains in the Genus database with same CATH superfamily
1C5WB 5HM2A 1JIMA 3A7YA 4OS5A 1EPTA 2ZF0H 5EXLA 1TB6H 1MABB 1O3PB 2F43B 4FUGA 3MMGA 4B76A 2Y81A 1UO6A 1P3CA 3Q3XA 4D76A 1LVMA 4DW2U 4E7RG 1UCYE 1NU7B 2B8OH 3LGWA 2GMTC 3RXCA 3AK5A 2B5TB 1VJ9U 1EKBB 1O2IA 3RXMA 1ZZZA 4IN2A 3UNQA 2HVYB 3LGYA 1SGFA 4CR9A 4ZH8A 2AS9A 2OINA 2CV3A 1C1SA 1LHFH 1A3BH 1L4ZA 3BEIB 4GPGA 4ABDA 5EU8A 3F9HA 5BPEA 3D49H 1A0JA 1L2EA 1C4V2 2VIPA 1WU1A 2J34A 1HV7A 4JYVH 1C9TA 1L1GA 2JKHA 1AWFH 1ZGVA 1SVPA 2ZHFH 3QZQA 1ELBA 4FU8A 4ABIA 1FPCH 4U2WA 2ZDKA 1D3PB 2BD2A 2STAE 1SGNE 1A5HA 4AGJA 3LPRA 3BG8A 3U8TH 1SOZA 1SR5C 1PPHE 1K0HA 1NT1A 1FIZA 1C5NH 2SNWA 3GY8A 1SMFE 1MUEB 3BF6H 2GZ9A 1BRUP 1Y3UA 1Y59T 2NWNA 4X8TH 1ZR0A 4NIVA 1WQSA 5HM9A 2HALA 1GHXH 1TE0A 4M9FA 3RMNH 2WPMS 2Z9GA 1GBLA 1MD8A 4AB8A 2PKSC 3QTVH 4ACBA 5T1VA 3LIWA 1V2OT 3AAUA 1O2HA 2UUYA 3PO1B 1IQNA 4WWYA 5L2YH 1ZPCA 1GI2A 1TNKA 1C9PA 3M7TA 2FESH 1TQ0B 1AUJA 1QCPA 2G51A 3KHVA 2VIVA 4BTUB 3O8BA 1L0ZA 1Z1IA 1TX8A 1G3EA 2WYJA 3ODFA 2H9TH 1GJ7B 2AGIX 2ODQA 3ZZCA 4H4FA 2BM2A 2A0QB 1W8BH 3VXFH 1TPSA 1G30B 2PUQH 3SO3A 5JYIA 1AB9B 1AIXH 3F2FA 4J1YA 3ZVCA 1QJ7B 3RXSA 3RXQA 8KME2 2HPPH 5DSFA 1P3EA 1O2VA 3D65E 3GYLB 1NFYA 1LHEH 4AOQA 5C94A 2F9BH 4FXGH 3R0FA 5T3HA 3EA7A 3PLKA 1TPAE 1DM4B 3DT0H 2BX3A 5DP9A 3TGIE 2OC0A 4FUEA 1T8NA 1GBAA 1BMFD 2SFAA 1BBRE 5A8ZA 1AZZA 3SN8A 6GCHG 4WH8A 1NRRH 4NA7A 3RXBA 3TLOA 1BTHH 1C1UH 1MBMA 1LQEA 1UK4A 5GPIB 4ISIH 1UVOA 3RMLH 2DE9A 1BITA 4MTBA 3BEUA 3NPSA 4NA8A 5IDKA 2C8XB 2BDIA 5CE1A 3EAJA 1OP2A 2NU2E 2BTCE 1T31A 1TX7A 1Y3VA 4THNH 1W7XH 5A0CA 5L2ZH 3BTEE 3S9BA 2HNTC 1GI9B 4CRBA 2AGGX 1XUGA 1DWDH 1S84A 3SJOA 1SSXA 1OS8A 1NBME 5EW1H 2FLRH 4F4OC 2EI7A 1GI4A 4DG4A 3HKIB 4CRGA 4CRAA 1V2ST 2D26C 1PJPA 2SGDE 1SLWB 1HUTH 2EC9H 2I6QA 4ZCNA 4DGJA 2BY6X 1LQDB 2ZDVH 1AFEH 1XMNB 1COWD 3NCLA 1NFXA 1UHBA 1YWUA 5JBBS 8GCHG 3BIUH 4OS6A 3HGNA 4NZLA 5DPAA 3TJNA 4U30A 3E3TA 1DY8A 4NSVA 4ZKRU 3OY6U 2Z9JA 1OWKA 4AZ2B 1KXFA 2ZGHA 3D23A 4BXSA 2V7QD 3NRLA 2FOCA 1SGRE 5E8EH 5EIYA 1ESBA 2ZNKH 1O5DH 3MNCA 4ZUHA 1AO5A 2EI8A 1IOEA 1H4WA 1SLVB 1NPMA 3PLBA 4YESB 2Y5GA 2HNTF 2QV1A 2AMQA 2FS9A 1OPHB 3FAOA 3IG6B 1GVZA 2BDBA 2J5UA 3SV8A 2YMSB 4NIXA 2ZFPH 1TPOA 3SI3H 1NRNH 1WQVH 4X6OA 1QB9A 4Y71A 1C1MA 1LCYA 4CREA 1GBEA 1FXYA 1IHSH 3T26A 4Z0KA 7GCHG 1M9UA 3OSYA 3SU2A 7ESTE 1C1WH 1G2MA 2H5DA 4Q80A 3SJIA 4ABGA 3GCHB 1C5RA 5AFZH 4F48B 3TGJE 4AG1A 1TX6A 2Z3CA 1MMJN 3E0PB 4FU7A 3A8AA 1V2RT 1LDTT 2H9EH 2R3YA 1H8IH 1XXFA 3OEED 3PROA 4LZ1H 5L6NH 4WF8A 2ZG0H 3BSQA 1Y3WA 1HAOH 1H8ED 1TAWA 4X2YA 4MNYA 4ABHA 2ZI2H 1P0SH 3S7HB 4I8KA 2QAAA 2C90B 5JDUB 1O2NA 4GAWA 2P8OC 3GCTF 4BXWA 1GJCB 4B75A 3S7KB 1O38A 1PYTD 1TA6A 3SHCH 1GI1A 1YLCA 1O2YA 1BMNH 2P3UB 2CHAC 1GHYH 1HBTH 2C8YB 4U01A 1HJ9A 2YOLA 4Q7YA 1P2KA 7GCHF 1WOFA 2ASUB 4IGDA 1K1MA 2G8TA 2W5EA 4WY3A 3GYMA 1TMUH 1T4UH 1S6HA 2YNAA 1P9SA 1HNEE 2ALPA 1LMWB 2V3OH 3PO1C 4MNXA 5HXFA 1NRSH 1UHBB 4BAOB 1HAVB 1O3AA 2ZEBA 5E0HA 1ELDE 2J95A 1GBHA 2TIOA 3M3VA 3BTHE 1MU6B 1EXFA 4QT8C 3TH4H 2TGPZ 4R0IA 1TMTH 4RKJB 3SOSA 2VH6A 1B5GH 