1EASA

Nonpeptidic inhibitors of human leukocyte elastase. 3. design, synthesis, x-ray crystallographic analysis, and structure-activity relationships for a series of orally active 3-amino-6-phenylpyridin-2-one trifluoromethyl ketones
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (serine protease)
molecule keywords PORCINE PANCREATIC ELASTASE
publication title Nonpeptidic inhibitors of human leukocyte elastase. 3. Design, synthesis, X-ray crystallographic analysis, and structure-activity relationships for a series of orally active 3-amino-6-phenylpyridin-2-one trifluoromethyl ketones.
pubmed doi rcsb
source organism Sus scrofa
total genus 58
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1994-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1easA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1easA01
1F5KU 3BTME 4BXSA 5EPYA 1T8MA 4F49A 3GDSA 5A8XA 4MPWA 3M5NA 2UUJB 4BAMB 1DXWA 1PPFE 1TAWA 2BD9A 2ZECA 1HNEE 5JPMH 5GJ4B 1OX1A 2QGRA 1GMHG 1EZUC 2VB0A 5T6GA 1TRYA 1ANCA 1EUFA 1HJ9A 1GPZA 1Y5AT 1OWKA 1C5XB 1GVKB 5J4QA 1DM4B 1XUFA 3ATLA 3U8TH 4DGJA 4Q7YA 4INKA 1Y3YA 1C5LH 1AFQC 1DICA 3SV2H 2VWNA 2WV4A 1YC0A 1GHAG 1ANDA 3V7TA 5FBIA 2VH0A 4YLQH 1THSH 5FHTA 1S81A 2ZC9H 2BDCA 5EQRA 3ZZ8A 1CT4E 1ELGA 4Y79A 5HGGA 3SO3A 1C1PA 1F0UA 4F4OC 1KXBA 4AN7A 1FJSA 3T25A 4A6LA 2ZNKH 1HYLA 1O3CA 1A0LA 2NU1E 4NFEA 4ZHAA 4MTBA 1HBTH 1OOKB 1O2WA 1P06A 1C2KA 4FU8A 2D1JA 4ABDA 2SGDE 2FOAA 1GI6A 3SUDA 1O2SA 3PO1C 1RTFB 3KQDA 4NSYA 4MNXA 1SOTA 3K6YA 3PWCA 2BZAA 3PM3A 4K60A 1SLWB 4NFFA 1CGJE 3VB7A 1V2UT 1O5AB 1CHOG 1DPOA 4CR5A 2ANWA 2OP9A 1TOCB 3LGUA 2OCVB 4O9VA 1GL0E 4LZ4B 2BXTH 2VWMA 2GD4B 4H6TA 2UUYA 1GI1A 1Z7KA 4Y10E 4AB8A 1B5GH 1AY6H 2JETC 2BD8A 1DWCH 1NC6A 1CA0C 1E35B 1DVAH 1KLJH 2XYAA 1EP6A 1ELCA 4CR9A 2R0KA 4TWYA 3ZVAA 2BDIA 3ATMA 1W12U 4B71A 1GG6C 2JKHA 2GMTB 1GJ9B 3MHWU 5JBBS 1O32A 3AASA 1TGSZ 2ZQ2A 3A80A 1BMNH 1QQUA 4DCDA 1K1PA 1GJCB 1QCPA 3HATH 5GCHG 1O0DH 3BTGE 3KGPA 4IW4E 3LH1A 4I8JA 1FPCH 1EOJA 1G3EA 1SGNE 2J95A 4O3TA 3A8AA 4D9QA 1D9IA 1C1WH 1PPBH 3SU2A 2DE9A 3TK5A 2R3UA 3FP8E 3ZZ5A 2Y81A 1C2HA 1NU7B 2AGEX 5A8YA 2A32A 1Z6EA 3E0NB 2V3HH 3NPSA 1ZRBA 2UUFB 2SNWA 3A83A 1FY3A 2FOMB 3A86A 1Z8IB 3SV9A 1GBKA 1YPKH 2UWOA 4X1RU 1AE8H 1Z1JA 2P3FH 1GBAA 4ZXXH 1FAKH 5FCKA 3RM2H 1F5RA 3RXFA 2JH5D 1C4V2 3VPKA 2A1DB 3LJOA 4YT7H 3SZNA 1GI3A 3BF6H 3SUEA 4NWLA 1SQAA 4NA7A 5EQQA 3UOUA 3ESTA 1UTMA 3RXEA 2C8XB 1IOEA 2PKSB 1ETTH 2V0BA 4AG1A 1YPMH 1IAUA 2A31A 6CHAC 4NZQA 3ATWA 5C1XA 3P95A 4NA8A 1IQIA 1GMCF 2UUKB 2BD7A 1BJVA 2FPZA 1FQ3A 4PROA 2GZ8A 1BITA 3P8FA 1RD3B 2EI7A 1HAGE 1XXFA 1SPJA 1S5SA 4FUJA 4E7RG 1P12E 3A82A 1SFQB 3SGAE 1NRRH 2K1QA 3UR6A 1HIAB 2BB4A 1SLXB 3GCOA 2BD2A 3SV7A 4A1VA 1K1IA 3A85A 2FDAA 4GAWA 1V2NT 3JZ2B 3GDUA 4NCYA 4AG2A 1J9CH 2BDAA 1GMDF 3RXKA 3P8GA 1SL3A 1W13U 1WU1A 4X2XA 1FLEE 1BJUA 3BTDE 3UREA 3QLPH 2GV6A 5K7RA 1GJ5H 4X6MA 1THRH 1JRTA 1TMTH 2Z9IA 2F9UA 2TPIZ 1HAZB 2SGAA 1GDUA 2C8YB 4CHAC 2V35A 5GWZA 1TX7A 1QY6A 3F9EA 1D3DB 3A89A 4CREA 3ZZ3A 1UK3A 3URDA 1WCZA 4MVNA 3TJUA 1PQ7A 3A7WA 4GUXA 2VVCA 1ZPZA 1FY5A 1O3AA 1Q3XA 1C5WB 1C5ZB 3ZZ6A 4B73A 1YPJH 2ZDLA 2ANKH 2ZU1A 2ZDVH 1O37A 2HLCA 1W7GH 3S9BA 1P04A 3UIRA 1S83A 2FI5E 2ZTYA 2BY6X 4K2YA 1GI5A 1KXCA 3RXOA 1C5RA 2TRMA 5DK1A 2A0QB 3E90B 4YOIA 1V2VT 3MU0A 2FTMA 2BTCE 1QL9A 1UHBB 1T8NA 1P2NA 4AZ2B 1O2ZA 4Y71A 1RIWC 2J2UA 1C1VH 1EOLA 1WOFA 3BTWE 4ZKSU 2O8TA 1DSTA 3N7OA 4GCHG 5FPYA 2GGVB 1C1TA 2ZGBH 4UDWH 1DWEH 1UK4A 8LPRA 4M7GA 1DUEA 1VZQH 1FI8A 1AFQB 1GBEA 3RMOH 2R9PA 1O39A 4I8KA 1O3EA 1CGIE 2VWLA 1AQ7A 1O2LA 3ITIA 2O8LA 3VXEH 3LC5A 2ZHDA 2BLOA 4WXVA 3VB5A 3TLOA 5JDUB 2XCFA 1F2SE 3QGJA 1EPTC 4JK6A 3DD2H 2OBQA 1ZGVA 1GL1A 3EYDA 2BLWA 1OP8A 3ZVEA 5FAHA 3PMAB 3RXTA 1IQMA 4A1TA 3VEQB 2OLGA 3TNSA 2ZWLH 4YOJA 1GCTC 6LPRA 2G55A 4ZKNU 2NU3E 3D62A 3GY4A 4YO9A 1OSSA 2FS8A 3ENSB 3NZIA 3RLWH 1C1MA 4H42U 4B75A 3SV8A 4NSVA 3FZZA 4ABGA 3PO1B 1BRBE 2GVFA 2PUXB 1FMGA 4WMDA 1NRSH 4JCNA 5EXLA 1OPHB 1FDPA 3ATIA 1SGEE 2A4RA 4WY3A 5LPEA 1PPHE 1BB0B 1HAIH 3M5OA 1D3QB 1HLTH 3EA7A 3SHCH 1D6RA 1O2PA 1TYNA 1P2KA 2FOHA 1EJNA 1HIAA 1P9SA 3SQEE 2ZHFH 1J15A 1JRSA 1ZOMA 2BVRH 3SNCA 4GHTA 4TY7A 1P2MA 1FPHH 1QB1A 1G30B 1TQ7B 1BQYA 3PLPA 3NCLA 1O34A 2M5TA 1PFXC 5A0BA 2OC8A 1GG6B 1RRKA 3ZZAA 3BIUH 1LMWB 1OWHA 1TOMH 2LPRA 2XBVA 1FNIA 1UMAH 3RMNH 3B23B 1TONA 3SU4A 2HGTH 1S85A 1ZJKA 1Y3VA 1FN8A 3GCTG 4ISLA 4U30A 1AIXH 1TALA 4ESTE 2OC0A 3HGNA 2QXHA 4ISHH 3ZZBA 5DKMA 1VITF 3GY3A 1CU1A 4KGAA 4YESB 1GGDB 2F91A 3E91A 1O3BA 1ELTA 5EW1H 3E3TA 1BOQA 3V13A 5C67A 1XM1A 3AAUA 4Q2KA 3UPEA 2STBE 1C2IA 2VH6A 4BXWA 1L0ZA 1V2OT 1GJAB 1SGDE 1BTYA 2Q1JA 2VNTA 1A5HA 4I8LA 3T62A 2Y6TA 3D23A 2BDYA 1F0TA 2BQ7B 4XDEA 1RS0A 5GCHF 5DO4H 2F3CE 1O33A 2FOFA 2F9NA 3RXBA 5A0CA 4Y11E 4Y7AA 5AHGH 2I6QA 3CS7A 1CT2E 1UTNA 4I8GA 1FONA 1SB1H 3MOCA 3DHKH 1UTQA 4ZHMU 1V2LT 1O3IA 2PTCE 4AX9H 2AMQA 3ZYDA 2HPPH 4Q7XA 1JIMA 3LT3A 3RXUA 1BTXA 1YPGH 2WPIS 3S69A 2FI3E 6CHAB 4ABAA 1MD7A 4INHA 4BAOB 4D8NA 3BEFB 2J4IA 1KLIH 1K1JA 2W3IA 1O2QA 2BOKA 5TCCA 5C1UA 1ABIH 3GY8A 1JBUH 3NUMA 1IQLA 3A8DA 5ETXA 