2CV3A

Crystal structure of porcine pancreatic elastase complexed with a macroclyclic peptide inhibitor
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
b'VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elastase 1
publication title Structure of the complex of porcine pancreatic elastase with a trimacrocyclic peptide inhibitor FR901451
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2cv3A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2cv3A01
1AFQB 1QBNA 5BRRE 3QGJA 2BY6X 1LO6A 1IQMA 3FFGA 1Z7KA 1LKAA 4R8TB 5DPAA 1DITH 5JB8S 1G2LA 3M3VA 2IOTA 1HIAB 1CA8B 2OCVB 3CP7A 3P8NA 4MNWA 1ZTJA 3KGPA 4OGXA 1E0FD 1K1IA 3ATLA 1THPB 2HALA 1OOKB 2PLXA 1WU1A 4H42U 1DUEA 1DWCH 2ZC9H 1JMOH 4ZXYH 6ESTA 1GI1A 1QRXA 1TRMA 1TRNA 1ZTLA 1UK2A 3SGAE 1K9OE 4XSKU 2R2WU 3A8CA 1FY5A 3E0PB 1BTXA 4GSOA 2VWMA 3A7VA 4Q7XA 1DFPA 1SHHB 3MU8A 2JETB 1VITG 1EB1H 3ZVEA 1GVZA 4NFEA 1GBAA 4B2BA 2Q6FA 2H1UA 2K1QA 1INCA 1ELAA 4WMEA 5GJ4B 3KQCA 1C5LH 1PPZA 3HKJB 2G51A 4FU8A 3SI4H 1EZQA 5EQRA 2TBSA 3LC5A 1T8LA 2VVVA 2ZFRH 3UNRA 2FP7B 1L4ZA 4J1YA 3DD2H 5GPIB 1P3EA 3RMNH 1TONA 2G81E 2ZHFH 3M61U 1ZGVA 1OWKA 3E90B 2VU8E 4X2VA 6GCHG 1FXYA 1V2WT 1XUFA 2ODYB 4WY3A 3QK1A 1SBWA 3SGQE 4U32A 4FUGA 1NY22 1WAYB 2GCHF 3TJOA 1B0FA 1FV9A 4DGJA 1LDTT 2ANMH 1O3AA 1OSSA 1S82A 3SU1A 1O5FH 2FOAA 1P2OA 1C1OA 4YESB 7GCHF 1V2PT 1EZUC 1UJ1A 2PV9B 3P95A 2W7SA 1KY9A 2XNIA 1NFWA 1YC0A 3K6YA 1NFUA 3HGPA 1DLEA 1GMHG 1LHCH 1EZXC 1P2QA 1MTWA 1SQOA 2PTCE 2GMTC 3MH7A 2A0QB 3B8JA 1FZZA 2XBWA 1J14A 1C2GA 1YPKH 1Q3XA 3ZZ4A 4I7YH 5TCCA 1J16A 4FUBA 1GHAG 2B8OH 4JMYA 3ATWA 3QTOH 3GCHC 2A2XH 3TH2H 4FUFA 4BAKB 3LONA 3F9GA 1SGQE 4CRBA 1EPTA 1VCPA 1UO6A 4FUDA 1W2KH 2PW8H 2WV5A 1J9CH 2PUQH 1PYTD 2UWLA 1C1MA 1OP2A 2QGRA 3M5NA 1AVWA 4H6TA 4AB9A 1DANH 1BBRE 4YTAA 1NFXA 1KXFA 1DWEH 1C5OH 2P59A 1LQEA 2G00A 2XBYA 5BPEA 5FPTA 3ZYEA 3RXDA 3A86A 3ZVFA 1ANEA 1ETRH 1TGBA 1UTOA 3STJA 1NS3A 3G01A 2ZDNA 2TGTA 2Z9GA 1S84A 2D2DA 5EOKA 3MNXA 1FY3A 3RXVA 1FIZA 1H4WA 3MU4A 6CHAC 2BD4A 3E8LA 1HRTH 3GCTG 1GJDB 2OP9A 1HLTH 1SR5C 1LVBA 1MCVA 3SW2B 4INKA 1YLCA 1BMMH 1LHEH 3M7TA 1RXPA 2ZGXH 1EAUA 1EX3A 1D4PB 1CBWC 1TYNA 1ETTH 2BY8X 4ISIH 4Y7AA 2RG3A 2F91A 1LKBA 1QRZA 3RXIA 2FYQA 1AU8A 4BAOB 1UTQA 2VIDA 4KKDA 1HBTH 1ZSKA 3URDA 4I8LA 1YPHC 5JPMH 1T8NA 4NIWA 4Z0KA 1O2OA 1DDJA 3P6ZB 2GX4A 2P93A 4TY6A 4IMZA 2BX4A 5GWZA 1TOMH 3EGKH 1H1BA 2VH6A 2UUFB 1UTNA 4YOGA 2XRCA 2BDYA 5EXMA 3W94A 1VCQA 3O8BA 5K7RA 3TK6A 3F1SB 1XKBC 1UMAH 2ZKSA 1ELVA 1RIWB 3BTKE 1S0QA 4RKOB 5CMXH 5L2ZH 4DJZB 2QXJA 2XXLA 1P2KA 1V3XA 1TBQH 1GHBG 4X6MA 2VVCA 3KHVA 3SNAA 4CRDA 1AN1E 1C2JA 4ZMAH 3VGCC 2Y81A 1O3GA 4FUCA 4JYVH 1QA7A 1FY1A 2AIPA 1NO9H 5E0HA 1CHOF 1Z6EA 2HGTH 3VEQB 1GHWH 2ZU2A 1GJAB 1UTLM 3CS0A 2BD5A 1C1PA 2Q6DA 3MU0A 1HJ8A 1V2JT 2F3CE 1JRSA 4BAQB 1O2NA 4K5ZA 1ESAA 1YCPK 3A82A 4AOQA 1ZPZA 3PO1B 5EXNA 5F8XA 1XUIA 4TWWA 1Q31A 1O0DH 2H6MA 1TPOA 1GHVH 2SGAA 5C5NA 3UOPA 2GDEH 2Y6TA 1LMWB 2IJOB 1HAZB 4KTSA 2ZHWH 1A0LA 1DLKB 3MNCA 2HNTF 1O2MA 1A3EH 1WBGB 1QGFA 3GOVB 1MKWK 3SUFA 1BRBE 1YM0A 1P02A 2H2ZA 2ZDLA 5T6FA 1XUHA 2PKAB 1MD7A 1XMNB 1AVGH 1P9UA 5E2PA 3E6PH 4H6SB 3ENSB 2BDBA 1FMGA 3GYLB 1SB1H 2P8OC 3BTFE 1QA0A 4Q2KA 5J4QA 4FVBA 1EUFA 1HB0B 1GI7B 1K1JA 1P2JA 3ATIA 5JYIA 2FESH 3A7ZA 4AFSA 1OX1A 1OYQA 2ANYA 2ZGBH 3LH1A 1YYY1 3U8RH 2BVRH 4MPUA 4FVDA 1MTVA 1HFDA 3LC3A 2OC1A 1KXCA 1BTUA 2H9EH 3BIVH 4RKJB 1QL9A 5A8XA 3SU0A 3ATKA 3ZVCA 1TNJA 1O2IA 4JK5A 3PMBB 4NG9H 3MO9A 1KDQB 1BTPA 1ANBA 2Z3EA 4TPYA 2NU0E 2TGAA 2UWOA 3VB5A 1N8OB 2LPRA 1EJMA 1YBWA 5EODA 1B7XB 3V13A 3M5LA 1NROH 3QO6A 4ZROA 1KLJH 1MU8B 2CV3A 2BD7A 2BLOA 1TX6A 3NCLA 1CO7E 3GY4A 3FAOA 2QYIA 2XCNA 3TJVA 1YPEH 5DJ7A 3SUDA 5FBEA 2QAAA 3SO3A 2O8TA 2GCHG 4WWYA 4BANB 1IQJA 3E1XB 1GJBB 4UEHH 1Y5UT 1EPTC 4JCNA 1FLEE 2P94A 1UHBB 1CQQA 3Q00A 3ZVDA 3BTDE 5JDUB 2ZDMA 3QN7A 4HTCH 7GCHG 2QC2A 2H5CA 3SQHE 1ZJDA 4ZAEA 4CRGA 1EOJA 1XM1A 4A92A 3UNQA 1V2OT 3RMLH 4VGCC 4UE7H 1ZJKA 1P10A 1QR3E 2GV7A 1NESE 2CF8H 2BQ6B 2ASUB 2G55A 1DXPA 2SNWA 1GI3A 4CRCA 3TGIE 1YP9A 4B71A 3VPKA 3UUZA 1ZRBA 1UVPA 2FI5E 5PTPA 2DE9A 1P57B 2Y5GA 4JZDH 1E36B 1GI6A 4LZ4B 4INHA 3AVZA 1A3BH 3MO6A 1LTOA 1IQHA 1V2MT 1HUTH 2A4GA 2A5KA 4B2AA 5C67A 1NRRH 1P05A 3OY6U 4MQAA 1BIOA 2NU2E 5SGAE 1T8OA 2YOLA 4FUJA 3SJIA 4OS1A 4D76A 5HM9A 1C2HA 3GCTF 1YPMH 1ZHRA 3DFLA 5JBBS 1O3DA 1EZSC 2BY9X 1FUJA 1NRSH 1L2EA 5CE1A 1TA6A 3LGUA 4MPVA 3S9BA 4O3TA 5EW2H 4YZUA 1DXWA 2ZWLH 4BTTB 3K65B 3M7QA 1MAXA 1ABJH 2SNVA 2ANWA 4I33A 5E0GA 1K28D 4AN7A 3UR9A 3P17H 2FPZA 4A6LA 6CHAB 5TJXA 1Z8JB 2W7UA 1KXBA 5GCHG 3SV6A 1MH0A 1YPHE 2AMQA 1S83A 3H7TA 3MMGA 4NFFA 3TU7H 1AFEH 2ZO3H 3T2NA 4X1QU 1W8BH 2OC0A 5I46H 1CBWB 1PQAA 1ZZZA 3JZ1B 3VFEA 1RTFB 2VIVA 3GYMA 1ZMNA 2ZCKP 3ZZAA 3EE0B 2ZDAH 2AH4X 1OP0A 4MDSA 4CREA 5A8YA 4Y7BA 1W13U 3Q77A 1DS2E 2SGDE 3UY9A 1BJUA 4Y6DA 2ZQ1A 4BTIB 5E8EH 4AFZA 1NM6A 1GJ8B 1GJ5H 1S5SA 4INLA 2XC4A 1W10U 3VXEH 1UVTH 1GDNA 1W12U 4OS5A 4IW4E 3RXHA 1GHBF 2WPJS 1SPJA 1OKXA 2ZA5A 2ODPA 1E38B 3IG6B 4IN2A 3KCGH 2CHAB 1V6DA 1LCYA 1QURH 3LGWA 1P2NA 3LJOA 1IQKA 1MKXH 