5C5OA

Structure of sars-3cl protease complex with a phenyl-beta-alanyl (s,r)-n-decalin type inhibitor
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
300
structure length
300
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Fused-ring structure of N-decalin as a novel scaffold for SARS 3CL protease inhibitors
rcsb
source organism Human sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
total genus 88
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 5c5oA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5c5oA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5c5oA02
1IAUA 4X1SU 1HAPH 1MD7A 1P2KA 3BTME 3RXCA 4CBNA 1YPMH 3PWBA 1C1TA 1TRNA 4OS4A 1W7GH 3OTJE 1O2UA 3ESTA 3HGNA 1AFEH 2HNTF 1O30A 1MZDA 5EPYA 1NPMA 1T8OA 4JK5A 3VB5A 1V2WT 2BY8X 1NROH 2ZU1A 4X1QU 3ODFA 4NA9H 1WTHD 2GD4B 1XUGA 1O35A 4Y7BA 1SGTA 2P93A 4FU7A 5ESTE 4E06H 1THSH 1LQEA 1CA0C 1AU8A 1PYTD 3A87A 4O03A 3P92A 1DPOA 2VINA 1GI0A 2HRVA 1HNEE 3BTDE 5LGOA 1OXGA 1BJUA 4MNYA 4CHAC 3ZZBA 3PMJA 1DS2E 1Q3XA 5CMXH 1O2MA 3LGYA 2V3HH 1BDAA 1O3BA 1L4DA 4MPWA 4AGKA 2XBVA 3RXGA 4SGBE 1HPGA 5DP5A 1HAVA 1T4VH 1EZXC 1UHBB 4X8VH 5EQQA 3CP7A 4MVNA 4XDEA 3MH7A 4PROA 1HLTH 4ZAEA 1UO6A 4X6MA 1UK2A 2F83A 4R8TB 5C20A 1NRNH 1GBMA 1E38B 2ZTXA 4MLFB 1AZ8A 1GJBB 3LT3A 4F49A 2C8YB 3ZZ3A 1DLEA 3CENA 1O5DH 2RDLA 1ELEE 5E0GA 4I8GA 1GVLA 1GJ9B 1S5SA 5HGGA 3TH4H 2FOCA 1GBEA 2YNAA 5ABWA 1UTPA 3VEQB 1O0DH 1LKBA 4K2YA 4Y7AA 3K6ZA 3UOPA 1CHOG 1P2IA 1TWXB 4CREA 1C5UA 5GXPA 1KXEA 5C1XA 4ZKOU 3ZVDA 1YLDA 1U6QA 2VWNA 2AGIX 3TK5A 3AVZA 1UTJA 3VFEA 2BY7X 2IOTA 2ALVA 1JIRA 3A8BA 3RXAA 2P95A 3URDA 2J34A 1DOJA 2M5TA 1CBWC 4OS2A 5HXFA 2ZC9H 2J92A 4JYUH 2H2ZA 2FOFA 4CRAA 3T27A 5C2ZA 1O2TA 2BLVA 4AFUA 1HRTH 4WH8A 2WV5A 1LPZB 5GDSH 1TNLA 4JK6A 4KP0A 4X1RU 1EJNA 3Q3YA 4JZEH 1W0YH 1RTLA 2F9BH 3BIUH 1C2IA 1GL0E 3ZZ9A 1P10A 4YOJA 1VR1H 6GCHF 1ZRKA 4I8JA 1S82A 3BSQA 3GY5A 2AGGX 4Y0YE 1QFKH 2G81E 2P16A 3ZV8A 1N8OB 1C1QA 4B2BA 4THNH 1GBAA 1O37A 2GDDA 1TALA 5A0AE 3BTEE 1C2HA 2ZU3A 2TRMA 1H9LB 1BITA 2ZWLH 1PFXC 4Y8ZA 1MAXA 1UK3A 3UNQA 1YPHE 3TJUA 4KTSA 2Y80A 1GG6C 3C27B 5J4SA 2YNBA 4DG4A 1O3CA 1ZSKA 3GICB 1EP6A 3S0NA 4XOJA 1O5EH 1TGBA 5JBTA 3GCTG 1MKWK 2O8LA 2ZTZA 4XE4A 2BD9A 3VPKA 1GVKB 1O2VA 1C5XB 1TPPA 3EYDA 1FAKH 3O8DA 4E7NA 1Y5AT 1P9UA 3V0XA 5DP7A 4Q7YA 3AAUA 2Z9GA 1AMHA 2PLXA 8GCHG 1LVOA 2PTCE 2PV9B 2R3YA 3A8DA 2GMTB 5DPAA 2XXLA 1BBRH 2Q6DA 1O2QA 1MCVA 1LMWB 4FVDA 5I46H 5JBCS 1CT2E 2KAIA 2V35A 3SZNA 4AB9A 4AFZA 2P3FH 1YCPK 1C2LA 1QNJA 3AAVA 2ANYA 1VCPA 2GCHF 1GHZA 3UWIA 1CT0E 1SGFG 1H1BA 1TNGA 4A1XA 3QZQA 4INLA 4D9QA 1O5FH 2PKAA 4YOGA 1CE5A 1TRMA 5FPTA 4Y71A 3BV9B 4YT7H 1B0EA 2I6QA 1C9PA 3M5MA 1O2WA 4D8NA 1O2HA 1UVOA 3M5OA 1P8VC 4X8TH 1DFPA 1A2CH 4I33A 4IBLH 1HUTH 1O2LA 3ZZDA 1ANCA 2GCTB 2XC4A 3HKJB 2WPKS 1CSOE 3M7UA 4Q2KA 4Q7XA 1J17T 2AMPA 1P01A 1QRWA 5FCRA 2ZFSA 1H9IE 2GP9B 2OLGA 1PPZA 1YC0A 1HJ9A 4KGAA 1A5HA 4M7GA 2BB4A 3KIDU 1DX5M 3BTWE 3SNDA 2B0FA 2LNCA 1GWAA 3T29A 2F3CE 4X8UH 3UNSA 3LH1A 1AVXA 2A5KA 3M3VA 1KXDA 4X6PA 3P17H 2Z3EA 3MFJA 1D3TB 2ZCKP 3QGNB 3STJA 5A8ZA 1O5AB 1IQNA 1TPSA 2FMJA 3A84A 2VWLA 5FPSA 3NWUA 3A88A 1TE0A 3EQ0H 1SGEE 4ABHA 1W13U 5C67A 1S85A 1K1PA 5PTPA 1BHXB 1OWDA 1QHRB 2HWLB 5DP4A 1GHYH 3OY5U 3QWCH 4NCYA 1EB1H 1WQSA 2AH4X 2ZO3H 1QB1A 3OX7U 1O2OA 4FUIA 1DT2A 4ISNA 1O39A 1C4V2 3RU4T 1SGRE 3SGAE 1GHXH 1BBRK 3FZZA 3BG8A 4X2XA 2OCVB 5LPEA 1O5CB 1DITH 3P8GA 1FY5A 4D7FA 1UMAH 3SW2B 1FY3A 1E35B 1C2FA 1V2QT 4MTBA 4GHQA 2P8OC 4X6NA 2CHAB 1FV9A 6GCHG 3KNXA 1O2SA 2ZDLA 3RXRA 2C8WB 3PLKA 2G8TA 1QBOA 2ZGXH 4DCDA 3UQVA 2BVRH 5EGMA 4KTCA 1S6FA 4E05H 2W3IA 3MU1A 2C93B 1DDJA 2A4RA 1H8IH 2Y6TA 2JH0D 1SVPA 3MNBA 4DW2U 2AS9A 2CXVA 3ATIA 4TYDA 4NSYA 1HJAB 1XUFA 1UTQA 9LPRA 3PM3A 1W12U 2XWBI 3GDSA 1C5LH 2PKSC 4A1TA 1ABIH 4FUJA 1IQFA 1NFXA 2FO9A 2ZCHP 1S0QA 2VIDA 1V2TT 1GMHG 3RXUA 1A1RA 1FNIA 4K3JA 2P3UB 4LOYH 1ID5H 2O8WA 3GCNA 1UCYE 1A3EH 1O3IA 3GISB 3SV6A 3SU5A 1UK4A 1MUEB 3PMAB 3ZVGA 3DFJA 2UUYA 1GBCA 4NFFA 4INHA 3SO3A 1MMJN 1A3BH 1SGDE 4AB8A 3FANA 1CA8B 3GY7A 1GDQA 2EI6A 2FOMB 3FP6E 3GCOA 2A5IA 1V3XA 1H8DH 1PQAA 4GSOA 1S84A 1LTOA 1BIOA 3Q77A 4YO9A 1IQLA 2IPHA 5FCKA 4ZUHA 1QJ7B 2ULLA 2DE8A 1OKXA 2VVCA 3KQEA 1Z1JA 2BYAX 1O36A 2Q1JA 2QXHA 1BCUH 3RLWH 1WTGH 4UE7H 1OWEA 2GCHG 1QBNA 1ZHPA 5JBAS 1G36A 5EQRA 1W11U 3KQDA 2HALA 1FI8A 3NXPA 1LHGH 2TGPZ 1AUJA 3B23B 3OYPA 1EUFA 1KY9A 2EEKA 1C1NA 3SV7A 2V6NA 2Z7FE 3A85A 2JKHA 3QLPH 4BANB 2BD2A 4AORA 1Z7KA 3MOCA 3TITA 2PW8H 2TIOA 2Z6BD 3EA8A 1TBQH 1GJDB 1P3EA 3S9BA 1AB9C 1O2IA 3QZRA 4NWLA 4Y79A 5HMAA 5E8EH 3M61U 1M9UA 4FUBA 3KGPA 4YT6H 1PPBH 3EE0B 3RU4D 3DA9B 3JZ2B 3SJ9A 3RC5A 1TBRH 4J2YB 1PQ8A 2A4GA 1SGPE 2R2WU 2ZHQH 2G5VA 2R9PA 1ZPCA 1RS0A 4BAOB 2VJ1A 3F68H 4WVPE 3MH5A 2ZNKH 3RXVA 4Q7ZA 3VB4A 3ZYEA 2BDCA 1SQAA 3FP8E 1W3CA 1K1IA 2AERH 3ZZ6A 4ZMAH 2CF9H 4YLQH 3FP7E 3TGIE 1CT4E 3U9AH 4IN2A 1CHGA 1DANH 1YM0A 4UDWH 3K6YA 1Q31A 3TH3H 2OD3B 1ZR0A 1HJ8A 2B9LA 4I8KA 4TY6A 1TOCB 2FESH 1GGDC 4WMFA 2H9HA 1ACBE 1C4U2 1G30B 2SGAA 1B7XB 1GI5A 1KIGH 4Y6DA 1C5YB 1B0FA 3DHKH 1G32B 