3M61U

Crystal structure of complex of urokinase and a upain-1 variant(w3a) in ph4.6 condition
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Crystal structure of complex of urokinase and a upain-1 variant(W3A) in pH4.6 condition
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 59
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2010-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3m61U02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3m61U01
1GJ5H 1SMFE 1MU8B 2ZA5A 2ZPSA 2ZWLH 2C93B 3A8CA 3U8RH 4NCYA 5C5OA 1IQJA 3E6PH 2QF3A 4FUEA 1L4DA 1HXEH 1WQVH 3VB6A 1HDTH 2ALVA 4TY7A 1SGEE 2WV4A 3BIUH 1WTGH 3SJIA 2ZEBA 4ABDA 1Z6JH 4AFSA 4MPVA 1L4ZA 7GCHF 3BTWE 4AFUA 2ANWA 3FP7E 1JIRA 2G4UA 2R2MB 2NWNA 3UUZA 6GCHF 4K1TA 3TH2H 3QUMP 4D9QA 1TGTA 2GTBA 4IN2A 1GI2A 4H6TA 3ZZ4A 2FOHA 1VITH 1C5LH 2BTCE 3A7WA 3RUOA 4MTBA 3Q77A 3UOUA 3PYHA 1E34B 3SI3H 1HAVB 1C5YB 3LGIA 1WV7H 1TGBA 1SLWB 1Z8JB 1M9UA 4IMZA 2A4QA 2BQWB 1G37A 2CN0H 3RXAA 1C5UA 2VIDA 3U9AH 1P12E 2BDIA 2P94A 1HBTH 4GAWA 1H9LB 1CGHA 5DPAA 1EAIA 1GCDA 3RXSA 1S6HA 4ZXXH 4JZ1A 1ZGIA 1CGJE 1RD3B 3SUEA 3SUFA 4BTTB 1GBHA 2BD4A 3TPIZ 1W7GH 4FUCA 1VCPA 2ODYB 5GPIB 2V35A 1C1MA 1D3PB 2WPMS 1O3PB 2EI6A 1O36A 1FY8E 4Y71A 1GMHG 1OOKB 2FYRA 1GJ8B 1A5HA 1MTNC 3M37A 3ATMA 1CU1A 5K0HA 3H5CB 3S7KB 2H2ZA 1AQ7A 1O3MA 1AUTC 1ELCA 3E91A 4M7GA 2B8OH 3RM2H 4IGDA 2CV3A 3F68H 3MFJA 4U2WA 3NKKA 4R0IA 3A7TA 1C2GA 2OUAA 4XBBA 4NIYA 2QGRA 1MZDA 1AE8H 1MQ5A 2TGDA 1Z8IB 4B71A 1K21H 3E90B 2W7SA 1D6RA 5HM2A 1GI0A 3BV9B 2UUYA 3N7OA 3UY9A 4KKDA 1CT0E 2A31A 1HAHH 1OWDA 6CHAC 4ZXYH 4D9RA 3P8OA 5E2OA 1IQKA 1HAZB 1O32A 2H1UA 4GHTA 3LPRA 4AOQA 5FX5A 1XMNB 1GVZA 4CRGA 1P2KA 2TIOA 2H9EH 3P6ZB 1AO5A 1V2KT 3E16B 3RP2A 1NRRH 2VINA 3QGNB 1HNEE 1GHVH 3KNXA 1GJCB 2BY8X 4K3JA 4D76A 2C90B 4X8SH 3BTTE 4BAOB 4Y76A 1RXPA 3RXGA 1YP9A 3EGKH 1SOTA 2SGEE 7LPRA 1LMWB 1P2NA 4TWYA 4AX9H 1FPHH 1DOJA 4Y6DA 3MYWA 2AERH 2ZI2H 3ZZBA 2LPRA 3L33A 1FLEE 1GBJA 3A8AA 3A8BA 1O3CA 3V0XA 1MBQA 2OQ5A 1Y59T 2FI4E 1NRNH 1T7CA 1CVWH 1N1LA 2F3CE 4ISNA 3RC5A 3QX5H 1O3OA 1HLTH 1FNIA 1OPHB 5FX6A 1PYTC 2OC0A 2BD7A 1O5BB 2R2WU 1EZQA 3UNQA 3BG8A 1Y5UT 2C8ZB 2EI8A 1O2VA 2PKAB 4DVAU 1PQ7A 2BY7X 2GZ7A 2BDHA 1F5KU 4YESB 1GBTA 3MHWU 4INLA 3SO3A 4ABHA 3SU4A 3LDXH 5C3NA 2DE9A 1CHOG 1JMOH 1GMDF 1KLIH 1TYNA 1W11U 1TWXB 1Z71A 4JK5A 3QLPH 3GY2A 2Z3DA 3PMJA 1BTUA 2BLVA 4NG9H 2R0LA 1BTHH 3W94A 3U8TH 1BJUA 2Z9KA 1TAWA 5IDKA 3P8FA 3SV9A 7KMEH 1O2OA 1GI7B 4DGJA 3BEFB 5EU8A 1OXGA 2HRVA 2TPIZ 1C1OA 2BDYA 3SV6A 2P3FH 2ZDKA 4X1SU 3GISB 5AFYH 2F91A 4CH2B 2CF8H 1CSOE 3GY7A 3IITA 4YO9A 2PTNA 2VIQA 2HVXA 2ZTZA 4Q7XA 1QTFA 1E36B 4X2WA 5EODA 1ELEE 2AYWA 1AVXA 1GMCG 4NSYA 1G2LA 1MQ6A 1IQEA 3EAJA 1SLVB 2FX4A 1F2SE 4DIIH 1ZRBA 3C27B 5LGOA 5L6NH 3HK6B 1SGTA 3UNRA 3TITA 5ABWA 2XNIA 1K1MA 2VIWA 2A4GA 5JBBS 3E1XB 1W0YH 3V12A 1O2JA 3EA8A 1GHAG 2Y80A 2ZDLA 1ZGVA 4F4OC 1AKSA 2C8YB 2IN2A 4AGKA 1RTKA 1ORFA 3OU0A 1C1RA 1CHGA 1ZJKA 1EQ9A 1IQNA 1YBWA 2QC2A 2TGPZ 2V3OH 4I8KA 3VFEA 2YNBA 3QWCH 1INCA 2FM2A 1UTPA 1D9IA 1VR1H 2P59A 4WWYA 1YPHE 1GI6A 1YPEH 3MU8A 3M5NA 1TMBH 3SHAH 4X2XA 2FO9A 3TK6A 1DANH 2UUKB 2QV1A 2ZCLP 1GHBG 3A83A 3EE0B 4H42U 2GDDA 2ZGCA 1ACBE 2GGVB 2W3KA 2WPIS 1AIXH 1JRTA 1H9IE 1AVGH 3SN8A 4BAHB 1GBAA 1S0QA 3U1IB 3A7XA 4JZDH 5F8ZA 2OC1A 5GWZA 5JB9S 1C1VH 1CA0C 2GP9B 1H4WA 4LK4A 1AMHA 4AORA 1DSTA 1AI8H 5DP7A 4A1VA 1JWTA 2NU1E 3UIRA 1W3CA 3KN2A 3PLPA 1E37B 5TCAA 3TU7H 2WPLS 3B8JA 2HNTF 3T2NA 1V2QT 1C2DA 3VEQB 3RMMH 2HLCA 3GCTG 1P02A 5T6FA 2ZGXH 3A80A 1J8AA 3M5MA 1O39A 1O5DH 3C1KA 3EA7A 3P8GA 1C1UH 3LGUA 3A7VA 1S0RA 1V2WT 2FMJA 2Y5GA 2FOMB 1GBCA 1LQDB 3FZDA 4GCHG 5JBTA 1ZSJA 4IC5A 2C4FH 3LT3A 3Q3YA 1EOLA 3MU1A 1JBUH 1O2MA 1ZJDA 3ZV8A 3KGPA 1NN6A 3S9BA 1O2UA 1GBKA 2ZDVH 5BPEA 2QXIA 3SJ8A 1SGPE 3ZVDA 1O3JA 2Z9LA 4MDSA 1QBVH 2GMTC 4BANB 2WV5A 1KDQB 4IW4E 4LOYH 1P10A 2PKSB 4AB9A 3I78A 1GJ7B 2FTMA 1ZTLA 1QJ6B 4YOGA 2FODA 4JMYA 1GDNA 1V2JT 3O8CA 1GL0E 1UHBA 4RSPA 3KIDU 5ESBA 1D3TB 2VH0A 3A81A 1NTPA 1RRKA 2AGEX 4INHA 4CREA 4Z6AH 1KXCA 2A0QB 5DJ7A 1C4V2 1EJMA 4OS5A 1O3LA 1GMCF 3B23B 3QTOH 1O3FA 1GI4A 3BTKE 4O9VA 1SSXA 3F1SB 5AF9H 1TABE 2LNCA 1OP0A 1TBQH 2BD2A 1W14U 4XSKU 3MI4A 2FTLE 4GVUA 4Y0ZE 1VGCB 1XM1A 4DW2U 1UVPA 4B76A 2A5IA 3GCHB 3LU9B 1U6QA 1UJ1A 3ZVBA 5DK1A 1FMGA 1PFXC 2BX3A 3LH3A 3RDZA 3JZ2B 3M7UA 6GCHG 1Y3WA 1P2IA 4XDEA 1EZSC 1ELVA 2VIVA 4YT6H 2OTVA 1Z6EA 1EP5A 1QJ7B 3QK1A 2GDEH 1ARCA 1NM6A 1RJXB 1IQGA 1C5VA 2VIOA 1ZMNA 1CE5A 1AWHB 1L0ZA 1N6XA 1OWEA 1C1TA 1XUHA 1A1RA 3K65B 2NU0E 1SG8B 2PR3A 1GVLA 1O2NA 3KQEA 3PTNA 1O2TA 3LC5A 1C1SA 1FI8A 1LPGB 4AZ2B 4Y7AA 2VWNA 3PMHB 1ABIH 1WOFA 1LHFH 1SQOA 1TRMA 1CQQA 4O3TA 3PMAB 4RKJB 3O8BA 3NCLA 3UWIA 3DUXH 1HCGA 1O0DH 1UK3A 3GCTF 1LHEH 3HKJB 1N8OB 3RXOA 2F9VA 2P93A 3TJVA 3HATH 2BZ6H 1XX9A 4O97A 1TNKA 1BTWA 3MMGA 4ZHAA 3VGCC 3GY6A 4I7YH 1TGCA 1F7ZA 4TY6A 2BOKA 2Q1JA 4FUJA 3GDVA 3MTYA 3GYMA 1ZMJA 4I8HA 5JPMH 1A0LA 1DX5M 4GCHF 3FANA 3FFGA 1P05A 1TRYA 1QRZA 3BSQA 1O2GH 1EPTC 3RM0H 1GI5A 1LVOA 3LGVA 1N8OC 3RXUA 4NA7A 2ZTYA 1IHSH 4BNRA 1KXDA 