1V2NT 2Y7XA 3MHWU 4X8UH 3NPSA 1HCGA 1SGFG 2F9VA 1GGDC 2BDIA 1GG6C 3ESTA 5HM2A 2ZGCA 4B2CA 2ZTXA 1HXEH 1Z8RA 5L6NH 2Z9KA 3VXFH 4KP0A 4NA8A 2GZ8A 1O36A 1O2YA 1A2CH 3T29A 3VGCB 4DIHH 5FCRA 1ETSH 1GI2A 4B75A 3S9CA 4LZ1H 2QF3A 2RCEA 2ZTZA 1FAKH 4WMDA 1CHOG 5GIBA 1O3PB 1C5WB 1MKWH 3CENA 1QNJA 4O97A 2PGBB 3AW1A 3TK5A 2CMYA 1MD8A 2A7JA 2GVFA 1HAXB 4JYTA 1UTPA 1ELGA 2AMDA 2D1JA 4LOYH 3NUMA 1WQVH 1O2HA 1ZYOA 3LIWA 4LXBH 3I77A 3L33A 3TPIZ 3KL6A 3EAJA 1CGJE 4X8VH 4ZHLU 3SN8A 2Z3CA 2FTMA 4E06H 3PMAB 5JB9S 1O3EA 3U8TH 4F4OC 4ZKRU 3C1KA 4Y71A 5C2ZA 2VNTA 1P2MA 1ZLRA 2VWLA 3LH3A 3TNSA 4I8JA 3NWUA 2ZPSA 1C2MA 1LVOA 1XVMA 1V2UT 5C20A 1A4WH 1NC6A 4ISLA 1A0JA 1OP8A 3MH6A 4JZEH 4CHAC 4NWKA 4B73A 4CRAA 2P8OB 5FX6A 2QCYA 3F6UH 4K3JA 2QXHA 2ESTE 1FNIA 1HXFH 4XFQA 1H9HE 1H8DH 1TPSA 2G5VA 1AZ8A 5CHAC 1O34A 2C8WB 1N8OC 1SSXA 2F9BH 1GL0E 1O5BB 4NA7A 3GICB 1C1RA 1TMUH 1TFXA 1OYTH 1T8MA 1DT2A 4WXIA 1C5YB 2D26C 1F5RA 5EPNA 1O2LA 1GBEA 4B1TA 1AUJA 2Z9LA 1O5CB 4ZHAA 1SGCA 1Y3XA 3SQEE 1GBDA 3L6PA 1D6WA 3SHAH 5HYOA 1Y5BT 2GKVE 4FU9A 5GDSH 1RFNA 3E0NB 1O35A 1YPJH 3NK8A 4MNVA 2FOHA 2XBVA 1QL7A 2Z9IA 3P70B 1KTTB 4A1XA 5EPYA 5C3NA 3AAVA 1SGFA 4IMQA 1T32A 1ZMLA 4K1SA 1QTFA 2Y5FA 3MNBA 4NZLA 1A61H 1UVOA 1C9TA 2G4TA 1G3CA 1O3OA 1CT2E 1NTPA 1QJ7B 2ZDKA 3BN9A 3RXJA 4WVPE 1GJ6A 7KMEH 1QB6A 2KAIA 2V3OH 3T26A 4X0WU 1J15A 1EJAA 1EPTB 3ZVAA 4TYDA 4THNH 2BDAA 2R3YA 3MNSA 2VINA 4GCHF 2C93B 3GCOA 3V3MA 1BHXF 1BTHH 1GVLA 5IYTA 2XWBI 1O5DH 2FI4E 2A1DB 4IBLH 1V2QT 1KTSB 1TGSZ 4FU7A 3GY7A 5C5OA 4U2WA 4VGCB 1Q2WA 1HAVA 3M3TA 1SQTA 1WCZA 1GJ7B 1A7SA 3B23B 4ZXXH 2ZCLP 3LOXA 4I32A 3M5OA 3GY3A 5A0AE 1ELCA 4DIIH 1BTYA 1GMCF 5J4SA 1SGIB 2FIRH 2A5IA 3RMOH 1TQ0B 1Z71A 1J8AA 3FZZA 1BZXE 1AVXA 2A2QH 3SORA 1CVWH 4IC6A 3U9AH 1VITH 3UQVA 3C27B 4ISHH 2G52A 3M35A 4AFUA 1WTGH 1GCTB 3RXGA 1Z8GA 2BY7X 1S6FA 3HK3B 2BZAA 2CJIA 3AASA 3TH3H 5LGOA 1T4UH 5A2MH 4R0IA 4DY7B 5DG6A 1MQ5A 2A32A 2NU3E 1NRPH 5L30H 1PPEE 3SOSA 4O9VA 4ZKSU 1L0ZA 1V2RT 3A89A 5GCHF 1DVAH 1NU9A 4K8YA 1DPOA 3U8OH 1HDTH 2FOCA 4XE4A 2ZHQH 2FLRH 4K8BA 2FX6A 5FXLA 1FPCH 5A0BA 1YF4A 1YPGH 2O8LA 3A87A 2Z3DA 5FAHA 2BTCE 1MQ6A 5FCKA 1CSOE 4YLUA 4UFFH 3BEUA 2AGEX 1Y5AT 2WYJA 2AGGX 3QGNB 1W11U 4ISOA 4OS6A 3UFAA 1TQ7B 1FN6A 2PGQB 1AI8H 2Q6GA 1GJCB 1HAPH 2TGDA 3U98H 1C5VA 1E35B 2ZGJA 2CN0H 4ESTE 3ZZ3A 4D7FA 3BV9B 1YCPM 4GHQA 3KN2A 1VR1H 2R3UA 3GY2A 3GISB 5DKMA 1QB1A 4A5TS 1OS8A 3QZRA 1Y8TA 1AUTC 2C8XB 2F9PA 2VGCB 2OUAA 2BVSH 1Y3VA 2UWPA 2B9LA 2C90B 1P11E 1ELTA 1PQ5A 4XBBA 5EGMA 2CHAC 3RM2H 3ATMA 2G8TA 4ABFA 2V6NA 3E16B 4ABAA 4NGAH 2VWOA 3RLYH 6LPRA 1O2GH 1P0SH 1CA0B 4I8KA 4Y8YA 2HPPH 5DP4A 4ZKOU 2WYGA 3PB1E 3TNTA 1ZPCA 5F8ZA 3B9FH 1ACBE 2ZFFH 1KSNA 4Y11E 1A5IA 1GBTA 5EU8A 4GLYA 2VH0A 4X6OA 4D7GA 3UWIA 1MTUA 8LPRA 2WPHS 3RXBA 3T28A 2C3SA 3A80A 1G3BA 1DM4B 1GGDB 1GG6B 1MKXK 2ZTYA 4E7RG 4OS7A 2ZECA 3SNEA 1MBQA 5TCAA 1WV7H 2FTLE 2JH5D 2ZF0H 2BLVA 4CBOA 4AYVB 1GBKA 4K69A 3M5MA 3AW0A 1Z1IA 4NSYA 2H9TH 1O3NA 2QF0A 3FVFB 3V7TA 4WMFA 1TGNA 1HJAC 1IQLA 3A85A 1HYLA 1BCUH 2SFAA 3P8FA 1CT0E 1PPBH 2OBOA 3E3TA 4KTUA 1NFYA 1YPLH 3UNSA 1HAOH 1TAWA 1KLIH 1C2KA 1FI8A 1VGCB 2OINA 3BF6H 3P8GA 3OYPA 5DO4H 1E37B 4IC5A 3ZZ5A 2ZP0H 1OWIA 5DP3A 1O32A 4AYYB 1BTWA 5C1XA 2GCTC 2TRMA 1H8IH 1MUEB 2EI7A 4E05H 1THRH 2C8ZB 4K60A 5EW1H 3RXSA 1TBRH 1D3QB 1BITA 2ALPA 2J94A 1AKSA 3RXUA 3EYDA 2AIQA 3HGNA 3KEEA 4AZ2B 1A5HA 3RXTA 2Z6BD 1PPCE 4JZ1A 1Y3YA 2BDHA 1DE7H 1THSH 3ZV8A 1ID5H 2BLWA 4GAWA 2BDGA 1GBCA 3HK6B 1O5EH 2SGPE 1W3CA 1DWDH 1Y59T 1O2KA 2FS8A 1AD8H 4CHAB 1GBLA 1TX7A 1GBJA 3BTME 2JH6D 1O2RA 3TJNA 4BXSA 1ZOMA 2B0FA 1SGNE 1O2PA 3SJ9A 2TIOA 5EQSA 1ANDA 3GY5A 1O2QA 3SJKA 1DX5M 2FOMB 3RP2A 2FODA 5CHAB 3A84A 2CF9H 4ISNA 3URCA 1DSTA 3STIA 1DICA 1NN6A 3A8BA 4AG2A 3R0FA 4QT8C 3S69A 1QY6A 3EA8A 3DFJA 1YLDA 3RXCA 2VJ1A 4WH6A 2PKSC 4DOQA 3A7WA 4IS5A 3TITA 3K6ZA 1AZZA 1QIXB 2BHGA 1IQFA 1BT7A 1SLUB 1N6XA 8ESTE 2QV1A 3MH5A 4H4FA 1A1RA 3RXPA 1YKTA 1SGPE 1A5GH 1HGTH 3TH4H 1OWDA 2TPIZ 2HVXA 1JWTA 1SGDE 1ZTKA 1DSUA 5A09A 2RDLA 2ZU3A 1UK4A 2PSXA 4NA9H 2BVXH 2RA3A 3HATH 3IWMA 1G9IE 2BD3A 3PLBA 1FQ3A 1G3EA 1P06A 1AMHA 1TRYA 2HNTC 1TABE 2BD8A 2B7DH 4X2WA 1FY4A 2QY0B 1AB9B 1F7ZA 4GCHG 1UTJA 1HAGE 4XBCA 1NRQH 4GVUA 2V35A 3LT3A 1EKBB 3QWCH 3PYHA 1F0SA 1PJPA 1XKAC 1ZGIA 2OC7A 2DE8A 2EEKA 4FUIA 4IN1A 2O8WA 4YT6H 1GCTC 1O2XA 2QA9E 1EAWA 1ZRKA 2BZ6H 2CXVA 1Z8IB 1SGEE 1XX9A 2UUKB 3BSQA 1GMCG 4BOHA 4JK6A 4BNRA 4FUEA 2XCFA 2Z94A 2GV6A 4X2YA 1MU6B 4MVNA 1GWAA 2PTNA 2J34A 5AFYH 1A0HB 4K1EA 1TNHA 4RSPA 1SLXB 2ZCHP 2SGEE 1EJNA 2BOHB 2FOFA 3BEIB 1QCPA 2OQ5A 1C1SA 4Y79A 3MU5A 1S0RA 1EAIA 1GL1A 3ZVBA 2BD2A 2I6SA 3SGBE 3RU4D 3CS7A 3A83A 2XW9A 3HPTB 4CH8B 9LPRA 4GHTA 1SQAA 3GY6A 3ITIA 3QDZB 2BDCA 1O2JA 1QFKH 3MH4A 3SBKA 3MYWA 4AORA 3SNCA 1K2I1 1K1LA 1C5ZB 3O8RA 3ZZ9A 3UTUH 1WUNH 1L1JA 1NRNH 4XBDA 2EI6A 4Q7YA 1GJ9B 3F9FA 2VGCC 2Z7FE 1S85A 8GCHF 2THFB 4NIVA 1JIRA 1BMNH 3SU3A 1O2ZA 5AFZH 2FM2A 5E2OA 1WOFA 3SU4A 4D9QA 5EXLA 1O38A 2FOGA 2FLBH 4SGAE 3TJUA 1ZHPA 1K1PA 3BTGE 1BBRK 4Y10E 2YNBA 1CA0C 1SG8B 2R2MB 1CHGA 2EA3A 