1FPHH 4LK4A 1HAHH 2CMYA 2KCOA 3MI4A 1A7SA 3E6PH 1AN1E 1SGDE 1MTUA 1MZDA 2ZPRA 1AU8A 2PV9B 3L33A 2QC2A 1FMGA 3JZ2B 3OEHD 1C5VA 4MPXA 1NU9A 3ZYDA 3QUMP 3S9CA 1LHDH 8GCHF 2W3KA 4A7IB 1SGQE 2ZU5A 2BQWB 1O3BA 2BD8A 2DUCA 2XYAA 2WUCA 1GCDA 1DXPA 1WSSH 2C4FH 3LU9B 2ZKSA 3KNXA 2ZDLA 1LVOA 4AX9H 1BIOA 4ZAEA 1IQJA 1AE5A 2F9PA 1RTLA 3ATIA 1A3EH 1G3DA 2BZAA 1O34A 1MKWH 2XCNA 4NWKA 3TK5A 2YMSD 1MTSA 3UOPA 2ZP0H 1C4U2 4K2YA 1A1RA 3F6UH 3M35A 1B0FA 2QXJA 1G9IE 4DCDA 4DY7B 5C67A 2EA3A 3RDZA 1GJBB 3P95A 1OOKB 5FX6A 1TMBH 1DWBH 2BD3A 3PTBA 1FN6A 1YBWA 3UNSA 3MO9A 1D3QB 3S9AA 3SV9A 4D9QA 2OBQA 1GBTA 3OY5U 2XC0A 1GJ6A 1BQYA 1DSTA 1OWJA 5HGGA 2AIQA 2XRCA 4YOIA 1PPEE 2HOBA 5C1UA 2QA9E 1J16A 4ASUD 2ZFFH 1ELEE 1FN8A 1W2KH 2IPHA 2OUAA 1NRQH 3D62A 1BT7A 2A4RA 2ZCKP 1GBDA 3SUDA 1UTPA 4Q7XA 1EPTC 3P8OA 3LONA 1OWHA 1PPCE 3V0XA 2ANYA 3RXOA 1BHXF 3LOXA 3MYWA 3KQDA 3W1EA 1EZSC 2BVSH 1GI3A 2FOFA 1INCA 1ZMJA 3A82A 4K1SA 3GY4A 3RMOH 3E90B 1MTVA 3AW0A 1P2IA 1FY4A 3S0NA 1QURH 3I29A 1EZXC 1RFNA 2Z6BD 1MD7A 1WUNH 2EI6A 4DOQA 1ZSKA 1TNLA 1CHOF 1DVAH 5F8XA 2ZGCA 1BTYA 5GDSH 4JCNA 2CF9H 1VCPA 1O2WA 2CF8H 3A88A 1O3JA 3KGPA 3FO8D 4NSYA 5EPYA 1Z8IB 1UVUH 1D6RA 1CBWB 2FOHA 2GCHF 5FPTA 5EXNA 4INHA 3MQKC 1JRSA 1CU1A 1WCZA 2ZPSA 1MTWA 4B71A 4I86A 3SNAA 1A2CH 1PQ5A 1H9LB 2BQ7B 1ZOMA 1GBMA 1G32B 2VIOA 2ZDAH 4JMYA 5FX5A 4A92A 4RI0A 5I25A 1C1RA 4CHAC 3KYGA 2OD3B 1DT2A 3BEFB 3Q3YA 1H1BA 1LKBA 3OE7D 1T4VH 3UIRA 2XNDD 5FPSA 3U8RH 2HRVA 2PLXA 1HAIH 1KIGH 4VGCB 1TWXB 1YPHE 1P9UA 3RXDA 4ABEA 1TOMH 3EGKH 2A5KA 1JXPA 3TH2H 1SQTA 1AD8H 1UTJA 3GDUA 1AUTC 2QY0B 1F0SA 1RIWB 4ISHH 3GY2A 1EP5A 1ID5H 1JOUB 1B0EA 1O3IA 2QF3A 3BTFE 3SU3A 3T27A 4A5TS 1ARBA 1P8VC 2FOGA 3TIUA 4AFQA 1VR1H 3C1KA 2BB4A 1MU8B 2J2UA 4FU9A 3PV5A 3UNRA 1GHWH 3URCA 4Y0ZE 4DJZB 1PPBH 3ODDA 1O2RA 3PLPA 1EJAA 1MKXK 1EFRD 2KM0A 4FUBA 5GIBA 2VVVA 2UWOA 1AB9C 5G4BA 1QFKH 1GI6A 2VBCA 4UFDH 3H7OA 4TT3D 1VGCC 3A87A 4OM9A 1S0RA 1SFIA 2BD5A 1TGSZ 1TNJA 8ESTE 3QWCH 3VFEA 3K2UA 3ZVEA 2HVXA 1FY5A 4DT4A 1BBRK 1GG6C 4BAKB 4GUXA 3PMJA 3SV2H 4A1VA 5F53A 2ZFQH 4ISNA 4BNRA 2A5AA 4WVPE 2PSYA 3QTOH 2RG3A 1W10U 2K0QA 1S5SA 3N99A 1K28D 1O5AB 2G5NA 1ZTKA 4GCHG 2FI5E 2O8MA 2QF5A 1FX0B 2BLOA 2M2AA 2BVRH 2BD4A 4K1EA 4X6PA 4FUJA 1Z8RA 2FDAA 5HIYA 1K21H 1O3FA 1ZMLA 1T8LA 1MAYA 1SLUB 3A89A 2D1JA 1TYNA 5DJ7A 3RP2A 4HG6A 4K69A 1TQ7B 1LPZB 1V2WT 1O31A 2XC4A 2ANKH 2ZDMA 1F5KU 5GCHG 3LGUA 2BHGA 3DSGA 2SGEE 1GHVH 3ZIAD 3TITA 2ZHWH 4OGXA 2B9LA 1BA8B 3UPEA 1U6QA 5IK2D 1P2OA 2R0KA 1J14A 2PR3A 1N8OC 4HGCA 1WTHD 3GCOA 3SHAH 1JMOH 1XX9A 1DX5M 2WHXA 1BMLA 2TBSA 2WPKS 3N7OA 1Y3XA 1CA0B 1EZUC 1J17T 3CS0A 4K8YA 5FCRA 1O2GH 1PQ7A 3OU0A 1NFWA 2ZTYA 1GI5A 1ORFA 3BTQE 4MG3A 1SGPE 3OFND 2OBOA 2AYWA 1O2KA 4I33A 1GMDG 5HYOA 1PPFE 2A7CA 1GI8B 2RA3A 4OS1A 2FIRH 1ZHPA 1O3MA 2GT7A 1FI8A 1Q2WA 1C5MD 2AMDA 3F2GA 1C2DA 2KCPA 2GZ8A 1OP0A 2OQUA 1Q3XA 3SGAE 2GDEH 1P02A 1HLTH 1HFDA 2BDYA 3RXRA 5LPFA 1ZMNA 3UTUH 2PHBA 2KR7A 3SU1A 3KL6A 1ANDA 4KELA 1C2GA 2FS8A 2PP6A 4RN6A 4FVBA 3MH4A 3BN9A 3UOUA 3ZZ6A 1NZQH 1AVGH 1CT2E 1XKBC 1Y5UT 