1GJ6A 4OS2A 5A0BA 1QJ1B 2CHAC 2Y7XA 2RG3A 3M5OA 2G81E 5EXLA 2FS9A 1DPOA 1IQHA 3MH7A 1F0TA 1NFUA 1T8MA 2BLOA 2WUCA 1FXYA 1O3GA 1EZXC 5ESTE 1SLXB 1DWDH 2ZFRH 1TE0A 1BHXF 1NC6A 3P8NA 1LQEA 4ZHLU 2FLRH 3F6UH 2J34A 1JXPA 3SU5A 2SGPE 1AFEH 2VWMA 2Q6GA 1TPAE 2B5TB 2FX6A 1FJSA 4Q80A 2HNTE 4YOIA 1MKWK 3SOSA 1HIAA 2UUJB 3RXDA 4CHAB 2A5KA 4WMDA 2XTTB 1SB1H 3PLKA 3ZZ9A 2OBOA 2BX4A 3BG4B 1JOUB 3M3TA 2XC5A 4BXWA 4X6NA 2G4TA 2BD8A 1AD8H 4NFFA 3BTDE 2PGQB 1O34A 2NU3E 2G51A 8GCHF 3ZVCA 4KTUA 1UVTH 1O3KA 1BCUH 2PUXB 2DE8A 5DP9A 2F9BH 1NESE 2ZHFH 2ZTXA 4IMQA 4CHAC 2BQ7B 5T6DA 1G30B 3BG4C 4FUDA 5CE1A 1UMAH 3SBKA 2OINA 3SZNA 1AB9B 1P2OA 3KCGH 1SL3A 3H7TA 1ARBA 4GLYA 1A4WH 2ALPA 1FAKH 4FUGA 3SNEA 2OC7A 2ZGHA 2AEIH 1E35B 1GMDG 1C2IA 4U30A 1TGNA 1O38A 1LHDH 2IPHA 5JBCS 4FUFA 2FOAA 4CBOA 2RA0A 1CA8B 4IC6A 2W7UA 4LXBH 1TA6A 4JYUH 1Y3YA 1AB9C 1DICA 5L2ZH 2CXVA 3M5LA 2VGCB 2J95A 1OYQA 2GKVE 1W10U 1YCPM 2GX4A 4ABAA 4X2YA 3A87A 1ZYOA 1W13U 3GY4A 1SFQB 5E0GA 4D7FA 2FI3E 2BVSH 4B75A 3FAOA 2P3UB 2VH6A 1EP6A 2SFAA 3PLBA 3OY5U 1G3BA 3G01A 1EX3A 1QRWA 4SGBE 3Q76A 2ZDNA 2A5AA 4WH6A 3ZZAA 2VGCC 4OGYA 3S9CA 1F0UA 1D6WA 5CHAB 1HAOH 1PPGE 1THSH 3K6ZA 2CJIA 4HFPB 1O37A 2Y7ZA 1V2RT 2EC9H 1GDUA 2CF9H 2SNWA 4E06H 2AH4X 4UONA 3DD2H 3GY3A 2FS8A 3BTQE 2ZECA 3B9FH 1J14A 3OTJE 3MWIU 1IQMA 1MAYA 3M3VA 1TNLA 3RXCA 2H5DA 2ODPA 1RS0A 1PPHE 2HALA 1FY1A 1C2JA 1K1LA 2Q6DA 4D8NA 4K8BA 5EOKA 3RC6A 1IQIA 2ZIQH 2AGIX 4DT7B 1O3BA 1XUFA 1DY8A 2ANMH 2XBYA 1WQSA 2W5EA 4ZKSU 3ZZ6A 5L30H 2J9NA 3RLYH 4ABEA 3ODFA 3SW2B 5LH8A 3KHVA 3A85A 4WH8A 3EDXB 4BTIB 5GJ4B 2FDAA 3ATKA 5A8XA 2SGFE 1NT1A 1C1NA 3NUMA 2QXGA 4AYVB 3TGIE 3ZZ3A 5A2MH 4UDWH 2O9QA 3SGQE 3RU4D 3BEIB 1SGCA 4JYVH 1WAYB 1FIZA 4I33A 3QGJA 3UPEA 5TJXA 3UR6A 4JYTA 5FCRA 4ZHMU 1O3HA 1OP2A 2GZ8A 1ELBA 1DXWA 1EUFA 1AVWA 3UTUH 1DS2E 1O2XA 1ZLRA 2AFQB 1HXFH 4XOJA 1P09A 3ZVFA 1C5PA 1S5SA 5GCHG 1HPGA 1SLUB 1UTNA 1QFKH 2QXHA 5HMAA 4LZ4B 1SQTA 1SGYE 3DA9B 4NA9H 1FPCH 4K1EA 3IG6B 5CMXH 4JZFH 5FAHA 1PQ8A 1OX1A 3MO3A 4HZHA 2GT7A 1O2IA 2I6QA 1C5WB 1P06A 2ZFFH 2UWOA 1NRQH 3SV7A 1RFNA 4U01A 1QRXA 3OYPA 1V2OT 2AIPA 1YPKH 2KAIB 3MNSA 4I8JA 1TNGA 1J15A 2C8XB 1KYNA 1EAXA 4F49A 4AB8A 4ZH8A 3A8DA 3UREA 3D62A 3ZYDA 1GVKB 4J1YA 5B6OA 1DDJA 4B2AA 3RXRA 8LPRA 4X8TH 1MU6B 2FI5E 1QIXB 3PWBA 1Z1JA 4UFEH 1Y3XA 2Q6FA 3LKWA 1A5IA 3RXEA 1DXPA 1BQYA 7ESTE 2ANKH 2ZPQA 2GV7A 4GHQA 1O3IA 2ZDMA 4IBLH 1OSSA 4WJG2 1KTSB 4X6OA 1AE5A 5GXPA 4CRFA 1IQFA 1TLDA 1LPKB 1W12U 3UQOA 1DWEH 1GG6B 2ODQA 1SGNE 2F9UA 1AFQB 1TX8A 2P16A 2PLXA 2ANYA 1UTJA 1YPHC 1YYY1 2G00A 1SGRE 1H8DH 4A7IB 2QYIA 2AMPA 2QY0B 2FZZA 3I29A 3CS7A 5C5NA 1DFPA 1GBDA 4YLUA 2BLQA 2VVVA 1IAUA 1THRH 2XBWA 1NRSH 1H9HE 2ZFTA 3SUDA 4E7NA 1A61H 1MZAA 2PSYA 1KY9A 3RXLA 3PM3A 1Y5AT 2BD3A 1KXFA 4X8VH 2TGTA 1NY22 2BY6X 4DJZB 5C1UA 1AFQC 4INKA 5DP5A 4X8UH 1H1BA 2BHGA 3E0PB 1TBRH 1L1GA 2R3UA 1W0ZU 2YNAA 2ZQ1A 1DM4B 2BD5A 3UNSA 4X6MA 1VITF 1HAVA 3RXQA 2FYQA 4TYDA 1C2FA 2ESTE 1D3QB 1MUEB 2ASUB 5E0HA 4AFZA 5JBAS 2OBQA 2Y6TA 1V2ST 1GJAB 2A1DB 1SGDE 1ZMLA 3BTME 1KXEA 2BM2A 3CENA 1XVMA 1C5TA 1XKAC 2V3HH 1EJNA 1C4Y2 2JETB 4VGCB 1ZR0A 3BIVH 1NPMA 2P3TB 1K22H 1MKXK 1YCPK 2FIRH 2ULLA 2HPPH 3FP6E 4SGAE 3DHKH 1PPEE 1TRNA 3TK9A 1T4UH 5GCHF 1ANCA 4KTCA 3MH4A 1LVMA 2JH6D 3M7QA 2PFEA 1QURH 2H9HA 1C2LA 2STBE 3LOXA 1PPCE 2WINI 2Z3EA 3BN9A 3QTVH 2JETC 2ZU5A 1PPBH 1TONA 2P95A 3A7YA 1UTLM 5E2PA 4DOQA 8KME2 2ZO3H 1FONA 1L1NA 1NS3A 1P2MA 2C8WB 2WPKS 3ATLA 5A8ZA 1OP8A 2OQUA 1ZHPA 1XXDA 3K2UA 1A3BH 4YTAA 4ZKNU 3NK8A 4CR5A 2AIQA 1HJ8A 3K9XB 2XBVA 3GICB 3ZVAA 1SGIB 2QF0A 1EB1H 2Z7FE 2ZDAH 1BIOA 2FOGA 2JH5D 1ZRKA 3TJNA 2ZU4A 3QZRA 1JIMA 5TCCA 4B1TA 1Y3VA 3BEUA 3KL6A 4ISLA 1B0EA 1QA7A 2J92A 3RMLH 1V2PT 5AFZH 3P92A 5LPFA 3KQBA 2HWLB 3E0NB 1ZHRA 4JK6A 1YLDA 1V2UT 5GDSH 3SV2H 3TJOA 1TGSZ 3EQ0H 2V6NA 2ZU1A 2BXUH 2G55A 1P01A 2OP9A 2OXSA 2Z9IA 2ZU3A 3TH4H 1QHRB 1P9SA 1HFDA 4Z0KA 1KTTB 1TMTH 3DT0H 1UVUH 4MLFB 1BITA 5HGGA 1UCYK 3DFLA 2PKSC 5BRRE 4CR9A 3ESTA 3HGNA 2FOBA 3PO1B 4X1QU 1SBWA 3A89A 1QBOA 3MH5A 5FPTA 1O30A 2OC8A 2THFB 3RLWH 8GCHG 4QT8C 4NGAH 1SC8U 2GCTB 3GOVB 1ETRH 1BRUP 1O3DA 4KELA 1TALA 3BTGE 1FDPA 4B2BA 1TOCB 1YLCA 3ATIA 2BZAA 1UCYE 4CRDA 1O5FH 1BRCE 1AY6H 1A7SA 1LPZB 1OWKA 1AZZA 3LJOA 3A84A 5C1YA 2Z9JA 3ZZCA 2A4OA 3RXJA 1VGCC 3ZZ5A 1BMMH 1HV7A 4FVDA 1FY5A 1T8NA 2B9LA 3STIA 2Z9GA 3W95A 3GCHC 3SJKA 4JCNA 1YGCH 2IOTA 1BTPA 1LCYA 1O33A 1F0SA 1MKXH 1YCPH 4JZEH 1NFXA 1QGFA 3OX7U 2A45B 2J4IA 1MTUA 1TNHA 4UEHH 1T32A 3SV8A 1C4U2 1DUAA 3UR9A 4A1TA 1DUEA 4Y8XA 1ZSLA 1TOMH 4UFDH 2D2DA 3A7ZA 4NFEA 1TMUH 1NFYA 1GCTB 4K2YA 2VVUA 4CH8B 1YPJH 1MD8A 4JZIA 1SPJA 1CO7E 1S85A 1F5RA 4BAQB 2UWPA 4Y8ZA 1BMLA 3MH6A 3LGTA 2B7DH 2HPQH 2O8MA 4FXGH 1C9PA 5FBIA 3PMBB 4ABBA 3GDUA 4XE4A 3SU0A 4RKOB 3T26A 4K5ZA 5EW2H 5I46H 1GCTC 4OS1A 4ASHA 1BJVA 1GHZA 2OD3B 3HGPA 3VB3A 1G32B 2D1JA 2R3YA 5EQRA 3LONA 2AMDA 1O35A 5DP3A 1P9UA 3MOCA 1QQUA 4Q7YA 1GI8B 1YKTA 3D65E 2OLGA 1H8IH 2M5TA 1KXAA 5EXMA 3AVZA 3GCOA 3GYLB 2HNTC 4DURA 2QIQA 3MNXA 2J94A 2ZNKH 5C67A 1GPZA 1P03A 3SGBE 2BLWA 3H7OA 4WY3A 