1P8VC 2GP9B 4HI3A 1O3BA 5ESTE 1AO5A 2AEIH 1EOLA 1P3CA 3RXKA 3TK9A 1GI9B 1RD3B 2FO9A 2ZPQA 1BRAA 2STBE 1D3DB 1P9SA 2OLGA 1V2TT 4UFDH 4ABJA 4ASHA 3AAUA 1N6YA 3A8AA 1ZHMA 1ELEE 4DW2U 5L2YH 4YOIA 1D3TB 1BRCE 1UCYH 3PLPA 1TPAE 1EP5A 4MNYA 1H9LB 2R0KA 1EXFA 1ARBA 3VB7A 1DUAA 4UD9H 4XOJA 3RXEA 2NU4E 1F0RA 3EQ0H 4DURA 1O3MA 2CGAA 2FYRA 3OY5U 3KQBA 1AHTH 1O3IA 1ORFA 1F5LA 1SC8U 4NCYA 1G30B 1TE0A 2FI3E 4GPGA 1ZSJA 4U30A 1VGCC 1S6HA 3K9XB 1JOUB 3KNXA 1PPGE 1EP6A 1AQ7A 1G36A 4ABGA 5DP9A 2GGVB 3QZQA 3UREA 3QLPH 2ZDVH 3DT0H 3SZNA 2VIPA 1NU7B 3V0XA 1C5TA 4BAHB 1HJAB 4JZIA 2F9NA 4K1TA 1CE5A 2WPLS 3Q3KA 1IHSH 1QJ1B 1K22H 2J9NA 3ODFA 2IPHA 4OS4A 1P09A 1SFIA 4F49A 4U01A 3BTQE 4WF8A 3H7OA 1FN8A 4KGAA 1O2WA 1ZPBA 1P2IA 2BYAX 2OBQA 3OTJE 3Q76A 1VJAU 2GCTB 1X7AC 1T7CA 5FPSA 2A31A 1PFXC 1H9IE 1QBVH 4X1NU 4BAMB 5DK1A 3TLOA 2Y7ZA 3MU1A 4XDEA 3LKWA 1XUGA 5DP5A 5HGGA 1G2MA 1C2FA 2GZ9A 4J2YB 5JBTA 1HIAA 4NIXA 2R9PA 5LH8A 7LPRA 1AGJA 2BX3A 1Y3UA 1C5SA 8KME2 1ANCA 4AB8A 1KXAA 1CGIE 1T4VH 1RS0A 1CGHA 1O2TA 5FBIA 1SLVB 1W14U 2JKHA 4Y8ZA 3RDZA 1O37A 3VB3A 3JZ2B 3SNDA 1A46H 5FPYA 1TGTA 2ZU1A 4I8HA 2HOBA 5FX5A 2WPIS 3UWJH 3MWIU 1UK3A 1HAHH 1RRKA 3A7YA 5HXFA 3SJOA 2P3UB 5F6MA 2ZIQH 2KAIB 2A5AA 2ZQ2A 3I78A 4ABIA 3A81A 4NWLA 1TBZH 1GJ4H 2PKSB 1TX8A 3D65E 3RXLA 1AIXH 3ZZBA 3QX5H 3BTEE 1L4DA 3SV9A 1C2DA 5G4BA 1C1UH 3ZYDA 9ESTA 2WINI 3SUEA 2Q1JA 4UONA 2Y82A 2FS9A 1KYNA 2BOKA 3D62A 3VB4A 2HNTE 1O39A 1JXPA 3ZZDA 3WY8A 2OXSA 1HAVB 1ESTA 4LK4A 1JRTA 1QJ6B 1CT4E 1G37A 3SU2A 4E7NA 3S0NA 1TMTH 1TNIA 4JYUH 1LVMA 3RUOA 3M37A 3OSYA 1SL3A 1GDUA 2VWNA 1M9UA 1AB9C 1ZR0A 1C4Y2 3PMHB 4WH8A 4CBNA 2AGIX 4RN6A 4X8SH 3RU4T 2DUCA 2P3FH 1O3FA 1TB6H 3LGVA 1O3KA 2P3TB 3F9HA 1BJVA 2A45B 2H9HA 1F5KU 2C4FH 2PWXA 4ZKNU 1LHGH 4ABDA 3LJJA 3QTVH 3RXFA 3UOUA 1DWBH 3U1IB 3SUGA 1C5QA 5EQQA 2AS9A 2VIQA 3KQDA 3ZZ8A 2VB0A 3H5CB 2ZFSA 4MTBA 1TNKA 1TOCB 4K2YA 4ABHA 2WPKS 3M36A 2AYWA 1O30A 3V12A 3A8DA 4DCDA 1C2LA 1BA8B 1BQYA 2B5TB 1V2KT 4TPIZ 5DP6A 4I8GA 1ELFA 1TLDA 5AHGH 1KIGH 1Z1JA 5DP7A 1GI0A 1GI8B 4HFPB 4Y0YE 1IQIA 3BG8A 2QN5T 1HAIH 4AGJA 1FAXA 1D3PB 2XYAA 1RTLA 4PROA 1BMLA 3BIUH 1DY9A 2RA0A 4Q7ZA 2NU1E 3T25A 2HLCA 4O3UA 3ZZ7A 3MFJA 4A7IB 1SHYA 3ELAH 4HGCA 4O03A 2P16A 1F92A 3LU9B 1BMAA 2W26A 1FJSA 4X2XA 1IQGA 1MTNC 1VJ9U 1HPGA 1RJXB 1JIMA 4Y8XA 1EQ9A 1BDAA 2ZG0H 1SFQB 5DGJA 3EDXB 1AE8H 4Q80A 1MTSA 2WUCA 1XUKA 1F0UA 3UIRA 1MZDA 1W0ZU 5FHTA 3QUMP 1TMBH 3DHKH 1LVYA 2C8YB 3LGIA 3W95A 2ULLA 4AGKA 3SV8A 1C1TA 1UTKA 1BBRH 1C5NH 1PQ8A 2ILNA 4MPXA 3RXQA 2ZPRA 2GT8A 2R0LA 2BY5X 3S7HB 4CH2B 3RU4E 2FDAA 2JH0D 2ZU4A 3P8OA 3PV4A 4BXWA 2PFEA 4DT7B 1PYTC 2V0BA 3GY8A 3ZZCA 5A0CA 8GCHG 5EG4A 3UPEA 4YM9A 3EA9A 1F2SE 3SV2H 2F9OA 2SGQE 5E0JA 1IQNA 2G4UA 1SOZA 1SLWB 1O2SA 1LPZB 5C1YA 2WV4A 1QL8A 1C4V2 3A88A 3TGJE 1G3DA 3ZVGA 3BG4C 1SGTA 4KELA 3MOCA 3N7OA 1HV7A 1BRUP 3MO3A 1K21H 1GMDF 1SGYE 2XWAA 1GPZA 3KIDU 1C4U2 2ZFQH 2XC5A 3PROA 3MTYA 2UUYA 1GVKB 5GXPA 1ABIH 1V2ST 1V2LT 4X8TH 4YLQH 1GCDA 1MZAA 5LPEA 1BB0B 3LGYA 1MCTA 1UTMA 1KXEA 1LPGB 1MMJN 1O31A 3FZDA 3SU6A 2PHBA 1U6QA 1IHTH 3BTTE 4A1VA 1O3JA 2ALVA 2O9QA 2ZGHA 1UCYK 5IDKA 2VVUA 1FONA 3RLWH 4ABEA 2SGFE 1SVPA 4M7GA 1AFQC 1QBOA 3D23A 1LHFH 2J2UA 1UVSH 2AERH 1AKSB 1AE5A 2M5TA 4A1TA 2I6QA 4AFQA 5JBAS 1GBFA 4D8NA 2G5NA 1ZSLA 2EI8A 1GI5A 3T62A 4Y76A 1TALA 3A7XA 3BTHE 1C5MD 3SJ8A 3VB6A 1V2VT 7ESTE 1S81A 3PMJA 2ZU5A 1MBMA 1C5RA 2A7HA 3RXMA 1EAXA 1K1OA 1OPHB 3S9AA 1GBIA 1UVUH 2STAE 3FANA 2VIOA 3F9EA 1CU1A 2Y80A 2QXGA 1GI4A 2W3IA 1B5GH 5JBCS 4MLFB 4HZHA 4NSVA 1P01A 3M7UA 3FP7E 3S7KB 4AG1A 1VITF 1OWJA 3Q3XA 5T3HA 5F03A 1L1GA 2AMPA 3TIUA 3T27A 2JETC 1E34B 5ETXA 3FP8E 1IOEA 2VIWA 4UFGH 2BQ7B 3KF2A 2OC8A 1O5GH 2OQUA 1T31A 2A4OA 2F9UA 1XXFA 3RC4A 4DG4A 3RC5A 2PKAA 1ARCA 3DA9B 2O8MA 4TY7A 1SGRE 2BXUH 1YGCH 2WPMS 3GDUA 1GHZA 5DP8A 3TGKE 6GCHF 1XXDA 2D8WA 1QB9A 3SHCH 1O3LA 2PUXB 2XTTB 3GCNA 3SU5A 2F83A 1Z6JH 3FP6E 4NZQA 2BLQA 2UUJB 5B6OA 1ESBA 1C2EA 1OWHA 5T6DA 5H4IB 3PWBA 3UR6A 4YOJA 4MG3A 1TNLA 2BXTH 3I29A 1PQ7A 1XVOA 4BTUB 2V3HH 1NPMA 5A8ZA 1KDQA 1FDPA 1QRWA 1K1MA 3UQOA 4ZH8A 3KQEA 1GMHF 3ODDA 3PWCA 1AY6H 1TA2A 2PR3A 4B74A 1O33A 3LPRA 4NIYA 1AWHB 1EATA 1ELBA 2A4QA 2J38A 1TNGA 2EC9H 1WYKA 2FX4A 1GHYH 4X1PU 4D9RA 1C5PA 1RGQA 1W7GH 1PPHE 1GHAF 3U1JB 1FY8E 1FIWA 3GDVA 4Y0ZE 1IAUA 1HJ9A 4SGBE 3RXOA 2J4IA 4KTCA 1QQ4A 2IN2A 5ABWA 1TWXB 2J92A 2OD3B 3M3SA 4B76A 1WTHD 1PPFE 2P95A 2GMTB 3L3TA 4I31A 2OTVA 3PTBA 4CR9A 1UHBA 4WXVA 3E91A 1HAYB 1O3CA 4X1RU 3LDXH 3RXRA 3SI3H 1QQUA 4GUXA 3ZV9A 1LQDB 1O3HA 4OS2A 1O5AB 1C1VH 3GCHB 1VZQH 2HPQH 3BTWE 3LGTA 1O2VA 3PM3A 5F8TA 3NXPA 3SNBA 4IGDA 1G32B 3RMMH 4WJG2 4TWYA 2FOBA 2FEQH 1ZMJA 2A7CA 2H5DA 2J95A 2PSYA 2GZ7A 3MI4A 4YT7H 1OWEA 3GDSA 1AWFH 2AFQB 2ZI2H 1BUIA 2ZFTA 3DUXH 2ZNKH 4UDWH 1TIOA 1RTKA 3R3GB 2BB4A 1GDQA 2BM2A 4X6NA 1C9PA 4ABBA 2FMJA 4DVAU 1C1NA 2GD4B 2FWWA 1W0YH 3PTNA 2HRVA 3P92A 1N1LA 3RC6A 1C5XB 1EB2A 1C1WH 1MTNB 1B0EA 5ESBA 3OX7U 5AVDA 2FOEA 4X6PA 3T5FH 2HWLB 1LHDH 3F68H 1TGCA 4AX9H 2Z9JA 2ZHDA 1NZQH 1C5UA 1K1NA 1LPKB 1WQSA 4CR5A 2WUBA 3A7TA 3ZZ6A 4OGYA 1UCYE 2ZFPH 3NZIA 3OU0A 4Z6AH 1F0TA 1TPPA 2O8UA 2QXIA 4FUHA 3BEFB 2A4RA 3HKIB 1BOQA 3D49H 1VCWA 5C1UA 3IITA 4ZHMU 1GBMA 1EASA 2GDDA 2W5EA 1SOTA 2FXRA 4UFEH 3O8DA 5K0HA 2ODQA 5AF9H 3U69H 1DY8A 1GBBA 1IQEA 3K2UA 1KLTA 1D6RA 1SMFE 3Q3YA 1XUJA 1NT1A 2Y5HA 1BHXB 2NWNA 1P12E 4MNXA 1JBUH 1D9IA 4FXGH 2ZZUH 4YO9A 1MAYA 3O8CA 5T6GA 2BQWB 4ZUHA 2XBXA 2FZZA 3TVJB 3BG4B 4MPWA 1RIWC 3RXAA 3SV7A 2GT7A 1KXDA 2QIQA 1BTZA 1GHXH 1J17T 2ZHEH 1W7XH 4CRFA 5I25A 2ANKH 1GMDG 1C2IA 1SI5H 5HMAA 1QHRB 2LNCA 2TGPZ 3EA7A 1P04A 2YNAA 1O2UA 2ZEBA 1YCPH 1GBHA 3NKKA 4X1SU 1Y3WA 3RM0H 1FPHH 1C1QA 2W3KA 2BD9A 1P03A 4JZFH 1OXGA 1DOJA 1ELDE 2XC0A 3PLKA 5LPFA 1WSSH 1L1NA 1HNEE 3PO1C 2GTBA 2BMGB 5LPRA
