2VNTA

Urokinase-type plasminogen activator inhibitor complex with a 1-(7- sulphoamidoisoquinolinyl)guanidine
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
262
structure length
257
Chain Sequence
KFQCGQKTLIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title Selective Urokinase-Type Plasminogen Activator (Upa) Inhibitors 4. 1-(7-Sulphonamidoisoquinolinyl) Guanidines
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 257
sequence length 262
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2008-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vntA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vntA01
2FOBA 1E38B 1HIAA 1ELCA 4ZKRU 1RTLA 2F9BH 1GL0E 4DCDA 4ABBA 1HIAB 1Y5UT 3MO6A 3P95A 1SGEE 3UR6A 2JKHA 4U32A 4X8UH 4CR9A 3RXTA 2H5CA 3RMMH 2XRCA 4JZEH 2G8TA 3BTFE 1OS8A 1TPAE 2F83A 3SUFA 5E0HA 2QYIA 4INKA 2O8MA 3T29A 1TABE 1YCPM 2TBSA 3PO1B 3SW2B 2A5AA 2H9TH 1AUTC 1TNGA 2OUAA 2WPJS 2UUYA 1EJNA 3RXSA 1ABIH 3MU1A 5F8ZA 4Y6DA 2P3TB 2BDIA 2VVUA 1C4U2 4ISLA 1Y5AT 1B5GH 4X2YA 3TLOA 1YPMH 5BRRE 3UOPA 1FQ3A 5TJXA 1W8BH 2JH0D 1K1OA 2BMGB 1LHFH 3URDA 3GYLB 1MTNC 1F0SA 1ELAA 3BTHE 1RIWB 4FVDA 4CRGA 3CENA 5AFZH 2FWWA 2BY9X 3LH1A 3MH5A 2XC5A 1PPGE 1WQVH 3SV7A 4BXWA 2QF0A 5EODA 4CRCA 5JBTA 2ZDKA 1DWCH 5JYIA 2ZCHP 2PUXB 3LH3A 3ATMA 4H4FA 4X6MA 3TITA 2ZDMA 2W3KA 1DVAH 1GBAA 5AHGH 1AO5A 5A8YA 1O5DH 1S6FA 2A2QH 2ANWA 4K2YA 2HVXA 2CHAB 4D7GA 2ZGXH 3ZZ6A 1C1WH 1LKBA 2B9LA 1OX1A 1Q2WA 1TFXA 2QIQA 1TA2A 3NXPA 2AH4X 1UHBB 6ESTA 1KTSB 1O39A 5EPNA 5L2YH 1L1GA 1C2KA 2OC0A 4YO9A 1CT0E 1SGFG 1QJ6B 1SQTA 4IW4E 3SQHE 1MU8B 3SJKA 5EXLA 3GOVB 1AQ7A 2F9NA 3E0PB 4BAKB 2FYQA 2FI3E 2PUQH 4J1YA 3O8BA 2HPPH 2PHBA 5GIBA 4AGJA 2FZZA 2W7UA 5DP3A 2Z9LA 1O36A 2FEQH 4GPGA 1C5MD 3GY7A 3A7TA 2ILNA 1O2GH 4B74A 1GVZA 2PKSC 1GMCG 4BAOB 4FUDA 1O3AA 3VB6A 3L3TA 3QGNB 1D6WA 1J15A 1G36A 3ITIA 3BEUA 3A8CA 1TOCB 3NPSA 3ZZ8A 2AIQA 2ZCLP 1JRSA 1O37A 2TGPZ 3VXEH 1C2JA 1O2NA 1OSSA 2PKAB 2QN5T 1QY6A 4IS5A 5DP4A 3TJNA 4HGCA 4JK6A 1UTPA 3QWCH 1YYY1 4DT7B 4D9RA 1YP9A 1GVLA 1O2SA 1AKSA 5EQQA 1C5WB 2BDHA 1ARBA 3HGNA 2ZFTA 1W3CA 2BXUH 1EPTC 2XWBI 1BHXB 5JBAS 3FZDA 5GXPA 5IDKA 1C2EA 2A7HA 5JPMH 2OTVA 2ZFRH 5LGOA 1P0SH 2PTCE 1P2JA 2R9PA 2BD5A 1NRPH 5FHTA 1DDJA 2SGDE 3R3GB 2ZGCA 2VIVA 1EP6A 1MKWH 2LNCA 2ZFSA 1ZMJA 2UWPA 3W94A 3MH4A 3ZVFA 2ZFQH 1XXFA 4H42U 5CMXH 2FTLE 2ZNKH 3A8BA 3ZV8A 1IQKA 1O3PB 3W95A 2IJOB 3KN2A 4WH8A 2VIQA 4FUGA 4SGAE 1NC6A 2H1UA 2CXVA 2BD9A 1K1JA 2OD3B 4OGYA 5G4BA 3V0XA 3GISB 1HCGA 1O3CA 3IG6B 2FX6A 1Y5BT 3CS0A 5EQSA 2SNWA 4RSPA 3VB7A 2QXJA 1WU1A 2VWLA 3SU5A 5LPRA 1HUTH 1HAGE 1OYTH 1P01A 3RXFA 3PROA 1FUJA 5T6FA 1WSSH 5DP5A 2GCTC 3ZZBA 3HK6B 1SGYE 1AVWA 3O8RA 3RC6A 3HK3B 1K1PA 1XUHA 1FN8A 1C2DA 1W7GH 1U6QA 2AEIH 1KSNA 3C27B 1K1MA 4R0IA 1CT2E 2FDAA 2BXTH 3LGIA 1HAVB 3VB4A 2BDGA 1JBUH 1OWHA 1G9IE 1F5RA 4ABHA 1QL9A 3M61U 3E1XB 1GJ8B 4A1VA 3UREA 3IITA 2WV4A 2VIOA 2JETC 1DFPA 1XKAC 1LTOA 3M7TA 3A7VA 3FAOA 1AU8A 1VR1H 3ZYDA 8LPRA 1V2OT 2B8OH 1C2LA 1MUEB 2HGTH 1DWEH 3E91A 2FLBH 2A5IA 4DG4A 1SQOA 1AZZA 3M37A 2CMYA 2A4QA 3ODFA 2XCNA 2EA3A 4A1XA 4ZKOU 4UFEH 1N8OC 2XBWA 1K1IA 2A7JA 3TIUA 4MQAA 1FDPA 2GZ7A 1C2GA 1EP5A 1AY6H 4GLYA 1QURH 3S9CA 2QCYA 3SNDA 5DKMA 4WJG2 3H5CB 4INLA 2F9VA 4D9QA 2F3CE 1KYNA 4THNH 3LKWA 1V2QT 4U01A 3UNRA 3GCTF 2Z3CA 5JB8S 5LPFA 5F6MA 4LK4A 1A4WH 2A4RA 1WV7H 1QJ1B 1DPOA 2SGFE 5AF9H 1FY4A 1VGCB 1LCYA 1XUJA 1Y3UA 2ZFFH 1O3HA 4Q80A 4UFDH 4I8HA 5DO4H 4E7RG 1TNHA 2SGEE 1MKXK 1KXDA 1BOQA 4MNYA 1G3BA 3D62A 1ETSH 1P05A 2VH6A 2P16A 1ABJH 1C5SA 1LPZB 2BVSH 1UTNA 2QC2A 4MLFB 1JIMA 4CRAA 5JB9S 5F8XA 4UONA 2O8LA 4DVAU 1C1QA 4CBOA 2OC1A 1UK2A 3RXQA 2R3UA 3UNSA 2BLOA 3E90B 1HJ9A 1C5UA 2H9EH 3GCNA 1F5KU 1XUKA 3RXKA 1O2VA 1HAHH 2FS8A 3K2UA 4X1SU 5A2MH 3FP7E 1MTNB 3M5MA 2BZ6H 1ZSKA 3CP7A 1QA0A 2PWXA 1O5GH 1O3DA 4AORA 2J38A 2GMTC 3KF2A 4GHQA 4X1NU 1V2WT 2V35A 1HAZB 2JH6D 1EUFA 3Q3YA 3BTGE 1DUAA 1NRQH 4SGBE 7ESTE 4WXVA 2WV5A 1GL1A 1D3TB 3SQEE 3RU4E 3BIVH 1DX5M 4UFFH 1GBTA 1MQ5A 3VPKA 2ZHQH 4YM9A 5HYOA 2QGRA 2GV6A 3NZIA 1XUGA 4JZDH 1C4Y2 2NU0E 4A92A 4AB9A 2I6QA 3LGVA 4NWKA 1TBRH 5L6NH 3E6PH 1GHXH 4NIYA 3OY5U 4YOGA 5E0JA 1O38A 6LPRA 4AN7A 1C5RA 2VJ1A 4ASHA 3EA7A 2BDYA 3MO9A 1GBBA 1O5FH 1O2TA 2FS9A 1QB1A 4X2XA 4B2AA 4E05H 1T31A 1TGTA 1WAYB 1H9HE 4WXIA 1W7XH 1AD8H 1XM1A 4AYYB 1SQAA 3T27A 1IAUA 1GJ5H 4ZXXH 1ZSJA 1G2MA 1YCPH 5E2OA 2J92A 4GHTA 4RKJB 2VIPA 3LJOA 1C2MA 1V2KT 1UVPA 4WWYA 3F1SB 1TBZH 2Y5HA 1O32A 1C5OH 3A81A 4LZ1H 1NFXA 1DM4B 3DA9B 2GZ9A 4FUEA 1IQLA 2VGCB 1MD8A 2SFAA 3AAUA 1ZJKA 1O2QA 2XYAA 2QXIA 1T8MA 3T28A 2XC0A 4B73A 4BTUB 1Z1IA 1AN1E 1E37B 1BBRH 1EPTB 1UK3A 4AYVB 2Y81A 1CE5A 2PLXA 1BMAA 2FPZA 3DFLA 2OXSA 2WPKS 5C1UA 1KY9A 1D4PB 3SHAH 1KLTA 1KDQA 1O2PA 1SHHB 3TGJE 1FMGA 2XBYA 3NK8A 1G3DA 2AMDA 4CRFA 2VVVA 3N7OA 2VB0A 5GCHF 3RXMA 3ZZ3A 2STAE 3UNQA 3KNXA 3Q3KA 1YPEH 1GDNA 4H6SB 1HDTH 2ZU2A 2OCVB 1HFDA 1NTPA 1A5IA 1V3XA 4Q7ZA 2Z9JA 4MNVA 1Z8GA 1S84A 1QL7A 1P57B 1W0ZU 5A0BA 3PMJA 3B23B 4FUHA 4ABFA 3PWCA 3RXGA 1NRSH 1LHGH 3P8NA 2XW9A 4TY7A 3F6UH 5FCRA 1AVXA 5GJ4B 2BX3A 