3M61U

Crystal structure of complex of urokinase and a upain-1 variant(w3a) in ph4.6 condition
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Crystal structure of complex of urokinase and a upain-1 variant(W3A) in pH4.6 condition
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 59
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2010-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3m61U02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3m61U01
1O3IA 2HOBA 1FQ3A 3VB7A 1PYTC 1LHDH 1ORFA 1S5SA 1ZYOA 1G3BA 1DPOA 3PTNA 3SV9A 2A7JA 1TOCB 1HB0B 1DLKB 3RLYH 5GWZA 1PQ5A 4WMDA 2ZPRA 1EUFA 2XBVA 3NPSA 3F9HA 2PGQB 1A61H 3ZZ3A 1OWDA 2OCVB 1BOQA 8GCHG 4WJG2 1O3KA 2BLOA 3BTEE 3SI3H 4AORA 3P17H 1TONA 1QL8A 1O3EA 4BXWA 2XRCA 2PKSB 4ZKSU 2PV9B 3Q3KA 1LVYA 5T6FA 2O8LA 1EPTB 2Q6GA 2Z94A 2AMDA 1EB1H 2FWWA 3L6PA 1C5YB 2F9UA 4X6OA 1UTQA 3TK5A 2NU1E 5DP8A 5FX6A 5E0JA 1H8IH 1YP9A 1CE5A 2P59A 1MKXK 2A4GA 3U9AH 5TJXA 1INCA 2BD7A 5DKMA 5DP5A 1F0SA 3A82A 1BMMH 2VVCA 2FS9A 1THRH 1GMHF 2A5IA 1SLXB 1UVTH 6CHAC 3T28A 4CBOA 3LH1A 2O8MA 2PW8H 3M5NA 3UWJH 3GYMA 1TGTA 1W0YH 4JZDH 3RXCA 2CMYA 1ELDE 2AMPA 5AFZH 2AH4X 3ZV8A 1RGQA 2ZHFH 3SNEA 1C2JA 1TNHA 1ESBA 3RXQA 3A84A 4CRBA 2FOGA 3MNXA 4ABDA 1G3CA 1GL0E 1UCYE 4B76A 5L6NH 2V35A 1P12E 2XBXA 3R0FA 1AVWA 1OXGA 2ZTYA 1IQNA 3T25A 5A8YA 1A3BH 1ZTKA 4JYTA 3NZIA 4KGAA 1C5SA 1GI2A 3E0NB 2BD2A 1TNLA 1V2OT 3ZZ8A 3RXJA 3N7OA 3RXLA 1AE5A 4KTSA 1EZUC 1SOZA 1ELEE 2ZHDA 3NWUA 3P8OA 2CV3A 2A31A 4CRGA 1CGIE 4UEHH 1BIOA 1CHOF 3RXRA 3ZVAA 3PLKA 1RTKA 1Y8TA 5K0HA 2BDYA 2C8WB 2Z3CA 3QK1A 2VIDA 5L30H 4D76A 2J4IA 5JBTA 2XCNA 2SNVA 2J95A 1AN1E 2SGEE 4Y0ZE 4AOQA 2EC9H 1HJ8A 1D3PB 2Y5HA 1HUTH 2AGGX 1GJ9B 5A2MH 1FZZA 1CT2E 3RXSA 1UTKA 3CENA 1GI6A 3BTHE 3GY6A 4DG4A 3KQBA 5C20A 4DIHH 2GTBA 1LPZB 3BSQA 4SGBE 3QTOH 1DWDH 3SN8A 3SZNA 1HIAB 1P05A 2P93A 3HATH 3SUEA 1BBRE 3FP7E 2JH0D 4JYUH 1NFWA 3SJIA 1HXFH 2Y5FA 2WPLS 1SLUB 1Z8JB 2FI5E 3OY6U 5IYTA 1SOTA 4H6TA 3HKJB 1O3AA 4ZHMU 5IDKA 2UWLA 3S9BA 3ZYEA 1XUKA 5PTPA 4E05H 1YF4A 3U8TH 1XUHA 4GUXA 2F9VA 2FI4E 3V7TA 1DVAH 1RRKA 1NS3A 4ABHA 2A4QA 2WV5A 1TE0A 1O2TA 1C2HA 2AGEX 1QBNA 2R3UA 2BVRH 3TVJB 2VB0A 1MTSA 3KHVA 1NT1A 2WPKS 2A0QB 4OGYA 2NWNA 1K1LA 3V12A 4DY7B 1NROH 1QL7A 3U69H 2I6QA 4BTUB 4GCHF 4I8KA 3ZZ7A 1W14U 1SGDE 3BTWE 1HDTH 5BPEA 3T26A 2BDGA 2ZU3A 5EXNA 4FU9A 1ZPCA 1D3DB 4CRDA 2H9EH 1W3CA 5C1UA 1E36B 3B9FH 3K65B 1BTPA 1DWCH 2C90B 2OD3B 4UFEH 3SU0A 1CSOE 1EZQA 6GCHF 3SUDA 2QXGA 4O3UA 5EOKA 3T2NA 2K1QA 3OY5U 1GJDB 3SHAH 4UE7H 2B0FA 3KF2A 2BY5X 3UIRA 1TX6A 1BBRH 3KQEA 1JIRA 4Q2KA 3UFAA 5T6DA 2RG3A 2WV4A 3RU4E 3KIDU 3HGNA 1OP2A 2W3KA 4IC5A 2PUXB 1FUJA 1BTUA 1ETTH 4WF8A 1O3NA 2BXUH 1SL3A 1HPGA 1QCPA 3ZZ6A 8ESTE 1O2UA 4MPVA 1LQDB 1YYY1 1BQYA 1S6FA 3M5LA 5FHTA 1OSSA 4Y10E 1O32A 3GDSA 4AG1A 1K1OA 1BCUH 1UHBA 2ZDKA 5JDUB 5EW1H 3D62A 3MO9A 4TY7A 1V2MT 3UWIA 1FXYA 1ZJDA 4JMYA 1V2ST 2SGDE 2TGAA 5JB8S 1T31A 3M7TA 3LC5A 1NESE 1FY1A 1ZZZA 3HKIB 1TMTH 1G2MA 1IHTH 4ZH8A 4B2CA 4LXBH 4GHTA 3ZZ4A 1TQ0B 4ABEA 2GV6A 4ZAEA 3TJNA 3S9CA 1AB9C 1O2KA 3ZVBA 8KME2 3F9FA 1TIOA 1MD7A 1GDNA 3QWCH 2G5NA 4I7YH 4FVBA 1YPGH 3A7TA 3E16B 1P2IA 2FOFA 4A7IB 2QIQA 2VWMA 1DWBH 3HPTB 1THSH 2GCHF 1ZMJA 4MPWA 2WPMS 3BF6H 1LVOA 1HAGE 2VWNA 2EA3A 1FLEE 3P8GA 3UQOA 3VB4A 1EB2A 5F6MA 5C3NA 2Z9LA 1GG6B 1NRPH 1FN6A 1AD8H 1XKAC 3Q76A 2VGCB 4IMQA 1BUIA 3UPEA 3B23B 1O3CA 1C9TA 1ZR0A 1A0LA 3SUGA 1P3EA 4NWKA 1OWJA 2TRMA 3E8LA 3SOSA 5GPIB 1UTPA 2ANWA 1C4U2 1TBZH 1BHXB 5HYOA 3R3GB 3QO6A 2FOEA 4CHAC 1KXDA 2HLCA 1V3XA 2BDHA 1AKSA 1C4V2 2P16A 2CF8H 3RXHA 3E6PH 4INLA 2ULLA 1GBDA 1GMCG 1O35A 2O9QA 4FUFA 3P6ZB 2VJ1A 3TJVA 2CXVA 4FUDA 4K3JA 4X8SH 1BRUP 2B5TB 3LGYA 1FMGA 1UTOA 4MLFB 4OS2A 5EU8A 3FAOA 3M61U 3RXAA 1VCWA 4HGCA 3ZVCA 2ZF0H 3TGJE 5CHAB 3E1XB 4ZKNU 4XBBA 1W2KH 3GCHC 3SGAE 1S85A 4OS5A 1FIZA 1C5QA 1MTNB 1N6XA 1UHBB 1SFQB 2TBSA 2ANKH 1KLJH 2QXHA 4NFEA 2BQWB 3OU0A 2PR3A 3W94A 2HWLB 1SI5H 2PFEA 1EKBB 1ETRH 1GJAB 3TK6A 2WINI 3SW2B 2Z9IA 1TABE 1Y3YA 9ESTA 5AF9H 1IAUA 2W26A 1ZGVA 2OXSA 3UNRA 1AFQC 1OWKA 2BDCA 4U30A 1YPJH 4E7RG 5HMAA 1F2SE 4UFFH 5FBIA 5DJ7A 2B9LA 4TWYA 4X6NA 3BTFE 1PJPA 2AFQB 1OWIA 1ANDA 4CH8B 3LJOA 4OS6A 3M5MA 2BD5A 5DP3A 3SV6A 4B75A 1DLEA 1AO5A 5FPYA 3U1IB 3TJUA 2H5CA 3NUMA 1SHHB 2R0LA 3TGIE 2G8TA 3MO3A 3P92A 2IPHA 1K1MA 5EQQA 3STIA 5A8ZA 4MNYA 5E2OA 2UUJB 3VB6A 2GMTC 1C1PA 1C2KA 1QNJA 1SGCA 4AFZA 1WUNH 4NIWA 1TWXB 4NSVA 1A46H 1N8OB 3FZDA 2C8ZB 1TA2A 1Y3UA 2BY9X 4A1TA 4ZXYH 2PHBA 1D3QB 3EA8A 3ZZBA 5F8XA 2P8OC 1VITF 1ANBA 4INKA 3TLOA 2O8WA 1HJAB 1GMCF 1AKSB 1ZHPA 2ZU2A 1O31A 4YESB 5ETXA 3FANA 1TPPA 2ZQ2A 2Y6TA 1S81A 1O2NA 1K1IA 1IQIA 3BTTE 1SGTA 1NFUA 2OC8A 2CN0H 5EXLA 1TYNA 2ZC9H 2BTCE 3LONA 3K6YA 1HBTH 1JMOH 4X0WU 3CS0A 1NFYA 1VGCB 1GI0A 2Z9GA 3PLPA 5G4BA 1ZHMA 3VEQB 1GWAA 2QCYA 2ZDAH 3KNXA 1OPHB 3RXPA 4AFUA 1PQ7A 4X2YA 2AGIX 1LO6A 2DE8A 2GCTC 2P3FH 2Y5GA 4I32A 2Q1JA 1CQQA 1ESTA 1Q31A 1B0FA 2HNTE 4YT6H 1SQTA 2Y7XA 2A4RA 2WPJS 3EA9A 3M7UA 4NIXA 4D7FA 2CF9H 4RKOB 1SQAA 2VH6A 1V2UT 2VIQA 1YPLH 3RLWH 1FY8E 2A7HA 4BXSA 