4YTAA

Bond length analysis of asp, glu and his residues in trypsin at 1.2a resolution
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protonation-state determination in proteins using high-resolution X-ray crystallography: effects of resolution and completeness.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ytaA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ytaA02
3PM3A 1O3CA 1C5WB 3KQBA 2ZECA 2OC0A 3T28A 3RXPA 1EZQA 3S9BA 1CA0C 2NU4E 5J4QA 2A2QH 4ISHH 5ESBA 3D65E 1ARBA 4JK5A 4Z6AH 1L1NA 1YP9A 2Q6GA 3UWIA 1A5IA 1XUHA 2G55A 4FUEA 3V13A 3LGWA 1SHYA 1AVGH 5EW2H 1MAXA 2CF8H 1FAKH 4BTUB 4U2WA 1YPHC 3QK1A 3PV4A 2ZA5A 3RXIA 1BMAA 5C3NA 3DUXH 3RUOA 1FONA 1TFXA 1IQHA 1HLTH 2ALPA 1OS8A 1C5NH 5E2OA 4WMDA 5C2ZA 5LPEA 1TAWA 1UHBA 2W3IA 4X2VA 3I77A 1ELCA 1CT4E 2WPMS 1LDTT 4IBLH 3GISB 1XUGA 1HGTH 1O5CB 3S9CA 1WV7H 3TIUA 2WPIS 4A1XA 1J17T 1VR1H 2GMTC 1V3XA 1SI5H 2NWNA 1XXFA 3SU2A 1NFXA 1TX7A 1S6HA 5HM9A 1FNIA 2XBXA 2BX3A 2UUYA 3Q3YA 2VGCB 2XC0A 5HXFA 2OC8A 4K1EA 5DGJA 1GHAF 1C5OH 2V3HH 4B1TA 1GI2A 4AOQA 3F9GA 3T29A 2RA0A 1Y5BT 3QUMP 1Z6EA 1HAYB 1DY9A 3D62A 4X1PU 1DFPA 5GPIB 3QX5H 2XBWA 2BQWB 4XOJA 2R2MB 1AVXA 1GL0E 5G4BA 3ZVGA 1ELEE 1P2IA 2ZCLP 4WMFA 4B75A 4RKOB 2ZEBA 4M7GA 1O38A 3SHAH 4J1YA 3LH1A 1PPFE 1ZGVA 4CBOA 3RXSA 3SJ9A 1AIXH 2BD9A 1V2VT 3GCNA 3MWIU 2XTTB 1MU8B 4B2BA 4UFGH 2HPQH 5TJXA 1A61H 2VVUA 3AAUA 3RU4E 1Y3XA 1WSSH 3E3TA 2SGQE 2J95A 3ATKA 1O30A 1EZXC 4Y71A 1DVAH 1ZR0A 3LOXA 1AGJA 1SVPA 4X2XA 3MH5A 1VZQH 1SGQE 1MCVA 2AH4X 5T6DA 5LGOA 2H9HA 2UWPA 3MU4A 4AFSA 4WJG2 1O3KA 2ALVA 3GYMA 2QA9E 2XCFA 3BTQE 1FY1A 1O5GH 1YPJH 1C5QA 3FANA 2DUCA 5C1UA 3GY7A 4A6LA 2ILNA 4ZXXH 2CMYA 5DP3A 1CE5A 2O8LA 1GG6C 1ELGA 1P06A 2ZF0H 1MU6B 2PSXA 4MNVA 2FM2A 4YT6H 3ZZ4A 2OCVB 1RS0A 1G32B 3TJOA 3HKIB 2TGTA 5H4IB 2OC7A 2AFQB 1VCQA 1NC6A 3ZV8A 4VGCB 3HGPA 3EQ0H 2G52A 1YCPK 1UCYK 1AWFH 1LO6A 1HJAB 1SQTA 1ZMJA 4DOQA 1IQGA 1THRH 1G30B 4XBBA 1CU1A 1FDPA 1O2QA 4ESTE 3M37A 3BG8A 2GCHG 3RXUA 5EXLA 2XW9A 3LPRA 1HAZB 4U32A 3STJA 4UONA 3P17H 3WY8A 4DT7B 1NN6A 4GCHG 4E7RG 1XVOA 1GBJA 1AFQC 2FIRH 3ZZ9A 1BIOA 1LPKB 1NM6A 3GICB 4I8LA 4X2YA 1ZPCA 4E7NA 1GMDF 1GCTB 1PPGE 3EE0B 1CQQA 1YF4A 1HV7A 1INCA 2ASUB 4ABHA 2AS9A 6CHAC 1H8IH 1EAXA 1EPTC 3ZVAA 1XM1A 3ATLA 4FVBA 4AG2A 3E0NB 1CGIE 1MMJN 4ZKOU 3QGNB 5JBBS 3T26A 3DD2H 4E05H 2WYGA 1ZOMA 1O2VA 1L4ZA 2GZ8A 4DW2U 2Y7ZA 4YZUA 5FPYA 1GJ7B 4NFFA 3BTDE 4INKA 2ANMH 5FX5A 3U8TH 5JBAS 2PHBA 4ZHAA 1QB1A 1OX1A 2XRCA 1EJNA 1QIXB 1ELBA 2OQ5A 5F8XA 3OX7U 1DX5M 1KYNA 2D2DA 2ZTXA 3EGKH 3LJOA 1EQ9A 1MTSA 1PPHE 2QXHA 1NTPA 1H9HE 1F5LA 2BZAA 2ZO3H 1C5TA 2JETC 1O2SA 4H6SB 4NFEA 1TX8A 1A0HB 1UK3A 2H9EH 1DUAA 1O2GH 2OC1A 4GVUA 4HZHA 1ZMNA 4ABIA 1BCUH 1AQ7A 1FIWA 3OY6U 5DKMA 5EQRA 1O3AA 2ZU1A 1HDTH 5EXMA 2WUCA 3CENA 6LPRA 1EB2A 3SN8A 2QCYA 1DXWA 4ABFA 1CHOG 8GCHF 2O8UA 2ZPQA 5F6MA 1NU7B 4OS1A 1TOCB 3SNBA 4BAKB 3HATH 3HPTB 1RRKA 2BY7X 2XBYA 4WXIA 3SBKA 3UNSA 3UY9A 1DUEA 3DFLA 1MQ5A 3PO1B 2C90B 4FUCA 2BDAA 1JBUH 1D4PB 3PMBB 4FUIA 1P12E 2FMJA 1GL1A 2FXRA 1HRTH 2G4UA 1SHHB 1W14U 2P59A 4INLA 5E0GA 1Q2WA 3GYLB 4FUJA 4JZIA 1YPKH 1GJ6A 4FU7A 4XFQA 3Q00A 1TA2A 4ABBA 2PKAB 2BHGA 3E6PH 2O8TA 2EI8A 1L2EA 1C2DA 4AN7A 4YOJA 2UWLA 4BAMB 5HM2A 2VIWA 4YTAA 3VB4A 2W5EA 3A8BA 1YM0A 1TMBH 1KXBA 5E2PA 1BTPA 3L3TA 3A86A 2ZU3A 3RXHA 1MBMA 2Y5HA 5EGMA 2R2WU 1TONA 2ZQ1A 5GIBA 1TPSA 3A88A 2A5AA 3FZZA 1O3PB 1UTMA 1O0DH 3A7VA 1FY4A 2R3YA 1C1SA 1GCTC 5FBEA 3UTUH 2W7SA 1GI1A 1Q3XA 1SGPE 5GJ4B 1EJAA 1Z71A 1E38B 1GGDC 1TYNA 1PQ5A 4ISOA 2Z3CA 2PR3A 3LC3A 1CBWC 1XVMA 3UQOA 2GCTB 4IN2A 4KTCA 1TRYA 3TH4H 3TPIZ 2G5NA 2H2ZA 2Z9LA 4JYTA 5E0JA 2GKVE 4BAOB 1WUNH 2HGTH 4NSYA 4O03A 4Q2KA 3M61U 4TWWA 1PQ8A 2O9QA 3E1XB 5E8EH 1ETTH 2FTLE 1C4U2 5LH8A 1BUIA 1SL3A 1SMFE 2P8OC 1MKWK 5L2YH 2P3UB 5JB8S 2GT7A 4ZUHA 1P2OA 3TGJE 1A3EH 1LKBA 4B2AA 3F9HA 4CHAC 1HAVB 1QURH 3U1JB 1WYKA 5E0HA 1UTKA 1LTOA 1RGQA 1ARCA 3PTBA 2Z9KA 2QIQA 2H5DA 5EG4A 3ZZ6A 1AN1E 1TALA 3URDA 4K8YA 1BBRE 1HAVA 5DP9A 1SPJA 4WMEA 2ZHDA 1UHBB 1V2TT 1QB9A 2GZ9A 1YYY1 2XC5A 4LXBH 5DP4A 1ABIH 1OP0A 1GI7B 3AW0A 1K22H 2BXTH 1HJAC 1BT7A 3VXEH 1QRZA 2XYAA 2FS8A 1WQVH 5GDSH 3GCHC 4BOHA 5A8ZA 2GVFA 1A4WH 2UUKB 1ZTJA 4MTBA 4ISLA 3SV2H 1KIGH 1TLDA 5FBIA 3U8RH 4FXGH 3SQHE 1OP8A 3SUFA 2P94A 1P2KA 4CBNA 1O33A 1FXYA 4NWLA 3P8GA 2FYQA 1EOJA 2A4OA 1ELTA 2A7JA 1D3TB 3E8LA 3BSQA 1RIWB 2A0QB 3BEFB 1AVWA 1LHEH 2BVRH 1DPOA 4BAQB 1QL8A 3RXVA 1ZMLA 1K1LA 1SQOA 1GJBB 2XNIA 5ETXA 1NRPH 4XSKU 2BLOA 1HXEH 4IS5A 1K1MA 1XXDA 2ZDVH 2OBOA 1NS3A 3E16B 1IAUA 1NRQH 2I6QA 5CMXH 2OLGA 4YM9A 4GHQA 1SLWB 1Z6JH 1VCPA 2A32A 2Z7FE 5EXNA 1Z1IA 4UEHH 2A4RA 1WTGH 3A8DA 4FU9A 1O3GA 3HK6B 1O36A 2B0FA 2ZCKP 4NIVA 4MPWA 4WXVA 5AFYH 3GOVB 2XWAA 1TWXB 1HAXB 3TGIE 1Y3YA 1S81A 1Y5UT 1WBGB 1SOZA 3EDXB 1U6QA 1W3CA 1YLDA 1N8OB 1TA6A 5TCAA 2ZGBH 2QXGA 2BM2A 3M3SA 1MZAA 3P8NA 4O97A 2WV4A 5EQQA 3M3VA 1SFIA 3RMMH 2JETB 2CHAB 3GY8A 5JPMH 2BY5X 2ZDLA 1ZHRA 4AYVB 1BHXF 4LZ4B 2ZGHA 1TQ7B 5HGGA 1ZRKA 1IHSH 1P10A 2W26A 2EEKA 3MO3A 3UREA 4ZHMU 3A7YA 3OY5U 5I46H 1C2KA 