1O2ZA 2BZAA 1TNHA 2VIQA 3RXKA 2H5CA 3SU6A 4Y10E 4DOQA 1L1NA 5E0HA 2OXSA 2FLBH 1SGQE 2ZFQH 4K60A 2EA3A 2GV7A 1UTNA 1JXPA 2C90B 2BLOA 1WAYB 4X2WA 2VIPA 2GKVE 1V2RT 3KHVA 4WJG2 5E0JA 4LZ1H 2BDBA 4BNRA 2BY9X 3H7TA 3R0FA 2ZQ2A 4B76A 3RXMA 5HYOA 1C5MD 4OS1A 3BIVH 2R2MB 3GY2A 1QJ6B 1TPOA 2QC2A 1GJ4H 2FOBA 1NRQH 3SNAA 1GMDF 4Y76A 4GCHG 1C1WH 1E36B 3LC3A 1O2JA 4MNWA 3L3TA 2ZGJA 1O33A 2VIOA 5AF9H 1MQ6A 2BD7A 1GI3A 1HXEH 1C5SA 1Z1IA 8LPRA 1GI1A 4Z6AH 5B6OA 2TGTA 1O2YA 1L0ZA 1DE7H 1PPEE 1ANBA 1KTTB 1K1MA 3JZ1B 2GGVB 1NFUA 5EOKA 4OS7A 3MH6A 5JB9S 1O3MA 1WV7H 5DKMA 5DGJA 1O38A 1UTOA 3UUZA 2C8ZB 4OS6A 4Y8YA 2B8OH 1FUJA 3GCTF 1GI8B 5EXNA 1SGYE 1KSNA 2PSXA 1G3DA 1CQQA 1F5RA 1V2ST 1TMUH 3PO1B 1VJ9U 3SJKA 1SFIA 4A5TS 2ILNA 3HATH 2BXTH 1MCTA 1G9IE 3ZVEA 3ZYDA 2TBSA 3MU0A 3EAJA 1GJ8B 4FUHA 1GHAG 3LOXA 1BB0B 1Z6JH 3T62A 3TNSA 2SGPE 2AIPA 1ZSLA 3LGVA 1BRAA 2Y5FA 2H6MA 3F9HA 3LU9B 3MMGA 4I32A 1IOEA 4GPGA 1TNIA 3AW0A 4NIVA 1C5QA 3FVFB 4AX9H 4WMDA 1YP9A 1ELFA 4HZHA 2A2XH 2ZKSA 1GHBG 1MU6B 2VGCB 2ASUB 4WY3A 2WINI 3MTYA 1GBDA 3PLPA 1C5PA 5C3NA 4B2CA 3RXFA 2IJOB 3PMHB 1BZXE 1XXFA 1C2JA 1NS3A 2PUQH 2CJIA 4UFEH 1F5LA 2XYAA 2D8WA 2HGTH 3A82A 2HPQH 2C3SA 5IDKA 1P03A 4Z0KA 1LQDB 1VGCB 3MU5A 2J94A 4JCNA 3MI4A 1LHCH 1AIXH 1EATA 1LDTT 1WSSH 2NWNA 4LK4A 1JBUH 1SGCA 5BRRE 1BTZA 1SLWB 1GCTB 1BMNH 2TGAA 3SOSA 4XFQA 1SR5C 3QN7A 4FVBA 5IYTA 4VGCB 2H5DA 2FI3E 1AZZA 5FXLA 1RXPA 2A32A 1CVWH 1T31A 3LIWA 4WF8A 1DWDH 3SU0A 1MBQA 1W0ZU 4ABDA 3PWCA 1GCDA 1A7SA 5EODA 2UUJB 1RGQA 2UUKB 3I29A 3LGIA 1YBWA 3QX5H 5JPMH 2CV3A 1HB0B 1TABE 2VWOA 3MWIU 3RXTA 3TJOA 4CRFA 1UJ1A 1O3GA 4O3UA 5DP3A 5L2YH 3GYMA 2XRCA 3T2NA 5AHGH 3S9AA 1SMFE 3UIRA 3SBKA 1NFWA 3SUEA 4K8YA 1XUHA 4ZKSU 5F8XA 4B1TA 1W14U 3P70B 3RLYH 3E6PH 3MH4A 4INKA 3RXBA 4FU8A 4CR5A 1DWEH 1DY9A 2PR3A 2D26C 4CRCA 1V2OT 2VH0A 1BRBE 2SGDE 1DVAH 3SU1A 1NFYA 1Y3XA 1UTKA 1GMDG 1TOMH 1XKBC 3V12A 1TX7A 4ISHH 6CHAB 1ESTA 1O3OA 8GCHF 4U32A 2ZIQH 2BM2A 1ZJKA 4ABAA 5T6FA 1W7XH 5L6NH 2ZP0H 2IN2A 1ARBA 1GBIA 4MPVA 2R0KA 1QIXB 4B75A 1K21H 1SL3A 4XBCA 3VGCC 3AW1A 1D3PB 1K1JA 1YPJH 2XTTB 1RIWC 3E91A 1EPTB 1MKXH 1MAYA 3Q76A 1AFQB 1OP0A 2WPIS 1GMHF 2FX4A 3TGKE 4X1PU 1HV7A 4ABBA 1SBWA 3ENSB 2ODYB 1ZJDA 4MQAA 3E16B 1HAIH 2ZF0H 2ZDMA 1UVUH 1GI9B 1XKAC 3KQCA 1WQVH 4UFFH 2BTCE 2AGEX 5F03A 3NKKA 2WYGA 4MNVA 4IC6A 1QL7A 2O9QA 4UEHH 1Q2WA 1GPZA 2UWPA 3NPSA 5GCHF 1ZRBA 1ETRH 1C5WB 1SLXB 3BG4B 2BX4A 4KTUA 1EZUC 3U69H 1SSXA 3O8BA 3FFGA 1TAWA 1ELBA 1HBTH 4H4FA 2P94A 5T3HA 3ZVCA 2PHBA 5DP8A 1DICA 4ZH8A 1BTYA 1UHBA 3GCHB 2EI8A 1W10U 2BXUH 1TX6A 1ZHRA 1GBTA 2SGFE 1YYY1 5CE1A 3VB3A 4B2AA 3SU3A 1FZZA 3MU8A 1A0JA 1V2UT 1S6HA 1FY4A 5H4IB 3RU4E 2BY6X 4CR9A 4ZROA 2ZCLP 2ODPA 3PROA 1AN1E 1EAWA 4TY7A 1GHWH 1TGSZ 1TBZH 5HM9A 2SNVA 1WU1A 3HKIB 5GJ4B 3T26A 1XUIA 1OOKB 2WYJA 4WH6A 3BEUA 1LVBA 1N1LA 2ZGCA 2WPHS 2CN0H 2BDAA 2FX6A 1X7AC 4IC5A 4AG1A 4BOHA 1QTFA 4ZHLU 2FIRH 1FY8E 4DGJA 2BOKA 1ELGA 2STAE 2FLRH 2YOLA 2FEQH 3FAOA 1BMAA 1GBJA 3IWMA 2Z9LA 2Y5HA 4JZFH 5C1UA 2VIWA 1Y5UT 3MYWA 4I8LA 4GLYA 1B5GH 1NU9A 2ANMH 1ESAA 2JETC 2OBOA 1MKXK 2Y82A 2XCFA 3A7ZA 3SGBE 4AG2A 2W5EA 2Y7ZA 1G2MA 2A7JA 2LIZA 2TPIZ 4ZKNU 1TGCA 3A7TA 1SC8U 4O9VA 3GY3A 1G37A 1P2JA 2ZHFH 3K9XB 4BAHB 1Y5BT 3NUMA 4ESTE 1O3PB 2VNTA 1HIAB 1TGTA 1TLDA 1MBMA 1GMCG 1QY6A 1P06A 1TGNA 1WOFA 3ODDA 2ZHEH 1H9HE 1BA8B 5CHAB 1MTNB 1EP5A 3UREA 2J38A 2GT7A 1O2NA 7ESTE 2GT8A 1DUAA 1JRSA 5FX6A 1KDQB 2ESTE 1S0RA 4FUGA 3ZVBA 1OWKA 2VU8E 3VXFH 5TJXA 1Y3VA 2NU1E 1SI5H 1FN6A 1ESBA 1CGIE 3PYHA 1RFNA 4DIHH 1J8AA 1GI2A 2ZI2H 2QXGA 1IQJA 2VH6A 5EXLA 2THFB 1QA7A 2ZFPH 4FUEA 3A7VA 3Q00A 1VGCC 1LPGB 2AMDA 1C1VH 1C9TA 1C2DA 2F9OA 1BMLA 3PLBA 2OC0A 4NIWA 1KXBA 3TJVA 2O8UA 1ETSH 4NZQA 1SQTA 4GCHF 3TIUA 1AVGH 4ZHMU 1PQ7A 3LGTA 1DLKB 3ELAH 1WUNH 1DXWA 1ZGIA 1OWHA 1BJVA 3SJ8A 3UPEA 1TNKA 3RUOA 3TK9A 3KF2A 2FTLE 3G01A 1C1UH 1ZSJA 1AY6H 3ZVFA 2HVXA 4NZLA 1QB9A 4H6TA 5LPRA 4D76A 2QYIA 5DG6A 1CA0B 1CGJE 1O5BB 1QGFA 1C2GA 5C1YA 4YLUA 2OQUA 1VITH 3DUXH 5GWZA 2ZHWH 4CHAB 4AGJA 5LH8A 1IQKA 5GCHG 3F6UH 2QA9E 1ELAA 1O2GH 4WXVA 3A7XA 4AFQA 1XM1A 2OQ5A 3EGKH 1TQ0B 2BQWB 5L2ZH 2QIQA 1GHAF 4MPXA 1IHTH 1NU7B 2F9UA 1IQEA 1GBLA 1EOLA 2WPMS 1SGIB 3TLOA 2Q6FA 1YPEH 1FPCH 2A31A 8ESTE 2C8XB 3P8FA 3O8RA 5A09A 5A8XA 1LVYA 5EQSA 1ANEA 2PSYA 3STIA 1P09A 3OU0A 1SPJA 4K69A 4GHTA 3RMLH 2O8TA 1NC6A 2AEIH 1N8OC 1J14A 3A81A 1VCQA 3D62A 1ZMJA 2ZDAH 3U1IB 2QN5T 2P3TB 3S69A 1GHBF 4YTAA 1G3CA 3DFLA 4NA7A 4BTIB 1JIMA 1ARCA 2BVSH 3PV4A 1IQMA 1JWTA 6LPRA 4AYVB 3UFAA 3M5LA 3BTHE 1AKSB 5DJ7A 1P05A 4D7GA 1AFQC 3GY8A 2NU2E 1ZTJA 1CBWB 3B9FH 5GPIB 4AOQA 1PJPA 3A83A 2ZG0H 3LKWA 1P2NA 1F92A 3TK6A 2Y81A 2BMGB 1VJAU 3ZZCA 2ZDNA 4ABEA 5EW2H 2BVXH 2ZU4A 3BTFE 1EJAA 1FQ3A 1FMGA 1PQ5A 3QGJA 3TNTA 2BY5X 3EA7A 1C5NH 1C1MA 4O97A 1J16A 1AO5A 1AE5A 3T25A 1PPHE 3SU4A 1EX3A 3ZZ8A 7GCHG 5EW1H 2GMTC 1GVZA 3R3GB 3SNEA 1TONA 1QA0A 2XBYA 4OS5A 1OX1A 1O3AA 1VITF 2FDAA 4FU9A 2RCEA 3VXEH 2Z9KA 4YM9A 1GDUA 2NU0E 1TA2A 2HNTE 3A8AA 4MG3A 1O2RA 3RM2H 2VWMA 3BTTE 4X8SH 1LHEH 4X2YA 1GG6B 2A4QA 5E2OA 3SU2A 1BTHH 2ZDVH 2FP7B 4GAWA 