4J2YB 3MU5A 2XWAA 1G3BA 3RXGA 1BUIA 3H7TA 2ZCHP 1BRUP 1V2WT 1UVOA 1L4ZA 1V2KT 1Z8RA 2AMPA 2P3TB 3UNQA 1AHTH 3QZRA 2HALA 1Y5BT 2P8OC 3K6ZA 2H2ZA 2XW9A 2ZA5A 3LONA 3TVJB 1FIWA 3T26A 1TPPA 1MQ5A 2WINI 4B74A 5BRRE 1GDQA 2ZFPH 1DUAA 1ZHRA 1ZSKA 1NRQH 3C1KA 4WF8A 5C20A 1TX8A 1EAUA 1TFXA 3HK6B 3RXQA 1YPEH 2OXSA 4XE4A 3VGCC 1MMJN 2GDDA 2V6NA 3RDZA 1NROH 3KQBA 4CHAB 1PYTD 6GCHG 1C2FA 4X1SU 4X8SH 1T8OA 4CBOA 1NZQH 2STAE 1TGBA 5AFYH 2BM2A 3SBKA 4UONA 5E2OA 1CE5A 3MH6A 3K65B 1MUEB 1AU8A 2CHAB 1T8LA 1G2MA 7GCHG 1K1MA 2FYRA 2NU0E 2C90B 3A7YA 5L2ZH 2YNAA 3CS0A 2CMYA 1NFUA 2W26A 1KY9A 3DA9B 2QY0B 2OINA 2BZ6H 4K1TA 4AOQA 1RIWB 3E8LA 1YYY1 2UWLA 2PKAB 1TGNA 2Y5HA 4IC6A 1EJMA 1AMHA 3HKIB 4WH6A 3LH3A 1OWJA 2XTTB 5FX6A 1ESAA 1KLTA 3T27A 3NKKA 2F9VA 4HZHA 4TYDA 2AGGX 2VIPA 2CN0H 1AVGH 5HYOA 2H1UA 4GLYA 1OYQA 1GBJA 2XNIA 3IWMA 4Y0YE 4CBNA 3PTNA 5CHAC 1EB1H 2F83A 1SGFG 3URCA 4LXBH 3SN8A 1C1QA 1TNLA 1HB0B 3ZZ4A 1QGFA 2WPJS 3GCHC 3BTFE 1DLKB 2ZO3H 1H9LB 4YZUA 4X2VA 1O2JA 1Q2WA 3EAJA 4B2BA 3MU4A 4B1TA 1CBWC 1GI8B 1MAYA 1ZPBA 2FM2A 5F6MA 2VINA 2GCHG 1OYTH 3MO3A 4JYTA 2PSYA 3Q3KA 1S6FA 3STIA 2DUCA 1BMAA 1MQ6A 3NK8A 3M35A 4E7NA 1Z71A 4B76A 3P8NA 3P8OA 3SQHE 1S0RA 2J34A 3DFLA 2GX4A 1L1JA 1DITH 1A0JA 5A2MH 2GCTC 1H4WA 2HRVA 3E6PH 1F7ZA 4DURA 2ILNA 2PWXA 3SV6A 2OBOA 1OWDA 1QHRB 1LPGB 1TE0A 5AVDA 2R3YA 3SW2B 3OY6U 1AWFH 4ABHA 2BD4A 1NU9A 4OS5A 4TPYA 3U8RH 4DJZB 1BTUA 2Z9JA 3A84A 3KF2A 5H4IB 1SGRE 3LKWA 1SOZA 3U69H 1YCPH 3I78A 3CP7A 1UCYH 3AVZA 3K9XB 1THPB 3RXIA 4ABBA 3SUFA 4BTUB 4JZFH 3GDVA 1KXFA 1TRMA 3W94A 1DSUA 1GBTA 3CENA 2XBWA 3V0XA 3ZZCA 2WUBA 4HTCH 4CRDA 1ANBA 1FAXA 1HDTH 1O2OA 1RJXB 3UTUH 4JYUH 3BG4C 5TJXA 5DP5A 3U9AH 5DJ7A 2WYGA 3PB1E 1YGCH 1GJ8B 2FO9A 2A4OA 1U6QA 2GT8A 1GI0A 1P57B 2FZZA 1QL8A 4OS6A 3DT0H 5EPNA 2TGTA 1BBRH 2H9HA 2BD3A 3SNBA 1ORFA 2BD5A 3FP7E 3LU9B 4Z6AH 4RKOB 1ETRH 2IOTA 4MPUA 3TGKE 1PJPA 1NFYA 1QL7A 3PMHB 4X1QU 5GDSH 1HCGA 4WXIA 1O3MA 1ZR0A 2JH0D 1O3PB 3UY9A 3LGVA 1SFIA 1BTHH 2KAIA 4H6SB 2QF0A 1YKTA 2PKAA 5E0GA 4K3JA 2A4QA 1GBFA 1AB9C 2ZU2A 3MYWA 4Z0KA 3OYPA 3M3SA 1G37A 1HGTH 1O3LA 1VGCC 1OXGA 4IN2A 1K1NA 3RMMH 2FS9A 4OS4A 2ZEBA 2IN2A 1YPHE 5DP6A 1AVXA 1O3HA 4NA9H 4B2AA 2OD3B 2XC4A 5EW2H 2Q6DA 4MQAA 1AFEH 1HRTH 4AYYB 4IN1A 5DP9A 2G5NA 4LZ1H 2B8OH 3ELAH 1O2VA 1IQKA 1EPTA 4A92A 1UCYE 3Q3YA 2CV3A 2ZPRA 1ZSLA 5ESBA 2ZDMA 1MBMA 3EE0B 3NWUA 1ZYOA 1A0HB 4DIIH 5F8TA 4R0IA 1CA8B 2D8WA 2O8MA 1IQJA 3BTQE 1AKSB 1S0QA 2GDEH 3IITA 3TJVA 3A8CA 1HFDA 1SHHB 2OQUA 1K21H 2W7UA 4OGYA 1CT0E 1GJ7B 4ZKOU 4YM9A 7ESTE 1CO7E 2FEQH 1UTLM 1NRPH 4ZH8A 1WSSH 5L6NH 3KL6A 1NO9H 3EA9A 3FVFB 1QNJA 3MH5A 1O5GH 1JMOH 1C1RA 1D6WA 4TY6A 5T6DA 2R2WU 2TBSA 4A5TS 4D7GA 4YT6H 1KSNA 3H7OA 3S7HB 4H4FA 2ZHWH 3QO6A 1KTTB 2GTBA 3PMBB 2FYQA 1F5LA 1ZLRA 2HPQH 2A2QH 1MKWH 3MWIU 1BMLA 1XXDA 1MKXH 2VU8E 3P92A 2A5KA 1TMUH 2AS9A 3RXMA 1GVZA 2ANMH 3AW1A 1PPGE 4YOGA 1BRAA 1SLUB 5LPRA 2G81E 3A88A 1NTPA 2P93A 1CQQA 1HAOH 1C2DA 1UVTH 4NIXA 2ALPA 3LOXA 1KTSB 3SGBE 1AN1E 1YCPK 1UTPA 3FZDA 1UCYK 1EZXC 2Y7XA 4Q7ZA 3SGQE 2GT7A 1N6XA 1XUIA 1Y59T 1SHYA 9LPRA 1J14A 2FOEA 1MU8B 3GY2A 3A7ZA 4CRCA 1LHEH 1SGYE 1AZZA 4NZLA 2VWOA 1C5SA 1SGTA 4IBLH 2D26C 3MFJA 2W7SA 2Z9KA 4FVBA 4ABFA 2G4TA 5T3HA 4E05H 1GBLA 1ZZZA 1P2OA 2EEKA 1ZMNA 2P16A 3M7TA 1MH0A 2WV5A 5IDKA 1GHZA 1TBQH 4KTSA 3UWJH 1O2MA 1TRNA 1BBRK 1C1NA 1QIXB 1XUJA 3E0PB 1EZQA 4OS1A 2QV1A 2PHBA 1C5NH 2VIOA 3ZV8A 1CBWB 1EXFA 1MTUA 1QJ6B 5C1YA 1BTPA 3T29A 3MMGA 4BAQB 1O2XA 1TPAE 3GY7A 4X2WA 9ESTA 1B7XB 1ACBE 4MNWA 1KIGH 4X8UH 3RP2A 2SGEE 2RA0A 4BAKB 3RXLA 3F9FA 3GOVB 2BXUH 1LHGH 1HAHH 1NFXA 2H6MA 4O97A 3V12A 1EJAA 3PLBA 3MNBA 1ZRKA 3RXPA 1MU6B 3FAOA 3UFAA 1GJ4H 1DY8A 3P70B 5DP4A 1H9IE 2ZFQH 1LVYA 3SJKA 3SJ8A 4X0WU 2WPMS 3ZVBA 2BY7X 4KTUA 3A7VA 3RLYH 4B2CA 1GMHF 4JYVH 2Z3CA 4UEHH 1SGCA 1AKSA 2C8WB 1FV9A 3LGYA 5C5OA 2H5DA 5CMXH 3WY8A 5A8ZA 1NN6A 1BTZA 1W10U 4KELA 3STJA 3G01A 1ETSH 1KDQB 4Y76A 3UOPA 3BIVH 4WVPE 4AFZA 4YTAA 2C3SA 1P3EA 3SJ9A 1GHAF 2BY8X 1A5IA 3RXSA 1P09A 2O9QA 2G8TA 1NM6A 4FUEA 5EQSA 1AZ8A 1A46H 2G52A 1ARBA 3SNDA 4DT7B 2FMJA 3T5FH 1SSXA 4YLUA 8GCHG 1EAXA 4ISOA 4NIWA 1O35A 4AFQA 4JZEH 2FIRH 3A8BA 5EXNA 1SQTA 3SUGA 3TK9A 2ZGJA 4WWYA 1C9PA 1HPGA 2ODQA 1J16A 8ESTE 3VB6A 2VIWA 4ABIA 1AGJA 2AIPA 2GP9B 3T2NA 2JETB 4RSPA 3O8CA 1TMBH 1SGQE 1CA0B 2BX4A 1TBRH 2ODYB 3GCNA 3M7QA 5G4BA 1AWHB 3M3TA 1MKWK 1K22H 3BTTE 1F0RA 5E0HA 1MKXK 2SGQE 1CHOF 1SC8U 4K8BA 4ZXYH 1TNKA 1NY22 2ZTXA 3BN9A 4FUFA 2VVVA 1O2YA 3RXCA 1YBWA 4JZIA 3K2UA 2WPKS 3HPTB 1GI4A 2ZKSA 4TWWA 5LPFA 2WUCA 5B6OA 1VCWA 2AGIX 5I25A 2SGFE 1C1UH 2AERH 2FX4A 1RFNA 5ESTE 2C4FH 4OS2A 2Z3DA 3S9AA 4IMZA 4AYVB 4WJG2 3S7KB 4Y8XA 1C5TA 1NRNH 2B0FA 1ZTKA 2JH6D 5FPTA 1P03A 5K0HA 3MH7A 1CHGA 1LHCH 3H5CB 2VIQA 1ZTLA 1OWIA 1V2MT 3TJNA 4XSKU 3PYHA 1GCDA 3OTJE 1QB6A 5JYIA 3UQOA 5EODA 1VJ9U 2QF3A 4TPIZ 1T7CA 1HAYB 2ZP0H 1YCPM 1Y3UA 2FESH 2CF9H 3O8BA 3A81A 2VIDA 4X1NU 3SU1A 1HXEH 1NS3A 4IMQA 2J92A 4OGXA 1IQNA 1BTWA 1QBNA 5E0JA 5JB9S 3SJIA 3UNSA 1QJ7B 1LTOA 2BDGA 4FU9A 5A09A 3M61U 1PQ5A 4VGCC 2QIQA 1LHDH 5FCRA 2ZU3A 4K1EA 4DIHH 2ASUB 2Y80A 2XXLA 3M5MA 3Q76A 