1EASA

Nonpeptidic inhibitors of human leukocyte elastase. 3. design, synthesis, x-ray crystallographic analysis, and structure-activity relationships for a series of orally active 3-amino-6-phenylpyridin-2-one trifluoromethyl ketones
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PORCINE PANCREATIC ELASTASE
publication title Nonpeptidic inhibitors of human leukocyte elastase. 3. Design, synthesis, X-ray crystallographic analysis, and structure-activity relationships for a series of orally active 3-amino-6-phenylpyridin-2-one trifluoromethyl ketones.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase (serine protease)
total genus 58
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1994-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1easA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1easA01
4K1EA 2PUQH 2J38A 3AASA 3OY5U 2GMTB 2AS9A 4MPWA 1K1NA 5I25A 1GDUA 3PMHB 1TQ7B 4TYDA 1O2UA 3MU0A 1IQNA 1K9OE 1YPHE 3TGJE 1VZQH 1H9IE 2ZGXH 4R0IA 3E16B 1QHRB 3SGAE 1P01A 4AG1A 1HUTH 2GV7A 2J92A 1BIOA 2FXRA 2AFQB 2BD4A 3RC4A 4IW4E 1A0JA 3BG4C 3HK6B 2BVRH 2STAE 1L2EA 1VJAU 1CU1A 1GBKA 4WMDA 1ID5H 1F7ZA 1EUFA 2G4UA 3VB6A 5B6OA 3QDZB 2EA3A 2ZQ1A 2Z9IA 3GY6A 2VINA 3SJ9A 2Z7FE 1OYQA 1C4U2 2ZEBA 1W0YH 2ZA5A 5DKMA 5H4IB 1FUJA 4IN2A 1CHOF 9LPRA 3RMNH 1ZTKA 1A5HA 1HAPH 1GHXH 4IC6A 3NWUA 1BJUA 1SFQB 5HXFA 4TWWA 2BY5X 1A3BH 2ZGJA 3BTDE 1LKBA 2XCFA 4GCHG 1XM1A 1PQ5A 2Z6BD 3PMBB 1GMCF 1AKSB 1DICA 1SPJA 5HGGA 4DY7B 3IITA 2FIRH 5JYIA 2JH6D 1LHEH 4A1TA 3LGUA 2GVFA 4NWLA 1QA7A 2RCEA 2K1QA 4SGAE 2YNAA 5BPEA 3U1IB 1LHFH 1V2PT 1S81A 1Z1IA 2NU0E 3BTME 3MTYA 1O3OA 3PTNA 1BHXF 3GYMA 3SU5A 1AY6H 1SFIA 2C8XB 1QRWA 3ZZ4A 2C8YB 2ZCHP 2WPIS 3TITA 1TNLA 3MNCA 1O5FH 1O5DH 3QK1A 2KAIB 2QIQA 1ANDA 1J14A 3IWMA 3P8OA 1CA0B 4JCNA 3NZIA 2DUCA 4ABDA 1QJ7B 6ESTA 1ZLRA 3GCNA 3O8BA 1MBMA 3UQOA 1C2FA 3KGPA 1ZJKA 1IQMA 2WUCA 4I8GA 2ZZUH 6GCHG 5L6NH 3E0NB 1L4DA 2A32A 4K1TA 1GBHA 2ESTE 4K8YA 4NZLA 1XVOA 2FOCA 1HIAA 1Y59T 3T2NA 3F1SB 2NU1E 1QGFA 2A4RA 2SGAA 1JRSA 1O3AA 2FI4E 4IS5A 3UTUH 1AVWA 1O2KA 2C4FH 1DT2A 4ABHA 2UUYA 1FLEE 1T8MA 2A4GA 3OTJE 4MPUA 5C2ZA 1MUEB 2ODQA 3RM2H 3N7OA 2SGDE 2TGAA 1EZQA 1W13U 3LJJA 1Y3VA 2FOGA 4NWKA 2GDEH 1RTFB 2FTLE 2A7HA 1GPZA 1O32A 4WVPE 3UQVA 4RKOB 3U9AH 5A2MH 1GBLA 2VIVA 4AFUA 5AF9H 2AH4X 1OYTH 1JBUH 2PWXA 1OKXA 1FQ3A 1Z6JH 1CGIE 4I32A 4IMQA 2WPMS 1OP2A 1GL1A 3L33A 4BAMB 5ETXA 2O8MA 4M7GA 4HFPB 3NPSA 1NTPA 4X8SH 5FBEA 1UTJA 2ZFSA 4Y8YA 4BAQB 1XUGA 1SGQE 3ENSB 2GZ7A 3M5MA 1PYTC 3LONA 3SU4A 6CHAB 2BVXH 4A7IB 2BD5A 3HGPA 4CRDA 2AMPA 1ESAA 1XMNB 2PR3A 1C1NA 3UREA 2R0KA 1GI1A 1Z1JA 1RD3B 1TNKA 1ESBA 4FUCA 1YP9A 1UVPA 3FANA 1MD8A 3RU4T 1C5NH 2CHAC 3A7VA 1AU8A 1UCYH 1LVBA 3ZZ8A 1B0FA 4DVAU 2WV5A 3SN8A 2BD8A 3ZZ6A 1GVZA 5EXNA 1HV7A 3E1XB 5TCCA 5L30H 2VWOA 1BBRK 1T4UH 4UFGH 5AFZH 3M5LA 1L1JA 1SLVB 3PWCA 2OTVA 1ZPCA 5DP7A 1P10A 3RXMA 5FAHA 1NRPH 2SGPE 3STJA 4YM9A 3AAVA 3SZNA 1GI7B 2F9VA 3ZVBA 1ZSKA 4XE4A 2BYAX 2B8OH 2J95A 3SGBE 1TIOA 2XTTB 1SGFG 3SV9A 1A0LA 1AE5A 2OC8A 4R8TB 5JBCS 1T4VH 1GJBB 1CT2E 1O3IA 4BANB 1YCPH 4DGJA 3BTKE 2HOBA 2GCHG 3ZV8A 3ZYDA 2D8WA 2GCTC 1MTNC 4CRCA 1YPHC 2R2MB 1EZUC 1EATA 1VGCB 3L6PA 2C90B 2GMTC 3ZVEA 1J9CH 4O9VA 2BXTH 4OS2A 1J16A 2Z3DA 1C4V2 3EQ0H 1YKTA 3BEIB 1ELTA 2GKVE 3RXOA 3K6ZA 3LGWA 3UNQA 3STIA 4Q7ZA 2VWMA 2ZU3A 1BRCE 1Z8GA 2VU8E 2ULLA 1QB9A 2WYJA 5FHTA 2Y81A 1ZRBA 4WXIA 1TPAE 1V2KT 1AQ7A 1G2MA 2XWAA 3EA9A 3MU1A 1DXWA 3RU4E 2ZHDA 1TNIA 4H4FA 1S0QA 3QWCH 1K1IA 1EP6A 1AUJA 3A82A 3SUDA 1CHGA 1MZDA 4OS5A 1IQEA 2Y80A 1ANCA 2BDCA 1Y5BT 1ZR0A 4Q80A 1PQ7A 3PYHA 5LH8A 2A2QH 4B74A 2BVSH 3RMMH 1QURH 4ZKRU 3P8NA 2QN5T 4X1RU 1P2MA 5A0CA 5C1XA 2B5TB 4HGCA 1ZGIA 3P92A 1UTQA 5E0HA 1O2JA 3E3TA 1KXAA 3E0PB 5JPMH 2ZCLP 1QNJA 1P57B 2GDDA 4THNH 1N8OB 3TVJB 3RXHA 1ZPBA 3K2UA 2R3UA 4XBCA 5DP4A 1DE7H 3ZYEA 5A8XA 2ANMH 1NM6A 5ESBA 2GTBA 1K1MA 3SHAH 1CA0C 5GDSH 1G3EA 1GBTA 4X2VA 2R0LA 1LCYA 5C5NA 5A09A 3SJIA 4CR9A 4PROA 4B2CA 3LKWA 4FUDA 3S7KB 3FP6E 1GG6B 1S0RA 2SGQE 2R2WU 4FUBA 1V2TT 1UTNA 2P3TB 3GCHB 1RTLA 4XBDA 1FONA 1C1TA 4X2XA 3KCGH 1KXFA 4A1XA 1O2PA 4B2BA 5JB9S 1AD8H 1TQ0B 2JH0D 3LU9B 1K2I1 1GI6A 5FPYA 2ZTXA 3PTBA 5FCRA 1TALA 2O8TA 2XW9A 5GXPA 3T26A 1H4WA 3HKIB 4NIXA 1UK4A 1W0ZU 1PQAA 4MNVA 5FCKA 2XBWA 1C5VA 2J34A 1K21H 1MTWA 1GJDB 4E05H 3BIUH 1MBQA 2ZU2A 3M3VA 1HRTH 1GHWH 1EOLA 1LPZB 2AGIX 1BRAA 2XXLA 7LPRA 4UFEH 1DM4B 2HNTF 4NFFA 3K65B 2BX4A 2LPRA 1GMHF 1P3CA 4Y7AA 2QA9E 1S83A 1BOQA 1WBGB 5HMAA 1GI4A 1ZTLA 2SGFE 4YT6H 1V2JT 2QYIA 1IQLA 4D9QA 1G3DA 2P3FH 3MFJA 3RXAA 1CBWB 4Y76A 3A87A 3ATMA 2NU3E 1F5RA 3SQHE 4TY6A 4WJG2 8ESTE 1G37A 1FNIA 3D49H 1Y3YA 1GMDF 1FMGA 3NK8A 4MVNA 5ABWA 2TPIZ 1A5IA 1O34A 1OP8A 2FOAA 3NXPA 2QAAA 2JKHA 3GYLB 1NC6A 4CR5A 3UOUA 3MO9A 6CHAC 4MNXA 2ZU1A 1RRKA 1V6DA 1W10U 1EPTB 1PPZA 2HRVA 4NGAH 3T25A 2WPJS 4I8JA 1SR5C 4BTTB 4D76A 2B7DH 4D8NA 5JB8S 1GBEA 3F6UH 1MZAA 1NU7B 1AFEH 4UONA 2C8WB 1P06A 1K1PA 2W5EA 1KLIH 4DW2U 3SUEA 1A3EH 1DY9A 1VITF 2I6QA 2Z9JA 1BDAA 3RUOA 3UWIA 4A92A 3A85A 4JZ1A 1GBJA 2J4IA 1AB9B 2Y5FA 3SW2B 1C5SA 1Q31A 3GDUA 3Q3YA 