2FYQA 1GJCB 1EOJA 1Z8JB 2JH5D 1J15A 4MPUA 5HM2A 2EC9H 4BTTB 1OYQA 3M37A 2FODA 1KXFA 2C4FH 4NWKA 1NRRH 1IQIA 3RC4A 1SHYA 2ANWA 5TCAA 2G5NA 3CS7A 1QRXA 2BX3A 1H4WA 1ZMLA 1K2I1 3RXLA 2CMYA 5FAHA 2ZZUH 1FN8A 1AQ7A 2JH6D 2OBQA 2A7CA 2ZDKA 2O8MA 1LHDH 4BAQB 4ISLA 3GOVB 3PTBA 3Q3XA 3HK3B 4NIYA 2LPRA 3NK8A 3BEFB 3HPTB 1AWHB 2GCTC 2ZGHA 3ZZ7A 5F6MA 3SNCA 1HAVB 4RSPA 1P3CA 1YLCA 1ZOMA 3A86A 3LH3A 3BTKE 4AZ2B 2OTVA 3ITIA 1TFXA 3E1XB 4Y8XA 1ELVA 1AUTC 4JZIA 3H7OA 5ESBA 1BUIA 4ABIA 1N6XA 1D3DB 4K8BA 2AFQB 2FXRA 3HK6B 1ZYOA 1NRPH 3ATLA 4BXWA 1RTKA 2HOBA 1L1GA 1K1LA 4X6OA 2GZ9A 2WUCA 4JZDH 3H5CB 1VZQH 1O3EA 3LGUA 2OINA 3E0PB 2FPZA 3RC6A 3SORA 2ZPRA 2W3KA 1T8LA 4D9RA 2BHGA 3RXPA 4GUXA 1MTUA 3IITA 2XC5A 3M3TA 1NN6A 3LDXH 1P2OA 1TRYA 1ZZZA 1C2EA 1AD8H 1PPCE 5SGAE 1Z71A 4FUFA 3TVJB 1JOUB 5JB8S 1FPHH 1RJXB 1C1RA 4NFEA 3A8CA 1BRCE 3UQOA 1QR3E 1EQ9A 4DY7B 3CS0A 1C5ZB 1SB1H 2CHAC 2PUXB 1BMMH 3D49H 1WBGB 3GY6A 4I31A 7KMEH 1K9OE 3F9FA 4H6SB 3RXIA 4A7IB 1OS8A 1OP8A 2A7HA 5DO4H 2PWXA 1C5TA 3MHWU 1DY8A 1YPLH 4JYTA 2FS9A 4CH2B 1Z8IB 2B5TB 3SV8A 4A92A 2FZZA 3KQBA 2D1JA 1O3LA 1HJAC 1SQOA 1P02A 2ZEBA 1ANDA 5T6DA 2A45B 3LONA 4UFGH 3F9EA 1AVWA 4ABGA 4UONA 1KLIH 2SGEE 3URCA 1OWIA 3P8OA 1XMNB 3SHAH 2F9VA 1GHVH 2QV1A 1YPKH 5EPNA 4RKJB 3RXQA 2Z9IA 9ESTA 3RM0H 2NU3E 2GZ7A 2ZA5A 2P8OB 1C1PA 1UVSH 1QURH 3A7YA 2UUFB 1DWCH 2J95A 3V13A 2H9TH 2PTNA 4JYVH 1A5IA 5F8TA 3UOUA 1CO7E 1YPHC 2Z94A 1O34A 4A6LA 4TWWA 3RXSA 1QL8A 3SI3H 1D9IA 1NT1A 2PGBB 1MKWH 1A46H 4HGCA 2ZHDA 2QY0B 1VITG 4ISOA 2WUBA 1C1SA 1GBBA 1ZTLA 6ESTA 1G3BA 2KAIB 1HGTH 1A0HB 1C4Y2 2FWWA 1MQ5A 3F1SB 4R0IA 3UR9A 1GJ6A 1MH0A 3E3TA 1V2NT 3A89A 2PKSB 1OSSA 2BD3A 2QXJA 1EAXA 1BQYA 2ZU5A 1LPKB 3BTGE 3N7OA 3U8TH 4FXGH 3E8LA 1C1OA 4RKOB 1GMCF 2PKAB 1T4UH 3LJOA 3SUFA 1EZQA 1THPB 1EAIA 1EZSC 1F0TA 5A2MH 4CRGA 4B71A 2QCYA 1YCPH 2BDIA 4K1SA 3TPIZ 5A0BA 1WCZA 2XBWA 1E34B 1NRSH 4LXBH 4NA8A 1TMTH 1T7CA 5ETXA 4F4OC 4LZ4B 3DT0H 1N6YA 4AN7A 3NCLA 1GDNA 3RMMH 1P11E 2J4IA 2J2UA 5A8YA 3SHCH 1LKAA 4ZXYH 4DVAU 3P95A 1TQ7B 3ZZAA 1FIZA 3S7HB 3TJNA 4BAKB 1KTSB 1HAOH 2W26A 3VB7A 3QO6A 1A5GH 1V2JT 1HAZB 5DP9A 2FOAA 1GI6A 2D2DA 2NU4E 4KELA 2FM2A 2GV6A 4CBOA 2P59A 4OGYA 1AB9B 3ATKA 3RMNH 1DXPA 1Y3WA 3ZVAA 1V2PT 2BQ7B 1J9CH 1P0SH 1SOZA 1IQGA 4ZXXH 3RXJA 1A4WH 1BBRE 4X2VA 2ZPQA 2GVFA 3KCGH 5EXMA 2G4TA 1O3NA 1KLJH 4Y11E 1TNJA 4HTCH 4JMYA 2ZECA 2K7XA 3UNRA 3T5FH 1T32A 1Z6EA 4BTUB 3PTNA 1C2KA 1PPGE 2PFEA 3SJOA 2WPJS 3ATMA 1SFQB 1OWJA 1Y3YA 1SGNE 4ZKRU 3SGQE 2FI4E 2QXIA 3U8OH 5GIBA 4I8HA 4X0WU 3C1KA 1DSTA 4WWYA 3D23A 1XVOA 1C5VA 2ALPA 1UTLM 1V2MT 1BHXF 3MO9A 5G4BA 2Z3CA 1LVMA 2DE9A 1ZHMA 2G00A 2VIVA 4XBDA 2RA0A 4DIIH 1HCGA 1FJSA 1TPAE 3RMOH 3PMBB 3RXHA 1TIOA 1TYNA 1GGDB 4YZUA 3WY8A 2QAAA 4NG9H 3MO3A 4XSKU 1K1OA 2FI5E 2A1DB 1IQHA 4HFPB 1ZPBA 1RD3B 1D6RA 2BD8A 1QQUA 3KL6A 1HAXB 3M7TA 3F9GA 1UVTH 2G4UA 3MO6A 1WYKA 4GVUA 1RTFB 1SLVB 2UWLA 3TGJE 1A61H 2Z3DA 4IW4E 1XUJA 1YGCH 3SUDA 2WV4A 3K65B 2G55A 2G52A 3SN8A 4U2WA 3QTVH 2F91A 1EKBB 1FDPA 2H9EH 3UY9A 4DURA 1KLTA 3UWJH 5L30H 1GBKA 2V3OH 3PO1C 5K7RA 3QUMP 1GJAB 1AWFH 1ZTKA 2FOHA 4B74A 1LHFH 2GZ8A 1O3HA 2VVUA 1SGFA 1ZLRA 4RN6A 2AMQA 2ZFRH 1D3QB 3OSYA 5EG4A 1GBHA 7GCHF 1HFDA 1O3KA 1W8BH 1QCPA 1HDTH 3SI4H 1HAYB 3T28A 3K2UA 2HLCA 4SGAE 3OY6U 1O2KA 3P8NA 2H1UA 2PGQB 2AIQA 2A0QB 5FBEA 3RXOA 1AHTH 1P57B 2XCNA 4J1YA 1EPTA 5AFZH 2UWOA 1EB2A 2FTMA 3AASA 3M36A 2TGDA 2SGQE 2I6SA 2VGCC 4I7YH 2EI7A 3SV2H 3IG6B 1MD8A 2GX4A 1V2KT 1NZQH 3RP2A 5FPYA 2FOEA 2XBXA 1EJMA 3U1JB 1Z8GA 4ABFA 3SNBA 1INCA 1MZAA 1PYTC 2R0LA 1FY1A 2VVVA 2BD5A 2BQ6B 2RG3A 1LCYA 3W95A 4Q80A 1VCWA 1T8MA 1S83A 3M35A 1GBFA 5DK1A 1CGHA 1O2XA 2OP9A 1F0UA 2F9PA 1GCTC 4KKDA 5J4QA 3ATWA 1EXFA 3M5NA 3E90B 4VGCC 3S9CA 1E0FD 1K22H 1YCPM 1S81A 4E7RG 2XNIA 1QJ1B 4UD9H 1QRZA 2K1QA 4ABJA 1FXYA 3BN9A 1BTUA 1HYLA 2CF8H 2ANKH 1TX8A 5C5NA 1ELDE 2OUAA 5EU8A 1BTPA 2A5AA 1FONA 4U01A 2DUCA 2STBE 2FYRA 3ZV9A 1UVPA 4IMQA 4CH8B 5JBBS 2SFAA 4DT7B 1NO9H 3TU7H 4A1VA 1OYTH 1ELTA 3I77A 4IS5A 1TB6H 1AE8H 1HXFH 5BPEA 4AYYB 4TWYA 1ZGVA 1NTPA 1XX9A 3LC5A 3L6PA 5T6GA 1ORFA 4NGAH 1UCYH 3P6ZB 3W94A 2BOHB 2HNTC 1BTXA 1F0RA 5FX5A 2B7DH 4WMEA 3BEIB 1AGJA 1YF4A 3VB6A 4CRBA 8KME2 4ISIH 4WXIA 1DM4B 3MNSA 6CHAC 1C2MA 1FLEE 1L1JA 4ASHA 1KXAA 1THRH 3DD2H 2BLWA 1O5GH 1A0LA 3SUGA 4U30A 3BTQE 1FAXA 1ABJH 1HAGE 3HGPA 2Q6GA 1C5RA 3MU4A 1SLUB 1BTWA 1HIAA 2W7SA 1EPTC 4JZ1A 1O3DA 1GJ5H 1GI7B 5AVDA 3LGWA 3KEEA 3MNXA 1XXDA 3EA9A 1JRTA 1NM6A 2ZGBH 3RDZA 2OC7A 1G2LA 1NY22 2GDEH 1W2KH 1KDQA 1C5OH 1K1NA 1L4ZA 3A7WA 2ODQA 1FIWA 1Y3UA 2R3UA 5JYIA 2ZQ1A 3M3SA 4X1NU 4HI3A 1P9SA 1D6WA 1EASA 1MU8B 1AI8H 1KXCA 4H42U 4O3TA 1MTVA 4TPYA 3UR6A 2Y5GA 1MTWA 1GL1A 7LPRA 2QGRA 1YPGH 1ETTH 3MNCA 2ZU2A 2WPLS 3BG4C 3L33A 4CRDA 1O32A 3QTOH 3V7TA 2BDGA 1CU1A 1JMOH 1SOTA 3A80A 3VGCB 1EAUA 3GCHC 1TA6A 2ZFFH 4BXSA 3GDUA 1GJ7B 1RIWB 3U98H 4IGDA 1F2SE 1OP2A 1PPFE 4NSVA 4UFDH 1YKTA 4QT8C 3EDXB 1BRUP 2BD4A 1O3JA 2BLQA 1Y8TA 1QL9A 1MTSA 3SQHE 1NESE 4MDSA 1QBVH 1SG8B 1SHHB 3D65E 3M7QA 4DJZB 2F9NA 5FHTA 1V2LT 5AFYH 1P2MA 1UCYK 4ZHAA 5I25A 4K5ZA 4MNXA 