2BXTH 3LGIA 1CT4E 4JK6A 1F0RA 3LKWA 1MCTA 3GCOA 2ZG0H 2VWOA 3RXVA 1HAOH 4CH2B 3KGPA 2VU8E 4BAQB 1PPGE 1FAKH 5CMXH 3SNAA 2W3IA 3RXFA 2FMJA 2XWBI 3OX7U 1E35B 4K8BA 1EJMA 1OS8A 1O3MA 1MQ6A 1HAYB 1P8VC 5FXLA 2PKSC 4I33A 1B0EA 1BTXA 2PSYA 3O8RA 3KQCA 4CREA 4IC6A 1EPTC 1L1JA 1NU9A 4ABAA 2OQUA 1UTLM 1HAZB 4FVDA 1DY9A 2BD3A 2A5KA 1Y59T 1GBHA 2GZ9A 1D6WA 3U8RH 1OX1A 5DGJA 4YLUA 1SVPA 2CGAA 2IN2A 4ISNA 1MH0A 3S7HB 3M36A 5AFYH 1GCDA 2BZ6H 1YGCH 1DDJA 3AW0A 1CA8B 3ATLA 2ZHQH 2THFB 4ASHA 1FN8A 3TJOA 2H9TH 4K2YA 1RD3B 2F3CE 1C5PA 1Y5BT 2AIQA 1JXPA 7LPRA 2BD9A 1HNEE 1P2NA 1A2CH 1L4ZA 3A81A 3RM0H 4X6PA 2ALPA 4HZHA 1AGJA 1P2MA 3C27B 4K1EA 2BDBA 4PROA 1DE7H 1CHOG 1KYNA 1QGFA 4IN1A 3UOUA 1ELCA 1W7GH 1C1RA 1QY6A 4NA8A 1WSSH 3GY2A 4Y11E 4YOIA 4MNXA 2H2ZA 2EI7A 1NO9H 3SHCH 4JZ1A 2ZPSA 1OOKB 3EGKH 3M35A 1SMFE 1T8MA 3SV7A 2QYIA 1FV9A 3RXMA 3TITA 2Y7ZA 1NM6A 1P2KA 2BOKA 2FOBA 5DK1A 3MU4A 2UUYA 3ESTA 1QQ4A 1DITH 1HIAA 2FOAA 2ZCKP 2VNTA 3Q00A 1GBLA 5ESTE 5EG4A 1L0ZA 1FI8A 1K9OE 2O8UA 1O37A 1MU8B 2A2QH 3LGTA 1TQ7B 1GHXH 2KAIA 1GCTB 4X2VA 1D3TB 4NA9H 5LGOA 2OLGA 1P03A 3VFEA 1KSNA 1TPSA 4INHA 1MZAA 5FX5A 1P2QA 2JETB 1C1TA 1T4VH 2J2UA 1TALA 1ZTLA 1TPOA 3RMLH 4B1TA 1P0SH 4KP0A 1KLTA 1BA8B 3P70B 1C2GA 1TA6A 2BQ6B 1NRRH 4JZIA 2ZP0H 1MZDA 1Z8GA 1FNIA 2FESH 5A0BA 4IN2A 2ZCLP 3ENSB 2OBQA 3QX5H 1TX8A 4ABFA 4AGJA 1LKAA 2PGBB 2JKHA 1ZRBA 3MU1A 4TPIZ 2F83A 2FYRA 1AWHB 1GMDG 2FTLE 4ISIH 2FI3E 2V3OH 1ELGA 2XC5A 4ABJA 3QDZB 4X1PU 1ZRKA 3M5OA 3UR9A 3MU8A 1GHZA 1MBQA 1WCZA 2A45B 3PMJA 2BY8X 2B8OH 4GCHG 1GDUA 4R0IA 2WYJA 2A2XH 2QV1A 3PMAB 1J9CH 3DFLA 2LPRA 1OYQA 3RC6A 4Y76A 2JH5D 2Z9JA 5BRRE 4JYVH 1O3OA 3PM3A 6GCHG 3BG4B 2ZGHA 5A0CA 3GY3A 4FUJA 3H5CB 3Q3XA 3RMMH 3MNSA 5I25A 1AWFH 2BDIA 1CA0C 1QHRB 3PO1B 3PWCA 1VCPA 4K1SA 4Y7AA 2GZ8A 1MKWH 1TPAE 2QA9E 5C67A 5JBBS 2R3YA 1DM4B 4M7GA 1UK3A 4XE4A 1O2PA 5FCKA 1O2GH 2STAE 3RXKA 3MHWU 2GV7A 4ZHLU 1BB0B 4ZUHA 3IG6B 1BMNH 1IQMA 1UVUH 1YBWA 4BNRA 1SGRE 1XX9A 3LGVA 1DWEH 3PYHA 2ZHEH 1NPMA 1O5EH 2KAIB 1JIMA 1QFKH 1MTWA 4GLYA 5B6OA 1LVBA 1EATA 1LQEA 1O3LA 2WUBA 1C5WB 2FM2A 2W7UA 4NIVA 1TGSZ 1WU1A 5A09A 1C1VH 1C5UA 4Y0YE 7KMEH 4KKDA 1O3PB 1OP8A 2C3SA 1GL1A 2SNWA 1F5RA 2SFAA 4U32A 4K5ZA 1UCYH 1MTVA 4GAWA 1AI8H 1S82A 3URDA 4OS4A 1EP5A 1GVKB 2ZDLA 4NWLA 1L4DA 1MU6B 1QTFA 5E0GA 1G30B 1O2WA 8LPRA 4X2XA 1IQJA 1CA0B 3UR6A 3EYDA 1OWHA 3V13A 3VGCB 2FOHA 3BIUH 1GMDF 1Q2WA 3VB5A 4LOYH 4YZUA 1O30A 1WYKA 3F9EA 2QGRA 1NU7B 2ZU4A 1CHGA 4WVPE 2GCHG 1EOJA 5LH8A 4CRFA 3A7YA 2BHGA 1Z1IA 4WWYA 2TGDA 1DY8A 1BTYA 5J4SA 1K22H 4NG9H 5DP4A 1EXFA 2Y80A 3MTYA 1MTUA 4K8YA 1HAPH 1O2RA 3A89A 3HGPA 1X7AC 1IOEA 3GICB 4D9RA 1TMBH 1W11U 2FTMA 2QC2A 3SNBA 2DE9A 2ZPQA 4QT8C 5DG6A 2V3HH 4JK5A 3HK3B 1LKBA 1LPKB 3F68H 5DO4H 4WXIA 4AFQA 2FYQA 1C1UH 1BZXE 1GBTA 1GI5A 3PV4A 4F49A 3MH7A 2RCEA 4Z0KA 4BTTB 4MQAA 3S69A 4DT7B 1UVSH 1UVPA 3DT0H 2AIPA 1G9IE 1DUEA 1ZGIA 4BANB 1SBWA 2UWPA 1C9PA 4NFFA 4X8TH 1LHGH 2A7CA 3A8DA 1CBWB 2F91A 3E91A 1DSUA 3U8OH 4X1QU 1V2NT 1NZQH 1HAIH 3VXFH 1G2LA 2NU2E 1O3BA 1LPGB 1GHYH 2ILNA 3SO3A 1C5TA 3T29A 1GG6C 1C5RA 4BOHA 2FDAA 1K28D 1Y3XA 5FBEA 1ACBE 1UMAH 2VGCC 1CU1A 1BMLA 2FX4A 1TRYA 5F8TA 3SGBE 1CO7E 1YLDA 1YPHC 2ODQA 5AVDA 3SV8A 3F6UH 2BY7X 2PWXA 1C2MA 3ODDA 4NZQA 2PSXA 1O5BB 1GGDB 7GCHG 4H42U 5AHGH 5HGGA 1ZJKA 1TGBA 3TU7H 2ZECA 1AMHA 4NA7A 5A8XA 1E0FD 1T7CA 4GSOA 1O2VA 3UREA 3A86A 5E2PA 1Z71A 1O34A 1AUJA 2AMQA 3RU4D 4AYVB 1N6YA 2DUCA 3GY7A 4YOGA 1QRWA 3GCNA 1C5LH 3RM2H 1KXAA 1YCPM 1QRZA 3SJ8A 2BD8A 2QN5T 5CHAC 2FX6A 1PPCE 1JRTA 2AYWA 1MTNC 1HLTH 4BAMB 5L2ZH 2J38A 5JPMH 4F4OC 1LHEH 5GXPA 4UD9H 1NTPA 4B74A 1GJCB 2BM2A 1ELVA 2TPIZ 4MTBA 1C2FA 1XM1A 4O3TA 2VVUA 2J92A 1FJSA 1O3GA 2WPHS 1V6DA 2ZQ1A 3RXUA 5HXFA 2FODA 1VITG 4CRAA 1GBKA 1RXPA 2Y82A 3UNQA 2TIOA 4CRCA 1T8NA 3F9GA 3RXTA 1FPCH 7ESTE 1O5GH 4DCDA 3DA9B 4K1TA 3NCLA 1YPMH 2XC4A 4OS1A 3CP7A 1GI9B 1F5LA 1EOLA 3U1JB 1S0QA 1O3JA 1QURH 2B7DH 3SQHE 2V6NA 5LPFA 3SU4A 2GT7A 3K9XB 1G32B 1EAXA 1XMNB 2CHAB 1ARBA 3RU4T 3ZZ9A 4A6LA 1D9IA 1RTFB 3ODFA 4GHQA 1TMUH 1GI7B 1OYTH 1SHYA 2XCFA 4Y8ZA 2SGAA 1A7SA 1TGNA 1YC0A 1NFXA 3ATIA 3U98H 1GJ6A 2ZDMA 5EQSA 4ZHAA 1SQOA 1ZMNA 2O8TA 1N8OC 1WV7H 2H6MA 1DX5M 2J34A 1GBMA 1O2ZA 3MI4A 3A8BA 1VCQA 1O2IA 7GCHF 1H9LB 3MOCA 4UDWH 3D23A 3A85A 1AHTH 3MU0A 4Q80A 2NU3E 1DXPA 1GBEA 2ZZUH 1F7ZA 3F1SB 4X2WA 1UK2A 1HJAC 4FU8A 4ZROA 2VIPA 3PTBA 3LC3A 1BMAA 1HAVA 4U01A 1GJ5H 6ESTA 4FUIA 3SJ9A 1BRCE 3H7TA 5C1YA 2ZI2H 4B73A 2FXRA 4CR5A 2EI6A 1ZSLA 1DOJA 2UUFB 1TX7A 1SC8U 1RIWB 1TB6H 1NRSH 2ZU1A 4XFQA 5H4IB 1QR3E 4XDEA 1V2WT 3E3TA 1P2OA 2VWLA 1VGCC 1W8BH 4DJZB 1BHXF 4TYDA 3VPKA 3T27A 1HAXB 1NRQH 3QGJA 2OUAA 4DOQA 3RC4A 3MFJA 4FUBA 3AAUA 1VJAU 1O2QA 2F9PA 2GVFA 2PTCE 3SNDA 1GHVH 3RXDA 1UVOA 1TGCA 2ZFRH 3WY8A 1T32A 3FVFB 1K1NA 2ESTE 3I77A 4Q7XA 3QLPH 2BZAA 3VXEH 1BJVA 1GBJA 4YLQH 5EODA 1O2MA 3JZ1B 1K1JA 4UONA 4IMZA 1Z6EA 1KXFA 1A0JA 3SU6A 3FZZA 1SGNE 3G01A 2ZU5A 3IITA 1P11E 4Y71A 3BIVH 4Z6AH 4Y7BA 2ZEBA 3K2UA 1IQFA 1P57B 2JH6D 2GT8A 1A3EH 4TY6A 1YKTA 1QJ1B 3SJKA 1HYLA 1Z6JH 1S83A 4AFSA 1YCPH 