4Z0KA 1C5RA 2EC9H 3UUZA 1ZJDA 1HLTH 1GMCG 1IHSH 4RN6A 3O8CA 1HIAB 3TJOA 3A8CA 1PPHE 2Q6GA 1ZGVA 4BAKB 4F4OC 1GHBG 4DJZB 3LPRA 3U8TH 1BBRH 3CP7A 3RXPA 1YYY1 4AYVB 1TAWA 1T31A 2QF3A 2BLVA 4X6PA 3BTEE 3KHVA 5AFYH 1S6FA 3QGJA 3VB4A 2FS8A 1UCYK 3HK3B 1EKBB 1VGCC 2HPQH 2W26A 1Z8IB 2QY0B 1O3DA 1HXEH 1GI0A 1YM0A 1W2KH 3ZV9A 3I77A 1E0FD 1FIWA 2P8OB 4X6MA 3KF2A 3S69A 1OWKA 5CHAB 1GHYH 4NA8A 5DJ7A 3IG6B 3EE0B 3BSQA 2QCYA 1AWFH 1SQTA 4A5TS 4Y71A 3MHWU 3SOSA 1OOKB 2ZDVH 1AFQB 3RXIA 1SGYE 1O3JA 2FOEA 1ETTH 2H5CA 1GHZA 1PFXC 3A7TA 1LVYA 1BTHH 2H2ZA 3QTVH 2OUAA 1YCPK 3VEQB 1LHCH 3EDXB 3FVFB 2BLOA 1DWCH 1C2KA 1AZZA 2XC4A 4BXWA 1YPJH 3KQEA 1ARCA 3OYPA 1O2TA 1RFNA 3LGYA 4I8LA 1NY22 5CMXH 2IOTA 3GDSA 1HAHH 2ZGCA 1O39A 3E6PH 4MQAA 1F0TA 3GY7A 4Q2KA 1DWEH 1HXFH 5LGOA 1XX9A 1NO9H 1ELGA 4WMEA 1S82A 2F91A 4MNYA 2GV6A 4FUEA 4ISNA 1ZMNA 1ORFA 3DUXH 1TBRH 1O2YA 1GI9B 2G5VA 2Z9GA 3QLPH 1TB6H 2BD2A 2PUXB 2OP9A 5EXMA 2OCVB 4NA9H 1O2GH 1V2UT 1TNHA 4IBLH 1N8OC 1QJ1B 2Y7XA 5DPAA 5CE1A 1PQ8A 1QQ4A 5K0HA 3PM3A 3ZZCA 2THFB 2XCNA 2UWPA 3TH4H 1C2HA 2BOKA 3HKJB 1O3MA 2F9BH 1EOJA 1HFDA 3U8RH 4CHAB 4ZXYH 3S9BA 1DLKB 1VCWA 4FXGH 4K69A 1GJ6A 2H1UA 2XC5A 1A7SA 1GG6C 1KXEA 1V2RT 1KTTB 1QL9A 1C5MD 3GCHC 1GI2A 4HI3A 2UWLA 4U2WA 1Q2WA 3SV2H 2VIQA 5DP5A 1QCPA 2VIOA 3A7WA 1FN6A 1C9PA 4GAWA 5GCHF 2JH5D 6LPRA 1WV7H 1GDQA 2GP9B 1XUJA 4XSKU 3QTOH 4I8HA 4BTIB 1AGJA 2RDLA 3M3TA 3SU3A 1BTUA 2D2DA 3ESTA 4Y11E 4B2AA 2UUJB 3EA7A 1EPTA 1KXBA 2FX4A 3E8LA 4CREA 2BXUH 1WYKA 4WF8A 5E0GA 3GY4A 3EGKH 4AZ2B 4RKJB 4ZROA 3FP7E 2AGEX 2A4OA 3DHKH 1QA0A 1IQGA 2ZG0H 1LO6A 2BX3A 1G3CA 1C1SA 1D3PB 3ZZAA 1TYNA 4DOQA 1MCTA 2HNTE 1GBCA 1L1NA 4AFZA 2BY8X 1C2LA 1O37A 4D9RA 1CBWC 5EQQA 1MKXK 3F9HA 3ODFA 3GY8A 4WXVA 1DUEA 4NFEA 4CRBA 4FU7A 3T5FH 1AIXH 4KGAA 1WQSA 3A81A 3SI4H 1B7XB 3ZZ3A 5C3NA 2BM2A 1GDNA 4Y8XA 1HJAB 3E91A 1AWHB 1VJ9U 1C5PA 5A0AE 1DXPA 4MTBA 2PV9B 1U6QA 1YCPM 1EPTC 3RXCA 1CE5A 1PPCE 3FZZA 4XBBA 4YT7H 3E90B 1QIXB 1F92A 2ODPA 2F9OA 1NRSH 1DSUA 2UUFB 3G01A 3B23B 1O2MA 1TMBH 1DWBH 1SSXA 2ANYA 3M7QA 1O38A 1QB1A 2V3HH 3SNDA 7KMEH 4CH8B 1GHAG 3O8RA 1FN8A 2GT8A 4ABJA 3SU1A 3P6ZB 2I6SA 1TRYA 3VB7A 1FIZA 1BTWA 1SGIB 1QQUA 4D7FA 4WY3A 2FLBH 4WH6A 3TJUA 1AB9C 3MO6A 2BQWB 1B5GH 1F5KU 2VWLA 1O2QA 1EB1H 1RIWB 1WUNH 4NSVA 8GCHF 2XRCA 1GWAA 2XNIA 5A0BA 1UHBA 1RTKA 2P59A 1S85A 4JYTA 3RMOH 3SU0A 1GBIA 3M3SA 5EW2H 2F9PA 5F6MA 1TX6A 2VVVA 3KIDU 5EOKA 5K7RA 1AMHA 1C1OA 1QFKH 2AMDA 1OWDA 1LHDH 4KTUA 1AO5A 2V35A 1J17T 1D3QB 1C2DA 2A0QB 3SNAA 4BXSA 1ABJH 2P8OC 1NU9A 1QR3E 2ODYB 3SGQE 2R3YA 3MI4A 5CHAC 5DP6A 5PTPA 1XKAC 1VCQA 2A7CA 3TK6A 3V3MA 5DO4H 2AMQA 4FUGA 2FMJA 2AERH 4H42U 1AFQC 3M35A 4DURA 5EW1H 2VNTA 3F9EA 2BZAA 3TK5A 2ZNKH 1TPSA 1C5ZB 1F0RA 4AGKA 4B75A 2H9HA 2P3UB 4ZKSU 3RP2A 4B1TA 4LK4A 1EXFA 1N1LA 3QGNB 1MTSA 2YOLA 4YOGA 4YOIA 1HGTH 1N6YA 1E36B 2VIWA 8KME2 1J8AA 3DD2H 1CT0E 2WUBA 1DY8A 4GCHF 3KEEA 1CA8B 5FX6A 1GI3A 1X7AC 4GPGA 4IN1A 1WSSH 1C5TA 3M36A 1AUTC 1V2VT 2YNBA 1H9HE 4Y10E 1F0SA 1GBAA 2BDIA 3RXJA 2IJOB 1TGTA 1EP5A 2TBSA 3AW1A 5EPYA 1MKWH 3I29A 3QN7A 3NKKA 1SI5H 4WWYA 1GBMA 5DP8A 1C1RA 2BLQA 1IOEA 4GHTA 3QO6A 1KLJH 4OGYA 1K22H 3R0FA 2PTNA 4U32A 1TWXB 2BTCE 4O3UA 3F9FA 2PLXA 4J1YA 2ZU5A 2OQUA 5JBAS 2XBVA 1UVOA 3VB3A 1QBNA 1FY3A 4JZEH 6GCHF 1L1GA 2ASUB 2BMGB 4UFFH 1IHTH 4CHAC 5J4SA 5EG4A 3TJVA 2D1JA 1C5WB 1GGDB 3A8BA 1GJ8B 5DGJA 4NIVA 1O2OA 2DE8A 1B0EA 1SGFA 4AG2A 5LPEA 1NFWA 2A5IA 4E06H 1ZHMA 3V0XA 3BV9B 3KQBA 3ZVGA 5FX5A 1O2VA 1HJ8A 1RS0A 3MWIU 3A88A 1QB6A 4H6TA 1QBVH 2GD4B 1JIMA 2V6NA 5HM2A 1HAYB 3A8AA 2FZZA 1H8DH 2V3OH 3RXTA 1UVUH 4DCDA 1SG8B 3S9CA 2Q6DA 2FX6A 1BRBE 4SGBE 4ABGA 3U98H 1O5AB 2XYAA 3GY2A 5GWZA 1ZSJA 2HLCA 2QXJA 2VH0A 2G5NA 2HNTC 3TNSA 1GJ4H 1QL7A 1BRUP 2UWOA 1IQFA 3SHCH 2ZC9H 1TONA 1AZ8A 1C2MA 3KN2A 1W12U 2G55A 1GVLA 3SJ8A 1W7XH 4TPIZ 3DA9B 3GCOA 1A46H 4I8KA 1QRZA 1V2ST 2GZ8A 5DK1A 1C1WH 4FUIA 1DWDH 2ZPRA 2FI5E 5C5OA 1YPEH 1SGRE 4I31A 4NSYA 5E0JA 2P16A 1EX3A 3RXSA 1LQDB 1PPBH 3O8DA 1A0HB 1P9SA 5DG6A 1GHVH 3P95A 3W95A 1ANBA 1HJAC 3M5NA 5TJXA 3PMJA 4ISHH 1MKXH 1PPEE 3MMGA 4TWYA 2ZFTA 3SNCA 3BTGE 3B8JA 4UDWH 1OP0A 4ZKOU 3BTQE 3A84A 4Y6DA 2CJIA 5T6FA 3RLYH 2QV1A 2BDGA 4IGDA 1MMJN 3ZVAA 1H8IH 1THSH 4XFQA 3RM0H 1NPMA 2ZFQH 5JDUB 1TRMA 4GVUA 3TLOA 2BD3A 4NIYA 2NWNA 1MD7A 1ELFA 3RDZA 1PPFE 1V2NT 1ELDE 1YF4A 2W3IA 1G36A 2BHGA 5L2ZH 4B76A 2XBXA 3GCTG 1V3XA 5J4QA 4MG3A 3Q00A 2ZKSA 1HPGA 4FUFA 1G9IE 1UTMA 2FS9A 3UOPA 2FI3E 2G00A 5C1YA 1SLWB 4B71A 2B0FA 2BDYA 2WV4A 1T32A 2ZHEH 1O2RA 1T8LA 4DT7B 3V12A 3F9GA 1NT1A 1RIWC 2OC7A 1QRXA 3AW0A 2GCHF 3RXRA 2RA3A 5DP3A 1EAIA 3H5CB 1C2GA 4OS4A 2FYQA 3KL6A 2VVCA 3LJOA 3PROA 2H6MA 3ATIA 5E2OA 2HWLB 1UTLM 2BDHA 1UVSH 3QUMP 5F8TA 1FXYA 1TA2A 1JMOH 1C1VH 1TMTH 5FBIA 1XVMA 2F83A 2A31A 2C8ZB 1P04A 5T6GA 3S7HB 1P0SH 1O30A 3UPEA 2H5DA 2PHBA 1P12E 2WPHS 1O3PB 1MQ5A 1BTZA 1ETSH 1ANEA 1TX8A 4MDSA 4ZKNU 4YTAA 4Q7XA 4B73A 3DFJA 1O3HA 5GPIB 1O2LA 1A4WH 4LZ4B 4FUJA 1O2SA 1NROH 2WYGA 1YPMH 1CHOG 2SFAA 1SLUB 3FFGA 1C2JA 1TE0A 5C1UA 3QX5H 1EAUA 1LTOA 3KQDA 1LVOA 1EAWA 4JMYA 2OBQA 1V2MT 3KNXA 1XUHA 1O3FA 5EU8A 2ZF0H 