3QGNB 1O5BB 2ZHEH 3ZVFA 2WYJA 1KDQA 2HNTC 3ZZ7A 8KME2 4D7FA 2GZ7A 3RC6A 2BHGA 1SGIB 2OTVA 1DANH 1VITH 1GBIA 4ZHLU 1H1BA 1QTFA 1AI8H 2AFQB 4FXGH 1W11U 2A4GA 3FP6E 2P3UB 2J9NA 4UFGH 3V3MA 1IHTH 3MO6A 2XC0A 4CH2B 1ZGIA 5EU8A 3UR9A 1GMCG 1TGCA 5ABWA 4FVDA 1P10A 3OX7U 1G3CA 1BIOA 1MCTA 1E36B 1O2IA 2QXJA 3TU7H 4GPGA 5LH8A 1DY9A 4U32A 1O2TA 4UD9H 1P9UA 1C5OH 2Z3EA 4BTTB 4R8TB 2NU2E 2PTNA 2Z6BD 1XMNB 1PQAA 2BLQA 2ZGCA 4AB9A 3SORA 3EGKH 3UQVA 4IS5A 1GBMA 1LHFH 5T6FA 5DP7A 1GMDG 1V3XA 4X6PA 4ISIH 1RGQA 1WV7H 2PLXA 4Q80A 1DLEA 3U8OH 1JWTA 2KAIB 5SGAE 3F1SB 4OS7A 3PTBA 1P05A 4JZ1A 1GHYH 1T31A 1Z8JB 1LDTT 3MU1A 3AW0A 1P2JA 1DOJA 3ZVDA 1Z1IA 2Z9LA 1W0ZU 4KP0A 1MD8A 1YLCA 1HAPH 5EG4A 4NG9H 4NIVA 1HXFH 2Y82A 1P0SH 3RXVA 1A3BH 1OP2A 3QWCH 1YF4A 1SR5C 2CXVA 5AFZH 3UUZA 2BYAX 3B9FH 1ZSJA 1ESTA 1MTNC 4FUDA 1A61H 1TBZH 3Q3XA 3GICB 1GJ6A 4J1YA 1EPTB 1WTGH 2I6SA 3S9CA 4GCHF 2FLRH 1QBVH 5C2ZA 3KN2A 1A4WH 2W5EA 3TK6A 1GBHA 1TIOA 1K2I1 3LJJA 1GCTB 4ISNA 3ZV9A 1TABE 2O8UA 1HJAC 4MLFB 1MAXA 1EAWA 3SNAA 2PFEA 1ZMJA 3MTYA 1GI7B 1KXAA 1LQEA 5DPAA 3E1XB 3BG8A 1Q31A 2DE8A 1O3NA 3A7XA 1E37B 4DOQA 1VCPA 1AD8H 1O5DH 2ZHQH 1JIRA 2ZZUH 1DWDH 4X8VH 1XUHA 3TGJE 1OWEA 3GY6A 5HXFA 3Q77A 5EGMA 3MNXA 4NGAH 4FUBA 2NU4E 1O3OA 1FUJA 1LVOA 1QQ4A 1XX9A 4U2WA 4Y7BA 1FY1A 1UK2A 1A2CH 4AGJA 1GHWH 3M7UA 1QA0A 3OU0A 1PYTC 3KEEA 3RXAA 1QB9A 1V2RT 1P3CA 4MG3A 1ELAA 2Y5FA 1MBQA 1ELVA 1FXYA 3ODDA 3RXRA 1S82A 4BNRA 5JBAS 1C9TA 8GCHF 5E2PA 4D76A 1QA7A 1PQ8A 1QFKH 2HNTE 3TJOA 3TPIZ 1MTVA 2H9TH 2ZF0H 4X6NA 5J4SA 2XWBI 1G3DA 4KKDA 3QZQA 2V3OH 1WBGB 1PPZA 1P02A 2Y7ZA 2ZFRH 1SG8B 2CGAA 5C5NA 2FOCA 1V2JT 5HM2A 1TNJA 2HWLB 3LGTA 1ELFA 3DUXH 2ZPSA 4K69A 2ESTE 3LIWA 3PV4A 1W2KH 4X6OA 2R2MB 1EAIA 3MH4A 2VGCC 1CVWH 2ZFFH 1EASA 2D2DA 4WMEA 1GJDB 1YP9A 2ZU4A 3S0NA 1TPSA 1P01A 3JZ1B 4RN6A 4Y8YA 3BEIB 1LPKB 2BVSH 3W95A 3GCTF 5L30H 1DX5M 1J8AA 1BMMH 1ELDE 1CGHA 3RXJA 1SGFA 3HGPA 1HAVB 1T32A 2C93B 4MPVA 4UFEH 2BQ6B 3TGIE 1V2QT 1O2KA 1RTKA 3TH4H 1B0FA 1TA6A 1VITG 1GHBG 3QDZB 2ZFTA 5FBEA 3MI4A 3M36A 3ZVCA 1GBBA 3TH3H 4AFUA 4HGCA 1DXPA 5JBTA 2TGAA 3A7TA 3MU8A 5F03A 3A87A 5IYTA 1SQOA 4X1PU 3LGIA 1JOUB 2FX6A 1T4UH 3B8JA 1ZJDA 1OS8A 1FY8E 3I29A 5EXMA 1VJAU 4VGCB 1B0EA 2AIQA 1GHVH 1C2EA 1NESE 1ABJH 2GKVE 1EZSC 3ZZ9A 1LQDB 3L6PA 1LCYA 4I7YH 1LPZB 5JB8S 1VR1H 4UFFH 3ZVGA 1DS2E 5I46H 5A0AE 2ZCLP 5DGJA 4BAHB 4I8HA 4THNH 1GGDC 1EB2A 4JZDH 1C2GA 1ZHMA 2C8ZB 3LDXH 5FXLA 2P8OB 4AGKA 3C27B 1HJ8A 4Y6DA 1O5FH 5BPEA 1FIZA 2ZGXH 5HMAA 2H9EH 2Z7FE 4D9RA 1E38B 2P94A 2G00A 1BBRE 2SFAA 1TWXB 3VGCB 2TGDA 2B9LA 5DG6A 4ZUHA 2ZDAH 3EDXB 1DDJA 4CRAA 3M3VA 1TNHA 1QJ1B 2EI6A 2RDLA 3KQCA 1XUGA 3ZYEA 5AF9H 1EX3A 2AYWA 4FUCA 1O36A 1BHXB 2IJOB 4K5ZA 2EC9H 1XVMA 3ODFA 2SNVA 2BDBA 1X7AC 2XRCA 1IQFA 2SGPE 4ZKRU 3VB3A 3RMLH 2HOBA 2XCNA 5FX5A 1V2TT 3RU4E 1O2GH 2PUQH 1QURH 2BY9X 4ZMAH 2B5TB 2A7JA 3PMJA 6GCHF 3QTOH 4MDSA 3PLKA 2EA3A 3R3GB 2FOGA 1EKBB 1LKAA 3LGWA 4MPXA 4CH8B 2F9OA 1Y8TA 1C5UA 1K1OA 2BDHA 2ZG0H 2VVUA 4JK5A 2R0LA 1DT2A 3VXFH 4MNYA 4XBBA 4KTCA 2XBYA 7GCHF 1ELBA 1ARCA 1YLDA 3D49H 1N8OC 1J17T 2Q6GA 1A7SA 1K1LA 1UVUH 1G32B 1GI9B 1KXEA 1S84A 2ZDKA 4ASHA 1MTNB 5CHAB 3SU0A 1WYKA 4INLA 1C4Y2 3GYLB 3SI4H 5L2YH 3GCHB 4HFPB 5DP8A 1HAVA 3MO9A 2BOHB 4LOYH 1C1OA 3BTHE 1GDNA 7LPRA 1GHXH 4Y8ZA 1HJAB 1Z6JH 1O3GA 2WPHS 1WAYB 1MCVA 2CHAC 1P8VC 2ZGHA 5F8ZA 4BANB 1O30A 3AAVA 1TPOA 1XUKA 2CJIA 3P6ZB 3F6UH 1VCQA 4XBDA 1D4PB 1GI2A 3T28A 3GYMA 2AMDA 3BEUA 2GZ9A 2ZTZA 4I31A 2Y5GA 4DY7B 1GWAA 2HVXA 4X2YA 1QRZA 2OUAA 2CF8H 2GCTB 1JXPA 1MZDA 2G5VA 4CRBA 1TNIA 2ZPQA 1W7XH 1O2UA 3PROA 1H8IH 1YPLH 3F9HA 3TITA 3QTVH 1BA8B 1O2NA 4CRFA 2GCHF 1O3KA 2FI4E 3F9GA 4A7IB 4DW2U 2IPHA 4ABJA 1FZZA 3U1JB 1N1LA 2OC1A 3SI3H 2XBXA 2GV7A 1L1GA 4FUGA 2QC2A 1RXPA 1UVPA 2RA3A 4SGBE 3HK3B 1C1SA 3HKJB 3RUOA 2AH4X 2PGBB 1A5GH 1FN6A 3EA8A 4UFDH 2FOBA 3BTEE 1C4U2 3NXPA 2XC5A 1ZPCA 3QK1A 1BRCE 3BG4B 3QUMP 3SOSA 1XKAC 4IC5A 1QRXA 4AFSA 1TQ0B 1K9OE 1NFWA 3SU6A 4K1SA 4MNVA 1TA2A 1O2RA 3RXDA 1LVBA 1XKBC 4E06H 2EI8A 2QYIA 2A2XH 3TNTA 1UTOA 1V2PT 1WQSA 2VGCB 1E0FD 1P2QA 2YNBA 1KYNA 1XVOA 3OY5U 4FU7A 5GIBA 1IQEA 1P2IA 1TNGA 3KIDU 1UTJA 2LNCA 3L3TA 2ZFSA 2QA9E 2TGPZ 2ZU5A 1HV7A 1L2EA 1AE5A 3O8DA 1W8BH 1TLDA 1ESBA 1ANEA 1Y5UT 2ODPA 2RG3A 1AB9B 3ATKA 3LPRA 4BOHA 4O03A 1UJ1A 1VGCB 2FODA 1C2MA 3E16B 1K28D 1V2ST 2J94A 3KQEA 5F8XA 4XFQA 1WTHD 2QXIA 2W3KA 2ULLA 1NPMA 1LKBA 2OQ5A 2ALVA 3KHVA 2FWWA 1C5VA 1O5CB 3KNXA 2F9BH 3L33A 2BVXH 2PGQB 4A1XA 1PPEE 5GPIB 2ZDNA 1M9UA 4SGAE 1L4DA 2PR3A 3LC3A 1AUJA 2VJ1A 2QN5T 3BTKE 1Z8GA 1GHBF 2THFB 1W0YH 3VB4A 1MZAA 2FLBH 4NWKA 3TH2H 3SNEA 1NT1A 1F0SA 1S6HA 2RCEA 1QRWA 1OKXA 3ZZDA 1RTLA 4JMYA 2AEIH 5TCAA 2A5AA 1QBOA 3DFJA 2ZI2H 2BQWB 5DP3A 3F68H 3RC4A 1O31A 4QT8C 4NIYA 4X8TH 1UHBA 1H8DH 2G51A 4HI3A 5JBCS 1V6DA 4K8YA 1O38A 2QAAA 4FUHA 1LVMA 2GMTC 2O8WA 2QCYA 2WPLS 1C5MD 2ANYA 1T4VH 3MNSA 1EQ9A 4UE7H 2YOLA 1A3EH 3EQ0H 4AORA 3M37A 1C5PA 2A45B 4FUIA 6ESTA 4WH8A 3RM0H 1HAXB 2A7CA 1OP0A 1FY4A 1CSOE 3SHAH 1C2JA 1L1NA 1D3PB 1GBCA 3UNRA 3GY5A 1QR3E 3P17H 1SBWA 1MTSA 2Q6FA 1C5YB 1GVLA 2VIVA 3R0FA 2A5IA 1EATA 1O3FA 