2CV3A

Crystal structure of porcine pancreatic elastase complexed with a macroclyclic peptide inhibitor
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elastase 1
publication title Structure of the complex of porcine pancreatic elastase with a trimacrocyclic peptide inhibitor FR901451
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2cv3A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2cv3A01
3A82A 3TH3H 2ZFRH 3KN2A 3AASA 1FY1A 1EUFA 4B76A 1K1NA 5FX5A 4K1SA 2QGRA 2PKSC 1C2LA 3RXHA 1HAZB 3PMJA 1X7AC 4IBLH 4IGDA 1QHRB 1AWHB 3ZV8A 2DE9A 2W3KA 3F9HA 2GCHF 3SU6A 2G4TA 1ZOMA 2V35A 1V2KT 2BY5X 2P95A 1SBWA 1N8OB 2AMPA 3AAVA 2BLWA 3KHVA 5JBAS 2EA3A 2ZECA 3GISB 1ZJDA 2BD4A 4IS5A 1XKAC 2BZ6H 4UONA 3E1XB 1BJVA 3ESTA 3S0NA 1M9UA 4BNRA 1V2NT 3L33A 3RXUA 4H42U 4YZUA 2TGDA 1T8LA 2GVFA 1DSTA 1YPLH 2AIPA 2BDGA 2ZHFH 3C1KA 1MU8B 3PO1B 2AGEX 4U2WA 2PW8H 3ZYEA 3M5OA 3BEUA 1H4WA 1G2LA 2FX4A 3ODFA 3KNXA 5ETXA 2AYWA 4E7NA 2W7SA 5GXPA 4Z0KA 3A88A 1AFEH 2XCNA 1CO7E 1N6YA 1PYTD 3A83A 1CQQA 3SU1A 1C5TA 3LC5A 1CT2E 4NIVA 2BX3A 3F6UH 5B6OA 1ZZZA 3ZZ6A 3QTOH 1ZTKA 3E91A 2Y80A 2J2UA 1VZQH 2XBXA 2F9VA 3MYWA 2AERH 1NC6A 1P0SH 3TGIE 1GJ8B 2OC0A 2FOEA 2CJIA 3TJVA 2A4QA 1IQEA 5DO4H 2WPHS 4WF8A 3ENSB 4TWYA 4NIXA 1SGDE 4Q7XA 1D6RA 2CHAC 1PYTC 2QIQA 2ZU3A 1LTOA 1G9IE 1BTXA 3UNRA 1C5ZB 3SU2A 4YTAA 3ZVAA 2P3UB 4WY3A 2WPIS 5EU8A 3SU3A 4AOQA 2VWMA 4UFFH 1YLDA 4Y0YE 5A8XA 1FPHH 4AX9H 4XFQA 7KMEH 1AUTC 4HTCH 1BBRK 1FY5A 3KEEA 3MNCA 1NRQH 5FPTA 2ODQA 1V2RT 1DVAH 3OYPA 3LC3A 3A8BA 1SFQB 3UREA 1DPOA 1AE8H 1OP8A 1C1PA 4IN1A 2BLQA 1FY4A 2XW9A 3GCTF 1KLIH 2R3UA 2O9QA 2ZPQA 3MNXA 1V3XA 1VGCC 4X2VA 1C1VH 1P01A 1HJ9A 2ZDKA 3TGKE 1HXFH 2B8OH 4NSVA 5FBEA 2NU3E 1EAUA 2BD5A 3QO6A 1CT0E 1D3DB 4O97A 1LHFH 4R8TB 3RLYH 1O5DH 3RXLA 1UVTH 3TJUA 1HAYB 1ZJKA 1B7XB 2ZC9H 1ZSJA 2R9PA 1EAWA 1W0YH 1FNIA 2JH6D 1YCPK 5E2OA 2GZ8A 1V2TT 3QLPH 2ANMH 3MO6A 1Y59T 3HKIB 3EA9A 1LO6A 4RSPA 1ZPZA 3S7KB 1AQ7A 1HAGE 4RKJB 1MH0A 2SNWA 1JOUB 5F8XA 5H4IB 4ISHH 1IHSH 5L2ZH 3H5CB 1E34B 3MH4A 3DFLA 1GHVH 2WINI 5HYOA 3V7TA 2P94A 4Y71A 4K1TA 1T31A 4VGCC 5A8ZA 1MMJN 2BD9A 2BY8X 1ABJH 2JH5D 2OD3B 2SNVA 3DUXH 3SGAE 3SJOA 1EATA 1QBVH 3P95A 5E8EH 2Y5FA 1GG6C 4CRGA 1EZUC 5AFYH 1C5PA 2ZU2A 1F5KU 1SLXB 4O3UA 1T8NA 3D49H 5DP8A 1FUJA 2FO9A 5E0HA 5ESBA 3SUGA 1GBJA 1TRYA 4YOGA 1GCDA 2OUAA 2Y7XA 2FOFA 2C90B 1AUJA 2ZFTA 2PKSB 1SR5C 2QC2A 3BIUH 1WOFA 2WPLS 1HJAC 2ZWLH 1YCPM 2QXIA 5EQSA 2FI5E 1HIAA 1NU9A 1ZGVA 4TWWA 1XUHA 2FMJA 4OS4A 1BHXF 2W26A 3M3SA 5C2ZA 1KTTB 4UFEH 1TQ0B 5L2YH 1ARCA 4Q80A 3GCHC 1IHTH 4X6OA 5DP3A 1F92A 1K2I1 1Z71A 2VIWA 1GJ7B 1OKXA 3RXAA 1RRKA 1TNIA 3P8GA 3HK6B 1UCYE 4MVNA 3TU7H 3GICB 2A4OA 5CHAC 4YOJA 4B2BA 1C1SA 2BQ6B 2G4UA 2QXJA 3Q3YA 4D76A 1JIMA 1KY9A 1EB1H 4E06H 2G51A 1VJAU 1YPGH 1FN6A 1KDQA 1CA8B 1H1BA 4YOIA 2F9UA 3DHKH 1O5GH 1ELAA 6ESTA 1QY6A 1ELDE 1MU6B 4SGBE 3RXFA 3WY8A 3RXDA 3FZDA 3SU0A 1F0TA 1C2GA 4B1TA 4BOHA 2LNCA 1OPHB 3RXIA 3LGVA 1DM4B 1NROH 3SV8A 4FUBA 1BRAA 2BD2A 3O8BA 5F8TA 3RXGA 3ODDA 2Y5HA 2EI7A 1PPCE 4HGCA 1LQDB 1TGSZ 3B23B 4AFZA 1UTLM 1A7SA 3AAUA 2VIPA 3LOXA 1TNKA 4WH8A 2R2MB 4LOYH 5C5OA 1NS3A 4CRBA 3SV2H 4BAQB 4Y8ZA 1FI8A 1T4UH 4DT7B 4DY7B 5F03A 1TMUH 4DVAU 3F9EA 2G8TA 1QB1A 1GI1A 1JRSA 1B0EA 1XVOA 5AF9H 2ZA5A 1FLEE 1ZPBA 2RA3A 4NZQA 2GCTB 2OP9A 1XUFA 2ZDVH 3B9FH 3M61U 1VITH 4CBOA 3GY2A 1IQNA 4FXGH 1Y5AT 3ZV9A 1ELFA 1OP2A 1DY9A 2XCFA 3SNBA 1Z6EA 2ZDMA 1QB6A 1ZHPA 3V12A 1K22H 4FVDA 3U8OH 1TLDA 2TBSA 1GBDA 3NPSA 3KQEA 1RXPA 2PSYA 2OBQA 5E2PA 1RD3B 1O2OA 4HZHA 1VGCB 2Q6GA 1NPMA 4JK6A 4YLQH 1UVSH 2ZGHA 1MCTA 1O34A 3PMHB 1E37B 1A3EH 1HIAB 3EA8A 3BTQE 4X2YA 2ALPA 3MU0A 4CREA 1BA8B 5HMAA 2BDCA 4Y7AA 2FTMA 2BB4A 3TNTA 1CGJE 3SNAA 4AFUA 4HFPB 1KLTA 3T27A 4DOQA 1DXPA 3UNQA 1C4V2 2ZU4A 1GJ4H 5FHTA 3TK9A 5G4BA 3A8AA 1Z7KA 1YP9A 1O3JA 4K1EA 1EOJA 1JIRA 1FPCH 1F7ZA 1HAIH 5L6NH 1TONA 2SGFE 2FOCA 1ANDA 2RDLA 3RU4T 1ORFA 2ZGBH 5FCRA 2WUCA 3CS7A 1KDQB 1OX1A 3T62A 2A5KA 1C9TA 2ZHDA 1EAXA 1EPTB 4I7YH 1TE0A 4ZAEA 1UK4A 3HGNA 3PO1C 1BTUA 4VGCB 3VB3A 4I8LA 4MG3A 1QL9A 4Z6AH 1P9UA 1WTGH 2VNTA 3BG8A 3FP8E 1C2HA 1GG6B 5LPEA 2Z9IA 1FXYA 1P12E 1C4U2 3STIA 4ABEA 2ZHWH 1H9HE 2Z94A 4MNYA 3SUDA 1RTFB 5JBBS 3UNSA 3MH7A 2GKVE 2D1JA 4OGYA 1ZHRA 4YT7H 1NT1A 1BTHH 4Y76A 5BRRE 4CRAA 1NFUA 1C1TA 2HNTF 1HJAB 1WV7H 1ZRKA 2FIRH 1P8VC 3SO3A 3F9FA 3T5FH 4Y8YA 1EXFA 4ZKRU 5JDUB 3A85A 4FU7A 2J95A 4KTSA 1NFWA 1C2IA 2H6MA 1CGHA 2FI4E 1HV7A 1O2LA 2WUBA 4AN7A 1GBLA 3LIWA 2GDDA 3GCHB 4GCHG 4TPYA 3M35A 1AMHA 1NU7B 3RM2H 1B0FA 3M37A 5DG6A 1BB0B 4KKDA 1QTFA 1ELTA 4TY7A 1C5QA 3SOSA 2FTLE 9ESTA 1P2JA 3CENA 2ZFQH 1FY8E 1NFXA 1HAHH 4DCDA 1EJAA 1LKBA 1UVPA 3ATLA 4K2YA 5CE1A 1OWDA 2G5NA 3RXMA 3GCNA 3RC6A 3GY6A 4JZIA 3M3VA 2A5IA 1O3BA 1OWKA 2NU0E 3QGNB 3PLBA 3MU4A 3MO9A 5FXLA 1P03A 1MTWA 1OXGA 1NRPH 3BEFB 4R0IA 2BQWB 2UUKB 4FU9A 4YT6H 1CHOG 1ZYOA 5EW1H 5GIBA 1BIOA 3UR6A 1AB9B 1DWBH 1LCYA 3IG6B 4X1QU 3SJ9A 3RXBA 1RFNA 5C5NA 2F9BH 1GBFA 2AMQA 3RUOA 1TALA 4DG4A 2AH4X 4WH6A 3O8RA 1GBBA 2AGGX 3OSYA 4X6NA 5FPYA 3RXKA 3ZZ8A 3SI4H 1QURH 