1T8NA 3PLBA 5GCHG 1ZMJA 1BMAA 3MOCA 1UCYE 2M5TA 1OWEA 1UK2A 1NS3A 2AEIH 1RJXB 1OWIA 4Y0ZE 3GICB 3MH5A 1EZSC 3PV4A 3SV6A 2CGAA 4NIWA 3SU6A 3PLKA 4XDEA 2TRMA 1DS2E 1H1BA 3VGCB 2ZWLH 2TGTA 1GI8B 2TIOA 3UR6A 2UUKB 1XXFA 1ZZZA 1O31A 1EB2A 4X6NA 3TGIE 1QBOA 1G3BA 1D4PB 2Z94A 2WINI 3TJNA 1IQIA 5EGMA 1P2NA 3GY5A 1C5XB 1O2HA 1V2QT 3MNSA 3BTHE 1CGHA 3ATLA 4MLFB 1SBWA 3FZDA 4X1NU 2QC2A 4D7GA 2FYRA 5IYTA 3SUGA 2ZO3H 3BEUA 1BA8B 1SHYA 2Y5GA 4YLUA 2ZFFH 3RC5A 1Z8RA 1UHBB 1HJ9A 1GGDC 1AN1E 4ZMAH 2H9TH 3CS0A 3LOXA 1LPGB 4OS1A 4UE7H 4MPXA 3A7ZA 3P8FA 1O5CB 3LT3A 3ZZBA 4LZ1H 1TNGA 5EQRA 1O2ZA 1MKWK 5T3HA 3FP8E 5AVDA 4JZFH 1NESE 1C2EA 3UNRA 1G2LA 4ZXXH 3C1KA 1Y5UT 1D9IA 3PLPA 5LPFA 4YLQH 1BT7A 1SGPE 3HGNA 4NG9H 5BRRE 1ELVA 1WOFA 1C2IA 4F49A 4GSOA 1NRQH 2G8TA 2A7JA 1TRNA 1P3EA 2ZDKA 5FPTA 5ESTE 4OS7A 5E2PA 2BD9A 3TNTA 3T62A 2AIQA 1SGDE 3K9XB 3NUMA 2FODA 4XOJA 2GX4A 3SO3A 1E38B 1UJ1A 4X2YA 4K60A 3R3GB 1P9UA 1DSTA 1GJ5H 1D6WA 1F5LA 1ELCA 4CRGA 3JZ2B 5GJ4B 1WU1A 1DANH 2Q6FA 1T7CA 2Q1JA 1ZHRA 1L0ZA 1P2JA 4KELA 2FESH 3SUFA 3ATWA 3ZVDA 2C3SA 3U1JB 1SC8U 2ZPQA 3P17H 1GVKB 2TGPZ 5L2YH 3A89A 3UR9A 1S6HA 1GCDA 4IC5A 2OBOA 2OC1A 1SGCA 1SMFE 3GDVA 3DT0H 1CSOE 3LGVA 1TOCB 2QXHA 1DX5M 3SORA 3W94A 3P70B 1NRRH 1P2IA 2O8WA 2ZPSA 2G51A 3BF6H 3V13A 2HPPH 7GCHF 1Y3XA 2FTMA 1WAYB 1TLDA 1SLXB 2ZGHA 1O3KA 2FOHA 4J2YB 1C5QA 4UD9H 1W8BH 1FAKH 1HYLA 3ELAH 1JIRA 3RXKA 1AE8H 5E8EH 4Q7YA 5SGAE 3LIWA 3SJKA 1L4ZA 1OS8A 3RXFA 1IQKA 2PSYA 1BTXA 1C5LH 1LKAA 1ZTJA 1O3BA 2PKAA 2F9NA 4K2YA 4YO9A 2CMYA 4RSPA 4U30A 1SVPA 4KTCA 1HAVA 4YESB 3PB1E 3CS7A 4HTCH 3BTTE 1GHBF 2ZGBH 2EI8A 2CV3A 2ZDNA 1NFUA 2ZHFH 4CRAA 1GBBA 5A8YA 2ZFRH 3Q76A 2J94A 9ESTA 4ABEA 1UTKA 2FDAA 3A7XA 4JK6A 1FDPA 2JETB 3ZZDA 1WQVH 3LGTA 2G4TA 3D23A 3H7TA 2BDBA 1SQAA 3OY6U 1TBQH 1VCPA 2A1DB 2A5AA 4LXBH 2ZP0H 1HBTH 4CH2B 1C4Y2 1F2SE 2ZECA 3EYDA 1V2LT 3A8DA 5HYOA 2RA0A 3MU4A 4X8UH 4ABIA 1O36A 1YPKH 4JZDH 1CVWH 1EQ9A 3VPKA 1V2WT 1D3TB 1BTPA 1HAXB 4X0WU 3D65E 1AI8H 1KSNA 2Y7ZA 4INLA 2GGVB 1O2WA 2EI7A 4INKA 1MAXA 1MU6B 1IAUA 2BOHB 1SOTA 1QJ6B 2FP7B 3BTFE 3ZZ5A 3TGKE 2PGQB 3RU4D 8LPRA 2BB4A 1JOUB 1WCZA 1TPPA 1CO7E 2PFEA 1IQJA 2VWNA 1FJSA 2IPHA 3EAJA 1P2QA 3LH3A 3V7TA 3B9FH 1ZMLA 1KXDA 1BTYA 2QXIA 3SI3H 1K1OA 2ALPA 2HGTH 1INCA 3DFLA 5TCAA 3VXFH 4ABAA 4NZQA 1E34B 2R9PA 3OU0A 1YPLH 3ODDA 3MU8A 4K1SA 1OSSA 2XC0A 3BIVH 1DDJA 1GCTB 2CN0H 1SL3A 3AAUA 4O03A 3SV7A 1BZXE 1TGCA 3TU7H 3SV8A 1EJAA 1KDQB 5JBTA 1NN6A 1MTUA 1J15A 3VGCC 4X6OA 1Y8TA 5HM9A 2BDAA 1TNJA 1LMWB 1SB1H 2CXVA 3WY8A 1FV9A 2G52A 1O3NA 2Z9KA 3K6YA 4DIHH 2QXGA 3TH2H 2O8UA 1KYNA 2NU2E 1BBRE 1AHTH 1XUFA 1P11E 2ZQ2A 2W7SA 2FLRH 4MNWA 1TMUH 1BITA 1DFPA 4X1SU 3SNBA 1QL8A 4ISIH 1LDTT 2ANKH 2SGEE 5EXLA 1C5OH 1QY6A 1W14U 2GT7A 1S5SA 3NCLA 4AGJA 1M9UA 1KIGH 2WPKS 5F8XA 3SNEA 1HAOH 3I78A 4H6SB 2OC0A 2ZCKP 4DG4A 1THPB 1BB0B 2BY6X 1W7GH 1ESTA 3VXEH 1P2KA 1TGSZ 1Y3WA 2PKSB 1O3CA 4X2WA 4AFQA 1GI5A 4ASHA 1YLDA 3LH1A 4OS6A 3SBKA 1RXPA 4YOJA 2ZTZA 3LC5A 2QF0A 4UEHH 1UVTH 5GIBA 2ZHWH 3UNSA 3TH3H 1XUKA 2OXSA 4ZHAA 1GMHG 2SNVA 1Z71A 2ZFPH 2PTCE 3A7YA 1TPOA 4GHQA 2OINA 2BQ6B 2CF8H 1K1LA 1SHHB 4ISOA 2VIPA 1P2OA 3A83A 1GBFA 1HAIH 1GJAB 3RXVA 1NRNH 4TPYA 7ESTE 4AYYB 2PW8H 1RGQA 1O0DH 1H9LB 2XWBI 3GOVB 1C5YB 1ETRH 3RXDA 1GL0E 3FAOA 1A61H 1ARBA 3MH7A 2FOFA 4AX9H 5F03A 2BD7A 1DITH 2VIDA 2F9UA 2O9QA 3U8OH 4ZHMU 1GMDG 4JK5A 2VVUA 2VGCB 4INHA 1G30B 1ELEE 4X1PU 1ZPZA 3RC6A 1E35B 1VR1H 3Q77A 1YBWA 2BQ7B 4WH8A 3PWBA 1OWJA 3T27A 3URCA 1AKSA 2AGGX 2WPLS 3TPIZ 3F68H 4K5ZA 4JYVH 1AVGH 4HZHA 1P05A 4ZHLU 3RXQA 4KTSA 2Y6TA 1HNEE 3GY3A 1OXGA 1BMNH 2EI6A 1TFXA 1QTFA 1YLCA 3A80A 3SQEE 3Q3XA 1HAZB 2J9NA 3PMAB 5FPSA 1ELBA 1Z6EA 1OPHB 2DE9A 1D3DB 1MH0A 3KQCA 1MAYA 3PO1B 1UO6A 1E37B 1C1PA 1VITG 4QT8C 1GHAF 1MTVA 5G4BA 3RXEA 1F0UA 3BG8A 1DVAH 1C5UA 2KAIA 1O2IA 4Y7BA 1XKBC 4AORA 3S9AA 1ACBE 3OSYA 4VGCB 1HAGE 2HVXA 2ZDMA 1XXDA 1THRH 1P09A 3D62A 5AHGH 2W7UA 3VFEA 1JXPA 1A5GH 1A1RA 1DLEA 1YPGH 4BAHB 3UFAA 3RXGA 4ESTE 1ABIH 1K1JA 2PGBB 1P03A 1PJPA 1G32B 2Y82A 4TY7A 1NZQH 1CQQA 3SU2A 2W3KA 4AFSA 2JETC 1C1QA 1O2NA 5EODA 1BHXB 2AYWA 1O5EH 3MYWA 4ZAEA 1Z8JB 4KKDA 2BY7X 4AOQA 3P8GA 4UFDH 1SOZA 1UTPA 1BMMH 1KY9A 1EJMA 3BG4B 3BN9A 1UTOA 3MO3A 1ZSLA 1EASA 1FY5A 1TBZH 4CRFA 1PYTD 1V2OT 2QGRA 5C20A 1OWHA 4LOYH 3TIUA 3MNBA 5C67A 3TK9A 4Y79A 1KDQA 1T8OA 3VB5A 5JBBS 3GISB 1KTSB 1ZYOA 3BTWE 2IN2A 3L3TA 1CT4E 1KXCA 2SNWA 4GUXA 4BOHA 1ZRKA 1A2CH 4K3JA 5EQSA 4FVBA 3T28A 1IQHA 2O8LA 1MU8B 1MCVA 3ITIA 4E7NA 2BY9X 2FO9A 3CENA 4ABBA 1FI8A 1W11U 4NCYA 3MNXA 3T29A 1LVMA 1S84A 1SQOA 2TGDA 2G81E 2A45B 4ZH8A 1GJ7B 1WTHD 4AB9A 1O35A 2GZ9A 1OX1A 3ZZ7A 3U69H 4JZIA 2AIPA 1GCTC 1TOMH 2C93B 5IDKA 2ZI2H 3LC3A 3UWJH 1XUIA 2J2UA 2OD3B 2NU4E 4BAOB 2ZDAH 4FU9A 4ISLA 4GLYA 1TA6A 4FU8A 2BLWA 1CGJE 2PKAB 3ZVFA 3ZZ9A 3HATH 1KLTA 1P02A 1HAVB 1NFYA 4KP0A 1NFXA 1Y5AT 4ZUHA 3EA8A 2H9EH 2EEKA 1FPCH 1UMAH 3RMLH 2Z3EA 1BCUH 1TGNA 2B9LA 2OLGA 4A6LA 5I46H 2ZU4A 1YC0A 4FVDA 3LGIA 2A2XH 4K8BA 2ANWA 3AVZA 3QZQA 3URDA 5LPRA 1SGNE 1N6XA 2XBYA 1GJ9B 3HPTB 7GCHG 1TABE 1YGCH 1ZOMA 1VITH 1HCGA 1O3GA 2ZDLA 4X8VH 3S0NA 5F8ZA 