1TMBH 3HKJB 4XE4A 2ZZUH 5T3HA 5DPAA 1C1UH 1JRTA 5HMAA 3GDVA 1Z1JA 4BNRA 4X8SH 1C9PA 1F0TA 1TQ7B 2A31A 3UWIA 3GY3A 2V3HH 2R2WU 1A2CH 3NCLA 2C8YB 1O5AB 2RCEA 2EI8A 1C4V2 3M7UA 1NFYA 4Y79A 1G37A 1W2KH 3DHKH 3MO3A 2ZCKP 5BPEA 3S0NA 2HLCA 1OP2A 1TNJA 2FYRA 2Z3EA 3RLWH 1TOMH 4MDSA 4JZIA 1ELDE 3P8FA 2GT7A 2JETB 1WBGB 3F9EA 3M7QA 1V2LT 4KKDA 4Y0YE 3M5OA 4X1QU 3HGPA 1ORFA 1BTUA 1DS2E 1GBKA 2A0QB 2PGQB 3E0NB 4LZ4B 1S6HA 5EU8A 3RP2A 1LQDB 1DWBH 3UR9A 1EATA 4M7GA 4CR5A 2NWNA 2GGVB 1O2LA 1GCTB 1N8OB 4K1TA 1LO6A 4ABAA 3F9FA 1W0YH 4B76A 3U98H 2UUJB 2XWAA 4FUFA 5JBBS 5CHAC 1QJ7B 5EXNA 4OS2A 1SHYA 5FPTA 2C8ZB 1AUJA 4ZH8A 2ZU1A 2EC9H 8ESTE 1E0FD 1CO7E 2BYAX 1JWTA 4NG9H 1E34B 4UE7H 1BRAA 1OWDA 5FBEA 1EASA 1HJAB 3A8DA 3NWUA 1O2HA 1VJ9U 1ZHPA 1EAUA 1G32B 3ZZ5A 2BDBA 3A87A 2Y7XA 1HAOH 3SGQE 2J34A 2EEKA 2DE8A 3RXRA 1UMAH 1GDUA 1P2MA 2ZHEH 1GI6A 1EX3A 1HPGA 2GDEH 1L0ZA 2BY6X 2GP9B 3ATLA 1GGDC 4K69A 2Z9KA 2QXHA 1GI1A 2OP9A 3BTKE 2G55A 1NU9A 3QZRA 3DUXH 4NIVA 1TIOA 1CA0C 4GVUA 1K1NA 2Z9GA 1K2I1 3SU4A 2RA0A 1ELFA 1ETTH 1CHGA 1PQ5A 2BD3A 4XSKU 1ZHMA 4VGCB 2P8OC 1PQAA 1NU7B 4O9VA 1P11E 3SNEA 1FLEE 2O8WA 2XC4A 1P3CA 2BQ7B 1BJVA 3U9AH 2QXGA 1H1BA 7LPRA 2P93A 3ZVAA 3UWJH 1KLIH 3LOXA 1AE8H 1UHBA 2ZG0H 3F9GA 3ZYEA 1UCYH 3S69A 2GMTB 3T2NA 3S9BA 4ZAEA 1V2VT 4JZFH 2I6SA 4ISIH 1WOFA 1GG6C 1EZUC 3D23A 5LPEA 3KQDA 3SV9A 3PMHB 1GJCB 3QDZB 3SGBE 2FTMA 2NU3E 1E35B 1T4VH 3MH6A 6GCHF 3SV8A 1GHBF 2GDDA 1GHWH 1QB9A 4K5ZA 1XKBC 1SGPE 2FOMB 4HFPB 1C9TA 3K6YA 4ABIA 2RDLA 1N1LA 2AGEX 1CBWB 3A7WA 3B8JA 5F8TA 2ULLA 3URCA 3DT0H 1PFXC 1QTFA 3BG4C 3ZZDA 3L6PA 1CA8B 3RXLA 4BTTB 1P10A 2BOHB 4ZHLU 1F7ZA 1ZLRA 1ESTA 4XBBA 1ZOMA 2Z6BD 4D8NA 2Y80A 1O5EH 3RXIA 1A0JA 3SO3A 3L33A 3GCOA 7GCHF 1LHEH 1V6DA 7GCHG 1HAPH 2AMQA 1EOLA 2PKAA 2C90B 1K9OE 3SV2H 8KME2 3BTME 4XDEA 1WTGH 1XXDA 1OWKA 1DE7H 1K22H 4ZHAA 4ABGA 1IQHA 1A5HA 1BTYA 1GBEA 2WYJA 3P8OA 2UUKB 5K0HA 1LVOA 1MTSA 3AW0A 4K1SA 3A84A 1L1JA 5ESTE 1TE0A 1L2EA 1RGQA 5HM9A 5EXMA 4AFUA 3FFGA 5FCKA 1YKTA 1Q3XA 1DT2A 3JZ1B 4IC6A 3O8CA 1KLJH 3CS7A 3G01A 3F9HA 1SGRE 2BD2A 3GY8A 1FAKH 3VGCC 2AIPA 2ALVA 2P95A 2B0FA 1C1RA 3P92A 2V0BA 1CHOF 1NY22 1CHOG 5EW2H 1B0EA 2ZPSA 3U8RH 3SU3A 2BLWA 2HNTF 2O9QA 3RXEA 5EQRA 1OXGA 3K6ZA 3GY5A 4AG1A 5J4SA 4Y76A 1P03A 2PFEA 2HNTC 5J4QA 3A80A 2Q6FA 3GICB 1KXBA 2K1QA 4FU8A 5FPSA 1FONA 3QTOH 1FY5A 1C1OA 3QN7A 3SORA 3RXAA 5A0CA 2SGAA 2OC8A 3M3TA 2PR3A 2ZQ1A 2GTBA 2J95A 5C3NA 4YTAA 1TRYA 1EZXC 4YLQH 1SC8U 2ZEBA 3ODDA 1YPJH 3V13A 3TU7H 3SN8A 4FUIA 1AHTH 1GBIA 1TRMA 4DOQA 1SOTA 1O3EA 5GDSH 1V2JT 3TK5A 3SUGA 3VEQB 3E8LA 1LDTT 1CT4E 1GDQA 1WUNH 2P3FH 1UJ1A 1W13U 1HAVA 2GCHF 1WTHD 1UTLM 5C2ZA 4AFZA 1QIXB 1SMFE 2AERH 1ELVA 3RXOA 3SI3H 2NU2E 1RXPA 3SNCA 1C1SA 2ASUB 1FXYA 5ESBA 2BD8A 2P59A 3RXCA 4BAMB 3OU0A 3RU4T 1QRZA 1S0QA 4TYDA 1EZSC 1ZTLA 1BRUP 2D26C 5A8ZA 1GI5A 4ABEA 5E8EH 2XXLA 2Y5GA 2FIRH 5T6GA 2QV1A 3PYHA 3TGIE 1SGIB 3A88A 1CGHA 4X1PU 3T25A 3I77A 4FUJA 5AVDA 5HXFA 1TPPA 1TX8A 3T62A 3LC5A 1MCVA 1S81A 1QBOA 3P6ZB 2TGTA 3A7YA 4AFQA 1IQEA 5ABWA 3SU1A 2FOGA 1HRTH 3M35A 2FP7B 2NU1E 1AWHB 1EZQA 1ANDA 3ZZAA 1SSXA 2OINA 1ZTJA 1O2XA 4CRBA 3GCTG 4ZMAH 4XOJA 1C2FA 3BSQA 2F9UA 1J17T 3OTJE 2FX4A 1AIXH 3UTUH 1MBMA 3OX7U 3MMGA 4X6NA 3A85A 1ZJDA 2NU4E 2GD4B 3LGUA 3MYWA 3EDXB 2IPHA 3MH7A 5EW1H 4O97A 1ACBE 1NROH 2C3SA 1MBQA 2WUCA 3MHWU 1O3KA 1FV9A 4AOQA 3SNBA 1QBVH 1P2OA 2G81E 4BAQB 4ESTE 4I8KA 4AZ2B 2QAAA 4CBNA 1BTXA 4LOYH 1W11U 5EPYA 1Z8IB 1T8LA 1QQ4A 1RFNA 3RXBA 2FOFA 2ZKSA 3M36A 1BMMH 1MMJN 4U2WA 2AFQB 1KIGH 3EQ0H 4JYVH 3RDZA 4B1TA 4XBCA 2JH5D 1V2RT 5F03A 2ZHWH 1T4UH 1HXFH 1FIZA 1Z6JH 5I25A 4B2CA 4TWWA 2FO9A 3DFJA 1O2IA 3TK6A 1H9IE 2XBVA 2W3IA 1RIWC 4Q2KA 1QBNA 4X8VH 1GI0A 4CHAC 4FXGH 1GGDB 1YGCH 3M5LA 2WYGA 4RN6A 2P94A 3SU0A 3MI4A 3S9AA 4K1EA 4FUCA 1SGQE 3PLKA 2ODQA 3A83A 4AGKA 1MQ6A 2RG3A 2YNBA 1SFIA 1C1PA 2VH0A 3A89A 4YT7H 1FY1A 3LGYA 3QZQA 3SUEA 5C5NA 1WYKA 2V3OH 1HAIH 1UTOA 3RUOA 4Q7XA 2QF3A 4WY3A 2G5VA 3MTYA 1P06A 1ZGVA 5SGAE 1BB0B 4YZUA 2ZI2H 4OS4A 4NSYA 1C5VA 3UQVA 2FOAA 3JZ2B 5AFYH 1GHYH 1UVSH 3A82A 3RM0H 3RMNH 3T5FH 2VU8E 1S83A 4O3TA 1HXEH 1BRCE 3TGKE 1SGFA 2ANYA 2B5TB 3H7OA 1BZXE 1GBJA 4F4OC 4FU7A 1P02A 4YOJA 2BB4A 1B7XB 1CSOE 1HYLA 2GX4A 3BG4B 4X6OA 1GJAB 2BHGA 2PKSB 1MZAA 1RJXB 1Y8TA 2R0LA 1MD7A 1BIOA 4MNXA 1ZPCA 3U8OH 1VITF 3RXJA 1VITG 3KHVA 1NN6A 1GI7B 1YLCA 3SHCH 1A3BH 1Z7KA 4NFFA 4ISNA 4ISHH 4IBLH 3MNBA 3K65B 3LDXH 3STIA 3P17H 4WH6A 1BDAA 1FIWA 1O30A 1ELBA 3QUMP 1T8NA 1GBLA 3H7TA 4CREA 3KEEA 1N6YA 1IQGA 3STJA 2ZDAH 5HM2A 1W14U 3SGAE 1BHXF 3SJ8A 1HAYB 1MCTA 1SPJA 1KTTB 4MPWA 1C2IA 1YPLH 2KAIB 1J16A 1EPTA 1YPHC 3MNSA 1N6XA 1UVUH 3HKIB 1ZR0A 1UK4A 2W5EA 2FOHA 4NA7A 1UTQA 3BTWE 1LPKB 4GCHF 4GCHG 1Y3XA 2FOEA 3Q76A 2TIOA 2Y82A 3VB5A 1P2NA 1SLVB 2FESH 4IMZA 2A1DB 2FLRH 4GUXA 1H9LB 5DG6A 1XUFA 1IHTH 1ZPBA 2J4IA 1Z8RA 1PPEE 1ANCA 1H4WA 2UUFB 5EOKA 5GCHG 1NPMA 2WUBA 4AG2A 3ATIA 4BAHB 4ZXYH 3TJUA 2FMJA 1RTFB 1UVOA 3U1JB 1EQ9A 4Y8YA 2FOCA 1TWXB 2ALPA 1VJAU 1EAXA 1TQ0B 3BTDE 2ZPQA 4DY7B 1Y59T 4BANB 4I8LA 4UEHH 1DICA 1JXPA 1O3OA 1C1MA 1ZZZA 2RA3A 