2STBE 4X1NU 3WY8A 1QL7A 1ZPZA 1O37A 1QTFA 2I6SA 3U98H 1V2NT 3MNBA 4SGBE 3KF2A 4R8TB 1TRMA 4UFFH 3P17H 2ILNA 4ISOA 4KTCA 3QO6A 2FM2A 1NS3A 2D2DA 1YLNA 4X1RU 1K22H 3F0PA 1ELAA 1EX3A 1CT0E 1DPOA 1OXGA 2O8LA 3MTYA 1QRXA 5AHGH 1LKAA 1ABJH 3UR6A 1O3OA 1Z6EA 1ELGA 1A0HB 1GBKA 2TGDA 1ESTA 1ANCA 3M7QA 2XBXA 3A83A 2UUKB 3ATLA 2H6MA 3FP6E 3OYPA 1N6XA 3HATH 3KEEA 3LJOA 1EQ9A 1V3XA 4GHTA 2HWLB 3AASA 3EA9A 1O2PA 2XXLA 4I8LA 4B2AA 1PFXC 2XCFA 1S6LA 1UTQA 3QX5H 4X6MA 4K5ZA 4IMQA 3GCHC 1QR3E 1DDJA 2Z94A 7KMEH 4UD9H 2SGAA 3W94A 4NG9H 1PQAA 2Z9IA 1HAXB 4KP0A 2QIQA 2BZ6H 2RDLA 1QHRB 2ZGBH 3ENSB 3ZYEA 4AYYB 1P01A 1QY6A 1BTPA 1HXFH 1XM1A 2ZQ1A 4YOGA 2TPIZ 1AKSA 1UVSH 3R3GB 2A32A 1XKAC 5SGAE 4AFZA 3DUXH 3TGKE 2FOEA 1NBMD 3SZEA 1T32A 3RU4D 1TLDA 3SNBA 3SNCA 3EYDA 1HAVA 1XXDA 2XWAA 1HDTH 1YPLH 4AC9A 4UFEH 4X1PU 1UTKA 2BD7A 4F49A 5EQSA 3TNTA 4Y7BA 4SGAE 4NFEA 3DCLA 5B6LA 1BMMH 1RGQA 3QGNB 1TBZH 3SYJA 4FUCA 2K1QA 5C1XA 2FXRA 2VGCC 3BTWE 4RT1A 1V2PT 2J4IA 2OC7A 3EE0B 1AE8H 1VITG 2BDGA 3ZVFA 5FHTA 2ZU2A 2ZQ2A 1E34B 1GDNA 2FYRA 2ZHEH 1YGCH 2GTBA 2GDDA 2LELA 1H9IE 2TRMA 2WV5A 2B0FA 5EPNA 2HPQH 2QYIA 4Y7AA 5ESBA 4X2VA 5DP3A 1C2EA 4ZHMU 2PGBB 1E1QD 5EW2H 5J4QA 1WBGB 2YMSC 4K60A 4NGAH 3SNDA 1QBOA 2A2QH 1MTNC 1HAGE 2FWWA 2LNCA 2XOKD 2PKAB 1D3DB 1DS2E 4X8VH 3SU4A 5A2MH 2G81E 3FKSD 2PKAA 1SLXB 4FUHA 1SGYE 1W13U 1GMHG 2Y5HA 2WPIS 2Y7ZA 1C5YB 3FVFB 3LDXH 3FP7E 1ZRKA 2FTLE 2NU0E 5E2OA 2LP6A 4IC6A 3U9AH 3DSPA 1SC8U 3A7ZA 3Q3KA 1WAYB 3DA9B 4AN7A 4O3TA 3NWUA 1D9IA 3FOAA 3GDSA 5A0AE 2Z3EA 3M61U 3W95A 2GT8A 2QCYA 4K1TA 1SFQB 2WV4A 3GDVA 4Y8ZA 2BY9X 2KAIB 1VGCB 1TRNA 2VINA 2PTCE 4TY6A 4KTSA 3SGQE 3SGBE 4WH6A 3ATKA 4XFQA 3V3MA 2BDHA 1J8AA 5C5NA 5I46H 1K1IA 1O33A 3L6PA 2O9QA 2W26A 1ANBA 1F2SE 1BHXB 2BY7X 2ZIQH 1BMAA 3WWFA 3SU6A 1V2TT 1SGIB 2FMJA 4K3JA 1IAUA 1HCGA 1W14U 1IQLA 1O2OA 2XBYA 3UR9A 4Y8XA 1BDAA 1UK3A 3P70B 4WXIA 1ELFA 2FOMB 1ZGIA 3QGJA 1LPKB 1LHCH 1BBRH 4AFUA 3MH5A 3HPTB 3LGVA 1C2MA 1GGDC 2OC8A 1T8OA 5TCAA 1MH0A 5FPYA 2ZU4A 2VWOA 3G01A 1PYTC 5IYTA 5JBAS 1AMHA 2JETB 3ZZ3A 3MFJA 3MNXA 4LXBH 1C5OH 3OAAD 1C1VH 2CXVA 1FZZA 1UCYH 2GKVE 1O35A 1FLEE 3SU0A 1G37A 4ZKSU 5KECA 3O8RA 1DXWA 2GVFA 2QN5T 4Y79A 1HAPH 4MPVA 1GDUA 3B9FH 2JJ2D 1O30A 1MCTA 5DP5A 5H4IB 4YOJA 3UY9A 2TGTA 2ZDNA 1FUJA 4YT7H 4O3UA 2FEQH 1NO9H 1SPJA 1ANEA 1TNIA 2GCTC 3A7WA 1SBWA 3BTDE 4JZDH 7LPRA 4Y76A 1HAYB 1GVKB 2JETC 1YPJH 1FJSA 2UWPA 4O03A 3PV2A 1UCYK 1TALA 3F9EA 1V2JT 4YXWD 2JH5D 1HIAA 3MNSA 1NM6A 3KQBA 1QNJA 3MU0A 1J15A 1MZAA 1E36B 1GJ8B 4IW4E 2EEKA 1HJAC 4P02A 5CHAB 1P2MA 1CGIE 4MVNA 1W7GH 4TYDA 1GCTB 2W3IA 1EZQA 5DKMA 1O36A 1W11U 2BVXH 5F03A 3FFGA 1VKYA 2BLQA 1K9OE 3LH3A 4JK5A 1UTMA 2WSSD 3B23B 2RDEA 2ODPA 3H09A 4FUFA 5DG6A 3RXHA 1UTOA 3F0OA 1FY1A 1YPMH 1CVWH 4TSFD 1ETRH 2EY4C 2P59A 1TA2A 3RLWH 1KDQA 2P16A 4TY7A 3UWJH 5L30H 1C5XB 3BTGE 3AW1A 1EOJA 1NC6A 3KQEA 2GZ7A 3V12A 4WMFA 4ABFA 1THRH 3ZZDA 1T8MA 4GLYA 1TONA 1GHAG 5GJ4B 3SQEE 1AFQC 3BV9B 1W12U 2J98A 1ELTA 1P06A 2SGFE 4MPWA 3WW7A 2BDAA 5CDFE 3OTPA 1DFPA 2RCEA 4E06H 4CRFA 2P95A 2BYAX 2QGRA 4BTIB 