1F0RA 2ZCKP 2XC0A 3PTBA 3CP7A 2VB0A 4IS5A 9ESTA 1HYLA 1P2QA 2ZP0H 4A5TS 1AWFH 1RGQA 1RIWB 1UCYH 2PW8H 1O2ZA 3ODDA 4ZKOU 2BY9X 4NWKA 1CT4E 1HAYB 1AGJA 1B7XB 1MMJN 1HRTH 4UFFH 1BMNH 4FUIA 5EPNA 2Z3CA 4Q2KA 1TPOA 5EGMA 3TNSA 1T8OA 2EI7A 1Z1IA 3M61U 4WF8A 1NO9H 1SGFA 3ITIA 2SGDE 4Q7ZA 3HPTB 4DG4A 1W7XH 1SFIA 1DVAH 1HAXB 5DG6A 2QAAA 1V2NT 1RIWC 3RXKA 3F9GA 1MH0A 1B5GH 3AAVA 3MU0A 3S7HB 2GCHF 1BDAA 1YPLH 5PTPA 1BBRK 1DITH 4A6LA 4NSVA 4NIXA 5C1XA 2R0KA 3T27A 5EW1H 1J17T 2ILNA 5LPRA 1A3EH 3MU4A 1O31A 1C5ZB 1O3EA 1HB0B 4WMFA 5EG4A 3VPKA 2PWXA 1JRSA 2J38A 3QDZB 1LHCH 1EAUA 1GBIA 4ISIH 1ELFA 4HI3A 3P95A 5T6GA 3VB5A 1C5NH 4KP0A 5DP6A 1TIOA 3Q00A 5C2ZA 1GI1A 1KSNA 1QL7A 1BBRE 1CT2E 1P2JA 3BTHE 1AKSB 1C9TA 4ABIA 1O5AB 5EPYA 2D8WA 3SJ9A 6LPRA 5EQSA 1CBWB 1NU7B 4THNH 4ESTE 3M3SA 4AFQA 1O2YA 1V2VT 3SJOA 1XUKA 4ABGA 1P04A 1F92A 1C5QA 1KDQA 2BDCA 2WPHS 4FVBA 4K1SA 4ZUHA 4X2VA 4CRCA 4X6PA 1A2CH 1VCWA 1XUGA 3PV4A 2BYAX 4YZUA 1LKAA 1S82A 2FLBH 5JYIA 1QL9A 3BF6H 3SORA 4YOJA 8ESTE 4OS7A 2PUQH 1SGQE 1TX7A 2SGAA 1CBWC 2XBXA 5HM9A 1O2KA 1OWJA 3TJUA 1OWHA 4ABFA 5G4BA 5F6MA 3LH1A 1FZZA 1GJ4H 1OWIA 1WYKA 4WVPE 3RXHA 2WYGA 1MTNB 3DFJA 1C2HA 2PTCE 1T8LA 3LIWA 5A0AE 3KQCA 2WYJA 4ZAEA 1ESBA 1QA0A 2FOEA 1OS8A 2CGAA 5LPEA 4UE7H 1ABJH 1XUIA 1D3DB 1WBGB 3NPSA 1NROH 3TVJB 3RXFA 1O5CB 3KF2A 3MO6A 4HTCH 3S0NA 2QCYA 1S6FA 2F9NA 1FUJA 1C2EA 2Y82A 1TA2A 5CHAC 3TH3H 4MPWA 1CGIE 4CRAA 2AS9A 2OCVB 1ELAA 1THPB 2ZFQH 3LC3A 5FBEA 3GCNA 2ZFPH 2A2XH 1TQ0B 6CHAB 4NIWA 4CRBA 5T3HA 3A82A 4YLQH 1VJAU 2BOHB 4KTSA 1MKWH 1GBBA 3QN7A 4MG3A 4FU7A 1Z7KA 1VCQA 1K9OE 3OSYA 4BTUB 4J2YB 1VITG 1BHXB 1F5LA 3ELAH 3HKIB 1E0FD 3NZIA 3UOPA 2H9TH 1AUJA 1S84A 5E0JA 3AW1A 1K1IA 2A7JA 1GL1A 2PV9B 5ETXA 2DUCA 2WUBA 1MTSA 1BBRH 4IN1A 4OGXA 3SU3A 1ZPCA 1UTOA 3V13A 2XC4A 3M7TA 3D23A 3Q3XA 1WU1A 1P11E 3SNBA 1Q2WA 1LDTT 2BB4A 4I32A 2P8OB 3M36A 3F9FA 4OS4A 1UHBB 1EZUC 3VB7A 4AYYB 1HUTH 1FN8A 2AMQA 2W3IA 1S81A 3RXVA 1G9IE 1ID5H 4BAKB 2VVCA 2ZU2A 1ESAA 1EPTA 1XVOA 3V7TA 2ZHWH 1G3DA 1GHWH 1O5GH 2ZC9H 3LGWA 1LVBA 1QR3E 1O2WA 2EEKA 2HOBA 5HXFA 5DP4A 4H4FA 4WXIA 2NU2E 2VWOA 2P8OC 1C5RA 1TPPA 1RTFB 2F83A 3SQEE 3URDA 4O03A 1SHHB 5J4QA 3M35A 1PYTD 3JZ1B 1KIGH 1IQLA 1XUJA 1B0FA 1DSUA 3RU4E 3U8OH 1WTHD 3ZV9A 4TWWA 3S9AA 5J4SA 3T5FH 3LGYA 3IWMA 3QZQA 1QB9A 1DE7H 3U1JB 1DWBH 1GBMA 3A88A 4MPUA 5FPSA 4Y10E 1DWCH 2GT8A 3PB1E 1ZHMA 3UWJH 1O3NA 1J16A 1LKBA 1AZ8A 2H5CA 2O8TA 3TK5A 5F8XA 4X1NU 1FY4A 1NZQH 1DY9A 2GVFA 5FCKA 1D4PB 1GJBB 4MQAA 3AAUA 1Y5BT 1YPMH 1P3CA 2XCFA 1MAXA 2FPZA 1P57B 1LO6A 1BB0B 2QN5T 2FOCA 1K28D 3A86A 4FU9A 2CMYA 1HJAB 1Z8RA 4MPXA 3K6YA 3UQVA 1P0SH 1QNJA 3KEEA 3KQDA 1K2I1 2BD9A 2W26A 2XWBI 1HAPH 3GY5A 2C3SA 2ZGJA 1BMAA 4Y0YE 3SNCA 1PQ5A 2SNVA 1UTKA 1EASA 1WUNH 2O8LA 2UUFB 3FVFB 1UVOA 2FXRA 1BRBE 4AGJA 1GMHF 1HJAC 1ANDA 1K1PA 4MNWA 4GPGA 1VZQH 2RDLA 1SOZA 3PWCA 1OYTH 3ZVGA 2IJOB 1GDQA 1ELDE 1GJDB 1GG6C 4YT7H 1DT2A 3E3TA 4FUBA 2PGBB 2D26C 3NWUA 1ETSH 2ZF0H 1G3CA 1P8VC 4MNYA 3SNAA 3URCA 1ESTA 3RXIA 1MCVA 2ZFSA 4ZMAH 3ATWA 1V2LT 2VNTA 3SU6A 1V3XA 5DO4H 1ZZZA 1NFWA 4FU8A 1ZPBA 2FOFA 4PROA 3MNCA 4ZKRU 9LPRA 1A5GH 1K1JA 1QY6A 4XFQA 2F9PA 3UFAA 4AG1A 3R3GB 1FN6A 1GJ9B 1MTVA 3STJA 2GZ9A 4AN7A 3VXEH 1ZTKA 2STAE 1SQAA 3BTEE 3VB4A 2F9OA 1FIWA 1EXFA 1ELTA 1GBFA 2TRMA 2VJ1A 3ZZ8A 3E8LA 5EQQA 4R8TB 1C1QA 1UTMA 1O2HA 1C2MA 2RCEA 1CA0B 4B74A 4X1RU 1G36A 1DLKB 4ZROA 4RN6A 2ZKSA 4MNVA 2PHBA 1ZTJA 2ZHDA 1BTXA 3SU2A 1BUIA 1HIAB 1GHYH 1W8BH 1C1PA 1EB2A 3WY8A 2BXTH 4D7GA 4A1XA 4KGAA 2ZCHP 3OY6U 5C20A 2VWLA 1V2MT 3O8DA 4VGCC 2BDAA 4B2CA 2Z94A 3O8RA 4CBNA 5FHTA 1YPGH 1E38B 3TLOA 3ZZDA 1W2KH 1KLJH 2FP7B 4NZQA 1KLTA 1HJ9A 2A2QH 1L1JA 3R0FA 2Y5FA 4K69A 4BAMB 3U69H 1ANEA 2QA9E 1V6DA 1IHTH 4DY7B 1BOQA 2PSXA 1T4VH 2B0FA 1CHOF 1MCTA 1Q3XA 1ZSKA 3RMNH 3PROA 4E7RG 3T28A 1O2LA 5DGJA 3SHCH 1MTWA 2BVRH 2GMTB 2ZHQH 1NRPH 1C2KA 1O2PA 3SNDA 2NU4E 1C5OH 2A32A 1ZOMA 3L6PA 4TPIZ 1Q31A 2ZG0H 1C5XB 4I8GA 1LHGH 3CS0A 3RU4T 3T25A 4I31A 1MD7A 5F8TA 1KXBA 4ISHH 1X7AC 2EA3A 3I77A 1TB6H 3AASA 2BDBA 5E8EH 2Y81A 5DP8A 1UO6A 1Y8TA 1PPFE 2HGTH 1NU9A 2G5NA 1AN1E 1SR5C 3EYDA 2ZQ2A 4NA8A 1EJAA 1Z8GA 3T62A 2QXJA 2TGAA 1EOJA 1UVSH 1K1NA 1IOEA 1FY3A 1BZXE 2BVXH 3NXPA 3P17H 5A8YA 5I25A 2O8WA 2G8TA 3L3TA 2WPJS 2SGQE 1Y3UA 1GHXH 3RXPA 2ZGBH 1TNJA 1QB1A 2GCHG 1YM0A 2A7HA 3HK3B 3LJJA 3FZZA 3RXBA 1UK2A 4GSOA 1C5SA 4Y8YA 2BQ6B 1AU8A 4YM9A 4H6SB 2PKAA 2ZZUH 5L2YH 1GI9B 2G52A 2R9PA 4X1PU 4ISOA 4K8YA 1EKBB 2XYAA 3D49H 3PO1C 1GGDB 1C5MD 1LVYA 4NZLA 3MU5A 5A0CA 1EAWA 3MNBA 1GHAF 2A7CA 2VIPA 1TBZH 1QBNA 2UWLA 4AG2A 2GCTC 5EXNA 3RXTA 2GV6A 5H4IB 2ZHEH 1BT7A 3T29A 7GCHG 1A46H 2KAIA 2K1QA 3RMOH 1QQ4A 3TGKE 2AGGX 2XW9A 5AVDA 1GGDC 2XCNA 1LTOA 1SHYA 1DLEA 4WMEA 1C1WH 1G2MA 3SU1A 3BTFE 4K60A 1PPZA 1FAXA 2FESH 1TPSA 3ZYEA 1QCPA 1GHBF 2GD4B 3SGAE 1O2RA 3F9HA 3RXMA 1BTYA 2A4RA 2BY5X 2XWAA 2TBSA 4XBCA 2Y5HA 4B73A 1J9CH 1GI3A 4Y79A 4MNXA 1K1OA 4WXVA 3TGJE 1ELGA 1HGTH 5IYTA 3SUGA 3V3MA 2XRCA 3AW0A 1PJPA 4U32A 4Y11E 1ANBA 1A0HB 2J2UA 4ABJA 4LZ1H 4HGCA 3MO9A 3ENSB 1V2TT 3VGCB 1L2EA 4UD9H 1N6YA 2I6SA 5GIBA 1QB6A 2YOLA 3RC4A 5HYOA 3GY8A 2Z6BD 1PQAA 1RTLA 4DCDA 4OS6A 1P3EA 3P70B 3S69A 5FXLA 5DKMA 1EPTB 4XBDA 1A0JA 2ZPRA 4NWLA 1O2SA 5F03A 1S83A 2CHAB 1T31A 2BMGB 3QO6A 4I8LA 1BTZA 3F9EA 4BXSA 1GBEA 3FP8E 3SI4H 5K7RA 2H6MA 5JB8S 4A92A 1FV9A 1WSSH 2BDGA 1GWAA 3SQHE 2FWWA 2O8UA 1EATA 2G5VA 4NIVA 1BRAA 1G3EA 1XKBC 1BA8B 1UK4A 5FPYA 3ZVEA 1HAIH 1HAGE 4MVNA 2RA3A 1O2QA 4X0WU 1QL8A 3TNTA 2JKHA 4O3UA 2V0BA 4GUXA 1WCZA 5JDUB 3ZZ7A 1O3AA 3VXFH 1XXFA 2XXLA 4DIHH 1OKXA 1TQ7B 2VU8E 3TIUA 1VJ9U 1SVPA 4Y7BA 4E05H 4TPYA 4FUHA 1AHTH 1ZPZA 1FQ3A 1YC0A 5A09A 1GBLA 3EA9A 1UTQA 6ESTA 2JH0D 1TNIA 1SI5H 1SGFG 4BOHA 3GDSA 3U98H 2FEQH 1ETTH 5SGAE 1TFXA 1O5EH 1TX6A 1MBMA 5AHGH 1YF4A 3Q3KA 4UFGH