3MU0A 1FPCH 5C1YA 1BTHH 4CH2B 1Y3WA 1WCZA 2BD7A 2G52A 1A0HB 1ZPZA 1KXAA 3D49H 2ZDLA 3GCHC 4KTCA 1TAWA 1TMUH 5DGJA 1VZQH 3GY6A 1HGTH 4NZQA 3LT3A 1TGNA 4NIXA 2GCTB 3LPRA 1CVWH 3IWMA 1IQMA 4MNWA 4E7NA 1IOEA 1P2IA 1LKAA 3RC5A 1FPHH 1OWIA 4JK5A 2YNAA 2PW8H 3LIWA 1IQFA 1Z71A 3RMOH 1GI3A 2BVXH 4NIWA 4X6PA 2PSXA 4NWLA 1MKWK 1TLDA 4Y11E 1WQSA 1GI2A 4IMQA 1FY3A 1F92A 3E3TA 2OLGA 1QNJA 1HJ8A 1TNIA 1DOJA 5LH8A 2R0KA 1QCPA 2J2UA 3FP8E 5A0AE 1MKXH 1TONA 2ODPA 2AGGX 9ESTA 1SBWA 4O3UA 3PLPA 4I31A 1NT1A 1C2HA 4D7FA 1O31A 5K7RA 5L30H 1RRKA 1XVOA 1T7CA 1ZGIA 3OSYA 1MZDA 1F0RA 1O3LA 1IQNA 2ZPRA 3MU8A 5C20A 5E2PA 1IQJA 3PWBA 1DITH 4TPYA 1S0RA 1O3JA 4JYTA 2CF9H 2G00A 1KXFA 1V2NT 3UPEA 1A0LA 1DXWA 1UO6A 1O3NA 2ZU3A 3P70B 2TRMA 1XX9A 1FAXA 2XBXA 1GWAA 1DANH 3BTTE 1S5SA 1TRNA 1CQQA 2J94A 1MH0A 1XVMA 1XMNB 1C5XB 2ZWLH 3NKKA 2ZTXA 3PTNA 1O2OA 1C5YB 4KELA 1OP0A 1AE5A 1TGCA 1AVGH 1VGCC 3SJOA 4Q7YA 2C8WB 2BOKA 1INCA 3ZZ7A 1VITH 2G5NA 2D8WA 4U30A 1V2TT 2Z9IA 1BBRE 1GHAF 1BT7A 1BQYA 1P8VC 1OWEA 1GHAG 8GCHF 2VIDA 2SNVA 1ELEE 2Y6TA 1NRRH 4A5TS 3AASA 3VFEA 8GCHG 1V2MT 5GPIB 1D6RA 2VVCA 3EYDA 3PMAB 1O2KA 1NM6A 1P12E 4X1RU 6CHAC 3TH2H 4NZLA 3RLYH 1JMOH 1V2ST 1SGTA 2VINA 1D9IA 2GT8A 4NGAH 3PLBA 1QA7A 1FZZA 1X7AC 3SU6A 1RTKA 1SLWB 2WPIS 4K3JA 1QRXA 3ZZCA 2AS9A 1ZRBA 1GJDB 1CGJE 1KXEA 1O3MA 1EB1H 2EI7A 4CHAB 3MFJA 4A7IB 3SI4H 2ZGBH 1MTVA 2G4TA 2ZIQH 2Q1JA 2SGQE 1NZQH 5EG4A 1V2PT 2G51A 3TPIZ 2BY7X 1EJAA 1SOZA 3TH3H 4BTIB 5PTPA 4CRDA 1QFKH 5JBCS 1TMTH 3LU9B 3V3MA 1P2KA 3KIDU 1THRH 6GCHG 1GHBG 2CJIA 1C1VH 1BMNH 2BDCA 2VWMA 5DP7A 1CU1A 4AX9H 1GBMA 4DURA 4B2BA 4MPUA 3KGPA 1ZRKA 3BIUH 1EXFA 1O5BB 5DJ7A 3TNSA 3U69H 2QA9E 2V6NA 2ZECA 1OYQA 1VCWA 3P8GA 3TH4H 2GKVE 2WINI 1A5GH 1SR5C 3R0FA 1K28D 1TALA 4FU9A 1GJ4H 1A3EH 2AMPA 2OQ5A 2ZHDA 5T6DA 3M3SA 1GJ6A 1HAXB 2OQUA 2TGDA 1Z6EA 4TY6A 4A1TA 2ZU4A 3GY2A 1HBTH 3ATKA 4FUBA 1S82A 1Y3YA 2A4OA 3A7XA 1P09A 1S85A 5DP6A 1LHDH 3GY4A 3M3VA 1AWFH 2XTTB 3ZVEA 1GMCF 2G4UA 4Z6AH 2A5KA 1BTWA 1LMWB 4K8BA 1EB2A 4YESB 3VXFH 2WPLS 2ZTYA 3MNCA 4A6LA 3QLPH 2ODYB 4X8TH 4IC5A 1YBWA 2A2XH 1G3EA 1Z8JB 1QB6A 5C5OA 1QRWA 1UTMA 1ZSLA 4OS1A 1EAIA 1SGDE 3ELAH 1HB0B 2VGCC 3BG8A 4D76A 1J8AA 2B7DH 2CF8H 2ZF0H 4MG3A 1DXPA 3RXPA 1PPCE 7KMEH 3A7ZA 1THPB 2O8TA 2QY0B 1MAXA 1H8IH 3PTBA 1AKSB 3UOUA 3EA8A 1HLTH 1L1NA 3A8AA 3AW1A 1E36B 1ESAA 2DUCA 3I29A 2UWOA 1P04A 2BLVA 4INHA 4FVBA 2OBOA 2BQ6B 1FY8E 4ZROA 4AFSA 1BMLA 1F0UA 3HATH 4KP0A 2YOLA 1O2MA 1SI5H 2BD4A 3QO6A 2GV7A 3UIRA 1PJPA 5DP8A 1O0DH 3ZZ4A 1PPZA 1VCQA 4NFEA 4HZHA 2D1JA 4XBDA 1YCPK 1AMHA 1RS0A 4HTCH 2O8UA 3V12A 3SU2A 3BF6H 2Q6DA 1AI8H 1D3QB 3EAJA 5FX5A 4F49A 3FVFB 1TGBA 1XUIA 3LJJA 4WF8A 1YPHE 4BXSA 1NFWA 1GVKB 1GMHF 4JMYA 1GMHG 2FI5E 2H6MA 1C5ZB 1EOJA 4Y8XA 4DW2U 1BTPA 2C93B 2Y5FA 1ZTKA 1AFQC 4I8GA 4TWYA 2D2DA 1ZYOA 1BCUH 5IYTA 3QTVH 3BEIB 3KL6A 3KQCA 3GCHB 1OP8A 1P9SA 4AB8A 2GCHG 2IOTA 1O3GA 4OS5A 1DLKB 4NCYA 3UY9A 1QR3E 1BBRK 1QGFA 1UCYE 3S7KB 4DIIH 3TNTA 5JDUB 4IN1A 3Q00A 1C1TA 2THFB 3RXDA 1J14A 2ZGHA 1H8DH 2A32A 1DSUA 4WMEA 4ABDA 4ZKSU 1YLDA 2FODA 4KTUA 2HWLB 2ZO3H 4X0WU 3ZV9A 1GBCA 3TK9A 1PPBH 4R8TB 1AGJA 1VCPA 4YOIA 3DD2H 1GMDF 2HOBA 4X2VA 1GMDG 2ZGJA 1Y3VA 2PTNA 5ETXA 3QGJA 4NA8A 1O3FA 1UTKA 4X2WA 4NA9H 4PROA 5TCAA 3I78A 1A46H 2ESTE 4ZHMU 1HNEE 4JZ1A 2Q6GA 1PPHE 2OBQA 1AZ8A 3KCGH 1O2ZA 1TBQH 1AB9C 5FXLA 1SL3A 1LPGB 3V7TA 1SLUB 1D3PB 1THSH 2H2ZA 1NFUA 1F5LA 1TPOA 4J2YB 1GCTC 1DSTA 1OOKB 2WPHS 2PV9B 4HI3A 1GI9B 1NS3A 2P3UB 2TPIZ 2ZA5A 1C5LH 1O2RA 4I7YH 1FJSA 3RXHA 2AYWA 4WMDA 4I32A 2BZAA 1BTZA 3GDUA 1O35A 1TPSA 1YF4A 3MU4A 1AFEH 5A09A 5L2ZH 1SB1H 3ZVDA 1GBHA 1JIRA 1G30B 2BX4A 3BEFB 1O5CB 1IHSH 3PO1C 2ZC9H 1SGNE 1MTUA 4H6TA 5CHAB 1ETRH 1GI8B 1TX6A 2IN2A 3KQEA 5I46H 4CH8B 2Z94A 1OKXA 1GJ7B 1KXCA 1O3BA 1G2LA 2C4FH 3HPTB 3ZZ9A 1A7SA 3ATWA 1GPZA 3MNXA 1C5PA 1GBDA 2STBE 1HJAC 2Z3DA 3AVZA 2ZFPH 1FNIA 2ZTZA 2ANKH 3UUZA 1Q31A 3MOCA 1A61H 1GI4A 1GJ9B 1L4DA 3PB1E 1HV7A 1O2WA 1O34A 2GZ8A 4OS6A 4OS7A 2BQWB 3M5NA 2VWOA 1W12U 1P2QA 3LC3A 1C5TA 1LVMA 4RKOB 4MPVA 6CHAB 1ZMLA 1TNKA 2PSYA 3SBKA 1EJMA 1L4ZA 1CA0B 1UVTH 4YT6H 5EGMA 3ZVGA 4VGCC 4Y7BA 2P8OB 2OC7A 3A86A 1YM0A 1QL8A 2CHAC 2BLQA 1DLEA 1SGCA 2A7CA 2EI6A 4ZUHA 1MTWA 5FX6A 4KTSA 1O2UA 1UTJA 3QX5H 3RXVA 3UFAA 1BITA 3BTQE 5C67A 3OY6U 3SJ9A 1BA8B 1GG6B 3RMLH 1T8OA 4I33A 3SJIA 1P9UA 1TB6H 2GVFA 4Y71A 2M5TA 2ZDNA 3FANA 4UD9H 3EA9A 2VNTA 4DGJA 1O2JA 1YPGH 1CBWC 1PQ7A 5FBIA 1ELGA 3PM3A 1M9UA 3BV9B 4ABJA 3B9FH 3K9XB 1SVPA 2CGAA 1JOUB 3BTEE 1NO9H 1ID5H 2CV3A 2VWNA 3ZVBA 5E0GA 3WY8A 1PYTD 2UWLA 2FM2A 4Y0ZE 3SNAA 1DY8A 2BY8X 4B75A 1LVYA 5TCCA 1BUIA 5C1XA 1LVBA 2W26A 2DE9A 1ESBA 2A4GA 4OGXA 2Z7FE 2ZU5A 4I8JA 1UCYK 4MPXA 1TX7A 1MAYA 1IQIA 3S7HB 2WPMS 2VIWA 1GBFA 2KAIA 3QK1A 1ZHRA 4Y8ZA 5FPYA 1V2UT 2H9HA 2HRVA 2BM2A 2SGPE 1W10U 2FXRA 3PMBB 3C1KA 5A8XA 3U1IB 1YC0A 1D3DB 1O2YA 4Z0KA 1GJBB 2R2MB 3PV4A 3TJOA 1ELTA 1DUEA 2ANMH 1ZMNA 3ENSB 3OYPA 3SZNA 4KGAA 2XCFA 3F68H 4BOHA 5GWZA 1GHZA 1TA6A 5FAHA 1EKBB 1SG8B 2H5DA 1T32A 3VGCB 4NSVA 2XNIA 2ZP0H 4K8YA 1TNLA 4MTBA 2W7SA 1CGIE 5CE1A 3EGKH 1SFQB 3VB3A 