1XUJA 1G2LA 2ZTZA 1QB6A 2DE8A 3TU7H 3PWCA 1TPPA 3QZRA 4X2XA 1MAXA 2V35A 4D9RA 1MCVA 2C8ZB 3A84A 3P6ZB 4Y11E 1BCUH 2F4LA 5F8ZA 3ATWA 1NY22 3U28C 3RLYH 4ZKNU 1OYTH 1DUAA 1FAXA 2QF0A 1QL8A 1QRWA 2QXIA 1GMDF 1LVYA 3MHWU 3VB3A 4AFSA 2P8OB 5CHBA 3TPIZ 2ZCHP 4WMEA 3ZVDA 2QF4A 2G55A 2V0BA 1F92A 2PUXB 1KXDA 4H6TA 4IC5A 2VU8E 1GCTC 3STJA 2A4GA 1V2MT 1YM0A 3GY6A 3RC6A 3NUMA 3ITIA 1IQGA 5HIZA 3SJ9A 1V2UT 1WV7H 4RSPA 2M5TA 2W7SA 3VXEH 2ZZUH 3DFLA 1PPGE 1V2LT 3VB7A 3RC5A 2FX6A 1MBQA 3LGTA 1HRTH 2AFQB 1H8DH 2B7DH 1DWCH 5LPEA 1O5CB 1ZHMA 3N7DA 2Y7XA 1P2JA 2W6ID 2Z9KA 3MU8A 1F0UA 3EE7A 4K8BA 3FZDA 1RJXB 4X1SU 4U32A 6LPRA 1LTOA 2BMGB 1K1LA 1RD3B 1AVWA 2KCYA 2OLGA 3LKWA 1A5GH 5AF9H 2QXHA 5FXLA 4RT0A 2FOBA 2C3SA 1AVXA 2G4UA 2J97A 4CHAB 5GXPA 3RXPA 1FDPA 3F3BA 2SNVA 1O2XA 2J98B 4E05H 1KY9A 2XBWA 4UEHH 1IQIA 1IQKA 1ZSJA 1RXPA 4YLQH 2G00A 1T7CA 1RTKA 4OS4A 2GMTB 2P3TB 2G4TA 3Q77A 5J4SA 4B1TA 2P3FH 1C5PA 4HI3A 3ESTA 1YP9A 3PYHA 4FUDA 2VIWA 3A86A 1O5FH 1THSH 1ZJKA 1HYLA 5E2PA 2XTTB 3PTNA 1SI5H 4JYTA 1F5RA 2WPJS 2ZTXA 3HKJB 1C2FA 4HFPB 4XE4A 4X6NA 3MH6A 1O2UA 2HGTH 3FANA 4AG2A 1GL1A 1FV9A 1GHBG 3RMMH 3MOCA 1DY9A 1TOCB 1UTNA 3QN7A 2LPRA 2J9NA 3PV4A 3RXKA 1ARCA 4WMDA 3VB4A 2ZCLP 4I8HA 3RUOA 2A7HA 3A8BA 5HKKD 1V2KT 1BZXE 2A31A 1E38B 1FQ3A 1JBUH 1AHTH 2IOTA 1EAUA 2AIPA 2JIZD 1GJ5H 3UAIC 3M3TA 3QK1A 3RM0H 1O2MA 4FETA 3ZZ4A 1THPB 5FAHA 4CBOA 5E0JA 5T6DA 1CA0C 3TJVA 1E0FD 2QXGA 3SQHE 1UVPA 1ZLRA 1CO7E 1E37B 3DD2H 3KCGH 4DVAU 3Q76A 4Q7ZA 2ZC9H 3V13A 1FIWA 1Z8GA 1FAKH 1AI8H 3KQCA 1GBBA 1P09A 1XUHA 3MU1A 2J38A 3ZZ9A 2PKSB 2QE7D 3STIA 2CN0H 1DICA 2FLBH 1ABIH 2XW9A 2O8TA 1P12E 4MNWA 2R2WU 2ZFSA 1O5BB 2OTVA 1BRBE 1DANH 3F2HA 1QJ1B 1LHGH 1TGBA 3RXTA 1G3BA 4Y0YE 1HJAB 2H9HA 1Z1JA 3DHKH 2BLWA 4Y6DA 1UJ1A 1GMCG 3BTTE 3PM3A 4O97A 4ACAA 4UONA 1SQRA 4NFFA 4X1QU 3BTKE 1QL9A 4P00A 3RXAA 4MNVA 2FOAA 4ABBA 1BRAA 4B2BA 1HGTH 3PRDA 1ELCA 4BANB 2GD4B 1C5TA 2C8WB 1C1QA 4B73A 2ANWA 3P8FA 1O3GA 3AVZA 2PTNA 2BDCA 3TVJB 3LT3A 2Y5FA 2PSXA 1BJUA 1GHAF 1DITH 1KLTA 3MH7A 1S0QA 3GCNA 1GMHF 2ZHDA 1H8HD 2VGCB 3BG4C 3SJ8A 2HLDD 4I32A 3OTJE 2V3MA 3HK3B 3E0NB 1O39A 5C20A 1KSNA 4XDEA 2ESTE 2A4QA 2RA0A 4I8JA 4INKA 5AFYH 1EASA 3HK6B 4BAHB 1DOJA 1P10A 3H7TA 1D3TB 1S6FA 2F3CE 3LC5A 3OX7U 4JZFH 4IBLH 3RC4A 1TGCA 2IN2A 1E1RD 1ZRBA 4JK6A 1O2SA 5JB8S 1CQQA 1HB0B 1W0ZU 2J94A 2NU3E 1Y8TA 1LPGB 1QRZA 4NZQA 1YPGH 2ODYB 1Z6JH 3T5FH 3TJUA 2CHAB 1BUIA 1RRKA 2VIQA 1XUIA 2VWLA 2PFEA 1DLKB 1NRPH 2HNTE 5DGJA 4MLFB 5FBIA 4AB9A 4I31A 4INLA 1TABE 5C1YA 3SUEA 2BY5X 2TGAA 1C5SA 1YC0A 2JDID 1YYY1 4X8SH 3T28A 1DE7H 3VB5A 1EAXA 1PQ8A 4O9VA 4GHQA 1IHTH 1KTTB 3RU4E 2A4OA 1P57B 1QJ6B 4IS5A 1EUFA 3FZZA 3WWBA 4BOHA 4OS7A 1AGJA 2ALVA 2KCAA 1PPZA 5FBEA 3KIDU 2KAIA 8LPRA 1CGHA 4NCYA 1P11E 2L6OA 4FVDA 5C17A 1AFQB 4GVUA 1EATA 2WPLS 4I7YH 3ZZ7A 1BRCE 2IPQX 1L4DA 3GS9A 2WZQA 1ELVA 1BTXA 1QBVH 2BX4A 1LVBA 2ZFRH 2CK3D 1W0KD 1C5UA 1WYKA 3BTME 2Q1JA 4NIWA 2ZA5A 3K6YA 4PROA 3URDA 4ZXXH 2AGEX 2AERH 1O3NA 4KGAA 4BAQB 3KQ5A 4AGKA 4LOYH 3V7TA 3C27B 3VPKA 2VH0A 4H6SB 4FUIA 1VCQA 2AMPA 