3L3TA 1GJ4H 4WH6A 5FAHA 1M9UA 5SGAE 3TGKE 4FUHA 1PPZA 1QQUA 4GVUA 1CVWH 3S9AA 2ZDVH 4R8TB 1C5VA 3E90B 1LVMA 3SGQE 5EPNA 1C1OA 3URCA 6LPRA 4YTAA 1YLCA 1E38B 1B7XB 1C2EA 3ZZ5A 2XTTB 4FXGH 2F9NA 3BTME 3MYWA 1P02A 3T62A 3CS7A 4BTIB 1BRBE 1QJ6B 3LOXA 2FOCA 1HAVB 3BG8A 2Z9KA 2P3UB 2WYGA 3ATKA 4X1RU 1BTZA 1WQVH 1IQLA 1ETSH 1W10U 1H8DH 1A5HA 1O2YA 1MBMA 2W7SA 1CT0E 3RC5A 1SLWB 3O8CA 2VIWA 1QB1A 1JWTA 1AVXA 1AVGH 4B71A 1QB6A 3RP2A 2P95A 2SGQE 3K6ZA 4E06H 1QBVH 4A1XA 1TNIA 5JBAS 4CBNA 1HAHH 3QGNB 2D2DA 1BT7A 3A7VA 4BAHB 4ABIA 2H9HA 4WH8A 2GZ7A 1A5IA 3A7XA 1AZ8A 1XVMA 3SQEE 1V2QT 2FP7B 1IQGA 1NY22 2R2WU 5EW2H 2ZDNA 1O36A 4I8GA 2ODPA 1GCTC 1MKXH 1DUAA 1H9HE 1GJ8B 2QXJA 2TGTA 2JETC 1AQ7A 3V0XA 2ASUB 1C1WH 2GGVB 4NGAH 2BLQA 5TCAA 1XXDA 1THPB 1HRTH 3LGWA 1FAXA 4H6SB 2ANYA 2BQ7B 3LT3A 3IWMA 1RFNA 1S6HA 1GI4A 5A0AE 1HV7A 1EASA 1O5DH 5EPYA 3ZVEA 2QF3A 3O8BA 3M7QA 1GJ7B 1ZMLA 2D1JA 4A5TS 4XBCA 2RA3A 4ZXXH 1VITH 1DICA 1GI1A 1J14A 5DP9A 1SGFG 2ZIQH 2XYAA 4YM9A 1KIGH 1A4WH 4HI3A 4XSKU 1XUIA 3UY9A 4IGDA 3TH3H 3A80A 2J94A 1O0DH 1P09A 5ABWA 5T3HA 1ID5H 2QF0A 3ZVDA 3DHKH 3SUFA 1DXWA 4WXVA 1P10A 2GDEH 2HVXA 3GYLB 2AS9A 2ZGBH 1HJ9A 1BTHH 1C2DA 3I29A 2ZHWH 4WY3A 1ZPBA 1TLDA 3RXOA 5EGMA 1GHAF 1Y5AT 3GCTF 2ZFSA 3UQVA 2BVSH 2XBWA 1YM0A 2I6SA 3Q77A 1H4WA 1H9IE 1O5CB 2BMGB 3BG4C 2G51A 1O33A 1C1MA 1O5AB 1V2PT 3PWBA 2AERH 1L1GA 4HFPB 5HM9A 2G55A 1A1RA 3PO1C 3PROA 2PTNA 1SGYE 1XKBC 3ZZAA 4BAOB 4AB8A 4IW4E 4RN6A 2GKVE 1WAYB 2OC7A 1GBBA 1GBFA 1F92A 1TRNA 3MO6A 2ZFTA 1NRNH 3M3SA 1O3HA 1D4PB 1NC6A 1O3FA 1IQHA 3A87A 3SU5A 2BX3A 1GDQA 4OS7A 5C5OA 1UO6A 2QAAA 3A83A 3ITIA 3GISB 2C8YB 3QUMP 1PPHE 2EEKA 1G37A 4AB9A 3P95A 2W5EA 3A7ZA 2YNAA 2PKAA 2G81E 1PFXC 4D7GA 3RDZA 2R9PA 1UJ1A 1RTLA 1O2LA 3UUZA 3PMBB 3TNSA 3ELAH 5J4QA 1EQ9A 4DVAU 2CJIA 3LDXH 1ELFA 1C5XB 1WQSA 3QZQA 4I8JA 3KEEA 4DIIH 1QB9A 3SU3A 1DANH 4MPXA 1QRXA 1ELBA 1KXBA 3OTJE 3UNSA 6CHAB 2H5DA 1Z7KA 1JRSA 3VGCC 3PLBA 2ANMH 1HGTH 8GCHF 1ARCA 3MH4A 4A92A 2NU4E 4KTCA 4ZMAH 4Y8YA 3BV9B 3FP8E 3GY8A 1V2RT 5F03A 1QJ7B 1C1NA 5GDSH 3ATMA 2ZA5A 4JZEH 1TBRH 1CGHA 2G4UA 5E8EH 3ZV9A 3A88A 2FEQH 1T8LA 3ZVFA 2R0KA 1XVOA 1A0HB 3AAVA 2HRVA 1Y3WA 3L33A 1E34B 1FY4A 4UFDH 1QL9A 1LTOA 2BOHB 1FY3A 1JOUB 1P2JA 4X6MA 1EP6A 1P3CA 4SGAE 2ZGJA 1T4UH 2BLVA 3QZRA 2ZWLH 4WMFA 3EA7A 2NU0E 3O8DA 1ZTJA 2ZFQH 1JBUH 3W95A 4RSPA 3A8CA 4FUCA 3AASA 2G4TA 3NK8A 1IQKA 3KL6A 3BEUA 4Y8XA 2Z3EA 3KQDA 3HK6B 1AU8A 1SFIA 3MH5A 1XXFA 1Z8IB 1GBCA 1FONA 1VJ9U 1CBWC 3BTQE 4JZFH 3LPRA 1A5GH 2C4FH 1GHBG 4Y6DA 5TCCA 5EXMA 2GDDA 1C2IA 1MKWK 3SNCA 1YPKH 2FLBH 1F0TA 2A1DB 4IBLH 1BITA 3FFGA 2C8XB 5FPTA 1EAWA 3TIUA 3A8AA 1IQEA 3UTUH 2HALA 4KTUA 2M5TA 2FPZA 4NIYA 2XWAA 4X1SU 1V2KT 3KN2A 5C5NA 3BTKE 2PKAB 2XXLA 2YNBA 5L2YH 1UK4A 3KCGH 1PQ8A 3QN7A 1S0RA 1GBAA 3GY5A 3PB1E 1SB1H 1GGDC 2FO9A 4THNH 2Z3DA 1MAYA 2G5VA 4Q7ZA 4I8HA 2YOLA 1P04A 1UCYK 1OWEA 4AN7A 3BN9A 1ABJH 2BLWA 3GDUA 3S0NA 1DSTA 1GJBB 2Q6DA 1P9UA 2ZTZA 2BDAA 2GX4A 1L1NA 5GCHG 1PYTD 1FY5A 4E7NA 1FIWA 1TNKA 1GPZA 1SGPE 9LPRA 2FS8A 1O2JA 2ZGXH 1E37B 1LHCH 1KTTB 2BX4A 4MDSA 4B2AA 2ODYB 4TPYA 1C2LA 3ZYDA 1KY9A 4I31A 4U2WA 1O2SA 1GHWH 4IS5A 1AE8H 3RXBA 3RMNH 1VR1H 1N1LA 3S7KB 3TNTA 3OSYA 1DFPA 3QTVH 1C1QA 3MMGA 1B5GH 2TGPZ 3AVZA 1RJXB 3TPIZ 2HPQH 1IHSH 1AFEH 4J1YA 1MCVA 2ZKSA 2H1UA 3TH2H 2VIOA 2UWOA 3DD2H 1O38A 1LHFH 4LZ1H 3PMHB 3D49H 2VH0A 3TK9A 2OTVA 5DP6A 1ELTA 1GHBF 4A1VA 3V3MA 5JBCS 3ZZCA 1BBRK 3JZ2B 1PPBH 1KXCA 1PPEE 3LH3A 4NSYA 4X8VH 2WPIS 3GDVA 2VIVA 1GBIA 4O97A 2A5AA 3TH4H 1LCYA 2HNTC 2V0BA 4MNWA 2WUCA 1ANEA 2AEIH 4B2BA 1OP0A 2CHAC 3NKKA 4VGCC 2Q6FA 1BTWA 3ATWA 3SU1A 1W0ZU 1WTGH 1KLIH 1G3DA 3MNCA 1Z1JA 4NCYA 5C2ZA 4LZ4B 4X8UH 2P94A 3SI4H 4K60A 5JB9S 1EAIA 3EE0B 3MNBA 2UUKB 3RMOH 2ZGCA 3MH6A 2BY6X 1EJAA 1LDTT 4X1NU 1O2XA 2OC1A 4K69A 1BJUA 4WMEA 1EJNA 3A7WA 3DUXH 5GCHF 2PUQH 2BVXH 4DW2U 1HCGA 2R2MB 2IJOB 1WBGB 1AZZA 2VINA 3FP6E 1RIWC 1C5NH 1ZHRA 2D8WA 1QBOA 1O3DA 3SJOA 4BAKB 1AB9B 2HGTH 1EAUA 1TRMA 1EX3A 3RXEA 5DPAA 1SG8B 4Q7YA 2QXIA 3RXIA 1TOMH 1GI3A 1HFDA 4VGCB 4ZKOU 4CR9A 1O39A 3MWIU 5I46H 1ZSKA 1O5FH 4MNVA 1XUGA 4NZLA 1SSXA 1GVZA 4JCNA 3SV2H 2RA0A 5CE1A 4XBDA 1NN6A 5LPEA 1ANCA 3GY4A 4I8LA 2SGFE 3ZVGA 3DFJA 2P3TB 4HTCH 2LNCA 3STJA 5E0HA 5FPSA 1TNGA 4AG2A 1T8OA 5GIBA 1UTMA 1DS2E 2ALVA 1YPEH 1FDPA 3SU2A 3LU9B 1L2EA 4ISLA 1J8AA 1MUEB 5T6GA 1G36A 1O2HA 1S84A 1PPFE 4CHAB 1SGEE 1P01A 1VZQH 4YT7H 2BD4A 4AZ2B 2GD4B 4GPGA 1J17T 4Y79A 1SGIB 5F8ZA 1WOFA 2D26C 1AIXH 1Y3VA 2IOTA 2FIRH 1D6RA 2XNIA 2OC0A 1SR5C 1GI8B 1GVLA 2HPPH 1KDQA 1C5OH 2ZFPH 1Q3XA 2PLXA 4ESTE 2EI8A 3EDXB 3M37A 3UOPA 3GCHB 1V2LT 3LJJA 1BDAA 1PQAA 3H7OA 4AX9H 1J15A 2Y81A 2OINA 4MPUA 1Z8RA 2HNTF 4FUGA 2BYAX 1V2JT 2G00A 2J9NA 1TAWA 4OGXA 1ESAA 3P8NA 1XUFA 1CGJE 4TWWA 4ABBA 2XC0A 3MU5A 5ESBA 2Z6BD 1XUJA 1C4Y2 1KXEA 2OP9A 2QY0B 1RS0A 5HM2A 1ABIH 1YPHE 1AFQB 2ZFFH 1BRAA 1V2TT 2OBOA 2ZO3H 1V2VT 1QA0A 1QIXB 3EQ0H 2C93B 4DURA 1TBQH 3C1KA 1DT2A 5FCRA 4MG3A 1C5ZB 1W7XH 5JYIA 2FZZA 1LMWB 2A4OA 3NXPA 1H1BA 1ZSJA 1P9SA 3D65E 1O2OA 1Y5UT 2XBYA 4O9VA 1UTNA 3I78A 1C1SA 1ZLRA 3P8FA 1G3EA 1OKXA 3ZZDA 3RUOA 2OQ5A 3T5FH 3SORA 4YOJA 4H4FA 1MAXA 1EPTA 1EZXC 3Q3YA 3B8JA 2A32A 2ZCHP 1QA7A 1K1PA 2GMTB 2GP9B 2VVVA 1F0UA 1MD8A 2BB4A 3GOVB 4MVNA 5DP7A 1J16A 1ZPZA 3M3TA 3EAJA 1AUTC 1KTSB 4YO9A 3SBKA 4ISHH 1SGFA 1GHAG 3GCTG 5LPRA 1HXEH 1C5MD 2F9OA 2P8OB 3E0PB 3LIWA 1W13U 4RKJB 1W12U 4FUEA 2XW9A 1K21H 1SGQE 3LGUA 4D9QA 4UFGH 1AY6H 1SPJA 1EZSC 3BTDE 2F9BH 1GMHG 4LK4A 4ABGA 1WTHD 1TFXA 3BEIB 1SLVB 2STBE 5C1XA 1P06A 4O03A 5K7RA 1ELAA 2FOMB 1FPHH 4XOJA 4FU7A 3BTGE 4ISOA 4D8NA 2ZTXA 1F5KU 4KELA 4ZKRU 3BEFB 1KDQB 5GJ4B 4AGKA 3VB3A 2RDLA 3OYPA 1MQ5A 1ZOMA 1YCPK 4DGJA 3M3VA 3AW1A 1TNJA 2Z7FE 4AYYB 2G52A 2GCTB 5EQRA 1K2I1 2ZNKH 1MMJN 3RXGA 2FLRH 2SGPE 4J2YB 1U6QA 1UTJA
