5C5OA

Structure of sars-3cl protease complex with a phenyl-beta-alanyl (s,r)-n-decalin type inhibitor
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
300
structure length
300
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-like proteinase
publication title Fused-ring structure of N-decalin as a novel scaffold for SARS 3CL protease inhibitors
rcsb
source organism Human sars coronavirus
total genus 88
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 5c5oA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5c5oA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5c5oA02
2QXIA 3RXFA 2O9QA 1O5EH 1OWEA 1J8AA 2DE9A 2TGPZ 4ZH8A 2NU2E 3T26A 1NFXA 1N1LA 2FOCA 5JDUB 2ZU5A 3LC5A 5GXPA 3M3SA 1IQKA 3NCLA 3MI4A 4YOGA 1P11E 2BY9X 3RM2H 4ESTE 4GLYA 1O3EA 3D23A 4BXSA 1KTTB 3B8JA 2STBE 1G37A 2F83A 4FUHA 1GMDG 1KSNA 3RU4T 1SGQE 1OWDA 3KQCA 1CA0B 5DP5A 1THSH 1N8OB 5C5OA 1DY8A 1UTQA 2FO9A 2CXVA 2ZCHP 4OS1A 1HXEH 2FI3E 2ZDLA 1O3GA 3GYMA 3NWUA 1GBDA 4DJZB 4WMDA 3UFAA 2J4IA 1EKBB 5C1XA 1O2ZA 1C5WB 1JBUH 3CP7A 1C1MA 1ZTLA 1YLCA 3SGBE 4WWYA 1GBIA 3LKWA 1YC0A 1W2KH 2K1QA 3UUZA 2F9PA 1L4DA 5A8ZA 1EXFA 2C3SA 1O3LA 3PWCA 4A1XA 3E8LA 1F5KU 4K1SA 4JZIA 1SGYE 1ELDE 3UWJH 1C9PA 1LPGB 2R2WU 3AAUA 3RXMA 4ISHH 1GI5A 1GJDB 5H4IB 1AGJA 1TGNA 4MVNA 4HGCA 3KCGH 2Z9JA 3LGIA 5A8XA 3ATLA 2A32A 3RXIA 1ABIH 2TPIZ 4I8GA 3SW2B 2BD5A 1GHZA 1MBMA 1SFQB 3TH4H 1DSUA 1Z71A 4LZ4B 3GYLB 5E2OA 1GJ9B 1LVMA 5L2YH 1QBNA 1GHBF 1LCYA 1EP6A 5TCCA 1AIXH 2FXRA 4CRGA 1JOUB 4AGJA 3RP2A 4JMYA 1NC6A 3BTEE 1OYTH 2H9TH 2B0FA 3RMMH 4UFEH 2BZ6H 2YOLA 2ALVA 1PPGE 4HZHA 3E3TA 4UD9H 1IQHA 1XVMA 4CRAA 1Z6EA 5GIBA 2M5TA 3LIWA 3ZZBA 2OBQA 2ZDNA 1XXDA 2VINA 3ZVDA 2FS8A 4XFQA 5EOKA 2GT7A 3VFEA 1G36A 3BG4B 3SBKA 1X7AC 2JETB 5F8ZA 4U2WA 1EZSC 1QQ4A 3QZRA 3VPKA 1IQFA 1FNIA 2F3CE 2ZPRA 1BCUH 3E16B 3GY7A 2Z6BD 2ZHDA 4X1PU 3EBNA 1O2RA 1O3KA 1QB9A 1CU1A 1AQ7A 2SFAA 1D3QB 3SU6A 4IN1A 1MU8B 1CT4E 1NFUA 2SGEE 3QO6A 1GI2A 3A80A 4SGBE 2UWPA 3MNCA 4NG9H 3ZZ5A 5K0HA 1GBEA 3E90B 3ODFA 1HAIH 1TNIA 4IGDA 1FN6A 1NFWA 4X8TH 2GMTB 3M61U 2TGAA 3A81A 1TABE 1GI9B 1O2YA 1BRAA 4AOQA 4ZHLU 2B9LA 1ZGVA 3JZ2B 3BTWE 1PPFE 4DIHH 1ZR0A 2GCHG 5EQRA 5J4QA 2H5CA 2CHAC 1QBVH 1SBWA 2P93A 1CHGA 3SU1A 2ZDKA 4CR9A 1EAXA 2WV5A 1HAGE 2HGTH 4BTIB 1QIXB 3P8GA 3RXEA 1OSSA 2R0LA 4UFGH 1L4ZA 1DXWA 1C1RA 4CRFA 1UTJA 4WY3A 1GJ4H 1O30A 4K8BA 1ZJKA 3P8OA 