1XVMA 1XUKA 3B8JA 3E0NB 5TCCA 1P04A 2AYWA 4XBBA 5F8ZA 1CHOF 1V6DA 4FUDA 2A4OA 3Q3KA 4IN1A 1O31A 3S7KB 1K28D 3RXEA 1E37B 2XC0A 1F5KU 2Y7XA 2FS8A 2RA3A 3ZZ4A 3LJJA 4B73A 2QF3A 3I78A 1DWBH 3O8CA 2OC1A 3RXDA 1DUEA 1V2VT 2V0BA 2G51A 3V3MA 1P12E 4BAMB 3FZDA 2ZFTA 1L2EA 1TMBH 2BZ6H 3GDVA 3QK1A 4IMZA 3U8RH 3ZZ5A 1HAHH 3SV9A 2FOGA 2ZTYA 2BDYA 2QF0A 1T8NA 2BDHA 1RRKA 3SQEE 5A0CA 5K0HA 1OPHB 1D4PB 1BOQA 1BT7A 1O3FA 2OC8A 5FBIA 4YESB 5JDUB 1Y59T 1Z8RA 1P2QA 3KN2A 4K1EA 3EBNA 2A2QH 1QQ4A 4TPIZ 1F0SA 4Y0ZE 2J9NA 1G3EA 1LO6A 1UTMA 2CGAA 4YOIA 4OGXA 1ELCA 5CHAC 1O2PA 3NZIA 1GI4A 1MTNC 1IHSH 1QB6A 3LPRA 1AKSA 1F7ZA 5C5OA 2GTBA 1DSUA 3SJIA 3PB1E 5E2PA 1ZPZA 2ZPSA 5LPFA 1ZMNA 4FUCA 3GYLB 4AFSA 2Z9JA 2HPPH 2XW9A 3BF6H 4NIXA 1KYNA 2SNWA 2JETB 5DP6A 2W7UA 3UTUH 2XWAA 2VB0A 4K1TA 3QDZB 3TH2H 3GY4A
chains in the Genus database with same CATH superfamily
1IAUA 4X1SU 1HAPH 1MD7A 1P2KA 3BTME 3RXCA 4CBNA 1YPMH 3PWBA 3DSGA 1C1TA 1TRNA 4OS4A 1W7GH 3OTJE 1O2UA 2PP6A 3ESTA 1AFEH 3HGNA 2HNTF 1WDIA 1O30A 1MZDA 5EPYA 1NPMA 1T8OA 4JK5A 3VB5A 1V2WT 2BY8X 1NROH 5HIZA 2ZU1A 4X1QU 3ODFA 1S6LA 4NA9H 1WTHD 2GD4B 1XUGA 1O35A 4Y7BA 1SGTA 2P93A 3F2HA 4FU7A 5ESTE 4E06H 1THSH 1LQEA 1CA0C 1AU8A 1PYTD 3A87A 4O03A 3P92A 1DPOA 2VINA 1GI0A 5EIYA 2F4LA 2HRVA 1HNEE 3BTDE 5LGOA 1OXGA 1BJUA 4MNYA 4CHAC 3ZZBA 3PMJA 1DS2E 1Q3XA 5CMXH 1O2MA 2WZQA 3LGYA 1NBMD 2V3HH 1BDAA 1O3BA 1L4DA 1KMHB 4MPWA 4AGKA 2XBVA 3RXGA 4SGBE 1HPGA 5DP5A 1HAVA 1T4VH 1EZXC 1UHBB 4X8VH 5EQQA 3CP7A 4MVNA 4XDEA 3MH7A 4PROA 1HLTH 4ZAEA 1UO6A 4X6MA 1UK2A 2F83A 4R8TB 5C20A 1NRNH 1GBMA 1E38B 2ZTXA 4MLFB 1AZ8A 1GJBB 3LT3A 4F49A 2C8YB 3ZZ3A 1DLEA 3CENA 1O5DH 2RDLA 1ELEE 3ZIAD 5E0GA 4I8GA 1GVLA 1GJ9B 3AK5A 1S5SA 5HGGA 3TH4H 2WHXA 2FOCA 1GBEA 2YNAA 5ABWA 1UTPA 3VEQB 1O0DH 1LKBA 4K2YA 4Y7AA 3K6ZA 3UOPA 1CHOG 1P2IA 1TWXB 4CREA 1C5UA 5GXPA 1KXEA 5C1XA 4ZKOU 3ZVDA 1YLDA 1U6QA 2VWNA 2YMSB 2AGIX 3TK5A 3AVZA 1UTJA 3VFEA 3WWFA 2BY7X 2IOTA 2ALVA 1JIRA 3A8BA 3RXAA 2P95A 3URDA 2J34A 1DOJA 2M5TA 4I86A 1CBWC 5DSFA 4OS2A 5HXFA 2ZC9H 2J92A 4JYUH 2H2ZA 2FOFA 4CRAA 3T27A 5C2ZA 1O2TA 2BLVA 4AFUA 1HRTH 4WH8A 2WV5A 1LPZB 5GDSH 1OHHD 1TNLA 4JK6A 4KP0A 4X1RU 2KCPA 1EJNA 3Q3YA 4JZEH 1W0YH 1RTLA 2F9BH 3BIUH 1C2IA 1GL0E 3ZZ9A 1P10A 4YOJA 1VR1H 6GCHF 1ZRKA 4I8JA 1S82A 3BSQA 3GY5A 2AGGX 4Y0YE 1QFKH 2G81E 2P16A 5CDFE 3ZV8A 1N8OB 1C1QA 4B2BA 4THNH 1GBAA 1O37A 2GDDA 1TALA 5A0AE 3BTEE 1C2HA 2ZU3A 2TRMA 1H9LB 1BITA 2ZWLH 1PFXC 4Y8ZA 1MAXA 1UK3A 3UNQA 1YPHE 3TJUA 3UAIC 4KTSA 2Y80A 1GG6C 3C27B 5J4SA 2YNBA 4DG4A 1O3CA 1ZSKA 3GICB 3OAAD 1EP6A 3S0NA 4XOJA 1O5EH 1TGBA 5JBTA 3GCTG 1MKWK 2O8LA 2ZTZA 4XE4A 2BD9A 3VPKA 1GVKB 1O2VA 2EQNA 1C5XB 1TPPA 3EYDA 1FAKH 3O8DA 4E7NA 1Y5AT 1P9UA 4B6EA 3V0XA 5DP7A 4Q7YA 3AAUA 2Z9GA 1AMHA 2PLXA 8GCHG 1LVOA 2PTCE 2PV9B 2R3YA 3A8DA 2GMTB 5DPAA 2XXLA 1BBRH 2Q6DA 1O2QA 1MCVA 1LMWB 3OEED 4FVDA 5I46H 5JBCS 1CT2E 2KAIA 2V35A 3SZNA 4AB9A 4AFZA 2P3FH 1YCPK 1C2LA 1QNJA 3AAVA 2ANYA 1VCPA 2GCHF 1GHZA 3UWIA 1CT0E 1SGFG 1H1BA 1TNGA 5CHBA 4A1XA 3OE7D 2WV9A 3QZQA 4INLA 4D9QA 1O5FH 2PKAA 4YOGA 1CE5A 1TRMA 5FPTA 4Y71A 3BV9B 4YT7H 1B0EA 2I6QA 1C9PA 3M5MA 1O2WA 4D8NA 1O2HA 1UVOA 3M5OA 1P8VC 4X8TH 1DFPA 1A2CH 4I33A 4IBLH 1HUTH 1O2LA 3ZZDA 1ANCA 2GCTB 2XC4A 2KX4A 3HKJB 2WPKS 1CSOE 3M7UA 4Q2KA 4Q7XA 1J17T 2AMPA 1P01A 1QRWA 5FCRA 2V7QD 2ZFSA 1H9IE 2GP9B 2OLGA 1PPZA 4AC9A 1YC0A 1HJ9A 4KGAA 1A5HA 4Z1MD 4M7GA 2BB4A 3KIDU 1DX5M 3BTWE 3SNDA 2B0FA 2LNCA 1GWAA 3T29A 2F3CE 4X8UH 3UNSA 3LH1A 1AVXA 2A5KA 3M3VA 1KXDA 4X6PA 3P17H 2Z3EA 3MFJA 1D3TB 2ZCKP 3QGNB 3STJA 5A8ZA 1O5AB 1IQNA 1TPSA 2FMJA 3A84A 2VWLA 5FPSA 3NWUA 3A88A 1TE0A 3EQ0H 1SGEE 4ABHA 1W13U 5C67A 1S85A 1K1PA 5PTPA 3F2GA 1BHXB 1OWDA 1QHRB 2HWLB 5DP4A 1GHYH 3OY5U 3QWCH 1H8HD 4NCYA 1EB1H 1WQSA 2AH4X 2ZO3H 1QB1A 1YWUA 1O2OA 3OX7U 4FUIA 3U28C 4F48B 1DT2A 4ISNA 1O39A 1C4V2 3RU4T 1SGRE 3SGAE 1GHXH 1BBRK 3FZZA 3BG8A 4X2XA 2OCVB 5LPEA 1O5CB 1DITH 3P8GA 1FY5A 4D7FA 1UMAH 3SW2B 1FY3A 1E35B 1C2FA 1V2QT 4MTBA 4GHQA 2P8OC 4X6NA 2CHAB 1FV9A 6GCHG 3KNXA 1O2SA 2ZDLA 3RXRA 2C8WB 3PLKA 2G8TA 1QBOA 2ZGXH 4DCDA 3UQVA 2BVRH 5EGMA 4KTCA 1S6FA 4E05H 2W3IA 3MU1A 2C93B 1DDJA 2A4RA 1H8IH 2Y6TA 2JH0D 1SVPA 3MNBA 4DW2U 2KCAA 2AS9A 2CXVA 3ATIA 4TYDA 4NSYA 1HJAB 1XUFA 1UTQA 9LPRA 3PM3A 1W12U 2XWBI 3GDSA 1C5LH 2PKSC 4A1TA 1ABIH 4FUJA 1IQFA 1NFXA 2FO9A 2ZCHP 1S0QA 2VIDA 1V2TT 1GMHG 3RXUA 1A1RA 1FNIA 4K3JA 2P3UB 4LOYH 1ID5H 1EFRD 2O8WA 3GCNA 1UCYE 1A3EH 1O3IA 3GISB 3NRLA 3SV6A 3SU5A 1UK4A 1MUEB 3PMAB 3ZVGA 3DFJA 2UUYA 1GBCA 4NFFA 4INHA 3SO3A 1MMJN 1A3BH 1SGDE 4AB8A 3FANA 1CA8B 3GY7A 1GDQA 2EI6A 2FOMB 3FP6E 3GCOA 2A5IA 1V3XA 1H8DH 1PQAA 4GSOA 1S84A 1LTOA 1BIOA 3Q77A 4YO9A 1IQLA 2IPHA 5FCKA 4ZUHA 1QJ7B 2ULLA 2DE8A 1OKXA 2VVCA 3KQEA 1Z1JA 2M2AA 2BYAX 1O36A 2Q1JA 2QXHA 1BCUH 3RLWH 1WTGH 4UE7H 2JJ2D 1OWEA 2GCHG 1QBNA 1ZHPA 5JBAS 1G36A 5EQRA 1W11U 3KQDA 3FN8A 2HALA 1FI8A 3NXPA 1LHGH 2TGPZ 1AUJA 3B23B 3OYPA 1EUFA 1KY9A 2EEKA 1C1NA 3SV7A 2V6NA 2Z7FE 3A85A 2JKHA 3QLPH 4BANB 2BD2A 4AORA 1Z7KA 1UW7A 3MOCA 3TITA 2PW8H 2TIOA 2Z6BD 3EA8A 1NBME 1TBQH 1GJDB 