5C5OA

Structure of sars-3cl protease complex with a phenyl-beta-alanyl (s,r)-n-decalin type inhibitor
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
300
structure length
300
Chain Sequence
b'SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Fused-ring structure of N-decalin as a novel scaffold for SARS 3CL protease inhibitors
rcsb
source organism Human sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
total genus 88
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 5c5oA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5c5oA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5c5oA02
1Y5AT 3URCA 1NY22 1L2EA 3E16B 1LHCH 1OYQA 1O2SA 4DW2U 1RS0A 1JMOH 1C2HA 1O5AB 1TPAE 1VITG 4XE4A 1HDTH 2BLVA 2FLBH 2QV1A 1AWFH 1GHZA 1WTHD 1P11E 1TGBA 2O8WA 1TRMA 4M7GA 5FHTA 4B2CA 1L0ZA 1FY4A 1EJAA 1TMUH 3E3TA 4NG9H 5LGOA 3GOVB 5E0HA 2AMPA 2BD2A 4X2WA 2HALA 4KTUA 2J92A 1NROH 2BDCA 2Q6FA 1UTQA 4O3TA 1JIRA 1HAYB 4ISOA 1V2WT 4WXVA 4Y7AA 1IQKA 2O9QA 3MFJA 1K1JA 4O97A 4JYTA 1GI8B 5AFZH 2VIWA 4Y71A 3KQCA 2SGFE 1QJ7B 5A0BA 2GVFA 2OINA 5F8TA 5T3HA 5AVDA 1C5UA 2QXHA 1NFWA 9LPRA 1C5YB 2BDIA 2CHAB 4Z0KA 1GMHF 5SGAE 4B73A 1TOCB 2BVSH 3UTUH 1HPGA 1LHDH 2ANYA 3M7UA 2ZFTA 2W7SA 2FI3E 1C5SA 3SU6A 2IN2A 3FP6E 1EZSC 1YKTA 1PPCE 1IQHA 2BY7X 4I8HA 1S0QA 4D9QA 1KDQB 2PFEA 2WV5A 5DP3A 1IHSH 3BTEE 4NFFA 2Y5FA 1D6WA 2BY5X 1O32A 3HKIB 2OXSA 1BHXF 3PMBB 4X1SU 1BHXB 3C27B 3GY6A 2QXIA 4NSYA 3FFGA 3QK1A 1TGTA 2PSYA 3K9XB 3TLOA 1O2RA 5CHAC 3QO6A 4TYDA 2G4UA 4UFDH 1BTZA 1SBWA 2ZHDA 1O2NA 1SLWB 1LVOA 3VGCC 5G4BA 1MQ6A 2Z9IA 1FI8A 5L30H 3S7KB 2ZEBA 1FJSA 5TCAA 1YCPH 3ZVCA 4AOQA 1O3AA 4Q2KA 5EOKA 3LGUA 4KP0A 2YNBA 3A8AA 1SGYE 1JOUB 1GBAA 5C67A 3SNDA 4NIXA 4NWLA 4WWYA 3V3MA 1H9LB 3E90B 3MI4A 3ZZ6A 1WUNH 1O3CA 2CJIA 4BOHA 3BG4C 1HAGE 2FODA 1MKXK 5EPYA 1K1PA 5EPNA 1Z7KA 1HAPH 1O2QA 1DWDH 1LQDB 1QJ6B 2FYQA 1TQ0B 2Y80A 1TGCA 1SFIA 3PMJA 2F91A 5HM2A 3T2NA 1EP6A 4NSVA 1CHOF 1PQAA 2W5EA 1ZPBA 1GBTA 1D3TB 1HFDA 1OP2A 1S5SA 1ZMNA 1AY6H 1KLTA 4DJZB 1CE5A 1GBIA 3QTOH 4MNXA 1ARCA 4IGDA 1Y3UA 3HPTB 1C1SA 4THNH 3MMGA 1C5VA 1T8LA 4KELA 1K28D 2P16A 2Z3DA 2QCYA 1AQ7A 1Y5UT 3O8RA 1O3DA 1AUTC 2BZAA 4U32A 1O3HA 1W12U 2F9UA 3F6UH 2A7JA 3BSQA 1JBUH 1MBMA 1RRKA 1UHBA 2Y81A 3BTKE 2FEQH 2GV6A 2FM2A 1UTMA 1EB2A 2V0BA 1TNLA 1SGRE 2D2DA 1V2UT 3E8LA 4BXSA 1BRBE 5EW1H 4NCYA 3QTVH 3S7HB 3RXFA 4X0WU 4Y8YA 1F0TA 1P03A 2WPKS 3NUMA 1GI2A 3HK6B 5FPSA 1BMNH 2G51A 1PYTC 1WCZA 1LPGB 2Z3EA 4BTIB 3RXPA 1O38A 1KY9A 2HGTH 5A8YA 2BDHA 1PPBH 4ZHAA 3LU9B 2F9PA 1H4WA 3SJIA 5A0AE 1A46H 1DICA 4MQAA 3P92A 1AVGH 2BX4A 2R0KA 1ZSJA 1DT2A 1NRSH 4E06H 1ZRBA 3ZVBA 3QWCH 1GBKA 2J2UA 3GY2A 1TQ7B 1TPPA 2GCHF 3H5CB 2ZDKA 4TPYA 1SFQB 3ZVDA 2HOBA 1G2MA 2F9NA 3A8BA 4UEHH 1MD8A 2H2ZA 3UNRA 1BTYA 5FPTA 2ALPA 1GVLA 1KTSB 1B0FA 2V3HH 1PPFE 1PQ5A 1TALA 3DD2H 2SGQE 2ASUB 2F9VA 5FBEA 4BAKB 2H5DA 2LPRA 3BEIB 1WBGB 4FUHA 9ESTA 1XKAC 2QN5T 1EZXC 1O34A 5DP7A 1ETTH 2AEIH 1O33A 3K6ZA 3OY5U 3PYHA 1GHAF 2BYAX 3P8NA 1ZPCA 3A8DA 2V3OH 1TX7A 4K3JA 2A31A 1ZGIA 1GMCF 1OKXA 2XBVA 1T8OA 2GGVB 2J38A 5FCRA 1OP0A 1EP5A 2XC4A 3LDXH 3U1IB 2GTBA 3HGPA 1BQYA 2WYJA 2OP9A 4CRFA 3AASA 3SUGA 3SI4H 3UIRA 1NZQH 2EI6A 2NU2E 2BOKA 4GSOA 1Y3WA 1TA2A 1DY8A 3G01A 4YT7H 3M7QA 3AW1A 2Z6BD 4MLFB 1QNJA 3EDXB 3P95A 3PB1E 2FDAA 3A7XA 3FVFB 3SHCH 3BTME 3PLBA 3DHKH 1A3BH 2SNVA 3F1SB 1DWCH 4MVNA 2P95A 2AIPA 4RKJB 2KAIA 3A7WA 2QXGA 3HK3B 1XKBC 4WMDA 1ELVA 1TBQH 2P59A 4ZAEA 5H4IB 2XCNA 4BXWA 5CHAB 1CGHA 4I8GA 1HAOH 3MU4A 1V3XA 3RU4E 1ABJH 3ZV9A 1IHTH 1P02A 3MH7A 1A1RA 3VGCB 2F3CE 2FTLE 3B8JA 2A7CA 1V2LT 3Q76A 4GCHG 5E0GA 1YGCH 3GY3A 1GHBF 2WPMS 3SO3A 4GUXA 3A7YA 1EAIA 2EA3A 1TNIA 5I46H 2PKSB 1GJCB 4X1NU 2H1UA 1UCYK 1ARBA 3ZVFA 2BD8A 1DVAH 3BG4B 1LPKB 1OWJA 1SLVB 1OWEA 2BMGB 3GCOA 3CS0A 4AG1A 3A7VA 1QRZA 3GCTF 1ZYOA 1RGQA 2VIVA 4KTSA 3RXDA 1O0DH 1XX9A 3W95A 2J95A 1L4DA 2UWPA 1O3FA 2VVCA 3TH2H 5IDKA 5GXPA 2C8WB 2Z7FE 2AMDA 3DT0H 2ANWA 1J16A 3BTQE 1Y5BT 2BQWB 1A5IA 2GX4A 4DURA 4ABGA 1BTWA 1QJ1B 3ATKA 1QCPA 4XOJA 4AB8A 5DP8A 1ID5H 1GBLA 1ZHMA 2GDEH 1NRNH 4ZKSU 3ZZ4A 2RG3A 1YPHE 3UNQA 2W7UA 3Q3XA 3RMLH 4E7RG 1C1UH 5T6FA 2IJOB 1H8DH 3SJ9A 1KXEA 1BBRK 3P8FA 5EXLA 1ANEA 4ASHA 3ZZAA 1AE5A 1ORFA 1MU8B 4F4OC 1NO9H 2FOBA 3VB3A 1QTFA 3D65E 3ZZCA 4GHTA 1O31A 1LQEA 3A89A 3KCGH 3KF2A 1T8NA 1XUKA 3BTDE 1RD3B 5GWZA 2C90B 5DGJA 3ZV8A 1BTXA 4YZUA 2FMJA 1MKWK 1INCA 2NU1E 3F68H 2ZU2A 3RXGA 3OY6U 1PYTD 3SGAE 1V6DA 3ZZ7A 4VGCC 3M5OA 2GT7A 3MNSA 2BY8X 5HGGA 3MHWU 1X7AC 3ATIA 2HRVA 1Y3YA 3IITA 5EQQA 2H6MA 1FUJA 4WXIA 4JK5A 1IOEA 3GDVA 1SG8B 2BD7A 3PTBA 1BTUA 1NRPH 3UOUA 4D9RA 1T31A 3H7OA 3UQVA 4IW4E 3LONA 3M5MA 3JZ1B 1ESBA 3NZIA 5J4SA 1P57B 2R2WU 2XRCA 4ABAA 4WMFA 4GLYA 1QGFA 1HGTH 3MU1A 3QN7A 2VH6A 1O35A 4FUEA 1P10A 2FP7B 1F0UA 3UY9A 3FAOA 3SU1A 1P04A 1G3DA 1UCYE 3MTYA 4A1XA 2ESTE 1C5RA 2AIQA 4K60A 1L4ZA 1C1WH 1TNHA 3SGQE 3M3VA 1C2JA 3E0PB 1WU1A 1UVOA 1SSXA 1LHEH 4ABBA 1QB1A 3KQEA 2C3SA 3Q3YA 1BT7A 2BXTH 1A5HA 1Z6EA 6LPRA 1MTSA 1CU1A 4CRBA 1GCTC 2TBSA 2WPHS 2YOLA 3FP8E 4I8KA 1O3BA 1HCGA 1W3CA 5JBCS 1C2DA 1GI3A 