3M5LA 1HUTH 3TIUA 4I32A 2HNTF 3D65E 1EP5A 1O3JA 1BDAA 4Y0ZE 1TGTA 4U01A 2OC7A 1A1RA 5EOKA 2PW8H 1BZXE 1P11E 2UWPA 2G4UA 1O5EH 5CE1A 2NWNA 1YM0A 1Y3XA 1N8OB 2BLVA 4GSOA 3FFGA 1W3CA 1ZTJA 3BV9B 3RU4T 1UO6A 2BY5X 3I77A 4DVAU 1H9HE 2H5CA 3RC5A 1TX6A 5C3NA 3SJOA 2PKSC 1ID5H 1IHSH 4GHQA 1N6YA 3FANA 4XOJA 1SMFE 1G36A 1WQVH 7KMEH 1O3DA 4ZAEA 3GISB 4XBCA 2FXRA 2ZQ1A 2J38A 3RU4D 1BHXF 3RXHA 2Z94A 2PV9B 5PTPA 4BTIB 1C5QA 3O8RA 2FP7B 2BX3A 1E34B 1G9IE 2PSXA 1SGPE 3QN7A 3SU5A 3PWBA 1C2LA 1SVPA 4I33A 2A7HA 4ABEA 4WMFA 3U1IB 2P59A 3Q00A 2F9PA 1UTKA 2ZIQH 1KXDA 1DWBH 1AO5A 1GJBB 3VFEA 4CRGA 1BT7A 2P95A 1YPHC 1DFPA 2Z9GA 1ZMLA 3SU3A 1IQGA 1WUNH 5E8EH 1F92A 1AVWA 1PPCE 5FPSA 1G2LA 1BCUH 1SI5H 2FTLE 4ZROA 3MNCA 1TB6H 3BSQA 2ZCKP 1IQHA 4GVUA 1UVSH 1W14U 2BMGB 3OSYA 1AUTC 4IGDA 1O2HA 5HM9A 2QXGA 3UWIA 1SLVB 3KCGH 4DG4A 1DE7H 1ZHPA 3IG6B 4RKJB 2TIOA 3QX5H 4LK4A 3U98H 1ELEE 4O3UA 1Y3WA 2B7DH 1D3TB 1GBDA 1LO6A 5GXPA 5LGOA 1INCA 1MTWA
chains in the Genus database with same CATH superfamily
3FOAA 1F5KU 3BTME 4BXSA 5EPYA 1T8MA 4F49A 3GDSA 2IJD1 1H8ED 5A8XA 1WXRA 4MPWA 2QF5A 3M5NA 2UUJB 4BAMB 1DXWA 1PPFE 1TAWA 2BD9A 2ZECA 1HNEE 2M2AA 5JPMH 5GJ4B 1OX1A 2QGRA 1GMHG 1EZUC 2VB0A 1E79D 5T6GA 1TRYA 1ANCA 1EUFA 1HJ9A 1GPZA 1Y5AT 1OWKA 1C5XB 1GVKB 5J4QA 3WW7A 1DM4B 1XUFA 4OM9A 3ATLA 3U8TH 4DGJA 4Q7YA 4INKA 1Y3YA 1C5LH 1AFQC 1DICA 4FOUC 3SV2H 2VWNA 2WV4A 1W0KD 1YC0A 1GHAG 1ANDA 3V7TA 5FBIA 2VH0A 4YLQH 1THSH 5FHTA 1S81A 2ZC9H 2BDCA 5EQRA 3ZZ8A 1CT4E 1ELGA 4Y79A 5HGGA 3SO3A 1C1PA 1F0UA 4F4OC 1KXBA 4AN7A 1FJSA 3T25A 4A6LA 2ZNKH 1HYLA 1O3CA 1A0LA 2NU1E 4NFEA 4ZHAA 4MTBA 1HBTH 1OOKB 1O2WA 1P06A 1C2KA 1WDIA 4FU8A 2D1JA 4ABDA 2SGDE 2FOAA 1GI6A 3SUDA 1O2SA 3PO1C 1RTFB 3KQDA 4NSYA 4MNXA 1SOTA 3K6YA 3PWCA 2BZAA 3PM3A 4P02A 4K60A 1SLWB 4NFFA 1CGJE 3VB7A 1V2UT 1O5AB 1CHOG 1DPOA 4CR5A 2ANWA 2OP9A 1TOCB 3LGUA 2OCVB 4O9VA 1GL0E 4LZ4B 2BXTH 2VWMA 2GD4B 4H6TA 2J98A 2UUYA 1GI1A 1Z7KA 4Y10E 4AB8A 1B5GH 1AY6H 2JETC 4RT1A 2BD8A 1DWCH 1NC6A 1CA0C 1E35B 1DVAH 1KLJH 2XYAA 1EP6A 1ELCA 4CR9A 2R0KA 4TWYA 1MABB 3ZVAA 2BDIA 3ATMA 1W12U 4B71A 1GG6C 2JKHA 2GMTB 1GJ9B 3MHWU 5JBBS 1O32A 3AASA 1TGSZ 2ZQ2A 3A80A 1BMNH 1QQUA 4DCDA 1K1PA 1GJCB 1QCPA 3HATH 5GCHG 1O0DH 3BTGE 3KGPA 4IW4E 3LH1A 4I8JA 1FX0B 1FPCH 1EOJA 1G3EA 1SGNE 2J95A 4O3TA 3A8AA 4D9QA 1D9IA 1C1WH 1PPBH 3SU2A 2DE9A 3TK5A 2R3UA 3FP8E 3ZZ5A 2Y81A 3F0PA 1C2HA 1NU7B 2LP6A 2AGEX 5A8YA 2A32A 1Z6EA 5KGOA 3E0NB 2V3HH 3NPSA 1ZRBA 2UUFB 2SNWA 3A83A 1FY3A 1NBMD 2FOMB 3A86A 1Z8IB 3SV9A 1GBKA 1YPKH 2UWOA 4X1RU 1AE8H 1Z1JA 2P3FH 1GBAA 4ZXXH 1FAKH 5FCKA 3RM2H 1F5RA 3RXFA 2JH5D 1C4V2 3VPKA 2A1DB 3LJOA 4YT7H 3SZNA 1GI3A 3BF6H 3SUEA 4NWLA 1SQAA 4NA7A 5EQQA 3UOUA 3ESTA 4ACBA 1UTMA 3PRBA 3RXEA 2C8XB 1IOEA 2PKSB 1ETTH 2V0BA 4AG1A 1YPMH 1IAUA 3MQKC 2A31A 6CHAC 4NZQA 3ATWA 5C1XA 3P95A 4NA8A 1IQIA 1GMCF 2UUKB 2BD7A 1BJVA 2FPZA 2XOKD 1FQ3A 4PROA 2GZ8A 1BITA 3P8FA 1RD3B 2EI7A 1HAGE 1XXFA 1SPJA 1S5SA 4FUJA 4E7RG 1P12E 3A82A 1SFQB 3SGAE 1NRRH 2K1QA 3UR6A 1HIAB 2BB4A 1SLXB 3GCOA 2BD2A 3SV7A 4A1VA 1K1IA 3A85A 2YMSC 2FDAA 2KM0A 4GAWA 1V2NT 3JZ2B 3GDUA 4NCYA 4AG2A 1J9CH 2BDAA 1GMDF 2IPQX 3RXKA 3P8GA 1SL3A 3F2HA 1W13U 1WU1A 4X2XA 1FLEE 1BJUA 3BTDE 5HIZA 3UREA 3QLPH 2GV6A 5K7RA 1GJ5H 4X6MA 2EY4C 1THRH 1JRTA 1TMTH 2Z9IA 2F9UA 2TPIZ 1HAZB 2SGAA 1GDUA 2C8YB 5T1VA 5DN6D 4CHAC 2V35A 5GWZA 1TX7A 1QY6A 3F9EA 1D3DB 3A89A 4CREA 3ZZ3A 1UK3A 3URDA 1WCZA 4MVNA 3TJUA 1PQ7A 3A7WA 4GUXA 2VVCA 1ZPZA 1FY5A 2OK5A 1O3AA 1Q3XA 1C5WB 1C5ZB 3ZZ6A 4B73A 1YPJH 2ZDLA 3H09A 2ANKH 2ZU1A 2ZDVH 1O37A 2HLCA 1W7GH 3S9BA 1P04A 3UIRA 1S83A 2FI5E 2ZTYA 2BY6X 4K2YA 1GI5A 1KXCA 3RXOA 1C5RA 2TRMA 5DK1A 2A0QB 2KCPA 3E90B 4YOIA 1V2VT 3MU0A 2FTMA 2BTCE 1QL9A 1UHBB 1T8NA 5F53A 5GNDA 1P2NA 4AZ2B 1O2ZA 4Y71A 1RIWC 2J2UA 1C1VH 1EOLA 1WOFA 3BTWE 4ZKSU 1K0HA 2O8TA 1DSTA 3N7OA 4GCHG 5FPYA 2GGVB 1C1TA 2ZGBH 4UDWH 1DWEH 1UK4A 8LPRA 4M7GA 1DUEA 1VZQH 1FI8A 1AFQB 1GBEA 3RMOH 2R9PA 1O39A 4I8KA 2QE7D 1O3EA 1CGIE 2VWLA 1AQ7A 1O2LA 3ITIA 2O8LA 3VXEH 3LC5A 2ZHDA 2BLOA 4WXVA 3VB5A 3DSOA 3TLOA 5JDUB 2XCFA 1F2SE 3QGJA 1EPTC 4JK6A 3DD2H 2OBQA 1ZGVA 1GL1A 3EYDA 2BLWA 1OP8A 3ZVEA 5FAHA 3PMAB 3RXTA 1IQMA 4A1TA 3VEQB 2OLGA 3TNSA 2ZWLH 4YOJA 1GCTC 6LPRA 2G55A 4ZKNU 2NU3E 3D62A 3GY4A 4YO9A 1OSSA 2FS8A 3ENSB 3NZIA 3RLWH 1C1MA 4H42U 4B75A 3SV8A 4NSVA 3FZZA 4ABGA 3PO1B 1BRBE 2GVFA 2PUXB 1FMGA 4WMDA 1NRSH 4JCNA 2K0QA 5EXLA 1OPHB 1FDPA 3ATIA 1SGEE 2A4RA 4WY3A 5LPEA 1PPHE 5C17A 1BB0B 1HAIH 3M5OA 1D3QB 1HLTH 3EA7A 3SHCH 1D6RA 1O2PA 1TYNA 1P2KA 2FOHA 1EJNA 1HIAA 1P9SA 3SQEE 2ZHFH 2F43B 1J15A 1JRSA 1ZOMA 2BVRH 3SNCA 4GHTA 4TY7A 2WHXA 1P2MA 1FPHH 1QB1A 1G30B 1TQ7B 1BQYA 3PLPA 3NCLA 1O34A 2M5TA 1PFXC 5A0BA 2OC8A 1GG6B 1RRKA 3ZZAA 3BIUH 1LMWB 1OWHA 4RT0A 1TOMH 2LPRA 2XBVA 1FNIA 1UMAH 3RMNH 3B23B 1TONA 3SU4A 2W6JD 2HGTH 1S85A 1ZJKA 1Y3VA 1FN8A 3GCTG 4ISLA 4U30A 1AIXH 1TALA 4ESTE 2OC0A 3HGNA 2QXHA 4ISHH 3ZZBA 5DKMA 1VITF 3GY3A 1CU1A 4KGAA 4YESB 1GGDB 2F91A 3E91A 1O3BA 1ELTA 5EW1H 3E3TA 1BOQA 3V13A 5C67A 1XM1A 3AAUA 4Q2KA 3UPEA 3VG8A 2STBE 1C2IA 2VH6A 4BXWA 1L0ZA 1V2OT 1GJAB 1SGDE 1BTYA 