5C20A 4AFUA 1C5YB 4F49A 1GVKB 1TRYA 3HGNA 4ZXXH 1WSSH 5ABWA 1O38A 1O3CA 2P95A 1O3PB 1B7XB 3O8DA 1O2MA 2GDDA 2G4UA 4O97A 1O2IA 3SZNA 1QGFA 1XMNB 3KNXA 1F0UA 1GL1A 3U8TH 3S0NA 2SGFE 1W7GH 2VIDA 1PPZA 4FU7A 1QR3E 4ABEA 2VIQA 1KXFA 1UCYH 1O3OA 3M36A 1P2OA 1FY4A 5EQQA 4JK5A 2NU0E 3PM3A 1LHEH 3LGYA 4K1TA 1P9UA 4NA7A 3RXPA 2ZFTA 3TPIZ 2XCNA 2WUCA 3HK6B 1BTZA 1GPZA 2OTVA 3QLPH 3SNCA 1NU9A 3MO3A 1O2QA 2GZ9A 1EASA 1K1LA 1K2I1 1IQNA 2QA9E 4B76A 4K2YA 3SJOA 1YPEH 2BD4A 2PW8H 1GHAG 1UJ1A 2BQ6B 4IMZA 1IHSH 2ZTXA 2ZQ1A 3Q76A 3ZVBA 1O32A 2XRCA 3P8NA 2BHGA 5EPNA 1ELBA 2GV7A 1K9OE 3F6UH 3QDZB 5C67A 2XNIA 4B1TA 1JWTA 2ZU1A 5JPMH 4YESB 5HM9A 4FUIA 2SGDE 2VIVA 3EA7A 4DCDA 1IQLA 1ESAA 1GI4A 3HK3B 5L30H 1C1UH 2ZFSA 2VB0A 3AVZA 2D1JA 1DLEA 3A7XA 2OP9A 3LOXA 1MTWA 4U32A 2ILNA 2VIOA 4X8VH 1LHCH 2Q1JA 1F7ZA 4KELA 3AAVA 1GG6C 1Y5UT 4Q7XA 2FTMA 1ARBA 6LPRA 1XM1A 1GBMA 1DWCH 1K1JA 1HJAB 1RIWB 2FWWA 2AIPA 1F5RA 2OQ5A 1O3IA 1SG8B 1TBQH 4J1YA 1SLVB 2ZDAH 1YPLH 2G51A 4A1TA 1MTUA 1XUJA 3SUGA 4Y79A 1BTUA 3Q3XA 1LPZB 1UTKA 1Q3XA 1ESTA 2HPQH 1C5SA 4BAQB 3HATH 1HIAB 1V2ST 1DFPA 3GDUA 3BEIB 1L1NA 2FESH 1XUHA 4XE4A 3ZZCA 3B23B 1C5NH 4ZROA 1BMLA 3LDXH 4CR5A 3F9FA 1ZTKA 5C2ZA 1W11U 1FPCH 2Y82A 4NIWA 1P01A 4O3TA 2C8YB 1WBGB 1Y8TA 1O3AA 3ATMA 3KQBA 4TWYA 1EJAA 1XVOA 3GY3A 1BT7A 1TWXB 4DOQA 2EI7A 2FIRH 1TPSA 5F03A 3KQDA 1VITF 2VWLA 4K1EA 3GY6A 3KEEA 3SU5A 1C1NA 1W0ZU 1ANCA 3TH3H 4YM9A 2EA3A 1T4UH 1VGCC 2D2DA 1HAYB 1VCWA 2TGDA 2F9OA 2A7JA 3SUDA 1KLIH 1PYTD 1YPMH 2CF8H 1RJXB 1UMAH 1V2MT 3BEUA 1G2LA 1LMWB 4ABDA 1GDQA 1SFIA 3I78A 2V35A 2BB4A 1V2VT 1HAOH 3GDSA 1CBWB 1FY5A 3DA9B 4WVPE 1EX3A 7GCHG 4X6MA 1K1NA 4ABIA 4CRDA 5JBBS 2PGQB 1D3DB 1RRKA 3A7VA 4WJG2 1V2JT 1QA0A 4H6TA 3P17H 3GOVB 2VIWA 1O3FA 1TBZH 2Z9GA 1AWHB 4X6OA 3LH3A 4YOIA 2ZU3A 2WINI 4X6NA 2JH6D 2P3TB 2OUAA 3PWBA 4U01A 2AMDA 2ZIQH 1QA7A 1NS3A 4WXIA 2XBYA 2VGCB 3EQ0H 2JKHA 2AEIH 4YZUA 5BPEA 2WPKS 2BZAA 1LVYA 3MU4A 2ASUB 2Y80A 1QJ7B 1O2WA 2FMJA 3HPTB 3M7UA 1YLDA 3ZVFA 1T8MA 2TRMA 3BTQE 2Z94A 4HI3A 1GVLA 1S82A 3CENA 1M9UA 3EAJA 1S5SA 1GBLA 2EC9H 1ELGA 3NXPA 3S9CA 1TMBH 2P3FH 1UTMA 2BXTH 2HALA 5B6OA 3LJJA 4X0WU 4D76A 1EAWA 3SJIA 1UO6A 2BY6X 3G01A 3TJOA 1SI5H 4ISNA 4JZDH 2JH0D 2DE8A 2OC0A 1MH0A 2H1UA 1TB6H 3U1IB 2HWLB 3SHCH 1DDJA 1C1OA 1TFXA 3LGWA 2AMPA 1J15A 4GAWA 4Y11E 5FPSA 2XBVA 1C2KA 1UCYE 2OBOA 3SUFA 5A8YA 1SB1H 3ZZ7A 2PV9B 1W3CA 