chains in the Genus database with same CATH superfamily
1O3IA 4F55A 2HOBA 1FQ3A 3VB7A 1PYTC 1LHDH 1ORFA 1S5SA 1E1RD 1ZYOA 1G3BA 1DPOA 3PTNA 3SV9A 2A7JA 1TOCB 1HB0B 1DLKB 3RLYH 5GWZA 1PQ5A 4WMDA 2ZPRA 1EUFA 2XBVA 3NPSA 3F9HA 2PGQB 1A61H 3ZZ3A 1OWDA 2OCVB 5HIZA 1BOQA 8GCHG 4WJG2 2PP6A 1O3KA 2BLOA 3BTEE 3SI3H 4AORA 3P17H 1TONA 1QL8A 1O3EA 4BXWA 2XRCA 2PKSB 4ZKSU 2PV9B 3Q3KA 1LVYA 5T6FA 2O8LA 1EPTB 2Q6GA 2Z94A 2AMDA 1EB1H 2FWWA 3L6PA 1C5YB 2F9UA 4X6OA 1UTQA 3TK5A 2NU1E 5DP8A 5FX6A 5E0JA 1H8IH 1YP9A 2QF5A 1CE5A 2P59A 1MKXK 2A4GA 3U9AH 5TJXA 1INCA 2BD7A 5DKMA 5DP5A 1F0SA 3A82A 1BMMH 2VVCA 2FS9A 1THRH 1GMHF 2A5IA 1SLXB 1UVTH 2J97A 6CHAC 3T28A 4CBOA 3LH1A 2O8MA 2PW8H 3M5NA 3UWJH 3GYMA 1TGTA 1W0YH 4JZDH 3RXCA 2CMYA 1ELDE 3KQ5A 2AMPA 5AFZH 2AH4X 3ZV8A 1RGQA 2ZHFH 2EY4C 3SNEA 1C2JA 1TNHA 1ESBA 3RXQA 3GS9A 3A84A 4CRBA 2FOGA 3MNXA 4ABDA 1G3CA 1GL0E 1UCYE 4B76A 5L6NH 2V35A 1P12E 2XBXA 3R0FA 1AVWA 1OXGA 2ZTYA 1IQNA 3T25A 5A8YA 1A3BH 1ZTKA 4JYTA 3NZIA 4KGAA 1C5SA 1GI2A 3E0NB 2BD2A 3F2FA 1TNLA 1V2OT 3ZZ8A 3RXJA 3N7OA 3RXLA 1AE5A 4KTSA 1EZUC 4TSFD 1SOZA 1ELEE 2ZHDA 1H8HD 3NWUA 3P8OA 2CV3A 2A31A 4CRGA 1CGIE 4UEHH 1BIOA 1CHOF 2V3MA 3RXRA 3ZVAA 3PLKA 1RTKA 1Y8TA 5K0HA 2BDYA 2C8WB 2Z3CA 3QK1A 2VIDA 5L30H 4D76A 2J4IA 5JBTA 2XCNA 2SNVA 2J95A 1AN1E 2SGEE 4Y0ZE 4AOQA 2EC9H 1HJ8A 1D3PB 2Y5HA 1HUTH 2AGGX 2KCYA 1GJ9B 1WDIA 4Z1MD 5A2MH 1FZZA 1CT2E 3RXSA 1UTKA 3CENA 1GI6A 3BTHE 3GY6A 4DG4A 3KQBA 5C20A 4DIHH 2GTBA 1LPZB 3BSQA 4SGBE 3QTOH 1DWDH 3SN8A 3SZNA 1HIAB 1P05A 2P93A 3HATH 3SUEA 1BBRE 3FP7E 2JH0D 2KCPA 1NFWA 4JYUH 3SJIA 1HXFH 2Y5FA 2WPLS 1SLUB 1Z8JB 2FI5E 3OY6U 5IYTA 1SOTA 4H6TA 3HKJB 1O3AA 4XRNA 4ZHMU 5IDKA 2UWLA 3S9BA 3ZYEA 1XUKA 5PTPA 2XNDD 4E05H 1YF4A 3U8TH 1XUHA 4GUXA 2F9VA 2K8IA 2FI4E 3V7TA 1DVAH 1RRKA 1NS3A 4ABHA 2A4QA 2WV5A 1TE0A 1O2TA 1C2HA 2AGEX 1QBNA 2R3UA 4RT0A 5F53A 3SYJA 2BVRH 1E79D 3TVJB 2VB0A 1MTSA 3KHVA 1NT1A 2WPKS 2A0QB 2QE7D 4OGYA 2NWNA 1K1LA 3V12A 4DY7B 1NROH 1QL7A 3U69H 5C0UA 2I6QA 4BTUB 4GCHF 4I8KA 3ZZ7A 1W14U 1SGDE 3BTWE 1HDTH 2V7QD 5BPEA 3T26A 2BDGA 2ZU3A 5EXNA 4FU9A 1ZPCA 1D3DB 4CRDA 2H9EH 1W3CA 3OE7D 5C1UA 4B6FA 1E36B 3B9FH 3K65B 1BTPA 1DWCH 2C90B 2OD3B 4UFEH 3SU0A 1CSOE 1EZQA 6GCHF 3SUDA 2QXGA 4O3UA 5EOKA 3T2NA 2K1QA 3OY5U 1GJDB 3SHAH 4UE7H 2B0FA 3KF2A 2BY5X 3UIRA 1TX6A 1BBRH 3KQEA 1JIRA 4Q2KA 3UFAA 5T6DA 2RG3A 2WV4A 3RU4E 3KIDU 3HGNA 1OP2A 2W3KA 4IC5A 2PUXB 3KYFA 1FUJA 1BTUA 1ETTH 4WF8A 1O3NA 2BXUH 1SL3A 1HPGA 1QCPA 3ZZ6A 8ESTE 1O2UA 2WSSD 4MPVA 1LQDB 1YYY1 1BQYA 1S6FA 3M5LA 5FHTA 1OSSA 4Y10E 1O32A 3GDSA 4AG1A 1K1OA 1BCUH 1UHBA 2ZDKA 5JDUB 5EW1H 3D62A 3MO9A 4TY7A 1V2MT 3UWIA 1FXYA 1ZJDA 4JMYA 1V2ST 2SGDE 2TGAA 5JB8S 1T31A 3M7TA 3LC5A 1NESE 1FY1A 1ZZZA 3HKIB 4ZCNA 1TMTH 1G2MA 1IHTH 4ZH8A 5HKKD 4B2CA 4LXBH 1SQRA 4GHTA 1TQ0B 3ZZ4A 4ABEA 2GV6A 5EIYA 4ZAEA 3TJNA 3S9CA 1AB9C 1O2KA 3ZVBA 8KME2 3F9FA 5C0TA 1TIOA 1MD7A 1GDNA 3QWCH 2G5NA 4I7YH 4FVBA 1YPGH 3A7TA 3E16B 1OHHD 1P2IA 2FOFA 4A7IB 2QIQA 2VWMA 1DWBH 3HPTB 1THSH 2GCHF 1ZMJA 4MPWA 2WPMS 3BF6H 1LVOA 1HAGE 2VWNA 2EA3A 1FLEE 3P8GA 3UQOA 3VB4A 1EB2A 5F6MA 5C3NA 2Z9LA 1GG6B 1NRPH 1FN6A 1AD8H 1XKAC 3Q76A 2VGCB 4IMQA 1BUIA 3UPEA 3B23B 1O3CA 1C9TA 1ZR0A 1A0LA 3SUGA 1P3EA 4NWKA 1OWJA 2TRMA 3E8LA 3SOSA 5GPIB 1UTPA 2ANWA 1C4U2 1TBZH 1BHXB 5HYOA 3R3GB 3QO6A 2FOEA 4CHAC 1KXDA 2HLCA 1V3XA 2BDHA 1AKSA 1C4V2 2P16A 2CF8H 3OEHD 3RXHA 3E6PH 4INLA 2ULLA 1GBDA 1GMCG 1O35A 2O9QA 4FUFA 3P6ZB 2VJ1A 3TJVA 2CXVA 4FUDA 4K3JA 4X8SH 1BRUP 2B5TB 3LGYA 1FMGA 1UTOA 4MLFB 2L6OA 4OS2A 5EU8A 3FAOA 2OK5A 3M61U 3RXAA 1VCWA 1YLNA 4HGCA 2RDEA 3ZVCA 4ACBA 2ZF0H 1SKYE 3OFND 3TGJE 3NRLA 5CHAB 3E1XB 4ZKNU 4XBBA 1W2KH 3GCHC 3SGAE 1S85A 4OS5A 1FIZA 1C5QA 1MTNB 1N6XA 1UHBB 1SFQB 2TBSA 2ANKH 2J5UA 1KLJH 2QXHA 4NFEA 2BQWB 3OU0A 2PR3A 1YY3A 3W94A 2HWLB 1SI5H 2PFEA 1EKBB 1ETRH 1GJAB 3TK6A 2WINI 3SW2B 2Z9IA 1TABE 1Y3YA 9ESTA 5AF9H 1IAUA 2W26A 1ZGVA 2OXSA 3UNRA 1AFQC 1OWKA 2BDCA 4U30A 1YPJH 4E7RG 5HMAA 1F2SE 4UFFH 5FBIA 5DJ7A 2B9LA 4TWYA 4X6NA 3BTFE 1PJPA 1OWIA 1ANDA 4CH8B 4B6EA 3LJOA 4OS6A 3M5MA 2BD5A 5DP3A 3SV6A 4B75A 1DLEA 1AO5A 5FPYA 3U1IB 3TJUA 2H5CA 3NUMA 1SHHB 2R0LA 3TGIE 2G8TA 3MO3A 3P92A 2IPHA 1K1MA 1UW7A 5EQQA 3STIA 5A8ZA 4MNYA 5E2OA 2UUJB 3VB6A 2GMTC 1C1PA 1C2KA 1QNJA 1SGCA 4AFZA 1WUNH 4NIWA 1TWXB 1WXRA 4NSVA 1A46H 1N8OB 3FZDA 2C8ZB 1TA2A 1Y3UA 