1P3EA 3S9BA 1AB9C 1O2IA 3QZRA 4NWLA 4Y79A 5HMAA 5E8EH 3M61U 1M9UA 4FUBA 3KGPA 4YT6H 1PPBH 3EE0B 3RU4D 3DA9B 3JZ2B 2LP6A 3SJ9A 3RC5A 1TBRH 4J2YB 1PQ8A 2A4GA 1SGPE 4XD7D 5C0TA 2R2WU 2ZHQH 2G5VA 2R9PA 1ZPCA 1RS0A 4BAOB 2VJ1A 5C94A 2KM0A 3F68H 4WVPE 3MH5A 2ZNKH 3RXVA 4Q7ZA 3VB4A 3ZYEA 2BDCA 1SQAA 3FP8E 1W3CA 1K1IA 2AERH 3ZZ6A 4ZMAH 2CF9H 4YLQH 3FP7E 3TGIE 1CT4E 3U9AH 4IN2A 1CHGA 1DANH 1YM0A 4UDWH 3K6YA 1Q31A 3TH3H 2OD3B 3KYGA 1ZR0A 1HJ8A 2B9LA 4I8KA 4TY6A 1TOCB 2FESH 1GGDC 4WMFA 2H9HA 1ACBE 1C4U2 1G30B 2SGAA 1B7XB 1GI5A 1KIGH 4Y6DA 1C5YB 1B0FA 3DHKH 3PRDA 1G32B 1O2ZA 2BZAA 1TNHA 2VIQA 3RXKA 2H5CA 3SU6A 4Y10E 4DOQA 1L1NA 5E0HA 2OXSA 2FLBH 1SGQE 2ZFQH 4K60A 2EA3A 2GV7A 1UTNA 1JXPA 2C90B 2BLOA 1WAYB 4X2WA 2VIPA 2GKVE 1V2RT 3KHVA 4WJG2 5E0JA 4LZ1H 2BDBA 4BNRA 2BY9X 3H7TA 3R0FA 2ZQ2A 1E1QD 4B76A 3RXMA 5HYOA 1C5MD 4FOUC 4OS1A 3BIVH 2R2MB 3GY2A 1QJ6B 1TPOA 2QC2A 1GJ4H 2FOBA 3OFND 1NRQH 3SNAA 1GMDF 4Y76A 4GCHG 1C1WH 1E36B 3LC3A 1O2JA 4MNWA 3L3TA 2ZGJA 1O33A 2VIOA 5AF9H 1MQ6A 1YLNA 2BD7A 1GI3A 1HXEH 1C5SA 1Z1IA 8LPRA 1GI1A 4Z6AH 5B6OA 2TGTA 1O2YA 1L0ZA 1DE7H 1PPEE 1ANBA 1KTTB 1K1MA 3JZ1B 2GGVB 1NFUA 5EOKA 4OS7A 3MH6A 5JB9S 1O3MA 1WV7H 5DKMA 5DGJA 1O38A 1UTOA 3UUZA 2C8ZB 4OS6A 4Y8YA 2B8OH 1FUJA 3GCTF 1GI8B 5EXNA 1SGYE 1KSNA 4XRNA 2PSXA 1G3DA 1CQQA 1F5RA 1V2ST 4ACBA 1TMUH 3PO1B 2IJD1 1VJ9U 3SJKA 1SFIA 4A5TS 2ILNA 3HATH 2BXTH 1MCTA 1G9IE 3ZVEA 3ZYDA 2TBSA 3MU0A 3EAJA 1GJ8B 4FUHA 1GHAG 3LOXA 1BB0B 1Z6JH 3F0PA 4Q63A 3T62A 3TNSA 2SGPE 2AIPA 1ZSLA 3LGVA 1BRAA 2Y5FA 2H6MA 3F9HA 3LU9B 3MMGA 4I32A 1IOEA 4GPGA 1TNIA 3AW0A 4NIVA 1C5QA 3FVFB 4AX9H 4WMDA 1YP9A 1ELFA 4HZHA 5EJLA 2A2XH 2ZKSA 1GHBG 1MU6B 2VGCB 2ASUB 4WY3A 2WINI 3MTYA 1GBDA 3PLPA 1C5PA 5C3NA 4B2CA 3RXFA 2IJOB 3PMHB 1BZXE 1XXFA 4Q4LA 1C2JA 1NS3A 2PUQH 2CJIA 4UFEH 1F5LA 2XYAA 2D8WA 2HGTH 3A82A 2HPQH 2C3SA 5IDKA 1P03A 4Z0KA 1LQDB 1VGCB 3MU5A 2J94A 4JCNA 3MI4A 1LHCH 1AIXH 1EATA 1LDTT 1WSSH 2NWNA 4LK4A 1JBUH 1SGCA 5BRRE 1BTZA 1SLWB 1GCTB 1BMNH 2TGAA 3SOSA 4XFQA 1SR5C 3DSPA 3QN7A 4FVBA 5IYTA 4VGCB 2H5DA 2FI3E 1AZZA 5FXLA 1RXPA 2A32A 1CVWH 1T31A 3LIWA 4WF8A 1DWDH 3SU0A 1MBQA 1W0ZU 4ABDA 3PWCA 1GCDA 1A7SA 5EODA 2UUJB 1RGQA 2UUKB 3I29A 3LGIA 1YBWA 3QX5H 5JPMH 2CV3A 1HB0B 1TABE 2VWOA 3MWIU 3RXTA 3TJOA 4CRFA 1UJ1A 1O3GA 4O3UA 5DP3A 5L2YH 3GYMA 2XRCA 3T2NA 5AHGH 3S9AA 1SMFE 3UIRA 3SBKA 1NFWA 3SUEA 4K8YA 1XUHA 4ZKSU 5F8XA 4B1TA 1W14U 3P70B 3RLYH 3E6PH 3MH4A 4INKA 4HG6A 4FU8A 3RXBA 4CR5A 1DWEH 1DY9A 2PR3A 2D26C 4CRCA 1V2OT 2VH0A 1BRBE 2SGDE 1DVAH 3SU1A 1NFYA 1Y3XA 1UTKA 1GMDG 1TOMH 1XKBC 3V12A 3F0OA 1TX7A 4ISHH 6CHAB 1ESTA 4ASUD 1O3OA 8GCHF 4U32A 2JDID 2ZIQH 2JJ1D 2BM2A 1ZJKA 4ABAA 5T6FA 1W7XH 5L6NH 2ZP0H 2IN2A 1ARBA 1GBIA 4MPVA 2R0KA 1QIXB 4B75A 1K21H 1SL3A 2XOKD 4XBCA 3VGCC 3AW1A 1D3PB 1K1JA 1YPJH 2XTTB 1RIWC 5HKKD 3E91A 1EPTB 1MKXH 5T1VA 1MAYA 3Q76A 1AFQB 1OP0A 2WPIS 1GMHF 2FX4A 3TGKE 4X1PU 1HV7A 4ABBA 2WSSD 2KR7A 1SBWA 3ENSB 2QF4A 2ODYB 1ZJDA 4MQAA 3E16B 1HAIH 2ZF0H 2ZDMA 1UVUH 1GI9B 3H09A 1XKAC 3KQCA 1WQVH 4UFFH 2BTCE 2AGEX 5F03A 3NKKA 2WYGA 4MNVA 4IC6A 1QL7A 3MQKC 2O9QA 4UEHH 1Q2WA 1GPZA 5KGOA 4P02A 2UWPA 3NPSA 5GCHF 1ZRBA 1ETRH 1C5WB 1SLXB 3BG4B 2BX4A 4KTUA 1EZUC 3U69H 1SSXA 3O8BA 3FFGA 1TAWA 1ELBA 1HBTH 4H4FA 2P94A 5T3HA 3ZVCA 2PHBA 4FETA 5DP8A 1DICA 4ZH8A 1BTYA 1UHBA 3GCHB 2EI8A 1W10U 2BXUH 3F2FA 3N99A 1TX6A 1ZHRA 1GBTA 2SGFE 1YYY1 5CE1A 3VB3A 4B2AA 3SU3A 1FZZA 3MU8A 1A0JA 1V2UT 1S6HA 2QF5A 1FY4A 5H4IB 3RU4E 2BY6X 4ACAA 4CR9A 4ZROA 2ZCLP 2ODPA 3PROA 1AN1E 1EAWA 4TY7A 1GHWH 1TGSZ 1TBZH 5HM9A 2SNVA 1WU1A 3HKIB 5GJ4B 3T26A 1XUIA 1OOKB 2WYJA 4WH6A 3BEUA 1LVBA 1N1LA 2ZGCA 2WPHS 2CN0H 2BDAA 2FX6A 1X7AC 4IC5A 4AG1A 4BOHA 1QTFA 4ZHLU 2FIRH 1FY8E 4DGJA 2BOKA 1ELGA 2STAE 2FLRH 2YOLA 2FEQH 3FAOA 1BMAA 1GBJA 3IWMA 2Z9LA 1FX0B 2Y5HA 4JZFH 5C1UA 2VIWA 1Y5UT 3MYWA 4I8LA 4GLYA 1B5GH 1NU9A 2ANMH 1ESAA 2JETC 2OBOA 1MKXK 2Y82A 2XCFA 3A7ZA 3SGBE 4AG2A 2W5EA 2Y7ZA 1G2MA 2A7JA 2LIZA 2TPIZ 4ZKNU 1TGCA 3A7TA 1SC8U 4O9VA 3F3BA 3GY3A 1G37A 1P2JA 2ZHFH 3K9XB 4BAHB 1Y5BT 3NUMA 4ESTE 1O3PB 2VNTA 1HIAB 1TGTA 1TLDA 1MBMA 1GMCG 4TSFD 1QY6A 1P06A 1TGNA 1WOFA 3ODDA 2L74A 2ZHEH 1H9HE 1BA8B 5CHAB 1MTNB 1EP5A 3UREA 2J38A 2LELA 2GT7A 1O2NA 7ESTE 2GT8A 1DUAA 1JRSA 5FX6A 1KDQB 3UB0A 2ESTE 1S0RA 2L6OA 4FUGA 3ZVBA 1OWKA 2VU8E 3VXFH 5TJXA 1Y3VA 2NU1E 1SI5H 1FN6A 1ESBA 1CGIE 3PYHA 1RFNA 4DIHH 1J8AA 1GI2A 2ZI2H 2QXGA 1IQJA 2VH6A 5EXLA 2THFB 1QA7A 2ZFPH 4FUEA 3A7VA 3Q00A 1VGCC 1LPGB 2AMDA 1C1VH 1C9TA 1C2DA 4B6FA 2F9OA 1BMLA 3PLBA 2OC0A 4NIWA 1KXBA 3TJVA 2O8UA 1ETSH 3FKSD 4NZQA 1SQTA 4GCHF 3TIUA 1AVGH 4OM9A 1PQ7A 4ZHMU 3LGTA 2V3MA 1DLKB 3ELAH 1WUNH 1DXWA 1ZGIA 1OWHA 1BJVA 3SJ8A 3UPEA 1TNKA 3RUOA 3TK9A 3KF2A 2FTLE 3G01A 1C1UH 1ZSJA 1AY6H 3ZVFA 2HVXA 4NZLA 1QB9A 4H6TA 5LPRA 4D76A 2QYIA 5DG6A 5C0UA 1CA0B 1CGJE 1O5BB 1QGFA 1C2GA 5C1YA 4YLUA 2OQUA 1VITH 3DUXH 1WXRA 5GWZA 2ZHWH 4CHAB 2YMSC 4AGJA 5LH8A 1IQKA 5GCHG 3F6UH 2QA9E 1ELAA 2HVYB 1O2GH 4DT4A 4WXVA 2W6ID 3A7XA 4AFQA 2KCYA 1XM1A 2OQ5A 3EGKH 1TQ0B 2BQWB 5L2ZH 2QIQA 1GHAF 4MPXA 1IHTH 1NU7B 2F9UA 1IQEA 1GBLA 