3QWCH 3KF2A 2O8UA 1TGSZ 3EE0B 1C5ZB 2IPHA 1FMGA 2PTCE 4I8JA 3M5LA 4O03A 2SNWA 4FUFA 1O2TA 3GCOA 1WTGH 1ABJH 4CRCA 5E0JA 4B71A 3SQEE 3VGCC 2CV3A 5GCHF 3RXAA 2GX4A 1QFKH 1ESBA 3RXKA 2I6QA 4AG2A 2ZWLH 1WTHD 1O39A 2ULLA 1KDQB 2ZG0H 1S6FA 2ZFFH 2BOHB 3UQOA 1BJVA 2Y6TA 4U30A 5E8EH 4FU8A 1TGTA 3SJKA 1YM0A 3FZZA 3OY6U 1JRTA 4UFFH 2Y7XA 1MAYA 4YTAA 3V7TA 1PJPA 4AB9A 1T32A 3P95A 2FTLE 2ZEBA 3KIDU 2FI5E 1QB6A 2ZFQH 2V3HH 4M7GA 4VGCC 1DWBH 4DT7B 3MH6A 4MTBA 1E35B 3U8OH 1G3DA 3P6ZB 4FXGH 1Y3XA 2THFB 2ZI2H 1VCQA 2O8MA 3A7YA 1W12U 1O5DH 4MNVA 1A0LA 1GDNA 2EI8A 2ZCLP 4WF8A 1HXFH 4AFZA 2Y5GA 5DP4A 4GUXA 1LKBA 4RSPA 3AASA 4KP0A 2FLBH 3TGKE 1TPPA 3E1XB 2R3YA 1BIOA 1C1TA 1C2MA 1O2LA 1SL3A 3UPEA 1P06A 1BMNH 1GJBB 2FYQA 4AORA 5EG4A 2UUFB 3UY9A 4XDEA 1ZSLA 1TPOA 2O8LA 2A4QA 3SI4H 1QQUA 1D6WA 1F2SE 1C9TA 4DG4A 2QXGA 3PMAB 1GL0E 3KQEA 1XUGA 4A92A 1TONA 3E91A 3OX7U 2W3KA 5C3NA 1NO9H 1YCPK 2HPPH 1ZSKA 3SI3H 3MYWA 2SNVA 4CREA 2QV1A 1E38B 2ZF0H 2VWOA 3VB4A 1MZAA 2OXSA 1O2OA 2Z3CA 1A0JA 2A2XH 4Y7BA 1LQDB 4BOHA 5GJ4B 1YKTA 1HNEE 9LPRA 1C1SA 1CQQA 2AGGX 4IS5A 4KTUA 3SV6A 3ENSB 3MU5A 3BN9A 3STJA 2K7XA 2PKAB 3S7HB 1G3EA 2W7SA 4BTUB 3K6YA 3T62A 1C1PA 1AD8H 2LNCA 5JB8S 3QK1A 3T29A 1WYKA 2VJ1A 1ELCA 1C5TA 4K69A 3O8BA 5E0GA 2HNTE 2JH5D 7KMEH 4NIYA 1K1PA 3BTME 4MLFB 3A8DA 4I7YH 4IC6A 1KTSB 3GY2A 2ZGBH 1AZZA 3A84A 1HCGA 5FHTA 1CT2E 4MG3A 4O9VA 1O5GH 4JYUH 3O8CA 1C5UA 3SJ9A 1F92A 2LPRA 2GKVE 5ESBA 5LPFA 1SGCA 4A5TS 2ZP0H 1GMDF 1NRPH 3A89A 1GMHG 4NWLA 4UFDH 1N6YA 1TX6A 1E36B 1C5PA 1T31A 3HKIB 4JYVH 4UEHH 4Y6DA 4WH6A 3P70B 1FDPA 5E2PA 4JYTA 2GZ7A 1FPHH 1HAXB 2AIQA 4DVAU 1ZRBA 1QJ1B 4X2YA 1EP5A 1BTYA 1P12E 4FUBA 1P09A 3E6PH 2BMGB 1DS2E 4I33A 4Y0ZE 3FP6E 2BVRH 1W8BH 1DUAA 4FVDA 3PTNA 4E7NA 3RXJA 3S9BA 2CHAB 5C1UA 3ZZDA 8GCHG 4RKOB 2FOAA 1GGDC 2Q6FA 3SQHE 3ATKA 4ZKNU 2QN5T 3TNTA 4LK4A 4CBNA 2G55A 2NU3E 1MMJN 1HJ8A 2D8WA 2QF0A 2FOBA 4AN7A 1C2FA 3BTKE 1C2EA 1N8OC 4ZKOU 1C5XB 2Z3DA 1O36A 2QF3A 4OS4A 5DP6A 4D8NA 1GBKA 4NZLA 2B5TB 2SGPE 5E0HA 2VWMA 1NN6A 3UNRA 3CS7A 1VCPA 1EATA 3K65B 4MPXA 1C2IA 3KL6A 1MKXK 1O2VA 3GY8A 4OS5A 4E06H 1HYLA 1VJ9U 1ZSJA 4RKJB 4MNXA 4X1SU 3RXCA 4DW2U 2XWBI 1SOTA 4B75A 3LH1A 1O2GH 2BYAX 5C5NA 2WPJS 1SGPE 3LC3A 1YYY1 4GHQA 2BDIA 2Y81A 4FUCA 1YGCH 3D62A 1YPHC 4E05H 2BDBA 1ZRKA 1SHYA 1ZGIA 1DPOA 1UVTH 2ANYA 3EA8A 2W26A 5HM2A 4JZ1A 1QB1A 1BRBE 4QT8C 3OSYA 2HNTF 3BIUH 2BVXH 