1PPCE 4JYVH 2BD8A 3RU4T 5EW1H 2FWWA 1NY22 2BMGB 1PQAA 3P70B 1W13U 1YPGH 1GMCG 1AO5A 1T7CA 1C2JA 2Z94A 1PYTC 1IOEA 2HPPH 1S84A 2IPHA 1LCYA 3KCGH 1N6XA 1O35A 3V3MA 4DCDA 1VITG 4I8JA 2C8YB 3OU0A 1CSOE 2P93A 3BTKE 1GBCA 1P2QA 2J2UA 2F9OA 1C1VH 2ZU2A 3IITA 4D7FA 3IWMA 1S83A 4BXSA 2VB0A 1O2TA 1P11E 1V2LT 3U1IB 2YNAA 1XKBC 1NZQH 1O5AB 3T2NA 1C2HA 1C5SA 3M7QA 4AGJA 3SI3H 4MVNA 4A1TA 3K6ZA 3V0XA 1BB0B 2PV9B 1TMUH 4O3UA 1AE5A 3H7TA 3RXDA 1GBIA 1O2NA 1T31A 1QBNA 1C4Y2 1SGDE 2FS9A 4R0IA 1BOQA 3GY4A 4X1SU 1TNIA 4ZMAH 3NXPA 3SNEA 3P95A 2V35A 3M3TA 1ETSH 3VPKA 2BYAX 1C1OA 2HNTF 3O8CA 1H4WA 3DFJA 4X6MA 1SG8B 4WH8A 3PTNA 1G36A 2ZKSA 3Q77A 1O2YA 1QL9A 4ZKRU 2H5CA 3MNCA 5DP8A 1BJVA 1BZXE 1O37A 2EA3A 2Y6TA 4AX9H 1Z1JA 3BTGE 1ABJH 2HNTE 5B6OA 4JK6A 1QA7A 5FCRA 1PQ7A 3URCA 3NUMA 2A1DB 2Z9IA 7GCHG 1BTYA 3MH4A 1MTVA 1ESTA 3QDZB 1TABE 1EPTA 1OYTH 3K65B 1MD8A 3RMNH 3QO6A 1GBTA 2P8OB 3MU8A 1HIAA 1TGNA 1O2RA 4D9RA 4D76A 1A5GH 3TU7H 4D9QA 3LGVA 1P05A 1QB6A 1OWHA 1C1NA 4WH6A 1O3FA 4K60A 4X8VH 1GWAA 1YLCA 3L33A 4Y7BA 4MLFB 4MPXA 3UR9A 4B2CA 1DSUA 4CH8B 1OWEA 4NIXA 1P2NA 1GBKA 2D8WA 2ODYB 7GCHF 2ZGJA 1G3BA 1W0ZU 4X8SH 1YPEH 2PTNA 4YO9A 5AHGH 2ZDKA 2ODQA 5FXLA 6CHAB 1WOFA 1A0LA 1RFNA 4YLUA 2ANKH 2H9TH 1O3IA 2GTBA 3GDVA 1EAWA 3LIWA 2BOKA 3PWBA 1CT2E 2HALA 2QN5T 3RXMA 3A80A 1E36B 2BD3A 1NPMA 1ZYOA 5GWZA 1MQ6A 4TY7A 2A7CA 6GCHF 1W12U 2J9NA 1HB0B 2RA3A 4O3TA 2BVSH 1FI8A 1GJAB 2UUFB 3UIRA 1HBTH 3PO1C 4YOIA 3QTVH 4KKDA 1FPCH 5FHTA 3UR6A 3GY3A 4HGCA 3S7HB 2G5VA 3ZYDA 1GJ9B 7ESTE 1P09A 1LHCH 1O2JA 3MI4A 3RXEA 1QBVH 3SI4H 3RC5A 2PGBB 3L6PA 3ZZ8A 1TIOA 3U9AH 3VB3A 1C1WH 3ZZBA 4LZ1H 2XC4A 2FZZA 2Y5GA 3ZZ7A 2BDBA 1TNJA 2OBQA 4JZDH 4OS2A 1F92A 1O3BA 4ASHA 1NROH 1GPZA 1AMHA 1BJUA 2AGGX 3PLBA 1MZDA 4BXWA 1KLJH 1O5BB 2ZFSA 4NA7A 3RM0H 4Z0KA 2ZPRA 2DE8A 1SLVB 3S7KB 3KF2A 5EU8A 5GCHF 3S69A 1ZTLA 3JZ2B 4E06H 5A8YA 1QL7A 1H9LB 2A5KA 2ZFFH 1A5HA 1F7ZA 3ZZ5A 4Y8XA 2FP7B 5DP7A 4F49A 1GBBA 1W0YH 3LT3A 3ZZCA 3OSYA 2G81E 1KXAA 1XMNB 3STIA 5CHAB 2DE9A 1YBWA 4IN1A 3NK8A 1OWJA 1C5MD 4DVAU 1K1NA 1TX6A 2OP9A 3B23B 2JH5D 3EA9A 3UPEA 3SJ8A 3FZDA 1HAHH 2PTCE 2ZIQH 3SW2B 1YC0A 3E91A 2Z9JA 4ZH8A 4TYDA 2SGAA 4Y10E 1X7AC 2UWOA 4NZQA 3W94A 1CO7E 1H8DH 1C9PA 5EODA 2VWOA 1VCWA 4BAHB 1P02A 2VIVA 2BB4A 2BD4A 4JCNA 4RN6A 4YOGA 2BDCA 3SU3A 1SGRE 4TPIZ 2VVVA 5BPEA 1AHTH 3TH3H 1G9IE 1ELVA 4AYYB 1MCTA 2BDGA 1TNGA 1F0UA 4WY3A 1O3OA 2PFEA 2C8XB 3VEQB 1FN8A 2WUBA 3A84A 1C2FA 1NRNH 2OQUA 3B9FH 1H9IE 3O8BA 4ABGA 3MNSA 4MQAA 4CRGA 1OWDA 5GXPA 2QY0B 2PKSB 3RP2A 2BDHA 1GHBF 1NT1A 4JZEH 4NIWA 2STBE 4Q7XA 6ESTA 3AVZA 5JDUB 1O3JA 1LVBA 1O5FH 1O3NA 1C2GA 3KQCA 2BY8X 2J34A 3M5LA 2VINA 4NCYA 3MH6A 3UFAA 4ZXYH 1TBZH 1O5DH 1B0FA 3SJKA 2G8TA 4K1SA 1QR3E 1AKSA 1ELFA 1EZSC 2P3TB 5L6NH 1LMWB 3SHCH 2AEIH 1W7GH 3C27B 1C1MA 4B71A 2AMPA 1PPBH 1TGBA 2BTCE 1KXFA 1O5EH 4GCHF 1HAOH 1TBQH 2V3OH 1AKSB 4AZ2B 3ZZ3A 4AB9A 2C4FH 2VWMA 1LHDH 1JWTA 3BTEE 2KAIB 1K1JA 1GJDB 2QV1A 3FFGA 4D7GA 1OWKA 4X8UH 3ZV9A 3SU5A 1DWEH 5ESTE 4K69A 4A1VA 1O34A 1HNEE 1JIMA 2OUAA 3PB1E 4UFDH 1K1IA 4AFZA 1ZPBA 2ZDNA 3O8RA 3GY5A 3GY2A 5IDKA 4I32A 3MMGA 3V12A 4LK4A 4XE4A 1UJ1A 1N1LA 1GI8B 2AGEX 1QHRB 1FQ3A 2ANYA 2ZHFH 5LPRA 1SQAA 1J15A 3LH3A 3VB5A 3MO6A 3RXJA 2J94A 3RC4A 2ESTE 2THFB 4CRAA 1GHZA 2BDYA 1THSH 1HFDA 5C5OA 4AFQA 1FUJA 1S0QA 3SO3A 1BTHH 1O2PA 2STAE 4AB8A 1SGEE 3A81A 4AFUA 3T62A 1BBRH 5SGAE 1P04A 1EB1H 1KTSB 1ZHPA 1GI6A 3OTJE 2VNTA 4A92A 2BQ6B 1ZJKA 1VITH 2TGAA 3HKJB 3SGBE 3QN7A 1IQMA 2WPKS 1UTPA 3LJJA 4H42U 3LGIA 1P01A 1EUFA 2SGDE 1FY3A 2XCNA 1E35B 3A83A 1QRXA 1C2EA 1SGTA 1V2UT 2BD5A 4WWYA 1DY8A 1ANBA 3LKWA 3GDSA 2ZG0H 1LHFH 1HAIH 2LPRA 1T8MA 1D3DB 4BTIB 2HRVA 1D6RA 4B73A 4ZHLU 2HVXA 3LDXH 2ZHEH 2D1JA 1P2JA 4AG1A 2FX6A 1CT0E 4DIHH 1ID5H 3ODDA 3RXQA 1S0RA 3ZZAA 2FOMB 2FO9A 4ZAEA 2GMTB 5A0BA 4RSPA 4MPUA 4MNWA 2TBSA 1DLEA 4XBCA 1O3HA 1P8VC 5C1YA 1P3EA 1TB6H 2QGRA 5A8XA 1ELAA 1ZZZA 1GBMA 1UCYE 2PSYA 2WINI 1RD3B 3LGTA 2SGFE 1EXFA 3EA8A 1K9OE 2FI3E 5DO4H 1ORFA 4DIIH 2RCEA 1GVLA 2ZP0H 3BEUA 1BMNH 4UFFH 2VWLA 1O31A 3A7XA 1DWDH 2FOHA 1TQ0B 3S0NA 2GCTC 1XUJA 4FUBA 1UVSH 3E90B 3MOCA 4B76A 2ULLA 5IYTA 2ZFRH 3TNTA 5JYIA 3NWUA 1KSNA 3MTYA 1Y5AT 3VB7A 3MO9A 1MKXH 4Y79A 4BANB 1QQ4A 1EPTB 1GBFA 4OS4A 4BNRA 1BMMH 1C2LA 4B74A 1IQFA 1W8BH 1A0JA 1CA0B 2C3SA 3SV9A 2BVXH 4Y11E 1FY8E 1SLXB 4CREA 1EAUA 3PLPA 1OOKB 5A0CA 1KXCA 2GDDA 4ABAA 2BDIA 2TIOA 2ZHQH 3O8DA 5J4SA 1D6WA 3P8OA 4X6PA 8KME2 3IG6B 1A1RA 3RMLH 1DXPA 1RTKA 1NESE 3DA9B 1HAPH 1DICA 3RMOH 1TOMH 2F91A 5AVDA 1MKWH 2JKHA 4U01A 3RXCA 3SUDA 3ELAH 1FV9A 3R0FA 1ZTKA 1E37B 4I31A 2W7UA 1SSXA 1JMOH 1GBDA 1SGCA 1LHGH 3BIVH 3NCLA 4Y8YA 5C20A 1DE7H 2PKSC 2Q1JA 1K28D 3P8FA 1J8AA 1EOLA 1UVUH 3B8JA 1O2OA 2SGEE 4CRFA 4IGDA 1UTNA 1F0SA 1UMAH 2TRMA 2YOLA 2SFAA 2Z6BD 1YPMH 3D49H 5DPAA 1VITF 1ZHMA 3UNQA 3OYPA 2OXSA 3TK6A 3SV8A 2VIPA 1SFQB 3BG4C 1SC8U 1GHVH 7LPRA 3BTFE 2JH0D 2GZ7A 3FP8E 1QBOA 1DSTA 1G3CA 3KNXA 4H4FA 1RTLA 1DWBH 1CBWB 1TBRH 3GY6A 5AFZH 1CVWH 3HK3B 3BTME 1NFUA 1GHWH 1SGFA 1GG6B 4HFPB 1JXPA 2W3KA 3BF6H 1GBHA 5DP5A 