chains in the Genus database with same CATH superfamily
1GJ5H 1SMFE 1MU8B 2ZA5A 2ZPSA 2ZWLH 2C93B 3A8CA 3U8RH 4NCYA 5C5OA 1IQJA 3E6PH 2QF3A 4FUEA 1L4DA 1HXEH 1WQVH 3VB6A 5C94A 1HDTH 2ALVA 4TY7A 1SGEE 2WV4A 3BIUH 1WTGH 3SJIA 2ZEBA 4ABDA 1Z6JH 4AFSA 4MPVA 1L4ZA 7GCHF 3BTWE 4AFUA 2ANWA 3FP7E 1JIRA 2G4UA 2R2MB 2NWNA 3UUZA 6GCHF 3MQKC 4K1TA 3TH2H 3QUMP 4D9QA 1TGTA 2GTBA 4IN2A 1GI2A 4H6TA 3ZZ4A 2FOHA 1VITH 1C5LH 2BTCE 3A7WA 3RUOA 4MTBA 3Q77A 3UOUA 3PYHA 1E34B 3SI3H 1HAVB 1C5YB 3LGIA 1WV7H 1TGBA 5DSFA 1SLWB 1QZ8A 1Z8JB 1M9UA 4IMZA 2A4QA 2BQWB 2JDID 1G37A 2CN0H 3RXAA 1C5UA 2VIDA 3U9AH 1P12E 2BDIA 2P94A 1HBTH 4GAWA 1H9LB 3PRBA 1CGHA 5DPAA 1EAIA 1GCDA 3RXSA 1S6HA 4ZXXH 4JZ1A 1ZGIA 1CGJE 1RD3B 3SUEA 3SUFA 4BTTB 1GBHA 2BD4A 3TPIZ 1W7GH 4FUCA 1VCPA 4I86A 2ODYB 5GPIB 2V35A 1C1MA 1D3PB 3F0OA 2WPMS 3F2HA 1O3PB 2EI6A 1O36A 1FY8E 4Y71A 1GMHG 1OOKB 5KEDA 2FYRA 1GJ8B 1A5HA 1MTNC 3M37A 3ATMA 1W0KD 1CU1A 5K0HA 3H5CB 3S7KB 2H2ZA 1AQ7A 1O3MA 1AUTC 1ELCA 3E91A 4M7GA 2B8OH 3RM2H 4IGDA 2CV3A 3F68H 3MFJA 4U2WA 3NKKA 4R0IA 3A7TA 1C2GA 2OUAA 4XBBA 4NIYA 2QGRA 1MZDA 1AE8H 1MQ5A 2TGDA 1Z8IB 4B71A 1K21H 3E90B 2W7SA 1D6RA 5HM2A 1GI0A 3BV9B 2UUYA 3N7OA 3UY9A 4KKDA 1CT0E 2A31A 1HAHH 1OWDA 6CHAC 4ZXYH 4D9RA 3P8OA 1H8HD 1IQKA 5E2OA 1HAZB 1O32A 2H1UA 4GHTA 3LPRA 4AOQA 4FETA 1XMNB 5FX5A 1GVZA 4CRGA 1P2KA 2TIOA 2H9EH 3P6ZB 1AO5A 1E1RD 1V2KT 3E16B 3RP2A 2JJ1D 1NRRH 2VINA 3QGNB 1HNEE 1GHVH 3KNXA 1GJCB 2BY8X 4K3JA 4D76A 2C90B 4X8SH 3BTTE 4BAOB 4Y76A 2J5UA 1RXPA 3RXGA 1YP9A 3EGKH 1SOTA 2SGEE 7LPRA 1LMWB 1P2NA 4TWYA 4AX9H 1FPHH 1DOJA 4Y6DA 3MYWA 2AERH 2ZI2H 3ZZBA 2LPRA 3L33A 1FLEE 1GBJA 3A8AA 3A8BA 1O3CA 3V0XA 1MBQA 3OAAD 2OQ5A 1Y59T 2FI4E 5HIZA 1NRNH 1T7CA 1CVWH 1N1LA 2F3CE 4ISNA 3RC5A 3QX5H 1O3OA 1HLTH 1FNIA 1OPHB 5FX6A 1PYTC 2OC0A 2BD7A 1FX0B 1O5BB 2R2WU 1EZQA 3UNQA 3BG8A 1Y5UT 2C8ZB 2EI8A 1O2VA 2PKAB 4DVAU 1PQ7A 2BY7X 2GZ7A 2BDHA 1F5KU 4YESB 1GBTA 3MHWU 4INLA 3SO3A 4ABHA 3SU4A 4ACAA 3LDXH 5C3NA 2DE9A 1CHOG 1JMOH 1GMDF 1KLIH 1TYNA 1W11U 1TWXB 1Z71A 4JK5A 3QLPH 3GY2A 2Z3DA 5FL7D 3PMJA 2KCOA 1BTUA 2BLVA 4NG9H 2R0LA 1BTHH 3W94A 5HKKD 3U8TH 1BJUA 2Z9KA 1TAWA 5IDKA 3P8FA 3SV9A 4ASUD 7KMEH 3ZIAD 3WW7A 2KCPA 1O2OA 1GI7B 4DGJA 5IK2D 3BEFB 5EU8A 1OXGA 2HRVA 2TPIZ 1C1OA 2BDYA 3SV6A 2P3FH 2ZDKA 3DCLA 4X1SU 3GISB 5AFYH 2F91A 4CH2B 2CF8H 1CSOE 3GY7A 3IITA 4YO9A 2PTNA 2VIQA 2HVXA 2ZTZA 4Q7XA 1QTFA 1E36B 4X2WA 5EODA 1ELEE 2AYWA 1AVXA 1GMCG 4NSYA 1G2LA 1MQ6A 1IQEA 3EAJA 1SLVB 2FX4A 1F2SE 4DIIH 1ZRBA 3C27B 5LGOA 5L6NH 3HK6B 1SGTA 3UNRA 3TITA 5ABWA 2XNIA 1K1MA 2VIWA 2A4GA 2QE7D 5JBBS 3E1XB 1W0YH 1WDIA 3V12A 1O2JA 3EA8A 1GHAG 2Y80A 2ZDLA 1ZGVA 1K0HA 4F4OC 1AKSA 2C8YB 2IN2A 4AGKA 1RTKA 1ORFA 2KX4A 3OU0A 1C1RA 1CHGA 1ZJKA 1EQ9A 1IQNA 1YBWA 2QC2A 2TGPZ 2V3OH 4I8KA 3VFEA 2YNBA 3QWCH 1INCA 2FM2A 1UTPA 1D9IA 1VR1H 2P59A 4WWYA 2V3MA 1YPHE 1GI6A 1YPEH 3MU8A 3M5NA 1TMBH 3SHAH 4X2XA 2FO9A 3TK6A 1DANH 2UUKB 2QV1A 2ZCLP 1GHBG 3A83A 3EE0B 4H42U 5GNDA 2GDDA 2ZGCA 1ACBE 2GGVB 2W3KA 2WPIS 1AIXH 1JRTA 1H9IE 1AVGH 3SN8A 4BAHB 1GBAA 1S0QA 3U1IB 3A7XA 4JZDH 5F8ZA 2OC1A 5GWZA 5JB9S 1C1VH 1CA0C 2GP9B 1H4WA 4LK4A 1AMHA 4AORA 1DSTA 1AI8H 5DP7A 4A1VA 1JWTA 2NU1E 3UIRA 1W3CA 3KN2A 3PLPA 1E37B 5TCAA 3TU7H 2WPLS 3B8JA 2HNTF 3T2NA 1V2QT 2WPDD 1C2DA 3VEQB 3RMMH 2HLCA 3GCTG 3FOAA 1P02A 5T6FA 2ZGXH 3A80A 1J8AA 3N7DA 3M5MA 1O39A 1O5DH 3C1KA 3EA7A 3P8GA 1C1UH 3LGUA 4TSFD 2J97A 3A7VA 1S0RA 1V2WT 2FMJA 2Y5GA 2FOMB 1GBCA 1LQDB 3FZDA 4GCHG 5JBTA 1ZSJA 4IC5A 2C4FH 3LT3A 3Q3YA 1EOLA 3MU1A 1JBUH 1O2MA 1ZJDA 3ZV8A 3KGPA 1NN6A 3S9BA 1O2UA 1GBKA 2ZDVH 5BPEA 2QXIA 3SJ8A 1SGPE 1YY3A 3ZVDA 1O3JA 2Z9LA 4MDSA 1QBVH 2GMTC 4BANB 2WV5A 1KDQB 4IW4E 4LOYH 1P10A 2PKSB 4AB9A 3I78A 5C0TA 1GJ7B 2FTMA 1ZTLA 1QJ6B 4YOGA 2FODA 4JMYA 1GDNA 1V2JT 2K8IA 3O8CA 1GL0E 1UHBA 4RSPA 3KIDU 5ESBA 1D3TB 2VH0A 3A81A 1NTPA 1RRKA 2AGEX 4INHA 4CREA 4Z6AH 1KXCA 2A0QB 5DJ7A 4XRNA 1C4V2 1EJMA 3KYFA 3N99A 4OS5A 1O3LA 1GMCF 3B23B 3QTOH 1O3FA 1GI4A 2WSSD 3BTKE 2CK3D 4O9VA 1SSXA 3F1SB 5AF9H 1TABE 2LNCA 1OP0A 1YLNA 1TBQH 2BD2A 1W14U 4XSKU 3MI4A 2FTLE 4GVUA 4Y0ZE 1VGCB 1XM1A 4DW2U 1UVPA 4B76A 2A5IA 3GCHB 3LU9B 1U6QA 1UJ1A 3ZVBA 5DK1A 1FMGA 1PFXC 2BX3A 3LH3A 3RDZA 3JZ2B 3M7UA 6GCHG 1Y3WA 1P2IA 4XDEA 1EZSC 1ELVA 2VIVA 5C17A 4YT6H 2OTVA 1Z6EA 1EP5A 1QJ7B 3QK1A 2GDEH 1ARCA 1NM6A 1RJXB 1IQGA 1C5VA 2VIOA 