4INLA 4WXVA 1HDTH 2ODQA 2ZC9H 4GVUA 3IWMA 3ZVGA 1BHXF 5FPYA 4Y7AA 2J38A 1EAIA 1O2XA 2EI6A 1A61H 2PUQH 4TY7A 1DOJA 1BBRK 2FX6A 3ATIA 3R0FA 1T8LA 2QXJA 1IQMA 1C2JA 5K7RA 2C93B 1O2NA 2PTNA 2A2QH 1LHFH 2F9BH 3M5OA 3RXUA 1EB2A 1O3DA 3ZZAA 2ZO3H 3MO9A 3E0NB 4MPVA 1QY6A 2GCHF 2AS9A 4NGAH 1W14U 1TPAE 1SGIB 2ZU2A 1K21H 1ORFA 1AWFH 1BRCE 4ZUHA 1HAPH 4JZFH 4INKA 1BMMH 4GSOA 1ETTH 1AY6H 2ALPA 2OD3B 2BX4A 3MWIU 1H9HE 4XSKU 1GBFA 1PYTC 2XC4A 3A82A 4THNH 1MD8A 1IQEA 3Q77A 5FAHA 5A2MH 4JZEH 4Q7YA 3MH7A 3MH5A 2Q6GA 1TNKA 4K5ZA 3T2NA 1TOCB 3UNSA 5JBTA 1F0RA 2PKSC 2IN2A 3K9XB 3S9AA 3A86A 1Y5BT 5PTPA 1AO5A 3MO6A 6ESTA 1CHOF 3T25A 1SGRE 2C8ZB 1GHWH 2R2MB 3BTTE 5EW2H 2FI4E 2H9HA 4LOYH 2GMTC 2ESTE 1DITH 3QTVH 1TMTH 3ATWA 2G81E 4Y10E 2GTBA 4D9QA 1P2KA 1SC8U 4B74A 1W7XH 4ISLA 4ABGA 1H4WA 3S69A 1WU1A 3ZZ4A 1E37B 1O33A 1V2LT 3F68H 1L1JA 3V13A 5GDSH 2PWXA 3LJOA 2P3UB 3VEQB 1QTFA 3EGKH 1FY8E 1P2JA 2R9PA 1C4Y2 1VR1H 4Q7ZA 2J92A 1VGCB 2VIPA 1SLWB 1IQGA 4D7GA 1PPEE 1ELFA 1UTNA 2FOFA 3NKKA 1V2UT 3GCHC 1FUJA 4IC5A 5I25A 1A4WH 4K8YA 2BOKA 3BTGE 4Q80A 1QURH 1C1QA 2A7HA 1SR5C 1AE8H 5AF9H 2AYWA 4AZ2B 4BAMB 1F0TA 2Y5HA 4HFPB 4GCHG 2Z7FE 1NY22 2ZTYA 5AVDA 5F8TA 1NT1A 4AB8A 1CE5A 1GCTC 1TA2A 3GY4A 1V2QT 1TGBA 1SHHB 4AGKA 1UVSH 2OC7A 5EU8A 2WYGA 4ZMAH 3A7ZA 3MNXA 1MQ6A 1T8OA 4BAOB 1G2MA 3ELAH 1Z8IB 1VITG 1NRRH 1Y5AT 2WV4A 1TLDA 3MMGA 4MNWA 4Y8YA 2ZDMA 1AFQC 2ZDVH 4HTCH 2ZHEH 2V3OH 3UOUA 2AH4X 4ZHMU 2ZGHA 3RMOH 4FUEA 5DP8A 1KXEA 2BLWA 2BQWB 3RXQA 2YNAA 1AMHA 3S7KB 1RGQA 1WUNH 4AFQA 3SV2H 1O3NA 1OP2A 1OKXA 1Z7KA 1XUFA 1SGTA 2XWAA 1QCPA 3BIVH 1MTNC 4ISOA 2J94A 3ITIA 4B2CA 3PMBB 1NESE 3RU4E 5I46H 3DT0H 1P9SA 1DXPA 5CHAC 5DP9A 2OLGA 3PLPA 1ACBE 3IITA 3SV7A 2GP9B 5AHGH 1OP0A 1P02A 2BD8A 2XW9A 2GV6A 1S84A 1E34B 3M7QA 1C2DA 3ODDA 2BDHA 3KGPA 5GPIB 3L3TA 1ZZZA 2J2UA 1O2SA 1UVOA 3M7TA 3GCTG 2XC5A 2GDEH 1HPGA 4NSVA 1O5AB 1XX9A 5TCAA 5EXNA 3MHWU 2PSYA 1AUTC 1FIWA 5EGMA 5EW1H 7GCHF 5LPEA 4X2WA 2A7CA 3D49H 1EPTC 1EOLA 4YLUA 3VGCB 2NU1E 1EJMA 4X2XA 1A7SA 2A4RA 1GBCA 1V2PT 1GDUA 2FLRH 2VNTA 1EJNA 3DFLA 1MCTA 2Z9IA 1MBQA 1TX7A 1HLTH 1Y3UA 4Y8ZA 5AFZH 4AX9H 3PLBA 4JCNA 4OS7A 1QJ6B 2EEKA 1B0FA 3L6PA 1BZXE 3L33A 3V12A 5DP7A 1A2CH 2TIOA 3URDA 1DSTA 1AHTH 3TK6A 1H8DH 3RXHA 3RU4D 2GCTC 1HAVB 2BD7A 1P04A 2W5EA 1O37A 1CVWH 1O2KA 3PO1C 4IW4E 1PQ5A 3VB5A 4VGCB 2P8OC 4YT6H 1RXPA 1NRQH 3M35A 1ZOMA 3LONA 2BDGA 1S0RA 