1CHGA 2Y6TA 1A61H 1N1LA 3U69H 1VZQH 2V3HH 3VGCC 4XBCA 2HLCA 4BAMB 3A8CA 1W0YH 4NA9H 2ULLA 5KEDA 1ZJDA 1GVLA 2H1UA 2UUJB 1A46H 2GX4A 4HZHA 3T2NA 3SV6A 3GOVB 4UE7H 4ASHA 2VNTA 2OXSA 2CJIA 2XBVA 1YLDA 1Y5AT 4MPUA 5A8YA 3RXEA 3DFJA 6CHAC 4VGCC 4XD7D 1Y5BT 1O2ZA 1BB0B 2BD9A 2GJGA 1SHYA 2FPZA 3RM2H 5DO4H 1SB1H 3QLPH 1C1PA 4DT7B 2FX4A 3N7EA 1YCPK 5JB9S 1SQAA 5HMAA 1XUFA 2ZPQA 2ZGJA 3M36A 3SZNA 3NK8A 5DP6A 1V2QT 1GMCF 2L74A 3QDZB 1QA0A 5EXMA 1WXRA 1GBFA 4TPYA 1GWAA 5FCKA 1ETTH 2C93B 3T29A 1XUKA 1TBQH 2K8IA 2BOKA 3M5MA 3CNRA 2WV9A 1ZYOA 4WJG2 2VVUA 1QZ8A 2BLVA 4JZIA 2WUBA 1P03A 1O5GH 1EP6A 1OSSA 2J92A 1VJAU 1BTZA 1TNGA 2A2XH 3NXPA 4TWWA 3HGPA 1MTNB 1GBCA 5DP8A 1NTPA 2EQNA 3F68H 3RXJA 3SUFA 1SKYE 4CRCA 2H2ZA 1OYQA 5B6OA 1OP8A 3MWIU 5E0GA 4A1TA 3ZZBA 2AH4X 4XBDA 1P2QA 2ZGXH 5CHAC 4ABJA 9LPRA 3A7XA 1A5IA 1VITH 2AHME 1AQ7A 2WPHS 5GCHF 1RS0A 1C2LA 2A5IA 4I8GA 4X8UH 5TCCA 1K2I1 1QQ4A 1S82A 3PWBA 1SG8B 2ZECA 4A6LA 2AEIH 1K1PA 5GNDA 2FYQA 2OC1A 2CGAA 3CS7A 1G3CA 5C0TA 4MQAA 3TJOA 1Y3YA 2W6JD 2F9VA 2WPDD 4MDSA 5C5OA 4XSKU 3M5NA 3UFAA 1TNHA 4Y10E 2FI4E 1ZTLA 2VWNA 1S83A 2FODA 1O0DH 2GV7A 3PRBA 1X7AC 2THFB 2VWMA 3EQ0H 1GI0A 1H9HE 3DSOA 3ZVBA 1O3KA 5F8TA 2PWXA 1UVTH 4YZUA 1F5LA 1O3DA 5EOKA 1C2KA 1GL0E 1UTLM 1P2NA 2SGQE 2FI3E 4IMZA 2OK5A 4LZ4B 5C3NA 1EJNA 2Z3DA 4Y8YA 1GJ9B 2F9OA 3GICB 1AWHB 3SW2B 1QB1A 3ZV9A 3EDXB 1RTFB 1DUEA 1IQMA 2Y82A 1KXCA 1O3EA 3S69A 1TIOA 2GP9B 5KGOA 2G5VA 2YNBA 1NROH 5T6FA 3MO3A 2Z9LA 5EG4A 4NWLA 4DIHH 1C1TA 1GBIA 1IQHA 2KX4A 5TJXA 5ESTE 2F9UA 2GGVB 3AAVA 4CR5A 4X0WU 1QA7A 5EQRA 5CMXH 3O8DA 2BOHB 2BXTH 1IQEA 1D4PB 3SV7A 4CRDA 3A7TA 5JBCS 1HPGA 4Z6AH 2WINI 5LGOA 1E79D 1MKWK 1Z7KA 3Q00A 4AORA 5A09A 3MO6A 2GCTB 1GDQA 3M37A 1FNIA 3LGIA 1MQ5A 4GSOA 1N6YA 4YM9A 3SORA 1BTWA 3NZIA 4CBNA 4F55A 1D6WA 1EOLA 5EQQA 1UMAH 4B6EA 5DN6D 4B74A 3MU4A 1O5EH 3KN2A 1A4WH 2R3UA 5T6GA 3PB1E 4XBBA 4ISLA 1XVOA 1AZ8A 2O8UA 3M3SA 2XC5A 1TGNA 2H5CA 1C5ZB 1L1JA 1HJ8A 2A45B 3U1JB 1KLJH 1Q31A 4ZROA 4B6FA 3LH1A 4YLUA 3MU5A 1FONA 3E16B 5K0HA 1EJMA 1DWEH 4NIYA 4ZKOU 1C2JA 1IQFA 1QBNA 1UW7A 5JBTA 3GCTG 2O8WA 1BOQA 1GHZA 2Y80A 1S85A 2GCHG 3E91A 5AVDA 1S81A 4YTAA 1KXBA 1YF4A 2XNIA 1N8OB 1YPHC 4Z1MD 3A8DA 2UUFB 3P8GA 1VITF 3UREA 1TRYA 3M5LA 1MKXH 3K65B 3L3TA 3I78A 2F91A 2A1DB 1CA8B 3RXVA 1QIXB 3EA8A 1O2TA 1C1NA 1YKTA 3SUGA 1SGTA 1BJVA 3P8NA 1ACBE 4H42U 1QGFA 5C0UA 2XWBI 3T62A 2UWLA 1OWDA 4XRNA 1YCPH 5LH8A 2ZO3H 3O8CA 1B7XB 4ABAA 3GY7A 3A85A 2Q6FA 3SU5A 3ZVGA 4Q63A 4B2CA 1W3CA 1O2JA 1SQOA 2BXUH 2R2MB 1G36A 1C5LH 3A7VA 4TPIZ 2FTMA 4FOUC 2OQ5A 2Q6GA 3F1SB 1GGDB 3M5OA 1HAZB 1KTSB 1VCWA 4IN1A 4E7NA 2D8WA 1GPZA 2IJD1 4WXVA 1ZHRA 2JH0D 1GJAB 1JIRA 2RFKC 1GG6B 1SL3A 1YPEH 3PMAB 1SGFG 1EPTB 1LO6A 4OS2A 1TGTA 3FN8A 4RKOB 1OHHD 2FO9A 2KZ4A 1SGEE 1P04A 1OWIA 2ANMH 3PMHB 1QQUA 5EODA 1ESAA 1HIAB 3VB6A 1DLEA 1O2QA 2Q6DA 1O3CA 1KMHB 3RU4T 5K7RA 1KYNA 5A0BA 1AKSB 5C2ZA 2FZZA 1YPKH 1P05A 3RXLA 1KXAA 6CHAB 5JPMH 2BY8X 4CH8B 2VJ1A 3ZVAA 1SGCA 3E8LA 5DP7A 1YCPM 4D8NA 3UUZA 3TNSA 2ZWLH 5EJLA 2R9PA 3BIVH 3NKKA 1FY3A 3U1IB 2W7UA 