2BY9X 4A1TA 4ZXYH 2PHBA 1D3QB 3EA8A 3ZZBA 5F8XA 2P8OC 1VITF 1ANBA 4INKA 3TLOA 2O8WA 1HJAB 1GMCF 1AKSB 1ZHPA 2ZU2A 5CHBA 1O31A 4YESB 5ETXA 3FANA 1TPPA 2ZQ2A 3KYGA 2Y6TA 1S81A 2HVYB 1O2NA 1K1IA 1IQIA 3BTTE 1SGTA 1NFUA 2OC8A 2CN0H 5EXLA 1TYNA 2ZC9H 2BTCE 3LONA 3K6YA 1HBTH 1JMOH 4X0WU 3CS0A 1NFYA 3FKSD 1VGCB 1GI0A 2Z9GA 3PLPA 5G4BA 1ZHMA 3VEQB 1GWAA 2QCYA 2ZDAH 3KNXA 4I86A 1OPHB 3RXPA 4AFUA 1PQ7A 4X2YA 2AGIX 1LO6A 2DE8A 2GCTC 2P3FH 2Y5GA 4I32A 2Q1JA 1CQQA 1ESTA 1Q31A 1B0FA 2HNTE 4YT6H 1SQTA 2Y7XA 2A4RA 2WPJS 3EA9A 3M7UA 4NIXA 4D7FA 3FN8A 2CF9H 4RKOB 1SQAA 2VH6A 1V2UT 2VIQA 1YPLH 2LP6A 3RLWH 1FY8E 2A7HA 3F2GA 2BXTH 4BXSA 3LGIA 1CT4E 4JK6A 1F0RA 3LKWA 1MCTA 3GCOA 2ZG0H 2VWOA 3RXVA 1HAOH 4CH2B 3KGPA 2VU8E 4BAQB 1PPGE 1FAKH 5B6LA 5CMXH 3SNAA 2W3IA 3RXFA 2FMJA 2XWBI 3OX7U 1E35B 4K8BA 1EJMA 1OS8A 1O3MA 1MQ6A 1HAYB 1P8VC 5FXLA 2PKSC 4I33A 1B0EA 1BTXA 2PSYA 3O8RA 3KQCA 4CREA 4IC6A 1EPTC 1L1JA 1NU9A 4ABAA 2OQUA 1UTLM 1HAZB 4FVDA 1DY9A 2BD3A 2A5KA 1Y59T 1GBHA 2GZ9A 1D6WA 3U8RH 1OX1A 5DGJA 4YLUA 1SVPA 4TT3D 2CGAA 2IN2A 4ISNA 1MH0A 3S7HB 3M36A 2F43B 3SZEA 5AFYH 1GCDA 2BZ6H 1YGCH 1DDJA 3AW0A 1CA8B 3ATLA 2ZHQH 2THFB 4ASHA 1FN8A 3TJOA 2H9TH 4K2YA 1RD3B 2F3CE 1C5PA 3WWBA 1Y5BT 2AIQA 1JXPA 7LPRA 2BD9A 1HNEE 1P2NA 1A2CH 1UTJA 4FETA 1L4ZA 3A81A 3RM0H 4X6PA 2ALPA 4HZHA 1AGJA 1P2MA 3C27B 4K1EA 2BDBA 4PROA 1DE7H 1CHOG 1KYNA 1QGFA 4IN1A 3UOUA 1ELCA 1W7GH 1C1RA 1QY6A 4NA8A 1WSSH 3GY2A 4Y11E 4YOIA 4MNXA 2H2ZA 2EI7A 1NO9H 3SHCH 4JZ1A 2ZPSA 1OOKB 3EGKH 3M35A 1SMFE 1T8MA 3SV7A 2QYIA 1FV9A 3RXMA 3TITA 2Y7ZA 1NM6A 1P2KA 2BOKA 2FOBA 5DK1A 3MU4A 2UUYA 3ESTA 1QQ4A 1DITH 1HIAA 2FOAA 2ZCKP 2VNTA 3Q00A 1GBLA 5ESTE 5EG4A 1L0ZA 1FI8A 1K9OE 2O8UA 1O37A 1MU8B 2A2QH 3LGTA 1TQ7B 1GHXH 2KAIA 1GCTB 4X2VA 1D3TB 2XOKD 4NA9H 5LGOA 2OLGA 1P03A 3VFEA 1KSNA 2HLDD 1TPSA 4INHA 5KGOA 1H8ED 1MZAA 3DCLA 5FX5A 1P2QA 2JETB 1C1TA 1T4VH 2J2UA 1TALA 1ZTLA 1TPOA 3RMLH 4B1TA 1P0SH 4KP0A 1BMFD 1KLTA 1BA8B 3P70B 1C2GA 1TA6A 2BQ6B 1NRRH 4JZIA 2ZP0H 1MZDA 1Z8GA 1FNIA 2FESH 5A0BA 4IN2A 2ZCLP 3ENSB 2OBQA 3QX5H 1TX8A 4ABFA 4FOUC 4AGJA 1LKAA 2PGBB 2JKHA 1ZRBA 3MU1A 4TPIZ 1VKYA 2F83A 2FYRA 1AWHB 1GMDG 2FTLE 4ISIH 2FI3E 2V3OH 1ELGA 2XC5A 4ABJA 3QDZB 4X1PU 1ZRKA 3M5OA 3UR9A 3MU8A 1GHZA 1MBQA 1WCZA 2A45B 3PMJA 3MQKC 2BY8X 2B8OH 4GCHG 1GDUA 4R0IA 2WYJA 2A2XH 5EJZA 2QV1A 3PMAB 1J9CH 3DFLA 2LPRA 1OYQA 3RC6A 4Y76A 2JH5D 2Z9JA 5BRRE 4JYVH 1O3OA 3PM3A 6GCHG 3BG4B 2ZGHA 5A0CA 3GY3A 4FUJA 3H5CB 3Q3XA 3UB0A 3RMMH 3MNSA 5I25A 1AWFH 2BDIA 1CA0C 1QHRB 3PO1B 3PWCA 1VCPA 4K1SA 4Y7AA 2GZ8A 1MKWH 1TPAE 2QA9E 5C67A 5JBBS 2R3YA 1DM4B 4M7GA 1UK3A 4XE4A 1O2PA 5FCKA 1O2GH 2STAE 3RXKA 3MHWU 2GV7A 4ZHLU 1BB0B 4ZUHA 3IG6B 1BMNH 1IQMA 1UVUH 1YBWA 4BNRA 1SGRE 1XX9A 3LGVA 2RFKC 1DWEH 3PYHA 2ZHEH 1NPMA 1O5EH 2KAIB 1JIMA 1QFKH 1MTWA 4GLYA 5B6OA 1LVBA 1EATA 1LQEA 1O3LA 2WUBA 1C5WB 2FM2A 2W7UA 5T1VA 4NIVA 1TGSZ 1WU1A 5A09A 1C1VH 1C5UA 4Y0YE 7KMEH 4KKDA 1O3PB 1OP8A 2C3SA 1GL1A 2SNWA 2KZ4A 2IPQX 1F5RA 2SFAA 4U32A 4K5ZA 1UCYH 1MTVA 4GAWA 1AI8H 1S82A 3URDA 4OS4A 1EP5A 4Q63A 1GVKB 2ZDLA 4NWLA 1L4DA 1MU6B 1QTFA 5E0GA 1G30B 1O2WA 8LPRA 4X2XA 1IQJA 1CA0B 3UR6A 3EYDA 1OWHA 3V13A 3EE7A 3VGCB 2FOHA 3BIUH 1GMDF 1Q2WA 3VB5A 4LOYH 4YZUA 1O30A 1WYKA 3F9EA 2QGRA 1NU7B 2ZU4A 1CHGA 4WVPE 2GCHG 1EOJA 5DN6D 5LH8A 4CRFA 3A7YA 2BHGA 1Z1IA 4WWYA 2TGDA 1DY8A 1BTYA 5J4SA 1K22H 4NG9H 5KECA 5DP4A 1EXFA 2Y80A 3MTYA 1MTUA 3PRDA 4K8YA 1O2RA 3A89A 1HAPH 3HGPA 1FX0B 1X7AC 1IOEA 3GICB 4D9RA 1TMBH 1W11U 2FTMA 2QC2A 3SNBA 2DE9A 2ZPQA 4QT8C 5DG6A 4AC9A 2V3HH 4JK5A 3W1EA 3HK3B 1LKBA 1LPKB 3F68H 5DO4H 4WXIA 5GNDA 4AFQA 2FYQA 2KX4A 1C1UH 1BZXE 1GBTA 1GI5A 3PV4A 4F49A 3MH7A 2RCEA 4Z0KA 4BTTB 4MQAA 3S69A 4DT7B 1UVSH 1UVPA 3DT0H 2GJGA 2AIPA 1G9IE 1DUEA 1ZGIA 4BANB 1SBWA 2UWPA 1C9PA 4NFFA 4X8TH 1LHGH 2A7CA 3A8DA 1CBWB 2F91A 3E91A 1DSUA 3U8OH 4X1QU 1V2NT 1NZQH 1HAIH 3VXFH 1G2LA 2NU2E 1O3BA 1LPGB 1GHYH 2ILNA 3SO3A 1C5TA 3T29A 1GG6C 1C5RA 4BOHA 2FDAA 1K28D 1Y3XA 5FBEA 1ACBE 1K0HA 1UMAH 2VGCC 1CU1A 1BMLA 2FX4A 1TRYA 5F8TA 3SGBE 1CO7E 1YLDA 1YPHC 2ODQA 5AVDA 3SV8A 3F6UH 2BY7X 2PWXA 1C2MA 3ODDA 4NZQA 2PSXA 1O5BB 1GGDB 7GCHG 4H42U 5AHGH 5HGGA 1ZJKA 1TGBA 3TU7H 3PV5A 2ZECA 1AMHA 4NA7A 5A8XA 1E0FD 1T7CA 4GSOA 1O2VA 3UREA 3A86A 5E2PA 1Z71A 1O34A 2KCAA 1AUJA 2AMQA 3RU4D 4AYVB 1N6YA 2DUCA 3GY7A 4YOGA 1QRWA 3GCNA 1C5LH 3RM2H 1KXAA 1YCPM 1QRZA 3SJ8A 2BD8A 2QN5T 5CHAC 2FX6A 1PPCE 1JRTA 5IK2D 2AYWA 1MTNC 1HLTH 4BAMB 5L2ZH 2J38A 5JPMH 4F4OC 1LHEH 5GXPA 3FO8D 4UD9H 1NTPA 4B74A 1GJCB 2BM2A 1ELVA 2TPIZ 4MTBA 3WW7A 1C2FA 1XM1A 4O3TA 2VVUA 2J92A 1FJSA 1O3GA 2WPHS 1V6DA 2ZQ1A 3RXUA 5HXFA 2YMSB 2FODA 1VITG 4CRAA 4DT4A 1QZ8A 1GBKA 1RXPA 2Y82A 3UNQA 2TIOA 4CRCA 1T8NA 3F9GA 3RXTA 1FPCH 2J98A 7ESTE 2KM0A 1O5GH 4DCDA 3DA9B 4K1TA 3NCLA 1YPMH 2XC4A 4OS1A 3CP7A 1GI9B 1F5LA 3OTPA 1EOLA 3U1JB 1S0QA 1O3JA 1QURH 2B7DH 3SQHE 2V6NA 5LPFA 3SU4A 2GT7A 3K9XB 1G32B 1EAXA 1XMNB 2CHAB 1ARBA 4M9FA 3RU4T 3ZZ9A 4A6LA 1D9IA 1RTFB 3ODFA 4GHQA 1TMUH 1GI7B 1OYTH 1SHYA 2XCFA 4Y8ZA 2SGAA 1A7SA 1TGNA 1YC0A 1NFXA 3ATIA 3N99A 