3SGQE 2PR3A 2VU8E 1Z8RA 4OS2A 1JIRA 1MZDA 5T6FA 2ZGCA 1Z1JA 3ZZ8A 4ZKRU 1TIOA 2QYIA 1UK2A 1GI7B 1NM6A 3PROA 1JMOH 1XXFA 4YO9A 4NZQA 1XUKA 1IHTH 1QBOA 1PFXC 2G5NA 5LGOA 2B8OH 4WMFA 1P10A 1FV9A 1GI6A 1TE0A 3GDVA 4ABJA 1SMFE 2H6MA 3OTJE 3ZV8A 2AGEX 1W0YH 4Y71A 4LXBH 4ZXYH 3I77A 3E0PB 1F5LA 1QRXA 2WPIS 1LDTT 1TOMH 1GWAA 1TMUH 4IBLH 1BITA 1Z8JB 2VVVA 3ZYDA 6GCHG 1ID5H 3A7TA 1YPGH 3I29A 2GVFA 1A5HA 1GJ5H 1S85A 4YT7H 3RXLA 5G4BA 4KKDA 1ETRH 1AN1E 3RUOA 4X1NU 1HIAA 1ELTA 1ARCA 1MCVA 3QX5H 2H9EH 1V3XA 1TYNA 1HBTH 2VH6A 4B73A 1HRTH 2SGQE 3T27A 1Y3WA 3SJ8A 3DFJA 2Y7ZA 3JZ1B 3BTFE 5JBAS 3TU7H 2ZHFH 1AB9C 1EQ9A 1LKAA 4XBBA 1GJCB 1L0ZA 3BF6H 1UK4A 1V2KT 1OP8A 4CHAC 3FVFB 3RDZA 5FBIA 1CGIE 1GBHA 4ZKSU 1C1WH 3BEFB 2FOMB 2OC8A 2YNBA 3GISB 4NFEA 5T6GA 1Z1IA 1MQ5A 5FX6A 1V2RT 2A31A 1N6XA 3SU0A 2J34A 4KTSA 4K60A 4WH8A 2P59A 4AFSA 5DPAA 3MTYA 1WCZA 2GT8A 5IDKA 1C5LH 1WOFA 2P16A 4BNRA 3RXBA 3LU9B 1V2WT 1GI1A 3TJNA 3UNQA 2WYJA 5DGJA 2B7DH 2ZHWH 5EODA 2A4GA 2FZZA 1LTOA 4BTTB 3SHAH 2ZKSA 1G30B 1DVAH 5F6MA 1VITH 4DGJA 3A8CA 2ZNKH 1V2TT 4IN2A 2Z9LA 1V6DA 2Z3EA 4NIXA 5FCKA 2ANKH 4FUJA 2PLXA 3WY8A 1FJSA 4DURA 1SLXB 3TNSA 5T6DA 4RN6A 1TALA 1Y3YA 1INCA 1BUIA 1MU6B 1K1OA 4UDWH 1OX1A 3V0XA 5A0BA 1QL9A 3LPRA 1TNHA 1C4U2 1BMAA 1V2OT 3MU1A 5JBCS 1O2JA 1GHYH 2BLQA 1O2HA 1EB1H 1GMCF 2H2ZA 1EZQA 1ZMJA 1PPCE 4O3UA 2Y5FA 4AYVB 3TGIE 2BD3A 1SQAA 3LGVA 1GGDB 1SGFG 3A7WA 5L2ZH 1SGDE 1HAVA 2CGAA 3FP8E 3RM0H 3BTDE 2BD2A 6CHAC 1O0DH 1Y59T 2UUYA 1AUJA 1QNJA 1T7CA 2UUJB 1MD7A 5EXMA 3FANA 1VJAU 3UOPA 3LT3A 2ZPQA 3SGAE 1HB0B 1K28D 1S81A 2CMYA 1CA8B 1KXDA 2FOEA 1HJ9A 1HV7A 1PPHE 2FDAA 2G5VA 9ESTA 5DKMA 2ODPA 1V2NT 1FAKH 1THRH 1EZXC 4NWKA 3NUMA 1GHBG 1SQOA 1DWDH 2XYAA 3R3GB 3W94A 2ZGJA 4H6SB 4FUDA 5JB9S 1YCPH 3HKJB 2C8WB 1J14A 2FX4A 1ZLRA 5EXLA 1K1IA 1O35A 2WPHS 1K1MA 1KXCA 1KDQA 3T5FH 1DWEH 1J16A 1RFNA 2UUKB 3RLYH 3RLWH 2ZPSA 2QCYA 3RC6A 1A3EH 4GHTA 5GWZA 3K2UA 4UE7H 1GMHF 1AE5A 3AW0A 1FAXA 2TGTA 8ESTE 3TVJB 2QC2A 1JRSA 3TITA 1NRSH 3KHVA 3GICB 1ANBA 3NK8A 4TPYA 1BTXA 2P94A 3U1JB 1CA0C 3O8RA 2NU4E 2RCEA 3ZYEA 1A5GH 1Z6JH 1O3BA 2C90B 2BDYA 4ZHAA 1FZZA 1CGJE 5J4SA 1IQJA 1C2HA 2GD4B 1C5MD 2FOGA 1TRNA 4Y76A 4DY7B 1H1BA 2XBWA 1ETSH 3OU0A 2WUBA 2RA0A 1ELVA 2VWNA 3A87A 3F1SB 2XC0A 4D9RA 8LPRA 1QL8A 3FFGA 8GCHF 3BG8A 4Z0KA 2SGAA 3Q00A 5EQSA 1SLUB 1RTKA 3TK9A 2G8TA 2ZCKP 4OS6A 1P03A 3RXDA 5A0AE 3BSQA 1UCYK 