1EOLA 2WPMS 1SGIB 1SKYE 3TLOA 2Q6FA 1YPEH 1YY3A 1FPCH 2A31A 8ESTE 2C8XB 3P8FA 3O8RA 5A09A 5A8XA 1LVYA 5EQSA 1ANEA 2PSYA 3STIA 1P09A 3OU0A 1SPJA 4K69A 4GHTA 3RMLH 2O8TA 1NC6A 2AEIH 1N8OC 1J14A 3A81A 1VCQA 2K8IA 3D62A 1ZMJA 2ZDAH 3U1IB 2QN5T 2P3TB 3S69A 1GHBF 4YTAA 1G3CA 3DFLA 4NA7A 4BTIB 1JIMA 1ARCA 2BVSH 3PV4A 1IQMA 5KECA 1JWTA 6LPRA 4AYVB 3UFAA 3M5LA 3BTHE 1AKSB 5DJ7A 1P05A 4D7GA 1AFQC 3GY8A 2NU2E 1ZTJA 1CBWB 3PRBA 3B9FH 5GPIB 2RFKC 4AOQA 1PJPA 3A83A 2ZG0H 3LKWA 1P2NA 1SQRA 1F92A 3TK6A 2Y81A 2BMGB 1VJAU 3ZZCA 2ZDNA 4ABEA 5EW2H 2BVXH 2ZU4A 3BTFE 1EJAA 1FQ3A 1FMGA 1PQ5A 1E1RD 3QGJA 3TNTA 2BY5X 2J98B 3EA7A 1C5NH 1C1MA 4O97A 1J16A 1AO5A 1AE5A 3T25A 1PPHE 3SU4A 1EX3A 3ZZ8A 7GCHG 5EW1H 2GMTC 1GVZA 3R3GB 3SNEA 3DCLA 1TONA 3OTPA 1QA0A 2XBYA 4OS5A 1OX1A 1O3AA 1VITF 2FDAA 4FU9A 2RCEA 3VXEH 2Z9KA 4YM9A 1GDUA 2NU0E 1TA2A 2HNTE 3A8AA 4MG3A 1O2RA 3RM2H 2VWMA 3BTTE 4X8SH 1LHEH 4X2YA 1GG6B 2A4QA 5E2OA 3SU2A 1BTHH 2ZDVH 2FP7B 4GAWA 4F55A 2FYQA 1GJCB 1EOJA 1Z8JB 2JH5D 1J15A 2KZ4A 4MPUA 5HM2A 2EC9H 4BTTB 1OYQA 3M37A 2FODA 1KXFA 2C4FH 4NWKA 1NRRH 1IQIA 3RC4A 1SHYA 2ANWA 5TCAA 2G5NA 3CS7A 1QRXA 2BX3A 1H4WA 1ZMLA 1K2I1 3RXLA 2CMYA 5FAHA 1VKYA 1FN8A 2ZZUH 1AQ7A 2JH6D 2OBQA 2A7CA 2ZDKA 2O8MA 1LHDH 4BAQB 4ISLA 3GOVB 3PTBA 3Q3XA 3HK3B 2JIZD 4NIYA 2LPRA 3NK8A 3BEFB 3HPTB 1AWHB 2GCTC 2ZGHA 3ZZ7A 5F6MA 3SNCA 1HAVB 4RSPA 1P3CA 1YLCA 1ZOMA 3A86A 3LH3A 3BTKE 4AZ2B 2OTVA 5HIYA 3ITIA 1TFXA 3E1XB 4Y8XA 1ELVA 1AUTC 4JZIA 3H7OA 5ESBA 1BUIA 4ABIA 1N6XA 1D3DB 4K8BA 2AFQB 2FXRA 3HK6B 1ZYOA 1NRPH 3ATLA 4BXWA 1RTKA 2HOBA 1L1GA 1K1LA 4X6OA 2GZ9A 2WUCA 4JZDH 3H5CB 1VZQH 1O3EA 3LGUA 2OINA 3E0PB 2FPZA 3RC6A 3SORA 2ZPRA 2W3KA 1T8LA 3SZEA 2BHGA 3RXPA 4D9RA 4GUXA 1MTUA 3IITA 2XC5A 3M3TA 1NN6A 3LDXH 1P2OA 1TRYA 1ZZZA 1MABB 1C2EA 1AD8H 1PPCE 5SGAE 1Z71A 4FUFA 3TVJB 1JOUB 5JB8S 1FPHH 1RJXB 1C1RA 4NFEA 3A8CA 1BRCE 3UQOA 1QR3E 1EQ9A 4DY7B 3CS0A 1C5ZB 1SB1H 2CHAC 2PUXB 1BMMH 3D49H 1WBGB 3GY6A 4I31A 7KMEH 1H8ED 1K9OE 3F9FA 4H6SB 3RXIA 4A7IB 1OS8A 1OP8A 2A7HA 5DO4H 2PWXA 1C5TA 1E79D 3MHWU 1DY8A 1YPLH 4JYTA 2FS9A 4CH2B 1Z8IB 2B5TB 3SV8A 4A92A 2FZZA 2F43B 3KQBA 2D1JA 1O3LA 3KQ5A 1HJAC 1SQOA 1P02A 2ZEBA 1ANDA 5T6DA 2A45B 3LONA 4UFGH 3F9EA 1AVWA 4ABGA 4UONA 1KLIH 2VBCA 2SGEE 3URCA 1OWIA 3P8OA 1XMNB 3SHAH 2F9VA 1GHVH 2QV1A 1YPKH 5EPNA 4RKJB 3RXQA 2Z9IA 9ESTA 3RM0H 2NU3E 2GZ7A 2ZA5A 2P8OB 1C1PA 1UVSH 1QURH 3A7YA 2UUFB 1DWCH 2J95A 3V13A 2H9TH 2PTNA 4JYVH 1A5IA 5F8TA 3UOUA 1CO7E 1YPHC 2Z94A 1O34A 4A6LA 4TWWA 3RXSA 1QL8A 3SI3H 1D9IA 1NT1A 2PGBB 1MKWH 1A46H 2KCOA 2ZHDA 4HGCA 2QY0B 1VITG 4ISOA 2WUBA 1C1SA 1GBBA 1ZTLA 6ESTA 1G3BA 2KAIB 1HGTH 1A0HB 1C4Y2 2FWWA 1MQ5A 3F1SB 4R0IA 3UR9A 1GJ6A 1MH0A 3E3TA 1V2NT 3A89A 2PKSB 1OSSA 2BD3A 2QXJA 1EAXA 1BQYA 2ZU5A 1LPKB 3BTGE 3N7OA 3U8TH 3DSOA 4FXGH 3E8LA 1C1OA 4RKOB 1GMCF 2PKAB 1T4UH 3LJOA 3SUFA 3WWBA 3GS9A 1EZQA 1THPB 1EAIA 1EZSC 1F0TA 2YMSD 5A2MH 4CRGA 4B71A 2QCYA 5EJ1A 1YCPH 2BDIA 4K1SA 3TPIZ 5A0BA 1WCZA 2XBWA 1E34B 4P00A 1NRSH 3CNRA 4LXBH 4NA8A 1TMTH 1T7CA 5ETXA 4F4OC 4LZ4B 3DT0H 1N6YA 4AN7A 4RT1A 3NCLA 1GDNA 3RMMH 1P11E 2J4IA 2J2UA 5A8YA 3SHCH 1LKAA 4ZXYH 4DVAU 3P95A 1TQ7B 3ZZAA 3WW7A 1FIZA 3S7HB 3TJNA 3VG8A 4BAKB 1KTSB 1HAOH 2W26A 3VB7A 3QO6A 1A5GH 1V2JT 1HAZB 5DP9A 2FOAA 1GI6A 2KFWA 2D2DA 2NU4E 4KELA 2FM2A 2GV6A 4CBOA 2P59A 4OGYA 1AB9B 3ATKA 3RMNH 1DXPA 2OK5A 1Y3WA 3ZVAA 1V2PT 2BQ7B 1J9CH 1P0SH 1SOZA 1IQGA 1QZ8A 4ZXXH 3RXJA 1A4WH 1BMFD 1BBRE 4X2VA 3N7DA 2ZPQA 2GVFA 3KCGH 5EXMA 2G4TA 1O3NA 1KLJH 4Y11E 1TNJA 4HTCH 4JMYA 2ZECA 2K7XA 3UNRA 3T5FH 1T32A 1Z6EA 4BTUB 3PTNA 1C2KA 1PPGE 2PFEA 3SJOA 2WPJS 3ATMA 1SFQB 1OWJA 1Y3YA 5B6LA 1SGNE 4ZKRU 3SGQE 2FI4E 2QXIA 3U8OH 5GIBA 4I8HA 4X0WU 3C1KA 1DSTA 4WWYA 3D23A 1XVOA 1C5VA 5IK2D 2ALPA 1UTLM 1V2MT 1BHXF 1W0KD 3OEHD 3MO9A 5G4BA 2Z3CA 1LVMA 2DE9A 1ZHMA 2G00A 2VIVA 4XBDA 2RA0A 4DIIH 1HCGA 1FJSA 1TPAE 3RMOH 3PMBB 5EJZA 3RXHA 1TIOA 1TYNA 1GGDB 4YZUA 3WY8A 1W0JD 2QAAA 4NG9H 3MO3A 4XSKU 5KEDA 1K1OA 2FI5E 2A1DB 1IQHA 4HFPB 1ZPBA 1RD3B 1D6RA 2BD8A 1QQUA 3KL6A 1HAXB 3M7TA 3F9GA 1UVTH 2G4UA 3MO6A 1WYKA 4GVUA 1RTFB 1SLVB 2UWLA 3TGJE 2J5UA 1A61H 2Z3DA 4IW4E 1XUJA 1YGCH 2IPQX 3SUDA 2WV4A 3K65B 2G55A 2G52A 3SN8A 4U2WA 3QTVH 2F91A 1EKBB 2WPDD 1FDPA 2H9EH 3UY9A 4DURA 1KLTA 3UWJH 5L30H 1GBKA 5F53A 2V3OH 3PO1C 5K7RA 3QUMP 1GJAB 1AWFH 2EY4C 1ZTKA 3FOAA 2FOHA 4B74A 1LHFH 2GZ8A 1O3HA 2VVUA 1SGFA 1ZLRA 4RN6A 2AMQA 2ZFRH 3EE7A 5C17A 1D3QB 3OSYA 5EG4A 1GBHA 7GCHF 1HFDA 1O3KA 1W8BH 1QCPA 1HDTH 3SI4H 1HAYB 3T28A 3K2UA 2HLCA 4SGAE 3KYFA 3OY6U 1O2KA 3P8NA 2H1UA 2PGQB 2AIQA 2A0QB 5FBEA 3RXOA 1AHTH 1P57B 2XCNA 4J1YA 1EPTA 5AFZH 2UWOA 1EB2A 2FTMA 3AASA 3M36A 2TGDA 2SGQE 5DN6D 2I6SA 2VGCC 4I7YH 1COWD 2EI7A 3SV2H 3IG6B 2K0QA 1MD8A 2GX4A 1V2KT 1NZQH 3RP2A 5GNDA 5FPYA 2FOEA 2XBXA 1EJMA 3U1JB 1Z8GA 4ABFA 3SNBA 3N7EA 1INCA 1MZAA 1PYTC 2R0LA 1FY1A 2VVVA 2BD5A 2BQ6B 3W1EA 2RG3A 1LCYA 3PV5A 3W95A 4Q80A 1VCWA 1T8MA 1S83A 3M35A 1GBFA 5DK1A 1CGHA 1O2XA 2OP9A 1F0UA 2F9PA 1GCTC 4KKDA 5J4QA 3ATWA 1EXFA 3M5NA 3E90B 4VGCC 3S9CA 1E0FD 1K22H 1YCPM 2AHME 1S81A 4E7RG 2XNIA 