2Q1JA 2VNTA 1A5HA 4I8LA 3T62A 2Y6TA 3D23A 2BDYA 1F0TA 2BQ7B 4Q4LA 4XDEA 1RS0A 5GCHF 5DO4H 3OEHD 2F3CE 1O33A 2FOFA 2F9NA 3RXBA 5A0CA 4Y11E 4Y7AA 5AHGH 2QF4A 2I6QA 3CS7A 1CT2E 1UTNA 4I8GA 1FONA 1SB1H 3MOCA 3DHKH 1UTQA 4ZHMU 1V2LT 1O3IA 5FL7D 2PTCE 4AX9H 2AMQA 3ZYDA 2HPPH 4Q7XA 1JIMA 3LT3A 1COWD 3RXUA 1BTXA 1YPGH 2WPIS 3S69A 2FI3E 6CHAB 4ABAA 1MD7A 4INHA 4BAOB 4D8NA 3BEFB 2J4IA 1KLIH 1K1JA 2W3IA 1O2QA 2BOKA 5TCCA 5C1UA 1ABIH 3GY8A 1JBUH 3NUMA 1IQLA 3A8DA 5ETXA 4J2YB 3MU5A 2XWAA 1G3BA 3RXGA 1BUIA 3H7TA 2ZCHP 1BRUP 5HIYA 1V2WT 1UVOA 1L4ZA 1V2KT 1Z8RA 2AMPA 2P3TB 3UNQA 1AHTH 3QZRA 2HALA 1Y5BT 2P8OC 3K6ZA 2H2ZA 2XW9A 2ZA5A 1E1QD 3LONA 3TVJB 1FIWA 3T26A 4DT4A 1TPPA 1MQ5A 2WINI 4B74A 5BRRE 3PV2A 1GDQA 2ZFPH 1DUAA 1ZHRA 1ZSKA 1NRQH 3C1KA 4WF8A 5C20A 1TX8A 1EAUA 1TFXA 3HK6B 1BMFD 1YPEH 2OXSA 4XE4A 3RXQA 3VGCC 1MMJN 2GDDA 2V6NA 3RDZA 1NROH 3KQBA 4CHAB 1PYTD 6GCHG 1C2FA 3F3BA 4X1SU 4X8SH 5CDFE 1T8OA 4CBOA 1NZQH 2STAE 1TGBA 5EJZA 5AFYH 2BM2A 3OFND 3SBKA 4UONA 5E2OA 1CE5A 3MH6A 3K65B 1MUEB 3NRLA 1AU8A 2CHAB 1T8LA 1G2MA 7GCHG 1K1MA 2J98B 2FYRA 2NU0E 2C90B 3A7YA 5L2ZH 2YNAA 3CS0A 2CMYA 1NFUA 2W26A 1KY9A 3DA9B 2QY0B 2OINA 2BZ6H 4K1TA 4AOQA 1RIWB 3E8LA 3GS9A 1YYY1 3F0OA 2UWLA 2PKAB 1TGNA 2Y5HA 4IC6A 1EJMA 1AMHA 3HKIB 4WH6A 3LH3A 1OWJA 3EE7A 2XTTB 5FX6A 1ESAA 1KLTA 3T27A 3UB0A 3NKKA 2F9VA 4HZHA 4TYDA 2AGGX 2VIPA 2CN0H 3PV5A 1UW7A 1AVGH 5HYOA 2H1UA 4GLYA 1OYQA 1GBJA 2XNIA 3IWMA 4Y0YE 4CBNA 3PTNA 5CHAC 1EB1H 2F83A 1SGFG 3URCA 4B6FA 4LXBH 3SN8A 1C1QA 1TNLA 1HB0B 2HLDD 3ZZ4A 1QGFA 2WPJS 3GCHC 3BTFE 1DLKB 2ZO3H 1H9LB 4YZUA 4X2VA 1O2JA 1Q2WA 3EAJA 4B2BA 3MU4A 4B1TA 1CBWC 1GI8B 1MAYA 1VKYA 1ZPBA 2FM2A 5F6MA 2VINA 2GCHG 1OYTH 3MO3A 4JYTA 2PSYA 3Q3KA 1S6FA 3STIA 2DUCA 1BMAA 2RFKC 1MQ6A 3NK8A 3M35A 4E7NA 1Z71A 3DSPA 4B76A 3P8NA 3P8OA 3SQHE 1S0RA 2J34A 2CK3D 3DFLA 2GX4A 1L1JA 3KQ5A 1DITH 1A0JA 5A2MH 2GCTC 1H4WA 2HRVA 3E6PH 1F7ZA 4DURA 2ILNA 2PWXA 3SV6A 2OBOA 1OWDA 1QHRB 1LPGB 1TE0A 5AVDA 2R3YA 3SW2B 3OY6U 1AWFH 4ABHA 2BD4A 1NU9A 4OS5A 4TPYA 3U8RH 4DJZB 1BTUA 2Z9JA 3A84A 3KF2A 5H4IB 1SGRE 3LKWA 1SOZA 3U69H 1YCPH 3I78A 3CP7A 1UCYH 3AVZA 3K9XB 1THPB 3RXIA 4ABBA 2RDEA 3SUFA 4BTUB 4JZFH 3GDVA 1KXFA 1TRMA 3W94A 1DSUA 1GBTA 3CENA 2XBWA 3V0XA 3ZZCA 2WUBA 4HTCH 4CRDA 1ANBA 1FAXA 1HDTH 1O2OA 1RJXB 3UTUH 4JYUH 3BG4C 5TJXA 3FKSD 5DP5A 3U9AH 5DJ7A 2WYGA 3PB1E 1YGCH 1GJ8B 2FO9A 4M9FA 2A4OA 1U6QA 2GT8A 1GI0A 1P57B 2FZZA 1QL8A 4OS6A 3DT0H 5EPNA 2TGTA 1BBRH 2H9HA 2BD3A 2GJGA 3SNBA 1ORFA 2BD5A 3FP7E 3LU9B 4Z6AH 4RKOB 1ETRH 2IOTA 4MPUA 3TGKE 1PJPA 1NFYA 1QL7A 3PMHB 4X1QU 5GDSH 1HCGA 4WXIA 1O3MA 1ZR0A 2JH0D 1O3PB 3UY9A 2WPDD 3LGVA 1SFIA 1BTHH 2KAIA 4H6SB 2QF0A 1YKTA 2PKAA 5E0GA 5B6LA 4K3JA 2A4QA 1GBFA 1AB9C 2ZU2A 3MYWA 4Z0KA 3OYPA 3M3SA 1G37A 1HGTH 1O3LA 5C94A 1VGCC 1OXGA 4IN2A 1K1NA 3RMMH 1QZ8A 2FS9A 4OS4A 2ZEBA 2IN2A 1YPHE 5DP6A 1AVXA 1O3HA 4NA9H 4B2AA 2OD3B 2XC4A 5EW2H 2Q6DA 4MQAA 1AFEH 1HRTH 4AYYB 4IN1A 5DP9A 2G5NA 4LZ1H 2B8OH 3ELAH 1O2VA 1IQKA 1EPTA 4A92A 1UCYE 3Q3YA 2CV3A 2ZPRA 1ZSLA 5ESBA 2ZDMA 1MBMA 3EE0B 3NWUA 1ZYOA 1A0HB 4DIIH 5F8TA 4R0IA 1CA8B 2D8WA 3F2FA 1S6LA 4P00A 2O8MA 3OTPA 1IQJA 3BTQE 1AKSB 1S0QA 2GDEH 3IITA 3TJVA 3A8CA 5KEDA 1HFDA 1SHHB 2OQUA 1K21H 2W7UA 4OGYA 2KFWA 1CT0E 1GJ7B 4ZKOU 4YM9A 7ESTE 1CO7E 2FEQH 1UTLM 1NRPH 4ZH8A 1WSSH 5L6NH 3KL6A 1NO9H 3EA9A 3FVFB 1QNJA 3MH5A 1O5GH 1JMOH 1C1RA 1D6WA 4TY6A 5T6DA 2R2WU 2TBSA 4A5TS 4D7GA 4YT6H 1KSNA 3H7OA 3S7HB 4H4FA 2ZHWH 3QO6A 4FETA 4YXWD 1KTTB 2GTBA 3PMBB 2FYQA 2V3MA 1F5LA 1ZLRA 2KZ4A 2HPQH 2A2QH 1MKWH 3MWIU 1BMLA 1XXDA 1MKXH 1SQRA 2VU8E 3P92A 2A5KA 1TMUH 2AS9A 3RXMA 1GVZA 2ANMH 3AW1A 1PPGE 4YOGA 1BRAA 1SLUB 3SYJA 5LPRA 2G81E 3A88A 1NTPA 2K8IA 2P93A 1CQQA 1HAOH 1C2DA 1UVTH 4NIXA 2ALPA 2VBCA 3LOXA 1KTSB 3SGBE 1AN1E 1YCPK 1UTPA 3FZDA 1UCYK 1EZXC 2Y7XA 4Q7ZA 3SGQE 2GT7A 1N6XA 1XUIA 1Y59T 1SHYA 9LPRA 1J14A 2FOEA 1MU8B 3GY2A 3A7ZA 4CRCA 1LHEH 1SGYE 1AZZA 4Z1MD 4NZLA 2VWOA 1C5SA 1SGTA 4IBLH 2D26C 3MFJA 2W7SA 2Z9KA 4FVBA 4ABFA 2G4TA 5T3HA 3W1EA 4E05H 1GBLA 1ZZZA 3CNRA 1P2OA 2EEKA 1ZMNA 2P16A 2L6OA 1SKYE 3M7TA 1MH0A 1E1RD 2WV5A 5IDKA 1GHZA 1TBQH 4KTSA 3UWJH 1O2MA 1TRNA 1BBRK 2HVYB 1C1NA 1QIXB 1XUJA 3FN8A 3E0PB 1EZQA 4OS1A 2QV1A 2PHBA 1C5NH 2VIOA 2KX4A 3ZV8A 1CBWB 1EXFA 1MTUA 1QJ6B 5C1YA 1BTPA 3T29A 3MMGA 4BAQB 1O2XA 4ZCNA 1TPAE 3GY7A 4X2WA 9ESTA 1B7XB 5EIYA 1ACBE 2WSSD 4MNWA 1KIGH 4X8UH 3RP2A 2SGEE 2RA0A 4BAKB 3RXLA 3F9FA 3GOVB 2BXUH 1LHGH 1HAHH 1NFXA 2H6MA 4O97A 3V12A 1EJAA 3PLBA 3MNBA 1ZRKA 3RXPA 1MU6B 3FAOA 3UFAA 1GJ4H 1DY8A 3P70B 5DP4A 1H9IE 2ZFQH 1LVYA 3SJKA 3SJ8A 4X0WU 2WPMS 3ZVBA 2BY7X 4KTUA 3A7VA 3RLYH 4B2CA 1GMHF 4Q63A 4JYVH 2Z3CA 4UEHH 1SGCA 1AKSA 2C8WB 1FV9A 3LGYA 5C5OA 2H5DA 5CMXH 3WY8A 5A8ZA 1NN6A 1BTZA 1W10U 4KELA 3STJA 3G01A 1ETSH 1KDQB 4Y76A 3UOPA 3BIVH 4WVPE 4AFZA 4YTAA 2C3SA 1P3EA 3SJ9A 1GHAF 2BY8X 1A5IA 3RXSA 1P09A 5EJ1A 2O9QA 2G8TA 1NM6A 4FUEA 5EQSA 1AZ8A 1A46H 2G52A 1ARBA 3SNDA 4DT7B 2FMJA 3T5FH 1SSXA 4YLUA 2LELA 8GCHG 1EAXA 4ISOA 4NIWA 1O35A 3KYGA 4AFQA 4XD7D 4JZEH 2JDID 2FIRH 3A8BA 5EXNA 1SQTA 3SUGA 3TK9A 2ZGJA 4WWYA 1C9PA 1HPGA 2ODQA 1J16A 