4GHQA 1ZPZA 1P3CA 1VZQH 3TGKE 2Y6TA 1DSTA 5CMXH 3UREA 2ZCLP 1VGCC 1XMNB 1GJ9B 4LK4A 2FOGA 4A6LA 1MBQA 1BOQA 1MUEB 2BVRH 2HVXA 4ISLA 4CRAA 3VXEH 2XCFA 1VCPA 5EQSA 3SV2H 1BBRE 1HBTH 3KHVA 5GPIB 4BANB 2WUBA 1ZSKA 2GD4B 3OU0A 3RMNH 3LH3A 3UQOA 1H8IH 2A4OA 2BD9A 1LPZB 5LH8A 5LPRA 2OCVB 1GWAA 4CH2B 1D3DB 4ISIH 1TONA 1CT2E 2PLXA 5LPEA 4UD9H 1OYTH 4JCNA 1T4UH 5DK1A 2WYGA 4ABIA 4Y10E 5C1YA 2ULLA 7GCHF 3F9HA 4MTBA 2ZGCA 4PROA 1IQIA 2OC0A 3V13A 1TMBH 1DLKB 1FQ3A 3KL6A 4XBDA 2SGDE 3E0NB 1E38B 3TIUA 2SFAA 1GBHA 1ZLRA 3P70B 1RFNA 2OUAA 8GCHF 2ODQA 3TH3H 4FUDA 1GI4A 3LT3A 1K2I1 4MPVA 2RA0A 1Z71A 4JYUH 4MG3A 1WV7H 2DE9A 3TVJB 3TJVA 5FCKA 1JXPA 3LH1A 4IBLH 4MPXA 4GAWA 2C4FH 2HPPH 4ISNA 1SC8U 2LIZA 3SUEA 3PWBA 4XFQA 2I6SA 3MU8A 1VCQA 3M61U 1O3MA 4MNWA 5FX5A 1SLUB 1P8VC 1V2KT 1EAUA 3I78A 1E36B 1L1GA 4ZHMU 2GCHG 5C5OA 1LVBA 4YOJA 3RXIA 1IQEA 1QHRB 2G00A 2HNTE 4UFGH 1TNGA 1YCPM 2FX4A 4Z6AH 4BNRA 2G52A 1G3CA 4H6SB 3UWJH 2VU8E 1D9IA 1WTGH 5HM9A 4AFUA 3SJOA 1Z8RA 1F5RA 2K7XA 2RCEA 1HAZB 2BVXH 2TGTA 1Q31A 4SGBE 3A82A 1K1MA 5F03A 1IQJA 4GPGA 1GHAG 1SL3A 5E0JA 1SQOA 1Y59T 2A5AA 1EAXA 3UR9A 3TH4H 1AGJA 3E1XB 3E6PH 1O2PA 3LPRA 5L6NH 1AMHA 1DITH 4AORA 5L2YH 4YOIA 3W94A 1K1LA 4IN2A 2CF8H 2ZP0H 4MPWA 4DIIH 5GJ4B 1ACBE 1LHFH 2ZU1A 4ABDA 1TPSA 2VWMA 1C5LH 1SOTA 2ZDNA 3MNXA 2QGRA 1CSOE 5DP4A 3SV8A 2BY9X 2PTCE 3KNXA 3ZZ3A 3AW0A 5LPFA 3U8OH 1CA0B 4YM9A 1LKBA 1HNEE 1Y8TA 2VWOA 1O3KA 1SOZA 4VGCB 3MU5A 1JWTA 3WY8A 4ESTE 4F49A 1O3PB 1L1JA 1G9IE 2Y5HA 4A92A 1MQ5A 1THRH 2OTVA 1C5WB 1TLDA 4UONA 4E05H 4FUIA 1TRNA 5JB8S 3VB4A 3M5LA 2TIOA 5EXMA 2QAAA 3ZZ8A 1ABIH 1O2XA 1O2YA 1UTJA 4IMZA 1YC0A 1FDPA 4KGAA 2PSXA 3TJOA 1DUAA 1QQUA 4AZ2B 1UMAH 1SHHB 1J9CH 4FU7A 1SGFG 2FWWA 2PKSC 4FU8A 4D76A 1YPEH 1K21H 1O3OA 2BX3A 1K22H 3A85A 3N7OA 2XNIA 3D49H 1OP8A 1QY6A 3S9CA 1ZMLA 2ZGXH 2ANMH 1P05A 3LGIA 2FOAA 1BRCE 1FN8A 4YTAA 5A2MH 2QF0A 4DIHH 1FIWA 1VITH 1ELTA 3A8CA 3U98H 3LC5A 1UO6A 3HGNA 1HJAC 4I7YH 1JIMA 2WV4A 1KDQA 1O2TA 5FX6A 2OQUA 1MU6B 5JB9S 2WPLS 3SU3A 1NS3A 3GCTG 3K2UA 3KN2A 4AGJA 1LCYA 4LZ4B 1SGQE 3SJ8A 4ABJA 2M5TA 1GCTB 1Q3XA 1MZDA 2BD5A 2A5IA 1BRUP 3RXSA 1LKAA 1MH0A 1CGIE 1BRAA 2STAE 1V2QT 4AFQA 5PTPA 1QB6A 3ZYEA 3O8BA 1VGCB 2EI8A 3P8GA 2UUKB 2SGAA 4CRCA 1UVPA 8ESTE 1GGDC 1V2VT 3FP7E 3LGYA 2GZ7A 1FPHH 2WPIS 1CBWC 1QURH 2CXVA 3RMMH 1EPTC 2PTNA 2BB4A 3DFLA 1ELCA 1ZTKA 3RXUA 3STJA 3AVZA 1P2NA 3GCHC 1GMDG 3VB7A 1O2JA 5GIBA 1EOJA 5A09A 1YYY1 1LVMA 2QYIA 1J15A 1QL9A 3O8CA 3T26A 3SU2A 1XUJA 4LZ1H 2QC2A 3MNBA 2RA3A 1AUJA 5HMAA 1HAXB 2TGPZ 3OYPA 5DPAA 2ZFRH 4CBOA 1ZJKA 1C5QA 4O9VA 1YLDA 3GY7A 1C5PA 4Y8ZA 3ATMA 3S69A 3PLKA 2BOHB 2ZHFH 1ZTJA 1ZR0A 3L33A 3TK6A 1A7SA 1BTHH 1OPHB 3ESTA 2BM2A 4Y0ZE 1G2LA 1O5EH 3LGVA 3RXHA 3UFAA 1RIWC 2ZGJA 1C4Y2 1LHGH 2Z94A 4H4FA 1W2KH 1KIGH 1NFYA 2XBWA 1F5LA 1PPEE 1BMAA 1MTNC 3NCLA 1K1NA 1SMFE 4A5TS 1Y3VA 2VH0A 2FI5E 1O3GA 2ZWLH 4OS5A 3AAUA 2LNCA 3MH5A 5I25A 1CO7E 3BV9B 2QY0B 3RU4T 1GDQA 1ELFA 2R3UA 1AZZA 1C2KA 3VB6A 2ZG0H 2VWNA 1VITF 1UVSH 4OS1A 2ZIQH 3A88A 3B23B 3Q00A 1TYNA 3GISB 1QQ4A 1FV9A 2P93A 3M3TA 1HRTH 1ESAA 5E8EH 2XBXA 4X8SH 1O2UA 6CHAC 2ZZUH 1P2QA 1RTKA 5EG4A 3SNAA 3T28A 4FVBA 1GBJA 1G30B 1OS8A 1OWKA 2VB0A 4OS6A 3QDZB 3SGBE 1K1OA 2ZFFH 1S84A 1DANH 3SQHE 1UK2A 1AHTH 3RXEA 1C1PA 1GBFA 1XUFA 1D4PB 1RTLA 1ZJDA 1NTPA 3ZVEA 1UK3A 3S0NA 5IYTA 3B9FH 1QL7A 1BUIA 2P3TB 4ABEA 1AO5A 4HTCH 4D7GA 1ANBA 1TE0A 3TNSA 1KLJH 2O8MA 2BDGA 4NA7A 4AG2A 1HJ8A 2H9EH 3Q77A 1LTOA 7GCHG 1GHXH 3STIA 4H6TA 3T62A 2BDAA 1ELAA 4X6PA 1RTFB 1GJ6A 4FUBA 4IC5A 4NZQA 5EGMA 2BDYA 3RXRA 4QT8C 1DS2E 1GCDA 1B7XB 5FXLA 1HAVB 8GCHG 2ZHQH 4B71A 5DKMA 2Z3CA 2XWAA 1AVXA 1B0EA 3TGJE 3GY4A 3SN8A 1PPZA 1C9PA 1WSSH 1YCPK 1O5FH 3SV9A 1XXDA 2G4TA 2G8TA 4Y0YE 1KXCA 2VGCC 4ZUHA 3PMAB 3A7ZA 2D8WA 1O3NA 2JH0D 2PUQH 4NGAH 1A3EH 1E34B 3SV7A 5FPYA 2SGPE 2IOTA 2I6QA 3DFJA 4DT7B 3RC4A 4FUCA 3UWIA 1O37A 1HAHH 3A80A 3L6PA 3EYDA 3BEFB 2UUJB 2ZDVH 3SJKA 1NPMA 1XM1A 3EQ0H 4ZH8A 3RM2H 2FOHA 2A4QA 4ABHA 2CV3A 1HJAB 1ESTA 1MD7A 2CMYA 2GKVE 3SNBA 2CF9H 2ZA5A 5K0HA 2ZDMA 4AGKA 3IWMA 1O3EA 2CN0H 1HAIH 2OQ5A 1HIAB 2QA9E 1DOJA 5JBBS 1DPOA 4R0IA 2OLGA 1TRYA 2GMTB 2ZKSA 2ZPSA 5DP9A 2PWXA 1O2WA 1OX1A 4FUFA 2HNTF 1DUEA 1HAVA 3UOPA 2ZFSA 1ELEE 1G3BA 1O5CB 1YBWA 1P2KA 1SGFA 1DWBH 3HATH 5EODA 1GGDB 1HYLA 1SGEE 2R0LA 3EA7A 1F7ZA 3VXFH 1FIZA 4K1TA 2GZ8A 1CBWB 1BJUA 5C5NA 3K65B 1EPTB 3QX5H 1TX8A 4LXBH 4XSKU 3RLWH 4ABFA 1GMHG 1MAXA 4K1EA 2GCTC 3M3SA 1GDNA 3GCHB 4K1SA 2Y5GA 2SNWA 2VNTA 6GCHF 1GVZA 1FY3A 5C20A 4SGAE 1CA0C 4ZKRU 1C1NA 3JZ2B 2W26A 1G36A 3GDUA 1VR1H 2YNAA 1OOKB 4DG4A 1EASA 2BXUH 3LIWA 3BTTE 2R2MB 1TBZH 1AZ8A 1SR5C 4IMQA 3GCNA 1OWIA 5GCHF 3TJUA 3LKWA 1GI7B 3OTJE 4BAHB 2XWBI 1P01A 1C5XB 3RM0H 1RIWB 1NFXA 3SW2B 4B2BA 4HI3A 1O36A 3RXAA 2FI4E 1SQTA 5FBIA 1UTLM 4ZROA 1MTNB 5ABWA 4WMEA 1TIOA 2AGGX 3RXOA 1T7CA 4MNYA 1GL0E 4R8TB 1CHGA 3EGKH 4JZFH 4B2AA 1DY9A 3M37A 1EPTA 1C5ZB 2BQ7B 1AVWA 1T4VH 1C2MA 1KXFA 1AD8H 4XBCA 1AKSB 2AFQB 1UTKA 1KTTB 1VCWA 4MPUA 1E37B 2JKHA 4X8VH 1HB0B 1MKXH 1ZHRA 3C1KA 1EAWA 4AFZA 1O2ZA 2THFB 2PKAB 3DUXH 4K69A 1CHOG 