1F2SE 3TVJB 2J9NA 4MVNA 1B0FA 3ESTA 3KQBA 3LGWA 4DJZB 1LHCH 4O03A 1P3EA 1YPKH 4ISOA 1OWJA 3TJVA 4IGDA 1KDQB 1FN6A 2BTCE 1SLXB 2BDAA 4E06H 1A1RA 4YLUA 1DWDH 1PPFE 1TGSZ 3FZZA 1FI8A 4QT8C 3E16B 2F91A 3MU5A 5DK1A 1PYTC 4B71A 1C5NH 1O33A 4GAWA 1BJUA 4TPIZ 4K60A 4Y7AA 3SUDA 1RD3B 4UDWH 3Q77A 1ANEA 3RXUA 1K1LA 4IN2A 4XFQA 1TYNA 3UQOA 3GYMA 2ZHFH 2HALA 4LXBH 2BY5X 3U8TH 1J9CH 1AFQB 2HPQH 1QQUA 4UFGH 1GCDA 2PGBB 4Y10E 2HNTE 2ZDVH 5H4IB 3EE0B 3FP6E 1OPHB 2BVRH 3LGTA 3RM2H 3SV6A 2F9PA 3RC4A 1NESE 2C8XB 1ANBA 2FI4E 4WMFA 1LQEA 1DY9A 3AAVA 4GSOA 1C1NA 3RU4D 4WVPE 5B6OA 4JCNA 9LPRA 1O3IA 5HGGA 5DP9A 2CN0H 3Q3XA 3O8DA 2R3YA 2F9OA 2A45B 1G3CA 3D65E 4DIHH 1C5QA 1GHVH 2ZQ2A 3ZVCA 3BN9A 3GDSA 3T26A 1BRBE 1K21H 4ZKNU 2TGAA 3SOSA 1QHRB 2LPRA 3MWIU 1ARCA 1NRNH 4JYUH 3NUMA 1PQ8A 1MU6B 3LONA 2Y7ZA 1AB9B 2AGIX 1EAWA
chains in the Genus database with same CATH superfamily
2FOBA 1E38B 1HIAA 1ELCA 4ZKRU 1RTLA 2F9BH 1GL0E 4DCDA 4ABBA 1HIAB 1Y5UT 3MO6A 3P95A 1SGEE 3UR6A 2JKHA 4U32A 4X8UH 4CR9A 3RXTA 2H5CA 4F48B 3RMMH 2XRCA 4JZEH 2G8TA 3BTFE 1OS8A 1TPAE 2F83A 3SUFA 5E0HA 2QYIA 4INKA 4P00A 2O8MA 3T29A 1TABE 1YCPM 2TBSA 3PO1B 3SW2B 2A5AA 2H9TH 1AUTC 1TNGA 2OUAA 2WPJS 2UUYA 1EJNA 3RXSA 1ABIH 3MU1A 5F8ZA 4Y6DA 2P3TB 2BDIA 2VVUA 1C4U2 2W6JD 4ISLA 1Y5AT 1B5GH 4X2YA 3TLOA 1YPMH 5BRRE 3UOPA 1FQ3A 5TJXA 1W8BH 2JH0D 1K1OA 2BMGB 1LHFH 3URDA 3GYLB 1MTNC 1F0SA 1ELAA 3BTHE 1RIWB 4FVDA 4CRGA 3CENA 3VG8A 5AFZH 2FWWA 2BY9X 3LH1A 1WXRA 3MH5A 2AHME 2XC5A 1PPGE 5EJ1A 1WQVH 3SV7A 4BXWA 2QF0A 5EODA 4CRCA 5JBTA 1COWD 1DWCH 2ZDKA 2ZCHP 2JJ1D 2PUXB 3LH3A 5JYIA 3ATMA 4H4FA 2JIZD 4X6MA 3TITA 2ZDMA 5C94A 2W3KA 1DVAH 1GBAA 5AHGH 1AO5A 5A8YA 1O5DH 1S6FA 2A2QH 2ANWA 4K2YA 2HVXA 2CHAB 4D7GA 2ZGXH 3ZZ6A 1C1WH 1LKBA 2B9LA 1OX1A 1Q2WA 1TFXA 2QIQA 2V7QD 1TA2A 3NXPA 2AH4X 1UHBB 6ESTA 1KTSB 1O39A 5EPNA 5L2YH 1L1GA 1C2KA 2OC0A 5C0TA 4YO9A 1CT0E 1SGFG 1QJ6B 1SQTA 4IW4E 3SQHE 1MU8B 3SJKA 5EXLA 3GOVB 1AQ7A 2F9NA 3E0PB 4BAKB 2FYQA 2FI3E 2PUQH 4J1YA 3O8BA 2HPPH 2PHBA 5GIBA 4AGJA 2FZZA 2W7UA 5DP3A 2Z9LA 1O36A 2FEQH 4GPGA 1C5MD 3GY7A 3A7TA 2ILNA 1O2GH 4B74A 1GVZA 2PKSC 1NBMD 1GMCG 4BAOB 4FUDA 1O3AA 3VB6A 3L3TA 4OS6A 3QGNB 1D6WA 1J15A 1G36A 3ITIA 3BEUA 3A8CA 1TOCB 3NPSA 3ZZ8A 2AIQA 2ZCLP 1JRSA 1O37A 5C0UA 2TGPZ 3VXEH 1C2JA 1O2NA 1OSSA 4HG6A 2PKAB 2QN5T 1QY6A 4IS5A 5DP4A 3TJNA 4HGCA 4JK6A 1UTPA 3QWCH 1YYY1 4DT7B 4D9RA 1YP9A 1GVLA 1O2SA 2JDID 1AKSA 5EQQA 4TSFD 1C5WB 2BDHA 1ARBA 3HGNA 2ZFTA 1W3CA 5DSFA 2BXUH 1EPTC 2XWBI 1BHXB 5JBAS 3FZDA 5GXPA 5IDKA 1C2EA 2A7HA 5JPMH 2OTVA 2ZFRH 5LGOA 1P0SH 2PTCE 1P2JA 2R9PA 4Q4LA 2BD5A 1NRPH 5FHTA 4DT4A 1DDJA 2SGDE 3R3GB 2ZGCA 2VIVA 1EP6A 1MKWH 2LNCA 2ZFSA 1ZMJA 2UWPA 3W94A 3MH4A 3ZVFA 2ZFQH 1XXFA 4H42U 5CMXH 2FTLE 2ZNKH 3A8BA 3ZV8A 1IQKA 1O3PB 3W95A 2IJOB 3KN2A 4WH8A 2VIQA 4FUGA 4SGAE 1NC6A 2H1UA 2CXVA 3F2HA 2BD9A 1K1JA 2OD3B 4OGYA 5G4BA 3V0XA 3GISB 1HCGA 1O3CA 3IG6B 2FX6A 1Y5BT 3CS0A 5EQSA 2SNWA 4RSPA 3VB7A 2QXJA 1WU1A 2VWLA 3SU5A 5LPRA 1HUTH 1HAGE 1OYTH 1P01A 3RXFA 3PROA 3N99A 1FUJA 5T6FA 1WSSH 5DP5A 2GCTC 3ZZBA 3HK6B 1SGYE 1AVWA 3W1EA 3O8RA 3RC6A 3HK3B 2YMSB 1K1PA 2F4LA 1XUHA 1FN8A 1C2DA 1W7GH 1U6QA 4XD7D 2AEIH 3N7DA 1KSNA 3C27B 1K1MA 4R0IA 1CT2E 2FDAA 2BXTH 3LGIA 1HAVB 3VB4A 2BDGA 1JBUH 1OWHA 1G9IE 1F5RA 4ABHA 1QL9A 3M61U 3E1XB 1E79D 1GJ8B 4A1VA 3CNRA 3UREA 3IITA 2WV4A 2VIOA 2JETC 1DFPA 1XKAC 1LTOA 3M7TA 3A7VA 3FAOA 1AU8A 1VR1H 3ZYDA 8LPRA 1V2OT 2B8OH 1C2LA 1MUEB 2HGTH 1DWEH 3E91A 2FLBH 2A5IA 4DG4A 1SQOA 1AZZA 3M37A 2CMYA 2A4QA 3ODFA 2XCNA 2EA3A 4A1XA 4ZKOU 4UFEH 1N8OC 2XBWA 1K1IA 2A7JA 3TIUA 4MQAA 1FDPA 5EJZA 2GZ7A 1C2GA 1EP5A 1AY6H 4GLYA 1QURH 3S9CA 2QCYA 3SNDA 5DKMA 4WJG2 3H5CB 4INLA 2F9VA 4D9QA 2F3CE 1KYNA 4THNH 3LKWA 1V2QT 4U01A 3UNRA 3GCTF 2Z3CA 5JB8S 5LPFA 5F6MA 4LK4A 1A4WH 2K0QA 2A4RA 1WV7H 1QJ1B 1DPOA 2SGFE 5AF9H 1FY4A 1VGCB 1LCYA 1XUJA 1Y3UA 2ZFFH 1O3HA 4Q80A 4UFDH 4I8HA 5DO4H 4ZCNA 4E7RG 1TNHA 2SGEE 1MKXK 1KXDA 1BOQA 4MNYA 1G3BA 3D62A 1ETSH 1P05A 2VH6A 2J98A 2P16A 1ABJH 1C5SA 1LPZB 2BVSH 1UTNA 2QC2A 4MLFB 1JIMA 4CRAA 5JB9S 5F8XA 4UONA 2O8LA 4DVAU 1C1QA 4CBOA 2OC1A 2IPQX 1UK2A 3RXQA 2R3UA 3UNSA 2BLOA 3E90B 1HJ9A 1C5UA 2H9EH 3GCNA 1F5KU 1XUKA 3RXKA 1O2VA 1HAHH 2FS8A 3K2UA 2KR7A 4X1SU 5CHBA 5A2MH 5T1VA 3FP7E 1MTNB 5KEDA 3M5MA 2BZ6H 1ZSKA 3CP7A 3DCLA 1QA0A 2PWXA 3DSPA 1O5GH 1O3DA 4AORA 2J38A 2GMTC 3KF2A 4GHQA 4X1NU 1V2WT 2V35A 3OEED 1HAZB 2JH6D 1EUFA 3Q3YA 3BTGE 1DUAA 1NRQH 4SGBE 7ESTE 4WXVA 2WV5A 1GL1A 1D3TB 3SQEE 3RU4E 3BIVH 1DX5M 4UFFH 1GBTA 1MQ5A 3VPKA 2ZHQH 4YM9A 5HYOA 2QGRA 2GV6A 3NZIA 1XUGA 4JZDH 1C4Y2 2NU0E 4F55A 4A92A 4AB9A 3OFND 2I6QA 3LGVA 4NWKA 1TBRH 5L6NH 3E6PH 1GHXH 4NIYA 3OY5U 4YOGA 5E0JA 1O38A 1E1QD 6LPRA 4AN7A 1C5RA 2VJ1A 4ASHA 3EA7A 2BDYA 3MO9A 1QZ8A 1GBBA 1O5FH 1O2TA 2FS9A 1QB1A 4X2XA 4B2AA 4E05H 3PRBA 1T31A 1TGTA 1WAYB 1H9HE 4WXIA 1W7XH 1AD8H 1XM1A 4AYYB 1SQAA 3T27A 1IAUA 1GJ5H 3UAIC 3GS9A 4ZXXH 1ZSJA 1G2MA 1YCPH 5E2OA 2J92A 4GHTA 4RKJB 2VIPA 3LJOA 1C2MA 3WW7A 1V2KT 1UVPA 4WWYA 3F1SB 1TBZH 2Y5HA 1O32A 1C5OH 3A81A 4LZ1H 1NFXA 1DM4B 3DA9B 2GZ9A 4FUEA 1IQLA 