1EAXA 3OX7U 1DUAA 1SGEE 4I33A 2PKSC 3A86A 2Z3CA 5T6DA 1HB0B 4CBOA 1EJNA 1O33A 1C1UH 4AB8A 1O5BB 2FM2A 3UIRA 3LDXH 1O3LA 1WTGH 2VJ1A 2P93A 1FY8E 2D26C 3JZ1B 4Y0YE 2P95A 3M7TA 1GJCB 2PSXA 2P94A 2Z9LA 5DP9A 4FUHA 1JWTA 3ATKA 1W3CA 4Y8ZA 1LHGH 3SJOA 2ALVA 1K28D 1FY1A 3MU5A 2ZTYA 1HDTH 1LQEA 2BZ6H 2HALA 2CF9H 2OQ5A 3ZVCA 1DPOA 1FZZA 5FXLA 3M5OA 4BNRA 4YZUA 5EPNA 4JYUH 1FPHH 3M61U 2FOMB 1BMLA 2VGCC 1BQYA 2F3CE 2VB0A 3RXBA 1BUIA 1C1MA 1D6RA 1UK3A 1EZXC 1TX7A 1ZHPA 2CHAB 4A1VA 3BEFB 4O3TA 1DOJA 3QZRA 1O3EA 4ABFA 3MH4A 2FPZA 2A5KA 2RG3A 1ELAA 2FOBA 2ZHQH 4E7RG 3UY9A 3RXUA 1MQ6A 3M7UA 3Q3KA 3RLWH 1P8VC 2A4QA 4CBNA 5A8ZA 3M37A 3PO1C 4BTUB 3RXLA 1FAXA 1Q3XA 2FEQH 4U01A 2VH6A 1GBDA 4X1QU 4IMZA 1O5GH 1BJVA 4O97A 4Z6AH 2ZIQH 1LPKB 2ILNA 1PPGE 4X8TH 3GCTF 4MPVA 2STBE 4OGXA 2FWWA 3H7OA 1JRTA 4I7YH 4VGCC 4WMFA 1Z7KA 1Y3UA 2V0BA 3C27B 4DIIH 4NA7A 1SGTA 1TGBA 3MH6A 1AVXA 8GCHG 2Y5HA 1O2XA 1C9TA 2LNCA 1FY4A 4AN7A 2GCTB 1MTNB
chains in the Genus database with same CATH superfamily
4K1EA 2PUQH 2J38A 3AASA 3OY5U 2GMTB 2AS9A 2V3MA 4MPWA 1K1NA 5I25A 1GDUA 4M9FA 3PMHB 1TQ7B 4TYDA 1O2UA 3MU0A 1IQNA 1K9OE 1YPHE 2J98B 1VZQH 3TGJE 1H9IE 2ZGXH 4R0IA 3E16B 1QHRB 3SGAE 1P01A 4AG1A 1HUTH 2GV7A 1QZ8A 2J92A 1BIOA 2W6JD 2FXRA 2AFQB 2BD4A 3RC4A 4IW4E 1A0JA 3BG4C 3HK6B 2BVRH 2STAE 2YMSC 1L2EA 1VJAU 1CU1A 1GBKA 4WMDA 1ID5H 1F7ZA 1EUFA 2G4UA 3VB6A 5B6OA 3QDZB 2EA3A 2ZQ1A 2Z9IA 3GY6A 2VINA 3N7EA 3WWBA 3SJ9A 2Z7FE 1OYQA 1C4U2 2ZEBA 1W0YH 2ZA5A 5DKMA 5H4IB 1FUJA 4IN2A 1CHOF 9LPRA 3RMNH 1ZTKA 1A5HA 1HAPH 1GHXH 4IC6A 3NWUA 1BJUA 1SFQB 5HXFA 4TWWA 2BY5X 1A3BH 2ZGJA 3BTDE 1LKBA 2XCFA 2PP6A 4GCHG 1XM1A 1PQ5A 2Z6BD 3PMBB 1GMCF 1AKSB 1DICA 1SPJA 5HGGA 4DY7B 3IITA 2FIRH 5JYIA 2JH6D 1LHEH 4A1TA 3LGUA 2GVFA 4NWLA 1QA7A 2RCEA 1WDIA 2K1QA 4SGAE 2YNAA 5BPEA 3U1IB 1LHFH 1V2PT 1S81A 1Z1IA 2NU0E 3BTME 3MTYA 1O3OA 3PTNA 1BHXF 3GYMA 3SU5A 1AY6H 1SFIA 2C8XB 1QRWA 3ZZ4A 2C8YB 2ZCHP 2WPIS 3TITA 1TNLA 3MNCA 1O5FH 1O5DH 3QK1A 2KAIB 2QIQA 1ANDA 1J14A 3IWMA 3P8OA 1CA0B 4JCNA 3NZIA 2DUCA 4ABDA 1QJ7B 6ESTA 1ZLRA 3GCNA 3O8BA 1MBMA 3UQOA 1C2FA 3KGPA 1ZJKA 1IQMA 2WUCA 4P00A 4I8GA 2ZZUH 6GCHG 5L6NH 3E0NB 1L4DA 2A32A 4K1TA 1GBHA 2ESTE 4K8YA 4NZLA 1XVOA 2FOCA 1HIAA 1Y59T 3T2NA 3F1SB 2NU1E 1QGFA 2A4RA 2SGAA 1JRSA 1O3AA 2FI4E 4IS5A 3UTUH 1AVWA 1O2KA 2C4FH 1DT2A 4ABHA 2UUYA 1FLEE 1T8MA 2A4GA 3OTJE 4MPUA 5C2ZA 1MUEB 2ODQA 3RM2H 3N7OA 2SGDE 2TGAA 1EZQA 1W13U 3LJJA 1Y3VA 2FOGA 4NWKA 2GDEH 1RTFB 2FTLE 2A7HA 1GPZA 1O32A 4WVPE 3UQVA 4RKOB 3U9AH 5A2MH 1GBLA 2VIVA 4AFUA 5AF9H 2AH4X 1OYTH 1JBUH 2PWXA 1OKXA 1FQ3A 1Z6JH 1CGIE 4I32A 4IMQA 4ACAA 2WPMS 1OP2A 1GL1A 3L33A 3F2FA 4BAMB 5ETXA 2O8MA 4M7GA 4HFPB 3NPSA 5KGOA 1NTPA 4X8SH 5FBEA 1UTJA 2ZFSA 4Y8YA 4BAQB 1XUGA 1SGQE 3ENSB 2GZ7A 3M5MA 1PYTC 3LONA 3SU4A 6CHAB 2BVXH 4A7IB 2BD5A 3HGPA 4CRDA 2AMPA 1ESAA 1XMNB 2PR3A 1C1NA 3UREA 2R0KA 1GI1A 1Z1JA 1RD3B 1TNKA 1ESBA 3OEHD 4FUCA 1YP9A 1UVPA 3FANA 1MD8A 3RU4T 1C5NH 2CHAC 3F0PA 3A7VA 1AU8A 1UCYH 1LVBA 3ZZ8A 1B0FA 4DVAU 2WV5A 3SN8A 2BD8A 3ZZ6A 1GVZA 5EXNA 1HV7A 3E1XB 5TCCA 5L30H 2VWOA 1BBRK 1T4UH 4UFGH 5AFZH 3M5LA 1L1JA 1SLVB 3PWCA 2KCAA 1ZPCA 2OTVA 1P10A 5DP7A 3RXMA 1NRPH 5FAHA 2SGPE 3STJA 4YM9A 3AAVA 3SZNA 1GI7B 2F9VA 5EJZA 3ZVBA 1ZSKA 4RT1A 4XE4A 2BYAX 2B8OH 2J95A 3SGBE 1TIOA 2XTTB 1SGFG 3SV9A 1A0LA 1AE5A 2OC8A 4R8TB 5JBCS 1T4VH 1GJBB 1CT2E 1O3IA 4BANB 1YCPH 4DGJA 3BTKE 2HOBA 2GCHG 3ZV8A 3DSGA 3ZYDA 2D8WA 2GCTC 1MTNC 4CRCA 3PRBA 1YPHC 2R2MB 1EZUC 1EATA 1VGCB 3L6PA 2QF4A 2C90B 2GMTC 3ZVEA 1J9CH 4O9VA 2BXTH 4OS2A 1J16A 2Z3DA 1C4V2 3EQ0H 1YKTA 3BEIB 1ELTA 2GKVE 3RXOA 3K6ZA 3LGWA 3UNQA 3STIA 4Q7ZA 2VWMA 2ZU3A 1BRCE 1Z8GA 2VU8E 2ULLA 1QB9A 2WYJA 5FHTA 4RI0A 2Y81A 1ZRBA 4WXIA 1TPAE 1V2KT 1AQ7A 1G2MA 2XWAA 3EA9A 3MU1A 1DXWA 3RU4E 2ZHDA 1TNIA 1SKYE 4H4FA 1S0QA 3QWCH 1K1IA 1EP6A 4XD7D 1AUJA 3A82A 3SUDA 1CHGA 1MZDA 4OS5A 1IQEA 2Y80A 1ANCA 2BDCA 1Y5BT 1ZR0A 4B6FA 4Q80A 1PQ7A 3PYHA 5LH8A 2A2QH 4B74A 2BVSH 5IK2D 3RMMH 1QURH 4ZKRU 3P8NA 2QN5T 4X1RU 1P2MA 5A0CA 5C1XA 2B5TB 4HGCA 1ZGIA 3P92A 1UTQA 5E0HA 1O2JA 3E3TA 3W1EA 1KXAA 5CHBA 3E0PB 5JPMH 2ZCLP 3F0OA 1QNJA 1P57B 2GDDA 4THNH 1N8OB 3TVJB 3RXHA 1ZPBA 5C0UA 5B6LA 3K2UA 2GJGA 2R3UA 4XBCA 5DP4A 1DE7H 3ZYEA 5A8XA 2ANMH 1NM6A 5ESBA 2GTBA 1K1MA 2WSSD 1MABB 3SHAH 1CA0C 5GDSH 1G3EA 3WW7A 1GBTA 4X2VA 2R0LA 1LCYA 5C5NA 5A09A 3SJIA 4CR9A 4PROA 4B2CA 3LKWA 2QE7D 4FUDA 3S7KB 3FP6E 1GG6B 1S0RA 2SGQE 2R2WU 4FUBA 1V2TT 1UTNA 2P3TB 3GCHB 1RTLA 4XBDA 1FONA 1C1TA 4X2XA 3KCGH 1KXFA 4A1XA 1O2PA 4B2BA 5JB9S 1AD8H 1TQ0B 2JH0D 3LU9B 1K2I1 1GI6A 5FPYA 4FETA 2ZTXA 3PTBA 5FCRA 1TALA 2O8TA 2XW9A 5GXPA 3T26A 1H4WA 3HKIB 4NIXA 1UK4A 1W0ZU 1PQAA 4MNVA 5FCKA 2XBWA 1C5VA 2J34A 1K21H 1MTWA 1GJDB 4E05H 3BIUH 1MBQA 2ZU2A 3M3VA 1HRTH 1GHWH 1EOLA 1LPZB 2AGIX 1BRAA 2XXLA 7LPRA 4UFEH 1DM4B 2HNTF 4NFFA 3K65B 2BX4A 1S6LA 2LPRA 1GMHF 1P3CA 4Y7AA 2QA9E 1S83A 1BOQA 1WBGB 5HMAA 1GI4A 1ZTLA 2SGFE 4YT6H 1V2JT 2QYIA 1IQLA 4D9QA 1G3DA 2P3FH 3MFJA 3RXAA 5C0TA 1CBWB 4Y76A 3A87A 3ATMA 2NU3E 1F5RA 3SQHE 4TY6A 4WJG2 8ESTE 1G37A 1FNIA 3D49H 1Y3YA 1GMDF 1FMGA 3NK8A 4MVNA 5ABWA 2TPIZ 