1ZMNA 1CE5A 1AWHB 1L0ZA 1N6XA 4DT4A 1OWEA 1C1TA 1XUHA 1A1RA 3K65B 2NU0E 1SG8B 2PR3A 1GVLA 1O2NA 3KQEA 3PTNA 1O2TA 3LC5A 1C1SA 1FI8A 1LPGB 4AZ2B 4Y7AA 2VWNA 3PMHB 1ABIH 1WOFA 3GS9A 4P00A 1LHFH 1SQOA 1TRMA 1CQQA 2YMSB 4O3TA 3PMAB 4RKJB 3O8BA 3NCLA 3UWIA 3DUXH 1HCGA 1O0DH 1UK3A 3GCTF 1LHEH 3HKJB 1N8OB 3RXOA 4ACBA 2F9VA 2P93A 3TJVA 3HATH 2BZ6H 1XX9A 4O97A 1TNKA 1BTWA 3MMGA 1W0JD 4ZHAA 3VGCC 3GY6A 4I7YH 1TGCA 1F7ZA 4TY6A 4TT3D 2BOKA 2Q1JA 2JIZD 4FUJA 3GDVA 3MTYA 3GYMA 1ZMJA 4I8HA 5JPMH 1A0LA 1DX5M 4GCHF 3FANA 3FFGA 1P05A 1TRYA 1QRZA 3BSQA 1O2GH 1EPTC 3RM0H 1GI5A 1LVOA 3LGVA 1N8OC 3RXUA 4NA7A 2ZTYA 1IHSH 4BNRA 1KXDA 1GJ6A 4OS2A 5A0BA 1QJ1B 2CHAC 2Y7XA 2RG3A 3M5OA 2G81E 2WV9A 5EXLA 2FS9A 1DPOA 1IQHA 3MH7A 5CDFE 1F0TA 1NFUA 1T8MA 2BLOA 2WUCA 1FXYA 1O3GA 3WWFA 1EZXC 5ESTE 1SLXB 1DWDH 2ZFRH 1TE0A 1BHXF 1NC6A 2QF4A 3P8NA 1LQEA 4ZHLU 2FLRH 3F6UH 2J34A 1JXPA 3SU5A 2SGPE 1AFEH 2VWMA 2Q6GA 1TPAE 2B5TB 2FX6A 1FJSA 4Q80A 2HNTE 4YOIA 1MKWK 3SOSA 1HIAA 2UUJB 3RXDA 4CHAB 2A5KA 4WMDA 2XTTB 1SB1H 3PLKA 3ZZ9A 2OBOA 2BX4A 3BG4B 1JOUB 3M3TA 2XC5A 4BXWA 4X6NA 2G4TA 2BD8A 1AD8H 4NFFA 3BTDE 5EJLA 2PGQB 1O34A 2NU3E 2G51A 8GCHF 3ZVCA 4KTUA 1UVTH 1O3KA 1BCUH 2PUXB 2DE8A 5DP9A 2F9BH 1NESE 3PRDA 2ZHFH 2ZTXA 4IMQA 4CHAC 2BQ7B 5T6DA 1G30B 3BG4C 4FUDA 5CE1A 1UMAH 3SBKA 2OINA 3OEHD 3SZNA 1AB9B 1P2OA 3KCGH 1SL3A 3H7TA 1ARBA 4GLYA 1A4WH 2ALPA 1FAKH 4FUGA 3SNEA 3F3BA 2OC7A 3VG8A 2ZGHA 2AEIH 1E35B 1GMDG 1C2IA 4U30A 1TGNA 1O38A 1LHDH 2IPHA 5JBCS 4FUFA 2FOAA 4CBOA 2RA0A 1CA8B 4IC6A 2W7UA 4LXBH 1TA6A 4JYUH 1Y3YA 4FOUC 1AB9C 1DICA 5L2ZH 2CXVA 3PV5A 3M5LA 2VGCB 2J95A 1OYQA 2GKVE 2L74A 1W10U 1YCPM 2GX4A 4ABAA 4X2YA 3A87A 1ZYOA 1W13U 3GY4A 1SFQB 5E0GA 4D7FA 2FI3E 2BVSH 4B75A 3SYJA 3FAOA 2P3UB 2VH6A 1EP6A 2SFAA 3PLBA 3OY5U 1G3BA 3G01A 1EX3A 3DSOA 1QRWA 4SGBE 3Q76A 2ZDNA 2A5AA 4WH6A 3ZZAA 2VGCC 4OGYA 5HIYA 2KR7A 3S9CA 1F0UA 1D6WA 5CHAB 1HAOH 1PPGE 1THSH 3K6ZA 2CJIA 4HFPB 1O37A 2Y7ZA 1V2RT 2EC9H 1GDUA 2CF9H 2SNWA 4E06H 2AH4X 4UONA 3DD2H 3GY3A 2FS8A 2HLDD 3BTQE 2ZECA 3B9FH 1J14A 3OTJE 3MWIU 1IQMA 1MAYA 3M3VA 1TNLA 3RXCA 2H5DA 2ODPA 1RS0A 1PPHE 2HALA 1FY1A 1C2JA 1K1LA 2Q6DA 4D8NA 4K8BA 5EOKA 3RC6A 1IQIA 2ZIQH 2AGIX 3KYGA 4DT7B 1O3BA 1XUFA 1DY8A 2ANMH 2XBYA 1WQSA 2W5EA 4ZKSU 3ZZ6A 5L30H 2J9NA 3RLYH 4ABEA 3ODFA 3SW2B 5LH8A 3KHVA 4Q4LA 3A85A 4WH8A 3EDXB 4BTIB 5GJ4B 2FDAA 3ATKA 5A8XA 2SGFE 1NT1A 1C1NA 3NUMA 2QXGA 4AYVB 3TGIE 3ZZ3A 5A2MH 4UDWH 2O9QA 3SGQE 3RU4D 3BEIB 1SGCA 4JYVH 1WAYB 1FIZA 4I33A 3QGJA 3UPEA 5TJXA 3UR6A 4JYTA 5FCRA 4ZHMU 1O3HA 1OP2A 2GZ8A 1ELBA 1DXWA 1EUFA 1AVWA 3UTUH 1DS2E 1O2XA 1ZLRA 2AFQB 1HXFH 4XOJA 2F4LA 1P09A 3ZVFA 1C5PA 1S5SA 5GCHG 1HPGA 1SLUB 1UTNA 1QFKH 2QXHA 5HMAA 4LZ4B 1SQTA 1SGYE 3DA9B 4NA9H 1FPCH 4K1EA 3IG6B 5CMXH 4JZFH 2QF5A 5FAHA 1PQ8A 1OX1A 3MO3A 4HZHA 2GT7A 1O2IA 2I6QA 1C5WB 1P06A 2ZFFH 2UWOA 1NRQH 3SV7A 1RFNA 4U01A 1QRXA 3OYPA 2M2AA 1V2OT 2AIPA 1YPKH 2KAIB 3MNSA 4I8JA 1TNGA 1J15A 2C8XB 1KYNA 1EAXA 4F49A 4AB8A 4ZH8A 3A8DA 3UREA 3D62A 3ZYDA 1GVKB 4J1YA 5B6OA 1DDJA 4B2AA 3RXRA 8LPRA 4X8TH 1MU6B 2FI5E 1QIXB 3PWBA 1Z1JA 4UFEH 1Y3XA 2Q6FA 3LKWA 1A5IA 5F53A 1DXPA 1BQYA 3RXEA 7ESTE 2ANKH 3OTPA 2ZPQA 4F55A 2GV7A 4GHQA 1O3IA 2ZDMA 4IBLH 1OSSA 4WJG2 1KTSB 4X6OA 1AE5A 5GXPA 4CRFA 1MABB 1IQFA 1TLDA 3FN8A 1LPKB 1W12U 3UQOA 1DWEH 1GG6B 2ODQA 1SGNE 1SKYE 2F9UA 1AFQB 1TX8A 2P16A 2PLXA 2ANYA 1UTJA 1YPHC 1YYY1 2G00A 1SGRE 1H8DH 4A7IB 2QYIA 2AMPA 2QY0B 2FZZA 3I29A 3CS7A 5C5NA 1DFPA 1GBDA 4YLUA 2BLQA 2VVVA 1IAUA 1THRH 2XBWA 1NRSH 1H9HE 1S6LA 2ZFTA 3SUDA 4E7NA 1A61H 1MZAA 2PSYA 1KY9A 3RXLA 3PM3A 1Y5AT 2BD3A 1KXFA 2RFKC 4X8VH 2TGTA 1NY22 2BY6X 4DJZB 5C1UA 1AFQC 4INKA 5DP5A 4X8UH 1H1BA 2BHGA 3E0PB 1TBRH 1L1GA 2R3UA 3CNRA 1W0ZU 2YNAA 2ZQ1A 1DM4B 2BD5A 3UNSA 5KECA 4X6MA 1VITF 1HAVA 3RXQA 2FYQA 4TYDA 1C2FA 2ESTE 1D3QB 1MUEB 2ASUB 5E0HA 4AFZA 5JBAS 2OBQA 2Y6TA 1V2ST 1GJAB 2A1DB 1SGDE 1ZMLA 3BTME 1KXEA 2BM2A 3CENA 1XVMA 1C5TA 4YXWD 1XKAC 2V3HH 1EJNA 1C4Y2 2JETB 4VGCB 1ZR0A 3BIVH 1NPMA 2P3TB 1K22H 1MKXK 1YCPK 2FIRH 2KM0A 2ULLA 2HPPH 3FP6E 4SGAE 3DHKH 1PPEE 1TRNA 3TK9A 1T4UH 2XNDD 5GCHF 1ANCA 4KTCA 3MH4A 1LVMA 2JH6D 3M7QA 2PFEA 1QURH 2H9HA 2RDEA 1C2LA 2STBE 3LOXA 1PPCE 2WINI 2Z3EA 3BN9A 3QTVH 2JETC 2ZU5A 1PPBH 1TONA 2P95A 3A7YA 1UTLM 5E2PA 4DOQA 8KME2 2ZO3H 1FONA 1L1NA 1NS3A 1P2MA 2C8WB 2WPKS 3ATLA 5A8ZA 1OP8A 2OQUA 1ZHPA 1XXDA 3K2UA 1A3BH 4YTAA 4ZKNU 3NK8A 4CR5A 2AIQA 1HJ8A 3K9XB 2XBVA 3GICB 3ZVAA 2PP6A 1SGIB 2QF0A 1EB1H 2Z7FE 2ZDAH 1BIOA 2FOGA 2J98A 2JH5D 1ZRKA 3TJNA 2ZU4A 3QZRA 1JIMA 5TCCA 4B1TA 1Y3VA 3BEUA 3KL6A 4ISLA 1B0EA 1QA7A 2J92A 3RMLH 1V2PT 5AFZH 3P92A 5LPFA 3KQBA 2JJ2D 2HWLB 3E0NB 1VKYA 1ZHRA 4JK6A 1YLDA 1V2UT 5GDSH 3SV2H 3TJOA 1WXRA 1TGSZ 3EQ0H 2V6NA 2ZU1A 2BXUH 2G55A 1P01A 2OP9A 2OXSA 2Z9IA 2ZU3A 3TH4H 1QHRB 1P9SA 1HFDA 4Z0KA 1KTTB 1TMTH 3DT0H 1UVUH 4MLFB 1BITA 1UW7A 5HGGA 1UCYK 3DFLA 2PKSC 5BRRE 4CR9A 3ESTA 3FKSD 3HGNA 2FOBA 3PO1B 4X1QU 1SBWA 3A89A 1QBOA 3MH5A 5FPTA 1O30A 2OC8A 2THFB 3RLWH 8GCHG 4QT8C 4NGAH 3WWBA 1SC8U 2GCTB 3GOVB 1ETRH 1BRUP 1O3DA 4KELA 1TALA 