1NFWA 3ATWA 4U30A 4TWYA 1C4V2 1GBAA 3K9XB 4Y0ZE 1J9CH 1HJ8A 1SR5C 3TH2H 2RDLA 1BQYA 3P6ZB 3UUZA 1V2KT 2GV7A 1J14A 1P2MA 1ESAA 1HIAB 1JRSA 1SGNE 1GI3A 1EP5A 2AIQA 3SV6A 2BLVA 1GJ5H 3RXBA 1V6DA 4CRCA 1FN6A 1IQEA 4XDEA 1UVOA 1T4UH 1P03A 1ANCA 2ZDMA 1GHBG 4I33A 5BRRE 1LPZB 3RXOA 2B5TB 1V2NT 4AORA 1DT2A 1T8LA 3FP6E 4X8TH 1YGCH 2FOAA 3Q76A 3TITA 3MNBA 1K21H 3RDZA 2QC2A 1N6YA 2D26C 3M36A 2QXJA 3P92A 3RXKA 1OPHB 1QJ1B 1FAXA 3UQVA 1C1QA 3RXTA 1G37A 4K2YA 3U98H 2FI5E 5AF9H 1GVZA 1IQLA 3JZ1B 1QCPA 2PKAA 3GCHB 3A82A 1CA8B 4GUXA 1GCDA 3PYHA 1T8OA 1O2LA 1OXGA 1W2KH 5EPYA 3BV9B 3TK9A 1TRNA 2VGCC 4IW4E 1GJ8B 4QT8C 1ZLRA 3AW1A 1Z7KA 4KTUA 1EX3A 1TPPA 3RXRA 2BLQA 3QZQA 2PLXA 1P3CA 1O2ZA 1QJ7B 1HXFH 2RG3A 2F83A 2VIOA 2VIDA 2HWLB 4O9VA 5JBTA 1JOUB 1TNHA 4NZLA 2OINA 5A2MH 3SUGA 1DITH 4K8BA 3D23A 2FI4E 3NKKA 2EC9H 4IMQA 1DDJA 3T27A 3SV7A 2NU3E 1EZUC 2NU0E 1TPOA 1UK2A 3SU6A 5F8ZA 5HYOA 4KGAA 1W7XH 2J38A 1P9SA 1S5SA 1GHAG 1C5PA 1SLUB 1GJ4H 9ESTA 5GCHG 3SNAA 3RU4D 3SOSA 4PROA 2WPLS 4KELA 3ZVEA 2QYIA 1O39A 1T32A 1IHTH 2FEQH 2WPHS 2ZU4A 5F03A 1TNKA 1L1JA 1KXEA 2Q6FA 4UDWH 3PMJA 1QFKH 1C5LH 1XX9A 1SGIB 4NGAH 5CHAC 2HOBA 1TNLA 1GI5A 1T8NA 2WYJA 4ISNA 1GMCF 2F9NA 3VGCC 1Q31A 3GCOA 1QJ6B 2PUQH 3MU5A 2ZGXH 3M5MA 1FZZA 2NU1E 1MH0A 1HJ9A 1XKAC 4CR9A 4FUFA 2BLWA 1GMDG 3DT0H 3KN2A 2K1QA 3SGQE 2TGDA 2FOBA 5DK1A 4FUGA 4HI3A 1GDNA 2ZGCA 1GDUA 3ZVBA 3A8CA 1MKXK 3Q3XA 1Z8IB 5A0AE 1GBLA 5DP6A 3W95A 3NZIA 7KMEH 3ODFA 1AE8H 4MPVA 1OWIA 3QLPH 1OKXA 2P95A 2FX4A 3K2UA 1AFEH 1A2CH 3ZVFA 4CR5A 2FOGA 3PROA 2AERH 2Z3EA 1G2MA 1K2I1 1C1RA 2A4GA 3KHVA 4YLQH 1DOJA 1E0FD 2A45B 1CHGA 3A7WA 1EKBB 4IMZA 1RTFB 5TCCA 1ZPZA 2GX4A 3SGAE 5HMAA 4R8TB 2GP9B 3CP7A 4VGCC 4Y8ZA 1F5KU 2QF0A 3G01A 3AAVA 4AGKA 3VXFH 4FUDA 4ZKSU 1Y3VA 3TVJB 2BX4A 2Y7XA 4X6OA 1F0RA 2F9PA 3SU1A 1F0TA 3U69H 4ABDA 2O8MA 4NSVA 1BTXA 1C5XB 3GCTG 5A09A 1O3MA 1MTNB 3QZRA 3RLYH 1AFQB 1UTJA 1MD7A 2BY9X 2ZDAH 2CN0H 4TPYA 1SGYE 3MU0A 2V0BA 3RXLA 3VFEA 3A85A 1V2OT 1VJAU 3VB6A 1CGHA 3BG4B 3I78A 1BTUA 2ANWA 3KIDU 2TPIZ 2GT8A 2R9PA 1B0EA 1BTZA 1KTTB 2A7HA 2GGVB 1NRRH 4OS6A 2G51A 3BTTE 9LPRA 1DLKB 2CXVA 2H1UA 3TJUA 3ENSB 5FPTA 1C2IA 2ODPA 2PGQB 3MYWA 1GVKB 2QXIA 1LVOA 3ATIA 3TGKE 1VGCC 2NU2E 1YKTA 2FYRA 1O2KA 3EYDA 3PWCA 2ZFQH 5EPNA 4Q7YA 3A87A 4CHAB 3S9AA 1WAYB 1BDAA 2J4IA 1ANEA 2QAAA 1QTFA 2Q6DA 2PUXB 4OGXA 4K3JA 4TY6A 4DY7B 2VU8E 1XUFA 2CHAC 3QWCH 3LC5A 1EJMA 1P9UA 3SNDA 2IJOB 3RC6A 1SBWA 2AIPA 1LVMA 5ABWA 4KP0A 1PYTD 4I8KA 2YNBA 4F4OC 1GHXH 1BMLA 4GSOA 3VGCB 4GPGA 3T5FH 1IQIA 3MNXA 4I8GA 3BN9A 3GCTF 1OYQA 1KY9A 4THNH 3SQEE 2FLBH 1Y59T 1L1GA 3EA7A 1MBQA 3LONA 2XBVA 3H7OA 1V2PT 4OS7A 3CS0A 3GDUA 4CH2B 1EATA 1S82A 2G4TA 1YPHE 1ZRBA 4UE7H 4GHTA 1Z8JB 3M35A 3Q3KA 2F9VA 4LOYH 1V2WT 3BTWE 1DANH 1FJSA 2FPZA 2ZPSA 4CRDA 2FLRH 1A7SA 4X1QU 2HNTC 2EI6A 3SU4A 1L4DA 2I6SA 1J16A 2VIQA 5K7RA 2A5IA 5T6FA 1ACBE 1V2JT 8LPRA 3FVFB 2A2XH 2AMDA 3T25A 3BEIB 4YT7H 1A46H 1S85A 1Y3UA 2ZFTA 1DS2E 3PMAB 1Z8RA 2J92A 1TPAE 1AY6H 2FOCA 1C9TA 3I29A 1O3DA 4J2YB 1HYLA 2B7DH 3KEEA 1MAYA 2BD2A 2IOTA 1UVTH 2GV6A 1FMGA 4XBDA 1O2MA 1AB9B 3M5OA 2WV5A 1QY6A 4MG3A 3QGJA 2BQ7B 1RXPA 1IQJA 4JMYA 4MNYA 1C5ZB 1F5RA 1FIZA 1BTWA 5L30H 1O2WA 1ETRH 1UCYH 1Y3WA 1ZSJA 3TJNA 3F9FA 4UD9H 1AZZA 2WPJS 1GGDB 4DJZB 3CS7A 3A7TA 4A5TS 1BHXB 1C5YB 4KTSA 4Y76A 3TK5A 5C5NA 2HLCA 1CGJE 2EI7A 1VGCB 2ZFPH 5LPFA 5FAHA 3TLOA 3ZVDA 4MNXA 1OSSA 2FDAA 2P3FH 3PLKA 4GAWA 3ZYEA 1ZJDA 5T3HA 2FOFA 1SGFG 1AUTC 3R3GB 2A4QA 2C8ZB 1B7XB 3SU0A 1H1BA 1VJ9U 1D3PB 1PPZA 1TE0A 1TRMA 5JB9S 1WQSA 1LKAA 1CHOF 2Y82A 8GCHG 3SZNA 1O2UA 2FESH 2B8OH 1BRUP 3DHKH 2ZTYA 1AZ8A 1KXDA 2CF9H 4JYUH 1O3LA 1P57B 2CGAA 3MFJA 5CE1A 3A89A 3AASA 3RXFA 4HTCH 4NA9H 1UTQA 3MU1A 1PFXC 4Y0YE 4ABJA 3LGUA 1XUIA 1V2ST 5PTPA 5C1XA 1GMHF 2C93B 1UTLM 3FP7E 2SGPE 1MTWA 1AB9C 1PJPA 1WU1A 2GDEH 2QF3A 1QRWA 1UVPA 2ZI2H 1RJXB 1LQDB 1K1OA 3A7ZA 2BD7A 8ESTE 1BRAA 4D8NA 1HPGA 1LQEA 2M5TA 1ANDA 2O8WA 1W11U 1EASA 1SB1H 1C1TA 4CRBA 1C1UH 4I7YH 4ABEA 1AD8H 2ZC9H 3ATMA 2OTVA 3ZVCA 2ZNKH 4WVPE 1DM4B 1TGTA 4GLYA 4SGBE 4Q7ZA 2XWBI 5DG6A 2BY6X 4DG4A 2G00A 4RKJB 4ISIH 1RIWC 1AU8A 3ITIA 2F9BH 1ZSKA 1P0SH 3RXAA 1V2QT 4MDSA 1L0ZA 5L2ZH 2AMQA 1FLEE 4JZFH 4OGYA 4NA8A 4X1NU 3RLWH 2ZWLH 1LPGB 2FODA 3LGYA 3U8OH 1BITA 1GBEA 1DWCH 1HAGE 1OP2A 3UNRA 2P16A 1GMHG 2Y5FA 1O32A 3NPSA 5FPSA 1EP6A 1THPB 1AI8H 1TMTH 2VWNA 4X6NA 2AYWA 2BOHB 1TGCA 2CJIA 2Z3DA 4YESB 2XXLA 2Y80A 4IC6A 2F9UA 1V2RT 4I8HA 1B5GH 1YCPH 1GDQA 2R0KA 1MUEB 2BXUH 2Z9GA 3KGPA 1Z8GA 3A8AA 4WF8A 3SJOA 2SNWA 1S6FA 1ESBA 6GCHG 3BTHE 5JBCS 2GCHF 5T6GA 3QTOH 3K6YA 1GI4A 4NG9H 5F8TA 2VVCA 4IC5A 3ESTA 4NWKA 2ZCHP 3MH7A 1AUJA 3EAJA 1NFYA 3KL6A 1Y8TA 2R3UA 1NO9H 3LU9B 3RXGA 1IQNA 4SGAE 2ZHWH 1LVYA 1BRBE 1GHYH 1C2MA 1D3QB 4INHA 3N7OA 4ZROA 1W10U 1SOTA 5K0HA 1EAIA 3UOPA 2CV3A 2H6MA 3F68H 4UFEH 2A31A 1ZSLA 2F3CE 2OD3B 2R0LA 1T4VH 5I25A 1YCPM 4Q80A 1PPEE 3PMHB 1C5RA 1TGSZ 2PW8H 4FVDA 2IN2A 1O2HA 1N8OC 4FUHA 1GJCB 3KQEA 1JRTA 1O2XA 1FPHH 1KDQA 1G3EA 1C5VA 3M7TA 2C8WB 1AWHB 1WTHD 3SJIA 4OS5A 4DGJA 1HUTH 3MHWU 1KDQB 1FY5A 3E0PB 1G3DA 1UO6A 1QA0A 3TNSA 4H6TA 1KLTA 2V6NA 2FOEA 2ZU5A 1C1PA 2UUJB 1O3EA 1NU9A 3F9EA 3UWJH 1UTOA 2SNVA 1V2MT 1MTUA 1BRCE 4X0WU 1HCGA 1XUKA 4X1RU 1F2SE 2VJ1A 5DJ7A 1YPLH 2GD4B 3FAOA 4K5ZA 1IQKA 4JZ1A 1K1PA 2FTMA 3SORA 4ZKNU 1NRSH 4FU8A 5EOKA 3ZZDA 3M7UA 1C5UA 3KQDA 1JIRA 3F6UH 2VH6A 1GI0A 2ZZUH 4Y6DA 1BA8B 3H5CB 2ZQ2A 4K1TA 1A3BH 3RM2H 1KLIH 2ZTZA 1UK4A 2AGIX 3TJVA 5EQSA 5C67A 1G2LA 3HGNA 2KAIA 1D9IA 1M9UA 3SNCA 1QQUA 4X2WA 2TGPZ 3SUEA 1ELDE 2B9LA 2PWXA 1BBRK 3M5NA 1WCZA 2VH0A 2JH6D 4DURA 1ZGIA 1GI9B 5FX6A 3BIUH 4NIYA 3UOUA 4BTTB 1MTNC 3F1SB 2Y81A 1QGFA 1E34B 4A7IB 2BZ6H 1O2IA 2LNCA 5FCKA 3C1KA 1QNJA 4Y7AA 3V7TA