2VGCB 1MD8A 2SFAA 3AAUA 1ZJKA 1O2QA 2XYAA 2QXIA 1T8MA 3T28A 2XC0A 4B73A 4BTUB 1Z1IA 1AN1E 1E37B 1BBRH 1EPTB 1UK3A 4AYVB 2Y81A 1CE5A 2PLXA 3FN8A 1BMAA 2FPZA 3DFLA 2OXSA 2WPKS 5C1UA 1KY9A 1D4PB 3SHAH 1BMFD 1KLTA 1KDQA 1O2PA 1SHHB 3TGJE 1FMGA 2XBYA 3NK8A 1G3DA 2AMDA 4CRFA 2VVVA 3N7OA 1K0HA 2VB0A 5GCHF 3RXMA 3ZZ3A 2STAE 3UNQA 3KNXA 3Q3KA 1YPEH 1GDNA 4H6SB 1HDTH 2ZU2A 2OCVB 1HFDA 1NTPA 1A5IA 1V3XA 4M9FA 4Q7ZA 2Z9JA 4MNVA 2QF4A 1Z8GA 1S84A 1QL7A 1P57B 1W0ZU 5A0BA 3PMJA 3B23B 4FUHA 4ABFA 3PWCA 3RXGA 1NRSH 1LHGH 3P8NA 2XW9A 4TY7A 3F6UH 5FCRA 1AVXA 5GJ4B 2BX3A 1TMBH 3HKJB 4XE4A 2ZZUH 5T3HA 5DPAA 1C1UH 1JRTA 5HMAA 3GDVA 1Z1JA 4BNRA 4X8SH 1C9PA 1F0TA 1TQ7B 2A31A 3UWIA 3GY3A 2V3HH 2R2WU 1A2CH 3NCLA 2C8YB 1O5AB 2RCEA 2EI8A 1C4V2 3M7UA 1NFYA 4Y79A 1G37A 1NBME 1W2KH 3DHKH 3MO3A 2ZCKP 5BPEA 3S0NA 2HLCA 1OP2A 1TNJA 2FYRA 2Z3EA 3RLWH 1TOMH 3NRLA 4MDSA 2KX4A 4JZIA 1ELDE 3P8FA 2GT7A 2JETB 1WBGB 3F9EA 3M7QA 1V2LT 4KKDA 2WZQA 4Y0YE 3M5OA 3F3BA 4X1QU 3HGPA 1ORFA 1BTUA 1DS2E 1GBKA 2A0QB 2PGQB 3E0NB 4LZ4B 1S6HA 5EU8A 3RP2A 1LQDB 1DWBH 3UR9A 1EATA 4M7GA 4AC9A 4CR5A 2NWNA 2GGVB 1O2LA 1GCTB 1N8OB 4K1TA 1LO6A 4ABAA 3F9FA 1W0YH 4B76A 3U98H 2UUJB 2XWAA 4FUFA 5JBBS 5CHAC 1QJ7B 5EXNA 4OS2A 1SHYA 5FPTA 2C8ZB 1AUJA 1VKYA 4ZH8A 2ZU1A 2EC9H 8ESTE 1E0FD 1CO7E 2BYAX 1JWTA 4NG9H 1E34B 4UE7H 1BRAA 1OWDA 2WV9A 5FBEA 1EASA 1HJAB 3A8DA 5F53A 3NWUA 1O2HA 1VJ9U 1ZHPA 3AK5A 1EAUA 1MABB 1G32B 3ZZ5A 2BDBA 3A87A 2Y7XA 1HAOH 3SGQE 2J34A 2EEKA 2DE8A 3RXRA 1UMAH 1GDUA 1P2MA 2PP6A 2ZHEH 1GI6A 1EX3A 1HPGA 2GDEH 1L0ZA 2BY6X 2GP9B 3ATLA 1GGDC 4K69A 2M2AA 2Z9KA 2QXHA 1GI1A 2OP9A 3BTKE 2G55A 1NU9A 3QZRA 3DUXH 4NIVA 1W0KD 1TIOA 1CA0C 4GVUA 1K1NA 2Z9GA 1K2I1 3SU4A 2RA0A 1ELFA 2BD3A 1ETTH 1CHGA 1PQ5A 1YWUA 3F2GA 4XSKU 1ZHMA 4VGCB 2P8OC 1PQAA 1NU7B 4O9VA 1P11E 3SNEA 1FLEE 2O8WA 2XC4A 1P3CA 2BQ7B 1BJVA 3U9AH 2QXGA 1H1BA 7LPRA 2P93A 3ZVAA 3UWJH 1KLIH 3LOXA 1AE8H 1UHBA 2ZG0H 3F9GA 3ZYEA 1UCYH 3S69A 2GMTB 3T2NA 3S9BA 4ZAEA 1V2VT 4JZFH 2I6SA 4ISIH 1WOFA 1GG6C 1EZUC 3D23A 5LPEA 3KQDA 3SV9A 3PMHB 1GJCB 3QDZB 3SGBE 2FTMA 2NU3E 1E35B 1T4VH 3MH6A 6GCHF 3SV8A 1GHBF 2GDDA 1GHWH 1QB9A 4K5ZA 1XKBC 1SGPE 2FOMB 4HFPB 1C9TA 3K6YA 4ABIA 2RDLA 1N1LA 2AGEX 1CBWB 3A7WA 3B8JA 5F8TA 2ULLA 3URCA 3DT0H 1PFXC 1QTFA 3BG4C 3ZZDA 3L6PA 1CA8B 3RXLA 4BTTB 2RFKC 2WSSD 1P10A 2BOHB 4ZHLU 1F7ZA 1ZLRA 1ESTA 2K8IA 4XBBA 1ZOMA 2Z6BD 4D8NA 2Y80A 2KCYA 1O5EH 3RXIA 1A0JA 3SO3A 3L33A 3GCOA 7GCHF 1LHEH 1OHHD 1V6DA 7GCHG 1HAPH 2AMQA 1EOLA 2PKAA 2C90B 1K9OE 3SV2H 8KME2 3BTME 4XDEA 1WTGH 1XXDA 3FO8D 1OWKA 1DE7H 1K22H 4ZHAA 4ABGA 1IQHA 1A5HA 1BTYA 1GBEA 2WYJA 3P8OA 2UUKB 5K0HA 1LVOA 1MTSA 3AW0A 4K1SA 3A84A 1L1JA 5ESTE 1TE0A 1L2EA 1RGQA 5HM9A 5EXMA 4AFUA 3FFGA 5FCKA 1YKTA 1Q3XA 1DT2A 3JZ1B 4IC6A 3O8CA 1KLJH 3CS7A 3G01A 3F9HA 1SGRE 2BD2A 3GY8A 3SZEA 1FAKH 3VGCC 2AIPA 2ALVA 2P95A 2B0FA 1C1RA 3P92A 2V0BA 1CHOF 1NY22 3F0OA 1CHOG 5EW2H 1B0EA 2ZPSA 3U8RH 3SU3A 2BLWA 2HNTF 2O9QA 3FOAA 3RXEA 5EQRA 1OXGA 3K6ZA 3GY5A 4AG1A 4RT1A 5J4SA 4Y76A 1P03A 2PFEA 2HNTC 5J4QA 3A80A 2Q6FA 3GICB 1KXBA 2K1QA 4FU8A 5FPSA 1FONA 3QTOH 1FY5A 1C1OA 3QN7A 3SORA 3RXAA 5A0CA 2SGAA 2OC8A 3WWFA 2CK3D 3M3TA 2PR3A 2ZQ1A 2GTBA 2J95A 5HIZA 5C3NA 4YTAA 1TRYA 1EZXC 4YLQH 1SC8U 2ZEBA 3ODDA 1YPJH 3V13A 3TU7H 3SN8A 4FUIA 1AHTH 1GBIA 1TRMA 4DOQA 1SOTA 2LELA 1O3EA 5GDSH 1V2JT 3TK5A 3SUGA 3VEQB 3E8LA 1LDTT 1CT4E 1GDQA 1WUNH 2P3FH 2F43B 1UJ1A 1W13U 1HAVA 2GCHF 1WTHD 1UTLM 5C2ZA 4AFZA 1QIXB 1SMFE 2AERH 1ELVA 3RXOA 3SI3H 2NU2E 1RXPA 3SNCA 1C1SA 2ASUB 1FXYA 5ESBA 2BD8A 2P59A 3RXCA 4BAMB 3OU0A 3RU4T 1QRZA 1S0QA 4TYDA 1EZSC 1ZTLA 1BRUP 2D26C 5A8ZA 1GI5A 4ABEA 5E8EH 2XXLA 2Y5GA 2FIRH 5T6GA 2QV1A 3PYHA 3TGIE 1SGIB 3A88A 1CGHA 4X1PU 3T25A 3I77A 4FUJA 5AVDA 3DSGA 5HXFA 1TPPA 1TX8A 3T62A 2V3MA 3LC5A 1MCVA 1S81A 1QBOA 3P6ZB 2TGTA 3A7YA 4AFQA 1IQEA 5ABWA 3SU1A 2FOGA 1HRTH 3M35A 2FP7B 4Z1MD 2NU1E 1AWHB 1EZQA 2EY4C 1ANDA 3ZZAA 1SSXA 1UW7A 2OINA 1ZTJA 1O2XA 4CRBA 3GCTG 4ZMAH 4XOJA 1C2FA 3BSQA 4I86A 2F9UA 1J17T 2HVYB 3OTJE 2FX4A 1AIXH 3UTUH 1MBMA 3OX7U 3MMGA 4X6NA 3A85A 1ZJDA 2NU4E 2GD4B 3LGUA 3MYWA 3EDXB 4OM9A 2IPHA 3MH7A 5EW1H 4O97A 1ACBE 1NROH 2C3SA 1MBQA 2WUCA 3MHWU 1O3KA 1FV9A 4AOQA 3SNBA 1QBVH 1P2OA 2G81E 4BAQB 4ESTE 4I8KA 4AZ2B 2QAAA 4CBNA 1BTXA 4LOYH 1W11U 5EPYA 1Z8IB 1T8LA 1QQ4A 1RFNA 3RXBA 2FOFA 2ZKSA 3M36A 1BMMH 1MMJN 4U2WA 2AFQB 1KIGH 3EQ0H 4JYVH 3RDZA 3PV2A 4B1TA 4XBCA 2JH5D 3EE7A 1V2RT 5F03A 2ZHWH 4YXWD 1T4UH 1HXFH 1FIZA 1Z6JH 5I25A 4B2CA 4TWWA 2FO9A 3DFJA 1O2IA 3TK6A 1H9IE 2XBVA 2W3IA 1RIWC 4Q2KA 1QBNA 4X8VH 1GI0A 4CHAC 4FXGH 1GGDB 1YGCH 2WHXA 3M5LA 3OE7D 2WYGA 4RN6A 2P94A 3SU0A 3MI4A 3S9AA 4K1EA 4FUCA 1SGQE 3MQKC 3PLKA 2ODQA 3A83A 3KYGA 4AGKA 1MQ6A 2RG3A 2YNBA 1SFIA 1C1PA 2VH0A 3A89A 4YT7H 1FY1A 3LGYA 3QZQA 3SUEA 5C5NA 1WYKA 2V3OH 1HAIH 1UTOA 3RUOA 4Q7XA 2QF3A 4WY3A 2G5VA 3MTYA 1P06A 1ZGVA 5SGAE 1BB0B 3OEHD 4YZUA 2ZI2H 4OS4A 4NSYA 1C5VA 3UQVA 2FOAA 3JZ2B 5AFYH 1GHYH 1UVSH 3A82A 2WPDD 3RM0H 3RMNH 3T5FH 2VU8E 1S83A 4O3TA 1HXEH 1BRCE 3TGKE 1SGFA 2ANYA 2B5TB 3H7OA 1BZXE 1GBJA 4F4OC 4FU7A 1P02A 4YOJA 