3BTGE 1FDPA 4B2BA 1TOCB 1YLCA 3ATIA 1E1QD 2BZAA 1UCYE 4CRDA 3OFND 1O5FH 1BRCE 1AY6H 1A7SA 1LPZB 1OWKA 1AZZA 3LJOA 3A84A 5C1YA 2Z9JA 3ZZCA 2A4OA 3RXJA 1VGCC 3ZZ5A 1BMMH 2W6JD 2GJGA 1HV7A 4FVDA 1FY5A 1T8NA 2B9LA 3STIA 2Z9GA 3W95A 3GCHC 2V7QD 3SJKA 4JCNA 1YGCH 2IOTA 1BTPA 1LCYA 1O33A 1F0SA 1MKXH 1YCPH 4JZEH 1NFXA 1QGFA 3OX7U 2A45B 2J4IA 1MTUA 1TNHA 4UEHH 1T32A 3SV8A 1C4U2 1DUAA 3UR9A 4A1TA 1DUEA 4Y8XA 1ZSLA 1TOMH 4UFDH 2D2DA 2AHME 3A7ZA 4NFEA 1TMUH 1NFYA 1GCTB 4K2YA 2VVUA 4CH8B 1YPJH 1MD8A 4JZIA 1SPJA 1CO7E 1S85A 1F5RA 4BAQB 2UWPA 4Y8ZA 1BMLA 5CHBA 3MH6A 3LGTA 2B7DH 2HPQH 2O8MA 4FXGH 1C9PA 5FBIA 3PMBB 4ABBA 3GDUA 4XE4A 3SU0A 4RKOB 3T26A 4K5ZA 5EW2H 5I46H 1GCTC 4OS1A 4ASHA 1BJVA 1GHZA 2OD3B 3HGPA 3VB3A 1G32B 2YMSC 2D1JA 2R3YA 5EQRA 3LONA 2AMDA 1O35A 5DP3A 1P9UA 2K0QA 3MOCA 1QQUA 4Q7YA 1GI8B 1YKTA 3D65E 2OLGA 1H8IH 2M5TA 1KXAA 5EXMA 3AVZA 3GCOA 3GYLB 2HNTC 4DURA 2QIQA 2WZQA 3MNXA 2J94A 2ZNKH 5C67A 2W6ID 1GPZA 1P03A 3SGBE 2BLWA 3H7OA 4WY3A 1F0RA 2ZCKP 2XC0A 3PTBA 3CP7A 2VB0A 4IS5A 9ESTA 1HYLA 1P2QA 2ZP0H 3DSGA 1NBMD 4A5TS 1AWFH 1RGQA 1RIWB 1UCYH 2PW8H 1O2ZA 3ODDA 4ZKOU 2BY9X 4NWKA 1CT4E 1HAYB 1AGJA 1B7XB 1MMJN 1HRTH 4UFFH 1BMNH 4FUIA 5EPNA 2Z3CA 4Q2KA 1TPOA 5EGMA 3TNSA 1T8OA 2EI7A 1Z1IA 3M61U 4WF8A 1NO9H 1SGFA 3ITIA 2SGDE 4Q7ZA 3HPTB 4DG4A 1EFRD 1W7XH 1SFIA 1DVAH 1HAXB 5DG6A 2QAAA 1V2NT 1RIWC 3RXKA 3F9GA 1MH0A 1B5GH 3AAVA 3MU0A 3S7HB 2GCHF 1BDAA 1YPLH 5PTPA 1BBRK 1DITH 4A6LA 4NSVA 4NIXA 5C1XA 2R0KA 3T27A 5EW1H 1J17T 2ILNA 5LPRA 1A3EH 3MU4A 1O31A 1C5ZB 1O3EA 1HB0B 4WMFA 5EG4A 3VPKA 2PWXA 1JRSA 2J38A 3QDZB 1LHCH 1EAUA 1GBIA 4ISIH 1ELFA 4HI3A 3P95A 5T6GA 3VB5A 3PV2A 1C5NH 4KP0A 5DP6A 1TIOA 3Q00A 4B6EA 5C2ZA 1GI1A 1KSNA 1QL7A 1BBRE 1CT2E 1P2JA 1H8ED 3BTHE 1AKSB 1C9TA 4ABIA 1O5AB 5EPYA 2D8WA 3SJ9A 6LPRA 5EQSA 1CBWB 1NU7B 4THNH 4ESTE 3M3SA 4AFQA 1O2YA 1V2VT 3SJOA 1XUKA 4ABGA 1P04A 1F92A 1C5QA 1KDQA 2BDCA 2WPHS 4FVBA 4K1SA 4ZUHA 4X2VA 5EJZA 4CRCA 4X6PA 1A2CH 1VCWA 1XUGA 3PV4A 2BYAX 4YZUA 1LKAA 1S82A 2FLBH 5JYIA 1QL9A 3BF6H 3SORA 4YOJA 8ESTE 1BMFD 4OS7A 1KMHB 2PUQH 1SGQE 1TX7A 3EE7A 3OEED 2SGAA 1CBWC 2XBXA 5HM9A 1O2KA 1OWJA 3TJUA 1OWHA 4ABFA 5G4BA 5F6MA 3LH1A 1FZZA 1GJ4H 5T1VA 1OWIA 1WYKA 3H09A 4WVPE 3RXHA 2WYGA 1MTNB 3DFJA 1C2HA 2PTCE 1T8LA 3LIWA 5A0AE 3KQCA 2WYJA 4ZAEA 1ESBA 1QA0A 2FOEA 1OS8A 2CGAA 5LPEA 4UE7H 1ABJH 1XUIA 1D3DB 1WBGB 3NPSA 2WHXA 1NROH 3TVJB 3RXFA 1O5CB 3KF2A 3MO6A 4HTCH 3S0NA 2QCYA 1S6FA 2F9NA 1FUJA 1C2EA 2Y82A 1TA2A 5CHAC 3TH3H 4MPWA 1CGIE 4CRAA 2AS9A 3U28C 2OCVB 1ELAA 1THPB 2ZFQH 3LC3A 5FBEA 3GCNA 2ZFPH 2A2XH 1TQ0B 2KCAA 6CHAB 3SZEA 4NIWA 4CRBA 5T3HA 3A82A 4YLQH 1VJAU 2BOHB 4KTSA 1MKWH 1GBBA 3QN7A 4MG3A 4FU7A 1Z7KA 1VCQA 1K9OE 3OSYA 4BTUB 4J2YB 1VITG 1BHXB 1F5LA 3ELAH 3HKIB 1E0FD 3NZIA 3UOPA 2H9TH 1AUJA 1S84A 2J98B 3AW1A 5E0JA 1K1IA 2A7JA 1GL1A 2PV9B 5ETXA 2DUCA 2WUBA 3DSPA 1MTSA 4HG6A 1BBRH 4IN1A 4OGXA 3SU3A 1ZPCA 1UTOA 3V13A 2XC4A 3M7TA 3D23A 3Q3XA 1WU1A 1P11E 3SNBA 1Q2WA 1LDTT 2BB4A 4I32A 2P8OB 3M36A 3F9FA 4OS4A 1UHBB 1EZUC 3VB7A 4AYYB 1HUTH 1FN8A 2AMQA 2W3IA 2XOKD 1S81A 3RXVA 1G9IE 1ID5H 4BAKB 2VVCA 2ZU2A 1ESAA 1EPTA 1XVOA 3V7TA 2ZHWH 1G3DA 1GHWH 1O5GH 2ZC9H 3LGWA 1LVBA 1QR3E 1O2WA 2EEKA 2HOBA 5HXFA 5DP4A 4H4FA 4WXIA 2NU2E 2VWOA 2P8OC 1C5RA 1TPPA 1RTFB 2F83A 3SQEE 3URDA 2KCYA 4O03A 1SHHB 2KFWA 5J4QA 3M35A 1PYTD 3JZ1B 1KIGH 1IQLA 1XUJA 1B0FA 1DSUA 3RU4E 3U8OH 1WTHD 4ZCNA 3ZV9A 4TWWA 3S9AA 5J4SA 3T5FH 3LGYA 3IWMA 3QZQA 1QB9A 1DE7H 3U1JB 1DWBH 1GBMA 3A88A 4MPUA 5FPSA 4Y10E 1DWCH 2GT8A 3PB1E 1ZHMA 3UWJH 1O3NA 3NRLA 1J16A 1LKBA 1AZ8A 2H5CA 2O8TA 4F48B 3TK5A 5F8XA 4X1NU 1FY4A 1NZQH 1DY9A 2GVFA 5FCKA 1D4PB 1GJBB 4MQAA 3AAUA 1Y5BT 2EY4C 1YPMH 1P3CA 2XCFA 1MAXA 2FPZA 1P57B 1LO6A 1BB0B 2QN5T 2FOCA 1K28D 3A86A 4FU9A 2CMYA 5C0UA 5EIYA 1HJAB 1Z8RA 2OK5A 1OHHD 4MPXA 3K6YA 3UQVA 1P0SH 1QNJA 3KEEA 3KQDA 1K2I1 2BD9A 2W26A 2XWBI 1HAPH 3GY5A 2C3SA 2ZGJA 1BMAA 4Y0YE 3SNCA 1PQ5A 2SNVA 1UTKA 1EASA 1WUNH 2O8LA 2UUFB 3FVFB 1UVOA 2FXRA 4B6FA 1BRBE 4AGJA 1GMHF 1HJAC 1ANDA 1K1PA 4MNWA 4GPGA 1VZQH 2RDLA 1SOZA 3PWCA 1OYTH 3ZVGA 2IJOB 1GDQA 1ELDE 1GJDB 1GG6C 4YT7H 1DT2A 3E3TA 4FUBA 2PGBB 2D26C 3NWUA 1ETSH 2ZF0H 1G3CA 1P8VC 4MNYA 3SNAA 3URCA 1ESTA 2L6OA 3RXIA 1MCVA 2ZFSA 4ZMAH 4AC9A 3ATWA 1V2LT 2VNTA 3SU6A 1V3XA 5DO4H 1ZZZA 1NFWA 3F0PA 4FU8A 1ZPBA 2FOFA 4PROA 3MNCA 4ZKRU 9LPRA 1A5GH 3OE7D 1K1JA 1QY6A 4XFQA 2F9PA 3UFAA 4AG1A 3R3GB 1FN6A 1GJ9B 1MTVA 3STJA 2GZ9A 4AN7A 3VXEH 1ZTKA 2STAE 1SQAA 3BTEE 3VB4A 2F9OA 1FIWA 1EXFA 1ELTA 1GBFA 2TRMA 2VJ1A 3ZZ8A 3E8LA 5EQQA 4R8TB 1C1QA 1UTMA 1O2HA 1C2MA 2RCEA 1CA0B 4B74A 4X1RU 2HVYB 1G36A 1DLKB 4ZROA 3F2FA 2VBCA 4RN6A 2ZKSA 3FO8D 4MNVA 2PHBA 1ZTJA 2ZHDA 1BTXA 3SU2A 3UB0A 1BUIA 1HIAB 1GHYH 1W8BH 1C1PA 1EB2A 3WY8A 2BXTH 4D7GA 4A1XA 4KGAA 2LP6A 2ZCHP 3OY6U 5C20A 2VWLA 1V2MT 3O8DA 4VGCC 2BDAA 4B2CA 2Z94A 3W1EA 3O8RA 4CBNA 5FHTA 1YPGH 1E38B 3TLOA 3ZZDA 1W2KH 1KLJH 2FP7B 4NZQA 3UAIC 1KLTA 1HJ9A 2A2QH 1L1JA 3R0FA 2Y5FA 4K69A 4BAMB 3U69H 1ANEA 2QA9E 1V6DA 1IHTH 4DY7B 1BOQA 2PSXA 1T4VH 2B0FA 1CHOF 1MCTA 1Q3XA 1ZSKA 3RMNH 