1A5IA 1O34A 1OP8A 2FOAA 3NXPA 2QAAA 2JKHA 3GYLB 1NC6A 4CR5A 3UOUA 3MO9A 6CHAC 4MNXA 2ZU1A 1RRKA 1V6DA 1W10U 1EPTB 1PPZA 2HRVA 4NGAH 3T25A 3OFND 2WPJS 4I8JA 1SR5C 4BTTB 5KEDA 4D76A 2B7DH 4D8NA 5JB8S 1GBEA 3F6UH 1MZAA 1NU7B 1AFEH 3KYFA 2C8WB 4UONA 1P06A 1K1PA 2W5EA 1KLIH 4DW2U 3SUEA 1A3EH 1DY9A 1VITF 2I6QA 2Z9JA 3OE7D 1BDAA 3RUOA 3UWIA 4A92A 3A85A 3SYJA 4JZ1A 1GBJA 4F48B 2J4IA 1AB9B 2Y5FA 2CK3D 3SW2B 1C5SA 1Q31A 3GDUA 3Q3YA 4Z0KA 1C5RA 2EC9H 3UUZA 1ZJDA 1HLTH 1GMCG 1IHSH 4RN6A 3O8CA 1HIAB 3TJOA 3A8CA 1PPHE 2Q6GA 1ZGVA 4BAKB 4F4OC 1GHBG 4DJZB 3LPRA 3U8TH 1BBRH 3CP7A 3RXPA 1YYY1 4AYVB 1TAWA 1T31A 2QF3A 2BLVA 4X6PA 3BTEE 3KHVA 5AFYH 4ZCNA 1S6FA 3QGJA 3VB4A 2FS8A 1UCYK 3HK3B 1EKBB 1VGCC 2KFWA 2HPQH 2W26A 1Z8IB 2QY0B 1O3DA 1E1RD 1GI0A 1HXEH 1YM0A 1W2KH 2EY4C 3ZV9A 3I77A 1COWD 1E0FD 1FIWA 2P8OB 4X6MA 3KF2A 3S69A 1OWKA 5CHAB 1GHYH 4NA8A 5DJ7A 3IG6B 3EE0B 1W0KD 3BSQA 2QCYA 1AWFH 1SQTA 4A5TS 4Y71A 2F43B 3MHWU 3SOSA 1OOKB 2ZDVH 1AFQB 3RXIA 1SGYE 1O3JA 2FOEA 1ETTH 2H5CA 1GHZA 2QF5A 1PFXC 2JJ1D 3A7TA 1LVYA 1BTHH 2H2ZA 3QTVH 2OUAA 1YCPK 3VEQB 1LHCH 3EDXB 3FVFB 2BLOA 1DWCH 4I86A 2V7QD 1C2KA 1AZZA 2XC4A 4BXWA 1YPJH 3F3BA 3KQEA 1ARCA 3OYPA 1O2TA 1RFNA 3LGYA 4I8LA 1NY22 5CMXH 2IOTA 3GDSA 1HAHH 2ZGCA 1O39A 3E6PH 4MQAA 1F0TA 3GY7A 4Q2KA 1DWEH 1HXFH 5LGOA 1XX9A 1NO9H 1ELGA 4WMEA 1S82A 2F91A 3FKSD 4MNYA 2GV6A 4FUEA 4ISNA 1ZMNA 1ORFA 3DUXH 1TBRH 1O2YA 1FX0B 1GI9B 2G5VA 2Z9GA 3QLPH 1TB6H 2BD2A 2PUXB 2OP9A 5EXMA 2OCVB 4NA9H 1O2GH 1V2UT 1TNHA 4IBLH 1N8OC 1QJ1B 2Y7XA 5DPAA 5CE1A 1PQ8A 1QQ4A 5K0HA 3PM3A 3ZZCA 2THFB 3DSOA 2XCNA 2UWPA 3TH4H 1C2HA 2BOKA 3HKJB 1O3MA 2F9BH 1EOJA 1K0HA 2K8IA 1HFDA 3U8RH 4CHAB 4ZXYH 3S9BA 1DLKB 1VCWA 4FXGH 4K69A 3FN8A 1GJ6A 2H1UA 2XC5A 1A7SA 1GG6C 1KXEA 1V2RT 1KTTB 1QL9A 1C5MD 3GCHC 2JDID 1GI2A 4HI3A 2UWLA 4U2WA 1Q2WA 3SV2H 5FL7D 2VIQA 5DP5A 1QCPA 2XNDD 2VIOA 3A7WA 1FN6A 1C9PA 4GAWA 5GCHF 5GNDA 2JH5D 6LPRA 1WV7H 1GDQA 2GP9B 1XUJA 4XSKU 3QTOH 4I8HA 4BTIB 1AGJA 2RDLA 3M3TA 3SU3A 1BTUA 2D2DA 3ESTA 4Y11E 4B2AA 2UUJB 3EA7A 1EPTA 1KXBA 2FX4A 3E8LA 4CREA 2BXUH 1WYKA 4WF8A 5E0GA 3GY4A 3EGKH 4AZ2B 4RKJB 4ZROA 3FP7E 2AGEX 2A4OA 3DHKH 1QA0A 1IQGA 2ZG0H 1LO6A 5EIYA 2BX3A 1G3CA 1C1SA 1D3PB 3ZZAA 1TYNA 4DOQA 1MCTA 2HNTE 1GBCA 1L1NA 4AFZA 2BY8X 1C2LA 1O37A 4D9RA 1CBWC 5EQQA 1MKXK 3F9HA 3ODFA 3GY8A 4WXVA 1DUEA 4NFEA 4CRBA 2LELA 4YXWD 4FU7A 3T5FH 1AIXH 4KGAA 5C17A 1WQSA 3A81A 3SI4H 1B7XB 4B6EA 3ZZ3A 5C3NA 2BM2A 1GDNA 4Y8XA 1HJAB 3E91A 1AWHB 1VJ9U 1C5PA 5A0AE 1DXPA 4MTBA 2PV9B 1U6QA 1YCPM 1EPTC 3RXCA 1CE5A 1PPCE 3FZZA 4XBBA 4YT7H 3E90B 1QIXB 1F92A 2ODPA 2F9OA 1NRSH 1DSUA 2UUFB 3G01A 3B23B 1O2MA 1TMBH 1DWBH 1SSXA 2ANYA 3M7QA 1O38A 1QB1A 2V3HH 3SNDA 7KMEH 4CH8B 1GHAG 3O8RA 2RFKC 1FN8A 2GT8A 4ABJA 3SU1A 3P6ZB 2I6SA 1TRYA 3VB7A 1FIZA 1BTWA 1SGIB 1QQUA 4D7FA 4WY3A 2FLBH 4WH6A 3TJUA 1AB9C 3MO6A 2BQWB 1B5GH 1F5KU 2VWLA 1O2QA 1EB1H 1RIWB 1WUNH 4NSVA 8GCHF 2XRCA 1GWAA 2XNIA 5A0BA 1UHBA 1RTKA 2P59A 1S85A 4JYTA 3RMOH 3SU0A 1GBIA 3M3SA 5EW2H 2F9PA 5F6MA 1TX6A 2VVVA 3KIDU 5EOKA 5K7RA 2HLDD 1AMHA 1C1OA 1QFKH 2AMDA 3OEED 2KCOA 1OWDA 1LHDH 4KTUA 1AO5A 2V35A 1J17T 1D3QB 1C2DA 2A0QB 3SNAA 4BXSA 1ABJH 2P8OC 1NU9A 1QR3E 2ODYB 3SGQE 2R3YA 3MI4A 5CHAC 5DP6A 5PTPA 1XKAC 1VCQA 2A7CA 3TK6A 3V3MA 5DO4H 2AMQA 4FUGA 2FMJA 2AERH 4H42U 4Z1MD 1AFQC 1YY3A 3M35A 4DURA 5EW1H 2VNTA 3F9EA 2BZAA 3TK5A 2ZNKH 1TPSA 1C5ZB 1F0RA 4AGKA 4B75A 2H9HA 3AK5A 2P3UB 5CDFE 4ZKSU 3RP2A 4B1TA 4LK4A 1EXFA 1N1LA 3QGNB 1MTSA 2YOLA 4YOGA 4YOIA 1HGTH 1N6YA 1E36B 2VIWA 8KME2 1J8AA 3DD2H 1CT0E 2WUBA 2KZ4A 1DY8A 1E79D 4GCHF 3KEEA 1CA8B 5FX6A 1GI3A 1X7AC 4GPGA 4IN1A 1WSSH 1C5TA 3M36A 1AUTC 5DSFA 1V2VT 2YNBA 1H9HE 4Y10E 1F0SA 1GBAA 2BDIA 3CNRA 3RXJA 2IJOB 1TGTA 1EP5A 2TBSA 3AW1A 5EPYA 1MKWH 3I29A 3QN7A 3NKKA 1SI5H 4WWYA 1GBMA 5DP8A 1C1RA 2BLQA 1W0JD 1IOEA 4GHTA 3QO6A 1KLJH 4OGYA 1K22H 2J97A 3R0FA 2PTNA 4U32A 1TWXB 2BTCE 4O3UA 3F9FA 2PLXA 4J1YA 2ZU5A 2OQUA 5JBAS 2XBVA 1UVOA 3VB3A 2KX4A 1QBNA 1FY3A 4JZEH 6GCHF 1L1GA 2ASUB 2BMGB 4UFFH 1IHTH 5KECA 4CHAC 5J4SA 5EG4A 3TJVA 2D1JA 1C5WB 1GGDB 3A8BA 1GJ8B 5DGJA 4NIVA 1O2OA 2DE8A 1B0EA 1SGFA 4AG2A 5LPEA 1NFWA 2A5IA 4E06H 3F2GA 1ZHMA 3V0XA 3BV9B 3KQBA 3ZVGA 5FX5A 1O2VA 1HJ8A 1RS0A 3MWIU 3A88A 1QB6A 3N7DA 4H6TA 1QBVH 2GD4B 1JIMA 2V6NA 5HM2A 1HAYB 3A8AA 2FZZA 1H8DH 2V3OH 3RXTA 1UVUH 4DCDA 1SG8B 3S9CA 2Q6DA 2FX6A 1BRBE 4SGBE 4ABGA 3U98H 1O5AB 3UAIC 4F55A 2XYAA 3GY2A 5F53A 5GWZA 1ZSJA 2HLCA 1UW7A 2QXJA 2VH0A 5EJ1A 2G5NA 2HNTC 3TNSA 1GJ4H 1QL7A 1BRUP 2UWOA 1IQFA 3SHCH 2ZC9H 1TONA 1AZ8A 1C2MA 3KN2A 1W12U 2G55A 1GVLA 3SJ8A 1W7XH 4TPIZ 3DA9B 3GCOA 1A46H 4I8KA 1QRZA 1V2ST 2XOKD 2GZ8A 5DK1A 1C1WH 1NBMD 4FUIA 1DWDH 2ZPRA 2FI5E 5C5OA 1YPEH 1SGRE 4I31A 2WPDD 4NSYA 3VG8A 5E0JA 2P16A 4RT0A 1EX3A 3RXSA 1LQDB 1PPBH 1SQRA 3O8DA 1A0HB 1P9SA 5DG6A 1GHVH 3P95A 3W95A 1ANBA 1HJAC 3M5NA 5TJXA 3PMJA 4ISHH 1MKXH 1PPEE 3MMGA 4TWYA 2ZFTA 3SNCA 3BTGE 3B8JA 4UDWH 1OP0A 4ZKOU 3BTQE 3A84A 4Y6DA 2CJIA 5T6FA 1YWUA 3RLYH 2QV1A 2BDGA 4IGDA 1MMJN 3ZVAA 1H8IH 1THSH 3UB0A 4XFQA 3RM0H 1NPMA 2ZFQH 5JDUB 1TRMA 4GVUA 3TLOA 2BD3A 4NIYA 2NWNA 1MD7A 