2BB4A 1B7XB 1CSOE 1HYLA 2GX4A 3BG4B 4X6OA 1GJAB 2BHGA 2PKSB 1MZAA 1RJXB 1Y8TA 2R0LA 1MD7A 1BIOA 4MNXA 1ZPCA 3U8OH 1VITF 3RXJA 1VITG 3KHVA 1NN6A 1GI7B 1YLCA 3SHCH 1A3BH 1Z7KA 4NFFA 4ISNA 4ISHH 4IBLH 3MNBA 3K65B 3LDXH 3STIA 3P17H 4WH6A 1BDAA 1FIWA 1O30A 1ELBA 3QUMP 1T8NA 1GBLA 3H7TA 4CREA 3KEEA 1N6YA 1IQGA 4TT3D 2ZDAH 3STJA 5HM2A 1W14U 3SGAE 1BHXF 3SJ8A 1HAYB 1MCTA 1SPJA 1KTTB 4MPWA 1C2IA 1YPLH 2KAIB 1J16A 1EPTA 1YPHC 3MNSA 1N6XA 1UVUH 3HKIB 1ZR0A 1UK4A 2W5EA 2EQNA 2FOHA 4NA7A 1UTQA 3BTWE 1LPKB 4GCHF 4GCHG 1Y3XA 2FOEA 3Q76A 2TIOA 2Y82A 3VB5A 1P2NA 1SLVB 2FESH 4IMZA 2A1DB 4B6FA 2FLRH 4GUXA 1H9LB 5DG6A 1XUFA 1IHTH 1ZPBA 2J4IA 1Z8RA 1PPEE 1ANCA 1H4WA 2UUFB 5EOKA 5GCHG 1NPMA 2WUBA 4AG2A 3ATIA 4BAHB 4ZXYH 3TJUA 2FMJA 1RTFB 5DN6D 2J5UA 1UVOA 3U1JB 1EQ9A 4Y8YA 2FOCA 1TWXB 2ALPA 1VJAU 4P02A 1EAXA 1TQ0B 3BTDE 3F2FA 2ZPQA 4DY7B 1Y59T 4BANB 4I8LA 4UEHH 1DICA 1JXPA 1O3OA 1C1MA 1ZZZA 2RA3A 3MU0A 1FPCH 5C1YA 1BTHH 4CH2B 1Y3WA 1WCZA 2BD7A 2G52A 1A0HB 1YY3A 1KXAA 1ZPZA 3D49H 2ZDLA 3GCHC 5C17A 4KTCA 1TAWA 1TMUH 5DGJA 1VZQH 3GY6A 1HGTH 4NZQA 3LT3A 1TGNA 4NIXA 2GCTB 3LPRA 1CVWH 3IWMA 1IQMA 4MNWA 4E7NA 1IOEA 1P2IA 1LKAA 3N7EA 3RC5A 1FPHH 1OWIA 4JK5A 4RT0A 2YNAA 3WWBA 2PW8H 1H8ED 3LIWA 1IQFA 1Z71A 3RMOH 1GI3A 2BVXH 4NIWA 4X6PA 2PSXA 4NWLA 1MKWK 1TLDA 2W6ID 4Y11E 1WQSA 3U28C 1GI2A 4IMQA 1FY3A 1F92A 3E3TA 2JJ2D 2OLGA 1QNJA 1HJ8A 1TNIA 1DOJA 5LH8A 2R0KA 1QCPA 2J2UA 3FP8E 5A0AE 1MKXH 1TONA 2ODPA 2AGGX 9ESTA 1SBWA 4O3UA 3PLPA 4I31A 1NT1A 1C2HA 4D7FA 1O31A 5K7RA 5L30H 1RRKA 1XVOA 2L6OA 1T7CA 1ZGIA 3OSYA 1MZDA 1F0RA 1O3LA 1IQNA 2VBCA 2ZPRA 3MU8A 5C20A 5E2PA 1IQJA 3PWBA 1DITH 4TPYA 1S0RA 1O3JA 4JYTA 2CF9H 2G00A 1KXFA 1V2NT 3UPEA 1A0LA 1DXWA 1UO6A 2HLDD 1O3NA 2ZU3A 3P70B 4FOUC 2TRMA 1XX9A 1FAXA 2XBXA 1GWAA 1DANH 5HKKD 3BTTE 1S5SA 1TRNA 1CQQA 2J94A 1MH0A 1XVMA 1XMNB 1C5XB 2ZWLH 3NKKA 2ZTXA 3PTNA 1O2OA 1C5YB 4KELA 1OP0A 1AE5A 1TGCA 1AVGH 1VGCC 3SJOA 4Q7YA 2C8WB 2BOKA 1INCA 3ZZ7A 1VITH 2G5NA 2D8WA 4U30A 1V2TT 2Z9IA 1BBRE 1GHAF 1BT7A 1BQYA 1P8VC 1OWEA 1GHAG 8GCHF 2VIDA 2SNVA 1ELEE 2Y6TA 1NRRH 4A5TS 3AASA 3VFEA 8GCHG 1V2MT 5GPIB 1D6RA 2VVCA 2KFWA 3EYDA 3PMAB 1O2KA 1NM6A 1P12E 4X1RU 6CHAC 3TH2H 4NZLA 3RLYH 1JMOH 1V2ST 1SGTA 2VINA 1D9IA 2GT8A 4NGAH 2L74A 3PLBA 1QA7A 1FZZA 1X7AC 3H09A 3SU6A 1RTKA 1SLWB 2WPIS 4K3JA 1QRXA 2KCAA 2AS9A 3ZZCA 1ZRBA 1GJDB 1CGJE 1KXEA 1O3MA 1EB1H 2EI7A 4CHAB 3MFJA 4A7IB 2KZ4A 3SI4H 2ZGBH 1MTVA 2G4TA 2ZIQH 2Q1JA 2SGQE 1NZQH 5EG4A 1V2PT 2G51A 3TPIZ 2BY7X 1EJAA 1SOZA 4ACBA 3TH3H 4BTIB 5PTPA 4CRDA 1QFKH 5JBCS 1TMTH 3LU9B 3V3MA 1P2KA 3KIDU 1THRH 6GCHG 1GHBG 2CJIA 1C1VH 1BMNH 2BDCA 2VWMA 5DP7A 1CU1A 4AX9H 1GBMA 4DURA 4B2BA 4MPUA 3KGPA 1ZRKA 3BIUH 1EXFA 1O5BB 5DJ7A 3TNSA 3U69H 2QA9E 2V6NA 2ZECA 1OYQA 1VCWA 3P8GA 3TH4H 2GKVE 2WINI 1A5GH 2QF5A 1SR5C 3R0FA 1K28D 1TALA 4FU9A 1GJ4H 1A3EH 2AMPA 2OQ5A 2ZHDA 5FL7D 5T6DA 3M3SA 1GJ6A 1HAXB 2OQUA 2TGDA 1Z6EA 4TY6A 4A1TA 2ZU4A 3GY2A 1HBTH 3ATKA 4FUBA 1S82A 2XNDD 1Y3YA 2A4OA 3A7XA 1P09A 1S85A 5DP6A 1LHDH 3GY4A 3M3VA 1AWFH 2XTTB 3ZVEA 1GMCF 2G4UA 4Z6AH 2A5KA 1BTWA 1LMWB 4K8BA 1EB2A 4YESB 3VXFH 2WPLS 5B6LA 2ZTYA 3MNCA 4A6LA 3QLPH 2ODYB 3KYFA 4X8TH 4IC5A 2QE7D 1YBWA 2A2XH 1G3EA 1Z8JB 1QB6A 5C5OA 1QRWA 1UTMA 2XOKD 1ZSLA 4Q63A 4OS1A 1EAIA 1SGDE 3ELAH 1HB0B 2VGCC 3BG8A 4D76A 1J8AA 2B7DH 2CF8H 2ZF0H 4MG3A 1DXPA 3RXPA 1PPCE 7KMEH 3A7ZA 1KMHB 1THPB 2O8TA 2QY0B 4B6EA 1MAXA 1H8IH 3PTBA 1AKSB 3UOUA 3EA8A 1HLTH 1L1NA 3A8AA 3AW1A 1E36B 1ESAA 2DUCA 3I29A 2UWOA 1P04A 2BLVA 4INHA 4FVBA 2OBOA 2BQ6B 1FY8E 4ZROA 4AFSA 1BMLA 1F0UA 3HATH 4KP0A 2YOLA 1O2MA 1SI5H 2BD4A 1EFRD 3QO6A 2GV7A 3UIRA 1PJPA 5DP8A 1O0DH 3ZZ4A 1PPZA 1VCQA 4NFEA 4FETA 4HZHA 2D1JA 4XBDA 1YCPK 1AMHA 1RS0A 4HTCH 2O8UA 3V12A 3SU2A 3BF6H 2Q6DA 3FKSD 1AI8H 1D3QB 3EAJA 5FX5A 4F49A 3FVFB 1TGBA 1XUIA 3LJJA 4WF8A 1YPHE 4BXSA 1NFWA 1GVKB 1GMHF 4JMYA 1GMHG 2FI5E 2H6MA 1C5ZB 1EOJA 4Y8XA 4DW2U 1BTPA 2C93B 2Y5FA 2J97A 1ZTKA 1AFQC 4I8GA 4TWYA 2D2DA 1ZYOA 1BCUH 5IYTA 3QTVH 3BEIB 3KL6A 3KQCA 1W0JD 3GCHB 1OP8A 1P9SA 4AB8A 2GCHG 2IOTA 1O3GA 4OS5A 1DLKB 4NCYA 3UY9A 1QR3E 1BBRK 1QGFA 1UCYE 3S7KB 4DIIH 3TNTA 5JDUB 4IN1A 3Q00A 1C1TA 2THFB 3RXDA 1J14A 2ZGHA 1H8DH 2A32A 1DSUA 4WMEA 4ABDA 4ZKSU 1YLDA 2FODA 4KTUA 2HWLB 2ZO3H 4X0WU 3ZV9A 1GBCA 5IK2D 3TK9A 1PPBH 4R8TB 1AGJA 1VCPA 4YOIA 3DD2H 1GMDF 2HOBA 4X2VA 1GMDG 2ZGJA 1Y3VA 2PTNA 5ETXA 3QGJA 3SYJA 4NA8A 1O3FA 1UTKA 4X2WA 4NA9H 4PROA 5TCAA 3I78A 1A46H 2ESTE 4ZHMU 1HNEE 4JZ1A 2Q6GA 1PPHE 2OBQA 1AZ8A 3KCGH 1O2ZA 1TBQH 1AB9C 5FXLA 1SL3A 1LPGB 3V7TA 1SLUB 1D3PB 1THSH 2H2ZA 1NFUA 1F5LA 1TPOA 4J2YB 1GCTC 1DSTA 1OOKB 2WPHS 2PV9B 4HI3A 1GI9B 1NS3A 2P3UB 2TPIZ 2ZA5A 1C5LH 1O2RA 4I7YH 1FJSA 3RXHA 2AYWA 4WMDA 4I32A 4RI0A 2BZAA 1BTZA 3GDUA 1O35A 1TPSA 1YF4A 3MU4A 1AFEH 5A09A 5L2ZH 1SB1H 3ZVDA 1GBHA 1JIRA 3PRDA 1G30B 2BX4A 3BEFB 1O5CB 1IHSH 3PO1C 2ZC9H 1SGNE 1MTUA 4H6TA 5CHAB 1ETRH 1GI8B 1TX6A 2IN2A 3KQEA 5I46H 4CH8B 2Z94A 1OKXA 1GJ7B 1KXCA 1O3BA 1G2LA 2C4FH 3HPTB 3ZZ9A 1A7SA 3ATWA 1GPZA 4ASUD 3MNXA 1C5PA 1GBDA 2STBE 1HJAC 2Z3DA 3AVZA 2ZFPH 4XRNA 1FNIA 2ZTZA 2ANKH 