1QJ1B 4UD9H 1QRZA 2K1QA 4ABJA 1FXYA 3BN9A 1BTUA 1HYLA 2CF8H 2ANKH 1TX8A 5C5NA 1ELDE 2OUAA 5EU8A 1BTPA 2A5AA 1FONA 4U01A 5FL7D 2DUCA 2STBE 2FYRA 3ZV9A 1UVPA 4IMQA 4CH8B 2XNDD 5JBBS 2SFAA 4DT7B 1NO9H 3TU7H 4A1VA 1OYTH 1ELTA 3I77A 4IS5A 1TB6H 1AE8H 1HXFH 5BPEA 4AYYB 4TWYA 1ZGVA 1NTPA 1XX9A 3LC5A 3L6PA 3PV2A 5T6GA 1ORFA 4NGAH 1UCYH 3P6ZB 3W94A 2BOHB 2HNTC 1BTXA 1F0RA 5FX5A 2B7DH 4WMEA 3BEIB 1AGJA 1YF4A 3VB6A 4CRBA 8KME2 4ISIH 4WXIA 1DM4B 4ZCNA 3MNSA 6CHAC 1C2MA 1FLEE 1L1JA 4ASHA 1KXAA 1THRH 3DD2H 2BLWA 1O5GH 1A0LA 1K0HA 3SUGA 3SYJA 4U30A 3BTQE 1FAXA 1ABJH 1HAGE 3HGPA 2Q6GA 1C5RA 3MU4A 1SLUB 1BTWA 1HIAA 2W7SA 1EPTC 4JZ1A 1O3DA 1GJ5H 1GI7B 5AVDA 3LGWA 3KEEA 3MNXA 1XXDA 3EA9A 1JRTA 1NM6A 2ZGBH 3RDZA 2OC7A 1G2LA 1NY22 2GDEH 1W2KH 1KDQA 1C5OH 1K1NA 1L4ZA 3A7WA 2ODQA 1FIWA 1Y3UA 2R3UA 2RDEA 5JYIA 2ZQ1A 3M3SA 4X1NU 4HI3A 1P9SA 1D6WA 1EASA 1MU8B 1AI8H 4RI0A 1KXCA 4H42U 4O3TA 1MTVA 4TPYA 3UR6A 2Y5GA 1MTWA 1GL1A 3FO8D 7LPRA 2QGRA 1YPGH 1ETTH 3MNCA 2ZU2A 2WPLS 3BG4C 3L33A 4CRDA 1O32A 3QTOH 3V7TA 2BDGA 1CU1A 2GJGA 1JMOH 1SOTA 3A80A 3VGCB 1EAUA 3GCHC 1TA6A 2ZFFH 2W6JD 4BXSA 3GDUA 1GJ7B 1RIWB 3U98H 4IGDA 1F2SE 1OP2A 1PPFE 4NSVA 4UFDH 1YKTA 4QT8C 3EDXB 1BRUP 2BD4A 1O3JA 2BLQA 2J97A 1Y8TA 1QL9A 1MTSA 3SQHE 1NESE 4MDSA 1QBVH 1SG8B 1SHHB 3D65E 3M7QA 4DJZB 2F9NA 4YXWD 5FHTA 1V2LT 5AFYH 1P2MA 1UCYK 4ZHAA 5I25A 4K5ZA 4MNXA 1XVMA 1XUKA 3B8JA 3E0NB 5TCCA 1P04A 2AYWA 4XBBA 5F8ZA 1CHOF 1V6DA 4FUDA 2A4OA 2CK3D 3Q3KA 4IN1A 1O31A 3S7KB 1K28D 3RXEA 1E37B 2XC0A 1F5KU 2Y7XA 2FS8A 2RA3A 3ZZ4A 3LJJA 4B73A 2QF3A 3I78A 1DWBH 3O8CA 2OC1A 3RXDA 1DUEA 1V2VT 2V0BA 2G51A 3V3MA 1P12E 4BAMB 3FZDA 2ZFTA 1L2EA 1TMBH 2BZ6H 3GDVA 3QK1A 4IMZA 3U8RH 3ZZ5A 1HAHH 3SV9A 2FOGA 2ZTYA 2BDYA 2QF0A 1T8NA 2BDHA 1RRKA 3SQEE 5A0CA 5K0HA 1OPHB 1D4PB 1BOQA 1BT7A 1O3FA 2OC8A 4M9FA 5FBIA 4YESB 5JDUB 1Y59T 1Z8RA 1P2QA 3KN2A 4K1EA 3EBNA 2A2QH 4RT0A 1QQ4A 4TPIZ 1F0SA 4Y0ZE 2J9NA 1G3EA 1LO6A 1UTMA 2CGAA 4YOIA 4OGXA 1ELCA 5CHAC 1O2PA 3NZIA 1GI4A 1MTNC 1IHSH 1QB6A 3LPRA 1AKSA 1F7ZA 5C5OA 2GTBA 1DSUA 2HLDD 3SJIA 3PB1E 5E2PA 1ZPZA 2ZPSA 2QE7D 5LPFA 1ZMNA 4FUCA 4TT3D 3GYLB 4AFSA 2Z9JA 2HPPH 2XW9A 3BF6H 4NIXA 1KYNA 2SNWA 2JETB 5DP6A 2W7UA 2J98A 3UTUH 2XWAA 2VB0A 4K1TA 3QDZB 3TH2H 3GY4A
chains in the Genus database with same CATH topology
1IAUA 4X1SU 1HAPH 1MD7A 1P2KA 3BTME 3RXCA 4CBNA 1YPMH 3PWBA 1C1TA 1TRNA 4OS4A 1W7GH 3OTJE 1O2UA 3ESTA 3HGNA 1AFEH 2HNTF 1O30A 1MZDA 5EPYA 1NPMA 1T8OA 4JK5A 3VB5A 1V2WT 2BY8X 1NROH 2ZU1A 4X1QU 3ODFA 4NA9H 1WTHD 2GD4B 1XUGA 1O35A 4Y7BA 1SGTA 2P93A 4FU7A 5ESTE 4E06H 1THSH 1LQEA 1CA0C 1AU8A 1PYTD 3A87A 4O03A 3P92A 1DPOA 2VINA 1GI0A 2HRVA 1HNEE 3BTDE 5LGOA 1OXGA 1BJUA 4MNYA 4CHAC 3ZZBA 3PMJA 1DS2E 1Q3XA 5CMXH 1O2MA 3LGYA 2V3HH 1BDAA 1O3BA 1L4DA 4MPWA 4AGKA 2XBVA 3RXGA 4SGBE 1HPGA 5DP5A 1HAVA 1T4VH 1EZXC 1UHBB 4X8VH 5EQQA 3CP7A 4MVNA 4XDEA 3MH7A 4PROA 1HLTH 4ZAEA 1UO6A 4X6MA 1UK2A 2F83A 4R8TB 5C20A 1NRNH 1GBMA 1E38B 2ZTXA 4MLFB 1AZ8A 1GJBB 3LT3A 4F49A 2C8YB 3ZZ3A 1DLEA 3CENA 1O5DH 2RDLA 1ELEE 5E0GA 4I8GA 1GVLA 1GJ9B 1S5SA 5HGGA 3TH4H 2FOCA 1GBEA 2YNAA 5ABWA 1UTPA 3VEQB 1O0DH 1LKBA 4K2YA 4Y7AA 3K6ZA 3UOPA 1CHOG 1P2IA 1TWXB 4CREA 1C5UA 5GXPA 1KXEA 5C1XA 4ZKOU 3ZVDA 1YLDA 1U6QA 2VWNA 2AGIX 3TK5A 3AVZA 1UTJA 3VFEA 2BY7X 2IOTA 2ALVA 1JIRA 3A8BA 3RXAA 2P95A 3URDA 2J34A 1DOJA 2M5TA 1CBWC 4OS2A 5HXFA 2ZC9H 2J92A 4JYUH 2H2ZA 2FOFA 4CRAA 3T27A 5C2ZA 1O2TA 2BLVA 4AFUA 1HRTH 4WH8A 2WV5A 1LPZB 5GDSH 1TNLA 4JK6A 4KP0A 4X1RU 1EJNA 3Q3YA 4JZEH 1W0YH 1RTLA 2F9BH 3BIUH 1C2IA 1GL0E 3ZZ9A 1P10A 4YOJA 1VR1H 6GCHF 1ZRKA 4I8JA 1S82A 3BSQA 3GY5A 2AGGX 4Y0YE 1QFKH 2G81E 2P16A 3ZV8A 1N8OB 1C1QA 4B2BA 4THNH 1GBAA 1O37A 2GDDA 1TALA 5A0AE 3BTEE 1C2HA 2ZU3A 2TRMA 1H9LB 1BITA 2ZWLH 1PFXC 4Y8ZA 1MAXA 1UK3A 3UNQA 1YPHE 3TJUA 4KTSA 2Y80A 1GG6C 3C27B 5J4SA 2YNBA 4DG4A 1O3CA 1ZSKA 3GICB 1EP6A 3S0NA 4XOJA 1O5EH 1TGBA 5JBTA 3GCTG 1MKWK 2O8LA 2ZTZA 4XE4A 2BD9A 3VPKA 1GVKB 1O2VA 1C5XB 1TPPA 3EYDA 1FAKH 3O8DA 4E7NA 1Y5AT 1P9UA 3V0XA 5DP7A 4Q7YA 3AAUA 2Z9GA 1AMHA 2PLXA 8GCHG 1LVOA 2PTCE 2PV9B 2R3YA 3A8DA 2GMTB 5DPAA 2XXLA 1BBRH 2Q6DA 1O2QA 1MCVA 1LMWB 4FVDA 5I46H 5JBCS 1CT2E 2KAIA 2V35A 3SZNA 4AB9A 4AFZA 2P3FH 1YCPK 1C2LA 1QNJA 3AAVA 2ANYA 1VCPA 2GCHF 1GHZA 3UWIA 1CT0E 1SGFG 1H1BA 1TNGA 4A1XA 3QZQA 4INLA 4D9QA 1O5FH 2PKAA 4YOGA 1CE5A 1TRMA 5FPTA 4Y71A 3BV9B 4YT7H 1B0EA 2I6QA 1C9PA 3M5MA 1O2WA 4D8NA 1O2HA 1UVOA 3M5OA 1P8VC 4X8TH 1DFPA 1A2CH 4I33A 4IBLH 1HUTH 1O2LA 3ZZDA 1ANCA 2GCTB 2XC4A 3HKJB 2WPKS 1CSOE 3M7UA 4Q2KA 4Q7XA 1J17T 2AMPA 1P01A 1QRWA 5FCRA 2ZFSA 1H9IE 2GP9B 2OLGA 1PPZA 1YC0A 1HJ9A 4KGAA 1A5HA 4M7GA 2BB4A 3KIDU 1DX5M 3BTWE 3SNDA 2B0FA 2LNCA 1GWAA 3T29A 2F3CE 4X8UH 3UNSA 3LH1A 1AVXA 2A5KA 3M3VA 1KXDA 4X6PA 3P17H 2Z3EA 3MFJA 1D3TB 2ZCKP 3QGNB 3STJA 5A8ZA 1O5AB 1IQNA 1TPSA 2FMJA 3A84A 2VWLA 5FPSA 3NWUA 3A88A 1TE0A 3EQ0H 1SGEE 4ABHA 1W13U 5C67A 1S85A 1K1PA 5PTPA 1BHXB 1OWDA 1QHRB 2HWLB 5DP4A 1GHYH 3OY5U 3QWCH 4NCYA 1EB1H 1WQSA 2AH4X 2ZO3H 1QB1A 3OX7U 1O2OA 4FUIA 1DT2A 4ISNA 1O39A 1C4V2 3RU4T 1SGRE 3SGAE 1GHXH 1BBRK 