2RDLA 3BV9B 1PQAA 4X8SH 3NZIA 1O2PA 4ABAA 1P2QA 1D6RA 2QY0B 1DICA 2ANMH 4Y8XA 1RD3B 1BTHH 1HFDA 3MH4A 1BDAA 3EYDA 5FX5A 1KLJH 5FPTA 5BRRE 1SVPA 2O8TA 3MNSA 2PKSB 1JXPA 1BTWA 1NFYA 2I6SA 3QUMP 3RMNH 4K3JA 1BRUP 5FBEA 3U98H 2A5AA 1VZQH 2Z9KA 1C4V2 1ANDA 3F9EA 4XBCA 1EZUC 1FIZA 1DUEA 3C1KA 1KXAA 5HXFA 2BXUH 3URCA 1DY9A 1KYNA 1TX8A 2OQUA 5LH8A 3H7OA 3SV8A 2G52A 4Q2KA 3VXFH 4NSYA 2FPZA 2PGBB 1A0HB 2F9NA 2LIZA 1TA6A 3V3MA 3TK5A 1GI8B 1NRNH 2PKAA 1AVGH 3AW1A 2RA3A 1GJ6A 4ABHA 2QAAA 4CH2B 4ASHA 1G9IE 2KAIB 3PB1E 1DE7H 1OWHA 2PHBA 2BDAA 4AG1A 5DJ7A 3UR6A 1P05A 3A83A 1TNLA 1J9CH 3PMHB 5FCRA 1O5FH 1GBAA 1P2MA 1G3CA 1AU8A 1TNGA 3BG4C 2H5DA 4Z6AH 1GJ8B 2G4TA 2JETC 4X1RU 3M37A 1GG6B 1MKXH 1YP9A 3GCHB 5DO4H 4B2BA 1CHOG 1BQYA 2WPLS 2Q6DA 3TGJE 3SUEA 1TBRH 2BLVA 2BLOA 2FYRA 4BXWA 3B9FH 1AKSB 1MTVA 3RC4A 1QL7A 2NWNA 1WAYB 1H8IH 1Z8GA 2WPMS 4ISIH 1LHDH 5FXLA 3T28A 1YPHE 4F4OC 1ANEA 4YOJA 1CSOE 1XKBC 1GCTB 1BA8B 1YF4A 5JYIA 1KIGH 1IOEA 5L6NH 1Y3VA 3DUXH 7LPRA 1OWIA 2V6NA 2FODA 1W10U 4XBDA 4TWWA 3NPSA 3RXGA 1T4VH 1L2EA 2XBXA 2J95A 1AFQB 1GCDA 1P3CA 1JIMA 1BBRH 2ZECA 2QIQA 3EDXB 1LHGH 2ODYB 1ZTJA 3PV4A 5LPRA 1GHAF 4OGYA 2F91A 4GPGA 4MNYA 4R8TB 2ZFPH 5DG6A 2UWLA 2VVCA 1SSXA 1MTNB 2R3UA 1ZYOA 1Q2WA 1H9IE 4INHA 3TLOA 2HOBA 4BAHB 3K6ZA 2ZA5A 5CHAB 1O3MA 1A5IA 1GJ7B 1NU7B 5HGGA 1B5GH 3SN8A 1MAXA 3VB6A 3VXEH 4I8KA 3STIA 4LZ1H 3A8AA 1P2IA 2ZTZA 2BY8X 1C5OH 3LGUA 3BTHE 1EUFA 3FP7E 4NIVA 3F9GA 1WQSA 4NA9H 2OINA 5A09A 1DANH 1EAUA 1KXBA 2AGIX 2IOTA 1CO7E 2A5KA 1DT2A 1MUEB 2FP7B 2IJOB 3QGJA 2W7UA 1BB0B 1TGCA 1W13U 2F9VA 1TNJA 5DK1A 1XUIA 3MU8A 3RXSA 1MTSA 2UWOA 5TJXA 5HMAA 1H9LB 1QRWA 4FVBA 1GI0A 3MFJA 2A45B 2ZHQH 3SU4A 1LVOA 1EPTB 3MOCA 2HRVA 5IYTA 4GCHF 4BANB 1UHBB 1DM4B 1TRMA 1SPJA 1S0QA 1UTPA 5EPYA 1IQIA 1FLEE 3UTUH 3QN7A 1UK3A 3A8BA 4MPUA 4ABBA 2RG3A 1U6QA 4AYYB 4CRBA 2C8XB 2GCTB 1XKAC 4OGXA 3SNEA 3RXRA 1A1RA 1K22H 1F0SA 3PO1B 2CF9H 4YLQH 4H4FA 1KLTA 4NFFA 3MU0A 2P8OB 4D7FA 2CJIA 1T8NA 3SNAA 1LPKB 2HLCA 1OPHB 4I31A 2KAIA 2BD9A 2QGRA 1NROH 4KTCA 4I32A 1CGHA 3TH2H 4Y0YE 2R0KA 3MNBA 1SQTA 2QXHA 3ZZ6A 1HJAC 1RIWC 4XOJA 3TJVA 3PTBA 4B2AA 1SGNE 4X1QU 1BOQA 1UTLM 1C5RA 3GY5A 2CN0H 1FXYA 3TJUA 1OXGA 2V0BA 4MPWA 1ZHMA 1UTOA 3U69H 2XCFA 4A6LA 5C1YA 1O31A 2J9NA 3SU2A 2OC1A 3GCNA 3ZVCA 1D3PB 1S6HA 2DUCA 2C4FH 3M3TA 3SORA 1C2LA 3RMLH 3U8RH 1AFEH 1AKSA 3PLKA 3C27B 5F8XA 3RC5A 4H42U 