2FOFA 1YM0A 1BZXE 4D8NA 1CT0E 4BTUB 1PQ8A 3NWUA 1G32B 1FXYA 3MO9A 1QBOA 1NC6A 1V2TT 3KIDU 3SORA 6CHAB 1MZAA 1V2PT 1BITA 1T8MA 3RXCA 1XUIA 1XXFA 4X2XA 2P94A 3BIUH 4X2VA 1JRTA 2ZF0H 3T5FH 2ZC9H 3RMOH 3KEEA 1AFEH 2P3FH 2D1JA 2C8YB 3CENA 1PQ7A 3BG8A 3IG6B 1ZZZA 1P3EA 3PMHB 4TWWA 1TPOA 3QUMP 1YPHC 2HWLB 2ZI2H 3MNCA 2C8XB 3L3TA 3T25A 3SUDA 1EJMA 1BB0B 1W0YH 3R3GB 1P2IA 1SGPE 1U6QA 1P0SH 1GPZA 2K1QA 1BMMH 4NZLA 1DFPA 3EAJA 4WH6A 5EQRA 4ZKOU 4X2YA 4JYVH 2FO9A 1N8OC 4U30A 5FAHA 2VIPA 2B5TB 2BLOA 2JH5D 2ODPA 1NESE 3RXLA 1IQMA 2GP9B 1P9UA 2FPZA 1HJ9A 2OC8A 1A61H 2B7DH 4AYVB 2UWLA 3TNTA 2VGCB 2ZU3A 5T6GA 3BTFE 1BMLA 4CHAC 1C1MA 4ZMAH 4B1TA 1QBVH 1AE8H 3CS7A 1QL8A 1GI1A 1EOLA 4Y7BA 2A7HA 1GHYH 1J8AA 3EE0B 2OBQA 3RXJA 3GY5A 2FXRA 1F0SA 1AIXH 4XBBA 2AYWA 3QZRA 4NA8A 1ELDE 2VIOA 1O2GH 2ZDLA 3FZDA 1O2LA 4IC6A 5DG6A 4DCDA 1TOMH 3V12A 1CGJE 1TB6H 1FN6A 1ETRH 2PGQB 4NA9H 1DLEA 1LO6A 1W14U 1FAKH 4AN7A 1CQQA 3RXBA 5JPMH 1GMCG 1BA8B 2ZECA 4CH8B 4X1PU 4YESB 1P2OA 3UPEA 3MU0A 3UR6A 2B0FA 3TU7H 2F9OA 3RC6A 1AN1E 3EA9A 5CE1A 3M7TA 1MTWA 2PR3A 3BTGE 4Y8XA 4WH8A 1C2IA 3RXMA 3LOXA 3P8OA 2J4IA 4IS5A 1FZZA 2G55A 3ZYDA 2XBYA 1QRWA 3M5NA 1O5DH 2F83A 1V2ST 2P3UB 1FMGA 2JH6D 4AB9A 2FS8A 3SU0A 4K8BA 2BDBA 2GCTB 1SLXB 1P12E 1YLCA 4NIWA 1UJ1A 1O2HA 2R9PA 1WQSA 5BPEA 2H9HA 1TGSZ 1FPCH 2FYRA 4WVPE 2QXJA 1GJAB 3M36A 1XUHA 2FOMB 4TWYA 4TPIZ 1FLEE 2FOCA 1EX3A 3EBNA 4YT6H 1ZRKA 1HLTH 1O2VA 3MYWA 1D6RA 1QR3E 1S6HA 2ZCHP 1TX6A 3R0FA 2ZGBH 1C4V2 1S6FA 2ZPQA 3H7TA 1Y3XA 1AFQC 3VEQB 4CR9A 1C1QA 1YF4A 2AGIX 2J9NA 4JMYA 1K9OE 7KMEH 2V6NA 2RDLA 1O2MA 1QRXA 1W8BH 4GVUA 1SGTA 4OGYA 1W7XH 1GHBG 2R3YA 1UTPA 1ETSH 3GYLB 1C1TA 3TITA 4NFEA 1THSH 3SBKA 2ZO3H 1FY1A 2W3IA 3SU4A 3OX7U 1S81A 3RU4D 2EC9H 1G37A 1BJVA 2BTCE 3ATLA 5K7RA 2ZTYA 3TJNA 1W7GH 1S85A 1EZUC 1XVOA 1C2FA 2TRMA 3RXTA 1UCYH 5J4QA 2NU3E 3GYMA 1EQ9A 3ENSB 4YO9A 1UHBB 4X1RU 1GJDB 2A32A 3URDA 4CREA 1O39A 4XDEA 3V0XA 1SI5H 3TK5A 1PPHE 1MTVA 1NU7B 2GMTC 2PW8H 4A1VA 1FNIA 2XXLA 1C5MD 1V2NT 3ITIA 1AB9C 4JK6A 2HNTC 1O2KA 4KKDA 4WJG2 4BTTB 2DE8A 1E35B 1A0HB 1O2IA 4AFSA 5A8XA 3SNCA 2G5VA 4WF8A 2TPIZ 1SGNE 1VJ9U 2BZ6H 3E91A 1SVPA 1H9IE 4K5ZA 2ODYB 3A87A 1J17T 1UVUH 2ZCKP 4UFFH 3BTWE 1NFUA 2VVUA 5HYOA 3QZQA 3MH4A 2HPQH 3VB5A 1BBRH 1OSSA 1OWDA 2AMQA 1GBEA 2B9LA 1GVKB 5A8ZA 3SV6A 3MO6A 3FANA 1MCTA 2P8OC 1S83A 4O3UA 1AWHB 2ZHEH 3Q3KA 6GCHG 1EZQA 1GHWH 1CT4E 3ODDA 1C5TA 1P2MA 3NK8A 4A7IB 3ODFA 1MKWH 1W10U 3KQDA 1SQAA 2A2QH 1D3PB 2BLWA 1ZGVA 2ZNKH 1V2JT 1F92A 5DP5A 1N8OB 2BD3A 3RXQA 1JRSA 3ZZDA 1L1NA 1TMTH 5GCHG 2Y82A 2A2XH 4OS4A 1SB1H 1P06A 2CGAA 2J34A 2GZ9A 1O3LA 4UFEH 3D23A 2W3KA 1IAUA 4I8LA 4Y76A 5JBTA 1G3EA 2ANKH 3PO1B 1DX5M 3SNEA 1IQGA 2ZU4A 1EUFA 4HFPB 2D26C 5F8XA 1BTPA 1W0ZU 2VIDA 4CHAB 1SPJA 3ZZ9A 2O8UA 2VIQA 3VPKA 3BEUA 5C3NA 1DDJA 3U9AH 1FY5A 2PGBB 4ZXYH 3O8DA 4MNVA 2VJ1A 2OBOA 1C9TA 2VWLA 4D7FA 2GDDA 3QLPH 3I29A 2JETC 2OC7A 1O2OA 4X1QU 4X8UH 3SHAH 3BTHE 2QIQA 3SU5A 1GI5A 3LGWA 2Z9LA 2PUXB 2AS9A 1A5GH 3I77A 1NU9A 1GJBB 2Y7ZA 2KAIB 5JBAS 1ANCA 4Q7YA 1SGCA 3P17H 2XC0A 2ZDAH 3VFEA 1YP9A 1QFKH 2PHBA 3LC3A 4MDSA 1YPJH 2ZQ1A 4U2WA 1O30A 4CR5A 1W11U 1BIOA 2G5NA 2ZU5A 1SGDE 4HGCA 1FONA 4I33A 4NWKA 2Z9GA 2ZTZA 4Q7XA 3A81A 3D62A 5DP6A 4B75A 4CBNA 1N1LA 1KSNA 3P6ZB 4INKA 5C1UA 3BN9A 1C2GA 3KGPA 1O5GH 1GDUA 1HXFH 4ISHH 3TPIZ 3U8TH 1MCVA 3PM3A 2VINA 1IQFA 2O8LA 5B6OA 5E2PA 1TNKA 5BRRE 4DGJA 3GDSA 2WINI 5L2ZH 1S0RA 1WQVH 2Q1JA 4LOYH 5ETXA 4I8JA 1NM6A 2A4GA 1EKBB 4YLUA 4CRDA 1A0LA 1P2JA 2WUCA 4DVAU 2DUCA 3SUFA 1A2CH 1Z8JB 4BAQB 4INLA 4FUJA 2H5CA 1EB1H 4B74A 3PLPA 1B5GH 2XYAA 1YPKH 4YOGA 1PPGE 1OXGA 2IPHA 4K8YA 5F8ZA 3PTNA 1H1BA 1EJNA 3S9AA 1AFQB 1ZMJA 4OGXA 5TJXA 5AF9H 2BD4A 1GBMA 4H42U 3UUZA 1KXDA 5JYIA 1GJ4H 3F9FA 3TK9A 1FAXA 4X6NA 2H9TH 4J2YB 2FX6A 1H9HE 2BY6X 3BF6H 1C5OH 1GJ7B 1EXFA 1QBNA 4B76A 1F2SE 1WAYB 3U69H 1ZSLA 5E2OA 2EEKA 1DM4B 4Y6DA 4DOQA 4RKOB 4UE7H 3ZZBA 1ZTLA 4O03A 1C2EA 1NN6A 1C4U2 1SHYA 3M35A 1ELGA 3MO3A 4FXGH 1T32A 3ZVAA 1TAWA 2FZZA 4J1YA 2A5KA 2ZTXA 1KLIH 1YPGH 1GG6C 5DJ7A 3DA9B 3LJJA 4YLQH 1NRRH 3SZNA 5GDSH 3GY8A 5AFYH 2GV7A 2FIRH 1O3IA 3SOSA 1EATA 3A7TA 1QB9A 1CVWH 3GICB 4Q7ZA 1GI9B 2NU4E 2Z9JA 4U01A 4K2YA 2ZGHA 1MMJN 2TGDA 4NIVA 1QIXB 1DXWA 1AB9B 8LPRA 2J94A 1THPB 3F9EA 1GBBA 2UUFB 1DWEH 2AGEX 2FESH 4UDWH 1KXBA 1NT1A 1QA0A 5T6DA 1DXPA 2V35A 3RXKA 1UVTH 1TWXB 1CA8B 1GI0A 1KYNA 1O3JA 4NIYA 1N6XA 4TY6A 2TGAA 2BLQA 2ZHWH 3MH6A 2EI7A 4HZHA 7LPRA 2XW9A 3RLYH 1V2MT 2FOEA 1WYKA 3U1JB 2B8OH 1Z1JA 1OWHA 1P9SA 1RJXB 1LMWB 4E7NA 2C8ZB 4ZHLU 2CHAC 1MTUA 3AAVA 2P8OB 1GMDF 7ESTE 1TA6A 3ATWA 3K6YA 1E0FD 3QGJA 1TBRH 4FVDA 1K1IA 1HIAA 3RP2A 1MAYA 1WOFA 1Z1IA 2F9BH 3HKJB 3ZVGA 5C1XA 1IQLA 2FS9A 4IN1A 2UUYA 3S9BA 1QA7A 3T29A 4ZXXH 3KQBA 2WPJS 1DE7H 3SQEE 1C1VH 5DO4H 1GBDA 2NWNA 6ESTA 2NU0E 3U8RH 1UTOA 1TGNA 4FU9A 4JZEH 2G81E 3A84A 2SGEE 1NRQH 4RN6A 2ZFPH 1RXPA 1FY8E 3PWCA 3RXVA 1IQNA 4TY7A 2C93B 1BDAA 1C5NH 1F5KU 2VVVA 5AHGH 4I32A 1V2OT 1SGIB 2AERH 5EW2H 4BAOB 3QGNB 1TNJA 1UK4A 5TCCA 2JETB 5C2ZA 5F6MA 2A4RA 2ZPRA 1N6YA 2OD3B 1D3QB 4JZ1A 1DSUA 5HXFA 2XTTB 