chains in the Genus database with same CATH superfamily
1AFQB 1QBNA 5BRRE 3QGJA 2BY6X 1LO6A 1IQMA 3FFGA 1Z7KA 1LKAA 4R8TB 5DPAA 1DITH 2K0QA 5JB8S 1G2LA 3M3VA 2IOTA 1HIAB 1CA8B 2OCVB 3CP7A 3P8NA 4MNWA 1ZTJA 4P02A 3KGPA 4OGXA 1E0FD 1K1IA 3ATLA 1THPB 2HALA 1OOKB 2PLXA 1WU1A 4H42U 1DUEA 1DWCH 2ZC9H 2KCAA 1JMOH 4ZXYH 6ESTA 1GI1A 1QRXA 1TRMA 1TRNA 1ZTLA 1UK2A 3SGAE 1K9OE 4XSKU 2R2WU 3A8CA 1FY5A 3E0PB 1BTXA 4GSOA 2VWMA 3A7VA 4Q7XA 1DFPA 1SHHB 3MU8A 2JETB 1VITG 1EB1H 3ZVEA 1GVZA 4NFEA 1GBAA 4B2BA 2Q6FA 2H1UA 2K1QA 1INCA 1ELAA 4WMEA 5GJ4B 3KQCA 1C5LH 1PPZA 3HKJB 2G51A 4FU8A 2JJ1D 2QF5A 3SI4H 1EZQA 2AHME 5EQRA 2TBSA 3LC5A 1T8LA 2VVVA 2ZFRH 2WSSD 3UNRA 2FP7B 1L4ZA 4J1YA 3DD2H 5GPIB 1P3EA 3RMNH 1TONA 2G81E 2ZHFH 3M61U 1ZGVA 1OWKA 3E90B 2VU8E 4X2VA 1QZ8A 6GCHG 5KGOA 1FXYA 1V2WT 1XUFA 2ODYB 2V7QD 4WY3A 3QK1A 1SBWA 3SGQE 4U32A 2J98A 4FUGA 1NY22 1WAYB 2GCHF 3TJOA 1B0FA 1FV9A 4DGJA 1LDTT 2ANMH 1O3AA 1OSSA 1S82A 3SU1A 1O5FH 2FOAA 1P2OA 1C1OA 4YESB 7GCHF 1V2PT 1EZUC 1UJ1A 2PV9B 3P95A 2W7SA 1KY9A 2XNIA 1NFWA 1YC0A 3K6YA 1NFUA 3PV5A 3HGPA 1DLEA 1GMHG 1LHCH 1EZXC 1P2QA 1MTWA 1SQOA 2PTCE 2GMTC 3MH7A 2A0QB 3B8JA 1FZZA 2XBWA 1J14A 1C2GA 1YPKH 1Q3XA 3ZZ4A 4I7YH 5TCCA 1J16A 4FUBA 1GHAG 2B8OH 3OE7D 4JMYA 3ATWA 3QTOH 3GCHC 2A2XH 3TH2H 4FUFA 4BAKB 3LONA 3F9GA 1SGQE 4CRBA 1EPTA 1VCPA 1UO6A 4FUDA 1W2KH 1KMHB 2PW8H 2WV5A 1J9CH 2PUQH 1PYTD 2UWLA 1C1MA 1OP2A 2QGRA 3M5NA 1MABB 1AVWA 4H6TA 4AB9A 1DANH 1BBRE 2IJD1 2W6ID 4YTAA 1NFXA 1KXFA 5HIZA 1DWEH 2W6JD 1C5OH 2P59A 1LQEA 2G00A 2XBYA 5BPEA 5FPTA 3ZYEA 3RXDA 3A86A 3ZVFA 1ANEA 1ETRH 1TGBA 1UTOA 3STJA 1NS3A 5B6LA 3G01A 2ZDNA 2TGTA 2Z9GA 1S84A 2D2DA 5EOKA 3MNXA 1FY3A 3RXVA 1FIZA 1H4WA 3MU4A 6CHAC 2BD4A 3E8LA 1HRTH 3GCTG 1GJDB 2OP9A 1HLTH 2XNDD 1SR5C 2YMSB 1LVBA 1MCVA 3SW2B 4INKA 1YLCA 1BMMH 1LHEH 3M7TA 1RXPA 2ZGXH 1EAUA 1EX3A 1D4PB 1CBWC 1TYNA 1ETTH 2BY8X 4ISIH 4Y7AA 2RG3A 2F91A 1LKBA 1QRZA 3RXIA 2FYQA 1AU8A 4BAOB 5FL7D 3SZEA 1UTQA 2VIDA 4KKDA 1HBTH 1ZSKA 3URDA 4I8LA 1YPHC 4HG6A 5JPMH 2M2AA 1T8NA 4NIWA 4Z0KA 1O2OA 1DDJA 3P6ZB 2GX4A 2P93A 4TY6A 2VBCA 4IMZA 2BX4A 5GWZA 1TOMH 3EGKH 1H1BA 2VH6A 2UUFB 4ACAA 1UTNA 4YOGA 2XRCA 2BDYA 5EXMA 3W94A 4FOUC 1VCQA 3O8BA 5K7RA 3TK6A 3F1SB 1XKBC 1UMAH 2ZKSA 1ELVA 1RIWB 3BTKE 1S0QA 4RKOB 5CMXH 5L2ZH 4DJZB 2QXJA 2XXLA 1P2KA 1V3XA 1TBQH 1GHBG 4X6MA 2VVCA 3KHVA 3SNAA 4CRDA 3N7DA 1AN1E 1C2JA 4ZMAH 3VGCC 2Y81A 1O3GA 4FUCA 4JYVH 1QA7A 1FY1A 2AIPA 1NO9H 5E0HA 1CHOF 1Z6EA 2HGTH 3VEQB 1GHWH 2ZU2A 1GJAB 1UTLM 3CS0A 2BD5A 1C1PA 2Q6DA 3MU0A 1HJ8A 1V2JT 2F3CE 1JRSA 4BAQB 1O2NA 4K5ZA 1ESAA 1YCPK 3A82A 4AOQA 1ZPZA 3PO1B 5EXNA 5F8XA 1XUIA 4TWWA 1H8ED 1Q31A 1H8HD 1O0DH 2H6MA 1TPOA 1GHVH 2SGAA 5C5NA 3UOPA 2GDEH 2Y6TA 3NRLA 1LMWB 2IJOB 1HAZB 4KTSA 2ZHWH 1A0LA 1DLKB 3MNCA 2HNTF 1O2MA 1A3EH 1WBGB 1QGFA 3GOVB 1MKWK 3SUFA 1BRBE 1YM0A 1P02A 2H2ZA 2ZDLA 5T6FA 1XUHA 2PKAB 1MD7A 1XMNB 1AVGH 1P9UA 5E2PA 3E6PH 4H6SB 3ENSB 2BDBA 1FMGA 3GYLB 1SB1H 2P8OC 3BTFE 1QA0A 4Q2KA 5J4QA 4FVBA 1EUFA 1HB0B 1GI7B 1K1JA 1P2JA 3ATIA 5JYIA 2FESH 3A7ZA 4AFSA 1OX1A 1OYQA 2ANYA 2ZGBH 3LH1A 1YYY1 3U8RH 2BVRH 4MPUA 4FVDA 3SYJA 2KFWA 1MTVA 1HFDA 3LC3A 2OC1A 1KXCA 1BTUA 2H9EH 3BIVH 4RKJB 1QL9A 5A8XA 3SU0A 3ATKA 3ZVCA 1TNJA 1O2IA 4JK5A 3PMBB 4NG9H 3MO9A 1KDQB 1BTPA 1ANBA 2Z3EA 4TPYA 2NU0E 2TGAA 2UWOA 3VB5A 1N8OB 2LPRA 3DCLA 1EJMA 1YBWA 5EODA 1B7XB 3V13A 3M5LA 1NROH 3QO6A 4ZROA 1KLJH 1MU8B 2CV3A 2BD7A 2BLOA 1TX6A 3NCLA 2KZ4A 1CO7E 3GY4A 3FAOA 2QYIA 2XCNA 3TJVA 1YPEH 5DJ7A 3SUDA 2J5UA 5FBEA 2QAAA 3SO3A 2O8TA 2GCHG 4WWYA 4BANB 1IQJA 3E1XB 1GJBB 4UEHH 1Y5UT 1EPTC 4JCNA 1FLEE 2P94A 1UHBB 1CQQA 3Q00A 5DN6D 3ZVDA 3BTDE 5JDUB 2ZDMA 3QN7A 4HTCH 7GCHG 2JDID 2QC2A 1S6LA 2H5CA 3SQHE 4M9FA 1ZJDA 4ZAEA 4CRGA 1EOJA 1XM1A 2YMSD 4A92A 3UNQA 1V2OT 3RMLH 4VGCC 4UE7H 1ZJKA 4TT3D 1P10A 1QR3E 1OHHD 2GV7A 1NESE 2CF8H 2BQ6B 2ASUB 2G55A 1DXPA 2SNWA 1GI3A 4CRCA 3TGIE 1YP9A 4B71A 3VPKA 3UUZA 5HKKD 1ZRBA 1UVPA 2FI5E 5PTPA 2DE9A 1P57B 2Y5GA 4JZDH 1E36B 1GI6A 4LZ4B 4INHA 3AVZA 1A3BH 3MO6A 1LTOA 1IQHA 1V2MT 1HUTH 2A4GA 2A5KA 4B2AA 5C67A 1NRRH 1P05A 3OY6U 4MQAA 1BIOA 2NU2E 5SGAE 1T8OA 2YOLA 3OFND 4FUJA 3SJIA 4OS1A 4D76A 5HM9A 1C2HA 4F48B 3GCTF 1YPMH 1ZHRA 3DFLA 5JBBS 1O3DA 1EZSC 2BY9X 1FUJA 1NRSH 1L2EA 5CE1A 1TA6A 3LGUA 4MPVA 4F55A 3S9BA 4O3TA 5EW2H 4YZUA 4FETA 1DXWA 2ZWLH 4BTTB 3K65B 3M7QA 1MAXA 