1ZMLA 3H7TA 1RTLA 3SU3A 1LQEA 4KGAA 3RXTA 2A4OA 3SOSA 4FUGA 1HGTH 1O5CB 1HAHH 4BAKB 1GBTA 3PMJA 2BVSH 1P3EA 4JK6A 3UR9A 2AMQA 1C5VA 3GCTF 2D26C 1NPMA 3HGPA 2GZ8A 2BQ7B 3SNBA 1UVPA 1ZPBA 2FM2A 3CS0A 3ZVAA 5CMXH 3F9HA 2PSXA 1ZPZA 2AERH 3OY5U 1S83A 1D4PB 1YCPM 1SGEE 1AB9B 1SOZA 2ZU4A 5ESTE 1BTPA 3TIUA 1YBWA 2ANWA 5CE1A 4CHAB 1AVXA 1FI8A 4X2VA 1AVWA 1TQ7B 1PQ8A 4IMQA 1CBWC 4ABFA 1KY9A 1GHXH 8KME2 1O2UA 3D65E 5T3HA 3H5CB 7ESTE 5GCHG 1J17T 4I8HA 2STAE 1FQ3A 2XTTB 1HUTH 1L1GA 3UIRA 1D3TB 1BJUA 1EOJA 4I8LA 3ESTA 3M5MA 3DHKH 4J2YB 1GVZA 3W95A 1P57B 1P0SH 1LVBA 2BY7X 3SV9A 2ZFRH 2BX3A 1GI3A 1ZPCA 1BHXB 2FEQH 2ZGXH 2VH0A 1FN8A 2VGCC 1TQ0B 2W3IA 2VVUA 3M3VA 1OYQA 1A46H 2ZQ2A 3N7OA 1P8VC 3KN2A 1QHRB 3ZVEA 2AFQB 1MKWK 1O5BB 1FY3A 2BM2A 4TYDA 4NCYA 3RXOA 4X8UH 1THPB 1PPBH 1TAWA 3P8FA 1FONA 2XXLA 2A1DB 4A1VA 1NZQH 1RS0A 1BBRE 3EA9A 1YPJH 1C1VH 3ZV9A 1OS8A 4X6PA 2PUXB 5HYOA 1CT0E 5A0CA 4R0IA 1EPTA 4TY6A 4UONA 1ELAA 1QRZA 1HAZB 1O3HA 1C2GA 2FOHA 3QTOH 1O34A 1PQ7A 1LO6A 1UHBA 3Q3KA 4CH8B 3A85A 1DLKB 1AZ8A 1G3BA 4TPIZ 6GCHF 2F9UA 1OOKB 5ETXA 3UREA 3OYPA 4A7IB 1WQVH 1GBJA 1GBBA 1P2NA 1SGFA 2O8WA 3A88A 3U9AH 4DIIH 3UWIA 3VB7A 5AFYH 1ZHPA 5DP3A 1ELEE 3VB3A 4FU9A 3QZQA 2HNTC 4E7RG 6CHAB 3IG6B 3FZDA 3DD2H 2GGVB 4MQAA 1AI8H 2A0QB 4SGAE 2A5IA 3RXVA 2BY5X 3UQVA 1IAUA 4CBOA 1O3JA 1B0EA 3SNDA 3FAOA 3LGTA 1GHVH 2TBSA 1ZHRA 3SO3A 3ZZ3A 4PROA 2OCVB 3PYHA 2BDCA 2G00A 1ZMNA 1OWKA 1NTPA 3P92A 1YPKH 3Q3YA 1RTFB 4MDSA 2BTCE 2HVXA 1FY1A 2FS9A 1UVUH 4WMEA 1GJAB 1G32B 1MKWH 1Q31A 1D9IA 3ZZ9A 4NA8A 1E0FD 1GMCG 1ZJDA 2ZZUH 5SGAE 3QGNB 1A3BH 2PFEA 1C5QA 1DX5M 3M5NA 4ZAEA 1WV7H 1OWJA
chains in the Genus database with same CATH superfamily
3KYFA 2QXIA 3RXFA 2O9QA 1O5EH 1COWD 1OWEA 1J8AA 2DE9A 2TGPZ 4ZH8A 2NU2E 3T26A 1NFXA 1N1LA 2FOCA 2WPDD 2ZU5A 3LC5A 5JDUB 5GXPA 3M3SA 1IQKA 3NCLA 3MI4A 4YOGA 1P11E 2BY9X 3RM2H 4ESTE 4GLYA 2KZ4A 1O3EA 3D23A 5KEDA 4BXSA 1KTTB 3B8JA 2STBE 1G37A 1QZ8A 2F83A 4FUHA 1GMDG 1KSNA 3RU4T 1SGQE 1OWDA 3KQCA 1CA0B 5DP5A 3OAAD 1THSH 1N8OB 5C5OA 1DY8A 1UTQA 2FO9A 2CXVA 2J97A 2ZCHP 4OS1A 1HXEH 2FI3E 2ZDLA 1O3GA 3GYMA 3NWUA 1GBDA 4DJZB 4WMDA 3UFAA 2J4IA 1EKBB 5C1XA 1O2ZA 1C5WB 1JBUH 3CP7A 1C1MA 1ZTLA 1YLCA 3SGBE 2L6OA 4WWYA 1GBIA 3LKWA 1YC0A 1W2KH 2K1QA 3UUZA 2F9PA 1L4DA 5A8ZA 1EXFA 2C3SA 1O3LA 3PWCA 4A1XA 3E8LA 1F5KU 4K1SA 4JZIA 1SGYE 1ELDE 3UWJH 1C9PA 3DSPA 1LPGB 2R2WU 5CHBA 