4NWKA 3PLPA 2F9OA 3MU1A 1TGTA 2NWNA 3M3TA 3RMOH 1SMFE 2ZU5A 1IQGA 1A5HA 2FWWA 1Q2WA 1Z1IA 1ZSKA 2GT8A 1GHZA 3MOCA 1A0JA 1YKTA 1RJXB 1QA0A 1F5RA 3ZZAA 2EI8A 2O8TA 1L4DA 3RXRA 5A2MH 5GWZA 1OWJA 2ZPSA 4WMDA 1FJSA 4X2WA 3UTUH 1U6QA 4NA9H 1BITA 3DT0H 1KSNA 1SG8B 1ELVA 3ZZ3A 1AY6H 1THRH 3GDVA 2HVXA 4ABFA 4D9QA 4JMYA 3ZVCA 1SOZA 1GBCA 1WBGB 4A1TA 1ETRH 1TOCB 1V2JT 1D6WA 1WU1A 1GHBF 3BG4B 2QF3A 1ABIH 1SGCA 1O3HA 2H9EH 1TFXA 2SGQE 1HB0B 1WCZA 1MZDA 5LH8A 2Z9LA 1DLKB 2OINA 2FESH 6CHAC 1MQ5A 4UEHH 1UJ1A 1QB9A 4Y11E 5DP5A 1DOJA 4ISNA 2TGTA 4ZKSU 2Z9JA 1LVMA 2QYIA 3GY7A 1HAPH 1P2OA 1WUNH 4FUIA 1TOMH 2VH0A 1GI5A 1C2EA 1O5CB 3TK6A 1DLEA 1P3EA 3SQHE 1O2HA 5A0BA 5EPNA 1C5YB 2H9TH 1P57B 3GY8A 3JZ2B 3RXVA 5DPAA 4H4FA 3HGPA 2A1DB 1EASA 3GYLB 4WMEA 1Y5UT 3T29A 1GVZA 1O35A 4AGKA 1JRTA 1TWXB 1CHGA 4H6SB 1MTVA 5DKMA 1MKXH 4MPXA 2VINA 2A0QB 1MQ6A 4JYTA 4BXSA 3QTVH 2JKHA 2B5TB 1E36B 1BMLA 1K1MA 1ELGA 1AKSA 1BDAA 1CGIE 2V0BA 4GCHF 5FPSA 2HNTE 1XVMA 4I8GA 2BTCE 1P02A 1H9LB 3F1SB 1P3CA 3PWBA 2OLGA 1H9IE 1UTMA 4IW4E 4GUXA 2BDIA 1QQ4A 1O2WA 7GCHF 5F8ZA 4ZXYH 1OWHA 2R2WU 1V6DA 4JZDH 1L1GA 4TY6A 1BBRE 4U32A 2YNAA 4BTTB 1YPJH 2OC7A 5GDSH 1TRNA 3LGYA 1C1QA 1NTPA 4O3TA 4MNXA 3U8RH 1TGBA 4B2CA 1LVBA 3K6YA 1UCYH 2UWOA 1AIXH 1C1NA 3SJKA 2A7HA 2V6NA 2G55A 2UWLA 5GJ4B 1PQ5A 1O2VA 1XUGA 4BAKB 3PTNA 5PTPA 1JBUH 1Z8JB 4GSOA 1SB1H 4Q2KA 1SGIB 5L30H 1MTNC 1O3PB 1EB2A 1P2NA 2VIQA 1QJ7B 5EODA 2D26C 2BVXH 1F2SE 1P2KA 2XC4A 1SGPE 2GCTC 1MKWK 1DUAA 3OU0A 3TH2H 5A09A 3ZYDA 1GI9B 2M5TA 2ZQ1A 2BQ7B 4UDWH 1O2JA 3LJOA 5CMXH 1GI6A 5DP9A 1G30B 1O3EA 3IWMA 1KXFA 2WPJS 2Y81A 1O3FA 1LVOA 3ITIA 1O3IA 2KAIA 4ISIH 4ZH8A 1BTZA 3SBKA 1HAVB 2UUFB 1C5MD 5I25A 2Y82A 1J14A 3K2UA 1T8MA 3NZIA 1D3TB 1QJ1B 1KYNA 1HUTH 1E35B 4GHQA 2Z9GA 1OYQA 4ABJA 3ZVBA 3NK8A 1YM0A 2Q6DA 1ZMNA 3KL6A 2PHBA 3E8LA 2GX4A 2GP9B 1Z8RA 1NN6A 1QRWA 2XBVA 1FQ3A 1O2SA 2BM2A 1FZZA 1PQ7A 4J1YA 2BD3A 3RXCA 1BQYA 4ZKNU 3PB1E 2ZNKH 1K1LA 1MTUA 2ANYA 2ZCLP 1W0ZU 2OQUA 4Y8XA 3BTME 5JBTA 2WV4A 1HBTH 1C2FA 1J15A 4MPUA 1QL8A 4QT8C 8KME2 2Z3EA 4JK5A 1Z8GA 2J9NA 1QIXB 3RMNH 1O5EH 1AKSB 1TMBH 1C5SA 3RU4D 3SHCH 4MLFB 1P2MA 4FU8A 1WAYB 1BMMH 1EPTC 1IQJA 3ZVGA 4AB9A 1GI0A 1CE5A 4X8VH 3GCOA 3L3TA 4MNVA 1F5LA 2HALA 1ZGIA 3SV7A 2GTBA 5EW2H 1NRRH 2ZEBA 4LZ1H 1Y5BT 1GJDB 1O2ZA 3RMLH 3TPIZ 3SUEA 3BF6H 4D7FA 2AEIH 4CH2B 2G52A 3MMGA 2F9PA 1CA0C 2UWPA 2HOBA 3E90B 3ATKA 1LHDH 2QN5T 4AG2A 2FYRA 2TIOA 2PUXB 2ZF0H 5DGJA 3TGJE 3CS0A 3EAJA 6CHAB 3MNBA 5EGMA 4MDSA 4THNH 5EXLA 3UWJH 3TVJB 2ULLA 4ABIA 1NY22 5EOKA 1BRCE 1EOLA 2RCEA 3UIRA 1KXDA 4F49A 4PROA 5EG4A 1EZSC 4A1VA 1TMTH 1V2UT 3GY5A 1SLWB 4BAMB 1D4PB 2AIQA 2GV7A 1TB6H 1O2RA 1O2YA 1GGDC 4B74A 1UK2A 4FUCA 2ZIQH 1C1RA 1G37A 3RXJA 3Q3XA 1ESBA 2VIVA 3SNEA 3PMBB 1SGRE 1S6FA 4BTUB 1FMGA 2KAIB 1Y3UA 4MPVA 1OWEA 5C1XA 4JYVH 2ZTZA 3MH6A 1S6HA 1GJCB 4LZ4B 4X2XA 3UQVA 1BZXE 1PJPA 1OOKB 1YPKH 8GCHG 3OY6U 2BMGB 2Z9KA 3T28A 1A2CH 2ZGCA 1IQHA 2BOKA 1V2LT 1AZ8A 1MUEB 1EPTA 3M36A 2DE8A 2OBOA 2VJ1A 1A0HB 1LDTT 1DWEH 4CBNA 1SHYA 3S9AA 1FY3A 1GMHG 1V2PT 2GT7A 1OWIA 1RTLA 1QR3E 3NKKA 2A4GA 6LPRA 3PV4A 1GL0E 1MKXK 3GYMA 1ZPCA 3PMAB 1G3BA 1O2KA 2TPIZ 4ABGA 1V2OT 2CMYA 3D62A 1AB9C 2ZZUH 2WYGA 1K28D 1XKBC 3RC5A 1SLVB 1AFQC 3ZZ9A 3RXQA 4A6LA 5LGOA 3SGQE 4ABDA 3A7YA 4M7GA 1HNEE 1YYY1 3PYHA 1MTNB 2VWLA 1G3EA 1J8AA 2CF9H 1ACBE 2JH0D 3RLWH 3UUZA 2PGQB 1D3PB 1UCYK 1A4WH 1O3LA 1GHAG 2FOGA 5JB8S 1AHTH 1XMNB 2PWXA 1PPGE 1DICA 2ZFSA 5BPEA 1EP5A 2GMTC 1ID5H 2EC9H 3S7HB 3VB4A 1MAYA 3K65B 1SGTA 3U1JB 4K69A 1GI7B 1GL1A 1EJNA 2VVUA 4CHAC 1TRMA 5JB9S 3VEQB 4U01A 1TPAE 2A7CA 1ANEA 2ASUB 1YGCH 3QGJA 5DP4A 4WJG2 3U1IB 1GHYH 3BG4C 1O0DH 5GCHG 2P16A 2ZTYA 1A0LA 3UPEA 3H7OA 3A7ZA 4NIYA 1J9CH 4NA7A 1NFYA 1Q31A 4A92A 1A5GH 4K8YA 1DDJA 1IQLA 1W11U 1K1IA 3QN7A 3TJNA 3MH5A 5JPMH 2LPRA 5A0CA 3F68H 1A1RA 1A61H 4NGAH 2R0KA 4AFSA 1MZAA 2O8LA 1TQ7B 3MNSA 1IQFA 3HK3B 1G2MA 1C1OA 1K1OA 4FUDA 2Z6BD 3EA7A 1UTNA 4FUGA 1GMCG 1C5UA 3M5MA 1Z8IB 4ABAA 1A3BH 2HNTC 4I33A 4JCNA 1Y3YA 4CR5A 3ZZ5A 1ZTJA 1HAOH 1V2QT 3URDA 3QWCH 1GI4A 1PPHE 1BHXB 1QBOA 1JXPA 3OY5U 1PFXC 4MNWA 1O2XA 3P92A 1GJ6A 1CA0B 2H5CA 1GDUA 1CBWC 3RDZA 5A0AE 2BD8A 4Y79A 1GWAA 3MFJA 2G00A 4AYVB 3Q3KA 1G3DA 4DGJA 1C2MA 2P93A 3RU4E 3ZZDA 1O2PA 3RC4A 1HXEH 3LH3A 8GCHF 2VVVA 1C5OH 3BSQA 1XUIA 3O8CA 1O2UA 2I6QA 2Q6FA 2QF0A 1L0ZA 1QFKH 2BXTH 3BTFE 1IQMA 3OX7U 1TAWA 2RG3A 1CVWH 1GMHF 1A5IA 2FODA 5T3HA 1VCPA 3UR9A 1THPB 1SOTA 1Z1JA 1S85A 1GGDB 3PM3A 2NU4E 4ESTE 3A89A 2XNIA 2ZHEH 1GVLA 3EYDA 4UE7H 4NIWA 2F83A 2PGBB 3KGPA 4IMZA 2QXHA 1SQAA 1QRXA 3LT3A 1GJ9B 1BBRH 2IPHA 1SC8U 2HGTH 2FPZA 4ABHA 1NO9H 1LVYA 2V3HH 5HGGA 3KQBA 3VXEH 1N1LA 1QNJA 1T4VH 5DP6A 3SNDA 3PWCA 1GBEA 1SGFA 2FYQA 1QQUA 1T32A 1T8OA 1TBZH 2FM2A 2WPMS 3P8NA 4XSKU 5TJXA 1W3CA 5FBIA 1GHAF 1V2VT 1XX9A 1GVKB 2FLBH 2STBE 1C2JA 2F3CE 1S83A 3ZZCA 1RTKA 2CF8H 1SL3A 3FP7E 1Z6JH 4JZEH 3KQCA 3SJIA 5T6GA 4BAOB 3STJA 1AFQB 1ZRBA 4Y6DA 1G3CA 2ZHQH 2BX4A 3M7TA 4TPIZ 2WPKS 1V2ST 3I29A 1O3CA 4INHA 1A46H 1BRUP 4LK4A 3SU4A 5C3NA 1O2QA 4Y10E 3E16B 1SGQE 2QV1A 