chains in the Genus database with same CATH superfamily
3PM3A 1O3CA 1C5WB 3KQBA 2ZECA 2OC0A 3T28A 3RXPA 1EZQA 3S9BA 1CA0C 2NU4E 5J4QA 2A2QH 4ISHH 5ESBA 3D65E 1ARBA 4JK5A 4Z6AH 1L1NA 1YP9A 2Q6GA 3UWIA 1A5IA 1XUHA 2G55A 4FUEA 3V13A 3LGWA 1SHYA 1AVGH 3NRLA 5EW2H 1MAXA 2CF8H 1FAKH 4BTUB 4U2WA 1YPHC 3QK1A 3W1EA 3PV4A 2ZA5A 3RXIA 1BMAA 5C3NA 3DUXH 3RUOA 1FONA 1TFXA 1IQHA 1HLTH 2ALPA 1OS8A 1C5NH 5E2OA 4WMDA 5C2ZA 5LPEA 1TAWA 1UHBA 2W3IA 4X2VA 3I77A 1ELCA 1CT4E 2WPMS 1LDTT 3F2FA 4IBLH 3GISB 1XUGA 1HGTH 1O5CB 3S9CA 1WV7H 3TIUA 2WPIS 4A1XA 1J17T 1VR1H 2GMTC 1V3XA 1SI5H 2NWNA 1XXFA 3SU2A 1NFXA 1TX7A 1S6HA 5HM9A 1FNIA 2XBXA 4RT1A 2BX3A 2UUYA 3Q3YA 2VGCB 2XC0A 5HXFA 2OC8A 4K1EA 5DGJA 1GHAF 1C5OH 2V3HH 4B1TA 1GI2A 2WPDD 4AOQA 3F9GA 3T29A 2RA0A 1Y5BT 3QUMP 1Z6EA 1HAYB 1DY9A 3D62A 4X1PU 1DFPA 5GPIB 3QX5H 2XBWA 2BQWB 4XOJA 3FN8A 2R2MB 1AVXA 1GL0E 5G4BA 3ZVGA 1ELEE 1P2IA 2ZCLP 4WMFA 4B75A 4RKOB 2ZEBA 4M7GA 4P02A 1O38A 3SHAH 4J1YA 3LH1A 1PPFE 1ZGVA 4CBOA 3RXSA 3SJ9A 1AIXH 2BD9A 2RDEA 1V2VT 3GCNA 4B6FA 3MWIU 2XTTB 1MU8B 4B2BA 4UFGH 2HPQH 5TJXA 1A61H 2VVUA 3AAUA 3RU4E 1Y3XA 1WSSH 3E3TA 2SGQE 2J95A 3ATKA 1O30A 1EZXC 1VKYA 4Y71A 1DVAH 1ZR0A 1WXRA 3LOXA 1AGJA 1SVPA 4X2XA 3MH5A 1VZQH 1SGQE 1MCVA 2AH4X 5T6DA 5LGOA 2H9HA 2KCPA 2UWPA 3MU4A 4AFSA 4WJG2 1NBMD 1O3KA 2ALVA 3GYMA 2QA9E 2XCFA 3BTQE 1FY1A 1O5GH 1YPJH 1C5QA 3FANA 2DUCA 5C1UA 3GY7A 4A6LA 2ILNA 4ZXXH 2CMYA 5DP3A 1CE5A 2O8LA 1GG6C 1ELGA 1P06A 2WHXA 2ZF0H 1MU6B 2PSXA 4MNVA 4TT3D 2FM2A 4YT6H 3ZZ4A 2OCVB 1RS0A 1G32B 3TJOA 3HKIB 2TGTA 5H4IB 2OC7A 2AFQB 1VCQA 1NC6A 3ZV8A 4VGCB 3HGPA 3EQ0H 2G52A 5EIYA 1YCPK 1UCYK 1AWFH 5CDFE 1LO6A 1HJAB 1SQTA 1ZMJA 4DOQA 1IQGA 1THRH 1G30B 4XBBA 1CU1A 1FDPA 1O2QA 4ESTE 3M37A 2GJGA 3BG8A 2GCHG 3RXUA 5EXLA 2XW9A 3LPRA 1HAZB 4U32A 3STJA 4UONA 3P17H 3WY8A 4DT7B 1NN6A 4GCHG 4E7RG 1XVOA 1GBJA 1AFQC 2FIRH 3ZZ9A 1BIOA 1LPKB 5KECA 1NM6A 3GICB 4F48B 4I8LA 4X2YA 1ZPCA 4E7NA 2KFWA 1GMDF 1GCTB 1PPGE 3EE0B 1CQQA 1YF4A 1HV7A 2HLDD 1INCA 3SZEA 2ASUB 4ABHA 2AS9A 6CHAC 1H8IH 1EAXA 2OK5A 1EPTC 3ZVAA 1XM1A 3ATLA 4FVBA 4AG2A 3E0NB 1CGIE 1MMJN 4ZKOU 3QGNB 2IPQX 5JBBS 3T26A 3DD2H 2YMSD 4E05H 2WYGA 1ZOMA 1O2VA 1L4ZA 2GZ8A 4DW2U 2Y7ZA 4YZUA 5FPYA 1GJ7B 4NFFA 3BTDE 4INKA 2ANMH 5FX5A 3U8TH 5JBAS 2PHBA 4ZHAA 1QB1A 1OX1A 2XRCA 1EJNA 1QIXB 1ELBA 2OQ5A 5F8XA 3OX7U 1DX5M 1KYNA 2D2DA 2ZTXA 3EGKH 3LJOA 1EQ9A 1MTSA 1PPHE 2QXHA 1NTPA 2JJ2D 1H9HE 1F5LA 2BZAA 2ZO3H 1C5TA 2JETC 1O2SA 4H6SB 4NFEA 1TX8A 1A0HB 1UK3A 2H9EH 1DUAA 1O2GH 2OC1A 4GVUA 4HZHA 1ZMNA 4ABIA 1BCUH 1AQ7A 1FIWA 3OY6U 5DKMA 5EQRA 1O3AA 2ZU1A 1HDTH 5EXMA 2WUCA 3CENA 6LPRA 4AC9A 1EB2A 3SN8A 2QCYA 1DXWA 4ABFA 1CHOG 8GCHF 2O8UA 2ZPQA 5F6MA 1NU7B 4OS1A 1TOCB 3SNBA 4BAKB 3HATH 3HPTB 1RRKA 2BY7X 2XBYA 4WXIA 3SBKA 3UNSA 3UY9A 1DUEA 3DFLA 1MQ5A 3PO1B 2C90B 4FUCA 2BDAA 1JBUH 1D4PB 3PMBB 4FUIA 1P12E 2FMJA 1GL1A 2FXRA 1HRTH 2G4UA 1SHHB 1W14U 2P59A 4INLA 5E0GA 1Q2WA 3GYLB 4FUJA 4JZIA 1YPKH 1GJ6A 4FU7A 5DSFA 5IK2D 4XFQA 3Q00A 1TA2A 4ABBA 2PKAB 2BHGA 3E6PH 2O8TA 2EI8A 1L2EA 1C2DA 4AN7A 4YOJA 2UWLA 4BAMB 5HM2A 2VIWA 4YTAA 3VB4A 2W5EA 3A8BA 1YM0A 1TMBH 1KXBA 3WWBA 5E2PA 1BTPA 3L3TA 3A86A 2ZU3A 3RXHA 1MBMA 2Y5HA 5EGMA 2R2WU 1TONA 2ZQ1A 5GIBA 1TPSA 3A88A 2A5AA 3FZZA 1O3PB 1UTMA 1O0DH 3A7VA 1FY4A 2R3YA 1C1SA 1GCTC 5FBEA 3UTUH 2W7SA 1GI1A 1Q3XA 1SGPE 5GJ4B 1EJAA 1Z71A 1E38B 1GGDC 1TYNA 1PQ5A 4ISOA 2Z3CA 2PR3A 3LC3A 1CBWC 1XVMA 3UQOA 2GCTB 4IN2A 4KTCA 3KQ5A 1TRYA 3TH4H 2CK3D 3TPIZ 2G5NA 2H2ZA 2Z9LA 4JYTA 5E0JA 2GKVE 4BAOB 1WUNH 2HGTH 4OM9A 4NSYA 3N7EA 4O03A 4Q2KA 3M61U 4TWWA 1S6LA 1PQ8A 2O9QA 3E1XB 5E8EH 1ETTH 2FTLE 1C4U2 3H09A 5LH8A 1BUIA 1SL3A 1SMFE 2P8OC 1MKWK 5L2YH 2P3UB 5JB8S 2F4LA 2GT7A 4ZUHA 1P2OA 3TGJE 1A3EH 1LKBA 4B2AA 1K0HA 3F9HA 3AK5A 4CHAC 1HAVB 1QURH 3U1JB 1WYKA 2K0QA 5E0HA 1UTKA 1LTOA 1RGQA 1ARCA 3PTBA 2Z9KA 2QIQA 2H5DA 5EG4A 3ZZ6A 1AN1E 2L6OA 1TALA 3URDA 4K8YA 1BBRE 1HAVA 5DP9A 1SPJA 4WMEA 1BMFD 2ZHDA 1UHBB 1V2TT 1QB9A 2GZ9A 1YYY1 4DT4A 2XC5A 4LXBH 5DP4A 1ABIH 1OP0A 1GI7B 3AW0A 1K22H 2BXTH 1HJAC 1BT7A 3VXEH 2JIZD 1QRZA 2XYAA 2FS8A 1WQVH 4RT0A 5GDSH 3GCHC 4BOHA 5A8ZA 2GVFA 1A4WH 2UUKB 1ZTJA 4MTBA 4ISLA 3SV2H 1KIGH 1TLDA 5FBIA 3U8RH 4FXGH 3SQHE 1OP8A 3SUFA 2P94A 1P2KA 4CBNA 1O33A 1FXYA 4NWLA 3P8GA 2FYQA 1EOJA 2A4OA 1ELTA 2A7JA 1D3TB 3E8LA 3BSQA 1RIWB 2A0QB 3BEFB 1AVWA 1LHEH 2BVRH 1DPOA 4BAQB 3DSGA 1QL8A 3RXVA 1ZMLA 1K1LA 