3PROA 4E7RG 4Z1MD 3T28A 1O2LA 5DGJA 3SHCH 1MTWA 2BVRH 2GMTB 2ZHQH 1NRPH 1C2KA 1O2PA 3SNDA 2NU4E 1C5OH 2A32A 1ZOMA 3L6PA 4TPIZ 1Q31A 2ZG0H 2LELA 1C5XB 4I8GA 1LHGH 3CS0A 3RU4T 3T25A 4I31A 1MD7A 5F8TA 1KXBA 4ISHH 1X7AC 5B6LA 2KZ4A 2EA3A 3I77A 1TB6H 3AASA 2BDBA 5E8EH 2Y81A 5DP8A 1UO6A 1Y8TA 1PPFE 2HGTH 1NU9A 2G5NA 1AN1E 1SR5C 3EYDA 2ZQ2A 4NA8A 1EJAA 1Z8GA 3T62A 4RT0A 2QXJA 2TGAA 1EOJA 1UVSH 1K1NA 1IOEA 1FY3A 1BZXE 2BVXH 3NXPA 3P17H 5A8YA 5I25A 2O8WA 2G8TA 3L3TA 2WPJS 2SGQE 1Y3UA 1GHXH 3RXPA 2ZGBH 1TNJA 1QB1A 2GCHG 1YM0A 2A7HA 3HK3B 3LJJA 3FZZA 3RXBA 1UK2A 4GSOA 1C5SA 4Y8YA 2BQ6B 1AU8A 4YM9A 4H6SB 2PKAA 2ZZUH 5L2YH 1GI9B 2G52A 2R9PA 4X1PU 4ISOA 4K8YA 1EKBB 2XYAA 3D49H 3PO1C 1GGDB 1C5MD 1LVYA 4NZLA 3MU5A 5A0CA 1EAWA 4M9FA 3MNBA 1GHAF 2A7CA 2VIPA 1TBZH 1QBNA 2UWLA 4AG2A 2GCTC 5EXNA 3RXTA 2GV6A 5H4IB 2ZHEH 2IJD1 1BT7A 3T29A 7GCHG 4OM9A 1A46H 2EQNA 2KAIA 2K1QA 3RMOH 5KGOA 5EJ1A 1QQ4A 3TGKE 2AGGX 2XW9A 5AVDA 1GGDC 2XCNA 1LTOA 1SHYA 1DLEA 3AK5A 4WMEA 1C1WH 1G2MA 3SU1A 3BTFE 4K60A 1PPZA 1FAXA 2FESH 2IPQX 1TPSA 3ZYEA 1QCPA 1GHBF 2GD4B 3SGAE 4P02A 1O2RA 3F9HA 3RXMA 1BTYA 2A4RA 2BY5X 1E79D 2XWAA 2TBSA 4XBCA 2Y5HA 4B73A 1J9CH 1GI3A 4Y79A 4MNXA 3F2GA 1K1OA 4WXVA 3TGJE 1ELGA 1HGTH 5IYTA 3SUGA 3V3MA 2XRCA 3AW0A 1PJPA 4U32A 4Y11E 1ANBA 4Q63A 1A0HB 2J2UA 4ABJA 4LZ1H 4HGCA 3MO9A 3ENSB 1V2TT 3VGCB 1L2EA 5DN6D 4UD9H 1N6YA 2I6SA 5GIBA 1QB6A 2YOLA 3RC4A 1SQRA 5HYOA 3GY8A 2Z6BD 1PQAA 1RTLA 4DCDA 4OS6A 1P3EA 3P70B 3S69A 5FXLA 5DKMA 1EPTB 4XBDA 1COWD 1A0JA 2ZPRA 4NWLA 1O2SA 5F03A 1S83A 2CHAB 1T31A 2BMGB 3QO6A 2YMSD 4I8LA 1BTZA 3F9EA 4BXSA 1GBEA 3FP8E 3SI4H 5K7RA 2H6MA 5JB8S 4A92A 1FV9A 1WSSH 2BDGA 4RT1A 1GWAA 3SQHE 2FWWA 2O8UA 1EATA 2G5VA 2F43B 4NIVA 1BRAA 1G3EA 1XKBC 1BA8B 1UK4A 5FPYA 3N7EA 3ZVEA 1HAIH 1HAGE 4MVNA 2RA3A 1O2QA 4X0WU 1QL8A 3TNTA 2JKHA 4O3UA 2V0BA 4GUXA 1WCZA 5JDUB 3ZZ7A 1O3AA 3VXFH 1XXFA 2XXLA 4DIHH 1OKXA 1TQ7B 2VU8E 3TIUA 1VJ9U 1SVPA 4Y7BA 4E05H 4TPYA 4FUHA 1AHTH 1YWUA 1ZPZA 1FQ3A 1YC0A 5A09A 1GBLA 3EA9A 4XD7D 1UTQA 6ESTA 2JH0D 1TNIA 1SI5H 1SGFG 4BOHA 3KQ5A 3GDSA 3U98H 2FEQH 4RI0A 1NBME 1ETTH 5SGAE 1TFXA 1O5EH 1TX6A 1MBMA 5AHGH 1YF4A 3Q3KA 4UFGH
chains in the Genus database with same CATH topology
1GJ5H 1SMFE 1MU8B 2ZA5A 2ZPSA 2ZWLH 2C93B 3A8CA 3U8RH 4NCYA 5C5OA 1IQJA 3E6PH 2QF3A 4FUEA 1L4DA 1HXEH 1WQVH 3VB6A 1HDTH 2ALVA 4TY7A 1SGEE 2WV4A 3BIUH 1WTGH 3SJIA 2ZEBA 4ABDA 1Z6JH 4AFSA 4MPVA 1L4ZA 7GCHF 3BTWE 4AFUA 2ANWA 3FP7E 1JIRA 2G4UA 2R2MB 2NWNA 3UUZA 6GCHF 4K1TA 3TH2H 3QUMP 4D9QA 1TGTA 2GTBA 4IN2A 1GI2A 4H6TA 3ZZ4A 2FOHA 1VITH 1C5LH 2BTCE 3A7WA 3RUOA 4MTBA 3Q77A 3UOUA 3PYHA 1E34B 3SI3H 1HAVB 1C5YB 3LGIA 1WV7H 1TGBA 1SLWB 1Z8JB 1M9UA 4IMZA 2A4QA 2BQWB 1G37A 2CN0H 3RXAA 1C5UA 2VIDA 3U9AH 1P12E 2BDIA 2P94A 1HBTH 4GAWA 1H9LB 1CGHA 5DPAA 1EAIA 1GCDA 3RXSA 1S6HA 4ZXXH 4JZ1A 1ZGIA 1CGJE 1RD3B 3SUEA 3SUFA 4BTTB 1GBHA 2BD4A 3TPIZ 1W7GH 4FUCA 1VCPA 2ODYB 5GPIB 2V35A 1C1MA 1D3PB 2WPMS 1O3PB 2EI6A 1O36A 1FY8E 4Y71A 1GMHG 1OOKB 2FYRA 1GJ8B 1A5HA 1MTNC 3M37A 3ATMA 1CU1A 5K0HA 3H5CB 3S7KB 2H2ZA 1AQ7A 1O3MA 1AUTC 1ELCA 3E91A 4M7GA 2B8OH 3RM2H 4IGDA 2CV3A 3F68H 3MFJA 4U2WA 3NKKA 4R0IA 3A7TA 1C2GA 2OUAA 4XBBA 4NIYA 2QGRA 1MZDA 1AE8H 1MQ5A 2TGDA 1Z8IB 4B71A 1K21H 3E90B 2W7SA 1D6RA 5HM2A 1GI0A 3BV9B 2UUYA 3N7OA 3UY9A 4KKDA 1CT0E 2A31A 1HAHH 1OWDA 6CHAC 4ZXYH 4D9RA 3P8OA 5E2OA 1IQKA 1HAZB 1O32A 2H1UA 4GHTA 3LPRA 4AOQA 5FX5A 1XMNB 1GVZA 4CRGA 1P2KA 2TIOA 2H9EH 3P6ZB 1AO5A 1V2KT 3E16B 3RP2A 1NRRH 2VINA 3QGNB 1HNEE 1GHVH 3KNXA 1GJCB 2BY8X 4K3JA 4D76A 2C90B 4X8SH 3BTTE 4BAOB 4Y76A 1RXPA 3RXGA 1YP9A 3EGKH 1SOTA 2SGEE 7LPRA 1LMWB 1P2NA 4TWYA 4AX9H 1FPHH 1DOJA 4Y6DA 3MYWA 2AERH 2ZI2H 3ZZBA 2LPRA 3L33A 1FLEE 1GBJA 3A8AA 3A8BA 1O3CA 3V0XA 1MBQA 2OQ5A 1Y59T 2FI4E 1NRNH 1T7CA 1CVWH 1N1LA 2F3CE 4ISNA 3RC5A 3QX5H 1O3OA 1HLTH 1FNIA 1OPHB 5FX6A 1PYTC 2OC0A 2BD7A 1O5BB 2R2WU 1EZQA 3UNQA 3BG8A 1Y5UT 2C8ZB 2EI8A 1O2VA 2PKAB 4DVAU 1PQ7A 2BY7X 2GZ7A 2BDHA 1F5KU 4YESB 1GBTA 3MHWU 4INLA 3SO3A 4ABHA 3SU4A 3LDXH 5C3NA 2DE9A 1CHOG 1JMOH 1GMDF 1KLIH 1TYNA 1W11U 1TWXB 1Z71A 4JK5A 3QLPH 3GY2A 2Z3DA 3PMJA 1BTUA 2BLVA 4NG9H 2R0LA 1BTHH 3W94A 3U8TH 1BJUA 2Z9KA 1TAWA 5IDKA 3P8FA 3SV9A 7KMEH 1O2OA 1GI7B 4DGJA 3BEFB 5EU8A 1OXGA 2HRVA 2TPIZ 1C1OA 2BDYA 3SV6A 2P3FH 2ZDKA 4X1SU 3GISB 5AFYH 2F91A 4CH2B 2CF8H 1CSOE 3GY7A 3IITA 4YO9A 2PTNA 2VIQA 2HVXA 2ZTZA 4Q7XA 1QTFA 1E36B 4X2WA 5EODA 1ELEE 2AYWA 1AVXA 1GMCG 4NSYA 1G2LA 1MQ6A 1IQEA 3EAJA 1SLVB 2FX4A 1F2SE 4DIIH 1ZRBA 3C27B 5LGOA 5L6NH 3HK6B 1SGTA 3UNRA 3TITA 5ABWA 2XNIA 1K1MA 2VIWA 2A4GA 5JBBS 3E1XB 1W0YH 3V12A 1O2JA 3EA8A 1GHAG 2Y80A 2ZDLA 1ZGVA 4F4OC 1AKSA 2C8YB 2IN2A 4AGKA 1RTKA 1ORFA 3OU0A 1C1RA 1CHGA 1ZJKA 1EQ9A 1IQNA 1YBWA 2QC2A 2TGPZ 2V3OH 4I8KA 3VFEA 2YNBA 3QWCH 1INCA 2FM2A 1UTPA 1D9IA 1VR1H 2P59A 4WWYA 1YPHE 1GI6A 1YPEH 3MU8A 3M5NA 1TMBH 3SHAH 4X2XA 2FO9A 3TK6A 1DANH 2UUKB 2QV1A 2ZCLP 1GHBG 3A83A 3EE0B 4H42U 2GDDA 2ZGCA 1ACBE 2GGVB 2W3KA 2WPIS 1AIXH 1JRTA 1H9IE 1AVGH 3SN8A 4BAHB 1GBAA 1S0QA 3U1IB 3A7XA 4JZDH 5F8ZA 2OC1A 5GWZA 5JB9S 