8ESTE 3VB6A 2VIWA 4ABIA 1AGJA 2AIPA 2GP9B 3T2NA 2JETB 4RSPA 3O8CA 1TMBH 1SGQE 3ZIAD 1CA0B 2BX4A 1TBRH 2ODYB 3GCNA 3M7QA 5G4BA 1AWHB 3M3TA 1MKWK 1K22H 3BTTE 1F0RA 4TT3D 5E0HA 1MKXK 5HKKD 2SGQE 1CHOF 1SC8U 4K8BA 4ZXYH 1TNKA 1NY22 2ZTXA 3BN9A 4FUFA 2VVVA 1O2YA 1H8HD 4ACAA 3RXCA 1YBWA 4JZIA 3K2UA 2WPKS 3HPTB 1GI4A 2ZKSA 4TWWA 5LPFA 2WUCA 3FO8D 5B6OA 1VCWA 2AGIX 5I25A 2SGFE 1C1UH 2AERH 3DCLA 2FX4A 1RFNA 5ESTE 2C4FH 4OS2A 2Z3DA 3S9AA 4IMZA 4AYVB 4WJG2 3S7KB 4Y8XA 1C5TA 1NRNH 2B0FA 1ZTKA 2JH6D 5FPTA 1P03A 5K0HA 3MH7A 1CHGA 1LHCH 3H5CB 2VIQA 1ZTLA 1OWIA 1V2MT 3TJNA 4XSKU 3PYHA 1GCDA 3OTJE 1QB6A 1W0JD 3UQOA 5JYIA 5EODA 1VJ9U 2QF3A 4TPIZ 1T7CA 1HAYB 2ZP0H 1YCPM 1Y3UA 2FESH 2CF9H 3O8BA 3A81A 2VIDA 4X1NU 3SU1A 1HXEH 1NS3A 4IMQA 2J92A 4OGXA 1IQNA 1BTWA 1QBNA 5E0JA 5JB9S 3SJIA 3UNSA 2J5UA 1QJ7B 4I86A 1LTOA 2BDGA 4FU9A 3OE7D 5A09A 3M61U 1PQ5A 4VGCC 2QIQA 1LHDH 5FCRA 2ZU3A 4K1EA 4DIHH 2ASUB 2Y80A 2XXLA 3M5MA 4HG6A 3Q76A 3QGNB 1O5BB 2ZHEH 3ZVFA 2WYJA 1KDQA 2HNTC 3ZZ7A 8KME2 4D7FA 2YMSB 2GZ7A 3RC6A 2BHGA 1SGIB 2OTVA 1DANH 1VITH 2KCYA 1GBIA 4ZHLU 1H1BA 1QTFA 1AI8H 2AFQB 4FXGH 1W11U 2A4GA 3FP6E 2P3UB 2J9NA 4UFGH 3V3MA 1IHTH 3MO6A 2XC0A 4CH2B 1ZGIA 5EU8A 3UR9A 1GMCG 1TGCA 5ABWA 4FVDA 1P10A 3OX7U 1G3CA 1BIOA 1MCTA 1E36B 1O2IA 2QXJA 3TU7H 4GPGA 5LH8A 1DY9A 4U32A 1O2TA 4UD9H 1P9UA 1C5OH 2Z3EA 4BTTB 2AHME 4R8TB 2NU2E 2PTNA 2Z6BD 1XMNB 1KMHB 1PQAA 2BLQA 2ZGCA 4AB9A 3SORA 3EGKH 3UQVA 4IS5A 1GBMA 1LHFH 5T6FA 5DP7A 4B6EA 1GMDG 1V3XA 4X6PA 4ISIH 3DSGA 1RGQA 1WV7H 2PLXA 4Q80A 1DLEA 3U8OH 1JWTA 2KAIB 5SGAE 3F1SB 4OS7A 3PTBA 1P05A 4JZ1A 1GHYH 1T31A 1Z8JB 1LDTT 3MU1A 3AW0A 1P2JA 1DOJA 3ZVDA 1Z1IA 2Z9LA 1W0ZU 4KP0A 1MD8A 1YLCA 1HAPH 2J97A 5EG4A 4NG9H 4NIVA 1HXFH 2Y82A 1P0SH 3RXVA 1A3BH 1OP2A 3QWCH 1YF4A 1SR5C 2CXVA 5AFZH 3UUZA 2BYAX 3B9FH 1ZSJA 1ESTA 1MTNC 4FUDA 1A61H 1TBZH 3Q3XA 3GICB 1GJ6A 4J1YA 1EPTB 1WTGH 2I6SA 3S9CA 4GCHF 2FLRH 1QBVH 5C2ZA 3KN2A 1A4WH 2W5EA 3TK6A 1GBHA 1TIOA 1K2I1 3LJJA 1YWUA 1GCTB 4ISNA 3ZV9A 1TABE 2O8UA 1HJAC 4MLFB 1MAXA 1EAWA 3SNAA 2PFEA 1ZMJA 3MTYA 3N7EA 1GI7B 1KXAA 1LQEA 5DPAA 3E1XB 3BG8A 1Q31A 2DE8A 1O3NA 3A7XA 1E37B 4DOQA 1VCPA 1AD8H 1O5DH 2ZHQH 1JIRA 2ZZUH 1DWDH 4X8VH 1XUHA 3TGJE 1OWEA 3GY6A 5HXFA 3Q77A 5EGMA 1YY3A 3MNXA 4NGAH 4FUBA 2WV9A 2NU4E 1O3OA 1FUJA 1LVOA 1QQ4A 1XX9A 4U2WA 4Y7BA 1FY1A 1UK2A 1A2CH 4AGJA 1GHWH 3M7UA 1QA0A 3OU0A 1PYTC 3KEEA 3RXAA 1QB9A 1V2RT 1P3CA 4MG3A 1ELAA 2Y5FA 1MBQA 1ELVA 1FXYA 3ODDA 3RXRA 1S82A 4BNRA 5JBAS 1C9TA 8GCHF 5E2PA 4D76A 1QA7A 1PQ8A 1QFKH 2HNTE 3N7DA 3TJOA 3TPIZ 1MTVA 2H9TH 2ZF0H 4X6NA 5J4SA 2XWBI 1G3DA 4KKDA 3QZQA 2V3OH 1WBGB 2JIZD 1PPZA 1P02A 2Y7ZA 2ZFRH 4F48B 1SG8B 2CGAA 5C5NA 2FOCA 1V2JT 5HM2A 1TNJA 5C0UA 2HWLB 3LGTA 1ELFA 3DUXH 2ZPSA 4K69A 4AC9A 2ESTE 3LIWA 3PV4A 1W2KH 4X6OA 3F2GA 5EJLA 5CHBA 2R2MB 1EAIA 3MH4A 2VGCC 1CVWH 2ZFFH 1EASA 2D2DA 4WMEA 1GJDB 2EQNA 1YP9A 2ZU4A 3S0NA 1TPSA 1P01A 3JZ1B 4RN6A 4Y8YA 3BEIB 1LPKB 2BVSH 3W95A 3GCTF 5L30H 1DX5M 1J8AA 1BMMH 1ELDE 1CGHA 3RXJA 1SGFA 3HGPA 1HAVB 1T32A 2YMSD 2C93B 4MPVA 4UFEH 2BQ6B 3TGIE 1V2QT 1O2KA 1RTKA 3TH4H 1B0FA 1TA6A 1VITG 1GHBG 3QDZB 2ZFTA 5FBEA 3MI4A 3M36A 3PRDA 1GBBA 3ZVCA 3TH3H 4AFUA 4HGCA 1DXPA 5JBTA 2TGAA 3A7TA 3MU8A 5F03A 3A87A 5IYTA 1SQOA 4X1PU 3LGIA 1JOUB 2FX6A 1T4UH 3B8JA 1ZJDA 1OS8A 1FY8E 2KCAA 3I29A 5EXMA 1VJAU 2KCOA 4VGCB 1B0EA 2AIQA 1GHVH 1C2EA 1NESE 1ABJH 4ASUD 2GKVE 1EZSC 3ZZ9A 1LQDB 3L6PA 1LCYA 4I7YH 1LPZB 5JB8S 1VR1H 4UFFH 3ZVGA 1DS2E 5I46H 5A0AE 2ZCLP 3WWFA 5DGJA 4BAHB 4I8HA 4THNH 1GGDC 1EB2A 4JZDH 1C2GA 1ZHMA 2C8ZB 3LDXH 5FXLA 2P8OB 4AGKA 3C27B 1HJ8A 4Y6DA 1O5FH 5BPEA 1FIZA 2ZGXH 5HMAA 2H9EH 2Z7FE 4D9RA 1E38B 2P94A 2G00A 1BBRE 2SFAA 1TWXB 3VGCB 2TGDA 2B9LA 5DG6A 4ZUHA 2ZDAH 3EDXB 1DDJA 4CRAA 3M3VA 1TNHA 1QJ1B 2EI6A 2RDLA 3KQCA 1XUGA 3ZYEA 5AF9H 1EX3A 2AYWA 4FUCA 1O36A 1BHXB 2IJOB 4K5ZA 2EC9H 1XVMA 3ODFA 2SNVA 2BDBA 2PP6A 1X7AC 2XRCA 2V7QD 1IQFA 2SGPE 4ZKRU 3VB3A 3RMLH 2HOBA 2XCNA 5FX5A 1V2TT 3RU4E 1O2GH 2PUQH 1QURH 2BY9X 4ZMAH 2B5TB 2A7JA 3PMJA 6GCHF 3QTOH 4MDSA 3PLKA 2EA3A 3R3GB 2FOGA 1EKBB 1LKAA 3LGWA 4MPXA 4CH8B 2F9OA 1Y8TA 1C5UA 1K1OA 5KECA 2BDHA 2ZG0H 2VVUA 4JK5A 2R0LA 1DT2A 3VXFH 4MNYA 4XBBA 4KTCA 2XBYA 7GCHF 1ELBA 1ARCA 1YLDA 3D49H 1N8OC 1J17T 3OAAD 2Q6GA 1A7SA 1K1LA 1UVUH 1G32B 1GI9B 1KXEA 1S84A 2ZDKA 4ASHA 1MTNB 2W6ID 5CHAB 3SU0A 1WYKA 4INLA 1C4Y2 3GYLB 3SI4H 5L2YH 3GCHB 4HFPB 5DP8A 1HAVA 3MO9A 2BOHB 4LOYH 1C1OA 3BTHE 5C0TA 1GDNA 7LPRA 1GHXH 4Y8ZA 1HJAB 1Z6JH 1O3GA 5DSFA 2WPHS 1WAYB 2JJ1D 1MCVA 2CHAC 1P8VC 2ZGHA 5F8ZA 4BANB 1O30A 3AAVA 1TPOA 1XUKA 2CJIA 3P6ZB 3F6UH 1VCQA 4XBDA 1D4PB 1GI2A 3T28A 3GYMA 2AMDA 3BEUA 2GZ9A 2ZTZA 4I31A 2Y5GA 4DY7B 1GWAA 2HVXA 4X2YA 1QRZA 2OUAA 2CF8H 2GCTB 1JXPA 1MZDA 2G5VA 4CRBA 1TNIA 2ZPQA 1W7XH 1O2UA 3PROA 1H8IH 1YPLH 3F9HA 3TITA 3QTVH 1BA8B 1O2NA 4CRFA 2GCHF 1O3KA 2FI4E 1YLNA 3F9GA 4A7IB 4DW2U 2IPHA 4ABJA 1FZZA 3U1JB 1N1LA 2OC1A 3SI3H 2XBXA 2GV7A 1L1GA 4FUGA 2QC2A 3WWBA 1RXPA 1UVPA 2RA3A 4SGBE 3HK3B 1C1SA 3HKJB 3RUOA 3SZEA 2AH4X 2PGBB 1A5GH 1FN6A 3EA8A 4UFDH 2FOBA 3BTEE 1C4U2 3NXPA 2XC5A 1ZPCA 3QK1A 1BRCE 3BG4B 3QUMP 