3FZZA 3BG8A 4X2XA 2OCVB 5LPEA 1O5CB 1DITH 3P8GA 1FY5A 4D7FA 1UMAH 3SW2B 1FY3A 1E35B 1C2FA 1V2QT 4MTBA 4GHQA 2P8OC 4X6NA 2CHAB 1FV9A 6GCHG 3KNXA 1O2SA 2ZDLA 3RXRA 2C8WB 3PLKA 2G8TA 1QBOA 2ZGXH 4DCDA 3UQVA 2BVRH 5EGMA 4KTCA 1S6FA 4E05H 2W3IA 3MU1A 2C93B 1DDJA 2A4RA 1H8IH 2Y6TA 2JH0D 1SVPA 3MNBA 4DW2U 2AS9A 2CXVA 3ATIA 4TYDA 4NSYA 1HJAB 1XUFA 1UTQA 9LPRA 3PM3A 1W12U 2XWBI 3GDSA 1C5LH 2PKSC 4A1TA 1ABIH 4FUJA 1IQFA 1NFXA 2FO9A 2ZCHP 1S0QA 2VIDA 1V2TT 1GMHG 3RXUA 1A1RA 1FNIA 4K3JA 2P3UB 4LOYH 1ID5H 2O8WA 3GCNA 1UCYE 1A3EH 1O3IA 3GISB 3SV6A 3SU5A 1UK4A 1MUEB 3PMAB 3ZVGA 3DFJA 2UUYA 1GBCA 4NFFA 4INHA 3SO3A 1MMJN 1A3BH 1SGDE 4AB8A 3FANA 1CA8B 3GY7A 1GDQA 2EI6A 2FOMB 3FP6E 3GCOA 2A5IA 1V3XA 1H8DH 1PQAA 4GSOA 1S84A 1LTOA 1BIOA 3Q77A 4YO9A 1IQLA 2IPHA 5FCKA 4ZUHA 1QJ7B 2ULLA 2DE8A 1OKXA 2VVCA 3KQEA 1Z1JA 2BYAX 1O36A 2Q1JA 2QXHA 1BCUH 3RLWH 1WTGH 4UE7H 1OWEA 2GCHG 1QBNA 1ZHPA 5JBAS 1G36A 5EQRA 1W11U 3KQDA 2HALA 1FI8A 3NXPA 1LHGH 2TGPZ 1AUJA 3B23B 3OYPA 1EUFA 1KY9A 2EEKA 1C1NA 3SV7A 2V6NA 2Z7FE 3A85A 2JKHA 3QLPH 4BANB 2BD2A 4AORA 1Z7KA 3MOCA 3TITA 2PW8H 2TIOA 2Z6BD 3EA8A 1TBQH 1GJDB 1P3EA 3S9BA 1AB9C 1O2IA 3QZRA 4NWLA 4Y79A 5HMAA 5E8EH 3M61U 1M9UA 4FUBA 3KGPA 4YT6H 1PPBH 3EE0B 3RU4D 3DA9B 3JZ2B 3SJ9A 3RC5A 1TBRH 4J2YB 1PQ8A 2A4GA 1SGPE 2R2WU 2ZHQH 2G5VA 2R9PA 1ZPCA 1RS0A 4BAOB 2VJ1A 3F68H 4WVPE 3MH5A 2ZNKH 3RXVA 4Q7ZA 3VB4A 3ZYEA 2BDCA 1SQAA 3FP8E 1W3CA 1K1IA 2AERH 3ZZ6A 4ZMAH 2CF9H 4YLQH 3FP7E 3TGIE 1CT4E 3U9AH 4IN2A 1CHGA 1DANH 1YM0A 4UDWH 3K6YA 1Q31A 3TH3H 2OD3B 1ZR0A 1HJ8A 2B9LA 4I8KA 4TY6A 1TOCB 2FESH 1GGDC 4WMFA 2H9HA 1ACBE 1C4U2 1G30B 2SGAA 1B7XB 1GI5A 1KIGH 4Y6DA 1C5YB 1B0FA 3DHKH 1G32B 1O2ZA 2BZAA 1TNHA 2VIQA 3RXKA 2H5CA 3SU6A 4Y10E 4DOQA 1L1NA 5E0HA 2OXSA 2FLBH 1SGQE 2ZFQH 4K60A 2EA3A 2GV7A 1UTNA 1JXPA 2C90B 2BLOA 1WAYB 4X2WA 2VIPA 2GKVE 1V2RT 3KHVA 4WJG2 5E0JA 4LZ1H 2BDBA 4BNRA 2BY9X 3H7TA 3R0FA 2ZQ2A 4B76A 3RXMA 5HYOA 1C5MD 4OS1A 3BIVH 2R2MB 3GY2A 1QJ6B 1TPOA 2QC2A 1GJ4H 2FOBA 1NRQH 3SNAA 1GMDF 4Y76A 4GCHG 1C1WH 1E36B 3LC3A 1O2JA 4MNWA 3L3TA 2ZGJA 1O33A 2VIOA 5AF9H 1MQ6A 2BD7A 1GI3A 1HXEH 1C5SA 1Z1IA 8LPRA 1GI1A 4Z6AH 5B6OA 2TGTA 1O2YA 1L0ZA 1DE7H 1PPEE 1ANBA 1KTTB 1K1MA 3JZ1B 2GGVB 1NFUA 5EOKA 4OS7A 3MH6A 5JB9S 1O3MA 1WV7H 5DKMA 5DGJA 1O38A 1UTOA 3UUZA 2C8ZB 4OS6A 4Y8YA 2B8OH 1FUJA 3GCTF 1GI8B 5EXNA 1SGYE 1KSNA 2PSXA 1G3DA 1CQQA 1F5RA 1V2ST 1TMUH 3PO1B 1VJ9U 3SJKA 1SFIA 4A5TS 2ILNA 3HATH 2BXTH 1MCTA 1G9IE 3ZVEA 3ZYDA 2TBSA 3MU0A 3EAJA 1GJ8B 4FUHA 1GHAG 3LOXA 1BB0B 1Z6JH 3T62A 3TNSA 2SGPE 2AIPA 1ZSLA 3LGVA 1BRAA 2Y5FA 2H6MA 3F9HA 3LU9B 3MMGA 4I32A 1IOEA 4GPGA 1TNIA 3AW0A 4NIVA 1C5QA 3FVFB 4AX9H 4WMDA 1YP9A 1ELFA 4HZHA 2A2XH 2ZKSA 1GHBG 1MU6B 2VGCB 2ASUB 4WY3A 2WINI 3MTYA 1GBDA 3PLPA 1C5PA 5C3NA 4B2CA 3RXFA 2IJOB 3PMHB 1BZXE 1XXFA 1C2JA 1NS3A 2PUQH 2CJIA 4UFEH 1F5LA 2XYAA 2D8WA 2HGTH 3A82A 2HPQH 2C3SA 5IDKA 1P03A 4Z0KA 1LQDB 1VGCB 3MU5A 2J94A 4JCNA 3MI4A 1LHCH 1AIXH 1EATA 1LDTT 1WSSH 2NWNA 4LK4A 1JBUH 1SGCA 5BRRE 1BTZA 1SLWB 1GCTB 1BMNH 2TGAA 3SOSA 4XFQA 1SR5C 3QN7A 4FVBA 5IYTA 4VGCB 2H5DA 2FI3E 1AZZA 5FXLA 1RXPA 2A32A 1CVWH 1T31A 3LIWA 4WF8A 1DWDH 3SU0A 1MBQA 1W0ZU 4ABDA 3PWCA 1GCDA 1A7SA 5EODA 2UUJB 1RGQA 2UUKB 3I29A 3LGIA 1YBWA 3QX5H 5JPMH 2CV3A 1HB0B 1TABE 2VWOA 3MWIU 3RXTA 3TJOA 4CRFA 1UJ1A 1O3GA 4O3UA 5DP3A 5L2YH 3GYMA 2XRCA 3T2NA 5AHGH 3S9AA 1SMFE 3UIRA 3SBKA 1NFWA 3SUEA 4K8YA 1XUHA 4ZKSU 5F8XA 4B1TA 1W14U 3P70B 3RLYH 3E6PH 3MH4A 4INKA 3RXBA 4FU8A 4CR5A 1DWEH 1DY9A 2PR3A 2D26C 4CRCA 1V2OT 2VH0A 1BRBE 2SGDE 1DVAH 3SU1A 1NFYA 1Y3XA 1UTKA 1GMDG 1TOMH 1XKBC 3V12A 1TX7A 4ISHH 6CHAB 1ESTA 1O3OA 8GCHF 4U32A 2ZIQH 2BM2A 1ZJKA 4ABAA 5T6FA 1W7XH 5L6NH 2ZP0H 2IN2A 1ARBA 1GBIA 4MPVA 2R0KA 1QIXB 4B75A 1K21H 1SL3A 4XBCA 3VGCC 3AW1A 1D3PB 1K1JA 1YPJH 2XTTB 1RIWC 3E91A 1EPTB 1MKXH 1MAYA 3Q76A 1AFQB 1OP0A 2WPIS 1GMHF 2FX4A 3TGKE 4X1PU 1HV7A 4ABBA 1SBWA 3ENSB 2ODYB 1ZJDA 4MQAA 3E16B 1HAIH 2ZF0H 2ZDMA 1UVUH 1GI9B 1XKAC 3KQCA 1WQVH 4UFFH 2BTCE 2AGEX 5F03A 3NKKA 2WYGA 4MNVA 4IC6A 1QL7A 2O9QA 4UEHH 1Q2WA 1GPZA 2UWPA 3NPSA 5GCHF 1ZRBA 1ETRH 1C5WB 1SLXB 3BG4B 2BX4A 4KTUA 1EZUC 3U69H 1SSXA 3O8BA 3FFGA 1TAWA 1ELBA 1HBTH 4H4FA 2P94A 5T3HA 3ZVCA 2PHBA 5DP8A 1DICA 4ZH8A 1BTYA 1UHBA 3GCHB 2EI8A 1W10U 2BXUH 1TX6A 1ZHRA 1GBTA 2SGFE 1YYY1 5CE1A 3VB3A 4B2AA 3SU3A 1FZZA 3MU8A 1A0JA 1V2UT 1S6HA 1FY4A 5H4IB 3RU4E 2BY6X 4CR9A 4ZROA 2ZCLP 2ODPA 3PROA 1AN1E 1EAWA 4TY7A 1GHWH 1TGSZ 1TBZH 5HM9A 2SNVA 1WU1A 3HKIB 5GJ4B 3T26A 1XUIA 1OOKB 2WYJA 4WH6A 3BEUA 1LVBA 1N1LA 2ZGCA 2WPHS 2CN0H 2BDAA 2FX6A 1X7AC 4IC5A 4AG1A 4BOHA 1QTFA 4ZHLU 2FIRH 1FY8E 4DGJA 2BOKA 1ELGA 2STAE 2FLRH 2YOLA 2FEQH 3FAOA 1BMAA 1GBJA 3IWMA 2Z9LA 2Y5HA 4JZFH 5C1UA 2VIWA 1Y5UT 3MYWA 4I8LA 4GLYA 1B5GH 1NU9A 2ANMH 1ESAA 2JETC 2OBOA 1MKXK 2Y82A 2XCFA 3A7ZA 3SGBE 4AG2A 2W5EA 2Y7ZA 1G2MA 2A7JA 2LIZA 2TPIZ 4ZKNU 1TGCA 3A7TA 1SC8U 4O9VA 3GY3A 1G37A 1P2JA 2ZHFH 3K9XB 4BAHB 1Y5BT 3NUMA 4ESTE 1O3PB 2VNTA 1HIAB 1TGTA 1TLDA 1MBMA 1GMCG 1QY6A 1P06A 1TGNA 1WOFA 3ODDA 2ZHEH 1H9HE 1BA8B 5CHAB 1MTNB 1EP5A 3UREA 2J38A 2GT7A 1O2NA 7