3U98H 1GJ6A 2ZDMA 5EQSA 4ZHAA 1SQOA 1ZMNA 2O8TA 1N8OC 1WV7H 2H6MA 1DX5M 5FL7D 2J34A 1GBMA 1O2ZA 3MI4A 3A8BA 1VCQA 1O2IA 7GCHF 1H9LB 3MOCA 4UDWH 3D23A 3A85A 1AHTH 3MU0A 4Q80A 2NU3E 1DXPA 1GBEA 2KCOA 2ZZUH 3F3BA 1F7ZA 3F1SB 4X2WA 1UK2A 1HJAC 4FU8A 4ZROA 2VIPA 3PTBA 5DSFA 3LC3A 1BMAA 1HAVA 4U01A 1GJ5H 6ESTA 4FUIA 3SJ9A 1BRCE 3H7TA 5C1YA 2ZI2H 4B73A 2FXRA 4CR5A 2EI6A 1ZSLA 1DOJA 2UUFB 1TX7A 1SC8U 1RIWB 1TB6H 1NRSH 2ZU1A 4XFQA 5H4IB 1QR3E 2F4LA 4XDEA 1V2WT 3E3TA 1P2OA 2VWLA 1VGCC 1W8BH 4DJZB 1BHXF 4TYDA 2LELA 3VPKA 3T27A 1W0KD 1HAXB 1NRQH 3QGJA 2OUAA 4DOQA 3RC4A 3MFJA 4FUBA 3AAUA 3OAAD 1VJAU 1O2QA 1YWUA 2F9PA 2GVFA 2PTCE 3SNDA 1GHVH 3RXDA 1UVOA 1TGCA 2ZFRH 3WY8A 1T32A 3FVFB 1K1NA 2ESTE 3I77A 4Q7XA 3QLPH 2BZAA 3VXEH 1BJVA 1GBJA 4YLQH 5EODA 1O2MA 3JZ1B 1K1JA 2JJ2D 4UONA 4IMZA 1Z6EA 1KXFA 2J98B 1A0JA 3SU6A 3FZZA 3U28C 1SGNE 3G01A 1S6LA 2ZU5A 5C94A 3IITA 1P11E 4Y71A 3BIVH 4Z6AH 4Y7BA 2ZEBA 4ACAA 3K2UA 1IQFA 1P57B 2JH6D 2GT8A 1A3EH 4TY6A 1YKTA 1QJ1B 3SJKA 1HYLA 1Z6JH 5EJ1A 1S83A 4AFSA 1YCPH 3L3TA 1GJ4H 4WH6A 5FAHA 1M9UA 5SGAE 3TGKE 4FUHA 1PPZA 1QQUA 4GVUA 1CVWH 3S9AA 2ZDVH 4R8TB 1C5VA 3E90B 1LVMA 3SGQE 5EPNA 1NBMD 1C1OA 3URCA 6LPRA 4YTAA 1YLCA 1E38B 1B7XB 1C2EA 3ZZ5A 2XTTB 4FXGH 2F9NA 3BTME 3MYWA 1P02A 3T62A 3CS7A 4BTIB 1BRBE 1QJ6B 3LOXA 2FOCA 1HAVB 3BG8A 2Z9KA 2P3UB 2WYGA 3F0PA 3ATKA 4X1RU 1BTZA 1WQVH 3DSPA 1IQLA 1ETSH 1W10U 1H8DH 1A5HA 1O2YA 1MBMA 2W7SA 1CT0E 3RC5A 1SLWB 3O8CA 2VIWA 1QB1A 1JWTA 1AVXA 1AVGH 4B71A 1QB6A 2YMSD 3RP2A 2P95A 2SGQE 3K6ZA 4E06H 1QBVH 4A1XA 1TNIA 5JBAS 4CBNA 1HAHH 3QGNB 2IJD1 2D2DA 1BT7A 3A7VA 4BAHB 4ABIA 2H9HA 4WH8A 2GZ7A 1A5IA 3A7XA 1AZ8A 1XVMA 3SQEE 1V2QT 2FP7B 1IQGA 1NY22 2R2WU 5EW2H 2ZDNA 1O36A 4I8GA 2ODPA 1GCTC 1MKXH 1EFRD 1DUAA 1H9HE 1GJ8B 2QXJA 2WHXA 3ZIAD 2TGTA 2JETC 1AQ7A 3V0XA 2ASUB 1C1WH 2GGVB 4NGAH 2BLQA 5TCAA 1XXDA 1THPB 1HRTH 3LGWA 1FAXA 4H6SB 2ANYA 2BQ7B 3LT3A 3IWMA 1RFNA 1S6HA 1GI4A 5A0AE 1HV7A 1EASA 1O5DH 5EPYA 1W0JD 3ZVEA 2QF3A 3O8BA 3M7QA 1GJ7B 1ZMLA 2D1JA 4A5TS 4XBCA 2RA3A 4ZXXH 1VITH 1DICA 1GI1A 1J14A 3F0OA 5DP9A 1SGFG 2ZIQH 2XYAA 4YM9A 1KIGH 1A4WH 4HI3A 4XSKU 1XUIA 3UY9A 4IGDA 3TH3H 3A80A 2J94A 1O0DH 1P09A 5ABWA 5T3HA 1ID5H 2QF0A 3ZVDA 3DHKH 3SUFA 1DXWA 2L74A 4WXVA 1P10A 2GDEH 2HVXA 3GYLB 2AS9A 2ZGBH 1HJ9A 1BTHH 1C2DA 3I29A 2ZHWH 4WY3A 1ZPBA 1TLDA 4RI0A 3RXOA 5EGMA 1GHAF 1Y5AT 3GCTF 2ZFSA 3UQVA 2BVSH 2XBWA 1YM0A 2I6SA 3Q77A 1H4WA 1H9IE 1O5CB 2BMGB 3BG4C 2K0QA 2G51A 1O33A 1C1MA 2CK3D 1O5AB 1V2PT 3PWBA 2AERH 1L1GA 4HFPB 5HM9A 2G55A 1A1RA 3PO1C 3PROA 2PTNA 1SGYE 1XKBC 3ZZAA 4BAOB 4AB8A 4IW4E 4RN6A 2GKVE 1WAYB 2OC7A 1GBBA 1GBFA 1F92A 1TRNA 3MO6A 2ZFTA 1NRNH 3M3SA 1O3HA 1D4PB 1NC6A 2WPDD 1O3FA 1IQHA 3A87A 3SU5A 2BX3A 1GDQA 4OS7A 5C5OA 1UO6A 2QAAA 3A83A 3ITIA 3AK5A 3GISB 2C8YB 4RT1A 3QUMP 1PPHE 2EEKA 1G37A 4AB9A 3P95A 2W5EA 3A7ZA 2YNAA 2PKAA 2G81E 1PFXC 4D7GA 3RDZA 2R9PA 1UJ1A 1RTLA 1O2LA 3UUZA 3PMBB 3TNSA 3ELAH 5J4QA 1MABB 1EQ9A 4DVAU 2CJIA 3LDXH 1ELFA 1C5XB 1WQSA 3QZQA 4I8JA 3KEEA 4DIIH 1QB9A 3SU3A 1DANH 4MPXA 1QRXA 1ELBA 1KXBA 3OTJE 3UNSA 6CHAB 2H5DA 1Z7KA 1JRSA 3VGCC 3PLBA 2ANMH 1HGTH 8GCHF 1ARCA 1COWD 3MH4A 4A92A 2NU4E 4KTCA 4ZMAH 4Y8YA 2JIZD 3BV9B 3PRBA 3FP8E 3GY8A 1V2RT 5F03A 1QJ7B 1C1NA 5GDSH 3ATMA 2ZA5A 4JZEH 1TBRH 1CGHA 2G4UA 5E8EH 3ZV9A 3A88A 2FEQH 1T8LA 3ZVFA 2R0KA 1XVOA 1A0HB 3AAVA 2HRVA 1Y3WA 3L33A 1E34B 1FY4A 1E1QD 4UFDH 1QL9A 1LTOA 2BOHB 1FY3A 1JOUB 1P2JA 4X6MA 1EP6A 1P3CA 4SGAE 2ZGJA 1T4UH 2BLVA 3QZRA 5KEDA 2ZWLH 4WMFA 3EA7A 2NU0E 3O8DA 1ZTJA 2ZFQH 1JBUH 3W95A 4RSPA 3A8CA 4FUCA 3AASA 2G4TA 2JJ1D 3NK8A 1IQKA 3KL6A 3BEUA 4Y8XA 2Z3EA 3KQDA 3HK6B 1AU8A 1SFIA 3MH5A 1XXFA 1Z8IB 1GBCA 1FONA 1VJ9U 1CBWC 3BTQE 4JZFH 3LPRA 1A5GH 2C4FH 1GHBG 4Y6DA 3DSGA 5TCCA 5EXMA 2QF4A 2GDDA 1C2IA 1MKWK 3SNCA 1YPKH 2FLBH 1F0TA 2A1DB 4IBLH 1BITA 3FFGA 2C8XB 5FPTA 1EAWA 3TIUA 3A8AA 1IQEA 3UTUH 2HALA 4KTUA 2M5TA 2FPZA 4NIYA 2XWAA 4X1SU 1V2KT 3KN2A 5C5NA 3BTKE 2PKAB 2XXLA 2YNBA 5L2YH 1UK4A 3KCGH 1PQ8A 3QN7A 1S0RA 1GBAA 3GY5A 3PB1E 1SB1H 1GGDC 2FO9A 4THNH 2Z3DA 1MAYA 2G5VA 4Q7ZA 4I8HA 2YOLA 1P04A 1UCYK 1OWEA 4AN7A 3BN9A 1ABJH 2BLWA 3GDUA 3S0NA 1DSTA 1GJBB 2Q6DA 1P9UA 2ZTZA 2BDAA 2GX4A 1L1NA 5GCHG 1PYTD 1FY5A 4E7NA 1FIWA 1TNKA 1GPZA 1SGPE 9LPRA 2FS8A 5C17A 1O2JA 2ZGXH 1E37B 1LHCH 1KTTB 2BX4A 4MDSA 4B2AA 2ODYB 4TPYA 1C2LA 3ZYDA 1KY9A 4I31A 2M2AA 4U2WA 1O2SA 1GHWH 4IS5A 1AE8H 3RXBA 3RMNH 1VR1H 1N1LA 3S7KB 3TNTA 2EQNA 3OSYA 1DFPA 3QTVH 1C1QA 3MMGA 1B5GH 2TGPZ 3AVZA 1RJXB 3TPIZ 2HPQH 1IHSH 2YMSC 1AFEH 4J1YA 1MCVA 3PV2A 2ZKSA 2H1UA 3TH2H 2VIOA 2UWOA 3DD2H 1O38A 2VBCA 1LHFH 4LZ1H 3PMHB 3D49H 2VH0A 3TK9A 2OTVA 5DP6A 1ELTA 1GHBF 4A1VA 3V3MA 5JBCS 3ZZCA 1BBRK 3JZ2B 1PPBH 1KXCA 1PPEE 3LH3A 4NSYA 4X8VH 2WPIS 3GDVA 2VIVA 1GBIA 4O97A 2A5AA 3TH4H 1LCYA 2HNTC 2V0BA 4MNWA 2WUCA 1ANEA 2AEIH 4B2BA 1OP0A 2CHAC 3NKKA 4VGCC 2Q6FA 1BTWA 4XD7D 3ATWA 1KMHB 3SU1A 1W0ZU 1WTGH 1KLIH 1G3DA 3MNCA 1Z1JA 4NCYA 5C2ZA 3N7EA 4LZ4B 4X8UH 2P94A 3SI4H 4K60A 5JB9S 2AHME 1EAIA 3EE0B 3MNBA 2UUKB 3RMOH 2ZGCA 3MH6A 2BY6X 1EJAA 1LDTT 4X1NU 1O2XA 2OC1A 