2BQ6B 1YPMH 2STBE 3LJOA 4DY7B 1Z8GA 1O5BB 1XUGA 1J14A 2A0QB 3BIVH 1C1OA 1F0RA 2FLRH 1GL1A 2UWOA 1A4WH 1GJ5H 4X8TH 3ZZ5A 3MWIU 3MOCA 3FZZA 4X6MA 3V7TA 2A45B 4A1TA 2ZQ2A 4JZDH 1A0JA 1AI8H 3OSYA 1Z8IB 5ESTE 2QF3A 2ILNA 3A83A 2Q6GA 4JZIA 1V2RT 1LVYA 3SI3H 2O8TA 3TGIE 5EXNA 3NXPA 1PFXC 4X6OA 1GJ8B 1HV7A 1C1RA 3LGTA 2AH4X 2Z9KA 1AKSA 1GBCA 3A86A 1PJPA 2OC1A 1Z6JH 3EA8A 4OS2A 2Q6DA 2ALVA 4RSPA 1TABE 2XC5A 2PKAA 1KXAA 1LDTT 2FTMA 3UNSA 4OS7A 5A0CA 1GI6A 2ZFQH 3CP7A 4Q80A 4ZKNU 1HXEH 4I31A 3PROA 4AYYB 3ELAH 4Y79A 4CRGA 2GT8A 3NKKA 1HUTH 1ANDA 4GCHF 2PV9B 2Y7XA 3RC5A 4AX9H 1C2LA 3PO1C 3PV4A 1M9UA 4KTCA 4BAMB 3NPSA 4Y11E 1UTNA 8KME2 1TFXA 5ESBA 1YPLH 5JDUB 1Q2WA 3RUOA 3F9GA 1VJAU 2BHGA 1ZOMA 1GHVH 4FUGA 1BCUH 2A1DB 4WY3A 1GG6B 1P09A 4INHA 1ZHPA 5EU8A 2HLCA 1XVMA 1ELBA 1W13U 1AU8A 3RDZA 3T27A 1S82A
chains in the Genus database with same CATH superfamily
1Y5AT 3URCA 2LP6A 1NY22 1L2EA 3E16B 1LHCH 1OYQA 1O2SA 4DW2U 1RS0A 1JMOH 4I86A 1C2HA 1O5AB 5DN6D 1TPAE 1VITG 4XE4A 1HDTH 2BLVA 2FLBH 2QV1A 1AWFH 1GHZA 1WTHD 1P11E 1TGBA 2O8WA 1TRMA 4M7GA 5FHTA 4B2CA 1L0ZA 1FY4A 1EJAA 1TMUH 3E3TA 4NG9H 5LGOA 3DSOA 3GOVB 5KECA 5E0HA 2AMPA 2BD2A 4X2WA 2HALA 4KTUA 2J92A 1NROH 2BDCA 4XD7D 2Q6FA 1UTQA 4O3TA 1JIRA 1HAYB 4ISOA 1V2WT 4WXVA 4Y7AA 1IQKA 3VG8A 2O9QA 3MFJA 1K1JA 4O97A 4JYTA 1GI8B 5AFZH 2VIWA 3UB0A 4Y71A 3KQCA 2SGFE 1QJ7B 5A0BA 2GVFA 2OINA 5F8TA 5T3HA 5AVDA 1C5UA 2QXHA 1NFWA 9LPRA 1C5YB 2BDIA 2CHAB 4Z0KA 1GMHF 5SGAE 4B73A 1TOCB 2BVSH 3UTUH 1HPGA 1LHDH 2ANYA 3M7UA 2ZFTA 2W7SA 2FI3E 1C5SA 3SU6A 2IN2A 3FP6E 5C94A 1EZSC 1YKTA 1PPCE 1IQHA 2BY7X 4I8HA 1S0QA 4D9QA 1KDQB 2PFEA 2WV5A 5DP3A 1IHSH 3BTEE 4NFFA 2Y5FA 1D6WA 2BY5X 1O32A 2EQNA 3HKIB 2OXSA 1BHXF 3PMBB 4X1SU 1BHXB 3C27B 3GY6A 2QXIA 4NSYA 3FFGA 3QK1A 1TGTA 2PSYA 3K9XB 3TLOA 1O2RA 5CHAC 3QO6A 4TYDA 2G4UA 4UFDH 1BTZA 1SBWA 2ZHDA 1O2NA 1SLWB 1LVOA 3VGCC 5G4BA 1MQ6A 2Z9IA 1FI8A 5L30H 4FOUC 3S7KB 2ZEBA 1FJSA 5TCAA 1YCPH 3ZVCA 4AOQA 1O3AA 4Q2KA 5EOKA 3LGUA 4KP0A 2YNBA 3A8AA 1SGYE 1JOUB 1GBAA 5C67A 3SNDA 4NIXA 4NWLA 4WWYA 3V3MA 1H9LB 3E90B 3MI4A 3ZZ6A 1WUNH 1O3CA 2CJIA 4BOHA 3BG4C 1HAGE 2FODA 1MKXK 5EPYA 1K1PA 5EPNA 1Z7KA 1HAPH 1O2QA 1DWDH 1LQDB 1QJ6B 2FYQA 1TQ0B 2Y80A 1TGCA 1SFIA 3PMJA 2F91A 5HM2A 3T2NA 1EP6A 3F0PA 4NSVA 1CHOF 5DSFA 1PQAA 2W5EA 1ZPBA 1GBTA 1D3TB 1HFDA 1OP2A 1S5SA 1ZMNA 1AY6H 1KLTA 4DJZB 1CE5A 3WWBA 1GBIA 3QTOH 3FN8A 4MNXA 1ARCA 4IGDA 1Y3UA 3HPTB 1C1SA 4XRNA 4THNH 2EY4C 3MMGA 1C5VA 1T8LA 4KELA 1K28D 2P16A 2Z3DA 2QCYA 1AQ7A 1Y5UT 3O8RA 1O3DA 1AUTC 2BZAA 4U32A 1O3HA 2K8IA 1W12U 3F2HA 2F9UA 3F6UH 2A7JA 3BSQA 1JBUH 1MBMA 1RRKA 1UHBA 2Y81A 3BTKE 2FEQH 2GV6A 2FM2A 1UTMA 1EB2A 2V0BA 1TNLA 1SGRE 2D2DA 1V2UT 3E8LA 4BXSA 1BRBE 5EW1H 4NCYA 3QTVH 3S7HB 3RXFA 4X0WU 4Y8YA 1F0TA 1P03A 2WPKS 3NUMA 1GI2A 3HK6B 5FPSA 1BMNH 2G51A 4YXWD 1PYTC 1S6LA 1WCZA 1LPGB 2Z3EA 4BTIB 3RXPA 1O38A 1KY9A 2HGTH 5A8YA 2BDHA 1PPBH 4ZHAA 3LU9B 2F9PA 1H4WA 3SJIA 5A0AE 1A46H 1DICA 4MQAA 3P92A 1AVGH 2BX4A 2R0KA 1ZSJA 1DT2A 1NRSH 4E06H 1ZRBA 3ZVBA 3QWCH 1GBKA 2J2UA 3GY2A 1TQ7B 1TPPA 2GCHF 3H5CB 2ZDKA 4TPYA 1SFQB 3ZVDA 2HOBA 1G2MA 2F9NA 3A8BA 4UEHH 1MD8A 2H2ZA 3UNRA 1BTYA 5FPTA 2ALPA 1GVLA 1KTSB 1B0FA 2V3HH 1PPFE 1PQ5A 1TALA 3DD2H 2SGQE 2ASUB 2F9VA 5FBEA 4BAKB 2H5DA 2LPRA 3BEIB 1WBGB 4FUHA 9ESTA 1XKAC 2QN5T 1EZXC 1O34A 5DP7A 1ETTH 2AEIH 1O33A 3K6ZA 3OY5U 3PYHA 1GHAF 2BYAX 3P8NA 1ZPCA 3A8DA 2V3OH 1TX7A 4K3JA 2A31A 1ZGIA 2V7QD 1GMCF 1OKXA 2XBVA 1T8OA 2GGVB 2J38A 5FCRA 1OP0A 1EP5A 2XC4A 5EIYA 2RFKC 3LDXH 3U1IB 2GTBA 3HGPA 1BQYA 2WYJA 2OP9A 4CRFA 3AASA 3SUGA 3FOAA 3SI4H 3UIRA 1NZQH 2M2AA 2EI6A 2NU2E 2BOKA 4GSOA 1Y3WA 1TA2A 1DY8A 3G01A 4YT7H 3M7QA 3AW1A 2Z6BD 4MLFB 1QNJA 3EDXB 3P95A 3PB1E 2FDAA 3A7XA 3FVFB 3SHCH 3BTME 3PLBA 3DHKH 1A3BH 2SNVA 3F1SB 1DWCH 4MVNA 2P95A 2AIPA 4RKJB 2KAIA 3A7WA 2QXGA 3HK3B 1XKBC 4WMDA 1ELVA 1TBQH 2P59A 4ZAEA 5H4IB 2XCNA 1MABB 4BXWA 5CHAB 1CGHA 4I8GA 1HAOH 3MU4A 1V3XA 3RU4E 1ABJH 3ZV9A 1IHTH 1P02A 3MH7A 1A1RA 3VGCB 2F3CE 2FTLE 3B8JA 2A7CA 1V2LT 3Q76A 3F2GA 4GCHG 5E0GA 1YGCH 3GY3A 1GHBF 2WPMS 3SO3A 5EJLA 4GUXA 3A7YA 1EAIA 4B6EA 2EA3A 1TNIA 5I46H 2PKSB 1GJCB 4X1NU 2J97A 2H1UA 1UCYK 1ARBA 3ZVFA 2BD8A 1DVAH 3BG4B 1LPKB 1OWJA 1SLVB 1OWEA 2BMGB 3GCOA 3CS0A 4AG1A 3A7VA 1QRZA 3GCTF 1ZYOA 1RGQA 2VIVA 4KTSA 3RXDA 1O0DH 1XX9A 2YMSC 2J95A 3W95A 1L4DA 2UWPA 1O3FA 2VVCA 3SYJA 3TH2H 5IDKA 5GXPA 2C8WB 2Z7FE 2WHXA 2AMDA 3DT0H 2ANWA 1J16A 3BTQE 1Y5BT 2BQWB 1A5IA 2GX4A 4DURA 4ABGA 1BTWA 3OE7D 1QJ1B 3ATKA 1QCPA 4XOJA 4M9FA 4AB8A 5DP8A 1ID5H 1GBLA 1ZHMA 2GDEH 1NRNH 4ZKSU 1W0JD 3ZZ4A 2RG3A 1YPHE 3UNQA 2W7UA 3Q3XA 3RMLH 4E7RG 1C1UH 5T6FA 2IJOB 1H8DH 3SJ9A 1KXEA 1BBRK 3P8FA 5EXLA 1ANEA 4ASHA 3ZZAA 1AE5A 1ORFA 1MU8B 4F4OC 2KFWA 1NO9H 2FOBA 3VB3A 1QTFA 3D65E 3N7EA 3ZZCA 4GHTA 1O31A 1LQEA 3A89A 3KCGH 3KF2A 1T8NA 1XUKA 3BTDE 1RD3B 2XOKD 5GWZA 2C90B 5DGJA 3ZV8A 1BTXA 4YZUA 2FMJA 1MKWK 1INCA 2NU1E 5CDFE 3F68H 2ZU2A 3RXGA 3OY6U 1PYTD 3SGAE 1V6DA 3ZZ7A 4VGCC 3M5OA 2GT7A 3MNSA 2BY8X 5HGGA 3MHWU 1X7AC 3ATIA 2HRVA 1Y3YA 3IITA 5EQQA 2H6MA 1FUJA 4WXIA 4JK5A 1IOEA 