2VVCA 3MWIU 6GCHG 2XRCA 3AW1A 3E3TA 2JETC 3ATMA 1QCPA 2BVSH 2ZGXH 2CV3A 2ZCKP 4K5ZA 1K21H 4BTIB 2AMDA 1J17T 3DD2H 5E0JA 1XUJA 1MD8A 3BTGE 1KTSB 4CRDA 1C1UH 2GMTB 1O30A 2HPPH 1WYKA 2GZ7A 2PKAA 1W10U 3QDZB 2UUJB 1O3AA 2BDBA 2B0FA 1NZQH 2BDHA 1GBHA 3RXOA 4CHAB 3N7OA 3F9GA 1DWDH 1UK3A 4YESB 1P11E 2NU1E 5K7RA 1EX3A 1SGEE 1YPHE 2FP7B 2PTNA 4AYYB 2BLVA 4K3JA 3V13A 2TGAA 2G5VA 3EGKH 1HJ8A 1K1PA 2FEQH 1GHWH 1G32B 3E6PH 4HI3A 1ZR0A 4WXVA 4NA8A 1GMCF 1LQEA 1SLUB 1O3DA 1Y8TA 2SGAA 1HAVA 3G01A 4I8KA 1EZXC 4XOJA 4DIIH 1C4Y2 2OCVB 1FAXA 4WVPE 3SV6A 1BT7A 2A45B 3LGIA 1O2MA 1EAIA 1OP0A 3PTBA 5DJ7A 4D8NA 3QZRA 1TABE 1W2KH 4A7IB 8LPRA 2P3TB 3H7TA 5J4QA 1GI8B 3A81A 1DXWA 3W94A 4AFQA 1JWTA 3BIVH 1GCTB 3LPRA 3RXSA 3A87A 3KF2A 4CRCA 1F0UA 1GPZA 1S84A 1AGJA 3V0XA 1DY8A 5EXMA 5F6MA 2FDAA 4WXIA 1NM6A 4ZUHA 3QZQA 2BY6X 1BTWA 2PLXA 5IYTA 4INLA 1HYLA 1GBKA 1QA7A 1GBMA 2W7UA 2HPQH 1AE5A 1YBWA 2BVRH 3VXFH 1SQTA 3EQ0H 5C67A 4I8HA 3S9CA 3QK1A 1CBWB 4DJZB 2C8XB 4Y7BA 4RN6A 1T7CA 4ASHA 2PR3A 2VIOA 2FI3E 2J4IA 1C5RA 3LGUA 1O3NA 1FONA 3W95A 2TRMA 1C2KA 2J94A 4CR9A 4X8UH 1MD7A 3ZZBA 1FV9A 5FCKA 4ABBA 1O3OA 1L4ZA 1P9SA 5T6DA 1VJ9U 4MQAA 3PROA 1YPMH 2C4FH 3SI3H 2ZDAH 1S0QA 2EEKA 3BV9B 3Q00A 4B2AA 5SGAE 3ELAH 1BTYA 1O3MA 2F9NA 5HM9A 1CHOF 1HFDA 1P2IA 5JBCS 2FOMB 1DX5M 4AB8A 3IITA 4MPWA 2PKAB 2B9LA 2C3SA 5AFZH 2XC5A 1O5BB 3TK5A 3TIUA 2ZI2H 3R3GB 1XXFA 1TGCA 2ZKSA 4O9VA 1SVPA 1UTQA 1TA6A 3GDUA 4NSYA 3PLKA 4OGXA 1WQSA 1TNLA 3UQOA 4GAWA 1D9IA 3U69H 3E0PB 3T26A 2BXUH 3SN8A 2Q1JA 5GPIB 2C8ZB 2AS9A 1ZHMA 3VPKA 3BTHE 1SGYE 1H8DH 3RXTA 4K8BA 1YC0A 6GCHF 3GDSA 3TITA 2SGDE 3P8FA 1SGNE 1ZTLA 1BJUA 1P05A 2Z7FE 3MTYA 2BD7A 1GMDG 4X0WU 3K9XB 2ZDNA 1BMAA 4OS7A 1LKAA 1PQ8A 1VITG 3SHAH 5C1YA 2XC0A 1EQ9A 3BTTE 4CH8B 2QCYA 3V3MA 5J4SA 1P04A 4OS1A 1SSXA 4GLYA 4FUHA 4E05H 1DT2A 2H1UA 3K6ZA 1UVUH 3URCA 1GBIA 1HAXB 2JETB 3JZ1B 1O38A 3T2NA 2IOTA 2C8YB 2P8OC 4IC5A 1GI2A 3ZZ4A 3MI4A 1PPEE 7ESTE 2R0LA 2GZ9A 2VWNA 3LGTA 4ZHMU 1ZMLA 2BDAA 3NCLA 1ANCA 2HRVA 1CU1A 3U9AH 1QJ6B 5A8YA 2FLRH 3NUMA 1W8BH 4WWYA 1ETSH 4BXWA 3HKJB 2CGAA 4XBBA 1PQAA 3I77A 1GDQA 4A5TS 1AVWA 1NESE 2FZZA 2XBWA 5AHGH 3UWIA 4XE4A 4FUJA 1MAXA 4UD9H 1UTOA 2ZGJA 2O8WA 3ZZ7A 4D7GA 3T25A 5TCCA 1HRTH 1K1JA 1W14U 1YPEH 1CSOE 3ZVFA 1O32A 2ODYB 5FX6A 2P3FH 3UY9A 3VGCC 4X1PU 2ILNA 4IN2A 4X8SH 2QAAA 1CT4E 3BEIB 3SUFA 4IMQA 3BTWE 3GY3A 1K9OE 1AVGH 1C1MA 1EKBB 1LHEH 5TCAA 3UOPA 4AG1A 2ZDLA 2QA9E 2ZPRA 1ZSLA 4H6TA 4XBCA 1C5LH 3B8JA 2FOBA 5AVDA 3HATH 1C9PA 1QBNA 1LPGB 4I31A 3GOVB 1WQVH 2BHGA 3EDXB 2NU2E 1O39A 1DUEA 3A8DA 1BTPA 2WV5A 1GJAB 3L6PA 2ZQ2A 2PFEA 2ZFFH 5I46H 3SU5A 3QX5H 3SJ8A 1NRSH 1OSSA 3VB6A 3NWUA 3U8TH 2A31A 1QRZA 3CP7A 3VB7A 3M7UA 2XBYA 1TX6A 1GJ5H 2J38A 3VB5A 2SGPE 1BUIA 5JYIA 4I32A 1AD8H 2HLCA 1SGFG 1HDTH 2H2ZA 4ZXXH 2XXLA 3A8CA 1ETTH 3A7WA 1RIWC 3LU9B 3HPTB 3MU8A 1W7XH 2O8UA 1FIWA 1UHBA 4O03A 1H8IH 1VR1H 3KCGH 2IN2A 1LHCH 2XWAA 3SQEE 1G36A 2OQ5A 3LH1A 2FS8A 1MCVA 1C5WB 1Q3XA 1UTJA 3O8DA 4KTUA 2ZCHP 4F4OC 1ELCA 3FZZA 1MTSA 4DW2U 2OC1A 2BDYA 3SW2B 3TNSA 4JYUH 2AFQB 1AU8A 1O36A 2ZU1A 4U30A 5EQQA 1O2IA 1UO6A 2FOAA 2Z3DA 5EQRA 1GMDF 2BZAA 2VGCC 3R0FA 1N6XA 3A84A 9LPRA 2Y6TA 4DURA 1S82A 1VITF 1ARBA 1BRBE 2CHAB 1C5XB 1TX8A 2ESTE 4ZMAH 1XXDA 1V2WT 2C8WB 2J34A 3SZNA 3SV9A 3FP6E 4ZHLU 5C1UA 1O5AB 1YF4A 3KQDA 1ESAA 1YPHC 1GHXH 2YOLA 2STAE 5E0GA 2VH6A 1O3GA 1IOEA 1RS0A 7LPRA 1O2GH 2FXRA 1L1NA 2I6SA 1DSUA 2ODPA 2A32A 1E38B 1SFIA 1S0RA 2WYJA 2J92A 4UFGH 3A86A 1NRNH 4KP0A 1D3QB 3MHWU 3UOUA 2XYAA 1WSSH 1VCQA 2Y5GA 4E7RG 4X8TH 1HLTH 4Q7ZA 3P6ZB 4ZKOU 2XWBI 2F91A 1W12U 4BANB 2AGIX 1S5SA 2D2DA 2A2XH 1F0RA 2PV9B 1KXAA 1LMWB 3RXEA 4FUFA 5DK1A 5LPFA 2GD4B 2FS9A 3GY4A 4X1SU 3VFEA 1UVOA 3P70B 2TGPZ 1BOQA 1PPZA 2K1QA 1THSH 2A2QH 1PPBH 2VB0A 4ZROA 1GJBB 3DFJA 4LXBH 3E0NB 4KGAA 1KLJH 1GCTC 1ELBA 2XTTB 3EE0B 3A7TA 3Q77A 2P8OB 4UFDH 2CN0H 2SGEE 2ZFPH 4Q7YA 2O8MA 1OS8A 1AVXA 3TH4H 4I8JA 2BY9X 4NG9H 4GPGA 2THFB 2A4RA 3BN9A 4TYDA 1GBAA 3TJOA 3A7VA 1GI3A 1DE7H 1N8OC 1XM1A 3A7XA 4NZLA 4INKA 4OS5A 2PTCE 5DP7A 3RP2A 2RA0A 2HWLB 4SGAE 2VIDA 1SHHB 4GHTA 1TIOA 4NFFA 1IQIA 1UHBB 4XDEA 4YO9A 3BTDE 1LPKB 1KXCA 3AW0A 3I78A 1GHBG 4X6MA 1F0SA 1SPJA 1TA2A 3BTKE 4NCYA 4ISOA 3ATWA 5HM2A 1TNGA 1QGFA 2OC8A 4B71A 3M5NA 2IJOB 4KELA 2A7JA 3P17H 4WMFA 1E0FD 4IC6A 1S81A 2GCHG 1P2QA 1INCA 3VGCB 4YLUA 1ELEE 1FN8A 1V2MT 1IAUA 1Y3VA 5FAHA 1TBRH 1P09A 1ZMJA 2H9HA 5T6FA 1BCUH 1O2TA 2BLOA 2ZO3H 4AORA 4AZ2B 2ANWA 1C1WH 1LPZB 3BTEE 1HCGA 4DIHH 4MTBA 1TNJA 5ABWA 1W7GH 3FFGA 2QY0B 2B7DH 2BY7X 2FOHA 4J2YB 3LONA 3U98H 1KIGH 2PUQH 2W5EA 4Y0ZE 1GBTA 1MKWH 1DITH 2OXSA 1P10A 2ZTXA 1YLCA 3P8OA 1JMOH 5EXNA 1AN1E 1FIZA 1TBQH 2C93B 2QXGA 1TPPA 1TPOA 1FDPA 2A5AA 1Y3WA 3RMMH 1TPSA 2OTVA 4OS2A 4JZ1A 1XUKA 1WTHD 3LDXH 5ESTE 7GCHG 2GV6A 5CHAB 1HGTH 1TX7A 2W3IA 1QL7A 8ESTE 1C5NH 2BOHB 2VWOA 3DA9B 4FVBA 1B5GH 1DFPA 1J16A 1PPFE 1AZZA 1SQOA 1RIWB 1P06A 2SFAA 2Z3CA 1TYNA 3D65E 3SORA 1Y3XA 2EI6A 4YM9A 1EZQA 2G81E 1O33A 1O37A 1VCWA 2D8WA 3FANA 2DUCA 2R3YA 1L1JA 4BAHB 3M7QA 5EPYA 1TGNA 1YCPH 3QUMP 1MBQA 4GVUA 5IDKA 4B73A 1O3KA 4X1NU 4CRFA 4AGJA 3Q76A 1AI8H 4FUEA 3ATIA 4KTCA 3RM0H 1EP6A 1GDNA 3C27B 3ZVEA 5K0HA 3LJJA 2VGCB 5GCHF 1KXEA 1C2DA 3KIDU 1OYTH 4X6PA 4NFEA 1UTPA 4OS6A 5HXFA 2GGVB 2GDEH 2Y7ZA 2UUYA 3MU5A 1DS2E 3S69A 1W13U 4XBDA 2V3OH 3M5LA 4JZFH 3S9BA 2ALVA 2P59A 4X1RU 3GCTG 2PSXA 3MO3A 2FX6A 1O5FH 4RKOB 1ANBA 3RXPA 1O31A 1IQKA 1O2NA 3OTJE 1BMNH 3FAOA 1SI5H 1DANH 5C20A 3TLOA 4B75A 3NXPA 2YNBA 1RGQA 4NWLA 1HPGA 3SNCA 2ZP0H 1LHGH 3ZVDA 1AWFH 1TNHA 4K60A 1DWCH 1L2EA 2BYAX 1MBMA 1ESTA 3LKWA 1C5VA 2VU8E 3LGWA 3FVFB 1UMAH 4A1XA 2H5DA 4ISLA 2CXVA 2ZG0H 3A80A 1ZLRA 3D23A 1EJMA 4D9RA 3UFAA 1AO5A 1FAKH 1KXBA 4ZHAA 1UTKA 2ANKH 3AVZA 5LPRA 3SGBE