1ABJH 2SNVA 2ANWA 4I33A 5E0GA 1K28D 4AN7A 3UR9A 3P17H 2FPZA 4A6LA 6CHAB 5TJXA 1Z8JB 2W7UA 1KXBA 5GCHG 3SV6A 1MH0A 1YPHE 2AMQA 1S83A 4I86A 3H7TA 3MMGA 4NFFA 3TU7H 1AFEH 2ZO3H 5T1VA 3T2NA 4X1QU 1W8BH 2OC0A 5I46H 1CBWB 1PQAA 1ZZZA 3JZ1B 3VFEA 1RTFB 2VIVA 3GYMA 1ZMNA 2ZCKP 3ZZAA 3EE0B 2ZDAH 2AH4X 1OP0A 4MDSA 4CREA 5A8YA 4Y7BA 1W13U 3Q77A 1DS2E 2SGDE 3UY9A 1BJUA 4Y6DA 2ZQ1A 4BTIB 2WZQA 5E8EH 4AFZA 1NM6A 1GJ8B 1GJ5H 1S5SA 4INLA 2XC4A 1W10U 3VXEH 1UVTH 1GDNA 1W12U 4OS5A 4IW4E 3RXHA 1GHBF 2WPJS 1SPJA 1OKXA 2ZA5A 2ODPA 1E38B 3IG6B 4IN2A 3KCGH 2CHAB 1V6DA 1LCYA 1QURH 3LGWA 1P2NA 3LJOA 1IQKA 1MKXH 1V2NT 2Y7XA 3MHWU 4X8UH 3NPSA 1HCGA 1SGFG 3PV2A 2F9VA 1GGDC 2BDIA 1GG6C 3ESTA 5HM2A 2ZGCA 2HVYB 2EQNA 2KCYA 2ZTXA 4B2CA 1HXEH 1Z8RA 5L6NH 2Z9KA 3VXFH 2L74A 4KP0A 4NA8A 2GZ8A 1O36A 1O2YA 1A2CH 3T29A 3VGCB 4DIHH 5FCRA 1ETSH 1GI2A 3F2HA 4B75A 3S9CA 4LZ1H 2QF3A 2RCEA 2ZTZA 1FAKH 4WMDA 1CHOG 5GIBA 1O3PB 3UAIC 1C5WB 1MKWH 3CENA 1QNJA 4O97A 2PGBB 3AW1A 3TK5A 2CMYA 1MD8A 2A7JA 2GVFA 1HAXB 4JYTA 1UTPA 1ELGA 2AMDA 2D1JA 4LOYH 3EE7A 3NUMA 1WQVH 1O2HA 1ZYOA 3LIWA 4LXBH 3I77A 3L33A 3TPIZ 3KL6A 3EAJA 1CGJE 1UW7A 2KR7A 3UB0A 4X8VH 4ZHLU 3SN8A 2Z3CA 2FTMA 4E06H 3PMAB 5JB9S 1O3EA 3U8TH 4F4OC 4ZKRU 2KM0A 3C1KA 4Y71A 5C2ZA 2VNTA 1P2MA 1ZLRA 2VWLA 3LH3A 3TNSA 4I8JA 3NWUA 2ZPSA 1C2MA 1LVOA 1XVMA 1V2UT 5C20A 1A4WH 1NC6A 4ISLA 1A0JA 1OP8A 3MH6A 1NBMD 4JZEH 4ZCNA 4NWKA 4CHAC 4B73A 4CRAA 2P8OB 5FX6A 2QCYA 3F6UH 4K3JA 2QXHA 2ESTE 1FNIA 1HXFH 4XFQA 1H9HE 2QF4A 1H8DH 1TPSA 2G5VA 1AZ8A 1W0KD 5CHAC 1O34A 2C8WB 1N8OC 1SSXA 2F9BH 1GL0E 1O5BB 2J98B 4NA7A 3GICB 1C1RA 1TMUH 1TFXA 1OYTH 3FKSD 1T8MA 1DT2A 4WXIA 1C5YB 2D26C 1F5RA 5EPNA 1O2LA 1GBEA 4B1TA 1AUJA 2Z9LA 1O5CB 4ZHAA 1SGCA 1Y3XA 3SQEE 1GBDA 3L6PA 1D6WA 3SHAH 5HYOA 1Y5BT 2GKVE 4FU9A 5GDSH 1RFNA 3E0NB 1O35A 1YPJH 3NK8A 4MNVA 2FOHA 2XBVA 1QL7A 2Z9IA 3P70B 1KTTB 4A1XA 5EPYA 5C3NA 3AAVA 1SGFA 4IMQA 1T32A 1ZMLA 4K1SA 1QTFA 2Y5FA 3MNBA 4NZLA 1A61H 1UVOA 1C9TA 2G4TA 1G3CA 1O3OA 1CT2E 1NTPA 1QJ7B 2ZDKA 3BN9A 3RXJA 4WVPE 1GJ6A 7KMEH 1QB6A 2KAIA 2V3OH 3T26A 4X0WU 1J15A 1EJAA 3F0PA 1EPTB 3ZVAA 4TYDA 4THNH 2BDAA 2R3YA 3MNSA 2VINA 4GCHF 2C93B 3GCOA 3V3MA 4B6EA 1BHXF 1BTHH 1GVLA 5IYTA 2XWBI 1O5DH 2FI4E 2A1DB 4IBLH 1V2QT 1KTSB 1TGSZ 4FU7A 2F43B 3GY7A 5C5OA 4U2WA 4VGCB 1Q2WA 1HAVA 2JJ2D 3M3TA 1SQTA 1WCZA 1GJ7B 1A7SA 3B23B 4ZXXH 2ZCLP 3DSOA 3LOXA 4I32A 3M5OA 3GY3A 5A0AE 1ELCA 3VG8A 4DIIH 1BTYA 1GMCF 5J4SA 1SGIB 2FIRH 2A5IA 3RMOH 1TQ0B 1Z71A 1J8AA 3FZZA 1BZXE 1AVXA 2A2QH 3SORA 1CVWH 4IC6A 3U9AH 1VITH 3UQVA 3C27B 4ISHH 2G52A 3M35A 4AFUA 5KECA 1WTGH 1GCTB 3RXGA 1E1QD 1Z8GA 2BY7X 1S6FA 3HK3B 2BZAA 2CJIA 3AASA 3TH3H 5LGOA 1T4UH 5A2MH 4R0IA 4DY7B 5DG6A 1MQ5A 2A32A 2NU3E 1NRPH 5L30H 1PPEE 3SOSA 2V3MA 4O9VA 4ZKSU 1L0ZA 1V2RT 3A89A 5GCHF 1DVAH 1NU9A 4K8YA 1DPOA 3U8OH 1HDTH 2FOCA 4XE4A 2ZHQH 2FLRH 4K8BA 2FX6A 5FXLA 1FPCH 5A0BA 1YF4A 1YPGH 2O8LA 3A87A 2Z3DA 5FAHA 2BTCE 1MQ6A 5FCKA 1CSOE 4YLUA 4UFFH 3BEUA 2AGEX 3KQ5A 1Y5AT 2WYJA 2AGGX 3QGNB 1W11U 4ISOA 2CK3D 4OS6A 4XRNA 3UFAA 1TQ7B 1FN6A 2PGQB 1AI8H 2Q6GA 1GJCB 1HAPH 2TGDA 3U98H 1YLNA 1C5VA 1E35B 2ZGJA 2CN0H 4ESTE 3ZZ3A 4D7FA 3BV9B 1YCPM 1W0JD 4GHQA 3KN2A 2HLDD 1VR1H 2R3UA 3GY2A 3GISB 5DKMA 1QB1A 4A5TS 1OS8A 3QZRA 1Y8TA 1BMFD 2RDEA 1AUTC 2C8XB 2F9PA 2VGCB 2OUAA 2BVSH 3DSGA 1Y3VA 2UWPA 2B9LA 2C90B 1P11E 3F0OA 1ELTA 1PQ5A 4XBBA 5EGMA 2CHAC 3RM2H 3ATMA 2G8TA 4ABFA 2V6NA 3E16B 4ABAA 4NGAH 2VWOA 3RLYH 6LPRA 1O2GH 1P0SH 1CA0B 2LELA 4I8KA 4Y8YA 2HPPH 5DP4A 4ZKOU 2WYGA 3PB1E 3TNTA 1ZPCA 5F8ZA 3B9FH 1ACBE 2ZFFH 1KSNA 4Y11E 1A5IA 1GBTA 5EU8A 4GLYA 2VH0A 3AK5A 4X6OA 4D7GA 3UWIA 4Z1MD 1MTUA 8LPRA 2WPHS 3RXBA 3T28A 2C3SA 3A80A 1G3BA 1DM4B 1GGDB 1GG6B 1MKXK 2ZTYA 2EY4C 4E7RG 4OS7A 2ZECA 3SNEA 1MBQA 5IK2D 5TCAA 1WV7H 2FTLE 2JH5D 2ZF0H 2BLVA 4CBOA 4AYVB 1E1RD 1GBKA 4K69A 3M5MA 3AW0A 1Z1IA 4NSYA 2H9TH 1O3NA 2QF0A 3FVFB 3V7TA 4WMFA 1TGNA 1HJAC 1IQLA 3A85A 1HYLA 1BCUH 2SFAA 3P8FA 5CHBA 1CT0E 1PPBH 2OBOA 3E3TA 4KTUA 1NFYA 1YPLH 3UNSA 1HAOH 1TAWA 1KLIH 1C2KA 1FI8A 1VGCB 2OINA 3BF6H 3P8GA 3OYPA 5DO4H 1E37B 4IC5A 3ZZ5A 2ZP0H 1OWIA 5DP3A 1O32A 3H09A 4AYYB 1BTWA 5C1XA 2GCTC 2RFKC 1YWUA 2TRMA 1H8IH 1MUEB 2EI7A 4E05H 1THRH 2C8ZB 2KCPA 4K60A 5EW1H 3RXSA 1TBRH 1D3QB 1BITA 2ALPA 2J94A 1AKSA 3RXUA 3EYDA 2AIQA 3HGNA 3KEEA 4AZ2B 1A5HA 3RXTA 2Z6BD 1PPCE 4JZ1A 1Y3YA 2BDHA 1DE7H 1THSH 3W1EA 3ZV8A 1ID5H 2BLWA 4GAWA 2BDGA 1GBCA 3HK6B 1O5EH 2SGPE 1W3CA 1DWDH 1Y59T 1O2KA 2FS8A 1AD8H 4CHAB 1GBLA 1TX7A 1GBJA 3BTME 2JH6D 1O2RA 3TJNA 4BXSA 1ZOMA 2B0FA 5GNDA 2F4LA 1SGNE 1O2PA 1FX0B 3SJ9A 2TIOA 5EQSA 1ANDA 2KCOA 3GY5A 1O2QA 3SJKA 1DX5M 2FOMB 3KYFA 3RP2A 2FODA 5CHAB 3A84A 2CF9H 4ISNA 3URCA 1DSTA 3STIA 1DICA 1NN6A 3A8BA 4AG2A 3R0FA 4QT8C 3S69A 1QY6A 1NBME 3EA8A 3DFJA 1YLDA 3RXCA 2VJ1A 4WH6A 2PKSC 4DOQA 5KEDA 3A7WA 4IS5A 5C0TA 4ACBA 3TITA 3K6ZA 1AZZA 1QIXB 2BHGA 1IQFA 1BT7A 1SLUB 1N6XA 8ESTE 2QV1A 3MH5A 4H4FA 1A1RA 3RXPA 1YKTA 1SGPE 1A5GH 1HGTH 1WDIA 3TH4H 1OWDA 2TPIZ 2HVXA 1JWTA 1SGDE 1ZTKA 1SQRA 1DSUA 5A09A 2RDLA 2ZU3A 3F2FA 1UK4A 2PSXA 4NA9H 2BVXH 