3GDVA 1SG8B 2BD7A 3PTBA 1BTUA 1NRPH 3UOUA 4D9RA 1T31A 3H7OA 3UQVA 4IW4E 3LONA 3M5MA 3JZ1B 1ESBA 3NZIA 5J4SA 1P57B 2R2WU 2XRCA 4ABAA 4WMFA 4GLYA 1QGFA 1HGTH 3MU1A 3QN7A 2VH6A 1O35A 4FUEA 1P10A 2FP7B 1F0UA 3UY9A 3FAOA 3SU1A 1P04A 1G3DA 1UCYE 3MTYA 4A1XA 2ESTE 1C5RA 1YWUA 2AIQA 4K60A 1L4ZA 1C1WH 1TNHA 3SGQE 3M3VA 1C2JA 3E0PB 1WU1A 1UVOA 2V3MA 1SSXA 5B6LA 1LHEH 4ABBA 1QB1A 2KCAA 3KQEA 2C3SA 3Q3YA 1BT7A 2BXTH 1A5HA 1Z6EA 6LPRA 1MTSA 1CU1A 4CRBA 1GCTC 2TBSA 2WPHS 2YOLA 3FP8E 4I8KA 1O3BA 1HCGA 1W3CA 5JBCS 1C2DA 1GI3A 4GHQA 2J5UA 1ZPZA 1P3CA 1VZQH 3TGKE 2Y6TA 1DSTA 5CMXH 3UREA 2ZCLP 1VGCC 1XMNB 1GJ9B 4LK4A 2FOGA 4A6LA 1MBQA 1BOQA 1MUEB 2BVRH 2HVXA 4ISLA 4CRAA 3VXEH 2XCFA 1VCPA 3F3BA 5EQSA 3SV2H 5C17A 1BBRE 1HBTH 3KHVA 5GPIB 4BANB 5EJ1A 2WUBA 1ZSKA 2GD4B 3OU0A 3RMNH 3LH3A 3UQOA 1H8IH 2A4OA 2BD9A 1LPZB 5LH8A 5LPRA 2OCVB 1GWAA 4CH2B 1D3DB 4ISIH 1TONA 1CT2E 2PLXA 5LPEA 4UD9H 1OYTH 4JCNA 1T4UH 5DK1A 2WYGA 4ABIA 4Y10E 5C1YA 2ULLA 7GCHF 3F9HA 4MTBA 2ZGCA 4PROA 1IQIA 2OC0A 3V13A 1TMBH 1DLKB 1FQ3A 3KL6A 4XBDA 2SGDE 3E0NB 1E38B 3TIUA 2SFAA 1GBHA 1ZLRA 3P70B 1RFNA 2OUAA 8GCHF 2ODQA 3TH3H 4FUDA 1GI4A 3LT3A 1K2I1 4MPVA 4P00A 2RA0A 1Z71A 4JYUH 4MG3A 1WV7H 2DE9A 3TVJB 3TJVA 5FCKA 1JXPA 3LH1A 4IBLH 4MPXA 3DSGA 4GAWA 2C4FH 2HPPH 4ISNA 1SC8U 2LIZA 3SUEA 3PWBA 4XFQA 2I6SA 4F55A 3MU8A 2XNDD 1VCQA 3M61U 1O3MA 4MNWA 5FX5A 1SLUB 1P8VC 1V2KT 1EAUA 3I78A 4AC9A 1E36B 1L1GA 4ZHMU 2GCHG 5C5OA 1LVBA 4YOJA 3RXIA 1IQEA 1QHRB 2G00A 2HNTE 4UFGH 1TNGA 1YCPM 2FX4A 4Z6AH 4BNRA 2G52A 1G3CA 4H6SB 3UWJH 2VU8E 1D9IA 2YMSD 1WTGH 2YMSB 5HM9A 4AFUA 3SJOA 1Z8RA 1F5RA 2K7XA 2RCEA 1HAZB 2BVXH 2TGTA 1Q31A 4SGBE 3A82A 1K1MA 5F03A 1IQJA 4GPGA 1GHAG 1SL3A 5E0JA 1SQOA 1Y59T 2A5AA 1EAXA 3UR9A 3TH4H 1AGJA 3E1XB 3PV2A 3E6PH 1O2PA 3LPRA 5L6NH 1AMHA 1DITH 4AORA 5L2YH 4YOIA 3W94A 1K1LA 4IN2A 3KYGA 2CF8H 2ZP0H 4MPWA 4DIIH 5GJ4B 1ACBE 1LHFH 4CRDA 2ZU1A 2KCPA 4ABDA 1TPSA 2VWMA 1C5LH 1SOTA 2ZDNA 3MNXA 2QGRA 1CSOE 4TT3D 2JIZD 2KR7A 5DP4A 3SV8A 2BY9X 2PTCE 3KNXA 3ZZ3A 3AW0A 5LPFA 3U8OH 1CA0B 4YM9A 1LKBA 1HNEE 1Y8TA 2VWOA 1O3KA 3PRDA 2HLDD 1SOZA 4VGCB 2KCYA 3MU5A 1JWTA 3WY8A 4ESTE 5EJZA 4F49A 1O3PB 1L1JA 1G9IE 2Y5HA 4A92A 1MQ5A 1THRH 2OTVA 1C5WB 1TLDA 4UONA 4E05H 4FUIA 1TRNA 5JB8S 3VB4A 3M5LA 2TIOA 5EXMA 2QAAA 2QF4A 3ZZ8A 4ACBA 1ABIH 1O2XA 1O2YA 1OHHD 1UTJA 4IMZA 1YC0A 1FDPA 4KGAA 2PSXA 3TJOA 1DUAA 1QQUA 4AZ2B 1UMAH 1SHHB 1J9CH 4FU7A 1SGFG 2FWWA 2PKSC 4FU8A 4D76A 1YPEH 1K21H 1O3OA 2BX3A 1K22H 3A85A 3N7OA 2XNIA 4Q63A 3D49H 1OP8A 1QY6A 3S9CA 1QZ8A 1ZMLA 2ZGXH 2ANMH 1P05A 1BMFD 2FOAA 3LGIA 1BRCE 1FN8A 4YTAA 5A2MH 2QF0A 4DIHH 1FIWA 1VITH 1ELTA 3A8CA 3U98H 2JJ1D 3LC5A 1UO6A 3HGNA 1HJAC 4I7YH 1JIMA 2WV4A 1KDQA 1O2TA 5FX6A 2OQUA 1MU6B 5JB9S 2WPLS 3SU3A 1NS3A 3GCTG 3K2UA 3KN2A 4AGJA 1LCYA 4LZ4B 1SGQE 3SJ8A 4ABJA 2M5TA 1GCTB 1Q3XA 1MZDA 2BD5A 2A5IA 1BRUP 3RXSA 1LKAA 1MH0A 1CGIE 1BRAA 2STAE 1V2QT 4AFQA 5PTPA 1QB6A 3ZYEA 2K0QA 3O8BA 1VGCB 2EI8A 3P8GA 2UUKB 2SGAA 4CRCA 1UVPA 8ESTE 1GGDC 1V2VT 3FP7E 3LGYA 2GZ7A 1FPHH 2WPIS 1H8ED 1CBWC 3NRLA 1QURH 2CXVA 3RMMH 3N7DA 1EPTC 2QE7D 2PTNA 2BB4A 3DFLA 1ELCA 1ZTKA 3RXUA 3STJA 3AVZA 1P2NA 3GCHC 1GMDG 3VB7A 1O2JA 5GIBA 1EOJA 5A09A 1YYY1 1LVMA 2QYIA 1J15A 1QL9A 3O8CA 4Z1MD 3T26A 3SU2A 1XUJA 4LZ1H 2QC2A 3MNBA 2RA3A 1AUJA 5HMAA 1HAXB 2TGPZ 3OYPA 5DPAA 2ZFRH 4CBOA 1ZJKA 1C5QA 4O9VA 1YLDA 3GY7A 1C5PA 4Y8ZA 3ATMA 3S69A 3PLKA 2BOHB 2ZHFH 1ZTJA 1ZR0A 3L33A 3TK6A 1A7SA 1BTHH 1OPHB 3ESTA 3OAAD 2BM2A 4Y0ZE 1G2LA 1O5EH 3LGVA 3RXHA 3UFAA 1RIWC 2F43B 2ZGJA 1C4Y2 1LHGH 2Z94A 4H4FA 1W2KH 1KIGH 1NFYA 2XBWA 4RT1A 1F5LA 1PPEE 2KZ4A 1BMAA 1MTNC 3NCLA 1K1NA 1SMFE 4A5TS 1Y3VA 2VH0A 2FI5E 1O3GA 2ZWLH 4OS5A 3AAUA 2LNCA 3MH5A 5I25A 3GS9A 1CO7E 3BV9B 2QY0B 3RU4T 4ASUD 3KQ5A 1GDQA 1ELFA 2R3UA 1AZZA 1C2KA 2L6OA 3VB6A 2ZG0H 2VWNA 1VITF 1UVSH 4OS1A 2ZIQH 3A88A 2WV9A 2WSSD 3B23B 3Q00A 1TYNA 3GISB 1QQ4A 1FV9A 2JDID 3U28C 2P93A 3M3TA 1HRTH 1ESAA 5E8EH 2XBXA 4X8SH 1O2UA 5F53A 6CHAC 2ZZUH 1P2QA 1RTKA 5EG4A 3SNAA 3PRBA 3T28A 4FVBA 1GBJA 1FX0B 1G30B 1OS8A 1OWKA 2VB0A 4OS6A 3QDZB 3SGBE 1K1OA 2ZFFH 3CNRA 1S84A 1DANH 3SQHE 1UK2A 1AHTH 3RXEA 1C1PA 1GBFA 4Q4LA 5KGOA 1XUFA 1D4PB 1RTLA 1ZJDA 1NTPA 3ZVEA 1UK3A 3S0NA 5IYTA 3B9FH 3SZEA 1QL7A 1BUIA 2P3TB 4ABEA 4B6FA 1AO5A 4HTCH 4D7GA 1ANBA 1TE0A 3TNSA 1KLJH 2O8MA 2BDGA 4NA7A 4AG2A 1HJ8A 2H9EH 3Q77A 1LTOA 7GCHG 1GHXH 2AHME 3OTPA 3STIA 4H6TA 3T62A 2BDAA 1ELAA 4X6PA 1RTFB 1GJ6A 4FUBA 4IC5A 4NZQA 5EGMA 2BDYA 3RXRA 4OM9A 4QT8C 1DS2E 1GCDA 5IK2D 1B7XB 5FXLA 1HAVB 8GCHG 2ZHQH 4B71A 5DKMA 2Z3CA 2XWAA 1AVXA 1B0EA 3TGJE 3GY4A 3SN8A 1PPZA 1C9PA 1WSSH 1YCPK 1O5FH 3N99A 3SV9A 1XXDA 2G4TA 2G8TA 4Y0YE 1KXCA 2VGCC 4ZUHA 3PMAB 3A7ZA 2D8WA 1O3NA 2JH0D 2PUQH 4NGAH 1A3EH 1E34B 3SV7A 5FPYA 2SGPE 2IOTA 2I6QA 3DFJA 4DT7B 3RC4A 4FUCA 3UWIA 1O37A 1HAHH 3A80A 3L6PA 3EYDA 3BEFB 2UUJB 2ZDVH 3SJKA 1NPMA 1XM1A 3EQ0H 4ZH8A 3RM2H 2FOHA 2A4QA 4ABHA 2CV3A 1HJAB 1ESTA 1MD7A 2CMYA 2GKVE 3SNBA 2CF9H 2ZA5A 5K0HA 2ZDMA 4AGKA 3IWMA 1O3EA 2CN0H 1HAIH 2OQ5A 1HIAB 2QA9E 1DOJA 5JBBS 1DPOA 4R0IA 2OLGA 1TRYA 4FETA 2GMTB 2ZKSA 