1SQOA 1GJBB 2XNIA 5ETXA 1NRPH 4XSKU 2BLOA 1HXEH 3OTPA 1H8ED 4IS5A 1K1MA 1XXDA 2ZDVH 2OBOA 1NS3A 3E16B 1IAUA 1NRQH 2I6QA 5CMXH 2OLGA 4YM9A 4GHQA 1SLWB 1Z6JH 1VCPA 2A32A 2Z7FE 5EXNA 1Z1IA 1OHHD 4UEHH 2A4RA 1WTGH 3A8DA 4FU9A 1O3GA 3HK6B 1O36A 2B0FA 2ZCKP 3F3BA 4NIVA 4MPWA 4WXVA 5AFYH 3GOVB 2XWAA 1TWXB 1HAXB 3TGIE 1Y3YA 1S81A 1Y5UT 1WBGB 1SOZA 3EDXB 1U6QA 1W3CA 1YLDA 1N8OB 1TA6A 5TCAA 2ZGBH 2QXGA 2BM2A 3M3SA 1MZAA 3P8NA 2LP6A 4O97A 2WV4A 5EQQA 3M3VA 1SFIA 3RMMH 2JETB 2CHAB 3GY8A 5JPMH 3UAIC 2BY5X 2ZDLA 1ZHRA 4AYVB 1BHXF 4LZ4B 2ZGHA 1TQ7B 5HGGA 1ZRKA 1IHSH 1P10A 2W26A 2EEKA 3MO3A 3UREA 5DN6D 4ZHMU 3A7YA 3OY5U 5I46H 1C2KA 1PPCE 4JYVH 2BD8A 3RU4T 5EW1H 2FWWA 1NY22 2BMGB 1PQAA 3P70B 1W13U 1YPGH 1GMCG 1AO5A 1T7CA 1C2JA 2Z94A 1PYTC 3PV5A 1IOEA 2HPPH 1S84A 2IPHA 1LCYA 3KCGH 1N6XA 1O35A 3V3MA 4DCDA 1VITG 4I8JA 2C8YB 3OU0A 1CSOE 2P93A 3BTKE 1GBCA 1P2QA 2J2UA 2F9OA 1C1VH 2ZU2A 3IITA 4D7FA 3IWMA 1S83A 4BXSA 2VB0A 1O2TA 1P11E 1V2LT 3U1IB 2YNAA 1XKBC 1NZQH 1O5AB 3T2NA 1C2HA 1C5SA 3M7QA 4AGJA 3SI3H 4MVNA 4A1TA 3K6ZA 3V0XA 1BB0B 2PV9B 1TMUH 4O3UA 1AE5A 3H7TA 3RXDA 1GBIA 1O2NA 1T31A 1QBNA 1C4Y2 1SGDE 2FS9A 4R0IA 1BOQA 3GY4A 4X1SU 1TNIA 3FOAA 4ZMAH 3NXPA 3SNEA 3P95A 2V35A 3M3TA 1ETSH 3VPKA 2BYAX 1C1OA 2KM0A 2HNTF 3O8CA 1H4WA 4Q63A 3DFJA 4X6MA 1SG8B 3N99A 4WH8A 3PTNA 1G36A 2ZKSA 3Q77A 1O2YA 1QL9A 4ZKRU 2H5CA 3MNCA 5DP8A 1BJVA 1BZXE 1O37A 2EA3A 2Y6TA 4AX9H 1Z1JA 3BTGE 1ABJH 2HNTE 5B6OA 4JK6A 1QA7A 3WW7A 5FCRA 1PQ7A 3URCA 3NUMA 2A1DB 2Z9IA 7GCHG 1BTYA 3MH4A 1MTVA 1ESTA 3QDZB 1TABE 1EPTA 1OYTH 3K65B 1MD8A 2QF5A 3RMNH 3QO6A 1GBTA 2P8OB 3MU8A 1HIAA 1TGNA 1O2RA 4D9RA 2EQNA 1KMHB 4D76A 1A5GH 3TU7H 4D9QA 3LGVA 1P05A 1QB6A 1OWHA 1C1NA 4WH6A 1O3FA 4K60A 4X8VH 1GWAA 1YLCA 3L33A 4Y7BA 4MLFB 2XNDD 4MPXA 3UR9A 4B2CA 1DSUA 4CH8B 1OWEA 4NIXA 1P2NA 1GBKA 2D8WA 2ODYB 7GCHF 2WSSD 2PP6A 2ZGJA 1G3BA 1W0ZU 4X8SH 1YPEH 2PTNA 4YO9A 5AHGH 2ZDKA 2ODQA 5FXLA 6CHAB 1WOFA 1A0LA 1RFNA 4YLUA 4HG6A 2ANKH 2H9TH 1O3IA 2GTBA 3GDVA 1EAWA 3LIWA 2BOKA 3PWBA 1CT2E 2HALA 2QN5T 3RXMA 3A80A 1E36B 2BD3A 1NPMA 1ZYOA 5GWZA 1MQ6A 4TY7A 2A7CA 6GCHF 1W12U 3CNRA 1W0JD 2J9NA 1HB0B 2RA3A 4O3TA 2BVSH 1FI8A 1GJAB 2UUFB 3UIRA 1HBTH 3PO1C 4YOIA 3QTVH 4KKDA 1FPCH 5CHBA 3ZIAD 5FHTA 3UR6A 3GY3A 4HGCA 3S7HB 2G5VA 3ZYDA 1GJ9B 7ESTE 1P09A 1LHCH 1O2JA 3MI4A 3RXEA 1QBVH 3SI4H 3RC5A 2PGBB 3L6PA 3ZZ8A 1TIOA 3U9AH 3VB3A 1C1WH 3ZZBA 4LZ1H 5B6LA 2XC4A 2FZZA 2Y5GA 3ZZ7A 2BDBA 1TNJA 2OBQA 4JZDH 4OS2A 1F92A 1O3BA 4ASHA 1NROH 1GPZA 1AMHA 1BJUA 2AGGX 3PLBA 5HIZA 1MZDA 4BXWA 1KLJH 1O5BB 2ZFSA 4NA7A 3RM0H 4Z0KA 2ZPRA 2DE8A 1SLVB 3S7KB 3KF2A 5EU8A 5GCHF 3S69A 1ZTLA 3JZ2B 2K8IA 4E06H 5A8YA 1QL7A 1H9LB 2A5KA 2WV9A 2ZFFH 1A5HA 1F7ZA 3ZZ5A 4RI0A 4Y8XA 2FP7B 5DP7A 4F49A 1GBBA 1W0YH 3LT3A 3ZZCA 3OSYA 2G81E 1KXAA 1XMNB 3STIA 5CHAB 2DE9A 1YBWA 4IN1A 3NK8A 1OWJA 1C5MD 4DVAU 1K1NA 1TX6A 2OP9A 3B23B 2JH5D 3EA9A 3UPEA 3SJ8A 3FZDA 1HAHH 2PTCE 2ZIQH 3SW2B 1YC0A 3E91A 2Z9JA 4ZH8A 4TYDA 2SGAA 4Y10E 1X7AC 2UWOA 4NZQA 5GNDA 3W94A 1CO7E 1H8DH 1C9PA 5EODA 2VWOA 1VCWA 4BAHB 1P02A 2VIVA 2BB4A 2BD4A 3GS9A 4JCNA 4RN6A 4YOGA 2BDCA 3SU3A 1SGRE 4TPIZ 2VVVA 5BPEA 1AHTH 3TH3H 1G9IE 1ELVA 4AYYB 1MCTA 2BDGA 1TNGA 1F0UA 4WY3A 1O3OA 2PFEA 2C8XB 3VEQB 4M9FA 1FN8A 2WUBA 4YXWD 3A84A 1C2FA 1NRNH 2OQUA 3B9FH 1H9IE 3O8BA 4ABGA 3MNSA 4MQAA 4CRGA 1OWDA 3F2GA 5GXPA 2QY0B 2PKSB 3RP2A 2BDHA 1GHBF 1NT1A 3KYGA 4JZEH 4NIWA 4Z1MD 2STBE 4Q7XA 6ESTA 3AVZA 5JDUB 1O3JA 2VBCA 1LVBA 1O5FH 1O3NA 1C2GA 3KQCA 2BY8X 2J34A 3M5LA 2VINA 4NCYA 3MH6A 2WZQA 3UFAA 4ZXYH 1TBZH 1O5DH 1B0FA 3SJKA 2G8TA 4K1SA 1QR3E 1AKSA 4B6EA 1ELFA 1EZSC 2P3TB 5L6NH 1LMWB 3SHCH 2AEIH 1W7GH 3C27B 1C1MA 4B71A 2AMPA 1PPBH 1TGBA 2BTCE 1KXFA 1O5EH 4GCHF 1HAOH 1TBQH 2V3OH 3F0PA 1AKSB 4AZ2B 3ZZ3A 4AB9A 2C4FH 2VWMA 1LHDH 1JWTA 3BTEE 2KAIB 1K1JA 1GJDB 2QV1A 3FFGA 4D7GA 1OWKA 4X8UH 3ZV9A 3SU5A 1DWEH 5ESTE 4K69A 4A1VA 1O34A 1HNEE 1JIMA 5C0TA 2OUAA 2M2AA 3PB1E 4UFDH 1K1IA 4AFZA 1ZPBA 2ZDNA 3O8RA 3GY5A 3GY2A 5IDKA 4I32A 3MMGA 3V12A 4LK4A 3PV2A 1UJ1A 4XE4A 1N1LA 1GI8B 2AGEX 1QHRB 1FQ3A 2ANYA 2ZHFH 5LPRA 1SQAA 1J15A 3LH3A 3VB5A 3MO6A 3RXJA 2J94A 3RC4A 2ESTE 2THFB 4CRAA 1GHZA 2BDYA 1THSH 1HFDA 5C5OA 4AFQA 1FUJA 1S0QA 3SO3A 1BTHH 1O2PA 2STAE 4AB8A 1SGEE 3A81A 4AFUA 3T62A 1BBRH 5SGAE 1P04A 1EB1H 1KTSB 1MABB 1ZHPA 1GI6A 3OTJE 2VNTA 4A92A 2BQ6B 4P00A 1ZJKA 1VITH 2TGAA 3HKJB 3SGBE 3QN7A 1IQMA 2WPKS 1UTPA 3LJJA 4H42U 3LGIA 4TSFD 1P01A 1EUFA 2SGDE 1FY3A 4I86A 2XCNA 1E35B 3A83A 1QRXA 1C2EA 1SGTA 1V2UT 2BD5A 4WWYA 1DY8A 1ANBA 3LKWA 3GDSA 2ZG0H 1LHFH 1HAIH 2LPRA 1T8MA 1D3DB 4BTIB 2HRVA 1D6RA 4B73A 4ZHLU 2HVXA 3LDXH 2ZHEH 2D1JA 1P2JA 4AG1A 2FX6A 1CT0E 4DIHH 1ID5H 3ODDA 3RXQA 1S0RA 3ZZAA 2FOMB 2FO9A 4ZAEA 2GMTB 5A0BA 4RSPA 4MPUA 4MNWA 2TBSA 1FX0B 1DLEA 4XBCA 1O3HA 1P8VC 5C1YA 1P3EA 1TB6H 2QGRA 5A8XA 1ELAA 1ZZZA 1GBMA 1UCYE 2PSYA 2WINI 5EJ1A 1RD3B 3LGTA 2SGFE 3FO8D 1EXFA 3EA8A 1K9OE 2FI3E 5DO4H 1ORFA 4DIIH 2RCEA 1GVLA 2ZP0H 3BEUA 5KEDA 1BMNH 4UFFH 2VWLA 1O31A 3A7XA 1DWDH 2FOHA 1TQ0B 3S0NA 2GCTC 1XUJA 4FUBA 1UVSH 3E90B 3MOCA 