1ELFA 3RDZA 1PPFE 1V2NT 1ELDE 1YF4A 2W3IA 1G36A 2BHGA 5L2ZH 4B76A 4P02A 2XBXA 3GCTG 1V3XA 5J4QA 4MG3A 3Q00A 2ZKSA 1HPGA 4FUFA 1G9IE 1UTMA 2FS9A 3UOPA 2FI3E 2G00A 5C1YA 1SLWB 4B71A 2B0FA 2BDYA 2WV4A 5T1VA 1T32A 2ZHEH 1O2RA 1T8LA 4DT7B 3V12A 3F9GA 1NT1A 1RIWC 2OC7A 1QRXA 3AW0A 2GCHF 3RXRA 2RA3A 5DP3A 1EAIA 3H5CB 1C2GA 4OS4A 2FYQA 3KL6A 2VVCA 3LJOA 3PROA 2H6MA 3ATIA 5E2OA 2HWLB 1UTLM 2BDHA 1UVSH 3QUMP 5F8TA 1FXYA 1TA2A 1JMOH 1C1VH 1TMTH 5FBIA 1XVMA 2F83A 2A31A 2C8ZB 1H8HD 1P04A 5T6GA 3S7HB 1P0SH 1O30A 3UPEA 2H5DA 2PHBA 1P12E 2WPHS 1O3PB 1MQ5A 1BTZA 1ETSH 1ANEA 1TX8A 3EE7A 4MDSA 4ZKNU 4YTAA 4Q7XA 4B73A 3DFJA 1O3HA 5GPIB 1O2LA 1A4WH 4LZ4B 2L74A 4FUJA 1O2SA 1NROH 2WYGA 1YPMH 1CHOG 2SFAA 1SLUB 3FFGA 1C2JA 1TE0A 5C1UA 3QX5H 1EAUA 2IPQX 1LTOA 3KQDA 2KR7A 1LVOA 1EAWA 4JMYA 2OBQA 1V2MT 3KNXA 1XUHA 1O3FA 5EU8A 2ZF0H 1T8NA 3PLBA 5GCHG 1ZMJA 1BMAA 3MOCA 1UCYE 2M5TA 1OWEA 1UK2A 1NS3A 2WV9A 2AEIH 1RJXB 1OWIA 4Y0ZE 3GICB 3MH5A 1EZSC 3PV4A 3SV6A 2CGAA 4NIWA 3SU6A 4ACBA 3PLKA 4XDEA 2TRMA 1DS2E 1H1BA 3VGCB 5HKKD 2ZWLH 2TGTA 3DSPA 1GI8B 2TIOA 3UR6A 2UUKB 1XXFA 1ZZZA 1O31A 1EB2A 4X6NA 3TGIE 1QBOA 3OAAD 1G3BA 1D4PB 2Z94A 2WINI 3TJNA 2KCYA 1IQIA 5EGMA 1P2NA 3GY5A 1C5XB 1O2HA 1V2QT 5HIZA 3MNSA 3BTHE 1CGHA 3ATLA 4MLFB 1SBWA 3FZDA 4X1NU 2QC2A 4D7GA 2FYRA 5IYTA 3SUGA 4XRNA 2ZO3H 3BEUA 1BA8B 1SHYA 2VBCA 2Y5GA 4YLUA 2ZFFH 2HVYB 3RC5A 1Z8RA 1UHBB 1HJ9A 1GGDC 1AN1E 4ZMAH 2H9TH 1OHHD 3CS0A 3LOXA 1LPGB 4OS1A 4UE7H 4MPXA 3A7ZA 3P8FA 1O5CB 3F2HA 3LT3A 3ZZBA 4LZ1H 1TNGA 5EQRA 1O2ZA 1MKWK 5T3HA 3FP8E 5AVDA 4JZFH 1NESE 1C2EA 3UNRA 1G2LA 4ZXXH 3C1KA 1Y5UT 1D9IA 3PLPA 5LPFA 4YLQH 1BT7A 1SGPE 3HGNA 4NG9H 5BRRE 1ELVA 1BMFD 1WOFA 1C2IA 4F49A 4GSOA 1NRQH 2G8TA 2A7JA 4DT4A 1TRNA 1P3EA 2ZDKA 5FPTA 2W6ID 5ESTE 4OS7A 5E2PA 3SZEA 2BD9A 3TNTA 3T62A 2AIQA 1SGDE 3K9XB 3NUMA 2FODA 4XOJA 2GX4A 3SO3A 1E38B 1UJ1A 4X2YA 4K60A 3R3GB 1P9UA 1DSTA 1GJ5H 1D6WA 1F5LA 1ELCA 2JIZD 4CRGA 3JZ2B 5GJ4B 1WU1A 1DANH 2Q6FA 1T7CA 2Q1JA 1ZHRA 1L0ZA 1P2JA 4KELA 2FESH 3SUFA 3ATWA 3ZVDA 2C3SA 3U1JB 1SC8U 2ZPQA 3P17H 1GVKB 2TGPZ 5L2YH 3A89A 3UR9A 1S6HA 1GCDA 4IC5A 2OBOA 1E1QD 2OC1A 1SGCA 1SMFE 3GDVA 3DT0H 1CSOE 3LGVA 1TOCB 2QXHA 1DX5M 3SORA 3W94A 3P70B 1NRRH 1P2IA 2O8WA 2ZPSA 2G51A 3BF6H 3V13A 2HPPH 7GCHF 1Y3XA 2FTMA 1WAYB 1TLDA 1SLXB 4TT3D 2ZGHA 1O3KA 2FOHA 4J2YB 1C5QA 4UD9H 1W8BH 1FAKH 1HYLA 3ELAH 1JIRA 3RXKA 1AE8H 5E8EH 4Q7YA 5SGAE 3LIWA 3SJKA 1L4ZA 3WWFA 1OS8A 3RXFA 1IQKA 2PSYA 1BTXA 1C5LH 1LKAA 1ZTJA 1O3BA 2PKAA 2F9NA 4K2YA 4YO9A 2CMYA 4RSPA 4U30A 1SVPA 4KTCA 1HAVA 4YESB 3PB1E 3CS7A 4HTCH 3BTTE 1GHBF 2ZGBH 2EI8A 3PV2A 2CV3A 2ZDNA 1NFUA 2ZHFH 4CRAA 1GBBA 5A8YA 2ZFRH 3Q76A 2J94A 9ESTA 4ABEA 1UTKA 2FDAA 3A7XA 4JK6A 1FDPA 2JETB 3ZZDA 1WQVH 3LGTA 2G4TA 3KQ5A 3D23A 3H7TA 2BDBA 1SQAA 3OY6U 4HG6A 1TBQH 1VCPA 2A1DB 3NRLA 2A5AA 4LXBH 2ZP0H 1HBTH 4CH2B 1C4Y2 1F2SE 2ZECA 3EYDA 1V2LT 3A8DA 5HYOA 4TSFD 2RA0A 3MU4A 4X8UH 4ABIA 1O36A 1YPKH 4JZDH 1CVWH 2AHME 1EQ9A 3VPKA 1V2WT 1D3TB 1BTPA 1HAXB 4X0WU 3D65E 1AI8H 1KSNA 2Y7ZA 4INLA 2GGVB 1O2WA 2EI7A 4INKA 1MAXA 1MU6B 1IAUA 2BOHB 1SOTA 1QJ6B 2FP7B 3BTFE 3ZZ5A 2WZQA 3TGKE 2PGQB 3RU4D 8LPRA 2BB4A 1JOUB 1WCZA 1TPPA 1CO7E 2PFEA 1IQJA 2VWNA 4FOUC 1FJSA 2IPHA 3EAJA 1P2QA 3LH3A 3V7TA 3B9FH 1ZMLA 1KXDA 1BTYA 2QXIA 3SI3H 1EFRD 1K1OA 2ALPA 2HGTH 1INCA 3DFLA 5TCAA 3VXFH 4ABAA 4NZQA 2KCPA 1E34B 2R9PA 3OU0A 1YPLH 3OTPA 3ODDA 3MU8A 4K1SA 1OSSA 2XC0A 3BIVH 1DDJA 1GCTB 2CN0H 2EQNA 1SL3A 4Q63A 3AAUA 4O03A 3SV7A 1BZXE 1TGCA 3TU7H 3SV8A 1EJAA 1KDQB 5JBTA 1NN6A 1MTUA 1J15A 3VGCC 4X6OA 1Y8TA 5HM9A 2BDAA 1TNJA 1LMWB 3H09A 1SB1H 2CXVA 3WY8A 1FV9A 2G52A 1O3NA 2Z9KA 3K6YA 4DIHH 2QXGA 3TH2H 2O8UA 1KYNA 2NU2E 1BBRE 4OM9A 1AHTH 1XUFA 1P11E 2ZQ2A 2W7SA 2FLRH 4MNWA 1TMUH 1BITA 1DFPA 4X1SU 3SNBA 1QL8A 4ISIH 1LDTT 2ANKH 2SGEE 5EXLA 1C5OH 1QY6A 1W14U 2GT7A 1S5SA 3NCLA 4AGJA 1M9UA 1KIGH 2WPKS 2YMSD 5F8XA 3SNEA 1HAOH 3I78A 4H6SB 2OC0A 2ZCKP 4DG4A 1THPB 1BB0B 2BY6X 1W7GH 2J5UA 1ESTA 3VXEH 1P2KA 1TGSZ 1Y3WA 2PKSB 1O3CA 4X2WA 4AFQA 1GI5A 4ASHA 5C94A 2J98A 1YLDA 3LH1A 4OS6A 3SBKA 1RXPA 4YOJA 2ZTZA 3LC5A 2QF0A 4UEHH 1UVTH 5GIBA 2ZHWH 3UNSA 3TH3H 1XUKA 2OXSA 4ZHAA 1GMHG 2SNVA 1Z71A 2ZFPH 2PTCE 3A7YA 1TPOA 4GHQA 2OINA 2BQ6B 2CF8H 1K1LA 1SHHB 4ISOA 2VIPA 1P2OA 3A83A 1GBFA 1HAIH 1GJAB 3RXVA 1NRNH 4TPYA 7ESTE 5DN6D 4AYYB 2PW8H 1RGQA 1O0DH 1H9LB 2XWBI 3GOVB 1C5YB 1ETRH 3RXDA 1GL0E 3FAOA 1A61H 1ARBA 3MH7A 2FOFA 4AX9H 5F03A 2BD7A 1DITH 2VIDA 2F9UA 2O9QA 3U8OH 4ZHMU 1GMDG 4JK5A 2VVUA 2VGCB 4INHA 1G30B 1ELEE 4X1PU 1ZPZA 3FOAA 1E35B 1VR1H 3Q77A 1YBWA 2BQ7B 4WH8A 3PWBA 3RC6A 1OWJA 3T27A 3URCA 1AKSA 2AGGX 2WPLS 3TPIZ 3F68H 4K5ZA 4JYVH 2OK5A 1AVGH 4HZHA 1P05A 4ZHLU 3RXQA 4KTSA 2Y6TA 1HNEE 3GY3A 1OXGA 2L6OA 1BMNH 2EI6A 1TFXA 1QTFA 1YLCA 3A80A 3SQEE 3Q3XA 1HAZB 2J9NA 3PMAB 5FPSA 1ELBA 1Z6EA 1OPHB 2DE9A 1D3DB 1MH0A 2M2AA 3KQCA 1MAYA 3PO1B 1UO6A 2WHXA 1E37B 1C1PA 1VITG 4QT8C 1GHAF 4Q4LA 1MTVA 5G4BA 3RXEA 1F0UA 5EJLA 3BG8A 1DVAH 1C5UA 2KAIA 1O2IA 4Y7BA 1XKBC 4AORA 3S9AA 1ACBE 3OSYA 4VGCB 1HAGE 2HVXA 2KM0A 2ZDMA 1XXDA 1THRH 1P09A 3D62A 5AHGH 2W7UA 3VFEA 1JXPA 1A5GH 