3UUZA 1Q31A 3MOCA 1A61H 2KCPA 1GI4A 1GJ9B 1L4DA 2J98B 1HV7A 1O2WA 1O34A 2GZ8A 2RDEA 3PB1E 1S6LA 4OS7A 1SKYE 2BQWB 2OK5A 5EIYA 3M5NA 2VWOA 1W12U 1P2QA 3OAAD 3LC3A 1C5TA 1LVMA 4RKOB 4MPVA 3UB0A 6CHAB 1ZMLA 1TNKA 2PSYA 3SBKA 1EJMA 1L4ZA 1CA0B 1UVTH 4YT6H 5EGMA 3ZVGA 4VGCC 4Y7BA 2P8OB 3DSOA 2OC7A 3A86A 1YM0A 1QL8A 2CHAC 2BLQA 1DLEA 1SGCA 2A7CA 2EI6A 4ZUHA 1MTWA 5FX6A 4KTSA 1O2UA 1SQRA 5CDFE 1UTJA 3QX5H 3RXVA 3UFAA 2KCOA 1BITA 3BTQE 5C67A 3OY6U 3SJ9A 1BA8B 1GG6B 3RMLH 1T8OA 4I33A 3SJIA 1P9UA 1TB6H 2GVFA 4Y71A 2M5TA 2ZDNA 3FANA 4UD9H 3EA9A 2VNTA 2GJGA 1YLNA 4DGJA 1O2JA 5KGOA 1YPGH 1CBWC 1PQ7A 3KQ5A 5FBIA 1ELGA 3PM3A 1M9UA 3BV9B 4ABJA 3B9FH 3K9XB 2KM0A 4ACAA 1E1RD 1SVPA 2CGAA 1JOUB 3BTEE 1NO9H 1ID5H 2CV3A 2VWNA 3ZVBA 5E0GA 3WY8A 1PYTD 2UWLA 5GNDA 2FM2A 4Y0ZE 3SNAA 1DY8A 2BY8X 4B75A 1LVYA 5TCCA 1BUIA 5C1XA 1LVBA 2W26A 2DE9A 1ESBA 2A4GA 2YMSD 4OGXA 2Z7FE 2ZU5A 4I8JA 1UCYK 4MPXA 1TX7A 1MAYA 1IQIA 3S7HB 2WPMS 2VIWA 1GBFA 2KAIA 3QK1A 1ZHRA 3ZIAD 4Y8ZA 5FPYA 1V2UT 2H9HA 2HRVA 2BM2A 2SGPE 1W10U 2FXRA 3PMBB 3C1KA 1H8HD 5A8XA 3U1IB 1YC0A 1D3DB 1O2YA 4Z0KA 1GJBB 2R2MB 3PV4A 3TJOA 1ELTA 1DUEA 2ANMH 1ZMNA 3ENSB 3OYPA 3SZNA 4KGAA 2XCFA 3F68H 4BOHA 5GWZA 1GHZA 1TA6A 5FAHA 5EJLA 1EKBB 1SG8B 2H5DA 1T32A 3OTPA 3VGCB 4NSVA 2XNIA 2ZP0H 4K8YA 1TNLA 4MTBA 2W7SA 1CGIE 5CE1A 3EGKH 1SFQB 3VB3A 1F2SE 3TVJB 2J9NA 4MVNA 1B0FA 3ESTA 3PV5A 3KQBA 3LGWA 4DJZB 1LHCH 4O03A 1P3EA 1YPKH 3F0PA 4ISOA 1OWJA 3TJVA 4IGDA 1KDQB 1FN6A 2BTCE 1SLXB 2BDAA 4E06H 1A1RA 4YLUA 1DWDH 1PPFE 1TGSZ 3FZZA 1FI8A 4QT8C 5HIYA 3E16B 2F91A 3MU5A 5DK1A 1PYTC 4B71A 1C5NH 1O33A 4GAWA 1BJUA 4TPIZ 4K60A 4Y7AA 3SUDA 1RD3B 4UDWH 3Q77A 1ANEA 3RXUA 1K1LA 4IN2A 4XFQA 1TYNA 2YMSC 3GYMA 3UQOA 2ZHFH 2HALA 4LXBH 2BY5X 3U8TH 1J9CH 1AFQB 2HPQH 1QQUA 4UFGH 1GCDA 2PGBB 4Y10E 2HNTE 2ZDVH 5H4IB 3EE0B 3FP6E 1OPHB 2BVRH 3LGTA 3RM2H 3SV6A 2F9PA 3RC4A 1NESE 1WDIA 2C8XB 1ANBA 2FI4E 4WMFA 1LQEA 1DY9A 3AAVA 4GSOA 1C1NA 3RU4D 4WVPE 5B6OA 4JCNA 5KECA 9LPRA 1FX0B 1O3IA 5HGGA 5DP9A 2CN0H 3Q3XA 3O8DA 2R3YA 2LP6A 2F9OA 2A45B 1G3CA 3D65E 4DIHH 1C5QA 1GHVH 2ZQ2A 3ZVCA 3BN9A 3GDSA 3T26A 1BRBE 1K21H 4ZKNU 2TGAA 3SOSA 1QHRB 2LPRA 3MWIU 1ARCA 1NRNH 4JYUH 2IJD1 3NUMA 1PQ8A 1MU6B 3LONA 2Y7ZA 1AB9B 2AGIX 1EAWA
chains in the Genus database with same CATH topology
2FOBA 1E38B 1HIAA 1ELCA 4ZKRU 1RTLA 2F9BH 1GL0E 4DCDA 4ABBA 1HIAB 1Y5UT 3MO6A 3P95A 1SGEE 3UR6A 2JKHA 4U32A 4X8UH 4CR9A 3RXTA 2H5CA 3RMMH 2XRCA 4JZEH 2G8TA 3BTFE 1OS8A 1TPAE 2F83A 3SUFA 5E0HA 2QYIA 4INKA 2O8MA 3T29A 1TABE 1YCPM 2TBSA 3PO1B 3SW2B 2A5AA 2H9TH 1AUTC 1TNGA 2OUAA 2WPJS 2UUYA 1EJNA 3RXSA 1ABIH 3MU1A 5F8ZA 4Y6DA 2P3TB 2BDIA 2VVUA 1C4U2 4ISLA 1Y5AT 1B5GH 4X2YA 3TLOA 1YPMH 5BRRE 3UOPA 1FQ3A 5TJXA 1W8BH 2JH0D 1K1OA 2BMGB 1LHFH 3URDA 3GYLB 1MTNC 1F0SA 1ELAA 3BTHE 1RIWB 4FVDA 4CRGA 3CENA 5AFZH 2FWWA 2BY9X 3LH1A 3MH5A 2XC5A 1PPGE 1WQVH 3SV7A 4BXWA 2QF0A 5EODA 4CRCA 5JBTA 2ZDKA 1DWCH 5JYIA 2ZCHP 2PUXB 3LH3A 3ATMA 4H4FA 4X6MA 3TITA 2ZDMA 2W3KA 1DVAH 1GBAA 5AHGH 1AO5A 5A8YA 1O5DH 1S6FA 2A2QH 2ANWA 4K2YA 2HVXA 2CHAB 4D7GA 2ZGXH 3ZZ6A 1C1WH 1LKBA 2B9LA 1OX1A 1Q2WA 1TFXA 2QIQA 1TA2A 3NXPA 2AH4X 1UHBB 6ESTA 1KTSB 1O39A 5EPNA 5L2YH 1L1GA 1C2KA 2OC0A 4YO9A 1CT0E 1SGFG 1QJ6B 1SQTA 4IW4E 3SQHE 1MU8B 3SJKA 5EXLA 3GOVB 1AQ7A 2F9NA 3E0PB 4BAKB 2FYQA 2FI3E 2PUQH 4J1YA 3O8BA 2HPPH 2PHBA 5GIBA 4AGJA 2FZZA 2W7UA 5DP3A 2Z9LA 1O36A 2FEQH 4GPGA 1C5MD 3GY7A 3A7TA 2ILNA 1O2GH 4B74A 1GVZA 2PKSC 1GMCG 4BAOB 4FUDA 1O3AA 3VB6A 3L3TA 3QGNB 1D6WA 1J15A 1G36A 3ITIA 3BEUA 3A8CA 1TOCB 3NPSA 3ZZ8A 2AIQA 2ZCLP 1JRSA 1O37A 2TGPZ 3VXEH 1C2JA 1O2NA 1OSSA 2PKAB 2QN5T 1QY6A 4IS5A 5DP4A 3TJNA 4HGCA 4JK6A 1UTPA 3QWCH 1YYY1 4DT7B 4D9RA 1YP9A 1GVLA 1O2SA 1AKSA 5EQQA 1C5WB 2BDHA 1ARBA 3HGNA 2ZFTA 1W3CA 2BXUH 1EPTC 2XWBI 1BHXB 5JBAS 3FZDA 5GXPA 5IDKA 1C2EA 2A7HA 5JPMH 2OTVA 2ZFRH 5LGOA 1P0SH 2PTCE 1P2JA 2R9PA 2BD5A 1NRPH 5FHTA 1DDJA 2SGDE 3R3GB 2ZGCA 2VIVA 1EP6A 1MKWH 2LNCA 2ZFSA 1ZMJA 2UWPA 3W94A 3MH4A 3ZVFA 2ZFQH 1XXFA 4H42U 5CMXH 2FTLE 2ZNKH 3A8BA 3ZV8A 1IQKA 1O3PB 3W95A 2IJOB 3KN2A 4WH8A 2VIQA 4FUGA 4SGAE 1NC6A 2H1UA 2CXVA 2BD9A 1K1JA 2OD3B 4OGYA 5G4BA 3V0XA 3GISB 1HCGA 1O3CA 3IG6B 2FX6A 1Y5BT 3CS0A 5EQSA 2SNWA 4RSPA 3VB7A 2QXJA 1WU1A 2VWLA 3SU5A 5LPRA 1HUTH 1HAGE 1OYTH 1P01A 3RXFA 3PROA 1FUJA 5T6FA 1WSSH 5DP5A 2GCTC 3ZZBA 3HK6B 1SGYE 1AVWA 3O8RA 3RC6A 3HK3B 1K1PA 1XUHA 1FN8A 1C2DA 1W7GH 1U6QA 2AEIH 1KSNA 3C27B 1K1MA 4R0IA 1CT2E 2FDAA 2BXTH 3LGIA 1HAVB 3VB4A 2BDGA 1JBUH 1OWHA 1G9IE 1F5RA 4ABHA 1QL9A 3M61U 3E1XB 1GJ8B 4A1VA 3UREA 3IITA 2WV4A 2VIOA 2JETC 1DFPA 1XKAC 1LTOA 3M7TA 3A7VA 3FAOA 1AU8A 1VR1H 3ZYDA 8LPRA 1V2OT 2B8OH 1C2LA 1MUEB 2HGTH 1DWEH 3E91A 2FLBH 2A5IA 4DG4A 1SQOA 1AZZA 3M37A 2CMYA 2A4QA 3ODFA 2XCNA 2EA3A 4A1XA 4ZKOU 4UFEH 1N8OC 2XBWA 1K1IA 2A7JA 3TIUA 4MQAA 1FDPA 2GZ7A 1C2GA 1EP5A 1AY6H 4GLYA 1QURH 3S9CA 2QCYA 3SNDA 5DKMA 4WJG2 3H5CB 4INLA 2F9VA 4D9QA 2F3CE 1KYNA 4THNH 3LKWA 1V2QT 4U01A 3UNRA 3GCTF 2Z3CA 5JB8S 5LPFA 5F6MA 4LK4A 1A4WH 2A4RA 1WV7H 1QJ1B 1DPOA 2SGFE 5AF9H 1FY4A 1VGCB 1LCYA 1XUJA 1Y3UA 2ZFFH 1O3HA 4Q80A 