4B76A 2ULLA 5IYTA 2ZFRH 3TNTA 5JYIA 5F53A 3NWUA 1KSNA 3MTYA 1Y5AT 3OEED 3VB7A 3MO9A 1MKXH 4Y79A 4BANB 1QQ4A 1EPTB 1GBFA 4OS4A 4BNRA 1BMMH 1C2LA 4B74A 2QF4A 1IQFA 1W8BH 1A0JA 1CA0B 2C3SA 3SV9A 2BVXH 4Y11E 1FY8E 1SLXB 4CREA 1EAUA 3PLPA 1OOKB 5A0CA 1KXCA 2GDDA 4ABAA 2BDIA 2TIOA 2ZHQH 3O8DA 5J4SA 1D6WA 3P8OA 4X6PA 8KME2 3IG6B 1A1RA 3RMLH 2J98A 1DXPA 1RTKA 1NESE 3DA9B 1HAPH 1DICA 3RMOH 1TOMH 2F91A 5AVDA 1MKWH 2JKHA 4U01A 3RXCA 3SUDA 3ELAH 1FV9A 3R0FA 3MQKC 1ZTKA 1E37B 2QE7D 4I31A 2W7UA 1SSXA 1JMOH 3U28C 1GBDA 1SGCA 1LHGH 3BIVH 3NCLA 4Y8YA 4XRNA 5C20A 1DE7H 2PKSC 2Q1JA 1K28D 3P8FA 1J8AA 1EOLA 1UVUH 3B8JA 1O2OA 2SGEE 4CRFA 3DSPA 4IGDA 1UTNA 1F0SA 1UMAH 2TRMA 2YOLA 2SFAA 2Z6BD 1YPMH 3D49H 5DPAA 1VITF 1ZHMA 3UNQA 3OYPA 2OXSA 3TK6A 3SV8A 1SFQB 2VIPA 3BG4C 1SC8U 1GHVH 7LPRA 3BTFE 2JH0D 2GZ7A 3FP8E 1QBOA 1DSTA 1G3CA 3KNXA 4H4FA 1RTLA 1DWBH 1CBWB 5EJZA 1TBRH 3GY6A 5AFZH 1CVWH 4ACBA 3HK3B 3BTME 1NFUA 1GHWH 1SGFA 1GG6B 4HFPB 1UW7A 1JXPA 2W3KA 3BF6H 1GBHA 5DP5A 1NFWA 3ATWA 4U30A 4TWYA 4ASUD 1C4V2 2J97A 1GBAA 3K9XB 4Y0ZE 1J9CH 1HJ8A 1SR5C 3TH2H 2RDLA 1E1RD 1BQYA 3P6ZB 3UUZA 1V2KT 2GV7A 1J14A 1P2MA 1ESAA 1HIAB 1JRSA 1SGNE 1GI3A 1EP5A 2AIQA 3SV6A 2BLVA 1GJ5H 3RXBA 1V6DA 4CRCA 1FN6A 1IQEA 4XDEA 1UVOA 1T4UH 1P03A 1ANCA 2ZDMA 1GHBG 4I33A 5BRRE 1LPZB 3RXOA 2B5TB 1V2NT 4AORA 1DT2A 1T8LA 3FP6E 4X8TH 1YGCH 2FOAA 3Q76A 3TITA 3MNBA 1K21H 3RDZA 2QC2A 1N6YA 2D26C 3M36A 2QXJA 3P92A 3RXKA 1OPHB 1QJ1B 1FAXA 3UQVA 1C1QA 3RXTA 1G37A 4K2YA 3U98H 2FI5E 5AF9H 1GVZA 1IQLA 3JZ1B 1QCPA 2PKAA 3GCHB 3A82A 1CA8B 4GUXA 1GCDA 3PYHA 1T8OA 1O2LA 1OXGA 1W2KH 5EPYA 3BV9B 3TK9A 1TRNA 2VGCC 4IW4E 1GJ8B 4QT8C 1ZLRA 3AW1A 1Z7KA 4KTUA 1EX3A 1TPPA 3RXRA 2BLQA 3DSOA 3QZQA 2PLXA 1P3CA 1O2ZA 3FKSD 1QJ7B 1HXFH 2RG3A 2F83A 2VIOA 2VIDA 2HWLB 4O9VA 5JBTA 1JOUB 1TNHA 4NZLA 2OINA 1QZ8A 3SUGA 5A2MH 1DITH 4K8BA 3D23A 2FI4E 3NKKA 2EC9H 4IMQA 1DDJA 3T27A 3SV7A 2NU3E 1EZUC 2NU0E 1TPOA 1COWD 1UK2A 3SU6A 5F8ZA 5HYOA 4KGAA 1W7XH 2J38A 1P9SA 1S5SA 1GHAG 1C5PA 1SLUB 1GJ4H 9ESTA 5GCHG 3SNAA 3RU4D 3SOSA 4PROA 5KGOA 2WPLS 4KELA 3ZVEA 2QYIA 1O39A 1T32A 1IHTH 2FEQH 2WPHS 2ZU4A 5F03A 1TNKA 1L1JA 1KXEA 2Q6FA 4UDWH 3PMJA 1QFKH 1C5LH 1XX9A 1SGIB 4NGAH 5CHAC 4FETA 2HOBA 1TNLA 1GI5A 1T8NA 2WYJA 4ISNA 1GMCF 2F9NA 3VGCC 1Q31A 3GCOA 1QJ6B 2PUQH 3MU5A 2KCOA 2ZGXH 3M5MA 1FZZA 2NU1E 1MH0A 1HJ9A 1XKAC 4CR9A 3KYFA 4FUFA 2BLWA 1GMDG 3DT0H 3KN2A 2K1QA 1YY3A 3SGQE 2TGDA 2FOBA 5DK1A 4FUGA 4HI3A 1GDNA 2ZGCA 1GDUA 3ZVBA 3A8CA 1MKXK 3Q3XA 1Z8IB 5A0AE 1GBLA 5DP6A 3W95A 3NZIA 7KMEH 3ODFA 1AE8H 4MPVA 1OWIA 3QLPH 1OKXA 2P95A 2FX4A 3K2UA 1AFEH 1A2CH 3ZVFA 4CR5A 2FOGA 3PROA 2AERH 2Z3EA 1G2MA 1K2I1 1C1RA 2A4GA 3KHVA 4YLQH 1DOJA 1E0FD 2A45B 1CHGA 3A7WA 1EKBB 4IMZA 1RTFB 5TCCA 4ZCNA 1ZPZA 3F0OA 2GX4A 3SGAE 5HMAA 3OEHD 4R8TB 2GP9B 3CP7A 4VGCC 4Y8ZA 1F5KU 2QF0A 3G01A 3AAVA 4AGKA 2HVYB 3VXFH 4FUDA 4ZKSU 1Y3VA 3TVJB 2BX4A 2Y7XA 4X6OA 1F0RA 2F9PA 3SU1A 1F0TA 3SYJA 3U69H 4ABDA 2O8MA 4NSVA 1BTXA 3PRBA 1C5XB 3GCTG 5A09A 1O3MA 1MTNB 3QZRA 3RLYH 1AFQB 1UTJA 1MD7A 2BY9X 2ZDAH 5EJLA 2CN0H 4TPYA 1SGYE 3MU0A 2V0BA 4XD7D 3RXLA 3VFEA 3A85A 1V2OT 1VJAU 2KZ4A 3VB6A 1CGHA 3BG4B 3I78A 1BTUA 2ANWA 3KIDU 3EE7A 2TPIZ 2GT8A 2R9PA 1B0EA 1BTZA 1KTTB 2A7HA 2GGVB 1NRRH 4OS6A 2G51A 3BTTE 9LPRA 3OAAD 1DLKB 2CXVA 2H1UA 3TJUA 3ENSB 5FPTA 1C2IA 2ODPA 2PGQB 3MYWA 1GVKB 2QXIA 1LVOA 3ATIA 3TGKE 1VGCC 2NU2E 1YKTA 2FYRA 1O2KA 3EYDA 3PWCA 2ZFQH 5EPNA 4Q7YA 3A87A 4CHAB 3F2HA 3S9AA 1WAYB 2AHME 1BDAA 2J4IA 1ANEA 2QAAA 1QTFA 2Q6DA 2PUXB 4OGXA 4K3JA 4TY6A 4DY7B 2VU8E 1XUFA 2CHAC 1SQRA 3QWCH 3LC5A 1EJMA 1P9UA 3SNDA 2IJOB 3RC6A 1SBWA 2AIPA 1LVMA 5ABWA 4KP0A 1PYTD 4I8KA 2YNBA 4F4OC 1GHXH 1BMLA 4GSOA 3VGCB 4GPGA 3OFND 3T5FH 1IQIA 3MNXA 4I8GA 3BN9A 3GCTF 2KX4A 1OYQA 1KY9A 4THNH 3SQEE 2FLBH 5C0UA 2RFKC 1Y59T 1L1GA 3EA7A 1MBQA 3LONA 2XBVA 3H7OA 1V2PT 4OS7A 3CS0A 3GDUA 4CH2B 1EATA 1S82A 3UNRA 2G4TA 1YPHE 1ZRBA 4UE7H 4GHTA 1Z8JB 3M35A 2J98B 3Q3KA 2F9VA 4LOYH 1V2WT 3BTWE 1DANH 3DCLA 1FJSA 2FPZA 2ZPSA 4CRDA 2FLRH 1A7SA 4X1QU 2HNTC 2EI6A 2V7QD 3SU4A 1L4DA 2I6SA 1J16A 2VIQA 5K7RA 2A5IA 5T6FA 1ACBE 2IJD1 1V2JT 3N7DA 3FVFB 8LPRA 2A2XH 2AMDA 5HKKD 3T25A 3BEIB 4YT7H 1A46H 1S85A 1Y3UA 2ZFTA 1DS2E 3PMAB 1Z8RA 2J92A 1TPAE 1AY6H 2FOCA 1C9TA 3I29A 2V3MA 1O3DA 4J2YB 1HYLA 2B7DH 3KEEA 1MAYA 2BD2A 2IOTA 1UVTH 2GV6A 1FMGA 4XBDA 1O2MA 1AB9B 3M5OA 2WV5A 1QY6A 4MG3A 3QGJA 2BQ7B 1RXPA 1IQJA 4JMYA 4MNYA 1C5ZB 1F5RA 1FIZA 1BTWA 5L30H 1O2WA 1ETRH 1UCYH 1Y3WA 1ZSJA 3TJNA 3F9FA 4UD9H 1AZZA 2WPJS 1GGDB 4DJZB 3CS7A 3A7TA 4A5TS 1BHXB 1C5YB 4KTSA 4Y76A 3TK5A 5C5NA 2HLCA 1CGJE 2EI7A 1VGCB 2ZFPH 5LPFA 5FAHA 3TLOA 3ZVDA 4MNXA 1OSSA 2FDAA 2P3FH 3PLKA 4GAWA 3ZYEA 1ZJDA 5T3HA 2FOFA 1SGFG 1AUTC 3R3GB 2A4QA 2C8ZB 1B7XB 3SU0A 5T1VA 1H1BA 1VJ9U 1D3PB 1PPZA 1TE0A 1TRMA 5JB9S 1WQSA 1LKAA 1CHOF 2Y82A 8GCHG 3SZNA 1O2UA 2FESH 2B8OH 1BRUP 3DHKH 2F43B 2ZTYA 1AZ8A 1KXDA 2CF9H 4JYUH 1O3LA 1P57B 2CGAA 2XOKD 3MFJA 5CE1A 3A89A 3AASA 3RXFA 4HTCH 4NA9H 1UTQA 3MU1A 1PFXC 4Y0YE 4ABJA 3LGUA 1XUIA 1V2ST 5PTPA 5C1XA 1GMHF 2C93B 