chains in the Genus database with same CATH superfamily
2KR7A 3A82A 3TH3H 2ZFRH 3KN2A 3AASA 1FY1A 2W6ID 1EUFA 4B76A 1K1NA 1H8ED 5FX5A 4K1SA 2QGRA 2PKSC 1C2LA 3RXHA 1HAZB 3PMJA 1X7AC 4IBLH 4IGDA 1QHRB 1AWHB 3ZV8A 2DE9A 2W3KA 3F9HA 2GCHF 3WW7A 3SU6A 2G4TA 1ZOMA 2V35A 1V2KT 2BY5X 2VBCA 2P95A 1SBWA 1N8OB 2AMPA 3AAVA 2BLWA 3KHVA 5JBAS 2EA3A 2ZECA 3GISB 1ZJDA 2BD4A 4IS5A 1XKAC 2BZ6H 4UONA 3E1XB 1BJVA 3ESTA 3S0NA 1M9UA 4BNRA 1V2NT 3L33A 3RXUA 4H42U 4YZUA 1E1RD 2TGDA 1T8LA 2GVFA 1OHHD 1DSTA 1YPLH 2AIPA 2BDGA 2ZHFH 3C1KA 1MU8B 3PO1B 2AGEX 2CK3D 4U2WA 2PW8H 3ZYEA 3M5OA 3BEUA 1H4WA 1G2LA 2FX4A 3ODFA 3KNXA 5ETXA 2AYWA 4E7NA 2W7SA 5GXPA 4Z0KA 1EFRD 4XRNA 3A88A 1AFEH 2XCNA 1CO7E 1N6YA 5C0TA 1PYTD 5C94A 3A83A 1CQQA 3SU1A 1C5TA 3LC5A 1CT2E 1MABB 4NIVA 2BX3A 3F6UH 5B6OA 1ZZZA 3ZZ6A 2KFWA 3QTOH 1ZTKA 3E91A 2Y80A 2J2UA 1VZQH 2XBXA 2F9VA 3MYWA 2AERH 1NC6A 1P0SH 3TGIE 4ACAA 1GJ8B 2OC0A 2FOEA 2CJIA 3TJVA 2A4QA 1IQEA 5DO4H 2WPHS 4WF8A 3ENSB 4TWYA 4NIXA 1SGDE 4Q7XA 1D6RA 2CHAC 1PYTC 4XD7D 2QIQA 2ZU3A 1LTOA 1G9IE 1BTXA 3UNRA 1C5ZB 3SU2A 5DSFA 4YTAA 3ZVAA 2P3UB 4WY3A 2WPIS 5EU8A 3SU3A 2KM0A 4AOQA 2VWMA 4UFFH 1H8HD 1YLDA 4Y0YE 5A8XA 1FPHH 2LELA 4XFQA 4AX9H 7KMEH 1AUTC 4HTCH 1BBRK 1FY5A 3KEEA 3MNCA 1NRQH 3OFND 5FPTA 4F55A 2ODQA 1V2RT 1DVAH 3OYPA 5C0UA 3LC3A 2QF4A 3A8BA 1SFQB 3UREA 5CDFE 1DPOA 1SKYE 1AE8H 1OP8A 1C1PA 4IN1A 2BLQA 1FY4A 2XW9A 3GCTF 1SQRA 1KLIH 2R3UA 2O9QA 2ZPQA 3DCLA 3MNXA 1V3XA 1VGCC 4X2VA 1C1VH 1P01A 1HJ9A 2ZDKA 3TGKE 4AC9A 1HXFH 2B8OH 4NSVA 5FBEA 2NU3E 1EAUA 2BD5A 3QO6A 4Q63A 1CT0E 1D3DB 4O97A 1LHFH 4R8TB 3RLYH 1O5DH 3RXLA 1UVTH 3TJUA 1HAYB 1ZJKA 1B7XB 2ZC9H 1ZSJA 2R9PA 1EAWA 1W0YH 1FNIA 5DN6D 2JH6D 1YCPK 5E2OA 2GZ8A 1V2TT 3QLPH 2ANMH 3MO6A 1Y59T 3HKIB 3EA9A 1LO6A 4RSPA 1ZPZA 3S7KB 1AQ7A 1HAGE 4RKJB 1MH0A 2SNWA 1JOUB 5F8XA 1QZ8A 5H4IB 3AK5A 4ISHH 1IHSH 5L2ZH 3SYJA 3H5CB 3U28C 1E34B 3MH4A 3DFLA 1GHVH 2WINI 5HYOA 3V7TA 2P94A 4Y71A 4K1TA 1T31A 4VGCC 5A8ZA 1MMJN 2BD9A 2BY8X 1ABJH 2JH5D 2OD3B 4ZCNA 2SNVA 3DUXH 3SGAE 3SJOA 1EATA 1QBVH 3P95A 5E8EH 2Y5FA 3OE7D 1GG6C 4CRGA 1EZUC 5AFYH 1C5PA 2ZU2A 1F5KU 1SLXB 4O3UA 1T8NA 3D49H 5DP8A 1FUJA 2FO9A 5E0HA 5ESBA 2KCYA 3SUGA 1WXRA 1GBJA 1TRYA 4YOGA 1GCDA 2OUAA 2Y7XA 2FOFA 2C90B 1AUJA 2ZFTA 2PKSB 1SR5C 2QC2A 3FOAA 3BIUH 1WOFA 2WPLS 1HJAC 2ZWLH 1YCPM 3MQKC 2QXIA 5EQSA 2FI5E 1HIAA 1NU9A 1ZGVA 4TWWA 1XUHA 2FMJA 4OS4A 1BHXF 2W26A 3M3SA 4P00A 5C2ZA 1KTTB 1KMHB 4UFEH 1TQ0B 5L2YH 1ARCA 4Q80A 3GCHC 1IHTH 4X6OA 5DP3A 1F92A 2IJD1 1K2I1 1Z71A 2VIWA 1GJ7B 1OKXA 3RXAA 1RRKA 1TNIA 3P8GA 3HK6B 1UCYE 4MVNA 3TU7H 3GICB 2A4OA 5CHAC 4YOJA 4B2BA 1C1SA 2BQ6B 2G4UA 2QXJA 3Q3YA 4D76A 1JIMA 1KY9A 1EB1H 4E06H 2G51A 1VJAU 1YPGH 1FN6A 1KDQA 3PV2A 1CA8B 1COWD 1H1BA 4YOIA 2F9UA 2F43B 3DHKH 1O5GH 1ELAA 6ESTA 1QY6A 1ELDE 1MU6B 4SGBE 3RXFA 3WY8A 3RXDA 3FZDA 3SU0A 1F0TA 1C2GA 4B1TA 4BOHA 2LNCA 1OPHB 3RXIA 3LGVA 1DM4B 1NROH 3SV8A 4FUBA 1BRAA 2BD2A 3O8BA 5F8TA 3RXGA 3ODDA 2Y5HA 2EI7A 1PPCE 4HGCA 1LQDB 1TGSZ 3B23B 4AFZA 2KCOA 1UTLM 1A7SA 3AAUA 2VIPA 3LOXA 1TNKA 4WH8A 2R2MB 4LOYH 5C5OA 1NS3A 4CRBA 3SV2H 4BAQB 4Y8ZA 1FI8A 1T4UH 4DT7B 4DY7B 5F03A 1TMUH 4DVAU 3F9EA 2G8TA 1QB1A 1GI1A 1JRSA 1B0EA 1XVOA 5AF9H 2ZA5A 1FLEE 1ZPBA 2RA3A 4NZQA 2GCTB 2OP9A 1XUFA 2ZDVH 3B9FH 3M61U 1VITH 4CBOA 3GY2A 1IQNA 4FXGH 1Y5AT 3ZV9A 1ELFA 1OP2A 1DY9A 2XCFA 3SNBA 1Z6EA 2ZDMA 1QB6A 1ZHPA 3V12A 1K22H 4FVDA 3U8OH 1TLDA 2TBSA 1GBDA 3NPSA 3KQEA 1RXPA 2PSYA 2OBQA 5E2PA 1RD3B 1O2OA 4HZHA 1VGCB 2Q6GA 1NPMA 4JK6A 4YLQH 1UVSH 2ZGHA 1MCTA 1O34A 3PMHB 1E37B 1A3EH 1HIAB 3EA8A 1W0JD 3BTQE 4X2YA 2ALPA 3MU0A 4CREA 1BA8B 5HMAA 2BDCA 4Y7AA 2FTMA 2BB4A 3TNTA 1CGJE 3OAAD 3SNAA 4AFUA 5B6LA 4HFPB 1KLTA 3T27A 4DOQA 1DXPA 3UNQA 1C4V2 2ZU4A 1GJ4H 5FHTA 3TK9A 5G4BA 3A8AA 1Z7KA 1YP9A 1O3JA 4K1EA 1EOJA 1JIRA 1FPCH 1F7ZA 1HAIH 5L6NH 1TONA 2SGFE 2FOCA 1ANDA 2RDLA 3RU4T 1ORFA 3FKSD 2ZGBH 5FCRA 2WUCA 3CS7A 1KDQB 1OX1A 3T62A 2A5KA 1C9TA 2ZHDA 1EAXA 1EPTB 4I7YH 1TE0A 3CNRA 4ZAEA 1UK4A 3HGNA 3PO1C 1BTUA 4VGCB 3VB3A 4I8LA 4MG3A 1QL9A 4Z6AH 1P9UA 1WTGH 2VNTA 3BG8A 3FP8E 1C2HA 1GG6B 5LPEA 2Z9IA 1FXYA 1P12E 1C4U2 3F2GA 3STIA 4ABEA 2ZHWH 1H9HE 2Z94A 4MNYA 3SUDA 1RTFB 5JBBS 3UNSA 3MH7A 2GKVE 2D1JA 4OGYA 1ZHRA 4YT7H 1NT1A 1BTHH 4Y76A 5BRRE 4CRAA 1NFUA 1C1TA 2HNTF 1HJAB 1WV7H 1ZRKA 2FIRH 1P8VC 3SO3A 3F9FA 3T5FH 4Y8YA 1EXFA 4ZKRU 5JDUB 3A85A 4FU7A 2J95A 4KTSA 1NFWA 