3IITA 5FL7D 5PTPA 1EAWA 3RXGA 2GV6A 2G52A 3CP7A 3RXUA 1K1OA 1ZSLA 2VIDA 5EJ1A 5EGMA 1CSOE 1KXEA 3SNEA 1L1NA 1AY6H 2NU4E 1EB1H 1CBWC 1KDQB 1ETSH 3T25A 2P93A 2Z7FE 3ELAH 2F9NA 3UWIA 1K1JA 1JWTA 3A80A 2BQ6B 4X2WA 3E1XB 1CT4E 1UK2A 4M7GA 1O2LA 3GY3A 4DIIH 1F0RA 2PGQB 4ZXYH 1TFXA 1GBJA 6GCHF 1ZPBA 2F83A 1EAIA 2VVCA 3K6ZA 5A8XA 3M7UA 3VEQB 1C2HA 4Q2KA 2VB0A 1KLIH 4OGYA 1K1NA 3LJJA 3B8JA 3VG8A 3ZZAA 1SHHB 1FY8E 4J2YB 1CGJE 1GJ4H 3SI4H 3I77A 1C4Y2 4CH2B 1OX1A 1XVMA 1V2VT 3BG4B 3VGCB 1C1OA 1RIWC 2ZU3A 1J9CH 5LPRA 2IJOB 4BTTB 9ESTA 1TBRH 1GI7B 1C2IA 2OP9A 4AYVB 4ZHLU 4D7GA 1WDIA 1MQ6A 3SJKA 1NFUA 2ZU1A 5ETXA 4A1XA 1CHOG 4JZ1A 3F9GA 4D7FA 5GWZA 1SOTA 1BTUA 1HXEH 4KKDA 6ESTA 4DURA 4XOJA 4ZMAH 1ZTJA 4YT6H 1WTGH 2NU1E 3SBKA 2FP7B 3RXFA 3ZZ5A 1OKXA 3CENA 2ZFTA 5DK1A 1F7ZA 1NN6A 1V6DA 3FP8E 4TWYA 3GISB 1NESE 1CE5A 3UB0A 1OWEA 3PMBB 1YY3A 3TK9A 3H5CB 3U8OH 3UQOA 3TK6A 4ESTE 3K9XB 4UDWH 3LC3A 2JH6D 4Q4LA 3A81A 1F0TA 3TH3H 3KYFA 2OCVB 1GHBF 1A0LA 2ZHQH 1E35B 2SGPE 3GY5A 3P92A 4YO9A 5ABWA 1C5QA 3ZZ8A 1Z71A 2PW8H 3F9FA 2R0LA 1DSUA 5F6MA 2V6NA 1Z8JB 1EB2A 4KTUA 4GCHF 4JYUH 2WYGA 1O32A 3UQVA 3ZV8A 1JRTA 4ZHAA 4JZEH 2KFWA 5DP4A 1O3LA 5BRRE 3IWMA 3ATMA 2A7JA 5EJZA 1GJDB 4UFGH 1W0JD 3RXIA 1O3HA 3JZ1B 2JJ1D 2P94A 4HTCH
chains in the Genus database with same CATH topology
1C5WB 5HM2A 1JIMA 3A7YA 4OS5A 1EPTA 2ZF0H 5EXLA 1TB6H 1O3PB 4FUGA 3MMGA 4B76A 2Y81A 1UO6A 1P3CA 3Q3XA 4D76A 1LVMA 4DW2U 4E7RG 1UCYE 1NU7B 2B8OH 3LGWA 2GMTC 3RXCA 2B5TB 1VJ9U 1EKBB 1O2IA 3RXMA 1ZZZA 4IN2A 3UNQA 3LGYA 1SGFA 4CR9A 4ZH8A 2AS9A 2OINA 2CV3A 1C1SA 1LHFH 1A3BH 1L4ZA 3BEIB 4GPGA 4ABDA 5EU8A 3F9HA 5BPEA 3D49H 1A0JA 1L2EA 1C4V2 2VIPA 1WU1A 2J34A 1HV7A 4JYVH 1C9TA 1L1GA 2JKHA 1AWFH 1ZGVA 1SVPA 2ZHFH 3QZQA 1ELBA 4FU8A 4ABIA 1FPCH 4U2WA 2ZDKA 1D3PB 2BD2A 2STAE 1SGNE 1A5HA 4AGJA 3LPRA 3BG8A 3U8TH 1SOZA 1SR5C 1PPHE 1NT1A 1FIZA 1C5NH 2SNWA 3GY8A 1SMFE 1MUEB 3BF6H 2GZ9A 1BRUP 1Y3UA 1Y59T 2NWNA 4X8TH 1ZR0A 4NIVA 1WQSA 5HM9A 2HALA 1GHXH 1TE0A 3RMNH 2WPMS 2Z9GA 1GBLA 1MD8A 4AB8A 2PKSC 3QTVH 3LIWA 1V2OT 3AAUA 1O2HA 2UUYA 3PO1B 1IQNA 4WWYA 5L2YH 1ZPCA 1GI2A 1TNKA 1C9PA 3M7TA 2FESH 1TQ0B 1AUJA 1QCPA 2G51A 3KHVA 2VIVA 4BTUB 3O8BA 1L0ZA 1Z1IA 1TX8A 1G3EA 2WYJA 3ODFA 2H9TH 1GJ7B 2AGIX 2ODQA 3ZZCA 4H4FA 2BM2A 2A0QB 1W8BH 3VXFH 1TPSA 1G30B 2PUQH 3SO3A 5JYIA 1AB9B 1AIXH 4J1YA 3ZVCA 1QJ7B 3RXSA 3RXQA 8KME2 2HPPH 1P3EA 1O2VA 3D65E 3GYLB 1NFYA 1LHEH 4AOQA 2F9BH 4FXGH 3R0FA 5T3HA 3EA7A 3PLKA 1TPAE 1DM4B 3DT0H 2BX3A 5DP9A 3TGIE 2OC0A 4FUEA 1T8NA 1GBAA 2SFAA 1BBRE 5A8ZA 1AZZA 3SN8A 6GCHG 4WH8A 1NRRH 4NA7A 3RXBA 3TLOA 1BTHH 1C1UH 1MBMA 1LQEA 1UK4A 5GPIB 4ISIH 1UVOA 3RMLH 2DE9A 1BITA 4MTBA 3BEUA 3NPSA 4NA8A 5IDKA 2C8XB 2BDIA 5CE1A 3EAJA 1OP2A 2NU2E 2BTCE 1T31A 1TX7A 1Y3VA 4THNH 1W7XH 5A0CA 5L2ZH 3BTEE 3S9BA 2HNTC 1GI9B 4CRBA 2AGGX 1XUGA 1DWDH 1S84A 3SJOA 1SSXA 1OS8A 5EW1H 2FLRH 4F4OC 2EI7A 1GI4A 4DG4A 3HKIB 4CRGA 4CRAA 1V2ST 2D26C 1PJPA 2SGDE 1SLWB 1HUTH 2EC9H 2I6QA 4DGJA 1LQDB 2BY6X 2ZDVH 1AFEH 1XMNB 3NCLA 1NFXA 1UHBA 5JBBS 8GCHG 3BIUH 4OS6A 3HGNA 