4K69A 1BJUA 4WMEA 1EJNA 3A7WA 3DUXH 4OM9A 5GCHF 2PUQH 2BVXH 4DW2U 1HCGA 2R2MB 2IJOB 1WBGB 1AZZA 2VINA 3FP6E 3H09A 1RIWC 1C5NH 1ZHRA 2KR7A 2D8WA 1QBOA 1O3DA 3SJOA 4BAKB 1AB9B 2HGTH 1EAUA 1TRMA 1EX3A 3RXEA 5DPAA 1SG8B 3WWFA 4Q7YA 2QXIA 3RXIA 1TOMH 1GI3A 1HFDA 4VGCB 4P02A 4CR9A 4ZKOU 1O39A 3MWIU 5I46H 1ZSKA 1O5FH 4MNVA 3F2HA 1XUGA 4NZLA 1SSXA 1GVZA 5CDFE 4JCNA 2KFWA 3SV2H 2RA0A 5CE1A 4XBDA 1NN6A 5LPEA 1ANCA 4YXWD 3GY4A 4I8LA 2SGFE 3ZVGA 3DFJA 2P3TB 4HTCH 2LNCA 3STJA 5E0HA 5FPSA 1TNGA 4AG2A 1T8OA 5GIBA 1UTMA 1DS2E 2ALVA 1YPEH 1FDPA 3SU2A 3FOAA 3LU9B 1L2EA 4ISLA 1J8AA 1MUEB 5T6GA 1G36A 1O2HA 1S84A 1PPFE 2W6ID 4CHAB 1SGEE 4P00A 3OEED 1P01A 1VZQH 4YT7H 2BD4A 4AZ2B 2GD4B 4GPGA 1J17T 4Y79A 1SGIB 5F8ZA 1WOFA 2D26C 1AIXH 1Y3VA 2IOTA 2FIRH 5EJLA 1D6RA 2XNIA 2OC0A 1SR5C 1GI8B 4ASUD 1GVLA 2HPPH 1KDQA 1C5OH 2ZFPH 1Q3XA 2PLXA 4ESTE 2EI8A 5HIYA 3EDXB 3M37A 3UOPA 3GCHB 1V2LT 3LJJA 1BDAA 1PQAA 2WV9A 3H7OA 4AX9H 1J15A 3VG8A 2Y81A 2OINA 4MPUA 1Z8RA 2HNTF 4FUGA 2BYAX 1V2JT 2G00A 2J9NA 1NBME 1TAWA 4OGXA 1ESAA 3P8NA 1XUFA 1CGJE 4TWWA 4ABBA 2XC0A 3MU5A 5ESBA 2Z6BD 1XUJA 1C4Y2 1KXEA 2OP9A 2QY0B 1RS0A 5HM2A 1ABIH 1YPHE 1AFQB 2ZFFH 1BRAA 1V2TT 2OBOA 2ZO3H 1V2VT 1QA0A 1QIXB 3EQ0H 2C93B 2JDID 1TBQH 4DURA 3C1KA 1DT2A 5FCRA 4MG3A 1C5ZB 1W7XH 5JYIA 2FZZA 1LMWB 2A4OA 3NXPA 1H1BA 1ZSJA 1P9SA 3D65E 1O2OA 1Y5UT 2XBYA 3DSOA 4O9VA 1UTNA 3I78A 1C1SA 1ZLRA 3P8FA 1G3EA 1OKXA 3ZZDA 3RUOA 2OQ5A 3T5FH 3CNRA 3SORA 4YOJA 2WZQA 4H4FA 1MAXA 1EPTA 1EZXC 3Q3YA 3B8JA 2A32A 2ZCHP 1QA7A 1K1PA 2GMTB 2GP9B 2VVVA 1F0UA 4HG6A 1MD8A 2BB4A 3GOVB 4MVNA 5DP7A 1J16A 1ZPZA 4F48B 3M3TA 3EAJA 1AUTC 1KTSB 4YO9A 3SBKA 4ISHH 1SGFA 1GHAG 3GCTG 5LPRA 1HXEH 1C5MD 2F9OA 2P8OB 3E0PB 3LIWA 1W13U 4RKJB 1W12U 4FUEA 2XW9A 1K21H 1SGQE 2W6JD 3LGUA 4D9QA 4UFGH 1AY6H 1SPJA 1EZSC 3BTDE 3N7DA 2F9BH 1GMHG 4LK4A 4ABGA 1WTHD 1TFXA 3BEIB 1SLVB 2STBE 5C1XA 1P06A 4O03A 5K7RA 1ELAA 2FOMB 1FPHH 4XOJA 4FU7A 3BTGE 4ISOA 4D8NA 2ZTXA 1F5KU 4KELA 4ZKRU 3BEFB 1KDQB 5GJ4B 4AGKA 3VB3A 2RDLA 3OYPA 1MQ5A 1ZOMA 1YCPK 4Q4LA 4DGJA 3M3VA 3AW1A 1TNJA 2Z7FE 4AYYB 2G52A 2GCTB 5EQRA 1K2I1 2ZNKH 1MMJN 3RXGA 2FLRH 2SGPE 4J2YB 1U6QA 2AFQB 3UAIC
chains in the Genus database with same CATH topology
1O3IA 2HOBA 1FQ3A 3VB7A 1PYTC 1LHDH 1ORFA 1S5SA 1ZYOA 1G3BA 1DPOA 3PTNA 3SV9A 2A7JA 1TOCB 1HB0B 1DLKB 3RLYH 5GWZA 1PQ5A 4WMDA 2ZPRA 1EUFA 2XBVA 3NPSA 3F9HA 2PGQB 1A61H 3ZZ3A 1OWDA 2OCVB 1BOQA 8GCHG 4WJG2 1O3KA 2BLOA 3BTEE 3SI3H 4AORA 3P17H 1TONA 1QL8A 1O3EA 4BXWA 2XRCA 2PKSB 4ZKSU 2PV9B 3Q3KA 1LVYA 5T6FA 2O8LA 1EPTB 2Q6GA 2Z94A 2AMDA 1EB1H 2FWWA 3L6PA 1C5YB 2F9UA 4X6OA 1UTQA 3TK5A 2NU1E 5DP8A 5FX6A 5E0JA 1H8IH 1YP9A 1CE5A 2P59A 1MKXK 2A4GA 3U9AH 5TJXA 1INCA 2BD7A 5DKMA 5DP5A 1F0SA 3A82A 1BMMH 2VVCA 2FS9A 1THRH 1GMHF 2A5IA 1SLXB 1UVTH 6CHAC 3T28A 4CBOA 3LH1A 2O8MA 2PW8H 3M5NA 3UWJH 3GYMA 1TGTA 1W0YH 4JZDH 3RXCA 2CMYA 1ELDE 2AMPA 5AFZH 2AH4X 3ZV8A 1RGQA 2ZHFH 3SNEA 1C2JA 1TNHA 1ESBA 3RXQA 3A84A 4CRBA 2FOGA 3MNXA 4ABDA 1G3CA 1GL0E 1UCYE 4B76A 5L6NH 2V35A 1P12E 2XBXA 3R0FA 1AVWA 1OXGA 2ZTYA 1IQNA 3T25A 5A8YA 1A3BH 1ZTKA 4JYTA 3NZIA 4KGAA 1C5SA 1GI2A 3E0NB 2BD2A 1TNLA 1V2OT 3ZZ8A 3RXJA 3N7OA 3RXLA 1AE5A 4KTSA 1EZUC 1SOZA 1ELEE 2ZHDA 3NWUA 3P8OA 2CV3A 2A31A 4CRGA 1CGIE 4UEHH 1BIOA 1CHOF 3RXRA 3ZVAA 3PLKA 1RTKA 1Y8TA 5K0HA 2BDYA 2C8WB 2Z3CA 3QK1A 2VIDA 5L30H 4D76A 2J4IA 5JBTA 2XCNA 2SNVA 2J95A 1AN1E 2SGEE 4Y0ZE 4AOQA 2EC9H 1HJ8A 1D3PB 2Y5HA 1HUTH 2AGGX 1GJ9B 5A2MH 1FZZA 1CT2E 3RXSA 1UTKA 3CENA 1GI6A 3BTHE 3GY6A 4DG4A 3KQBA 5C20A 4DIHH 2GTBA 1LPZB 3BSQA 4SGBE 3QTOH 1DWDH 3SN8A 3SZNA 1HIAB 1P05A 2P93A 3HATH 3SUEA 1BBRE 3FP7E 2JH0D 4JYUH 1NFWA 3SJIA 1HXFH 2Y5FA 2WPLS 1SLUB 1Z8JB 2FI5E 3OY6U 5IYTA 1SOTA 4H6TA 3HKJB 1O3AA 4ZHMU 5IDKA 2UWLA 3S9BA 3ZYEA 1XUKA 5PTPA 4E05H 1YF4A 3U8TH 1XUHA 4GUXA 2F9VA 2FI4E 3V7TA 1DVAH 1RRKA 1NS3A 4ABHA 2A4QA 2WV5A 1TE0A 1O2TA 1C2HA 2AGEX 1QBNA 2R3UA 2BVRH 3TVJB 2VB0A 1MTSA 3KHVA 1NT1A 2WPKS 2A0QB 4OGYA 2NWNA 1K1LA 3V12A 4DY7B 1NROH 1QL7A 3U69H 2I6QA 4BTUB 4GCHF 4I8KA 3ZZ7A 1W14U 1SGDE 3BTWE 1HDTH 5BPEA 3T26A 2BDGA 2ZU3A 5EXNA 4FU9A 1ZPCA 1D3DB 4CRDA 2H9EH 1W3CA 5C1UA 1E36B 3B9FH 3K65B 1BTPA 1DWCH 2C90B 2OD3B 4UFEH 3SU0A 1CSOE 1EZQA 6GCHF 3SUDA 2QXGA 4O3UA 5EOKA 3T2NA 2K1QA 3OY5U 1GJDB 3SHAH 4UE7H 2B0FA 3KF2A 2BY5X 3UIRA 1TX6A 1BBRH 3KQEA 1JIRA 4Q2KA 3UFAA 5T6DA 2RG3A 2WV4A 3RU4E 3KIDU 3HGNA 1OP2A 2W3KA 4IC5A 2PUXB 1FUJA 1BTUA 1ETTH 4WF8A 1O3NA 2BXUH 1SL3A 1HPGA 1QCPA 3ZZ6A 8ESTE 1O2UA 4MPVA 1LQDB 1YYY1 1BQYA 1S6FA 3M5LA 5FHTA 1OSSA 4Y10E 1O32A 3GDSA 4AG1A 1K1OA 1BCUH 1UHBA 2ZDKA 5JDUB 5EW1H 3D62A 3MO9A 4TY7A 1V2MT 3UWIA 1FXYA 1ZJDA 4JMYA 1V2ST 2SGDE 2TGAA 5JB8S 1T31A 3M7TA 3LC5A 1NESE 1FY1A 1ZZZA 3HKIB 1TMTH 1G2MA 1IHTH 4ZH8A 4B2CA 4LXBH 4GHTA 3ZZ4A 1TQ0B 4ABEA 2GV6A 4ZAEA 3TJNA 3S9CA 1AB9C 1O2KA 3ZVBA 8KME2 3F9FA 1TIOA 1MD7A 1GDNA 3QWCH 2G5NA 4I7YH 4FVBA 1YPGH 3A7TA 3E16B 1P2IA 2FOFA 4A7IB 2QIQA 2VWMA 1DWBH 3HPTB 1THSH 2GCHF 1ZMJA 4MPWA 2WPMS 3BF6H 1LVOA 1HAGE 2VWNA 2EA3A 1FLEE 3P8GA 3UQOA 3VB4A 1EB2A 5F6MA 5C3NA 2Z9LA 