4UFDH 4I8HA 5DO4H 4E7RG 1TNHA 2SGEE 1MKXK 1KXDA 1BOQA 4MNYA 1G3BA 3D62A 1ETSH 1P05A 2VH6A 2P16A 1ABJH 1C5SA 1LPZB 2BVSH 1UTNA 2QC2A 4MLFB 1JIMA 4CRAA 5JB9S 5F8XA 4UONA 2O8LA 4DVAU 1C1QA 4CBOA 2OC1A 1UK2A 3RXQA 2R3UA 3UNSA 2BLOA 3E90B 1HJ9A 1C5UA 2H9EH 3GCNA 1F5KU 1XUKA 3RXKA 1O2VA 1HAHH 2FS8A 3K2UA 4X1SU 5A2MH 3FP7E 1MTNB 3M5MA 2BZ6H 1ZSKA 3CP7A 1QA0A 2PWXA 1O5GH 1O3DA 4AORA 2J38A 2GMTC 3KF2A 4GHQA 4X1NU 1V2WT 2V35A 1HAZB 2JH6D 1EUFA 3Q3YA 3BTGE 1DUAA 1NRQH 4SGBE 7ESTE 4WXVA 2WV5A 1GL1A 1D3TB 3SQEE 3RU4E 3BIVH 1DX5M 4UFFH 1GBTA 1MQ5A 3VPKA 2ZHQH 4YM9A 5HYOA 2QGRA 2GV6A 3NZIA 1XUGA 4JZDH 1C4Y2 2NU0E 4A92A 4AB9A 2I6QA 3LGVA 4NWKA 1TBRH 5L6NH 3E6PH 1GHXH 4NIYA 3OY5U 4YOGA 5E0JA 1O38A 6LPRA 4AN7A 1C5RA 2VJ1A 4ASHA 3EA7A 2BDYA 3MO9A 1GBBA 1O5FH 1O2TA 2FS9A 1QB1A 4X2XA 4B2AA 4E05H 1T31A 1TGTA 1WAYB 1H9HE 4WXIA 1W7XH 1AD8H 1XM1A 4AYYB 1SQAA 3T27A 1IAUA 1GJ5H 4ZXXH 1ZSJA 1G2MA 1YCPH 5E2OA 2J92A 4GHTA 4RKJB 2VIPA 3LJOA 1C2MA 1V2KT 1UVPA 4WWYA 3F1SB 1TBZH 2Y5HA 1O32A 1C5OH 3A81A 4LZ1H 1NFXA 1DM4B 3DA9B 2GZ9A 4FUEA 1IQLA 2VGCB 1MD8A 2SFAA 3AAUA 1ZJKA 1O2QA 2XYAA 2QXIA 1T8MA 3T28A 2XC0A 4B73A 4BTUB 1Z1IA 1AN1E 1E37B 1BBRH 1EPTB 1UK3A 4AYVB 2Y81A 1CE5A 2PLXA 1BMAA 2FPZA 3DFLA 2OXSA 2WPKS 5C1UA 1KY9A 1D4PB 3SHAH 1KLTA 1KDQA 1O2PA 1SHHB 3TGJE 1FMGA 2XBYA 3NK8A 1G3DA 2AMDA 4CRFA 2VVVA 3N7OA 2VB0A 5GCHF 3RXMA 3ZZ3A 2STAE 3UNQA 3KNXA 3Q3KA 1YPEH 1GDNA 4H6SB 1HDTH 2ZU2A 2OCVB 1HFDA 1NTPA 1A5IA 1V3XA 4Q7ZA 2Z9JA 4MNVA 1Z8GA 1S84A 1QL7A 1P57B 1W0ZU 5A0BA 3PMJA 3B23B 4FUHA 4ABFA 3PWCA 3RXGA 1NRSH 1LHGH 3P8NA 2XW9A 4TY7A 3F6UH 5FCRA 1AVXA 5GJ4B 2BX3A 1TMBH 3HKJB 4XE4A 2ZZUH 5T3HA 5DPAA 1C1UH 1JRTA 5HMAA 3GDVA 1Z1JA 4BNRA 4X8SH 1C9PA 1F0TA 1TQ7B 2A31A 3UWIA 3GY3A 2V3HH 2R2WU 1A2CH 3NCLA 2C8YB 1O5AB 2RCEA 2EI8A 1C4V2 3M7UA 1NFYA 4Y79A 1G37A 1W2KH 3DHKH 3MO3A 2ZCKP 5BPEA 3S0NA 2HLCA 1OP2A 1TNJA 2FYRA 2Z3EA 3RLWH 1TOMH 4MDSA 4JZIA 1ELDE 3P8FA 2GT7A 2JETB 1WBGB 3F9EA 3M7QA 1V2LT 4KKDA 4Y0YE 3M5OA 4X1QU 3HGPA 1ORFA 1BTUA 1DS2E 1GBKA 2A0QB 2PGQB 3E0NB 4LZ4B 1S6HA 5EU8A 3RP2A 1LQDB 1DWBH 3UR9A 1EATA 4M7GA 4CR5A 2NWNA 2GGVB 1O2LA 1GCTB 1N8OB 4K1TA 1LO6A 4ABAA 3F9FA 1W0YH 4B76A 3U98H 2UUJB 2XWAA 4FUFA 5JBBS 5CHAC 1QJ7B 5EXNA 4OS2A 1SHYA 5FPTA 2C8ZB 1AUJA 4ZH8A 2ZU1A 2EC9H 8ESTE 1E0FD 1CO7E 2BYAX 1JWTA 4NG9H 1E34B 4UE7H 1BRAA 1OWDA 5FBEA 1EASA 1HJAB 3A8DA 3NWUA 1O2HA 1VJ9U 1ZHPA 1EAUA 1G32B 3ZZ5A 2BDBA 3A87A 2Y7XA 1HAOH 3SGQE 2J34A 2EEKA 2DE8A 3RXRA 1UMAH 1GDUA 1P2MA 2ZHEH 1GI6A 1EX3A 1HPGA 2GDEH 1L0ZA 2BY6X 2GP9B 3ATLA 1GGDC 4K69A 2Z9KA 2QXHA 1GI1A 2OP9A 3BTKE 2G55A 1NU9A 3QZRA 3DUXH 4NIVA 1TIOA 1CA0C 4GVUA 1K1NA 2Z9GA 1K2I1 3SU4A 2RA0A 1ELFA 1ETTH 1CHGA 1PQ5A 2BD3A 4XSKU 1ZHMA 4VGCB 2P8OC 1PQAA 1NU7B 4O9VA 1P11E 3SNEA 1FLEE 2O8WA 2XC4A 1P3CA 2BQ7B 1BJVA 3U9AH 2QXGA 1H1BA 7LPRA 2P93A 3ZVAA 3UWJH 1KLIH 3LOXA 1AE8H 1UHBA 2ZG0H 3F9GA 3ZYEA 1UCYH 3S69A 2GMTB 3T2NA 3S9BA 4ZAEA 1V2VT 4JZFH 2I6SA 4ISIH 1WOFA 1GG6C 1EZUC 3D23A 5LPEA 3KQDA 3SV9A 3PMHB 1GJCB 3QDZB 3SGBE 2FTMA 2NU3E 1E35B 1T4VH 3MH6A 6GCHF 3SV8A 1GHBF 2GDDA 1GHWH 1QB9A 4K5ZA 1XKBC 1SGPE 2FOMB 4HFPB 1C9TA 3K6YA 4ABIA 2RDLA 1N1LA 2AGEX 1CBWB 3A7WA 3B8JA 5F8TA 2ULLA 3URCA 3DT0H 1PFXC 1QTFA 3BG4C 3ZZDA 3L6PA 1CA8B 3RXLA 4BTTB 1P10A 2BOHB 4ZHLU 1F7ZA 1ZLRA 1ESTA 4XBBA 1ZOMA 2Z6BD 4D8NA 2Y80A 1O5EH 3RXIA 1A0JA 3SO3A 3L33A 3GCOA 7GCHF 1LHEH 1V6DA 7GCHG 1HAPH 2AMQA 1EOLA 2PKAA 2C90B 1K9OE 3SV2H 8KME2 3BTME 4XDEA 1WTGH 1XXDA 1OWKA 1DE7H 1K22H 4ZHAA 4ABGA 1IQHA 1A5HA 1BTYA 1GBEA 2WYJA 3P8OA 2UUKB 5K0HA 1LVOA 1MTSA 3AW0A 4K1SA 3A84A 1L1JA 5ESTE 1TE0A 1L2EA 1RGQA 5HM9A 5EXMA 4AFUA 3FFGA 5FCKA 1YKTA 1Q3XA 1DT2A 3JZ1B 4IC6A 3O8CA 1KLJH 3CS7A 3G01A 3F9HA 1SGRE 2BD2A 3GY8A 1FAKH 3VGCC 2AIPA 2ALVA 2P95A 2B0FA 1C1RA 3P92A 2V0BA 1CHOF 1NY22 1CHOG 5EW2H 1B0EA 2ZPSA 3U8RH 3SU3A 2BLWA 2HNTF 2O9QA 3RXEA 5EQRA 1OXGA 3K6ZA 3GY5A 4AG1A 5J4SA 4Y76A 1P03A 2PFEA 2HNTC 5J4QA 3A80A 2Q6FA 3GICB 1KXBA 2K1QA 4FU8A 5FPSA 1FONA 3QTOH 1FY5A 1C1OA 3QN7A 3SORA 3RXAA 5A0CA 2SGAA 2OC8A 3M3TA 2PR3A 2ZQ1A 2GTBA 2J95A 5C3NA 4YTAA 1TRYA 1EZXC 4YLQH 1SC8U 2ZEBA 3ODDA 1YPJH 3V13A 3TU7H 3SN8A 4FUIA 1AHTH 1GBIA 1TRMA 4DOQA 1SOTA 1O3EA 5GDSH 1V2JT 3TK5A 3SUGA 3VEQB 3E8LA 1LDTT 1CT4E 1GDQA 1WUNH 2P3FH 1UJ1A 1W13U 1HAVA 2GCHF 1WTHD 1UTLM 5C2ZA 4AFZA 1QIXB 1SMFE 2AERH 1ELVA 3RXOA 3SI3H 2NU2E 1RXPA 3SNCA 1C1SA 2ASUB 1FXYA 5ESBA 2BD8A 2P59A 3RXCA 4BAMB 3OU0A 3RU4T 1QRZA 1S0QA 4TYDA 1EZSC 1ZTLA 1BRUP 2D26C 5A8ZA 1GI5A 4ABEA 5E8EH 2XXLA 2Y5GA 2FIRH 5T6GA 2QV1A 3PYHA 3TGIE 1SGIB 3A88A 1CGHA 4X1PU 3T25A 3I77A 4FUJA 5AVDA 5HXFA 1TPPA 1TX8A 3T62A 3LC5A 1MCVA 1S81A 1QBOA 3P6ZB 2TGTA 3A7YA 4AFQA 1IQEA 5ABWA 3SU1A 2FOGA 1HRTH 3M35A 2FP7B 2NU1E 1AWHB 1EZQA 1ANDA 3ZZAA 1SSXA 2OINA 1ZTJA 1O2XA 4CRBA 3GCTG 4ZMAH 4XOJA 1C2FA 3BSQA 2F9UA 1J17T 3OTJE 2FX4A 1AIXH 3UTUH 1MBMA 3OX7U 3MMGA 4X6NA 3A85A 1ZJDA 2NU4E 2GD4B 3LGUA 3MYWA 3EDXB 2IPHA 3MH7A 5EW1H 4O97A 1ACBE 1NROH 2C3SA 1MBQA 2WUCA 3MHWU 1O3KA 1FV9A 4AOQA 3SNBA 1QBVH 1P2OA 2G81E 4BAQB 4ESTE 4I8KA 4AZ2B 2QAAA 4CBNA 1BTXA 4LOYH 1W11U