1W0KD 1UTLM 3FP7E 2SGPE 1MTWA 1AB9C 1PJPA 1WU1A 2GDEH 2QF3A 1QRWA 1UVPA 2ZI2H 1RJXB 1LQDB 1K1OA 3A7ZA 2BD7A 8ESTE 1BRAA 4D8NA 1HPGA 1LQEA 5HIYA 2M5TA 1ANDA 2O8WA 1W11U 1EASA 1SB1H 1C1TA 4CRBA 1C1UH 4I7YH 4FOUC 4ABEA 1AD8H 2ZC9H 3ATMA 2OTVA 3ZVCA 2J5UA 1SKYE 2ZNKH 4WVPE 1DM4B 1TGTA 4GLYA 4SGBE 4Q7ZA 2XWBI 1EFRD 5DG6A 2BY6X 4DG4A 2G00A 4RKJB 4ISIH 1RIWC 1AU8A 3ITIA 2F9BH 1ZSKA 1P0SH 3RXAA 2KCAA 1V2QT 4MDSA 3WWFA 1L0ZA 1NBME 5L2ZH 2AMQA 3VG8A 1FLEE 4JZFH 4OGYA 4NA8A 4X1NU 3RLWH 2ZWLH 1LPGB 2FODA 3LGYA 3U8OH 1BITA 1GBEA 1DWCH 1HAGE 1OP2A 3OE7D 4F55A 2P16A 1GMHG 2Y5FA 1O32A 3NPSA 5FPSA 1EP6A 1THPB 1AI8H 1TMTH 2VWNA 4X6NA 2AYWA 2BOHB 1TGCA 2CJIA 2Z3DA 4YESB 2XXLA 2Y80A 4IC6A 2F9UA 1V2RT 4I8HA 2YMSB 1B5GH 1YCPH 1GDQA 2R0KA 1MUEB 2BXUH 2Z9GA 3KGPA 1Z8GA 3A8AA 4WF8A 3SJOA 1YLNA 2SNWA 1S6FA 5C17A 1ESBA 6GCHG 3BTHE 5JBCS 2GCHF 5T6GA 3QTOH 3K6YA 1GI4A 4NG9H 5F8TA 2VVCA 4IC5A 3ESTA 4NWKA 2ZCHP 3MH7A 1E79D 1AUJA 2LELA 3EAJA 1NFYA 3KL6A 3UB0A 1Y8TA 2R3UA 1NO9H 3LU9B 3RXGA 2EY4C 1IQNA 4SGAE 2ZHWH 2L74A 1H8HD 1LVYA 1BRBE 1GHYH 1C2MA 1D3QB 4INHA 3N7OA 5C94A 4ZROA 1W10U 1SOTA 5K0HA 1EAIA 3UOPA 2CV3A 2H6MA 3F68H 4UFEH 2A31A 1ZSLA 2F3CE 2OD3B 2R0LA 1T4VH 5I25A 1YCPM 4Q80A 1PPEE 3PMHB 1C5RA 1TGSZ 2PW8H 4FVDA 2IN2A 1O2HA 1N8OC 4FUHA 1GJCB 3KQEA 1JRTA 1O2XA 1FPHH 1KDQA 1G3EA 1C5VA 3M7TA 2C8WB 1AWHB 1WTHD 3SJIA 4ACAA 4OS5A 4DGJA 1HUTH 2JDID 3MHWU 1KDQB 1FY5A 3E0PB 1G3DA 1UO6A 1QA0A 3TNSA 4H6TA 1KLTA 2V6NA 2FOEA 2ZU5A 1C1PA 2UUJB 1O3EA 1NU9A 3F9EA 3UWJH 3PRDA 1UTOA 2SNVA 1V2MT 1MTUA 1BRCE 4X0WU 1HCGA 2JJ1D 1XUKA 4X1RU 1F2SE 2VJ1A 5DJ7A 1YPLH 2GD4B 3FAOA 4K5ZA 1IQKA 4JZ1A 5FL7D 1K1PA 2FTMA 3SORA 2W6ID 4ZKNU 1NRSH 4FU8A 5EOKA 3ZZDA 3M7UA 1C5UA 3KQDA 1JIRA 3F6UH 2VH6A 1GI0A 2ZZUH 4Y6DA 1BA8B 3H5CB 2ZQ2A 4K1TA 1A3BH 3RM2H 1KLIH 2ZTZA 1UK4A 2AGIX 3TJVA 5EQSA 5C67A 1G2LA 3HGNA 2KAIA 1D9IA 2KR7A 1M9UA 3SNCA 2KCYA 1QQUA 4X2WA 2TGPZ 3SUEA 1ELDE 2B9LA 2PWXA 1BBRK 3M5NA 1WCZA 1WDIA 2VH0A 2JH6D 4DURA 1ZGIA 1E1QD 1GI9B 4Q4LA 5FX6A 3BIUH 4NIYA 2YMSC 3UOUA 2W6JD 4BTTB 1MTNC 3F1SB 2Y81A 1QGFA 1E34B 4A7IB 2BZ6H 1O2IA 2LNCA 5FCKA 3C1KA 1QNJA 4Y7AA 1YWUA 3V7TA
chains in the Genus database with same CATH topology
3PM3A 1O3CA 1C5WB 3KQBA 2ZECA 2OC0A 3T28A 3RXPA 1EZQA 3S9BA 1CA0C 2NU4E 5J4QA 2A2QH 4ISHH 5ESBA 3D65E 1ARBA 4JK5A 4Z6AH 1L1NA 1YP9A 2Q6GA 3UWIA 1A5IA 1XUHA 2G55A 4FUEA 3V13A 3LGWA 1SHYA 1AVGH 5EW2H 1MAXA 2CF8H 1FAKH 4BTUB 4U2WA 1YPHC 3QK1A 3PV4A 2ZA5A 3RXIA 1BMAA 5C3NA 3DUXH 3RUOA 1FONA 1TFXA 1IQHA 1HLTH 2ALPA 1OS8A 1C5NH 5E2OA 4WMDA 5C2ZA 5LPEA 1TAWA 1UHBA 2W3IA 4X2VA 3I77A 1ELCA 1CT4E 2WPMS 1LDTT 4IBLH 3GISB 1XUGA 1HGTH 1O5CB 3S9CA 1WV7H 3TIUA 2WPIS 4A1XA 1J17T 1VR1H 2GMTC 1V3XA 1SI5H 2NWNA 1XXFA 3SU2A 1NFXA 1TX7A 1S6HA 5HM9A 1FNIA 2XBXA 2BX3A 2UUYA 3Q3YA 2VGCB 2XC0A 5HXFA 2OC8A 4K1EA 5DGJA 1GHAF 1C5OH 2V3HH 4B1TA 1GI2A 4AOQA 3F9GA 3T29A 2RA0A 1Y5BT 3QUMP 1Z6EA 1HAYB 1DY9A 3D62A 4X1PU 1DFPA 5GPIB 3QX5H 2XBWA 2BQWB 4XOJA 2R2MB 1AVXA 1GL0E 5G4BA 3ZVGA 1ELEE 1P2IA 2ZCLP 4WMFA 4B75A 4RKOB 2ZEBA 4M7GA 1O38A 3SHAH 4J1YA 3LH1A 1PPFE 1ZGVA 4CBOA 3RXSA 3SJ9A 1AIXH 2BD9A 1V2VT 3GCNA 3MWIU 2XTTB 1MU8B 4B2BA 4UFGH 2HPQH 5TJXA 1A61H 2VVUA 3AAUA 3RU4E 1Y3XA 1WSSH 3E3TA 2SGQE 2J95A 3ATKA 1O30A 1EZXC 4Y71A 1DVAH 1ZR0A 3LOXA 1AGJA 1SVPA 4X2XA 3MH5A 1VZQH 1SGQE 1MCVA 2AH4X 5T6DA 5LGOA 2H9HA 2UWPA 3MU4A 4AFSA 4WJG2 1O3KA 2ALVA 3GYMA 2QA9E 2XCFA 3BTQE 1FY1A 1O5GH 1YPJH 1C5QA 3FANA 2DUCA 5C1UA 3GY7A 4A6LA 2ILNA 4ZXXH 2CMYA 5DP3A 1CE5A 2O8LA 1GG6C 1ELGA 1P06A 2ZF0H 1MU6B 2PSXA 4MNVA 2FM2A 4YT6H 3ZZ4A 2OCVB 1RS0A 1G32B 3TJOA 3HKIB 2TGTA 5H4IB 2OC7A 2AFQB 1VCQA 1NC6A 3ZV8A 4VGCB 3HGPA 3EQ0H 2G52A 1YCPK 1UCYK 1AWFH 1LO6A 1HJAB 1SQTA 1ZMJA 4DOQA 1IQGA 1THRH 1G30B 4XBBA 1CU1A 1FDPA 1O2QA 4ESTE 3M37A 3BG8A 2GCHG 3RXUA 5EXLA 2XW9A 3LPRA 1HAZB 4U32A 3STJA 4UONA 3P17H 3WY8A 4DT7B 1NN6A 4GCHG 4E7RG 1XVOA 1GBJA 1AFQC 2FIRH 3ZZ9A 1BIOA 1LPKB 1NM6A 3GICB 4I8LA 4X2YA 1ZPCA 4E7NA 1GMDF 1GCTB 1PPGE 3EE0B 1CQQA 1YF4A 1HV7A 1INCA 2ASUB 4ABHA 2AS9A 6CHAC 1H8IH 1EAXA 1EPTC 3ZVAA 1XM1A 3ATLA 4FVBA 4AG2A 3E0NB 1CGIE 1MMJN 4ZKOU 3QGNB 5JBBS 3T26A 3DD2H 4E05H 2WYGA 1ZOMA 1O2VA 1L4ZA 2GZ8A 4DW2U 2Y7ZA 4YZUA 5FPYA 1GJ7B 4NFFA 3BTDE 4INKA 2ANMH 5FX5A 3U8TH 5JBAS 2PHBA 4ZHAA 1QB1A 1OX1A 2XRCA 1EJNA 1QIXB 1ELBA 2OQ5A 5F8XA 3OX7U 1DX5M 1KYNA 2D2DA 2ZTXA 3EGKH 3LJOA 1EQ9A 1MTSA 1PPHE 2QXHA 1NTPA 1H9HE 1F5LA 2BZAA 2ZO3H 1C5TA 2JETC 1O2SA 4H6SB 4NFEA 1TX8A 1A0HB 1UK3A 2H9EH 1DUAA 1O2GH 2OC1A 4GVUA 4HZHA 1ZMNA 4ABIA 1BCUH 1AQ7A 1FIWA 3OY6U 5DKMA 5EQRA 1O3AA 2ZU1A 1HDTH 5EXMA 2WUCA 3CENA 6LPRA 1EB2A 3SN8A 2QCYA 1DXWA 4ABFA 1CHOG 8GCHF 2O8UA 2ZPQA 5F6MA 1NU7B 4OS1A 1TOCB 3SNBA 4BAKB 3HATH 3HPTB 1RRKA 2BY7X 2XBYA 4WXIA 3SBKA 3UNSA 3UY9A 1DUEA 3DFLA 1MQ5A 3PO1B 2C90B 4FUCA 2BDAA 1JBUH 1D4PB 3PMBB 4FUIA 1P12E 2FMJA 1GL1A 2FXRA 1HRTH 2G4UA 1SHHB 1W14U 2P59A 4INLA 5E0GA 1Q2WA 3GYLB 4FUJA 4JZIA 1YPKH 1GJ6A 4FU7A 4XFQA 3Q00A 1TA2A 4ABBA 2PKAB 2BHGA 3E6PH 2O8TA 2EI8A 1L2EA 1C2DA 4AN7A 4YOJA 2UWLA 4BAMB 5HM2A 2VIWA 