3SOSA 1XKAC 1OHHD 4IC5A 1QRXA 4AFSA 1TQ0B 1K9OE 1NFWA 4RI0A 3SU6A 4K1SA 4MNVA 1TA2A 1O2RA 3RXDA 1LVBA 1XKBC 4E06H 2EI8A 2QYIA 2A2XH 3N99A 3TNTA 1UTOA 1V2PT 1WQSA 2VGCB 1E0FD 1P2QA 2YNBA 1KYNA 1XVOA 3OY5U 4FU7A 5GIBA 2JJ2D 1IQEA 1P2IA 1TNGA 3KIDU 1UTJA 2LNCA 3L3TA 2ZFSA 2QA9E 2TGPZ 2ZU5A 1HV7A 1L2EA 1AE5A 3O8DA 1W8BH 1TLDA 1ESBA 1ANEA 1Y5UT 2ODPA 2RG3A 1AB9B 3ATKA 3LPRA 4BOHA 4O03A 1UJ1A 1VGCB 4TSFD 2FODA 1C2MA 3E16B 2KR7A 1K28D 1V2ST 2J94A 3KQEA 5F8XA 4XFQA 1WTHD 2QXIA 2W3KA 2ULLA 1NPMA 1LKBA 2OQ5A 2ALVA 3KHVA 2FWWA 1C5VA 1O5CB 3KNXA 2F9BH 3L33A 2BVXH 2PGQB 2L74A 3KYFA 4A1XA 1PPEE 5GPIB 2ZDNA 1M9UA 4SGAE 1L4DA 2PR3A 3LC3A 1AUJA 2VJ1A 2QN5T 3BTKE 1Z8GA 1GHBF 2THFB 1W0YH 3VB4A 1MZAA 2FLBH 4NWKA 3TH2H 3SNEA 1NT1A 1F0SA 1S6HA 2RCEA 1QRWA 1OKXA 2F4LA 3ZZDA 1RTLA 3U28C 4JMYA 2AEIH 5TCAA 2A5AA 1QBOA 3DFJA 2ZI2H 2BQWB 5DP3A 3F68H 3RC4A 1O31A 4QT8C 5IK2D 4NIYA 4X8TH 1UHBA 1NBME 1H8DH 2G51A 4HI3A 5JBCS 1V6DA 4K8YA 1O38A 2QAAA 4FUHA 1LVMA 2GMTC 2O8WA 2QCYA 2WPLS 1C5MD 2ANYA 1T4VH 3MNSA 1EQ9A 4UE7H 3UAIC 2YOLA 1A3EH 3EQ0H 4AORA 3M37A 1C5PA 2A45B 4FUIA 6ESTA 4WH8A 3RM0H 1HAXB 2A7CA 1OP0A 1FY4A 1CSOE 3SHAH 1C2JA 1L1NA 4F55A 1D3PB 1GBCA 3UNRA 3GY5A 1QR3E 3P17H 1SBWA 1MTSA 2Q6FA 1C5YB 1GVLA 2VIVA 3R0FA 2A5IA 1EATA 1O3FA 3M5LA 1HUTH 3TIUA 4I32A 4XRNA 2HNTF 3D65E 1EP5A 1O3JA 1BDAA 4Y0ZE 1TGTA 4U01A 2OC7A 1A1RA 5EOKA 2PW8H 1BZXE 1P11E 3OEED 2UWPA 2G4UA 1O5EH 5CE1A 2NWNA 1YM0A 1Y3XA 1N8OB 2BLVA 4GSOA 3FFGA 1W3CA 1ZTJA 3BV9B 3RU4T 1UO6A 2BY5X 3I77A 4DVAU 1H9HE 2H5CA 3RC5A 1TX6A 5C3NA 3SJOA 2PKSC 1ID5H 1IHSH 4GHQA 1N6YA 3FANA 4XOJA 1SMFE 1G36A 1WQVH 7KMEH 1O3DA 4ZAEA 3GISB 4XBCA 2FXRA 2ZQ1A 2J38A 3RU4D 1BHXF 3RXHA 2Z94A 2PV9B 5PTPA 4BTIB 1C5QA 3O8RA 2FP7B 2BX3A 1E34B 1G9IE 2PSXA 1SGPE 3QN7A 3SU5A 3PWBA 1C2LA 1SVPA 4I33A 2A7HA 4ABEA 4WMFA 3U1IB 2P59A 3Q00A 2F9PA 1UTKA 2ZIQH 1KXDA 1DWBH 1AO5A 1GJBB 3VFEA 4CRGA 1BT7A 2P95A 1YPHC 1DFPA 2Z9GA 1ZMLA 3SU3A 1IQGA 1WUNH 5E8EH 1F92A 1AVWA 1PPCE 2WZQA 5FPSA 1G2LA 1BCUH 2XNDD 1SI5H 3AK5A 2FTLE 4ZROA 3MNCA 1TB6H 3BSQA 2ZCKP 1IQHA 4GVUA 1UVSH 1W14U 2BMGB 3OSYA 1AUTC 4IGDA 1O2HA 5HM9A 2QXGA 3UWIA 1SLVB 3KCGH 4DG4A 1DE7H 1ZHPA 3IG6B 1EFRD 4RKJB 2TIOA 3QX5H 4LK4A 3U98H 1ELEE 4O3UA 1Y3WA 2B7DH 1D3TB 1GBDA 1LO6A 5GXPA 5LGOA 1INCA 1MTWA
chains in the Genus database with same CATH topology
1F5KU 3BTME 4BXSA 5EPYA 1T8MA 4F49A 3GDSA 5A8XA 4MPWA 3M5NA 2UUJB 4BAMB 1DXWA 1PPFE 1TAWA 2BD9A 2ZECA 1HNEE 5JPMH 5GJ4B 1OX1A 2QGRA 1GMHG 1EZUC 2VB0A 5T6GA 1TRYA 1ANCA 1EUFA 1HJ9A 1GPZA 1Y5AT 1OWKA 1C5XB 1GVKB 5J4QA 1DM4B 1XUFA 3ATLA 3U8TH 4DGJA 4Q7YA 4INKA 1Y3YA 1C5LH 1AFQC 1DICA 3SV2H 2VWNA 2WV4A 1YC0A 1GHAG 1ANDA 3V7TA 5FBIA 2VH0A 4YLQH 1THSH 5FHTA 1S81A 2ZC9H 2BDCA 5EQRA 3ZZ8A 1CT4E 1ELGA 4Y79A 5HGGA 3SO3A 1C1PA 1F0UA 4F4OC 1KXBA 4AN7A 1FJSA 3T25A 4A6LA 2ZNKH 1HYLA 1O3CA 1A0LA 2NU1E 4NFEA 4ZHAA 4MTBA 1HBTH 1OOKB 1O2WA 1P06A 1C2KA 4FU8A 2D1JA 4ABDA 2SGDE 2FOAA 1GI6A 3SUDA 1O2SA 3PO1C 1RTFB 3KQDA 4NSYA 4MNXA 1SOTA 3K6YA 3PWCA 2BZAA 3PM3A 4K60A 1SLWB 4NFFA 1CGJE 3VB7A 1V2UT 1O5AB 1CHOG 1DPOA 4CR5A 2ANWA 2OP9A 1TOCB 3LGUA 2OCVB 4O9VA 1GL0E 4LZ4B 2BXTH 2VWMA 2GD4B 4H6TA 2UUYA 1GI1A 1Z7KA 4Y10E 4AB8A 1B5GH 1AY6H 2JETC 2BD8A 1DWCH 1NC6A 1CA0C 1E35B 1DVAH 1KLJH 2XYAA 1EP6A 1ELCA 4CR9A 2R0KA 4TWYA 3ZVAA 2BDIA 3ATMA 1W12U 4B71A 1GG6C 2JKHA 2GMTB 1GJ9B 3MHWU 5JBBS 1O32A 3AASA 1TGSZ 2ZQ2A 3A80A 1BMNH 1QQUA 4DCDA 1K1PA 1GJCB 1QCPA 3HATH 5GCHG 1O0DH 3BTGE 3KGPA 4IW4E 3LH1A 4I8JA 1FPCH 1EOJA 1G3EA 1SGNE 2J95A 4O3TA 3A8AA 4D9QA 1D9IA 1C1WH 1PPBH 3SU2A 2DE9A 3TK5A 2R3UA 3FP8E 3ZZ5A 2Y81A 1C2HA 1NU7B 2AGEX 5A8YA 2A32A 1Z6EA 3E0NB 2V3HH 3NPSA 1ZRBA 2UUFB 2SNWA 3A83A 1FY3A 2FOMB 3A86A 1Z8IB 3SV9A 1GBKA 1YPKH 2UWOA 4X1RU 1AE8H 1Z1JA 2P3FH 1GBAA 4ZXXH 1FAKH 5FCKA 3RM2H 1F5RA 3RXFA 2JH5D 1C4V2 3VPKA 2A1DB 3LJOA 4YT7H 3SZNA 1GI3A 3BF6H 3SUEA 4NWLA 1SQAA 4NA7A 5EQQA 3UOUA 3ESTA 1UTMA 3RXEA 2C8XB 1IOEA 2PKSB 1ETTH 2V0BA 4AG1A 1YPMH 1IAUA 2A31A 6CHAC 4NZQA 3ATWA 5C1XA 3P95A 4NA8A 1IQIA 1GMCF 2UUKB 2BD7A 1BJVA 2FPZA 1FQ3A 4PROA 2GZ8A 1BITA 3P8FA 1RD3B 2EI7A 1HAGE 1XXFA 1SPJA 1S5SA 4FUJA 4E7RG 1P12E 3A82A 1SFQB 3SGAE 1NRRH 2K1QA 3UR6A 1HIAB 2BB4A 1SLXB 3GCOA 2BD2A 3SV7A 4A1VA 1K1IA 3A85A 2FDAA 4GAWA 1V2NT 3JZ2B 3GDUA 4NCYA 4AG2A 1J9CH 2BDAA 1GMDF 3RXKA 3P8GA 1SL3A 1W13U 1WU1A 4X2XA 1FLEE 1BJUA 3BTDE 3UREA 3QLPH 2GV6A 5K7RA 1GJ5H 4X6MA 1THRH 1JRTA 1TMTH 2Z9IA 2F9UA 2TPIZ 1HAZB 2SGAA 1GDUA 2C8YB 4CHAC 2V35A 5GWZA 1TX7A 1QY6A 3F9EA 1D3DB 3A89A 4CREA 3ZZ3A 1UK3A 3URDA 1WCZA 4MVNA 3TJUA 1PQ7A 3A7WA 4GUXA 2VVCA 1ZPZA 1FY5A 1O3AA 1Q3XA 1C5WB 1C5ZB 3ZZ6A 4B73A 1YPJH 2ZDLA 2ANKH 2ZU1A 2ZDVH 1O37A 2HLCA 1W7GH 3S9BA 1P04A 3UIRA 1S83A 2FI5E 2ZTYA 2BY6X 4K2YA 1GI5A 1KXCA 3RXOA 1C5RA 2TRMA 5DK1A 2A0QB 3E90B 4YOIA 1V2VT 3MU0A 2FTMA 2BTCE 1QL9A 1UHBB 1T8NA 1P2NA 4AZ2B 1O2ZA 4Y71A 1RIWC 2J2UA 1C1VH 1EOLA 1WOFA 3BTWE 4ZKSU 2O8TA 1DSTA 3N7OA 4GCHG 5FPYA 2GGVB 1C1TA 2ZGBH 4UDWH 1DWEH 1UK4A 8LPRA 4M7GA 1DUEA 1VZQH 1FI8A 1AFQB 1GBEA 3RMOH 2R9PA 1O39A 4I8KA 1O3EA 1CGIE 2VWLA 1AQ7A 1O2LA 3ITIA 2O8LA 3VXEH 3LC5A 2ZHDA 