1C2IA 2H6MA 1BMFD 1CGHA 2FI4E 1HV7A 5EJZA 1O2LA 2LP6A 2WUBA 4AN7A 1GBLA 3LIWA 2GDDA 3GCHB 4GCHG 4TPYA 3M35A 4RT0A 1AMHA 1NU7B 3WWFA 3RM2H 1B0FA 3M37A 5DG6A 1BB0B 3F0OA 1QTFA 4KKDA 1ELTA 4TY7A 1C5QA 3SOSA 2FTLE 9ESTA 1P2JA 3CENA 2ZFQH 1FY8E 1NFXA 1HAHH 4DCDA 1E1QD 1EJAA 1LKBA 1UVPA 3ATLA 4K2YA 5CE1A 1OWDA 2G5NA 3RXMA 3GCNA 3OEHD 3RC6A 3GY6A 4JZIA 3M3VA 2A5IA 1O3BA 1OWKA 2NU0E 3QGNB 3OTPA 3PLBA 3MU4A 3UB0A 3MO9A 5FXLA 1P03A 1MTWA 2K8IA 1OXGA 1NRPH 3BEFB 4R0IA 2BQWB 2UUKB 4FU9A 4YT6H 1CHOG 1ZYOA 5EW1H 2JIZD 5GIBA 1BIOA 3UR6A 1AB9B 1DWBH 1LCYA 3IG6B 4X1QU 3SJ9A 3RXBA 1RFNA 5C5NA 2F9BH 1GBFA 2AMQA 3RUOA 1TALA 4DG4A 2AH4X 4WH6A 3O8RA 1GBBA 2AGGX 3OSYA 4X6NA 5FPYA 3RXKA 2L74A 3ZZ8A 3SI4H 1QURH 4NWKA 3PLPA 2F9OA 3MU1A 1TGTA 2NWNA 3M3TA 3RMOH 1SMFE 2ZU5A 1IQGA 1A5HA 2FWWA 1Q2WA 1Z1IA 1ZSKA 2GT8A 1GHZA 3MOCA 1A0JA 1YKTA 1RJXB 1QA0A 1F5RA 3ZZAA 2EI8A 2O8TA 1L4DA 3RXRA 5A2MH 5GWZA 1OWJA 3FN8A 2ZPSA 4WMDA 1FJSA 4X2WA 3UTUH 1U6QA 4NA9H 1BITA 3DT0H 1KSNA 1SG8B 1ELVA 3ZZ3A 1AY6H 1THRH 3GDVA 2HVXA 4ABFA 4D9QA 4JMYA 3ZVCA 1SOZA 1GBCA 1WBGB 4A1TA 1ETRH 1TOCB 1V2JT 1D6WA 1WU1A 1GHBF 3BG4B 2QF3A 1ABIH 1SGCA 1O3HA 2H9EH 1TFXA 2SGQE 1HB0B 1WCZA 1MZDA 5LH8A 2Z9LA 1DLKB 2OINA 2FESH 6CHAC 1MQ5A 4UEHH 1UJ1A 1QB9A 4Y11E 5DP5A 1DOJA 4ISNA 2TGTA 4ZKSU 2Z9JA 1LVMA 2QYIA 3GY7A 1HAPH 1P2OA 1WUNH 2GJGA 4FUIA 1TOMH 2VH0A 1GI5A 1C2EA 1O5CB 3TK6A 1DLEA 5HIZA 1P3EA 3SQHE 1O2HA 5A0BA 5EPNA 1C5YB 2H9TH 1P57B 3GY8A 3JZ2B 3RXVA 5DPAA 4H4FA 3HGPA 2A1DB 1EASA 3GYLB 4WMEA 1Y5UT 3T29A 1GVZA 1O35A 4AGKA 1JRTA 1TWXB 5F53A 1CHGA 4H6SB 1MTVA 4M9FA 5DKMA 1MKXH 4MPXA 2VINA 2A0QB 1MQ6A 4JYTA 4BXSA 3QTVH 2JKHA 2B5TB 1E36B 1BMLA 1K1MA 1ELGA 1AKSA 1BDAA 1CGIE 4YXWD 2V0BA 4GCHF 5FPSA 2HNTE 1XVMA 3DSPA 4I8GA 2BTCE 1P02A 1H9LB 3F1SB 1P3CA 3PWBA 2OLGA 1H9IE 1UTMA 4IW4E 4GUXA 2BDIA 1QQ4A 1O2WA 7GCHF 3H09A 5F8ZA 4ZXYH 1OWHA 2R2WU 1V6DA 4JZDH 1L1GA 4TY6A 1BBRE 4U32A 2YNAA 4BTTB 1YPJH 2OC7A 5GDSH 2QF5A 1TRNA 3LGYA 1C1QA 1NTPA 4O3TA 4MNXA 3U8RH 1TGBA 4B2CA 1LVBA 3K6YA 1UCYH 2UWOA 1AIXH 1C1NA 3SJKA 2A7HA 2V6NA 2G55A 2UWLA 5GJ4B 1PQ5A 1O2VA 1XUGA 4BAKB 3PTNA 5PTPA 1JBUH 1Z8JB 4GSOA 1SB1H 4Q2KA 1SGIB 5L30H 1MTNC 1O3PB 1EB2A 1P2NA 2VIQA 1QJ7B 5EODA 2D26C 2BVXH 1F2SE 1P2KA 2XC4A 1SGPE 2GCTC 1MKWK 1DUAA 3OU0A 3TH2H 5A09A 3ZYDA 1GI9B 2M5TA 2ZQ1A 2BQ7B 4UDWH 1O2JA 2JJ2D 3LJOA 5CMXH 1GI6A 5DP9A 1G30B 1O3EA 3IWMA 1KXFA 2WPJS 2Y81A 1O3FA 1LVOA 3ITIA 1O3IA 2KAIA 4ISIH 4ZH8A 1BTZA 3W1EA 3SBKA 1HAVB 2UUFB 1C5MD 5I25A 2Y82A 1J14A 3K2UA 1T8MA 3NZIA 1D3TB 1QJ1B 1KYNA 1HUTH 3ZIAD 1E35B 4GHQA 2Z9GA 1OYQA 4ABJA 3ZVBA 3NK8A 1YM0A 2Q6DA 1ZMNA 3KL6A 2PHBA 2KCPA 3E8LA 2GX4A 2GP9B 1Z8RA 1NN6A 1QRWA 2XBVA 1FQ3A 1O2SA 2BM2A 1FZZA 1PQ7A 4J1YA 2BD3A 3RXCA 1BQYA 4ZKNU 5FL7D 3PB1E 2ZNKH 1K1LA 1MTUA 2ANYA 2ZCLP 1W0ZU 2OQUA 4Y8XA 3BTME 5JBTA 2WV4A 1HBTH 1C2FA 1J15A 4MPUA 1QL8A 4QT8C 8KME2 2Z3EA 4JK5A 1Z8GA 2J9NA 1QIXB 3RMNH 1O5EH 1AKSB 1TMBH 1C5SA 3RU4D 3SHCH 4MLFB 1P2MA 4FU8A 1WAYB 1BMMH 1EPTC 1IQJA 3ZVGA 4AB9A 1GI0A 1CE5A 4X8VH 3GCOA 3L3TA 4MNVA 1F5LA 2HALA 1ZGIA 3SV7A 2GTBA 2RFKC 5EW2H 1NRRH 2ZEBA 4LZ1H 1Y5BT 1GJDB 1O2ZA 3RMLH 3TPIZ 3SUEA 3BF6H 4D7FA 2AEIH 4CH2B 2G52A 3MMGA 2F9PA 1CA0C 2UWPA 2HOBA 3E90B 3ATKA 1LHDH 2QN5T 4AG2A 2FYRA 2TIOA 2PUXB 2ZF0H 5DGJA 3TGJE 3CS0A 3EAJA 6CHAB 3MNBA 5EGMA 4MDSA 4THNH 5EXLA 3UWJH 3TVJB 2ULLA 4ABIA 3SZEA 1NY22 5EOKA 1BRCE 1EOLA 2RCEA 3UIRA 1KXDA 4F49A 4PROA 5EG4A 1EZSC 4A1VA 1TMTH 1V2UT 3GY5A 1SLWB 4BAMB 1D4PB 2AIQA 2GV7A 1TB6H 1O2RA 1O2YA 1GGDC 4B74A 1UK2A 4FUCA 5GNDA 2ZIQH 1C1RA 1G37A 3RXJA 3Q3XA 1K0HA 1ESBA 2VIVA 4I86A 3SNEA 3PMBB 1SGRE 1S6FA 4BTUB 1FMGA 2KAIB 1Y3UA 4MPVA 1OWEA 5C1XA 4JYVH 2ZTZA 3MH6A 1S6HA 1GJCB 4LZ4B 4X2XA 3UQVA 1BZXE 1PJPA 1OOKB 1YPKH 8GCHG 3OY6U 2BMGB 2Z9KA 3T28A 1A2CH 2ZGCA 4Z1MD 1IQHA 2BOKA 1V2LT 1AZ8A 1MUEB 1EPTA 2YMSD 3M36A 2DE8A 2OBOA 2VJ1A 1A0HB 1LDTT 1DWEH 4CBNA 1SHYA 2QE7D 3S9AA 1FY3A 1GMHG 1V2PT 2GT7A 1OWIA 1RTLA 1QR3E 3NKKA 2A4GA 6LPRA 3PV4A 1GL0E 1MKXK 2WV9A 3GYMA 1ZPCA 3PMAB 1G3BA 1O2KA 2TPIZ 4ABGA 1V2OT 2CMYA 3D62A 1AB9C 2ZZUH 2WYGA 1K28D 1XKBC 3RC5A 1E79D 1AFQC 1SLVB 3ZZ9A 3RXQA 4A6LA 5LGOA 3SGQE 4ABDA 3A7YA 4M7GA 2F4LA 1HNEE 1YYY1 3PYHA 1MTNB 2VWLA 2V3MA 1G3EA 1J8AA 2CF9H 1ACBE 2V7QD 2JH0D 3RLWH 3UUZA 2PGQB 1D3PB 1UCYK 1A4WH 1O3LA 1GHAG 2FOGA 5JB8S 1AHTH 1XMNB 2PWXA 1PPGE 1DICA 3PRDA 2ZFSA 5BPEA 1EP5A 2GMTC 1ID5H 2EC9H 2OK5A 3S7HB 3VB4A 1MAYA 3K65B 1SGTA 3U1JB 4K69A 1GI7B 1GL1A 1EJNA 2VVUA 4CHAC 1TRMA 5JB9S 3VEQB 4U01A 1TPAE 2A7CA 1ANEA 2ASUB 1YGCH 3QGJA 2K0QA 5DP4A 4WJG2 3U1IB 1GHYH 3BG4C 1O0DH 5GCHG 2P16A 2ZTYA 1A0LA 3F2FA 3UPEA 3H7OA 3A7ZA 4NIYA 1J9CH 4NA7A 1NFYA 1Q31A 4A92A 1A5GH 4K8YA 1DDJA 1IQLA 5KEDA 1W11U 1K1IA 3QN7A 3TJNA 3MH5A 5JPMH 2LPRA 5A0CA 3F68H 1A1RA 1A61H 4NGAH 2R0KA 4AFSA 1MZAA 2O8LA 1TQ7B 3MNSA 1IQFA 3HK3B 1G2MA 1C1OA 1K1OA 4FUDA 2Z6BD 3EA7A 1UTNA 3UAIC 4FUGA 1GMCG 1C5UA 3M5MA 1Z8IB 4ABAA 1A3BH 2HNTC 4I33A 4JCNA 1Y3YA 4CR5A 3ZZ5A 1ZTJA 1HAOH 1V2QT 3URDA 3QWCH 1GI4A 4OM9A 1PPHE 1BHXB 1QBOA 3F3BA 1JXPA 3OY5U 1PFXC 4MNWA 