2ZPSA 5DP9A 2PWXA 1O2WA 1OX1A 1E1QD 1E79D 4FUFA 2HNTF 1DUEA 1HAVA 3UOPA 2ZFSA 1ELEE 1G3BA 1O5CB 1YBWA 1P2KA 1SGFA 1DWBH 3HATH 5EODA 1GGDB 1HYLA 1SGEE 2R0LA 3EA7A 1F7ZA 3VXFH 1FIZA 4K1TA 2GZ8A 1CBWB 1BJUA 5C5NA 3K65B 1EPTB 3QX5H 1TX8A 4LXBH 4XSKU 3RLWH 4ABFA 1GMHG 1MAXA 4K1EA 2GCTC 3M3SA 1GDNA 3GCHB 4K1SA 2Y5GA 3H09A 2SNWA 2VNTA 6GCHF 1GVZA 1FY3A 5C20A 4SGAE 1CA0C 4ZKRU 1C1NA 3JZ2B 2W26A 1G36A 3GDUA 1VR1H 2YNAA 1OOKB 4DG4A 1EASA 2BXUH 3LIWA 3BTTE 2R2MB 1TBZH 1AZ8A 1SR5C 5FL7D 4IMQA 1W0KD 3GCNA 1OWIA 5GCHF 3TJUA 3LKWA 1GI7B 3OTJE 4BAHB 2XWBI 1P01A 1C5XB 3RM0H 1RIWB 1NFXA 3SW2B 4B2BA 4HI3A 1O36A 3RXAA 2FI4E 1SQTA 5FBIA 1UTLM 4ZROA 1MTNB 3OEHD 5ABWA 4WMEA 1TIOA 2AGGX 3RXOA 1T7CA 4MNYA 1GL0E 4R8TB 2IPQX 1CHGA 3EGKH 4JZFH 4B2AA 1DY9A 3M37A 1EPTA 1C5ZB 2BQ7B 1AVWA 1T4VH 1C2MA 1KXFA 1AD8H 4XBCA 1AKSB 2AFQB 1UTKA 5C0UA 1KTTB 1VCWA 4MPUA 3AK5A 1E37B 2JKHA 4X8VH 1HB0B 1MKXH 1ZHRA 2F4LA 3C1KA 1EAWA 4AFZA 1O2ZA 2THFB 2PKAB 3DUXH 4K69A 1CHOG 2FOFA 1YM0A 1BZXE 4D8NA 1CT0E 4BTUB 1PQ8A 3NWUA 1G32B 1FXYA 3MO9A 1QBOA 2LELA 1NC6A 1V2TT 3KIDU 3SORA 2PP6A 6CHAB 1MZAA 1V2PT 1BITA 1T8MA 3RXCA 1XUIA 1XXFA 4X2XA 2P94A 3BIUH 4X2VA 2WZQA 3UAIC 1JRTA 2ZF0H 3T5FH 2ZC9H 3RMOH 3KEEA 1AFEH 2P3FH 2D1JA 2C8YB 3CENA 1PQ7A 3BG8A 3IG6B 1ZZZA 1P3EA 3PMHB 4TWWA 1TPOA 3QUMP 1YPHC 2HWLB 2ZI2H 3MNCA 2C8XB 2KX4A 3L3TA 3T25A 3SUDA 3FO8D 1EJMA 1BB0B 1W0YH 3R3GB 1P2IA 1SGPE 1U6QA 1P0SH 1GPZA 2K1QA 1BMMH 4NZLA 1DFPA 1SKYE 3EAJA 4WH6A 5EQRA 4ZKOU 4X2YA 2JJ2D 4JYVH 2OK5A 2FO9A 1N8OC 4U30A 5FAHA 2VIPA 5HIYA 2B5TB 2BLOA 2JH5D 2ODPA 1NESE 3RXLA 1IQMA 2GP9B 1P9UA 2FPZA 1HJ9A 2OC8A 1A61H 2B7DH 4AYVB 2UWLA 3TNTA 2VGCB 2ZU3A 5T6GA 3BTFE 1BMLA 4CHAC 1C1MA 1YY3A 4ZMAH 4B1TA 1QBVH 1AE8H 3CS7A 1QL8A 1GI1A 1EOLA 4Y7BA 2A7HA 1GHYH 1J8AA 3EE0B 2OBQA 3RXJA 3GY5A 2FXRA 1F0SA 1AIXH 4XBBA 2AYWA 3QZRA 4NA8A 1ELDE 2VIOA 1O2GH 2ZDLA 3FZDA 1O2LA 4IC6A 5DG6A 4DCDA 1TOMH 3V12A 1CGJE 1TB6H 4DVAU 1FN6A 1ETRH 2PGQB 4NA9H 1DLEA 1LO6A 1W14U 1FAKH 4AN7A 1CQQA 3RXBA 5JPMH 1GMCG 1BA8B 2ZECA 4CH8B 4X1PU 4YESB 1P2OA 1NBME 3UPEA 3MU0A 4RI0A 3UR6A 2B0FA 3TU7H 2F9OA 3RC6A 1AN1E 3EA9A 5CE1A 3M7TA 1MTWA 2PR3A 3BTGE 4Y8XA 4WH8A 1C2IA 3WW7A 3RXMA 3LOXA 3P8OA 2J4IA 4IS5A 1FZZA 2G55A 3ZYDA 2XBYA 1QRWA 3M5NA 1O5DH 2F83A 1V2ST 2P3UB 1FMGA 2JH6D 4AB9A 2FS8A 3SU0A 4K8BA 2BDBA 2GCTB 1SLXB 1P12E 1YLCA 4NIWA 1UJ1A 1O2HA 2R9PA 1WQSA 5BPEA 2H9HA 1TGSZ 1FPCH 2FYRA 4WVPE 2QXJA 1GJAB 3M36A 1XUHA 2FOMB 4TWYA 4TPIZ 1FLEE 2FOCA 1EX3A 3EBNA 4YT6H 1ZRKA 1HLTH 1O2VA 3MYWA 1COWD 1D6RA 4ACAA 1QR3E 1S6HA 2ZCHP 1TX6A 3R0FA 2ZGBH 1C4V2 1S6FA 2ZPQA 3H7TA 1Y3XA 1AFQC 3VEQB 4CR9A 1C1QA 1YF4A 2AGIX 2J9NA 4JMYA 2WPDD 1K9OE 7KMEH 2V6NA 2RDLA 1O2MA 1QRXA 1W8BH 4GVUA 1SGTA 4OGYA 1W7XH 3OEED 1GHBG 2R3YA 1UTPA 1ETSH 3GYLB 2W6ID 1C1TA 3TITA 4NFEA 1THSH 3SBKA 2ZO3H 1FY1A 2W3IA 3SU4A 3OX7U 1S81A 3RU4D 2EC9H 1G37A 1BJVA 2BTCE 3ATLA 5K7RA 2ZTYA 3TJNA 1W7GH 1S85A 1EZUC 1XVOA 1C2FA 2TRMA 3RXTA 1UCYH 3KYFA 5J4QA 2NU3E 3GYMA 1EQ9A 3ENSB 4YO9A 1UHBB 1VKYA 4X1RU 1GJDB 2A32A 3URDA 4CREA 1O39A 4XDEA 3V0XA 1SI5H 3TK5A 1PPHE 1MTVA 1NU7B 2GMTC 2PW8H 4A1VA 1FNIA 2XXLA 1C5MD 1V2NT 3ITIA 1AB9C 4JK6A 2HNTC 1O2KA 4KKDA 4WJG2 4BTTB 2DE8A 1E35B 1A0HB 1O2IA 4AFSA 5A8XA 3SNCA 2G5VA 4WF8A 2TPIZ 1SGNE 1VJ9U 2BZ6H 3E91A 1SVPA 1H9IE 4K5ZA 2ODYB 3A87A 1J17T 1UVUH 2GJGA 2ZCKP 4UFFH 3BTWE 1NFUA 2VVUA 5HYOA 3QZQA 3MH4A 2HPQH 3VB5A 1BBRH 5KEDA 1OSSA 1OWDA 3PV5A 2AMQA 1GBEA 2B9LA 1GVKB 5A8ZA 3SV6A 3MO6A 3FANA 1MCTA 2P8OC 3DCLA 1S83A 2W6JD 4O3UA 1AWHB 2ZHEH 3Q3KA 6GCHG 1WDIA 1EZQA 1GHWH 1CT4E 3ODDA 1C5TA 1P2MA 3NK8A 4A7IB 3ODFA 2IJD1 1MKWH 1W10U 3KQDA 1SQAA 2A2QH 1D3PB 2BLWA 1ZGVA 2ZNKH 1V2JT 1F92A 5DP5A 1N8OB 2BD3A 3RXQA 1JRSA 3ZZDA 1L1NA 1TMTH 5GCHG 2Y82A 2A2XH 4OS4A 1SB1H 1P06A 2CGAA 2J34A 2GZ9A 1O3LA 4UFEH 3D23A 2W3KA 5C0TA 1IAUA 4I8LA 4Y76A 5JBTA 1G3EA 2ANKH 3PO1B 1DX5M 3SNEA 1IQGA 2ZU4A 1EUFA 4HFPB 2D26C 5F8XA 1YLNA 1BTPA 1UW7A 1W0ZU 2VIDA 4CHAB 1SPJA 3ZZ9A 2O8UA 2VIQA 3VPKA 3BEUA 3W1EA 5C3NA 1DDJA 3U9AH 1FY5A 2PGBB 4ZXYH 3O8DA 5HIZA 4MNVA 2VJ1A 2OBOA 1C9TA 2VWLA 4D7FA 2GDDA 3QLPH 3I29A 2JETC 2OC7A 1O2OA 4X1QU 4X8UH 3SHAH 3BTHE 2QIQA 3SU5A 3F2FA 1GI5A 3LGWA 2Z9LA 2PUXB 2AS9A 1A5GH 3I77A 1NU9A 1GJBB 2Y7ZA 2KAIB 5JBAS 1ANCA 4Q7YA 1SGCA 3P17H 2XC0A 2ZDAH 3VFEA 1SQRA 1YP9A 1QFKH 2PHBA 3LC3A 4MDSA 1YPJH 2ZQ1A 2L74A 4U2WA 1O30A 4CR5A 1W11U 1BIOA 2G5NA 2ZU5A 1SGDE 4HGCA 1FONA 4I33A 4NWKA 2Z9GA 2ZTZA 4Q7XA 3A81A 3D62A 5DP6A 1WXRA 4B75A 4CBNA 1N1LA 1KSNA 3P6ZB 4INKA 5C1UA 3BN9A 1C2GA 3KGPA 1O5GH 1GDUA 1HXFH 4ISHH 3TPIZ 3U8TH 1MCVA 3PM3A 2VINA 1IQFA 2O8LA 5B6OA 5E2PA 1TNKA 5BRRE 2QF5A 4DGJA 3GDSA 2WINI 5L2ZH 1S0RA 1WQVH 2Q1JA 4LOYH 5ETXA 4I8JA 1NM6A 2A4GA 1EKBB 4YLUA 2J98B 1A0LA 1P2JA 2WUCA 4HG6A 2DUCA 3SUFA 1A2CH 1Z8JB 3MQKC 4BAQB 4INLA 4FUJA 2H5CA 1EB1H 4B74A 3PLPA 1B5GH 2XYAA 1YPKH 4YOGA 1PPGE 1OXGA 2IPHA 4K8YA 5F8ZA 3PTNA 1H1BA 1EJNA 3S9AA 1AFQB 1ZMJA 4OGXA 5TJXA 5AF9H 2BD4A 1GBMA 4H42U 3UUZA 1KXDA 4DT4A 5JYIA 1GJ4H 3DSPA 3F9FA 3TK9A 1FAXA 4X6NA 2H9TH 4J2YB 2FX6A 1H9HE 2BY6X 3BF6H 1C5OH 1GJ7B 1EXFA 1QBNA 