2BLOA 4WXVA 3VB5A 3TLOA 5JDUB 2XCFA 1F2SE 3QGJA 1EPTC 4JK6A 3DD2H 2OBQA 1ZGVA 1GL1A 3EYDA 2BLWA 1OP8A 3ZVEA 5FAHA 3PMAB 3RXTA 1IQMA 4A1TA 3VEQB 2OLGA 3TNSA 2ZWLH 4YOJA 1GCTC 6LPRA 2G55A 4ZKNU 2NU3E 3D62A 3GY4A 4YO9A 1OSSA 2FS8A 3ENSB 3NZIA 3RLWH 1C1MA 4H42U 4B75A 3SV8A 4NSVA 3FZZA 4ABGA 3PO1B 1BRBE 2GVFA 2PUXB 1FMGA 4WMDA 1NRSH 4JCNA 5EXLA 1OPHB 1FDPA 3ATIA 1SGEE 2A4RA 4WY3A 5LPEA 1PPHE 1BB0B 1HAIH 3M5OA 1D3QB 1HLTH 3EA7A 3SHCH 1D6RA 1O2PA 1TYNA 1P2KA 2FOHA 1EJNA 1HIAA 1P9SA 3SQEE 2ZHFH 1J15A 1JRSA 1ZOMA 2BVRH 3SNCA 4GHTA 4TY7A 1P2MA 1FPHH 1QB1A 1G30B 1TQ7B 1BQYA 3PLPA 3NCLA 1O34A 2M5TA 1PFXC 5A0BA 2OC8A 1GG6B 1RRKA 3ZZAA 3BIUH 1LMWB 1OWHA 1TOMH 2LPRA 2XBVA 1FNIA 1UMAH 3RMNH 3B23B 1TONA 3SU4A 2HGTH 1S85A 1ZJKA 1Y3VA 1FN8A 3GCTG 4ISLA 4U30A 1AIXH 1TALA 4ESTE 2OC0A 3HGNA 2QXHA 4ISHH 3ZZBA 5DKMA 1VITF 3GY3A 1CU1A 4KGAA 4YESB 1GGDB 2F91A 3E91A 1O3BA 1ELTA 5EW1H 3E3TA 1BOQA 3V13A 5C67A 1XM1A 3AAUA 4Q2KA 3UPEA 2STBE 1C2IA 2VH6A 4BXWA 1L0ZA 1V2OT 1GJAB 1SGDE 1BTYA 2Q1JA 2VNTA 1A5HA 4I8LA 3T62A 2Y6TA 3D23A 2BDYA 1F0TA 2BQ7B 4XDEA 1RS0A 5GCHF 5DO4H 2F3CE 1O33A 2FOFA 2F9NA 3RXBA 5A0CA 4Y11E 4Y7AA 5AHGH 2I6QA 3CS7A 1CT2E 1UTNA 4I8GA 1FONA 1SB1H 3MOCA 3DHKH 1UTQA 4ZHMU 1V2LT 1O3IA 2PTCE 4AX9H 2AMQA 3ZYDA 2HPPH 4Q7XA 1JIMA 3LT3A 3RXUA 1BTXA 1YPGH 2WPIS 3S69A 2FI3E 6CHAB 4ABAA 1MD7A 4INHA 4BAOB 4D8NA 3BEFB 2J4IA 1KLIH 1K1JA 2W3IA 1O2QA 2BOKA 5TCCA 5C1UA 1ABIH 3GY8A 1JBUH 3NUMA 1IQLA 3A8DA 5ETXA 4J2YB 3MU5A 2XWAA 1G3BA 3RXGA 1BUIA 3H7TA 2ZCHP 1BRUP 1V2WT 1UVOA 1L4ZA 1V2KT 1Z8RA 2AMPA 2P3TB 3UNQA 1AHTH 3QZRA 2HALA 1Y5BT 2P8OC 3K6ZA 2H2ZA 2XW9A 2ZA5A 3LONA 3TVJB 1FIWA 3T26A 1TPPA 1MQ5A 2WINI 4B74A 5BRRE 1GDQA 2ZFPH 1DUAA 1ZHRA 1ZSKA 1NRQH 3C1KA 4WF8A 5C20A 1TX8A 1EAUA 1TFXA 3HK6B 3RXQA 1YPEH 2OXSA 4XE4A 3VGCC 1MMJN 2GDDA 2V6NA 3RDZA 1NROH 3KQBA 4CHAB 1PYTD 6GCHG 1C2FA 4X1SU 4X8SH 1T8OA 4CBOA 1NZQH 2STAE 1TGBA 5AFYH 2BM2A 3SBKA 4UONA 5E2OA 1CE5A 3MH6A 3K65B 1MUEB 1AU8A 2CHAB 1T8LA 1G2MA 7GCHG 1K1MA 2FYRA 2NU0E 2C90B 3A7YA 5L2ZH 2YNAA 3CS0A 2CMYA 1NFUA 2W26A 1KY9A 3DA9B 2QY0B 2OINA 2BZ6H 4K1TA 4AOQA 1RIWB 3E8LA 1YYY1 2UWLA 2PKAB 1TGNA 2Y5HA 4IC6A 1EJMA 1AMHA 3HKIB 4WH6A 3LH3A 1OWJA 2XTTB 5FX6A 1ESAA 1KLTA 3T27A 3NKKA 2F9VA 4HZHA 4TYDA 2AGGX 2VIPA 2CN0H 1AVGH 5HYOA 2H1UA 4GLYA 1OYQA 1GBJA 2XNIA 3IWMA 4Y0YE 4CBNA 3PTNA 5CHAC 1EB1H 2F83A 1SGFG 3URCA 4LXBH 3SN8A 1C1QA 1TNLA 1HB0B 3ZZ4A 1QGFA 2WPJS 3GCHC 3BTFE 1DLKB 2ZO3H 1H9LB 4YZUA 4X2VA 1O2JA 1Q2WA 3EAJA 4B2BA 3MU4A 4B1TA 1CBWC 1GI8B 1MAYA 1ZPBA 2FM2A 5F6MA 2VINA 2GCHG 1OYTH 3MO3A 4JYTA 2PSYA 3Q3KA 1S6FA 3STIA 2DUCA 1BMAA 1MQ6A 3NK8A 3M35A 4E7NA 1Z71A 4B76A 3P8NA 3P8OA 3SQHE 1S0RA 2J34A 3DFLA 2GX4A 1L1JA 1DITH 1A0JA 5A2MH 2GCTC 1H4WA 2HRVA 3E6PH 1F7ZA 4DURA 2ILNA 2PWXA 3SV6A 2OBOA 1OWDA 1QHRB 1LPGB 1TE0A 5AVDA 2R3YA 3SW2B 3OY6U 1AWFH 4ABHA 2BD4A 1NU9A 4OS5A 4TPYA 3U8RH 4DJZB 1BTUA 2Z9JA 3A84A 3KF2A 5H4IB 1SGRE 3LKWA 1SOZA 3U69H 1YCPH 3I78A 3CP7A 1UCYH 3AVZA 3K9XB 1THPB 3RXIA 4ABBA 3SUFA 4BTUB 4JZFH 3GDVA 1KXFA 1TRMA 3W94A 1DSUA 1GBTA 3CENA 2XBWA 3V0XA 3ZZCA 2WUBA 4HTCH 4CRDA 1ANBA 1FAXA 1HDTH 1O2OA 1RJXB 3UTUH 4JYUH 3BG4C 5TJXA 5DP5A 3U9AH 5DJ7A 2WYGA 3PB1E 1YGCH 1GJ8B 2FO9A 2A4OA 1U6QA 2GT8A 1GI0A 1P57B 2FZZA 1QL8A 4OS6A 3DT0H 5EPNA 2TGTA 1BBRH 2H9HA 2BD3A 3SNBA 1ORFA 2BD5A 3FP7E 3LU9B 4Z6AH 4RKOB 1ETRH 2IOTA 4MPUA 3TGKE 1PJPA 1NFYA 1QL7A 3PMHB 4X1QU 5GDSH 1HCGA 4WXIA 1O3MA 1ZR0A 2JH0D 1O3PB 3UY9A 3LGVA 1SFIA 1BTHH 2KAIA 4H6SB 2QF0A 1YKTA 2PKAA 5E0GA 4K3JA 2A4QA 1GBFA 1AB9C 2ZU2A 3MYWA 4Z0KA 3OYPA 3M3SA 1G37A 1HGTH 1O3LA 1VGCC 1OXGA 4IN2A 1K1NA 3RMMH 2FS9A 4OS4A 2ZEBA 2IN2A 1YPHE 5DP6A 1AVXA 1O3HA 4NA9H 4B2AA 2OD3B 2XC4A 5EW2H 2Q6DA 4MQAA 1AFEH 1HRTH 4AYYB 4IN1A 5DP9A 2G5NA 4LZ1H 2B8OH 3ELAH 1O2VA 1IQKA 1EPTA 4A92A 1UCYE 3Q3YA 2CV3A 2ZPRA 1ZSLA 5ESBA 2ZDMA 1MBMA 3EE0B 3NWUA 1ZYOA 1A0HB 4DIIH 5F8TA 4R0IA 1CA8B 2D8WA 2O8MA 1IQJA 3BTQE 1AKSB 1S0QA 2GDEH 3IITA 3TJVA 3A8CA 1HFDA 1SHHB 2OQUA 1K21H 2W7UA 4OGYA 1CT0E 1GJ7B 4ZKOU 4YM9A 7ESTE 1CO7E 2FEQH 1UTLM 1NRPH 4ZH8A 1WSSH 5L6NH 3KL6A 1NO9H 3EA9A 3FVFB 1QNJA 3MH5A 1O5GH 1JMOH 1C1RA 1D6WA 4TY6A 5T6DA 2R2WU 2TBSA 4A5TS 4D7GA 4YT6H 1KSNA 3H7OA 3S7HB 4H4FA 2ZHWH 3QO6A 1KTTB 2GTBA 3PMBB 2FYQA 1F5LA 1ZLRA 2HPQH 2A2QH 1MKWH 3MWIU 1BMLA 1XXDA 1MKXH 2VU8E 3P92A 2A5KA 1TMUH 2AS9A 3RXMA 1GVZA 2ANMH 3AW1A 1PPGE 4YOGA 1BRAA 1SLUB 5LPRA 2G81E 3A88A 1NTPA 2P93A 1CQQA 1HAOH 1C2DA 1UVTH 4NIXA 2ALPA 3LOXA 1KTSB 3SGBE 1AN1E 1YCPK 1UTPA 3FZDA 1UCYK 1EZXC 2Y7XA 4Q7ZA 3SGQE 2GT7A 1N6XA 1XUIA 1Y59T 1SHYA 9LPRA 1J14A 2FOEA 1MU8B 3GY2A 3A7ZA 4CRCA 1LHEH 1SGYE 1AZZA 4NZLA 2VWOA 1C5SA 1SGTA 4IBLH 2D26C 3MFJA 2W7SA 2Z9KA 4FVBA 4ABFA 2G4TA 5T3HA 4E05H 1GBLA 1ZZZA 1P2OA 2EEKA 1ZMNA 2P16A 3M7TA 1MH0A 2WV5A 5IDKA 1GHZA 1TBQH 4KTSA 3UWJH 1O2MA 1TRNA 1BBRK 1C1NA 1QIXB 1XUJA 3E0PB 1EZQA 4OS1A 2QV1A 2PHBA 1C5NH 2VIOA 3ZV8A 1CBWB 1EXFA 1MTUA 1QJ6B 5C1YA 1BTPA 3T29A 3MMGA 4BAQB 1O2XA 1TPAE 3GY7A 4X2WA 9ESTA 1B7XB 1ACBE 4MNWA 1KIGH 4X8UH 3RP2A 2SGEE 2RA0A 4BAKB 3RXLA 3F9FA 3GOVB 2BXUH 1LHGH 1HAHH 1NFXA 2H6MA 4O97A 3V12A 1EJAA 3PLBA