1C1VH 1CA0C 2GP9B 1H4WA 4LK4A 1AMHA 4AORA 1DSTA 1AI8H 5DP7A 4A1VA 1JWTA 2NU1E 3UIRA 1W3CA 3KN2A 3PLPA 1E37B 5TCAA 3TU7H 2WPLS 3B8JA 2HNTF 3T2NA 1V2QT 1C2DA 3VEQB 3RMMH 2HLCA 3GCTG 1P02A 5T6FA 2ZGXH 3A80A 1J8AA 3M5MA 1O39A 1O5DH 3C1KA 3EA7A 3P8GA 1C1UH 3LGUA 3A7VA 1S0RA 1V2WT 2FMJA 2Y5GA 2FOMB 1GBCA 1LQDB 3FZDA 4GCHG 5JBTA 1ZSJA 4IC5A 2C4FH 3LT3A 3Q3YA 1EOLA 3MU1A 1JBUH 1O2MA 1ZJDA 3ZV8A 3KGPA 1NN6A 3S9BA 1O2UA 1GBKA 2ZDVH 5BPEA 2QXIA 3SJ8A 1SGPE 3ZVDA 1O3JA 2Z9LA 4MDSA 1QBVH 2GMTC 4BANB 2WV5A 1KDQB 4IW4E 4LOYH 1P10A 2PKSB 4AB9A 3I78A 1GJ7B 2FTMA 1ZTLA 1QJ6B 4YOGA 2FODA 4JMYA 1GDNA 1V2JT 3O8CA 1GL0E 1UHBA 4RSPA 3KIDU 5ESBA 1D3TB 2VH0A 3A81A 1NTPA 1RRKA 2AGEX 4INHA 4CREA 4Z6AH 1KXCA 2A0QB 5DJ7A 1C4V2 1EJMA 4OS5A 1O3LA 1GMCF 3B23B 3QTOH 1O3FA 1GI4A 3BTKE 4O9VA 1SSXA 3F1SB 5AF9H 1TABE 2LNCA 1OP0A 1TBQH 2BD2A 1W14U 4XSKU 3MI4A 2FTLE 4GVUA 4Y0ZE 1VGCB 1XM1A 4DW2U 1UVPA 4B76A 2A5IA 3GCHB 3LU9B 1U6QA 1UJ1A 3ZVBA 5DK1A 1FMGA 1PFXC 2BX3A 3LH3A 3RDZA 3JZ2B 3M7UA 6GCHG 1Y3WA 1P2IA 4XDEA 1EZSC 1ELVA 2VIVA 4YT6H 2OTVA 1Z6EA 1EP5A 1QJ7B 3QK1A 2GDEH 1ARCA 1NM6A 1RJXB 1IQGA 1C5VA 2VIOA 1ZMNA 1CE5A 1AWHB 1L0ZA 1N6XA 1OWEA 1C1TA 1XUHA 1A1RA 3K65B 2NU0E 1SG8B 2PR3A 1GVLA 1O2NA 3KQEA 3PTNA 1O2TA 3LC5A 1C1SA 1FI8A 1LPGB 4AZ2B 4Y7AA 2VWNA 3PMHB 1ABIH 1WOFA 1LHFH 1SQOA 1TRMA 1CQQA 4O3TA 3PMAB 4RKJB 3O8BA 3NCLA 3UWIA 3DUXH 1HCGA 1O0DH 1UK3A 3GCTF 1LHEH 3HKJB 1N8OB 3RXOA 2F9VA 2P93A 3TJVA 3HATH 2BZ6H 1XX9A 4O97A 1TNKA 1BTWA 3MMGA 4ZHAA 3VGCC 3GY6A 4I7YH 1TGCA 1F7ZA 4TY6A 2BOKA 2Q1JA 4FUJA 3GDVA 3MTYA 3GYMA 1ZMJA 4I8HA 5JPMH 1A0LA 1DX5M 4GCHF 3FANA 3FFGA 1P05A 1TRYA 1QRZA 3BSQA 1O2GH 1EPTC 3RM0H 1GI5A 1LVOA 3LGVA 1N8OC 3RXUA 4NA7A 2ZTYA 1IHSH 4BNRA 1KXDA 1GJ6A 4OS2A 5A0BA 1QJ1B 2CHAC 2Y7XA 2RG3A 3M5OA 2G81E 5EXLA 2FS9A 1DPOA 1IQHA 3MH7A 1F0TA 1NFUA 1T8MA 2BLOA 2WUCA 1FXYA 1O3GA 1EZXC 5ESTE 1SLXB 1DWDH 2ZFRH 1TE0A 1BHXF 1NC6A 3P8NA 1LQEA 4ZHLU 2FLRH 3F6UH 2J34A 1JXPA 3SU5A 2SGPE 1AFEH 2VWMA 2Q6GA 1TPAE 2B5TB 2FX6A 1FJSA 4Q80A 2HNTE 4YOIA 1MKWK 3SOSA 1HIAA 2UUJB 3RXDA 4CHAB 2A5KA 4WMDA 2XTTB 1SB1H 3PLKA 3ZZ9A 2OBOA 2BX4A 3BG4B 1JOUB 3M3TA 2XC5A 4BXWA 4X6NA 2G4TA 2BD8A 1AD8H 4NFFA 3BTDE 2PGQB 1O34A 2NU3E 2G51A 8GCHF 3ZVCA 4KTUA 1UVTH 1O3KA 1BCUH 2PUXB 2DE8A 5DP9A 2F9BH 1NESE 2ZHFH 2ZTXA 4IMQA 4CHAC 2BQ7B 5T6DA 1G30B 3BG4C 4FUDA 5CE1A 1UMAH 3SBKA 2OINA 3SZNA 1AB9B 1P2OA 3KCGH 1SL3A 3H7TA 1ARBA 4GLYA 1A4WH 2ALPA 1FAKH 4FUGA 3SNEA 2OC7A 2ZGHA 2AEIH 1E35B 1GMDG 1C2IA 4U30A 1TGNA 1O38A 1LHDH 2IPHA 5JBCS 4FUFA 2FOAA 4CBOA 2RA0A 1CA8B 4IC6A 2W7UA 4LXBH 1TA6A 4JYUH 1Y3YA 1AB9C 1DICA 5L2ZH 2CXVA 3M5LA 2VGCB 2J95A 1OYQA 2GKVE 1W10U 1YCPM 2GX4A 4ABAA 4X2YA 3A87A 1ZYOA 1W13U 3GY4A 1SFQB 5E0GA 4D7FA 2FI3E 2BVSH 4B75A 3FAOA 2P3UB 2VH6A 1EP6A 2SFAA 3PLBA 3OY5U 1G3BA 3G01A 1EX3A 1QRWA 4SGBE 3Q76A 2ZDNA 2A5AA 4WH6A 3ZZAA 2VGCC 4OGYA 3S9CA 1F0UA 1D6WA 5CHAB 1HAOH 1PPGE 1THSH 3K6ZA 2CJIA 4HFPB 1O37A 2Y7ZA 1V2RT 2EC9H 1GDUA 2CF9H 2SNWA 4E06H 2AH4X 4UONA 3DD2H 3GY3A 2FS8A 3BTQE 2ZECA 3B9FH 1J14A 3OTJE 3MWIU 1IQMA 1MAYA 3M3VA 1TNLA 3RXCA 2H5DA 2ODPA 1RS0A 1PPHE 2HALA 1FY1A 1C2JA 1K1LA 2Q6DA 4D8NA 4K8BA 5EOKA 3RC6A 1IQIA 2ZIQH 2AGIX 4DT7B 1O3BA 1XUFA 1DY8A 2ANMH 2XBYA 1WQSA 2W5EA 4ZKSU 3ZZ6A 5L30H 2J9NA 3RLYH 4ABEA 3ODFA 3SW2B 5LH8A 3KHVA 3A85A 4WH8A 3EDXB 4BTIB 5GJ4B 2FDAA 3ATKA 5A8XA 2SGFE 1NT1A 1C1NA 3NUMA 2QXGA 4AYVB 3TGIE 3ZZ3A 5A2MH 4UDWH 2O9QA 3SGQE 3RU4D 3BEIB 1SGCA 4JYVH 1WAYB 1FIZA 4I33A 3QGJA 3UPEA 5TJXA 3UR6A 4JYTA 5FCRA 4ZHMU 1O3HA 1OP2A 2GZ8A 1ELBA 1DXWA 1EUFA 1AVWA 3UTUH 1DS2E 1O2XA 1ZLRA 2AFQB 1HXFH 4XOJA 1P09A 3ZVFA 1C5PA 1S5SA 5GCHG 1HPGA 1SLUB 1UTNA 1QFKH 2QXHA 5HMAA 4LZ4B 1SQTA 1SGYE 3DA9B 4NA9H 1FPCH 4K1EA 3IG6B 5CMXH 4JZFH 5FAHA 1PQ8A 1OX1A 3MO3A 4HZHA 2GT7A 1O2IA 2I6QA 1C5WB 1P06A 2ZFFH 2UWOA 1NRQH 3SV7A 1RFNA 4U01A 1QRXA 3OYPA 1V2OT 2AIPA 1YPKH 2KAIB 3MNSA 4I8JA 1TNGA 1J15A 2C8XB 1KYNA 1EAXA 4F49A 4AB8A 4ZH8A 3A8DA 3UREA 3D62A 3ZYDA 1GVKB 4J1YA 5B6OA 1DDJA 4B2AA 3RXRA 8LPRA 4X8TH 1MU6B 2FI5E 1QIXB 3PWBA 1Z1JA 4UFEH 1Y3XA 2Q6FA 3LKWA 1A5IA 3RXEA 1DXPA 1BQYA 7ESTE 2ANKH 2ZPQA 2GV7A 4GHQA 1O3IA 2ZDMA 4IBLH 1OSSA 4WJG2 1KTSB 4X6OA 1AE5A 5GXPA 4CRFA 1IQFA 1TLDA 1LPKB 1W12U 3UQOA 1DWEH 1GG6B 2ODQA 1SGNE 2F9UA 1AFQB 1TX8A 2P16A 2PLXA 2ANYA 1UTJA 1YPHC 1YYY1 2G00A 1SGRE 1H8DH 4A7IB 2QYIA 2AMPA 2QY0B 2FZZA 3I29A 3CS7A 5C5NA 1DFPA 1GBDA 4YLUA 2BLQA 2VVVA 1IAUA 1THRH 2XBWA 1NRSH 1H9HE 2ZFTA 3SUDA 4E7NA 1A61H 1MZAA 2PSYA 1KY9A 3RXLA 3PM3A 1Y5AT 2BD3A 1KXFA 4X8VH 2TGTA 1NY22 2BY6X 4DJZB 5C1UA 1AFQC 4INKA 5DP5A 4X8UH 1H1BA 2BHGA 3E0PB 1TBRH 1L1GA 2R3UA 1W0ZU 2YNAA 2ZQ1A 1DM4B 2BD5A 3UNSA 4X6MA 1VITF 1HAVA 3RXQA 2FYQA 4TYDA 1C2FA 2ESTE 1D3QB 1MUEB 2ASUB 5E0HA 4AFZA 5JBAS 2OBQA 2Y6TA 1V2ST 1GJAB 2A1DB 1SGDE 1ZMLA 3BTME 1KXEA 2BM2A 3CENA 1XVMA 1C5TA 1XKAC 2V3HH 1EJNA 1C4Y2 2JETB 4VGCB 1ZR0A 3BIVH 1NPMA 2P3TB 1K22H 1MKXK 1YCPK 2FIRH 2ULLA 2HPPH 3FP6E 4SGAE 3DHKH 1PPEE 1TRNA 3TK9A 1T4UH 5GCHF 1ANCA 4KTCA 3MH4A 1LVMA 2JH6D 3M7QA 2PFEA 1QURH 2H9HA 1C2LA 2STBE 3LOXA 1PPCE 2WINI