1O2XA 3P92A 1GJ6A 1CA0B 2H5CA 1GDUA 1CBWC 3RDZA 5A0AE 3N7EA 2BD8A 4Y79A 1GWAA 3MFJA 2G00A 4AYVB 3Q3KA 1G3DA 4DGJA 1C2MA 2P93A 3RU4E 2HVYB 3ZZDA 1O2PA 3RC4A 1HXEH 3LH3A 8GCHF 2VVVA 1C5OH 3BSQA 1XUIA 1NBME 2PP6A 3O8CA 4ACBA 1O2UA 2I6QA 2Q6FA 2QF0A 1L0ZA 1QFKH 2BXTH 3BTFE 1IQMA 3OX7U 1TAWA 2RG3A 1CVWH 1GMHF 2HLDD 1A5IA 2FODA 5T3HA 1VCPA 3UR9A 1THPB 1SOTA 1Z1JA 1S85A 1GGDB 3PM3A 2NU4E 4ESTE 3A89A 2XNIA 4ASUD 2ZHEH 4Q4LA 1GVLA 3EYDA 4UE7H 4NIWA 2F83A 2PGBB 3KGPA 4IMZA 2QXHA 1SQAA 1QRXA 3LT3A 3F2HA 3OEED 1GJ9B 1BBRH 2IPHA 1SC8U 2HGTH 2FPZA 4ABHA 1NO9H 1LVYA 2V3HH 5HGGA 3KQBA 3VXEH 1N1LA 1QNJA 1T4VH 5DP6A 3SNDA 3PWCA 1GBEA 1SGFA 2FYQA 1QQUA 1T32A 1T8OA 1TBZH 2FM2A 2WPMS 3P8NA 4XSKU 5TJXA 1W3CA 5FBIA 1GHAF 1V2VT 1XX9A 1GVKB 2FLBH 2STBE 1C2JA 2F3CE 1S83A 3ZZCA 1RTKA 2CF8H 1SL3A 3FP7E 1Z6JH 4JZEH 3KQCA 3SJIA 5T6GA 4BAOB 3STJA 4HG6A 1AFQB 1ZRBA 4Y6DA 1G3CA 2ZHQH 2BX4A 3M7TA 4TPIZ 2WPKS 1V2ST 3I29A 1O3CA 4INHA 1A46H 1BRUP 4LK4A 3SU4A 5C3NA 1O2QA 4Y10E 3E16B 1SGQE 2QV1A 2VVCA 3MWIU 6GCHG 2XRCA 3AW1A 3E3TA 2JETC 3ATMA 1QCPA 2BVSH 2ZGXH 2CV3A 2ZCKP 3KYFA 4K5ZA 1K21H 4BTIB 2AMDA 1J17T 3DD2H 5E0JA 1XUJA 1MD8A 3BTGE 1KTSB 4CRDA 1C1UH 2GMTB 1O30A 2HPPH 1WYKA 2GZ7A 2PKAA 1W10U 3QDZB 2UUJB 2W6JD 1O3AA 2BDBA 1S6LA 2B0FA 1NZQH 2BDHA 1GBHA 3RXOA 4CHAB 3N7OA 3F9GA 1DWDH 1UK3A 4YESB 1P11E 2NU1E 5K7RA 1EX3A 1SGEE 1YPHE 2FP7B 2PTNA 4AYYB 2BLVA 4K3JA 3V13A 2TGAA 2G5VA 3EGKH 1HJ8A 1K1PA 2FEQH 3EE7A 1GHWH 1G32B 3E6PH 4HI3A 1ZR0A 4WXVA 4NA8A 1GMCF 1LQEA 1SLUB 1O3DA 1Y8TA 2SGAA 1HAVA 3G01A 4I8KA 1EZXC 4XOJA 4DIIH 1C4Y2 2OCVB 1FAXA 4WVPE 3SV6A 1BT7A 2A45B 3LGIA 1O2MA 2EY4C 1EAIA 1OP0A 3PTBA 5DJ7A 4D8NA 3QZRA 1TABE 1W2KH 3NRLA 4A7IB 8LPRA 3DSGA 2P3TB 3H7TA 5J4QA 1GI8B 3A81A 1DXWA 3W94A 4AFQA 1JWTA 2L6OA 1GCTB 3BIVH 3LPRA 3RXSA 3A87A 3KF2A 4CRCA 1F0UA 1GPZA 1S84A 1AGJA 3V0XA 1DY8A 5EXMA 5F6MA 2FDAA 4WXIA 1NM6A 4ZUHA 3QZQA 2BY6X 1BTWA 2PLXA 5IYTA 4INLA 1HYLA 1GBKA 1QA7A 1GBMA 2W7UA 2HPQH 1AE5A 1YBWA 2BVRH 3VXFH 1SQTA 4FOUC 3EQ0H 4TT3D 5C67A 4I8HA 3S9CA 3QK1A 1CBWB 1W0KD 4DJZB 2C8XB 4Y7BA 4RN6A 1T7CA 4ASHA 2PR3A 2VIOA 2FI3E 2J4IA 1C5RA 3LGUA 1O3NA 1FONA 3W95A 2TRMA 1C2KA 2J94A 4CR9A 4X8UH 1MD7A 3ZZBA 1FV9A 5FCKA 4ABBA 1O3OA 1L4ZA 1P9SA 5T6DA 1VJ9U 4MQAA 3PROA 1YPMH 2C4FH 3SI3H 2ZDAH 1S0QA 2EEKA 3BV9B 3Q00A 4B2AA 5SGAE 3ELAH 1BTYA 1O3MA 2F9NA 5HM9A 1CHOF 1HFDA 1P2IA 5JBCS 2FOMB 1DX5M 4AB8A 3IITA 4MPWA 2PKAB 2B9LA 2C3SA 5AFZH 2XC5A 1O5BB 3TK5A 3TIUA 2ZI2H 3R3GB 1XXFA 1TGCA 2ZKSA 4O9VA 5KGOA 1SVPA 1UTQA 1TA6A 3GDUA 4NSYA 3PLKA 4OGXA 1WQSA 1TNLA 3UQOA 3PRBA 4GAWA 1D9IA 3U69H 3E0PB 3T26A 2BXUH 3SN8A 2Q1JA 5GPIB 2C8ZB 2AS9A 1ZHMA 3VPKA 3BTHE 1SGYE 1H8DH 3RXTA 4K8BA 1YC0A 6GCHF 3GDSA 3TITA 2SGDE 3P8FA 1SGNE 1ZTLA 1BJUA 1P05A 2Z7FE 3MTYA 2BD7A 1GMDG 3N99A 4X0WU 3K9XB 2ZDNA 1BMAA 4OS7A 1LKAA 1PQ8A 1VITG 3SHAH 5C1YA 2XC0A 1EQ9A 3BTTE 4CH8B 2KCAA 2QCYA 3V3MA 5J4SA 1P04A 4OS1A 1SSXA 4GLYA 4FUHA 4E05H 1DT2A 2H1UA 3K6ZA 1UVUH 3URCA 1GBIA 3N7DA 1HAXB 2JETB 3JZ1B 1O38A 3T2NA 2IOTA 2C8YB 2P8OC 4IC5A 1GI2A 3ZZ4A 5KECA 3MI4A 1PPEE 7ESTE 2R0LA 2GZ9A 2VWNA 3LGTA 4ZHMU 1ZMLA 2BDAA 3NCLA 1ANCA 2HRVA 1NBMD 1CU1A 3U9AH 1QJ6B 5A8YA 2FLRH 3NUMA 1W8BH 4WWYA 1ETSH 4BXWA 3HKJB 2CGAA 4XBBA 1PQAA 3I77A 1GDQA 4A5TS 1AVWA 4FETA 1NESE 2FZZA 2XBWA 5AHGH 3UWIA 4XE4A 4FUJA 1MAXA 4UD9H 5IK2D 1UTOA 2ZGJA 2O8WA 3ZZ7A 4D7GA 3T25A 5TCCA 1HRTH 1K1JA 1W14U 1YPEH 1CSOE 3ZVFA 1O32A 2ODYB 5FX6A 2P3FH 3UY9A 3VGCC 4X1PU 2ILNA 4IN2A 4X8SH 3FO8D 2QAAA 1CT4E 3BEIB 3SUFA 4IMQA 3BTWE 2M2AA 3GY3A 1K9OE 1AVGH 1C1MA 1EKBB 1LHEH 5TCAA 3UOPA 4AG1A 2ZDLA 2QA9E 2ZPRA 1ZSLA 4H6TA 4XBCA 1C5LH 3B8JA 2FOBA 5AVDA 3HATH 1C9PA 1QBNA 1LPGB 3F0PA 4I31A 3GOVB 4B6FA 1YWUA 1WQVH 2BHGA 3EDXB 2NU2E 1O39A 1DUEA 3A8DA 1BTPA 2WV5A 1GJAB 3L6PA 2ZQ2A 2PFEA 2ZFFH 5I46H 5C17A 3SU5A 3QX5H 3SJ8A 2J5UA 1NRSH 1OSSA 3VB6A 3NWUA 3U8TH 2A31A 1QRZA 3CP7A 3VB7A 3M7UA 2XBYA 1TX6A 1GJ5H 2J38A 3VB5A 2SGPE 2J98A 1BUIA 5JYIA 4I32A 1AD8H 2HLCA 1SGFG 1HDTH 2H2ZA 4ZXXH 2XXLA 3A8CA 1ETTH 3A7WA 1RIWC 3LU9B 3HPTB 3MU8A 1W7XH 2KX4A 2O8UA 1FIWA 1UHBA 5CHBA 4O03A 1H8IH 1VR1H 3KCGH 2IN2A 4RT1A 2YMSC 1LHCH 2XWAA 3SQEE 1G36A 1YLNA 2OQ5A 2FS8A 1MCVA 3LH1A 1C5WB 1Q3XA 1WDIA 1UTJA 3O8DA 4KTUA 2ZCHP 4F4OC 1ELCA 3FZZA 2JDID 1MTSA 4DW2U 2OC1A 2BDYA 3SW2B 3TNSA 4JYUH 2AFQB 1AU8A 1O36A 2ZU1A 4U30A 5EQQA 1O2IA 1UO6A 4TSFD 4F48B 2FOAA 2JJ1D 2Z3DA 5EQRA 1GMDF 2BZAA 2VGCC 3R0FA 1N6XA 2RDEA 3A84A 2Y6TA 9LPRA 4DURA 4B6EA 1S82A 1VITF 1ARBA 1BRBE 2CHAB 1C5XB 1TX8A 2ESTE 3VG8A 4ZMAH 1XXDA 1V2WT 2C8WB 2J34A 3SZNA 3SV9A 3FP6E 4ZHLU 5C1UA 1O5AB 1YF4A 3KQDA 1ESAA 1YPHC 1GHXH 2YOLA 2STAE 5E0GA 2VH6A 1O3GA 1IOEA 1RS0A 7LPRA 1O2GH 2FXRA 1L1NA 2I6SA 1DSUA 2ODPA 2A32A 1E38B 1SFIA 1S0RA 2WYJA 2J92A 4UFGH 3A86A 1NRNH 4KP0A 5T1VA 1D3QB 3MHWU 3UOUA 5EJLA 2XYAA 1WSSH 1VCQA 2J97A 2Y5GA 2WZQA 4E7RG 4X8TH 1HLTH 4Q7ZA 3P6ZB 4ZKOU 2XWBI 2F91A 1W12U 2WHXA 4BANB 2AGIX 1S5SA 2D2DA 2A2XH 1F0RA 2PV9B 1KXAA 1LMWB 3RXEA 4FUFA 5DK1A 5HIYA 5LPFA 2GD4B 2FS9A 3GY4A 4X1SU 3VFEA 1UVOA 3P70B 2TGPZ 1BOQA 1PPZA 