4NZLA 5DPAA 3TJNA 4U30A 3E3TA 1DY8A 4NSVA 4ZKRU 3OY6U 2Z9JA 1OWKA 4AZ2B 1KXFA 2ZGHA 3D23A 4BXSA 2FOCA 1SGRE 5E8EH 1ESBA 2ZNKH 1O5DH 3MNCA 4ZUHA 1AO5A 2EI8A 1IOEA 1H4WA 1SLVB 1NPMA 3PLBA 4YESB 2Y5GA 2HNTF 2QV1A 2AMQA 2FS9A 1OPHB 3FAOA 3IG6B 1GVZA 2BDBA 3SV8A 4NIXA 2ZFPH 1TPOA 3SI3H 1NRNH 1WQVH 4X6OA 1QB9A 4Y71A 1C1MA 1LCYA 4CREA 1GBEA 1FXYA 1IHSH 3T26A 4Z0KA 7GCHG 1M9UA 3OSYA 3SU2A 7ESTE 1C1WH 1G2MA 2H5DA 4Q80A 3SJIA 4ABGA 3GCHB 1C5RA 5AFZH 3TGJE 4AG1A 1TX6A 2Z3CA 1MMJN 3E0PB 4FU7A 3A8AA 1V2RT 1LDTT 2H9EH 2R3YA 1H8IH 1XXFA 3PROA 4LZ1H 5L6NH 4WF8A 2ZG0H 3BSQA 1Y3WA 1HAOH 1TAWA 4X2YA 4MNYA 4ABHA 2ZI2H 1P0SH 3S7HB 4I8KA 2QAAA 2C90B 5JDUB 1O2NA 4GAWA 2P8OC 3GCTF 4BXWA 1GJCB 4B75A 3S7KB 1O38A 1PYTD 1TA6A 3SHCH 1GI1A 1YLCA 1O2YA 1BMNH 2P3UB 2CHAC 1GHYH 1HBTH 2C8YB 4U01A 1HJ9A 2YOLA 4Q7YA 1P2KA 7GCHF 1WOFA 2ASUB 4IGDA 1K1MA 2G8TA 2W5EA 4WY3A 3GYMA 1TMUH 1T4UH 1S6HA 2YNAA 1P9SA 1HNEE 2ALPA 1LMWB 2V3OH 3PO1C 4MNXA 5HXFA 1NRSH 1UHBB 4BAOB 1HAVB 1O3AA 2ZEBA 5E0HA 1ELDE 2J95A 1GBHA 2TIOA 3M3VA 3BTHE 1MU6B 1EXFA 4QT8C 3TH4H 2TGPZ 4R0IA 1TMTH 4RKJB 3SOSA 2VH6A 1B5GH 1FPHH 4LK4A 1HAHH 2CMYA 3MI4A 1A7SA 3E6PH 1AN1E 1SGDE 1MTUA 1MZDA 2ZPRA 1AU8A 2PV9B 3L33A 2QC2A 1FMGA 3JZ2B 1C5VA 4MPXA 1NU9A 3ZYDA 3QUMP 3S9CA 1LHDH 8GCHF 2W3KA 4A7IB 1SGQE 2ZU5A 2BQWB 1O3BA 2BD8A 2DUCA 2XYAA 2WUCA 1GCDA 1DXPA 1WSSH 2C4FH 3LU9B 2ZKSA 3KNXA 2ZDLA 1LVOA 4AX9H 1BIOA 4ZAEA 1IQJA 1AE5A 2F9PA 1RTLA 3ATIA 1A3EH 1G3DA 2BZAA 1O34A 1MKWH 2XCNA 4NWKA 3TK5A 1MTSA 3UOPA 2ZP0H 1C4U2 4K2YA 1A1RA 3F6UH 3M35A 1B0FA 2QXJA 1G9IE 4DCDA 4DY7B 5C67A 2EA3A 3RDZA 1GJBB 3P95A 1OOKB 5FX6A 1TMBH 1DWBH 2BD3A 3PTBA 1FN6A 1YBWA 3UNSA 3MO9A 1D3QB 3S9AA 3SV9A 4D9QA 2OBQA 1GBTA 3OY5U 2XC0A 1GJ6A 1BQYA 1DSTA 1OWJA 5HGGA 2AIQA 2XRCA 4YOIA 1PPEE 2HOBA 5C1UA 2QA9E 1J16A 2ZFFH 1ELEE 1FN8A 1W2KH 2IPHA 2OUAA 1NRQH 3D62A 1BT7A 2A4RA 2ZCKP 1GBDA 3SUDA 1UTPA 4Q7XA 1EPTC 3P8OA 3LONA 1OWHA 1PPCE 3V0XA 2ANYA 3RXOA 1BHXF 3LOXA 3MYWA 3KQDA 1EZSC 2BVSH 1GI3A 2FOFA 1INCA 1ZMJA 3A82A 4K1SA 3GY4A 3RMOH 3E90B 1MTVA 3AW0A 1P2IA 1FY4A 3S0NA 1QURH 3I29A 1EZXC 1RFNA 2Z6BD 1MD7A 1WUNH 2EI6A 4DOQA 1ZSKA 1TNLA 1CHOF 1DVAH 5F8XA 2ZGCA 1BTYA 5GDSH 4JCNA 2CF9H 1VCPA 1O2WA 2CF8H 3A88A 1O3JA 3KGPA 4NSYA 5EPYA 1Z8IB 1UVUH 1D6RA 1CBWB 2FOHA 2GCHF 5FPTA 5EXNA 4INHA 1JRSA 1CU1A 1WCZA 2ZPSA 1MTWA 4B71A 3SNAA 1A2CH 1PQ5A 1H9LB 2BQ7B 1ZOMA 1GBMA 1G32B 2VIOA 2ZDAH 4JMYA 5FX5A 4A92A 5I25A 1C1RA 4CHAC 2OD3B 1DT2A 3BEFB 3Q3YA 1H1BA 1LKBA 1T4VH 3UIRA 5FPSA 3U8RH 2HRVA 2PLXA 1HAIH 1KIGH 4VGCB 1TWXB 1YPHE 1P9UA 3RXDA 4ABEA 1TOMH 3EGKH 2A5KA 1JXPA 3TH2H 1SQTA 1AD8H 1UTJA 3GDUA 1AUTC 2QY0B 1F0SA 1RIWB 4ISHH 3GY2A 1EP5A 1ID5H 1JOUB 1B0EA 1O3IA 2QF3A 3BTFE 3SU3A 3T27A 4A5TS 1ARBA 1P8VC 2FOGA 3TIUA 4AFQA 1VR1H 3C1KA 2BB4A 1MU8B 2J2UA 4FU9A 3UNRA 1GHWH 3URCA 4Y0ZE 4DJZB 1PPBH 3ODDA 1O2RA 3PLPA 1EJAA 1MKXK 4FUBA 5GIBA 2VVVA 2UWOA 1AB9C 5G4BA 1QFKH 1GI6A 4UFDH 3H7OA 1VGCC 3A87A 1S0RA 1SFIA 2BD5A 1TGSZ 1TNJA 8ESTE 3QWCH 3VFEA 3K2UA 3ZVEA 2HVXA 1FY5A 1BBRK 1GG6C 4BAKB 4GUXA 3PMJA 3SV2H 4A1VA 2ZFQH 