4B76A 1F2SE 1WAYB 3U69H 1ZSLA 5E2OA 2EEKA 1DM4B 4Y6DA 4DOQA 4RKOB 4UE7H 3ZZBA 1ZTLA 4O03A 1C2EA 1NN6A 1C4U2 1SHYA 3M35A 1ELGA 3MO3A 4FXGH 1T32A 3ZVAA 1TAWA 2FZZA 4J1YA 2A5KA 2ZTXA 1KLIH 1YPGH 1GG6C 5DJ7A 3DA9B 3LJJA 4YLQH 1NRRH 2J98A 3SZNA 5GDSH 3GY8A 5AFYH 2GV7A 5T1VA 2FIRH 1O3IA 3SOSA 1EATA 3A7TA 4F48B 1QB9A 1CVWH 3GICB 4Q7ZA 3EE7A 1GI9B 2VBCA 2NU4E 2Z9JA 4U01A 4K2YA 2ZGHA 1MMJN 2TGDA 4NIVA 1QIXB 3ZIAD 1DXWA 1AB9B 8LPRA 2J94A 1THPB 3F9EA 4RT0A 1GBBA 2UUFB 1DWEH 2AGEX 2FESH 4UDWH 1KXBA 1NT1A 1QA0A 5T6DA 1DXPA 2V35A 3RXKA 1UVTH 1TWXB 1CA8B 1GI0A 1E1RD 1KYNA 1O3JA 4NIYA 1N6XA 4TY6A 2TGAA 2BLQA 2ZHWH 3MH6A 2EI7A 4HZHA 7LPRA 2XW9A 3RLYH 1V2MT 2FOEA 1WYKA 3U1JB 2B8OH 1Z1JA 1OWHA 1P9SA 1RJXB 1LMWB 4E7NA 2C8ZB 4ZHLU 2CHAC 4P02A 1MTUA 1NBMD 2KCOA 3AAVA 2P8OB 1GMDF 7ESTE 1TA6A 2KM0A 3ATWA 3K6YA 1E0FD 3QGJA 1TBRH 4FVDA 1K1IA 1HIAA 3RP2A 1MAYA 1K0HA 1WOFA 1Z1IA 2F9BH 3HKJB 3ZVGA 5C1XA 1IQLA 2FS9A 4IN1A 2UUYA 3S9BA 1QA7A 3T29A 4ZXXH 3F0OA 3KQBA 2WPJS 1DE7H 3SQEE 1C1VH 5DO4H 1GBDA 2NWNA 4TSFD 6ESTA 2NU0E 3U8RH 1UTOA 1TGNA 4FU9A 4JZEH 2G81E 3A84A 2SGEE 1NRQH 4RN6A 2ZFPH 1RXPA 1EFRD 1FY8E 3PWCA 3RXVA 1IQNA 3WWFA 4TY7A 2C93B 1BDAA 1C5NH 1F5KU 2VVVA 5AHGH 4I32A 1V2OT 1SGIB 2AERH 5EW2H 4BAOB 5GNDA 3QGNB 1TNJA 1UK4A 5TCCA 2JETB 5C2ZA 5F6MA 2A4RA 2ZPRA 1N6YA 2OD3B 1D3QB 4JZ1A 1DSUA 5HXFA 2XTTB 2BQ6B 1YPMH 2STBE 3LJOA 4DY7B 1Z8GA 1O5BB 1XUGA 1J14A 2A0QB 3BIVH 1C1OA 1F0RA 2FLRH 1GL1A 2UWOA 1A4WH 1GJ5H 4X8TH 3ZZ5A 3MWIU 3MOCA 3FZZA 4X6MA 3V7TA 2A45B 4A1TA 2ZQ2A 4JZDH 1A0JA 1AI8H 3OSYA 1Z8IB 5ESTE 2RDEA 2QF3A 2ILNA 3A83A 2Q6GA 4JZIA 1V2RT 1LVYA 3SI3H 2O8TA 3TGIE 5EXNA 3NXPA 1PFXC 1KMHB 4X6OA 1GJ8B 1HV7A 1C1RA 3LGTA 2AH4X 2Z9KA 1AKSA 1GBCA 3A86A 1PJPA 2OC1A 2CK3D 1Z6JH 3EA8A 4OS2A 2Q6DA 2ALVA 4RSPA 1TABE 2XC5A 2PKAA 1KXAA 1LDTT 2FTMA 3UNSA 5CHBA 4OS7A 5A0CA 1GI6A 2ZFQH 3CP7A 4Q80A 4ZKNU 1HXEH 4I31A 3PROA 4AYYB 3ELAH 4Y79A 4CRGA 2GT8A 5HKKD 3NKKA 1HUTH 1ANDA 4GCHF 2PV9B 2Y7XA 3RC5A 1H8HD 4AX9H 1C2LA 3PO1C 3PV4A 2HVYB 1M9UA 4KTCA 4BAMB 3NPSA 4Y11E 1UTNA 8KME2 1TFXA 5ESBA 1YPLH 5JDUB 1Q2WA 3OFND 3RUOA 3F9GA 1VJAU 2BHGA 1ZOMA 1GHVH 4FUGA 1BCUH 2A1DB 4WY3A 1GG6B 1P09A 4INHA 4ZCNA 1ZHPA 5EU8A 2HLCA 1XVMA 1ELBA 1W13U 1AU8A 3RDZA 3FKSD 3T27A 1S82A
chains in the Genus database with same CATH topology
1Y5AT 3URCA 1NY22 1L2EA 3E16B 1LHCH 1OYQA 1O2SA 4DW2U 1RS0A 1JMOH 1C2HA 1O5AB 1TPAE 1VITG 4XE4A 1HDTH 2BLVA 2FLBH 2QV1A 1AWFH 1GHZA 1WTHD 1P11E 1TGBA 2O8WA 1TRMA 4M7GA 5FHTA 4B2CA 1L0ZA 1FY4A 1EJAA 1TMUH 3E3TA 4NG9H 5LGOA 3GOVB 5E0HA 2AMPA 2BD2A 4X2WA 2HALA 4KTUA 2J92A 1NROH 2BDCA 2Q6FA 1UTQA 4O3TA 1JIRA 1HAYB 4ISOA 1V2WT 4WXVA 4Y7AA 1IQKA 2O9QA 3MFJA 1K1JA 4O97A 4JYTA 1GI8B 5AFZH 2VIWA 4Y71A 3KQCA 2SGFE 1QJ7B 5A0BA 2GVFA 2OINA 5F8TA 5T3HA 5AVDA 1C5UA 2QXHA 1NFWA 9LPRA 1C5YB 2BDIA 2CHAB 4Z0KA 1GMHF 5SGAE 4B73A 1TOCB 2BVSH 3UTUH 1HPGA 1LHDH 2ANYA 3M7UA 2ZFTA 2W7SA 2FI3E 1C5SA 3SU6A 2IN2A 3FP6E 1EZSC 1YKTA 1PPCE 1IQHA 2BY7X 4I8HA 1S0QA 4D9QA 1KDQB 2PFEA 2WV5A 5DP3A 1IHSH 3BTEE 4NFFA 2Y5FA 1D6WA 2BY5X 1O32A 3HKIB 2OXSA 1BHXF 3PMBB 4X1SU 1BHXB 3C27B 3GY6A 2QXIA 4NSYA 3FFGA 3QK1A 1TGTA 2PSYA 3K9XB 3TLOA 1O2RA 5CHAC 3QO6A 4TYDA 2G4UA 4UFDH 1BTZA 1SBWA 2ZHDA 1O2NA 1SLWB 1LVOA 3VGCC 5G4BA 1MQ6A 2Z9IA 1FI8A 5L30H 3S7KB 2ZEBA 1FJSA 5TCAA 1YCPH 3ZVCA 4AOQA 1O3AA 4Q2KA 5EOKA 3LGUA 4KP0A 2YNBA 3A8AA 1SGYE 1JOUB 1GBAA 5C67A 3SNDA 4NIXA 4NWLA 4WWYA 3V3MA 1H9LB 3E90B 3MI4A 3ZZ6A 1WUNH 1O3CA 2CJIA 4BOHA 3BG4C 1HAGE 2FODA 1MKXK 5EPYA 1K1PA 5EPNA 1Z7KA 1HAPH 1O2QA 1DWDH 1LQDB 1QJ6B 2FYQA 1TQ0B 2Y80A 1TGCA 1SFIA 3PMJA 2F91A 5HM2A 3T2NA 1EP6A 4NSVA 1CHOF 1PQAA 2W5EA 1ZPBA 1GBTA 1D3TB 1HFDA 1OP2A 1S5SA 1ZMNA 1AY6H 1KLTA 4DJZB 1CE5A 1GBIA 3QTOH 4MNXA 1ARCA 4IGDA 1Y3UA 3HPTB 1C1SA 4THNH 3MMGA 1C5VA 1T8LA 4KELA 1K28D 2P16A 2Z3DA 2QCYA 1AQ7A 1Y5UT 3O8RA 1O3DA 1AUTC 2BZAA 4U32A 1O3HA 1W12U 2F9UA 3F6UH 2A7JA 3BSQA 1JBUH 1MBMA 1RRKA 1UHBA 2Y81A 3BTKE 2FEQH 2GV6A 2FM2A 1UTMA 1EB2A 2V0BA 1TNLA 1SGRE 2D2DA 1V2UT 3E8LA 4BXSA 1BRBE 5EW1H 4NCYA 3QTVH 3S7HB 3RXFA 4X0WU 4Y8YA 1F0TA 1P03A 2WPKS 3NUMA 1GI2A 3HK6B 5FPSA 1BMNH 2G51A 1PYTC 1WCZA 1LPGB 2Z3EA 4BTIB 3RXPA 1O38A 1KY9A 2HGTH 5A8YA 2BDHA 1PPBH 4ZHAA 3LU9B 2F9PA 1H4WA 3SJIA 5A0AE 1A46H 1DICA 4MQAA 3P92A 1AVGH 2BX4A 2R0KA 1ZSJA 1DT2A 1NRSH 4E06H 1ZRBA 3ZVBA 3QWCH 1GBKA 2J2UA 3GY2A 1TQ7B 1TPPA 2GCHF 3H5CB 2ZDKA 4TPYA 1SFQB 3ZVDA 2HOBA 1G2MA 2F9NA 3A8BA 4UEHH 1MD8A 2H2ZA 3UNRA 1BTYA 5FPTA 2ALPA 1GVLA 1KTSB 1B0FA 2V3HH 1PPFE 1PQ5A 1TALA 3DD2H 2SGQE 2ASUB 2F9VA 5FBEA 4BAKB 2H5DA 2LPRA 3BEIB 1WBGB 4FUHA 9ESTA 1XKAC 2QN5T 1EZXC 1O34A 5DP7A 1ETTH 2AEIH 1O33A 3K6ZA 3OY5U 3PYHA 1GHAF 2BYAX 3P8NA 1ZPCA 3A8DA 2V3OH 1TX7A 4K3JA 2A31A 1ZGIA 1GMCF 1OKXA 2XBVA 1T8OA 2GGVB 2J38A 5FCRA 1OP0A 1EP5A 2XC4A 3LDXH 3U1IB 2GTBA 3HGPA 1BQYA 2WYJA 2OP9A 4CRFA 3AASA 3SUGA 3SI4H 3UIRA 1NZQH 2EI6A 2NU2E 2BOKA 4GSOA 1Y3WA 1TA2A 1DY8A 3G01A 4YT7H 3M7QA 3AW1A 2Z6BD 4MLFB 1QNJA 3EDXB 3P95A 3PB1E 2FDAA 3A7XA 3FVFB 3SHCH 3BTME 3PLBA 3DHKH 1A3BH 2SNVA 3F1SB 1DWCH 4MVNA 2P95A 2AIPA 4RKJB 2KAIA 