2K1QA 1THSH 2A2QH 1PPBH 2VB0A 4ZROA 1GJBB 3DFJA 4LXBH 3E0NB 3WWBA 4KGAA 2AHME 5EJ1A 2WPDD 1KLJH 1GCTC 1ELBA 2XTTB 5HKKD 3EE0B 3A7TA 3Q77A 2P8OB 4UFDH 2CN0H 2SGEE 2ZFPH 4Q7YA 2O8MA 1OS8A 1AVXA 3TH4H 4I8JA 2BY9X 4NG9H 4GPGA 2XOKD 2IPQX 2THFB 2A4RA 2J98B 3BN9A 4TYDA 1GBAA 3TJOA 3A7VA 1GI3A 5EIYA 1DE7H 1N8OC 1XM1A 3A7XA 4NZLA 4INKA 4OS5A 2PTCE 5DP7A 3RP2A 2RA0A 2HWLB 4SGAE 2VIDA 1SHHB 4GHTA 1TIOA 4NFFA 1IQIA 1UHBB 4XDEA 4YO9A 3BTDE 1LPKB 1KXCA 3AW0A 3I78A 1GHBG 4X6MA 1F0SA 1SPJA 1TA2A 3BTKE 2KZ4A 2XNDD 4NCYA 4ISOA 3ATWA 5HM2A 1TNGA 1QGFA 2OC8A 4B71A 3M5NA 2IJOB 4KELA 2A7JA 3P17H 4WMFA 1E0FD 4IC6A 1S81A 2GCHG 1P2QA 1INCA 3VGCB 4YLUA 3GS9A 1ELEE 1FN8A 1V2MT 1IAUA 1Y3VA 5FAHA 1TBRH 2WSSD 1P09A 1ZMJA 2H9HA 5T6FA 1BCUH 1O2TA 2BLOA 2ZO3H 4AORA 4AZ2B 2ANWA 1C1WH 1LPZB 3BTEE 1HCGA 4DIHH 4MTBA 1VKYA 1TNJA 5ABWA 1W7GH 2EQNA 2QY0B 3FFGA 2B7DH 2BY7X 2FOHA 4J2YB 3LONA 3U98H 1KIGH 2PUQH 4P02A 2W5EA 4Y0ZE 1GBTA 1MKWH 1DITH 2OXSA 1P10A 2ZTXA 1YLCA 1UW7A 3P8OA 1JMOH 5EXNA 1AN1E 1FIZA 1TBQH 2C93B 2QXGA 1TPPA 1TPOA 1FDPA 2A5AA 1Y3WA 3RMMH 1TPSA 2OTVA 4OS2A 4JZ1A 1XUKA 1WTHD 3LDXH 5ESTE 7GCHG 2GV6A 5CHAB 1HGTH 1TX7A 2W3IA 1QL7A 8ESTE 1C5NH 2BOHB 2VWOA 3DA9B 4FVBA 1B5GH 1DFPA 1J16A 3PV5A 1PPFE 1AZZA 1SQOA 1RIWB 1P06A 2SFAA 2Z3CA 1TYNA 3D65E 3SORA 1Y3XA 2EI6A 4YM9A 2YMSB 1EZQA 2G81E 1O33A 1O37A 1VCWA 2D8WA 3FANA 2DUCA 2R3YA 1L1JA 4RI0A 3M7QA 5EPYA 4BAHB 1TGNA 1YCPH 4DT4A 3QUMP 1MBQA 4GVUA 5IDKA 4B73A 1O3KA 4X1NU 4CRFA 4AGJA 3Q76A 1AI8H 4FUEA 3ATIA 4KTCA 3RM0H 1EP6A 1GDNA 3C27B 3ZVEA 5K0HA 3LJJA 2VGCB 5GCHF 1KXEA 1C2DA 3KIDU 1OYTH 4X6PA 4NFEA 1UTPA 4OS6A 5HXFA 2GGVB 2GDEH 2Y7ZA 2UUYA 3MU5A 1DS2E 3S69A 1W13U 4XBDA 2V3OH 3M5LA 4JZFH 3S9BA 2ALVA 2P59A 4X1RU 3GCTG 3DSOA 2PSXA 3KQ5A 3MO3A 2FX6A 1O5FH 4RKOB 1ANBA 3RXPA 1O31A 1IQKA 1O2NA 3OTJE 1BMNH 3FAOA 1SI5H 1DANH 5C20A 3TLOA 4B75A 3NXPA 2YNBA 1RGQA 4NWLA 1HPGA 3SNCA 2ZP0H 1LHGH 3ZVDA 1AWFH 1TNHA 4K60A 1DWCH 1L2EA 2BYAX 1MBMA 1ESTA 3LKWA 1C5VA 2VU8E 3LGWA 3FVFB 1UMAH 4A1XA 2H5DA 4ISLA 2CXVA 2ZG0H 3A80A 1ZLRA 3D23A 1EJMA 1FX0B 4D9RA 3KYGA 3UFAA 1AO5A 1FAKH 1KXBA 4ZHAA 1UTKA 1YY3A 2ANKH 3AVZA 5LPRA 3SGBE
chains in the Genus database with same CATH topology
3A82A 3TH3H 2ZFRH 3KN2A 3AASA 1FY1A 1EUFA 4B76A 1K1NA 5FX5A 4K1SA 2QGRA 2PKSC 1C2LA 3RXHA 1HAZB 3PMJA 1X7AC 4IBLH 4IGDA 1QHRB 1AWHB 3ZV8A 2DE9A 2W3KA 3F9HA 2GCHF 3SU6A 2G4TA 1ZOMA 2V35A 1V2KT 2BY5X 2P95A 1SBWA 1N8OB 2AMPA 3AAVA 2BLWA 3KHVA 5JBAS 2EA3A 2ZECA 3GISB 1ZJDA 2BD4A 4IS5A 1XKAC 2BZ6H 4UONA 3E1XB 1BJVA 3ESTA 3S0NA 1M9UA 4BNRA 1V2NT 3L33A 3RXUA 4H42U 4YZUA 2TGDA 1T8LA 2GVFA 1DSTA 1YPLH 2AIPA 2BDGA 2ZHFH 3C1KA 1MU8B 3PO1B 2AGEX 4U2WA 2PW8H 3ZYEA 3M5OA 3BEUA 1H4WA 1G2LA 2FX4A 3ODFA 3KNXA 5ETXA 2AYWA 4E7NA 2W7SA 5GXPA 4Z0KA 3A88A 1AFEH 2XCNA 1CO7E 1N6YA 1PYTD 3A83A 1CQQA 3SU1A 1C5TA 3LC5A 1CT2E 4NIVA 2BX3A 3F6UH 5B6OA 1ZZZA 3ZZ6A 3QTOH 1ZTKA 3E91A 2Y80A 2J2UA 1VZQH 2XBXA 2F9VA 3MYWA 2AERH 1NC6A 1P0SH 3TGIE 1GJ8B 2OC0A 2FOEA 2CJIA 3TJVA 2A4QA 1IQEA 5DO4H 2WPHS 4WF8A 3ENSB 4TWYA 4NIXA 1SGDE 4Q7XA 1D6RA 2CHAC 1PYTC 2QIQA 2ZU3A 1LTOA 1G9IE 1BTXA 3UNRA 1C5ZB 3SU2A 4YTAA 3ZVAA 2P3UB 4WY3A 2WPIS 5EU8A 3SU3A 4AOQA 2VWMA 4UFFH 1YLDA 4Y0YE 5A8XA 1FPHH 4AX9H 4XFQA 7KMEH 1AUTC 4HTCH 1BBRK 1FY5A 3KEEA 3MNCA 1NRQH 5FPTA 2ODQA 1V2RT 1DVAH 3OYPA 3LC3A 3A8BA 1SFQB 3UREA 1DPOA 1AE8H 1OP8A 1C1PA 4IN1A 2BLQA 1FY4A 2XW9A 3GCTF 1KLIH 2R3UA 2O9QA 2ZPQA 3MNXA 1V3XA 1VGCC 4X2VA 1C1VH 1P01A 1HJ9A 2ZDKA 3TGKE 1HXFH 2B8OH 4NSVA 5FBEA 2NU3E 1EAUA 2BD5A 3QO6A 1CT0E 1D3DB 4O97A 1LHFH 4R8TB 3RLYH 1O5DH 3RXLA 1UVTH 3TJUA 1HAYB 1ZJKA 1B7XB 2ZC9H 1ZSJA 2R9PA 1EAWA 1W0YH 1FNIA 2JH6D 1YCPK 5E2OA 2GZ8A 1V2TT 3QLPH 2ANMH 3MO6A 1Y59T 3HKIB 3EA9A 1LO6A 4RSPA 1ZPZA 3S7KB 1AQ7A 1HAGE 4RKJB 1MH0A 2SNWA 1JOUB 5F8XA 5H4IB 4ISHH 1IHSH 5L2ZH 3H5CB 1E34B 3MH4A 3DFLA 1GHVH 2WINI 5HYOA 3V7TA 2P94A 4Y71A 4K1TA 1T31A 4VGCC 5A8ZA 1MMJN 2BD9A 2BY8X 1ABJH 2JH5D 2OD3B 2SNVA 3DUXH 3SGAE 3SJOA 1EATA 1QBVH 3P95A 5E8EH 2Y5FA 1GG6C 4CRGA 1EZUC 5AFYH 1C5PA 2ZU2A 1F5KU 1SLXB 4O3UA 1T8NA 3D49H 5DP8A 1FUJA 2FO9A 5E0HA 5ESBA 3SUGA 1GBJA 1TRYA 4YOGA 1GCDA 2OUAA 2Y7XA 2FOFA 2C90B 1AUJA 2ZFTA 2PKSB 1SR5C 2QC2A 3BIUH 1WOFA 2WPLS 1HJAC 2ZWLH 1YCPM 2QXIA 5EQSA 2FI5E 1HIAA 1NU9A 1ZGVA 4TWWA 1XUHA 2FMJA 4OS4A 1BHXF 2W26A 3M3SA 5C2ZA 1KTTB 4UFEH 1TQ0B 5L2YH 1ARCA 4Q80A 3GCHC 1IHTH 4X6OA 5DP3A 1F92A 1K2I1 1Z71A 2VIWA 1GJ7B 1OKXA 3RXAA 1RRKA 1TNIA 3P8GA 3HK6B 1UCYE 4MVNA 3TU7H 3GICB 2A4OA 5CHAC 4YOJA 4B2BA 1C1SA 2BQ6B 2G4UA 2QXJA 3Q3YA 4D76A 1JIMA 1KY9A 1EB1H 4E06H 2G51A 1VJAU 1YPGH 1FN6A 1KDQA 1CA8B 1H1BA 4YOIA 2F9UA 3DHKH 1O5GH 1ELAA 6ESTA 1QY6A 1ELDE 1MU6B 4SGBE 3RXFA 3WY8A 3RXDA 3FZDA 3SU0A 1F0TA 1C2GA 4B1TA 4BOHA 2LNCA 1OPHB 3RXIA 3LGVA 1DM4B 1NROH 3SV8A 4FUBA 1BRAA 2BD2A 3O8BA 5F8TA 3RXGA 3ODDA 2Y5HA 2EI7A 1PPCE 4HGCA 1LQDB 1TGSZ 3B23B 4AFZA 1UTLM 1A7SA 3AAUA 2VIPA 3LOXA 1TNKA 4WH8A 2R2MB 4LOYH 5C5OA 1NS3A 4CRBA 3SV2H 4BAQB 4Y8ZA 1FI8A 1T4UH 4DT7B 4DY7B 5F03A 1TMUH 4DVAU 3F9EA 2G8TA 1QB1A 1GI1A 1JRSA 1B0EA 1XVOA 5AF9H 