1A1RA 1DLEA 1YPGH 4BAHB 3UFAA 3RXGA 4ESTE 1VKYA 1ABIH 1K1JA 2PGBB 1P03A 1PJPA 1G32B 2Y82A 4TY7A 1NZQH 1CQQA 3SU2A 2W3KA 4AFSA 2JETC 1C1QA 1O2NA 5EODA 1BHXB 2AYWA 3U28C 1O5EH 3MYWA 4ZAEA 1Z8JB 4KKDA 2BY7X 4AOQA 3P8GA 4UFDH 1SOZA 1UTPA 1BMMH 1KY9A 1EJMA 3BG4B 3BN9A 1UTOA 2YMSB 3MO3A 1ZSLA 1EASA 2IJD1 1FY5A 1TBZH 4CRFA 1PYTD 1V2OT 2QGRA 5C20A 1OWHA 4LOYH 3TIUA 3MNBA 5C67A 3TK9A 4Y79A 1KDQA 1T8OA 3VB5A 5JBBS 3GISB 1KTSB 1ZYOA 3BTWE 2IN2A 3L3TA 1CT4E 1KXCA 2SNWA 4GUXA 4BOHA 1ZRKA 1A2CH 3KYGA 4K3JA 5EQSA 1WXRA 4FVBA 3T28A 1IQHA 2O8LA 1MU8B 1MCVA 3ITIA 4E7NA 2BY9X 2FO9A 3CENA 4ABBA 1FI8A 1W11U 4NCYA 3MNXA 3T29A 1LVMA 1S84A 1SQOA 2TGDA 2G81E 2A45B 4ZH8A 1GJ7B 1WTHD 4AB9A 1O35A 2GZ9A 1OX1A 3ZIAD 3ZZ7A 3U69H 4JZIA 2AIPA 1GCTC 1TOMH 2C93B 5IDKA 2ZI2H 3LC3A 3UWJH 1XUIA 2RDEA 2J2UA 2OD3B 2NU4E 4BAOB 2ZDAH 4FU9A 4ISLA 4GLYA 1TA6A 4FU8A 2BLWA 1CGJE 2PKAB 3ZVFA 3ZZ9A 3HATH 1KLTA 1P02A 1HAVB 1NFYA 4KP0A 1NFXA 1Y5AT 4ZUHA 3EA8A 2H9EH 2EEKA 1FPCH 1UMAH 3RMLH 2Z3EA 1BCUH 1TGNA 2B9LA 2OLGA 4A6LA 5I46H 2ZU4A 1YC0A 4FVDA 3LGIA 2A2XH 4K8BA 2ANWA 3AVZA 3QZQA 3URDA 5LPRA 1SGNE 1N6XA 2XBYA 1GJ9B 3GS9A 3PV5A 1YLNA 3HPTB 7GCHG 1TABE 1YGCH 1ZOMA 1VITH 1HCGA 1O3GA 2ZDLA 4X8VH 3S0NA 5F8ZA 1EAXA 3OX7U 1DUAA 1SGEE 4I33A 2PKSC 3A86A 3MQKC 2Z3CA 5T6DA 1HB0B 4CBOA 1EJNA 1O33A 1C1UH 2K0QA 4AB8A 1O5BB 2FM2A 3UIRA 3LDXH 1O3LA 1WTGH 3DCLA 2VJ1A 2P93A 1FY8E 2D26C 3JZ1B 4Y0YE 2P95A 3M7TA 3PRDA 1GJCB 2PSXA 2P94A 2Z9LA 4AC9A 4FUHA 5DP9A 1KMHB 1JWTA 3ATKA 1W3CA 4Y8ZA 1LHGH 3SJOA 2ALVA 1NBME 1K28D 1FY1A 3MU5A 2ZTYA 1HDTH 1LQEA 2BZ6H 2HALA 1H8ED 2CF9H 2OQ5A 3ZVCA 1DPOA 1FZZA 5FXLA 2F4LA 3M5OA 4BNRA 4YZUA 5EPNA 4JYUH 1FPHH 3M61U 2FOMB 1BMLA 2VGCC 1BQYA 2F3CE 2VB0A 2JJ2D 3RXBA 1BUIA 1C1MA 1D6RA 1UK3A 1EZXC 5HIYA 1TX7A 1ZHPA 2CHAB 4A1VA 3BEFB 4ASUD 4O3TA 1DOJA 3QZRA 1O3EA 4ABFA 3MH4A 3N99A 2FPZA 2A5KA 2RG3A 1ELAA 2FOBA 2ZHQH 4E7RG 3UY9A 3FO8D 3RXUA 1MQ6A 3M7UA 3Q3KA 3RLWH 1P8VC 2A4QA 4CBNA 5A8ZA 3M37A 3PO1C 4BTUB 3RXLA 1FAXA 1Q3XA 2FEQH 4U01A 2VH6A 1GBDA 4X1QU 4IMZA 1O5GH 1BJVA 4O97A 4Z6AH 2ZIQH 1LPKB 2ILNA 1PPGE 2LP6A 4X8TH 3GCTF 4MPVA 2STBE 4OGXA 2FWWA 3H7OA 1JRTA 4I7YH 4VGCC 4WMFA 1Z7KA 1Y3UA 2V0BA 3C27B 4DIIH 4NA7A 1SGTA 1TGBA 3MH6A 1AVXA 8GCHG 2Y5HA 1O2XA 1C9TA 2LNCA 1FY4A 4AN7A 2GCTB 1MTNB
chains in the Genus database with same CATH topology
4K1EA 2PUQH 2J38A 3AASA 3OY5U 2GMTB 2AS9A 4MPWA 1K1NA 5I25A 1GDUA 3PMHB 1TQ7B 4TYDA 1O2UA 3MU0A 1IQNA 1K9OE 1YPHE 3TGJE 1VZQH 1H9IE 2ZGXH 4R0IA 3E16B 1QHRB 3SGAE 1P01A 4AG1A 1HUTH 2GV7A 2J92A 1BIOA 2FXRA 2AFQB 2BD4A 3RC4A 4IW4E 1A0JA 3BG4C 3HK6B 2BVRH 2STAE 1L2EA 1VJAU 1CU1A 1GBKA 4WMDA 1ID5H 1F7ZA 1EUFA 2G4UA 3VB6A 5B6OA 3QDZB 2EA3A 2ZQ1A 2Z9IA 3GY6A 2VINA 3SJ9A 2Z7FE 1OYQA 1C4U2 2ZEBA 1W0YH 2ZA5A 5DKMA 5H4IB 1FUJA 4IN2A 1CHOF 9LPRA 3RMNH 1ZTKA 1A5HA 1HAPH 1GHXH 4IC6A 3NWUA 1BJUA 1SFQB 5HXFA 4TWWA 2BY5X 1A3BH 2ZGJA 3BTDE 1LKBA 2XCFA 4GCHG 1XM1A 1PQ5A 2Z6BD 3PMBB 1GMCF 1AKSB 1DICA 1SPJA 5HGGA 4DY7B 3IITA 2FIRH 5JYIA 2JH6D 1LHEH 4A1TA 3LGUA 2GVFA 4NWLA 1QA7A 2RCEA 2K1QA 4SGAE 2YNAA 5BPEA 3U1IB 1LHFH 1V2PT 1S81A 1Z1IA 2NU0E 3BTME 3MTYA 1O3OA 3PTNA 1BHXF 3GYMA 3SU5A 1AY6H 1SFIA 2C8XB 1QRWA 3ZZ4A 2C8YB 2ZCHP 2WPIS 3TITA 1TNLA 3MNCA 1O5FH 1O5DH 3QK1A 2KAIB 2QIQA 1ANDA 1J14A 3IWMA 3P8OA 1CA0B 4JCNA 3NZIA 2DUCA 4ABDA 1QJ7B 6ESTA 1ZLRA 3GCNA 3O8BA 1MBMA 3UQOA 1C2FA 3KGPA 1ZJKA 1IQMA 2WUCA 4I8GA 2ZZUH 6GCHG 5L6NH 3E0NB 1L4DA 2A32A 4K1TA 1GBHA 2ESTE 4K8YA 4NZLA 1XVOA 2FOCA 1HIAA 1Y59T 3T2NA 3F1SB 2NU1E 1QGFA 2A4RA 2SGAA 1JRSA 1O3AA 2FI4E 4IS5A 3UTUH 1AVWA 1O2KA 2C4FH 1DT2A 4ABHA 2UUYA 1FLEE 1T8MA 2A4GA 3OTJE 4MPUA 5C2ZA 1MUEB 2ODQA 3RM2H 3N7OA 2SGDE 2TGAA 1EZQA 1W13U 3LJJA 1Y3VA 2FOGA 4NWKA 2GDEH 1RTFB 2FTLE 2A7HA 1GPZA 1O32A 4WVPE 3UQVA 4RKOB 3U9AH 5A2MH 1GBLA 2VIVA 4AFUA 5AF9H 2AH4X 1OYTH 1JBUH 2PWXA 1OKXA 1FQ3A 1Z6JH 1CGIE 4I32A 4IMQA 2WPMS 1OP2A 1GL1A 3L33A 4BAMB 5ETXA 2O8MA 4M7GA 4HFPB 3NPSA 1NTPA 4X8SH 5FBEA 1UTJA 2ZFSA 4Y8YA 4BAQB 1XUGA 1SGQE 3ENSB 2GZ7A 3M5MA 1PYTC 3LONA 3SU4A 6CHAB 2BVXH 4A7IB 2BD5A 3HGPA 4CRDA 2AMPA 1ESAA 1XMNB 2PR3A 1C1NA 3UREA 2R0KA 1GI1A 1Z1JA 1RD3B 1TNKA 1ESBA 4FUCA 1YP9A 1UVPA 3FANA 1MD8A 3RU4T 1C5NH 2CHAC 3A7VA 1AU8A 1UCYH 1LVBA 3ZZ8A 1B0FA 4DVAU 2WV5A 3SN8A 2BD8A 3ZZ6A 1GVZA 5EXNA 1HV7A 3E1XB 5TCCA 5L30H 2VWOA 1BBRK 1T4UH 4UFGH 5AFZH 3M5LA 1L1JA 1SLVB 3PWCA 2OTVA 1ZPCA 5DP7A 1P10A 3RXMA 5FAHA 1NRPH 2SGPE 3STJA 4YM9A 3AAVA 3SZNA 1GI7B 2F9VA 3ZVBA 1ZSKA 4XE4A 2BYAX 2B8OH 2J95A 3SGBE 1TIOA 2XTTB 1SGFG 3SV9A 1A0LA 1AE5A 2OC8A 4R8TB 5JBCS 1T4VH 1GJBB 1CT2E 1O3IA 4BANB 1YCPH 4DGJA 3BTKE 2HOBA 2GCHG 3ZV8A 3ZYDA 2D8WA 2GCTC 1MTNC 4CRCA 1YPHC 2R2MB 1EZUC 1EATA 1VGCB 3L6PA 2C90B 2GMTC 3ZVEA 1J9CH 4O9VA 2BXTH 4OS2A 1J16A 2Z3DA 1C4V2 3EQ0H 1YKTA 3BEIB 1ELTA 2GKVE 3RXOA 3K6ZA 3LGWA 3UNQA 3STIA 4Q7ZA 2VWMA 2ZU3A 1BRCE 1Z8GA 2VU8E 2ULLA 1QB9A 2WYJA 5FHTA 2Y81A 1ZRBA 4WXIA 1TPAE 1V2KT 1AQ7A 1G2MA 2XWAA 3EA9A 3MU1A 1DXWA 3RU4E 2ZHDA 1TNIA 4H4FA 1S0QA 3QWCH 1K1IA 1EP6A 1AUJA 3A82A 3SUDA 1CHGA 1MZDA 4OS5A 1IQEA 2Y80A 1ANCA 2BDCA 1Y5BT 1ZR0A 4Q80A 1PQ7A 3PYHA 5LH8A 2A2QH 