2RA3A 3HATH 3IWMA 1G9IE 2BD3A 3PLBA 1FQ3A 1G3EA 1P06A 1AMHA 1TRYA 2HNTC 1TABE 2BD8A 2B7DH 4X2WA 1FY4A 2QY0B 1AB9B 1F7ZA 4GCHG 3WW7A 1UTJA 1HAGE 4XBCA 3U28C 4P00A 1NRQH 4GVUA 2V35A 3LT3A 1EKBB 3QWCH 3PYHA 1F0SA 1PJPA 1XKAC 1ZGIA 2OC7A 2DE8A 2EEKA 4FUIA 4IN1A 2O8WA 4YT6H 1GCTC 1O2XA 2QA9E 1EAWA 1ZRKA 2BZ6H 1K0HA 2CXVA 1Z8IB 1SGEE 1XX9A 2UUKB 3BSQA 1GMCG 4BOHA 4JK6A 4BNRA 4FUEA 2XCFA 2Z94A 2GV6A 4X2YA 1MU6B 4MVNA 1GWAA 2PTNA 2J34A 5AFYH 1A0HB 4K1EA 1TNHA 4RSPA 1SLXB 4XD7D 2J97A 2ZCHP 2SGEE 1EJNA 2BOHB 2FOFA 3BEIB 4RT0A 1QCPA 2OQ5A 1C1SA 4Y79A 3MU5A 1S0RA 1EAIA 1GL1A 3ZVBA 2BD2A 2I6SA 3SGBE 3RU4D 3CS7A 3A83A 2XW9A 3HPTB 4CH8B 9LPRA 4GHTA 1SQAA 3GY6A 3ITIA 3QDZB 2BDCA 1O2JA 1QFKH 3MH4A 3SBKA 3MYWA 4AORA 3SNCA 1K2I1 1K1LA 1C5ZB 3O8RA 3ZZ9A 3UTUH 1WUNH 1L1JA 1NRNH 4XBDA 2EI6A 4Q7YA 1GJ9B 3F9FA 2VGCC 2Z7FE 1S85A 8GCHF 1E79D 2THFB 4NIVA 1JIRA 1BMNH 3SU3A 1O2ZA 3N99A 5AFZH 2FM2A 5E2OA 1WOFA 3SU4A 4D9QA 5EXLA 1O38A 2FOGA 2FLBH 4SGAE 1COWD 3TJUA 1ZHPA 1K1PA 3BTGE 1BBRK 4Y10E 2YNBA 1CA0C 1SG8B 2R2MB 1CHGA 2EA3A 1P8VC 2GP9B 4HI3A 1O3BA 5ESTE 1AO5A 2AEIH 1EOLA 1P3CA 3RXKA 3TK9A 1GI9B 1RD3B 2FO9A 2ZPQA 1BRAA 2STBE 2LP6A 1D3DB 1P9SA 2OLGA 1V2TT 4UFDH 4ABJA 4ASHA 3AAUA 1N6YA 3A8AA 1ZHMA 1ELEE 4DW2U 5L2YH 4YOIA 1D3TB 1BRCE 1UCYH 3PLPA 1TPAE 1EP5A 4MNYA 1H9LB 2R0KA 1EXFA 1ARBA 3VB7A 1DUAA 4UD9H 4XOJA 3RXEA 2NU4E 1F0RA 3EQ0H 4DURA 1O3MA 2CGAA 2FYRA 3OY5U 3KQBA 1AHTH 1O3IA 1ORFA 1F5LA 1SC8U 4NCYA 3PRDA 1G30B 1TE0A 2FI3E 4GPGA 1ZSJA 4U30A 1VGCC 1S6HA 3K9XB 1JOUB 5EJ1A 3KNXA 1PPGE 1EP6A 1AQ7A 1G36A 4ABGA 5DP9A 2GGVB 3QZQA 3UREA 3QLPH 2ZDVH 3DT0H 3SZNA 2VIPA 1NU7B 3V0XA 1C5TA 3OTPA 4BAHB 1HJAB 4JZIA 2F9NA 4K1TA 1CE5A 2WPLS 3Q3KA 1IHSH 1QJ1B 1K22H 2J9NA 3ODFA 2IPHA 4OS4A 1P09A 1SFIA 4F49A 4U01A 3BTQE 4WF8A 3H7OA 3PRBA 1FN8A 4KGAA 1O2WA 1ZPBA 1P2IA 2BYAX 2OBQA 3OTJE 3Q76A 1VJAU 2GCTB 1X7AC 1T7CA 5FPSA 2A31A 1PFXC 1H9IE 1QBVH 5DSFA 4X1NU 4BAMB 5DK1A 3TLOA 2Y7ZA 3MU1A 4XDEA 3LKWA 1XUGA 5DP5A 5HGGA 1G2MA 1C2FA 2GZ9A 4J2YB 5JBTA 1HIAA 4NIXA 2R9PA 5LH8A 7LPRA 1AGJA 2BX3A 3FO8D 1Y3UA 1C5SA 8KME2 1ANCA 4AB8A 1KXAA 1CGIE 1T4VH 1RS0A 1CGHA 1O2TA 5FBIA 1SLVB 1W14U 2JKHA 4Y8ZA 3RDZA 1SKYE 1O37A 3VB3A 3JZ2B 3SNDA 1A46H 5FPYA 1TGTA 2ZU1A 4I8HA 2HOBA 5FX5A 2WPIS 3UWJH 3MWIU 1UK3A 1HAHH 1RRKA 3A7YA 5HXFA 3SJOA 2P3UB 5F6MA 2ZIQH 2KAIB 2A5AA 2ZQ2A 3I78A 4ABIA 3A81A 4NWLA 1TBZH 1GJ4H 2PKSB 1TX8A 3D65E 5HIYA 3RXLA 1AIXH 3ZZBA 3QX5H 3BTEE 1L4DA 3SV9A 1C2DA 5G4BA 1C1UH 3ZYDA 9ESTA 2WINI 3SUEA 2Q1JA 4UONA 2Y82A 2FS9A 1KYNA 2BOKA 3D62A 3VB4A 2HNTE 1O39A 1JXPA 3ZZDA 3WY8A 2OXSA 1HAVB 1ESTA 4LK4A 1JRTA 1QJ6B 1CT4E 1G37A 3SU2A 4E7NA 3S0NA 1TMTH 1TNIA 4JYUH 1LVMA 3RUOA 3M37A 3OSYA 1SL3A 1GDUA 2VWNA 1M9UA 1AB9C 1ZR0A 1C4Y2 3PMHB 4WH8A 4CBNA 2AGIX 4RN6A 4X8SH 3RU4T 2DUCA 2P3FH 1O3FA 1TB6H 3LGVA 1O3KA 2P3TB 5EJLA 3F9HA 1BJVA 2A45B 2H9HA 1F5KU 2C4FH 2PWXA 4ZKNU 1LHGH 4ABDA 3LJJA 3QTVH 3RXFA 3UOUA 1DWBH 3U1IB 3SUGA 1C5QA 5EQQA 2AS9A 2VIQA 3KQDA 3ZZ8A 2VB0A 3H5CB 2ZFSA 4MTBA 1TNKA 1TOCB 4K2YA 4ABHA 2WPKS 3M36A 2AYWA 1O30A 3V12A 3A8DA 3ZIAD 4DCDA 1C2LA 1BA8B 1BQYA 2B5TB 1V2KT 4TPIZ 5DP6A 4I8GA 1ELFA 1TLDA 5AHGH 1KIGH 1Z1JA 5DP7A 1GI0A 1GI8B 4HFPB 4Y0YE 1IQIA 3BG8A 2QN5T 1HAIH 4AGJA 1FAXA 1D3PB 2XYAA 1RTLA 4PROA 1BMLA 3BIUH 1DY9A 2RA0A 4Q7ZA 2NU1E 3T25A 2HLCA 4O3UA 3ZZ7A 3MFJA 4A7IB 1SHYA 3ELAH 4HGCA 4O03A 2P16A 1F92A 3LU9B 1BMAA 2W26A 1FJSA 4X2XA 1IQGA 1MTNC 1VJ9U 1HPGA 1RJXB 1JIMA 4Y8XA 1EQ9A 1BDAA 2ZG0H 1SFQB 5DGJA 5C94A 3EDXB 1AE8H 4Q80A 1MTSA 4B6FA 2WUCA 1XUKA 4OM9A 1F0UA 3UIRA 1MZDA 1W0ZU 5FHTA 3QUMP 1TMBH 3DHKH 1LVYA 2C8YB 3LGIA 3W95A 2ULLA 4AGKA 3SV8A 1C1TA 1UTKA 3OEHD 1BBRH 1C5NH 1PQ8A 2ILNA 2WPDD 4MPXA 3RXQA 1WXRA 2ZPRA 2GT8A 2R0LA 2BY5X 3S7HB 4CH2B 3RU4E 2FDAA 2JH0D 2ZU4A 3P8OA 3N7EA 3PV4A 4BXWA 2PFEA 4DT7B 1PYTC 2V0BA 3GY8A 3ZZCA 5A0CA 8GCHG 5EG4A 3UPEA 4YM9A 3EA9A 1F2SE 4DT4A 3DSPA 3SV2H 2F9OA 2SGQE 5E0JA 1IQNA 2G4UA 1SOZA 1SLWB 1O2SA 1LPZB 5C1YA 5C17A 2WV4A 1QL8A 1C4V2 3A88A 3TGJE 1G3DA 4ASUD 3ZVGA 3BG4C 1SGTA 4KELA 3MOCA 3N7OA 1HV7A 1BRUP 3MO3A 1K21H 1GMDF 1SGYE 2XWAA 1GPZA 3KIDU 1C4U2 2ZFQH 2XC5A 3PROA 3MTYA 2UUYA 1GVKB 5GXPA 1ABIH 1V2ST 1V2LT 4X8TH 4YLQH 1GCDA 1MZAA 5LPEA 1BB0B 3LGYA 1MCTA 1UTMA 1KXEA 1LPGB 1MMJN 1O31A 3FZDA 3SU6A 2PHBA 1U6QA 1IHTH 3BTTE 4A1VA 1O3JA 2ALVA 2O9QA 2ZGHA 1UCYK 5IDKA 2VVUA 1FONA 3RLWH 4ABEA 2SGFE 1SVPA 4M7GA 1AFQC 1QBOA 3D23A 1LHFH 2J2UA 5CDFE 1UVSH 2AERH 1AKSB 4Q4LA 1AE5A 2M5TA 4A1TA 2I6QA 4AFQA 5JBAS 1GBFA 4D8NA 2G5NA 1ZSLA 2EI8A 3WWFA 1GI5A 3T62A 2GJGA 4Y76A 1TALA 3A7XA 3BTHE 1C5MD 3SJ8A 3VB6A 1V2VT 7ESTE 1S81A 3PMJA 2ZU5A 1MBMA 1C5RA 2A7HA 3RXMA 1EAXA 1K1OA 1OPHB 3S9AA 1GBIA 1UVUH 2STAE 3FANA 2VIOA 3F9EA 1CU1A 2Y80A 2QXGA 1GI4A 2W3IA 1B5GH 5JBCS 4MLFB 4HZHA 4NSVA 1P01A 2L6OA 3M7UA 3FP7E 3S7KB 4AG1A 1VITF 1OWJA 2WV9A 3Q3XA 5T3HA 5F03A 1L1GA 2AMPA 3TIUA 3T27A 2JETC 1E34B 5ETXA 3FP8E 1IOEA 2VIWA 4UFGH 2BQ7B 3KF2A 2OC8A 1O5GH 2OQUA 1T31A 2A4OA 2F9UA 1XXFA 3RC4A 4DG4A 3RC5A 2PKAA 1ARCA 3DA9B 2O8MA 4TY7A 1SGRE 2BXUH 3WWBA 1YGCH 2WPMS 3GDUA 