4YTAA 3VB4A 2W5EA 3A8BA 1YM0A 1TMBH 1KXBA 5E2PA 1BTPA 3L3TA 3A86A 2ZU3A 3RXHA 1MBMA 2Y5HA 5EGMA 2R2WU 1TONA 2ZQ1A 5GIBA 1TPSA 3A88A 2A5AA 3FZZA 1O3PB 1UTMA 1O0DH 3A7VA 1FY4A 2R3YA 1C1SA 1GCTC 5FBEA 3UTUH 2W7SA 1GI1A 1Q3XA 1SGPE 5GJ4B 1EJAA 1Z71A 1E38B 1GGDC 1TYNA 1PQ5A 4ISOA 2Z3CA 2PR3A 3LC3A 1CBWC 1XVMA 3UQOA 2GCTB 4IN2A 4KTCA 1TRYA 3TH4H 3TPIZ 2G5NA 2H2ZA 2Z9LA 4JYTA 5E0JA 2GKVE 4BAOB 1WUNH 2HGTH 4NSYA 4O03A 4Q2KA 3M61U 4TWWA 1PQ8A 2O9QA 3E1XB 5E8EH 1ETTH 2FTLE 1C4U2 5LH8A 1BUIA 1SL3A 1SMFE 2P8OC 1MKWK 5L2YH 2P3UB 5JB8S 2GT7A 4ZUHA 1P2OA 3TGJE 1A3EH 1LKBA 4B2AA 3F9HA 4CHAC 1HAVB 1QURH 3U1JB 1WYKA 5E0HA 1UTKA 1LTOA 1RGQA 1ARCA 3PTBA 2Z9KA 2QIQA 2H5DA 5EG4A 3ZZ6A 1AN1E 1TALA 3URDA 4K8YA 1BBRE 1HAVA 5DP9A 1SPJA 4WMEA 2ZHDA 1UHBB 1V2TT 1QB9A 2GZ9A 1YYY1 2XC5A 4LXBH 5DP4A 1ABIH 1OP0A 1GI7B 3AW0A 1K22H 2BXTH 1HJAC 1BT7A 3VXEH 1QRZA 2XYAA 2FS8A 1WQVH 5GDSH 3GCHC 4BOHA 5A8ZA 2GVFA 1A4WH 2UUKB 1ZTJA 4MTBA 4ISLA 3SV2H 1KIGH 1TLDA 5FBIA 3U8RH 4FXGH 3SQHE 1OP8A 3SUFA 2P94A 1P2KA 4CBNA 1O33A 1FXYA 4NWLA 3P8GA 2FYQA 1EOJA 2A4OA 1ELTA 2A7JA 1D3TB 3E8LA 3BSQA 1RIWB 2A0QB 3BEFB 1AVWA 1LHEH 2BVRH 1DPOA 4BAQB 1QL8A 3RXVA 1ZMLA 1K1LA 1SQOA 1GJBB 2XNIA 5ETXA 1NRPH 4XSKU 2BLOA 1HXEH 4IS5A 1K1MA 1XXDA 2ZDVH 2OBOA 1NS3A 3E16B 1IAUA 1NRQH 2I6QA 5CMXH 2OLGA 4YM9A 4GHQA 1SLWB 1Z6JH 1VCPA 2A32A 2Z7FE 5EXNA 1Z1IA 4UEHH 2A4RA 1WTGH 3A8DA 4FU9A 1O3GA 3HK6B 1O36A 2B0FA 2ZCKP 4NIVA 4MPWA 4WXVA 5AFYH 3GOVB 2XWAA 1TWXB 1HAXB 3TGIE 1Y3YA 1S81A 1Y5UT 1WBGB 1SOZA 3EDXB 1U6QA 1W3CA 1YLDA 1N8OB 1TA6A 5TCAA 2ZGBH 2QXGA 2BM2A 3M3SA 1MZAA 3P8NA 4O97A 2WV4A 5EQQA 3M3VA 1SFIA 3RMMH 2JETB 2CHAB 3GY8A 5JPMH 2BY5X 2ZDLA 1ZHRA 4AYVB 1BHXF 4LZ4B 2ZGHA 1TQ7B 5HGGA 1ZRKA 1IHSH 1P10A 2W26A 2EEKA 3MO3A 3UREA 4ZHMU 3A7YA 3OY5U 5I46H 1C2KA 1PPCE 4JYVH 2BD8A 3RU4T 5EW1H 2FWWA 1NY22 2BMGB 1PQAA 3P70B 1W13U 1YPGH 1GMCG 1AO5A 1T7CA 1C2JA 2Z94A 1PYTC 1IOEA 2HPPH 1S84A 2IPHA 1LCYA 3KCGH 1N6XA 1O35A 3V3MA 4DCDA 1VITG 4I8JA 2C8YB 3OU0A 1CSOE 2P93A 3BTKE 1GBCA 1P2QA 2J2UA 2F9OA 1C1VH 2ZU2A 3IITA 4D7FA 3IWMA 1S83A 4BXSA 2VB0A 1O2TA 1P11E 1V2LT 3U1IB 2YNAA 1XKBC 1NZQH 1O5AB 3T2NA 1C2HA 1C5SA 3M7QA 4AGJA 3SI3H 4MVNA 4A1TA 3K6ZA 3V0XA 1BB0B 2PV9B 1TMUH 4O3UA 1AE5A 3H7TA 3RXDA 1GBIA 1O2NA 1T31A 1QBNA 1C4Y2 1SGDE 2FS9A 4R0IA 1BOQA 3GY4A 4X1SU 1TNIA 4ZMAH 3NXPA 3SNEA 3P95A 2V35A 3M3TA 1ETSH 3VPKA 2BYAX 1C1OA 2HNTF 3O8CA 1H4WA 3DFJA 4X6MA 1SG8B 4WH8A 3PTNA 1G36A 2ZKSA 3Q77A 1O2YA 1QL9A 4ZKRU 2H5CA 3MNCA 5DP8A 1BJVA 1BZXE 1O37A 2EA3A 2Y6TA 4AX9H 1Z1JA 3BTGE 1ABJH 2HNTE 5B6OA 4JK6A 1QA7A 5FCRA 1PQ7A 3URCA 3NUMA 2A1DB 2Z9IA 7GCHG 1BTYA 3MH4A 1MTVA 1ESTA 3QDZB 1TABE 1EPTA 1OYTH 3K65B 1MD8A 3RMNH 3QO6A 1GBTA 2P8OB 3MU8A 1HIAA 1TGNA 1O2RA 4D9RA 4D76A 1A5GH 3TU7H 4D9QA 3LGVA 1P05A 1QB6A 1OWHA 1C1NA 4WH6A 1O3FA 4K60A 4X8VH 1GWAA 1YLCA 3L33A 4Y7BA 4MLFB 4MPXA 3UR9A 4B2CA 1DSUA 4CH8B 1OWEA 4NIXA 1P2NA 1GBKA 2D8WA 2ODYB 7GCHF 2ZGJA 1G3BA 1W0ZU 4X8SH 1YPEH 2PTNA 4YO9A 5AHGH 2ZDKA 2ODQA 5FXLA 6CHAB 1WOFA 1A0LA 1RFNA 4YLUA 2ANKH 2H9TH 1O3IA 2GTBA 3GDVA 1EAWA 3LIWA 2BOKA 3PWBA 1CT2E 2HALA 2QN5T 3RXMA 3A80A 1E36B 2BD3A 1NPMA 1ZYOA 5GWZA 1MQ6A 4TY7A 2A7CA 6GCHF 1W12U 2J9NA 1HB0B 2RA3A 4O3TA 2BVSH 1FI8A 1GJAB 2UUFB 3UIRA 1HBTH 3PO1C 4YOIA 3QTVH 4KKDA 1FPCH 5FHTA 3UR6A 3GY3A 4HGCA 3S7HB 2G5VA 3ZYDA 1GJ9B 7ESTE 1P09A 1LHCH 1O2JA 3MI4A 3RXEA 1QBVH 3SI4H 3RC5A 2PGBB 3L6PA 3ZZ8A 1TIOA 3U9AH 3VB3A 1C1WH 3ZZBA 4LZ1H 2XC4A 2FZZA 2Y5GA 3ZZ7A 2BDBA 1TNJA 2OBQA 4JZDH 4OS2A 1F92A 1O3BA 4ASHA 1NROH 1GPZA 1AMHA 1BJUA 2AGGX 3PLBA 1MZDA 4BXWA 1KLJH 1O5BB 2ZFSA 4NA7A 3RM0H 4Z0KA 2ZPRA 2DE8A 1SLVB 3S7KB 3KF2A 5EU8A 5GCHF 3S69A 1ZTLA 3JZ2B 4E06H 5A8YA 1QL7A 1H9LB 2A5KA 2ZFFH 1A5HA 1F7ZA 3ZZ5A 4Y8XA 2FP7B 5DP7A 4F49A 1GBBA 1W0YH 3LT3A 3ZZCA 3OSYA 2G81E 1KXAA 1XMNB 3STIA 5CHAB 2DE9A 1YBWA 4IN1A 3NK8A 1OWJA 1C5MD 4DVAU 1K1NA 1TX6A 2OP9A 3B23B 2JH5D 3EA9A 3UPEA 3SJ8A 3FZDA 1HAHH 2PTCE 2ZIQH 3SW2B 1YC0A 3E91A 2Z9JA 4ZH8A 4TYDA 2SGAA 4Y10E 1X7AC 2UWOA 4NZQA 3W94A 1CO7E 1H8DH 1C9PA 5EODA 2VWOA 1VCWA 4BAHB 1P02A 2VIVA 2BB4A 2BD4A 4JCNA 4RN6A 4YOGA 2BDCA 3SU3A 1SGRE 4TPIZ 2VVVA 5BPEA 1AHTH 3TH3H 1G9IE 1ELVA 4AYYB 1MCTA 2BDGA 1TNGA 1F0UA 4WY3A 1O3OA 2PFEA 2C8XB 3VEQB 1FN8A 2WUBA 3A84A 1C2FA 1NRNH 2OQUA 3B9FH 1H9IE 3O8BA 4ABGA 3MNSA 4MQAA 4CRGA 1OWDA 5GXPA 2QY0B 2PKSB 3RP2A 2BDHA 1GHBF 1NT1A 4JZEH 4NIWA 2STBE 4Q7XA 6ESTA 3AVZA 5JDUB 1O3JA 1LVBA 1O5FH 1O3NA 1C2GA 3KQCA 2BY8X 2J34A 3M5LA 2VINA 4NCYA 3MH6A 3UFAA 4ZXYH 1TBZH 1O5DH 1B0FA 3SJKA 2G8TA 4K1SA 1QR3E 1AKSA 1ELFA 1EZSC 2P3TB 5L6NH 1LMWB 3SHCH 2AEIH 1W7GH 3C27B 1C1MA 4B71A 2AMPA 1PPBH 1TGBA 2BTCE 1KXFA 1O5EH 4GCHF 1HAOH 1TBQH 2V3OH 1AKSB 4AZ2B 3ZZ3A 4AB9A 2C4FH 2VWMA 1LHDH 1JWTA 3BTEE 2KAIB 1K1JA 1GJDB 2QV1A 3FFGA 4D7GA 1OWKA 4X8UH 3ZV9A 3SU5A 1DWEH 5ESTE 4K69A 4A1VA 1O34A 1HNEE 1JIMA 2OUAA 3PB1E 4UFDH 1K1IA 4AFZA 1ZPBA 2ZDNA 3O8RA 3GY5A 3GY2A 5IDKA 4I32A 3MMGA 3V12A 4LK4A 4XE4A 1UJ1A 1N1LA 1GI8B 2AGEX 1QHRB 1FQ3A 2ANYA 2ZHFH 5LPRA 1SQAA 1J15A 3LH3A 3VB5A 3MO6A 3RXJA 2J94A 3RC4A