2ZA5A 1FLEE 1ZPBA 2RA3A 4NZQA 2GCTB 2OP9A 1XUFA 2ZDVH 3B9FH 3M61U 1VITH 4CBOA 3GY2A 1IQNA 4FXGH 1Y5AT 3ZV9A 1ELFA 1OP2A 1DY9A 2XCFA 3SNBA 1Z6EA 2ZDMA 1QB6A 1ZHPA 3V12A 1K22H 4FVDA 3U8OH 1TLDA 2TBSA 1GBDA 3NPSA 3KQEA 1RXPA 2PSYA 2OBQA 5E2PA 1RD3B 1O2OA 4HZHA 1VGCB 2Q6GA 1NPMA 4JK6A 4YLQH 1UVSH 2ZGHA 1MCTA 1O34A 3PMHB 1E37B 1A3EH 1HIAB 3EA8A 3BTQE 4X2YA 2ALPA 3MU0A 4CREA 1BA8B 5HMAA 2BDCA 4Y7AA 2FTMA 2BB4A 3TNTA 1CGJE 3SNAA 4AFUA 4HFPB 1KLTA 3T27A 4DOQA 1DXPA 3UNQA 1C4V2 2ZU4A 1GJ4H 5FHTA 3TK9A 5G4BA 3A8AA 1Z7KA 1YP9A 1O3JA 4K1EA 1EOJA 1JIRA 1FPCH 1F7ZA 1HAIH 5L6NH 1TONA 2SGFE 2FOCA 1ANDA 2RDLA 3RU4T 1ORFA 2ZGBH 5FCRA 2WUCA 3CS7A 1KDQB 1OX1A 3T62A 2A5KA 1C9TA 2ZHDA 1EAXA 1EPTB 4I7YH 1TE0A 4ZAEA 1UK4A 3HGNA 3PO1C 1BTUA 4VGCB 3VB3A 4I8LA 4MG3A 1QL9A 4Z6AH 1P9UA 1WTGH 2VNTA 3BG8A 3FP8E 1C2HA 1GG6B 5LPEA 2Z9IA 1FXYA 1P12E 1C4U2 3STIA 4ABEA 2ZHWH 1H9HE 2Z94A 4MNYA 3SUDA 1RTFB 5JBBS 3UNSA 3MH7A 2GKVE 2D1JA 4OGYA 1ZHRA 4YT7H 1NT1A 1BTHH 4Y76A 5BRRE 4CRAA 1NFUA 1C1TA 2HNTF 1HJAB 1WV7H 1ZRKA 2FIRH 1P8VC 3SO3A 3F9FA 3T5FH 4Y8YA 1EXFA 4ZKRU 5JDUB 3A85A 4FU7A 2J95A 4KTSA 1NFWA 1C2IA 2H6MA 1CGHA 2FI4E 1HV7A 1O2LA 2WUBA 4AN7A 1GBLA 3LIWA 2GDDA 3GCHB 4GCHG 4TPYA 3M35A 1AMHA 1NU7B 3RM2H 1B0FA 3M37A 5DG6A 1BB0B 4KKDA 1QTFA 1ELTA 4TY7A 1C5QA 3SOSA 2FTLE 9ESTA 1P2JA 3CENA 2ZFQH 1FY8E 1NFXA 1HAHH 4DCDA 1EJAA 1LKBA 1UVPA 3ATLA 4K2YA 5CE1A 1OWDA 2G5NA 3RXMA 3GCNA 3RC6A 3GY6A 4JZIA 3M3VA 2A5IA 1O3BA 1OWKA 2NU0E 3QGNB 3PLBA 3MU4A 3MO9A 5FXLA 1P03A 1MTWA 1OXGA 1NRPH 3BEFB 4R0IA 2BQWB 2UUKB 4FU9A 4YT6H 1CHOG 1ZYOA 5EW1H 5GIBA 1BIOA 3UR6A 1AB9B 1DWBH 1LCYA 3IG6B 4X1QU 3SJ9A 3RXBA 1RFNA 5C5NA 2F9BH 1GBFA 2AMQA 3RUOA 1TALA 4DG4A 2AH4X 4WH6A 3O8RA 1GBBA 2AGGX 3OSYA 4X6NA 5FPYA 3RXKA 3ZZ8A 3SI4H 1QURH 4NWKA 3PLPA 2F9OA 3MU1A 1TGTA 2NWNA 3M3TA 3RMOH 1SMFE 2ZU5A 1IQGA 1A5HA 2FWWA 1Q2WA 1Z1IA 1ZSKA 2GT8A 1GHZA 3MOCA 1A0JA 1YKTA 1RJXB 1QA0A 1F5RA 3ZZAA 2EI8A 2O8TA 1L4DA 3RXRA 5A2MH 5GWZA 1OWJA 2ZPSA 4WMDA 1FJSA 4X2WA 3UTUH 1U6QA 4NA9H 1BITA 3DT0H 1KSNA 1SG8B 1ELVA 3ZZ3A 1AY6H 1THRH 3GDVA 2HVXA 4ABFA 4D9QA 4JMYA 3ZVCA 1SOZA 1GBCA 1WBGB 4A1TA 1ETRH 1TOCB 1V2JT 1D6WA 1WU1A 1GHBF 3BG4B 2QF3A 1ABIH 1SGCA 1O3HA 2H9EH 1TFXA 2SGQE 1HB0B 1WCZA 1MZDA 5LH8A 2Z9LA 1DLKB 2OINA 2FESH 6CHAC 1MQ5A 4UEHH 1UJ1A 1QB9A 4Y11E 5DP5A 1DOJA 4ISNA 2TGTA 4ZKSU 2Z9JA 1LVMA 2QYIA 3GY7A 1HAPH 1P2OA 1WUNH 4FUIA 1TOMH 2VH0A 1GI5A 1C2EA 1O5CB 3TK6A 1DLEA 1P3EA 3SQHE 1O2HA 5A0BA 5EPNA 1C5YB 2H9TH 1P57B 3GY8A 3JZ2B 3RXVA 5DPAA 4H4FA 3HGPA 2A1DB 1EASA 3GYLB 4WMEA 1Y5UT 3T29A 1GVZA 1O35A 4AGKA 1JRTA 1TWXB 1CHGA 4H6SB 1MTVA 5DKMA 1MKXH 4MPXA 2VINA 2A0QB 1MQ6A 4JYTA 4BXSA 3QTVH 2JKHA 2B5TB 1E36B 1BMLA 1K1MA 1ELGA 1AKSA 1BDAA 1CGIE 2V0BA 4GCHF 5FPSA 2HNTE 1XVMA 4I8GA 2BTCE 1P02A 1H9LB 3F1SB 1P3CA 3PWBA 2OLGA 1H9IE 1UTMA 4IW4E 4GUXA 2BDIA 1QQ4A 1O2WA 7GCHF 5F8ZA 4ZXYH 1OWHA 2R2WU 1V6DA 4JZDH 1L1GA 4TY6A 1BBRE 4U32A 2YNAA 4BTTB 1YPJH 2OC7A 5GDSH 1TRNA 3LGYA 1C1QA 1NTPA 4O3TA 4MNXA 3U8RH 1TGBA 4B2CA 1LVBA 3K6YA 1UCYH 2UWOA 1AIXH 1C1NA 3SJKA 2A7HA 2V6NA 2G55A 2UWLA 5GJ4B 1PQ5A 1O2VA 1XUGA 4BAKB 3PTNA 5PTPA 1JBUH 1Z8JB 4GSOA 1SB1H 4Q2KA 1SGIB 5L30H 1MTNC 1O3PB 1EB2A 1P2NA 2VIQA 1QJ7B 5EODA 2D26C 2BVXH 1F2SE 1P2KA 2XC4A 1SGPE 2GCTC 1MKWK 1DUAA 3OU0A 3TH2H 5A09A 3ZYDA 1GI9B 2M5TA 2ZQ1A 2BQ7B 4UDWH 1O2JA 3LJOA 5CMXH 1GI6A 5DP9A 1G30B 1O3EA 3IWMA 1KXFA 2WPJS 2Y81A 1O3FA 1LVOA 3ITIA 1O3IA 2KAIA 4ISIH 4ZH8A 1BTZA 3SBKA 1HAVB 2UUFB 1C5MD 5I25A 2Y82A 1J14A 3K2UA 1T8MA 3NZIA 1D3TB 1QJ1B 1KYNA 1HUTH 1E35B 4GHQA 2Z9GA 1OYQA 4ABJA 3ZVBA 3NK8A 1YM0A 2Q6DA 1ZMNA 3KL6A 2PHBA 3E8LA 2GX4A 2GP9B 1Z8RA 1NN6A 1QRWA 2XBVA 1FQ3A 1O2SA 2BM2A 1FZZA 1PQ7A 4J1YA 2BD3A 3RXCA 1BQYA 4ZKNU 3PB1E 2ZNKH 1K1LA 1MTUA 2ANYA 2ZCLP 1W0ZU 2OQUA 4Y8XA 3BTME 5JBTA 2WV4A 1HBTH 1C2FA 1J15A 4MPUA 1QL8A 4QT8C 8KME2 2Z3EA 4JK5A 1Z8GA 2J9NA 1QIXB 3RMNH 1O5EH 1AKSB 1TMBH 1C5SA 3RU4D 3SHCH 4MLFB 1P2MA 4FU8A 1WAYB 1BMMH 1EPTC 1IQJA 3ZVGA 4AB9A 1GI0A 1CE5A 4X8VH 3GCOA 3L3TA 4MNVA 1F5LA 2HALA 1ZGIA 3SV7A 2GTBA 5EW2H 1NRRH 2ZEBA 4LZ1H 1Y5BT 1GJDB 1O2ZA 3RMLH 3TPIZ 3SUEA 3BF6H 4D7FA 2AEIH 4CH2B 2G52A 3MMGA 2F9PA 1CA0C 2UWPA 2HOBA 3E90B 3ATKA 1LHDH 2QN5T 4AG2A 2FYRA 2TIOA 2PUXB 2ZF0H 5DGJA 3TGJE 3CS0A 3EAJA 6CHAB 3MNBA 5EGMA 4MDSA 4THNH 5EXLA 3UWJH 3TVJB 2ULLA 4ABIA 1NY22 5EOKA 1BRCE 1EOLA 2RCEA 3UIRA 1KXDA 4F49A 4PROA 5EG4A 1EZSC 4A1VA 1TMTH 1V2UT 3GY5A 1SLWB 4BAMB 1D4PB 2AIQA 2GV7A 1TB6H 1O2RA 1O2YA 1GGDC 4B74A 1UK2A 4FUCA 2ZIQH 1C1RA 1G37A 3RXJA 3Q3XA 1ESBA 2VIVA 3SNEA 3PMBB 1SGRE 1S6FA 4BTUB 1FMGA 2KAIB 1Y3UA 4MPVA 1OWEA 5C1XA 4JYVH 2ZTZA 3MH6A 1S6HA 1GJCB 4LZ4B 4X2XA 3UQVA 1BZXE 1PJPA 1OOKB 1YPKH 8GCHG 3OY6U 2BMGB 2Z9KA 3T28A 1A2CH 2ZGCA 1IQHA 2BOKA 1V2LT 1AZ8A 1MUEB 1EPTA 3M36A 2DE8A 2OBOA 2VJ1A 1A0HB 1LDTT 1DWEH 4CBNA 1SHYA 3S9AA 1FY3A 1GMHG 1V2PT 2GT7A 1OWIA 1RTLA 1QR3E 3NKKA 2A4GA 6LPRA 3PV4A 1GL0E 1MKXK 3GYMA 1ZPCA 3PMAB 1G3BA 1O2KA 2TPIZ 4ABGA 1V2OT 2CMYA 3D62A 1AB9C 2ZZUH 2WYGA 1K28D 1XKBC 3RC5A 1SLVB 1AFQC 3ZZ9A 3RXQA 4A6LA 5LGOA 3SGQE