1GG6B 1NRPH 1FN6A 1AD8H 1XKAC 3Q76A 2VGCB 4IMQA 1BUIA 3UPEA 3B23B 1O3CA 1C9TA 1ZR0A 1A0LA 3SUGA 1P3EA 4NWKA 1OWJA 2TRMA 3E8LA 3SOSA 5GPIB 1UTPA 2ANWA 1C4U2 1TBZH 1BHXB 5HYOA 3R3GB 3QO6A 2FOEA 4CHAC 1KXDA 2HLCA 1V3XA 2BDHA 1AKSA 1C4V2 2P16A 2CF8H 3RXHA 3E6PH 4INLA 2ULLA 1GBDA 1GMCG 1O35A 2O9QA 4FUFA 3P6ZB 2VJ1A 3TJVA 2CXVA 4FUDA 4K3JA 4X8SH 1BRUP 2B5TB 3LGYA 1FMGA 1UTOA 4MLFB 4OS2A 5EU8A 3FAOA 3M61U 3RXAA 1VCWA 4HGCA 3ZVCA 2ZF0H 3TGJE 5CHAB 3E1XB 4ZKNU 4XBBA 1W2KH 3GCHC 3SGAE 1S85A 4OS5A 1FIZA 1C5QA 1MTNB 1N6XA 1UHBB 1SFQB 2TBSA 2ANKH 1KLJH 2QXHA 4NFEA 2BQWB 3OU0A 2PR3A 3W94A 2HWLB 1SI5H 2PFEA 1EKBB 1ETRH 1GJAB 3TK6A 2WINI 3SW2B 2Z9IA 1TABE 1Y3YA 9ESTA 5AF9H 1IAUA 2W26A 1ZGVA 2OXSA 3UNRA 1AFQC 1OWKA 2BDCA 4U30A 1YPJH 4E7RG 5HMAA 1F2SE 4UFFH 5FBIA 5DJ7A 2B9LA 4TWYA 4X6NA 3BTFE 1PJPA 2AFQB 1OWIA 1ANDA 4CH8B 3LJOA 4OS6A 3M5MA 2BD5A 5DP3A 3SV6A 4B75A 1DLEA 1AO5A 5FPYA 3U1IB 3TJUA 2H5CA 3NUMA 1SHHB 2R0LA 3TGIE 2G8TA 3MO3A 3P92A 2IPHA 1K1MA 5EQQA 3STIA 5A8ZA 4MNYA 5E2OA 2UUJB 3VB6A 2GMTC 1C1PA 1C2KA 1QNJA 1SGCA 4AFZA 1WUNH 4NIWA 1TWXB 4NSVA 1A46H 1N8OB 3FZDA 2C8ZB 1TA2A 1Y3UA 2BY9X 4A1TA 4ZXYH 2PHBA 1D3QB 3EA8A 3ZZBA 5F8XA 2P8OC 1VITF 1ANBA 4INKA 3TLOA 2O8WA 1HJAB 1GMCF 1AKSB 1ZHPA 2ZU2A 1O31A 4YESB 5ETXA 3FANA 1TPPA 2ZQ2A 2Y6TA 1S81A 1O2NA 1K1IA 1IQIA 3BTTE 1SGTA 1NFUA 2OC8A 2CN0H 5EXLA 1TYNA 2ZC9H 2BTCE 3LONA 3K6YA 1HBTH 1JMOH 4X0WU 3CS0A 1NFYA 1VGCB 1GI0A 2Z9GA 3PLPA 5G4BA 1ZHMA 3VEQB 1GWAA 2QCYA 2ZDAH 3KNXA 1OPHB 3RXPA 4AFUA 1PQ7A 4X2YA 2AGIX 1LO6A 2DE8A 2GCTC 2P3FH 2Y5GA 4I32A 2Q1JA 1CQQA 1ESTA 1Q31A 1B0FA 2HNTE 4YT6H 1SQTA 2Y7XA 2A4RA 2WPJS 3EA9A 3M7UA 4NIXA 4D7FA 2CF9H 4RKOB 1SQAA 2VH6A 1V2UT 2VIQA 1YPLH 3RLWH 1FY8E 2A7HA 4BXSA 2BXTH 3LGIA 1CT4E 4JK6A 1F0RA 3LKWA 1MCTA 3GCOA 2ZG0H 2VWOA 3RXVA 1HAOH 4CH2B 3KGPA 2VU8E 4BAQB 1PPGE 1FAKH 5CMXH 3SNAA 2W3IA 3RXFA 2FMJA 2XWBI 3OX7U 1E35B 4K8BA 1EJMA 1OS8A 1O3MA 1MQ6A 1HAYB 1P8VC 5FXLA 2PKSC 4I33A 1B0EA 1BTXA 2PSYA 3O8RA 3KQCA 4CREA 4IC6A 1EPTC 1L1JA 1NU9A 4ABAA 2OQUA 1UTLM 1HAZB 4FVDA 1DY9A 2BD3A 2A5KA 1Y59T 1GBHA 2GZ9A 1D6WA 3U8RH 1OX1A 5DGJA 4YLUA 1SVPA 2CGAA 2IN2A 4ISNA 1MH0A 3S7HB 3M36A 5AFYH 1GCDA 2BZ6H 1YGCH 1DDJA 3AW0A 1CA8B 3ATLA 2ZHQH 2THFB 4ASHA 1FN8A 3TJOA 2H9TH 4K2YA 1RD3B 2F3CE 1C5PA 1Y5BT 2AIQA 1JXPA 7LPRA 2BD9A 1HNEE 1P2NA 1A2CH 1L4ZA 3A81A 3RM0H 4X6PA 2ALPA 4HZHA 1AGJA 1P2MA 3C27B 4K1EA 2BDBA 4PROA 1DE7H 1CHOG 1KYNA 1QGFA 4IN1A 3UOUA 1ELCA 1W7GH 1C1RA 1QY6A 4NA8A 1WSSH 3GY2A 4Y11E 4YOIA 4MNXA 2H2ZA 2EI7A 1NO9H 3SHCH 4JZ1A 2ZPSA 1OOKB 3EGKH 3M35A 1SMFE 1T8MA 3SV7A 2QYIA 1FV9A 3RXMA 3TITA 2Y7ZA 1NM6A 1P2KA 2BOKA 2FOBA 5DK1A 3MU4A 2UUYA 3ESTA 1QQ4A 1DITH 1HIAA 2FOAA 2ZCKP 2VNTA 3Q00A 1GBLA 5ESTE 5EG4A 1L0ZA 1FI8A 1K9OE 2O8UA 1O37A 1MU8B 2A2QH 3LGTA 1TQ7B 1GHXH 2KAIA 1GCTB 4X2VA 1D3TB 4NA9H 5LGOA 2OLGA 1P03A 3VFEA 1KSNA 1TPSA 4INHA 1MZAA 5FX5A 1P2QA 2JETB 1C1TA 1T4VH 2J2UA 1TALA 1ZTLA 1TPOA 3RMLH 4B1TA 1P0SH 4KP0A 1KLTA 1BA8B 3P70B 1C2GA 1TA6A 2BQ6B 1NRRH 4JZIA 2ZP0H 1MZDA 1Z8GA 1FNIA 2FESH 5A0BA 4IN2A 2ZCLP 3ENSB 2OBQA 3QX5H 1TX8A 4ABFA 4AGJA 1LKAA 2PGBB 2JKHA 1ZRBA 3MU1A 4TPIZ 2F83A 2FYRA 1AWHB 1GMDG 2FTLE 4ISIH 2FI3E 2V3OH 1ELGA 2XC5A 4ABJA 3QDZB 4X1PU 1ZRKA 3M5OA 3UR9A 3MU8A 1GHZA 1MBQA 1WCZA 2A45B 3PMJA 2BY8X 2B8OH 4GCHG 1GDUA 4R0IA 2WYJA 2A2XH 2QV1A 3PMAB 1J9CH 3DFLA 2LPRA 1OYQA 3RC6A 4Y76A 2JH5D 2Z9JA 5BRRE 4JYVH 1O3OA 3PM3A 6GCHG 3BG4B 2ZGHA 5A0CA 3GY3A 4FUJA 3H5CB 3Q3XA 3RMMH 3MNSA 5I25A 1AWFH 2BDIA 1CA0C 1QHRB 3PO1B 3PWCA 1VCPA 4K1SA 4Y7AA 2GZ8A 1MKWH 1TPAE 2QA9E 5C67A 5JBBS 2R3YA 1DM4B 4M7GA 1UK3A 4XE4A 1O2PA 5FCKA 1O2GH 2STAE 3RXKA 3MHWU 2GV7A 4ZHLU 1BB0B 4ZUHA 3IG6B 1BMNH 1IQMA 1UVUH 1YBWA 4BNRA 1SGRE 1XX9A 3LGVA 1DWEH 3PYHA 2ZHEH 1NPMA 1O5EH 2KAIB 1JIMA 1QFKH 1MTWA 4GLYA 5B6OA 1LVBA 1EATA 1LQEA 1O3LA 2WUBA 1C5WB 2FM2A 2W7UA 4NIVA 1TGSZ 1WU1A 5A09A 1C1VH 1C5UA 4Y0YE 7KMEH 4KKDA 1O3PB 1OP8A 2C3SA 1GL1A 2SNWA 1F5RA 2SFAA 4U32A 4K5ZA 1UCYH 1MTVA 4GAWA 1AI8H 1S82A 3URDA 4OS4A 1EP5A 1GVKB 2ZDLA 4NWLA 1L4DA 1MU6B 1QTFA 5E0GA 1G30B 1O2WA 8LPRA 4X2XA 1IQJA 1CA0B 3UR6A 3EYDA 1OWHA 3V13A 3VGCB 2FOHA 3BIUH 1GMDF 1Q2WA 3VB5A 4LOYH 4YZUA 1O30A 1WYKA 3F9EA 2QGRA 1NU7B 2ZU4A 1CHGA 4WVPE 2GCHG 1EOJA 5LH8A 4CRFA 3A7YA 2BHGA 1Z1IA 4WWYA 2TGDA 1DY8A 1BTYA 5J4SA 1K22H 4NG9H 5DP4A 1EXFA 2Y80A 3MTYA 1MTUA 4K8YA 1HAPH 1O2RA 3A89A 3HGPA 1X7AC 1IOEA 3GICB 4D9RA 1TMBH 1W11U 2FTMA 2QC2A 3SNBA 2DE9A 2ZPQA 4QT8C 5DG6A 2V3HH 4JK5A 3HK3B 1LKBA 1LPKB 3F68H 5DO4H 4WXIA 4AFQA 2FYQA 1C1UH 1BZXE 1GBTA 1GI5A 3PV4A 4F49A 3MH7A 2RCEA 4Z0KA 4BTTB 4MQAA 3S69A 4DT7B 1UVSH 1UVPA 3DT0H 2AIPA 1G9IE 1DUEA 1ZGIA 4BANB 1SBWA 2UWPA 1C9PA 4NFFA 4X8TH 1LHGH 2A7CA 3A8DA 1CBWB 2F91A 3E91A 1DSUA 3U8OH 4X1QU 1V2NT 1NZQH 1HAIH 3VXFH 1G2LA 2NU2E 1O3BA 1LPGB 1GHYH 2ILNA 3SO3A 1C5TA 3T29A 1GG6C 1C5RA 4BOHA 2FDAA 1K28D 1Y3XA 5FBEA 1ACBE 1UMAH 2VGCC 1CU1A 1BMLA 2FX4A 1TRYA 5F8TA 3SGBE 1CO7E 1YLDA 1YPHC 2ODQA 5AVDA 3SV8A 3F6UH 2BY7X 2PWXA 1C2MA 3ODDA 4NZQA 2PSXA 1O5BB 1GGDB 7GCHG 4H42U 5AHGH 5HGGA 1ZJKA 1TGBA 3TU7H 2ZECA