3A7WA 2QXGA 3HK3B 1XKBC 4WMDA 1ELVA 1TBQH 2P59A 4ZAEA 5H4IB 2XCNA 4BXWA 5CHAB 1CGHA 4I8GA 1HAOH 3MU4A 1V3XA 3RU4E 1ABJH 3ZV9A 1IHTH 1P02A 3MH7A 1A1RA 3VGCB 2F3CE 2FTLE 3B8JA 2A7CA 1V2LT 3Q76A 4GCHG 5E0GA 1YGCH 3GY3A 1GHBF 2WPMS 3SO3A 4GUXA 3A7YA 1EAIA 2EA3A 1TNIA 5I46H 2PKSB 1GJCB 4X1NU 2H1UA 1UCYK 1ARBA 3ZVFA 2BD8A 1DVAH 3BG4B 1LPKB 1OWJA 1SLVB 1OWEA 2BMGB 3GCOA 3CS0A 4AG1A 3A7VA 1QRZA 3GCTF 1ZYOA 1RGQA 2VIVA 4KTSA 3RXDA 1O0DH 1XX9A 3W95A 2J95A 1L4DA 2UWPA 1O3FA 2VVCA 3TH2H 5IDKA 5GXPA 2C8WB 2Z7FE 2AMDA 3DT0H 2ANWA 1J16A 3BTQE 1Y5BT 2BQWB 1A5IA 2GX4A 4DURA 4ABGA 1BTWA 1QJ1B 3ATKA 1QCPA 4XOJA 4AB8A 5DP8A 1ID5H 1GBLA 1ZHMA 2GDEH 1NRNH 4ZKSU 3ZZ4A 2RG3A 1YPHE 3UNQA 2W7UA 3Q3XA 3RMLH 4E7RG 1C1UH 5T6FA 2IJOB 1H8DH 3SJ9A 1KXEA 1BBRK 3P8FA 5EXLA 1ANEA 4ASHA 3ZZAA 1AE5A 1ORFA 1MU8B 4F4OC 1NO9H 2FOBA 3VB3A 1QTFA 3D65E 3ZZCA 4GHTA 1O31A 1LQEA 3A89A 3KCGH 3KF2A 1T8NA 1XUKA 3BTDE 1RD3B 5GWZA 2C90B 5DGJA 3ZV8A 1BTXA 4YZUA 2FMJA 1MKWK 1INCA 2NU1E 3F68H 2ZU2A 3RXGA 3OY6U 1PYTD 3SGAE 1V6DA 3ZZ7A 4VGCC 3M5OA 2GT7A 3MNSA 2BY8X 5HGGA 3MHWU 1X7AC 3ATIA 2HRVA 1Y3YA 3IITA 5EQQA 2H6MA 1FUJA 4WXIA 4JK5A 1IOEA 3GDVA 1SG8B 2BD7A 3PTBA 1BTUA 1NRPH 3UOUA 4D9RA 1T31A 3H7OA 3UQVA 4IW4E 3LONA 3M5MA 3JZ1B 1ESBA 3NZIA 5J4SA 1P57B 2R2WU 2XRCA 4ABAA 4WMFA 4GLYA 1QGFA 1HGTH 3MU1A 3QN7A 2VH6A 1O35A 4FUEA 1P10A 2FP7B 1F0UA 3UY9A 3FAOA 3SU1A 1P04A 1G3DA 1UCYE 3MTYA 4A1XA 2ESTE 1C5RA 2AIQA 4K60A 1L4ZA 1C1WH 1TNHA 3SGQE 3M3VA 1C2JA 3E0PB 1WU1A 1UVOA 1SSXA 1LHEH 4ABBA 1QB1A 3KQEA 2C3SA 3Q3YA 1BT7A 2BXTH 1A5HA 1Z6EA 6LPRA 1MTSA 1CU1A 4CRBA 1GCTC 2TBSA 2WPHS 2YOLA 3FP8E 4I8KA 1O3BA 1HCGA 1W3CA 5JBCS 1C2DA 1GI3A 4GHQA 1ZPZA 1P3CA 1VZQH 3TGKE 2Y6TA 1DSTA 5CMXH 3UREA 2ZCLP 1VGCC 1XMNB 1GJ9B 4LK4A 2FOGA 4A6LA 1MBQA 1BOQA 1MUEB 2BVRH 2HVXA 4ISLA 4CRAA 3VXEH 2XCFA 1VCPA 5EQSA 3SV2H 1BBRE 1HBTH 3KHVA 5GPIB 4BANB 2WUBA 1ZSKA 2GD4B 3OU0A 3RMNH 3LH3A 3UQOA 1H8IH 2A4OA 2BD9A 1LPZB 5LH8A 5LPRA 2OCVB 1GWAA 4CH2B 1D3DB 4ISIH 1TONA 1CT2E 2PLXA 5LPEA 4UD9H 1OYTH 4JCNA 1T4UH 5DK1A 2WYGA 4ABIA 4Y10E 5C1YA 2ULLA 7GCHF 3F9HA 4MTBA 2ZGCA 4PROA 1IQIA 2OC0A 3V13A 1TMBH 1DLKB 1FQ3A 3KL6A 4XBDA 2SGDE 3E0NB 1E38B 3TIUA 2SFAA 1GBHA 1ZLRA 3P70B 1RFNA 2OUAA 8GCHF 2ODQA 3TH3H 4FUDA 1GI4A 3LT3A 1K2I1 4MPVA 2RA0A 1Z71A 4JYUH 4MG3A 1WV7H 2DE9A 3TVJB 3TJVA 5FCKA 1JXPA 3LH1A 4IBLH 4MPXA 4GAWA 2C4FH 2HPPH 4ISNA 1SC8U 2LIZA 3SUEA 3PWBA 4XFQA 2I6SA 3MU8A 1VCQA 3M61U 1O3MA 4MNWA 5FX5A 1SLUB 1P8VC 1V2KT 1EAUA 3I78A 1E36B 1L1GA 4ZHMU 2GCHG 5C5OA 1LVBA 4YOJA 3RXIA 1IQEA 1QHRB 2G00A 2HNTE 4UFGH 1TNGA 1YCPM 2FX4A 4Z6AH 4BNRA 2G52A 1G3CA 4H6SB 3UWJH 2VU8E 1D9IA 1WTGH 5HM9A 4AFUA 3SJOA 1Z8RA 1F5RA 2K7XA 2RCEA 1HAZB 2BVXH 2TGTA 1Q31A 4SGBE 3A82A 1K1MA 5F03A 1IQJA 4GPGA 1GHAG 1SL3A 5E0JA 1SQOA 1Y59T 2A5AA 1EAXA 3UR9A 3TH4H 1AGJA 3E1XB 3E6PH 1O2PA 3LPRA 5L6NH 1AMHA 1DITH 4AORA 5L2YH 4YOIA 3W94A 1K1LA 4IN2A 2CF8H 2ZP0H 4MPWA 4DIIH 5GJ4B 1ACBE 1LHFH 2ZU1A 4ABDA 1TPSA 2VWMA 1C5LH 1SOTA 2ZDNA 3MNXA 2QGRA 1CSOE 5DP4A 3SV8A 2BY9X 2PTCE 3KNXA 3ZZ3A 3AW0A 5LPFA 3U8OH 1CA0B 4YM9A 1LKBA 1HNEE 1Y8TA 2VWOA 1O3KA 1SOZA 4VGCB 3MU5A 1JWTA 3WY8A 4ESTE 4F49A 1O3PB 1L1JA 1G9IE 2Y5HA 4A92A 1MQ5A 1THRH 2OTVA 1C5WB 1TLDA 4UONA 4E05H 4FUIA 1TRNA 5JB8S 3VB4A 3M5LA 2TIOA 5EXMA 2QAAA 3ZZ8A 1ABIH 1O2XA 1O2YA 1UTJA 4IMZA 1YC0A 1FDPA 4KGAA 2PSXA 3TJOA 1DUAA 1QQUA 4AZ2B 1UMAH 1SHHB 1J9CH 4FU7A 1SGFG 2FWWA 2PKSC 4FU8A 4D76A 1YPEH 1K21H 1O3OA 2BX3A 1K22H 3A85A 3N7OA 2XNIA 3D49H 1OP8A 1QY6A 3S9CA 1ZMLA 2ZGXH 2ANMH 1P05A 3LGIA 2FOAA 1BRCE 1FN8A 4YTAA 5A2MH 2QF0A 4DIHH 1FIWA 1VITH 1ELTA 3A8CA 3U98H 3LC5A 1UO6A 3HGNA 1HJAC 4I7YH 1JIMA 2WV4A 1KDQA 1O2TA 5FX6A 2OQUA 1MU6B 5JB9S 2WPLS 3SU3A 1NS3A 3GCTG 3K2UA 3KN2A 4AGJA 1LCYA 4LZ4B 1SGQE 3SJ8A 4ABJA 2M5TA 1GCTB 1Q3XA 1MZDA 2BD5A 2A5IA 1BRUP 3RXSA 1LKAA 1MH0A 1CGIE 1BRAA 2STAE 1V2QT 4AFQA 5PTPA 1QB6A 3ZYEA 3O8BA 1VGCB 2EI8A 3P8GA 2UUKB 2SGAA 4CRCA 1UVPA 8ESTE 1GGDC 1V2VT 3FP7E 3LGYA 2GZ7A 1FPHH 2WPIS 1CBWC 1QURH 2CXVA 3RMMH 1EPTC 2PTNA 2BB4A 3DFLA 1ELCA 1ZTKA 3RXUA 3STJA 3AVZA 1P2NA 3GCHC 1GMDG 3VB7A 1O2JA 5GIBA 1EOJA 5A09A 1YYY1 1LVMA 2QYIA 1J15A 1QL9A 3O8CA 3T26A 3SU2A 1XUJA 4LZ1H 2QC2A 3MNBA 2RA3A 1AUJA 5HMAA 1HAXB 2TGPZ 3OYPA 5DPAA 2ZFRH 4CBOA 1ZJKA 1C5QA 4O9VA 1YLDA 3GY7A 1C5PA 4Y8ZA 3ATMA 3S69A 3PLKA 2BOHB 2ZHFH 1ZTJA 1ZR0A 3L33A 3TK6A 1A7SA 1BTHH 1OPHB 3ESTA 2BM2A 4Y0ZE 1G2LA 1O5EH 3LGVA 3RXHA 3UFAA 1RIWC 2ZGJA 1C4Y2 1LHGH 2Z94A 4H4FA 1W2KH 1KIGH 1NFYA 2XBWA 1F5LA 1PPEE 1BMAA 1MTNC 3NCLA 1K1NA 1SMFE 4A5TS 1Y3VA 2VH0A 2FI5E 1O3GA 2ZWLH 4OS5A 3AAUA 2LNCA 3MH5A 5I25A 1CO7E 3BV9B 2QY0B 3RU4T 1GDQA 1ELFA 2R3UA 1AZZA 1C2KA 3VB6A 2ZG0H 2VWNA 1VITF 1UVSH 4OS1A 2ZIQH 3A88A 3B23B 3Q00A 1TYNA 3GISB 1QQ4A 1FV9A 2P93A 3M3TA 1HRTH 1ESAA 5E8EH 2XBXA 4X8SH 1O2UA 6CHAC 2ZZUH 1P2QA 1RTKA 5EG4A 3SNAA 3T28A 4FVBA 1GBJA 1G30B 1OS8A 1OWKA 2VB0A 4OS6A 3QDZB 3SGBE 1K1OA 2ZFFH 1S84A 1DANH 3SQHE 1UK2A 1AHTH 3RXEA 1C1PA 1GBFA 1XUFA 1D4PB 1RTLA 1ZJDA 1NTPA 3ZVEA 1UK3A 3S0NA 5IYTA 3B9FH 1QL7A 1BUIA 2P3TB 4ABEA 1AO5A 4HTCH 4D7GA 1ANBA 1TE0A