4B74A 2BVSH 3RMMH 1QURH 4ZKRU 3P8NA 2QN5T 4X1RU 1P2MA 5A0CA 5C1XA 2B5TB 4HGCA 1ZGIA 3P92A 1UTQA 5E0HA 1O2JA 3E3TA 1KXAA 3E0PB 5JPMH 2ZCLP 1QNJA 1P57B 2GDDA 4THNH 1N8OB 3TVJB 3RXHA 1ZPBA 3K2UA 2R3UA 4XBCA 5DP4A 1DE7H 3ZYEA 5A8XA 2ANMH 1NM6A 5ESBA 2GTBA 1K1MA 3SHAH 1CA0C 5GDSH 1G3EA 1GBTA 4X2VA 2R0LA 1LCYA 5C5NA 5A09A 3SJIA 4CR9A 4PROA 4B2CA 3LKWA 4FUDA 3S7KB 3FP6E 1GG6B 1S0RA 2SGQE 2R2WU 4FUBA 1V2TT 1UTNA 2P3TB 3GCHB 1RTLA 4XBDA 1FONA 1C1TA 4X2XA 3KCGH 1KXFA 4A1XA 1O2PA 4B2BA 5JB9S 1AD8H 1TQ0B 2JH0D 3LU9B 1K2I1 1GI6A 5FPYA 2ZTXA 3PTBA 5FCRA 1TALA 2O8TA 2XW9A 5GXPA 3T26A 1H4WA 3HKIB 4NIXA 1UK4A 1W0ZU 1PQAA 4MNVA 5FCKA 2XBWA 1C5VA 2J34A 1K21H 1MTWA 1GJDB 4E05H 3BIUH 1MBQA 2ZU2A 3M3VA 1HRTH 1GHWH 1EOLA 1LPZB 2AGIX 1BRAA 2XXLA 7LPRA 4UFEH 1DM4B 2HNTF 4NFFA 3K65B 2BX4A 2LPRA 1GMHF 1P3CA 4Y7AA 2QA9E 1S83A 1BOQA 1WBGB 5HMAA 1GI4A 1ZTLA 2SGFE 4YT6H 1V2JT 2QYIA 1IQLA 4D9QA 1G3DA 2P3FH 3MFJA 3RXAA 1CBWB 4Y76A 3A87A 3ATMA 2NU3E 1F5RA 3SQHE 4TY6A 4WJG2 8ESTE 1G37A 1FNIA 3D49H 1Y3YA 1GMDF 1FMGA 3NK8A 4MVNA 5ABWA 2TPIZ 1A5IA 1O34A 1OP8A 2FOAA 3NXPA 2QAAA 2JKHA 3GYLB 1NC6A 4CR5A 3UOUA 3MO9A 6CHAC 4MNXA 2ZU1A 1RRKA 1V6DA 1W10U 1EPTB 1PPZA 2HRVA 4NGAH 3T25A 2WPJS 4I8JA 1SR5C 4BTTB 4D76A 2B7DH 4D8NA 5JB8S 1GBEA 3F6UH 1MZAA 1NU7B 1AFEH 4UONA 2C8WB 1P06A 1K1PA 2W5EA 1KLIH 4DW2U 3SUEA 1A3EH 1DY9A 1VITF 2I6QA 2Z9JA 1BDAA 3RUOA 3UWIA 4A92A 3A85A 4JZ1A 1GBJA 2J4IA 1AB9B 2Y5FA 3SW2B 1C5SA 1Q31A 3GDUA 3Q3YA 4Z0KA 1C5RA 2EC9H 3UUZA 1ZJDA 1HLTH 1GMCG 1IHSH 4RN6A 3O8CA 1HIAB 3TJOA 3A8CA 1PPHE 2Q6GA 1ZGVA 4BAKB 4F4OC 1GHBG 4DJZB 3LPRA 3U8TH 1BBRH 3CP7A 3RXPA 1YYY1 4AYVB 1TAWA 1T31A 2QF3A 2BLVA 4X6PA 3BTEE 3KHVA 5AFYH 1S6FA 3QGJA 3VB4A 2FS8A 1UCYK 3HK3B 1EKBB 1VGCC 2HPQH 2W26A 1Z8IB 2QY0B 1O3DA 1HXEH 1GI0A 1YM0A 1W2KH 3ZV9A 3I77A 1E0FD 1FIWA 2P8OB 4X6MA 3KF2A 3S69A 1OWKA 5CHAB 1GHYH 4NA8A 5DJ7A 3IG6B 3EE0B 3BSQA 2QCYA 1AWFH 1SQTA 4A5TS 4Y71A 3MHWU 3SOSA 1OOKB 2ZDVH 1AFQB 3RXIA 1SGYE 1O3JA 2FOEA 1ETTH 2H5CA 1GHZA 1PFXC 3A7TA 1LVYA 1BTHH 2H2ZA 3QTVH 2OUAA 1YCPK 3VEQB 1LHCH 3EDXB 3FVFB 2BLOA 1DWCH 1C2KA 1AZZA 2XC4A 4BXWA 1YPJH 3KQEA 1ARCA 3OYPA 1O2TA 1RFNA 3LGYA 4I8LA 1NY22 5CMXH 2IOTA 3GDSA 1HAHH 2ZGCA 1O39A 3E6PH 4MQAA 1F0TA 3GY7A 4Q2KA 1DWEH 1HXFH 5LGOA 1XX9A 1NO9H 1ELGA 4WMEA 1S82A 2F91A 4MNYA 2GV6A 4FUEA 4ISNA 1ZMNA 1ORFA 3DUXH 1TBRH 1O2YA 1GI9B 2G5VA 2Z9GA 3QLPH 1TB6H 2BD2A 2PUXB 2OP9A 5EXMA 2OCVB 4NA9H 1O2GH 1V2UT 1TNHA 4IBLH 1N8OC 1QJ1B 2Y7XA 5DPAA 5CE1A 1PQ8A 1QQ4A 5K0HA 3PM3A 3ZZCA 2THFB 2XCNA 2UWPA 3TH4H 1C2HA 2BOKA 3HKJB 1O3MA 2F9BH 1EOJA 1HFDA 3U8RH 4CHAB 4ZXYH 3S9BA 1DLKB 1VCWA 4FXGH 4K69A 1GJ6A 2H1UA 2XC5A 1A7SA 1GG6C 1KXEA 1V2RT 1KTTB 1QL9A 1C5MD 3GCHC 1GI2A 4HI3A 2UWLA 4U2WA 1Q2WA 3SV2H 2VIQA 5DP5A 1QCPA 2VIOA 3A7WA 1FN6A 1C9PA 4GAWA 5GCHF 2JH5D 6LPRA 1WV7H 1GDQA 2GP9B 1XUJA 4XSKU 3QTOH 4I8HA 4BTIB 1AGJA 2RDLA 3M3TA 3SU3A 1BTUA 2D2DA 3ESTA 4Y11E 4B2AA 2UUJB 3EA7A 1EPTA 1KXBA 2FX4A 3E8LA 4CREA 2BXUH 1WYKA 4WF8A 5E0GA 3GY4A 3EGKH 4AZ2B 4RKJB 4ZROA 3FP7E 2AGEX 2A4OA 3DHKH 1QA0A 1IQGA 2ZG0H 1LO6A 2BX3A 1G3CA 1C1SA 1D3PB 3ZZAA 1TYNA 4DOQA 1MCTA 2HNTE 1GBCA 1L1NA 4AFZA 2BY8X 1C2LA 1O37A 4D9RA 1CBWC 5EQQA 1MKXK 3F9HA 3ODFA 3GY8A 4WXVA 1DUEA 4NFEA 4CRBA 4FU7A 3T5FH 1AIXH 4KGAA 1WQSA 3A81A 3SI4H 1B7XB 3ZZ3A 5C3NA 2BM2A 1GDNA 4Y8XA 1HJAB 3E91A 1AWHB 1VJ9U 1C5PA 5A0AE 1DXPA 4MTBA 2PV9B 1U6QA 1YCPM 1EPTC 3RXCA 1CE5A 1PPCE 3FZZA 4XBBA 4YT7H 3E90B 1QIXB 1F92A 2ODPA 2F9OA 1NRSH 1DSUA 2UUFB 3G01A 3B23B 1O2MA 1TMBH 1DWBH 1SSXA 2ANYA 3M7QA 1O38A 1QB1A 2V3HH 3SNDA 7KMEH 4CH8B 1GHAG 3O8RA 1FN8A 2GT8A 4ABJA 3SU1A 3P6ZB 2I6SA 1TRYA 3VB7A 1FIZA 1BTWA 1SGIB 1QQUA 4D7FA 4WY3A 2FLBH 4WH6A 3TJUA 1AB9C 3MO6A 2BQWB 1B5GH 1F5KU 2VWLA 1O2QA 1EB1H 1RIWB 1WUNH 4NSVA 8GCHF 2XRCA 1GWAA 2XNIA 5A0BA 1UHBA 1RTKA 2P59A 1S85A 4JYTA 3RMOH 3SU0A 1GBIA 3M3SA 5EW2H 2F9PA 5F6MA 1TX6A 2VVVA 3KIDU 5EOKA 5K7RA 1AMHA 1C1OA 1QFKH 2AMDA 1OWDA 1LHDH 4KTUA 1AO5A 2V35A 1J17T 1D3QB 1C2DA 2A0QB 3SNAA 4BXSA 1ABJH 2P8OC 1NU9A 1QR3E 2ODYB 3SGQE 2R3YA 3MI4A 5CHAC 5DP6A 5PTPA 1XKAC 1VCQA 2A7CA 3TK6A 3V3MA 5DO4H 2AMQA 4FUGA 2FMJA 2AERH 4H42U 1AFQC 3M35A 4DURA 5EW1H 2VNTA 3F9EA 2BZAA 3TK5A 2ZNKH 1TPSA 1C5ZB 1F0RA 4AGKA 4B75A 2H9HA 2P3UB 4ZKSU 3RP2A 4B1TA 4LK4A 1EXFA 1N1LA 3QGNB 1MTSA 2YOLA 4YOGA 4YOIA 1HGTH 1N6YA 1E36B 2VIWA 8KME2 1J8AA 3DD2H 1CT0E 2WUBA 1DY8A 4GCHF 3KEEA 1CA8B 5FX6A 1GI3A 1X7AC 4GPGA 4IN1A 1WSSH 1C5TA 3M36A 1AUTC 1V2VT 2YNBA 1H9HE 4Y10E 1F0SA 1GBAA 2BDIA 3RXJA 2IJOB 1TGTA 1EP5A 2TBSA 3AW1A 5EPYA 1MKWH 3I29A 3QN7A 3NKKA 1SI5H 4WWYA 1GBMA 5DP8A 1C1RA 2BLQA 1IOEA 4GHTA 3QO6A 1KLJH 4OGYA 1K22H 3R0FA 2PTNA 4U32A 1TWXB 2BTCE 4O3UA 3F9FA 2PLXA 4J1YA 2ZU5A 2OQUA 5JBAS 2XBVA 1UVOA 3VB3A 1QBNA 1FY3A 4JZEH 6GCHF 1L1GA 2ASUB 2BMGB 4UFFH 1IHTH 4CHAC 5J4SA 5EG4A 3TJVA 2D1JA 1C5WB 1GGDB 3A8BA 1GJ8B 5DGJA 4NIVA 1O2OA 2DE8A 1B0EA 1SGFA 4AG2A 5LPEA 1NFWA 2A5IA 4E06H 1ZHMA 3V0XA 3BV9B 3KQBA 3ZVGA 5FX5A 1O2VA 1HJ8A 1RS0A 3MWIU 3A88A 1QB6A 4H6TA 1QBVH 2GD4B 1JIMA 2V6NA 5HM2A 1HAYB 3A8AA 2FZZA 1H8DH 2V3OH 3RXTA 1UVUH 4DCDA 1SG8B 3S9CA 2Q6DA 2FX6A