1GHZA 5DP8A 3TGKE 6GCHF 1XXDA 2D8WA 1QB9A 3SHCH 1O3LA 2WHXA 2K8IA 2PUXB 2XTTB 3GCNA 3SU5A 2F83A 1Z6JH 3FP6E 4NZQA 1EFRD 2BLQA 2UUJB 5B6OA 1ESBA 1C2EA 1OWHA 5T6DA 5H4IB 3PWBA 3UR6A 3KYGA 4YOJA 4MG3A 1TNLA 2BXTH 3I29A 1PQ7A 3MQKC 1XVOA 4BTUB 2V3HH 1NPMA 5A8ZA 1KDQA 1FDPA 1QRWA 1K1MA 3UQOA 4ZH8A 3KQEA 1GMHF 2PP6A 3ODDA 3PWCA 1AY6H 1TA2A 2PR3A 4B74A 1O33A 3GS9A 3LPRA 4NIYA 3F3BA 1AWHB 1EATA 1ELBA 2A4QA 2J38A 1TNGA 2EC9H 1WYKA 2FX4A 1GHYH 4X1PU 4D9RA 1C5PA 1RGQA 1W7GH 1PPHE 1VKYA 1GHAF 3U1JB 1FY8E 1FIWA 3GDVA 3F2GA 4Y0ZE 1IAUA 3CNRA 1HJ9A 4SGBE 3RXOA 2J4IA 4KTCA 1QQ4A 2IN2A 5ABWA 4RI0A 1TWXB 2J92A 2OD3B 3M3SA 4B76A 1WTHD 1PPFE 2P95A 2GMTB 3L3TA 4I31A 2OTVA 3PTBA 5C0UA 4CR9A 1UHBA 4WXVA 3E91A 5EIYA 1HAYB 1O3CA 4X1RU 3LDXH 3RXRA 3SI3H 1QQUA 4GUXA 3ZV9A 1LQDB 2IPQX 2KX4A 1O3HA 3OAAD 4OS2A 1O5AB 1C1VH 3GCHB 1VZQH 2HPQH 3BTWE 3LGTA 1O2VA 3PM3A 5F8TA 3NXPA 3SNBA 4IGDA 2OK5A 1G32B 4YXWD 3RMMH 4WJG2 4TWYA 2FOBA 2FEQH 1ZMJA 2A7CA 2H5DA 4AC9A 2J95A 2PSYA 2GZ7A 3MI4A 4YT7H 1OWEA 3GDSA 1AWFH 2QE7D 2AFQB 2ZI2H 1BUIA 2ZFTA 3DUXH 2ZNKH 4UDWH 1TIOA 1RTKA 3R3GB 2BB4A 1GDQA 2BM2A 4X6NA 1C9PA 4ABBA 2FMJA 4DVAU 1C1NA 2GD4B 2FWWA 1W0YH 3PTNA 2HRVA 3P92A 1N1LA 2YMSC 3RC6A 1C5XB 1EB2A 1C1WH 1MTNB 4RT1A 1B0EA 5ESBA 1YY3A 3OX7U 5AVDA 2FOEA 4X6PA 3T5FH 2HWLB 1LHDH 3F68H 1TGCA 4AX9H 2Z9JA 2ZHDA 1NZQH 1C5UA 3FN8A 1K1NA 2JIZD 1LPKB 1WQSA 4CR5A 2WUBA 3A7TA 3ZZ6A 4OGYA 1UCYE 2ZFPH 3NZIA 3OU0A 4Z6AH 1F0TA 1TPPA 2O8UA 2QXIA 4FUHA 3BEFB 2A4RA 3HKIB 1BOQA 3D49H 1VCWA 4Q63A 5C1UA 3IITA 4ZHMU 1GBMA 1EASA 2GDDA 2W5EA 1SOTA 2FXRA 4UFEH 3O8DA 5K0HA 2ODQA 5AF9H 3U69H 1DY8A 1GBBA 1IQEA 3K2UA 1KLTA 1D6RA 1SMFE 3Q3YA 1XUJA 4TSFD 1NT1A 2Y5HA 1BHXB 2NWNA 1P12E 4MNXA 1JBUH 1D9IA 4FXGH 2ZZUH 4YO9A 5F53A 1MAYA 3O8CA 5T6GA 2BQWB 4ZUHA 2XBXA 2FZZA 3TVJB 3BG4B 4MPWA 1RIWC 3RXAA 5EJZA 3SV7A 2GT7A 1KXDA 2QIQA 1BTZA 1GHXH 1J17T 2ZHEH 1W7XH 4CRFA 5I25A 2ANKH 1GMDG 1C2IA 1SI5H 3FOAA 3OEED 5HMAA 1QHRB 2LNCA 2TGPZ 3EA7A 1P04A 2YNAA 1O2UA 2ZEBA 1YCPH 1GBHA 3NKKA 4X1SU 1Y3WA 3RM0H 1FPHH 1C1QA 2W3KA 2BD9A 1P03A 4JZFH 1OXGA 1DOJA 1ELDE 2XC0A 3PLKA 5LPFA 2XOKD 1WSSH 1L1NA 1HNEE 3PO1C 2GTBA 2BMGB 5LPRA
chains in the Genus database with same CATH topology
1AFQB 1QBNA 5BRRE 3QGJA 2BY6X 1LO6A 1IQMA 3FFGA 1Z7KA 1LKAA 4R8TB 5DPAA 1DITH 5JB8S 1G2LA 3M3VA 2IOTA 1HIAB 1CA8B 2OCVB 3CP7A 3P8NA 4MNWA 1ZTJA 3KGPA 4OGXA 1E0FD 1K1IA 3ATLA 1THPB 2HALA 1OOKB 2PLXA 1WU1A 4H42U 1DUEA 1DWCH 2ZC9H 1JMOH 4ZXYH 6ESTA 1GI1A 1QRXA 1TRMA 1TRNA 1ZTLA 1UK2A 3SGAE 1K9OE 4XSKU 2R2WU 3A8CA 1FY5A 3E0PB 1BTXA 4GSOA 2VWMA 3A7VA 4Q7XA 1DFPA 1SHHB 3MU8A 2JETB 1VITG 1EB1H 3ZVEA 1GVZA 4NFEA 1GBAA 4B2BA 2Q6FA 2H1UA 2K1QA 1INCA 1ELAA 4WMEA 5GJ4B 3KQCA 1C5LH 1PPZA 3HKJB 2G51A 4FU8A 3SI4H 1EZQA 5EQRA 2TBSA 3LC5A 1T8LA 2VVVA 2ZFRH 3UNRA 2FP7B 1L4ZA 4J1YA 3DD2H 5GPIB 1P3EA 3RMNH 1TONA 2G81E 2ZHFH 3M61U 1ZGVA 1OWKA 3E90B 2VU8E 4X2VA 6GCHG 1FXYA 1V2WT 1XUFA 2ODYB 4WY3A 3QK1A 1SBWA 3SGQE 4U32A 4FUGA 1NY22 1WAYB 2GCHF 3TJOA 1B0FA 1FV9A 4DGJA 1LDTT 2ANMH 1O3AA 1OSSA 1S82A 3SU1A 1O5FH 2FOAA 1P2OA 1C1OA 4YESB 7GCHF 1V2PT 1EZUC 1UJ1A 2PV9B 3P95A 2W7SA 1KY9A 2XNIA 1NFWA 1YC0A 3K6YA 1NFUA 3HGPA 1DLEA 1GMHG 1LHCH 1EZXC 1P2QA 1MTWA 1SQOA 2PTCE 2GMTC 3MH7A 2A0QB 3B8JA 1FZZA 2XBWA 1J14A 1C2GA 1YPKH 1Q3XA 3ZZ4A 4I7YH 5TCCA 1J16A 4FUBA 1GHAG 2B8OH 4JMYA 3ATWA 3QTOH 3GCHC 2A2XH 3TH2H 4FUFA 4BAKB 3LONA 3F9GA 1SGQE 4CRBA 1EPTA 1VCPA 1UO6A 4FUDA 1W2KH 2PW8H 2WV5A 1J9CH 2PUQH 1PYTD 2UWLA 1C1MA 1OP2A 2QGRA 3M5NA 1AVWA 4H6TA 4AB9A 1DANH 1BBRE 4YTAA 1NFXA 1KXFA 1DWEH 1C5OH 2P59A 1LQEA 2G00A 2XBYA 5BPEA 5FPTA 3ZYEA 3RXDA 3A86A 3ZVFA 1ANEA 1ETRH 1TGBA 1UTOA 3STJA 1NS3A 3G01A 2ZDNA 2TGTA 2Z9GA 1S84A 2D2DA 5EOKA 3MNXA 1FY3A 3RXVA 1FIZA 1H4WA 3MU4A 6CHAC 2BD4A 3E8LA 1HRTH 3GCTG 1GJDB 2OP9A 1HLTH 1SR5C 1LVBA 1MCVA 3SW2B 4INKA 1YLCA 1BMMH 1LHEH 3M7TA 1RXPA 2ZGXH 1EAUA 1EX3A 1D4PB 1CBWC 1TYNA 1ETTH 2BY8X 4ISIH 4Y7AA 2RG3A 2F91A 1LKBA 1QRZA 3RXIA 2FYQA 1AU8A 4BAOB 1UTQA 2VIDA 4KKDA 1HBTH 1ZSKA 3URDA 4I8LA 1YPHC 5JPMH 1T8NA 4NIWA 4Z0KA 1O2OA 1DDJA 3P6ZB 2GX4A 2P93A 4TY6A 4IMZA 2BX4A 5GWZA 1TOMH 3EGKH 1H1BA 2VH6A 2UUFB 1UTNA 4YOGA 2XRCA 2BDYA 5EXMA 3W94A 1VCQA 3O8BA 5K7RA 3TK6A 3F1SB 1XKBC 1UMAH 2ZKSA 1ELVA 1RIWB 3BTKE 1S0QA 4RKOB 5CMXH 5L2ZH 4DJZB 2QXJA 2XXLA 1P2KA 1V3XA 1TBQH 1GHBG 4X6MA 2VVCA 3KHVA 3SNAA 4CRDA 1AN1E 1C2JA 4ZMAH 3VGCC 2Y81A 1O3GA 4FUCA 4JYVH 1QA7A 1FY1A 2AIPA 1NO9H 5E0HA 1CHOF 1Z6EA 2HGTH 3VEQB 1GHWH 2ZU2A 1GJAB 1UTLM 3CS0A 2BD5A 1C1PA 2Q6DA 3MU0A 1HJ8A 1V2JT 2F3CE 1JRSA 4BAQB 1O2NA 4K5ZA 1ESAA 1YCPK 3A82A 4AOQA 1ZPZA 3PO1B 5EXNA 5F8XA 1XUIA 4TWWA 1Q31A 1O0DH 2H6MA 1TPOA 1GHVH 2SGAA 5C5NA 3UOPA 2GDEH 2Y6TA 1LMWB 2IJOB 1HAZB 4KTSA 2ZHWH 1A0LA 1DLKB 3MNCA 2HNTF 1O2MA 1A3EH 1WBGB 1QGFA 3GOVB 1MKWK 3SUFA 1BRBE 1YM0A 1P02A 2H2ZA 2ZDLA 5T6FA 1XUHA 2PKAB 1MD7A 1XMNB 1AVGH 1P9UA 5E2PA 3E6PH 4H6SB 3ENSB 2BDBA 1FMGA 3GYLB 1SB1H 2P8OC 3BTFE 1QA0A 4Q2KA 5J4QA 4FVBA 1EUFA 1HB0B 1GI7B 1K1JA 1P2JA 3ATIA 5JYIA 2FESH 3A7ZA 4AFSA 1OX1A 1OYQA 2ANYA 2ZGBH 3LH1A 1YYY1 