4ISNA 4BNRA 2A5AA 4WVPE 2PSYA 3QTOH 2RG3A 1W10U 1S5SA 1K28D 1O5AB 2G5NA 1ZTKA 4GCHG 2FI5E 2O8MA 2BLOA 2BVRH 2BD4A 4K1EA 4X6PA 4FUJA 1Z8RA 2FDAA 1K21H 1O3FA 1ZMLA 1T8LA 1MAYA 1SLUB 3A89A 2D1JA 1TYNA 5DJ7A 3RP2A 4K69A 1TQ7B 1LPZB 1V2WT 1O31A 2XC4A 2ANKH 2ZDMA 1F5KU 5GCHG 3LGUA 2BHGA 2SGEE 1GHVH 3TITA 2ZHWH 4OGXA 2B9LA 1BA8B 3UPEA 1U6QA 1P2OA 2R0KA 1J14A 2PR3A 1N8OC 4HGCA 1WTHD 3GCOA 3SHAH 1JMOH 1XX9A 1DX5M 1BMLA 2TBSA 2WPKS 3N7OA 1Y3XA 1CA0B 1EZUC 1J17T 3CS0A 4K8YA 5FCRA 1O2GH 1PQ7A 3OU0A 1NFWA 2ZTYA 1GI5A 1ORFA 3BTQE 4MG3A 1SGPE 2OBOA 2AYWA 1O2KA 4I33A 1GMDG 5HYOA 1PPFE 2A7CA 1GI8B 2RA3A 4OS1A 2FIRH 1ZHPA 1O3MA 2GT7A 1FI8A 1Q2WA 1C5MD 2AMDA 1C2DA 2GZ8A 1OP0A 2OQUA 1Q3XA 3SGAE 2GDEH 1P02A 1HLTH 1HFDA 2BDYA 3RXRA 5LPFA 1ZMNA 3UTUH 2PHBA 3SU1A 3KL6A 1ANDA 4KELA 1C2GA 2FS8A 4RN6A 4FVBA 3MH4A 3BN9A 3UOUA 3ZZ6A 1NZQH 1AVGH 1CT2E 1XKBC 1Y5UT 2STBE 4X1NU 3WY8A 1QL7A 1ZPZA 1O37A 1QTFA 2I6SA 3U98H 1V2NT 3MNBA 4SGBE 3KF2A 4R8TB 1TRMA 4UFFH 3P17H 2ILNA 4ISOA 4KTCA 3QO6A 2FM2A 1NS3A 2D2DA 4X1RU 1K22H 1ELAA 1EX3A 1CT0E 1DPOA 1OXGA 2O8LA 3MTYA 1QRXA 5AHGH 1LKAA 1ABJH 3UR6A 1O3OA 1Z6EA 1ELGA 1A0HB 1GBKA 2TGDA 1ESTA 1ANCA 3M7QA 2XBXA 3A83A 2UUKB 3ATLA 2H6MA 3FP6E 3OYPA 1N6XA 3HATH 3KEEA 3LJOA 1EQ9A 1V3XA 4GHTA 2HWLB 3AASA 3EA9A 1O2PA 2XXLA 4I8LA 4B2AA 1PFXC 2XCFA 1UTQA 3QX5H 4X6MA 4K5ZA 4IMQA 3GCHC 1QR3E 1DDJA 2Z94A 7KMEH 4UD9H 2SGAA 3W94A 4NG9H 1PQAA 2Z9IA 1HAXB 4KP0A 2QIQA 2BZ6H 2RDLA 1QHRB 2ZGBH 3ENSB 3ZYEA 4AYYB 1P01A 1QY6A 1BTPA 1HXFH 1XM1A 2ZQ1A 4YOGA 2TPIZ 1AKSA 1UVSH 3R3GB 2A32A 1XKAC 5SGAE 4AFZA 3DUXH 3TGKE 2FOEA 1T32A 3RU4D 1TLDA 3SNBA 3SNCA 3EYDA 1HAVA 1XXDA 2XWAA 1HDTH 1YPLH 4UFEH 4X1PU 1UTKA 2BD7A 4F49A 5EQSA 3TNTA 4Y7BA 4SGAE 4NFEA 1BMMH 1RGQA 3QGNB 1TBZH 4FUCA 2K1QA 5C1XA 2FXRA 2VGCC 3BTWE 1V2PT 2J4IA 2OC7A 3EE0B 1AE8H 1VITG 2BDGA 3ZVFA 5FHTA 2ZU2A 2ZQ2A 1E34B 1GDNA 2FYRA 2ZHEH 1YGCH 2GTBA 2GDDA 1H9IE 2TRMA 2WV5A 2B0FA 5EPNA 2HPQH 2QYIA 4Y7AA 5ESBA 4X2VA 5DP3A 1C2EA 4ZHMU 2PGBB 5EW2H 5J4QA 1WBGB 4K60A 4NGAH 3SNDA 1QBOA 2A2QH 1MTNC 1HAGE 2FWWA 2LNCA 2PKAB 1D3DB 1DS2E 4X8VH 3SU4A 5A2MH 2G81E 2PKAA 1SLXB 4FUHA 1SGYE 1W13U 1GMHG 2Y5HA 2WPIS 2Y7ZA 1C5YB 3FVFB 3LDXH 3FP7E 1ZRKA 2FTLE 2NU0E 5E2OA 3U9AH 4IC6A 1SC8U 3A7ZA 3Q3KA 1WAYB 3DA9B 4AN7A 4O3TA 3NWUA 1D9IA 3GDSA 5A0AE 2Z3EA 3M61U 3W95A 2GT8A 2QCYA 4K1TA 1SFQB 2WV4A 3GDVA 4Y8ZA 2BY9X 2KAIB 1VGCB 1TRNA 2VINA 2PTCE 4TY6A 4KTSA 3SGQE 3SGBE 4WH6A 3ATKA 4XFQA 3V3MA 2BDHA 1J8AA 5C5NA 5I46H 1K1IA 1O33A 3L6PA 2O9QA 2W26A 1ANBA 1F2SE 1BHXB 2BY7X 2ZIQH 1BMAA 3SU6A 1V2TT 1SGIB 2FMJA 4K3JA 1IAUA 1HCGA 1W14U 1IQLA 2XBYA 1O2OA 3UR9A 4Y8XA 1BDAA 1UK3A 3P70B 4WXIA 1ELFA 2FOMB 1ZGIA 3QGJA 1LPKB 1LHCH 1BBRH 4AFUA 3MH5A 3HPTB 3LGVA 1C2MA 1GGDC 2OC8A 1T8OA 5TCAA 1MH0A 5FPYA 2ZU4A 2VWOA 3G01A 1PYTC 5IYTA 5JBAS 1AMHA 2JETB 3ZZ3A 3MFJA 3MNXA 4LXBH 1C5OH 1C1VH 2CXVA 1FZZA 1UCYH 2GKVE 1O35A 1FLEE 3SU0A 1G37A 4ZKSU 3O8RA 1DXWA 2GVFA 2QN5T 4Y79A 1HAPH 4MPVA 1GDUA 3B9FH 1O30A 1MCTA 5DP5A 5H4IB 4YOJA 3UY9A 2TGTA 2ZDNA 1FUJA 4YT7H 4O3UA 2FEQH 1NO9H 1SPJA