3U8RH 2BVRH 4MPUA 4FVDA 1MTVA 1HFDA 3LC3A 2OC1A 1KXCA 1BTUA 2H9EH 3BIVH 4RKJB 1QL9A 5A8XA 3SU0A 3ATKA 3ZVCA 1TNJA 1O2IA 4JK5A 3PMBB 4NG9H 3MO9A 1KDQB 1BTPA 1ANBA 2Z3EA 4TPYA 2NU0E 2TGAA 2UWOA 3VB5A 1N8OB 2LPRA 1EJMA 1YBWA 5EODA 1B7XB 3V13A 3M5LA 1NROH 3QO6A 4ZROA 1KLJH 1MU8B 2CV3A 2BD7A 2BLOA 1TX6A 3NCLA 1CO7E 3GY4A 3FAOA 2QYIA 2XCNA 3TJVA 1YPEH 5DJ7A 3SUDA 5FBEA 2QAAA 3SO3A 2O8TA 2GCHG 4WWYA 4BANB 1IQJA 3E1XB 1GJBB 4UEHH 1Y5UT 1EPTC 4JCNA 1FLEE 2P94A 1UHBB 1CQQA 3Q00A 3ZVDA 3BTDE 5JDUB 2ZDMA 3QN7A 4HTCH 7GCHG 2QC2A 2H5CA 3SQHE 1ZJDA 4ZAEA 4CRGA 1EOJA 1XM1A 4A92A 3UNQA 1V2OT 3RMLH 4VGCC 4UE7H 1ZJKA 1P10A 1QR3E 2GV7A 1NESE 2CF8H 2BQ6B 2ASUB 2G55A 1DXPA 2SNWA 1GI3A 4CRCA 3TGIE 1YP9A 4B71A 3VPKA 3UUZA 1ZRBA 1UVPA 2FI5E 5PTPA 2DE9A 1P57B 2Y5GA 4JZDH 1E36B 1GI6A 4LZ4B 4INHA 3AVZA 1A3BH 3MO6A 1LTOA 1IQHA 1V2MT 1HUTH 2A4GA 2A5KA 4B2AA 5C67A 1NRRH 1P05A 3OY6U 4MQAA 1BIOA 2NU2E 5SGAE 1T8OA 2YOLA 4FUJA 3SJIA 4OS1A 4D76A 5HM9A 1C2HA 3GCTF 1YPMH 1ZHRA 3DFLA 5JBBS 1O3DA 1EZSC 2BY9X 1FUJA 1NRSH 1L2EA 5CE1A 1TA6A 3LGUA 4MPVA 3S9BA 4O3TA 5EW2H 4YZUA 1DXWA 2ZWLH 4BTTB 3K65B 3M7QA 1MAXA 1ABJH 2SNVA 2ANWA 4I33A 5E0GA 1K28D 4AN7A 3UR9A 3P17H 2FPZA 4A6LA 6CHAB 5TJXA 1Z8JB 2W7UA 1KXBA 5GCHG 3SV6A 1MH0A 1YPHE 2AMQA 1S83A 3H7TA 3MMGA 4NFFA 3TU7H 1AFEH 2ZO3H 3T2NA 4X1QU 1W8BH 2OC0A 5I46H 1CBWB 1PQAA 1ZZZA 3JZ1B 3VFEA 1RTFB 2VIVA 3GYMA 1ZMNA 2ZCKP 3ZZAA 3EE0B 2ZDAH 2AH4X 1OP0A 4MDSA 4CREA 5A8YA 4Y7BA 1W13U 3Q77A 1DS2E 2SGDE 3UY9A 1BJUA 4Y6DA 2ZQ1A 4BTIB 5E8EH 4AFZA 1NM6A 1GJ8B 1GJ5H 1S5SA 4INLA 2XC4A 1W10U 3VXEH 1UVTH 1GDNA 1W12U 4OS5A 4IW4E 3RXHA 1GHBF 2WPJS 1SPJA 1OKXA 2ZA5A 2ODPA 1E38B 3IG6B 4IN2A 3KCGH 2CHAB 1V6DA 1LCYA 1QURH 3LGWA 1P2NA 3LJOA 1IQKA 1MKXH 1V2NT 2Y7XA 3MHWU 4X8UH 3NPSA 1HCGA 1SGFG 2F9VA 1GGDC 2BDIA 1GG6C 3ESTA 5HM2A 2ZGCA 4B2CA 2ZTXA 1HXEH 1Z8RA 5L6NH 2Z9KA 3VXFH 4KP0A 4NA8A 2GZ8A 1O36A 1O2YA 1A2CH 3T29A 3VGCB 4DIHH 5FCRA 1ETSH 1GI2A 4B75A 3S9CA 4LZ1H 2QF3A 2RCEA 2ZTZA 1FAKH 4WMDA 1CHOG 5GIBA 1O3PB 1C5WB 1MKWH 3CENA 1QNJA 4O97A 2PGBB 3AW1A 3TK5A 2CMYA 1MD8A 2A7JA 2GVFA 1HAXB 4JYTA 1UTPA 1ELGA 2AMDA 2D1JA 4LOYH 3NUMA 1WQVH 1O2HA 1ZYOA 3LIWA 4LXBH 3I77A 3L33A 3TPIZ 3KL6A 3EAJA 1CGJE 4X8VH 4ZHLU 3SN8A 2Z3CA 2FTMA 4E06H 3PMAB 5JB9S 1O3EA 3U8TH 4F4OC 4ZKRU 3C1KA 4Y71A 5C2ZA 2VNTA 1P2MA 1ZLRA 2VWLA 3LH3A 3TNSA 4I8JA 3NWUA 2ZPSA 1C2MA 1LVOA 1XVMA 1V2UT 5C20A 1A4WH 1NC6A 4ISLA 1A0JA 1OP8A 3MH6A 4JZEH 4CHAC 4NWKA 4B73A 4CRAA 2P8OB 5FX6A 2QCYA 3F6UH 4K3JA 2QXHA 2ESTE 1FNIA 1HXFH 4XFQA 1H9HE 1H8DH 1TPSA 2G5VA 1AZ8A 5CHAC 1O34A 2C8WB 1N8OC 1SSXA 2F9BH 1GL0E 1O5BB 4NA7A 3GICB 1C1RA 1TMUH 1TFXA 1OYTH 1T8MA 1DT2A 4WXIA 1C5YB 2D26C 1F5RA 5EPNA 1O2LA 1GBEA 4B1TA 1AUJA 2Z9LA 1O5CB 4ZHAA 1SGCA 1Y3XA 3SQEE 1GBDA 3L6PA 1D6WA 3SHAH 5HYOA 1Y5BT 2GKVE 4FU9A 5GDSH 1RFNA 3E0NB 1O35A 1YPJH 3NK8A 4MNVA 2FOHA 2XBVA 1QL7A 2Z9IA 3P70B 1KTTB 4A1XA 5EPYA 5C3NA 3AAVA 1SGFA 4IMQA 1T32A 1ZMLA 4K1SA 1QTFA 2Y5FA 3MNBA 4NZLA 1A61H 1UVOA 1C9TA 2G4TA 1G3CA 1O3OA 1CT2E 1NTPA 1QJ7B 2ZDKA 3BN9A 3RXJA 4WVPE 1GJ6A 7KMEH 1QB6A 2KAIA 2V3OH 3T26A 4X0WU 1J15A 1EJAA 1EPTB 3ZVAA 4TYDA 4THNH 2BDAA 2R3YA 3MNSA 2VINA 4GCHF 2C93B 3GCOA 3V3MA 1BHXF 1BTHH 1GVLA 5IYTA 2XWBI 1O5DH 2FI4E 2A1DB 4IBLH 1V2QT 1KTSB 1TGSZ 4FU7A 3GY7A 5C5OA 4U2WA 4VGCB 1Q2WA 1HAVA 3M3TA 1SQTA 1WCZA 1GJ7B 1A7SA 3B23B 4ZXXH 2ZCLP 3LOXA 4I32A 3M5OA 3GY3A 5A0AE 1ELCA 4DIIH 1BTYA 1GMCF 5J4SA 1SGIB 2FIRH 2A5IA 3RMOH 1TQ0B 1Z71A 1J8AA 3FZZA 1BZXE 1AVXA 2A2QH 3SORA 1CVWH 4IC6A 3U9AH 1VITH 3UQVA 3C27B 4ISHH 2G52A 3M35A 4AFUA 1WTGH 1GCTB 3RXGA 1Z8GA 2BY7X 1S6FA 3HK3B 2BZAA 2CJIA 3AASA 3TH3H 5LGOA 1T4UH 5A2MH 4R0IA 4DY7B 5DG6A 1MQ5A 2A32A 2NU3E 1NRPH 5L30H 1PPEE 3SOSA 4O9VA 4ZKSU 1L0ZA 1V2RT 3A89A 5GCHF 1DVAH 1NU9A 4K8YA 1DPOA 3U8OH 1HDTH 2FOCA 4XE4A 2ZHQH 2FLRH 4K8BA 2FX6A 5FXLA 1FPCH 5A0BA 1YF4A 1YPGH 2O8LA 3A87A 2Z3DA 5FAHA 2BTCE 1MQ6A 5FCKA 1CSOE 4YLUA 4UFFH 3BEUA 2AGEX 1Y5AT 2WYJA 2AGGX 3QGNB 1W11U 4ISOA 4OS6A 3UFAA 1TQ7B 1FN6A 2PGQB 1AI8H 2Q6GA 1GJCB 1HAPH 2TGDA 3U98H 1C5VA 1E35B 2ZGJA 2CN0H 4ESTE 3ZZ3A 4D7FA 3BV9B 1YCPM 4GHQA 3KN2A 1VR1H 2R3UA 3GY2A 3GISB 5DKMA 1QB1A 4A5TS 1OS8A 3QZRA 1Y8TA 1AUTC 2C8XB 2F9PA 2VGCB 2OUAA 2BVSH 1Y3VA 2UWPA 2B9LA 2C90B 1P11E 1ELTA 1PQ5A 4XBBA 5EGMA 2CHAC 3RM2H 3ATMA 2G8TA 4ABFA 2V6NA 3E16B 4ABAA 4NGAH 2VWOA 3RLYH 6LPRA 1O2GH 1P0SH 1CA0B 4I8KA 4Y8YA 2HPPH 5DP4A 4ZKOU 2WYGA 3PB1E 3TNTA 1ZPCA 5F8ZA 3B9FH 1ACBE 2ZFFH 1KSNA 4Y11E 1A5IA 1GBTA 5EU8A 4GLYA 2VH0A 4X6OA 4D7GA 3UWIA 1MTUA 8LPRA 2WPHS 3RXBA 3T28A 2C3SA 3A80A 1G3BA 1DM4B 1GGDB 1GG6B 1MKXK 2ZTYA 4E7RG 4OS7A 2ZECA 3SNEA 1MBQA 5TCAA 1WV7H 2FTLE 2JH5D 2ZF0H 2BLVA 4CBOA 4AYVB 1GBKA 4K69A 3M5MA 3AW0A 1Z1IA 4NSYA 2H9TH 1O3NA 2QF0A 3FVFB 3V7TA 4WMFA 1TGNA 1HJAC 1IQLA 3A85A 1HYLA 1BCUH 2SFAA 3P8FA 1CT0E 1PPBH 2OBOA 3E3TA 4KTUA 1NFYA 1YPLH 3UNSA 1HAOH 1TAWA 1KLIH 1C2KA 1FI8A 1VGCB 2OINA 3BF6H 3P8GA 3OYPA 5DO4H 1E37B 4IC5A 3ZZ5A 2ZP0H 1OWIA 5DP3A 1O32A 4AYYB 1BTWA 5C1XA 2GCTC 2TRMA 1H8IH 1MUEB 2EI7A 4E05H 1THRH 2C8ZB 4K60A 5EW1H 3RXSA 1TBRH 1D3QB