3AAUA 3RXMA 4ISHH 1GI5A 2RDEA 1GJDB 5H4IB 1AGJA 1TGNA 4MVNA 4HGCA 3KCGH 2Z9JA 3LGIA 5A8XA 3ATLA 2A32A 3RXIA 1ABIH 2TPIZ 4I8GA 3SW2B 1WDIA 1GHZA 1MBMA 2BD5A 1SFQB 3TH4H 3ZIAD 1DSUA 1Z71A 4LZ4B 3GYLB 5E2OA 1GJ9B 1LVMA 5L2YH 1QBNA 1GHBF 1LCYA 1EP6A 5TCCA 1AIXH 2M2AA 2FXRA 4CRGA 1JOUB 4AGJA 3RP2A 4JMYA 1NC6A 4B6EA 3BTEE 1OYTH 2H9TH 2B0FA 3RMMH 4UFEH 2BZ6H 2YOLA 2ALVA 1PPGE 4HZHA 3E3TA 4UD9H 1IQHA 1XVMA 4CRAA 1Z6EA 5GIBA 2M5TA 2IJD1 3LIWA 3ZZBA 2OBQA 2ZDNA 1XXDA 2VINA 5DSFA 3ZVDA 2FS8A 4XFQA 5EOKA 2GT7A 3VFEA 1G36A 3BG4B 3SBKA 1X7AC 2JETB 5F8ZA 4U2WA 1EZSC 1QQ4A 3QZRA 3VPKA 1IQFA 1FNIA 2F3CE 2ZPRA 1BCUH 3E16B 3GY7A 2Z6BD 2ZHDA 4X1PU 3EBNA 1O2RA 1O3KA 1QB9A 1CU1A 1AQ7A 3SZEA 2SFAA 5KGOA 1D3QB 3SU6A 4IN1A 1MU8B 1CT4E 1NFUA 2SGEE 3QO6A 1GI2A 2HLDD 3A80A 4SGBE 2UWPA 3MNCA 4NG9H 3ZZ5A 5K0HA 1GBEA 3E90B 3ODFA 1HAIH 1TNIA 4IGDA 1FN6A 1NFWA 4X8TH 2GMTB 3M61U 5DN6D 2TGAA 3A81A 1TABE 1GI9B 1O2YA 1BRAA 4AOQA 4ZHLU 2B9LA 1ZGVA 3JZ2B 3BTWE 1PPFE 4DIHH 1ZR0A 2GCHG 5EQRA 5J4QA 2H5CA 2CHAC 1QBVH 1SBWA 2P93A 1CHGA 3SU1A 2ZDKA 4CR9A 1EAXA 2WV5A 1HAGE 2HGTH 4BTIB 1QIXB 3P8GA 3RXEA 4DT4A 1OSSA 2R0LA 4UFGH 1L4ZA 1DXWA 2J98B 1C1RA 4CRFA 1UTJA 4WY3A 1GJ4H 4RI0A 3PRBA 1O30A 4K8BA 1ZJKA 3P8OA 5C20A 4AFUA 1C5YB 4F49A 1GVKB 1TRYA 3HGNA 4ZXXH 1WSSH 5ABWA 1O38A 1O3CA 2P95A 3EE7A 1O3PB 1B7XB 3O8DA 1O2MA 2GDDA 2G4UA 4O97A 1O2IA 3SZNA 1QGFA 1XMNB 3KNXA 1F0UA 1GL1A 3PV5A 3U8TH 3S0NA 2SGFE 1W7GH 2VIDA 1PPZA 4FU7A 1QR3E 4ABEA 2VIQA 1KXFA 1UCYH 1O3OA 4ZCNA 3M36A 1P2OA 1FY4A 5EQQA 4JK5A 2NU0E 3PM3A 1LHEH 3LGYA 4K1TA 1P9UA 4NA7A 3RXPA 2ZFTA 3TPIZ 2XCNA 2WUCA 3HK6B 1BTZA 1GPZA 2OTVA 3QLPH 3SNCA 1NU9A 3MO3A 1O2QA 2GZ9A 1EASA 1K1LA 1K2I1 1IQNA 2QA9E 4B76A 4K2YA 3SJOA 1YPEH 2KR7A 2BD4A 5EJLA 2PW8H 1GHAG 1UJ1A 2BQ6B 4IMZA 4ASUD 1IHSH 2ZTXA 2ZQ1A 3Q76A 3ZVBA 1O32A 2XRCA 3P8NA 2BHGA 5EPNA 1ELBA 2GV7A 1K9OE 1YLNA 3F6UH 3QDZB 5C67A 2XNIA 1K0HA 4B1TA 1JWTA 2ZU1A 5JPMH 4YESB 2JJ1D 5HM9A 3OEED 4FUIA 2SGDE 2VIVA 3EA7A 4DCDA 1IQLA 1ESAA 1GI4A 3HK3B 5L30H 1C1UH 4XRNA 2ZFSA 2VB0A 3AVZA 2D1JA 1DLEA 3A7XA 2OP9A 3LOXA 1MTWA 4U32A 2ILNA 2VIOA 4X8VH 1LHCH 2Q1JA 1F7ZA 4KELA 3AAVA 1GG6C 1Y5UT 4Q7XA 2FTMA 1ARBA 6LPRA 5C94A 1XM1A 1GBMA 1DWCH 1K1JA 1HJAB 1RIWB 2FWWA 2AIPA 1F5RA 2OQ5A 1O3IA 1SG8B 1TBQH 4J1YA 1SLVB 2ZDAH 1YPLH 3DSGA 2G51A 4A1TA 1MTUA 1XUJA 3SUGA 4Y79A 1BTUA 3Q3XA 1LPZB 1YWUA 1UTKA 1Q3XA 1ESTA 2HPQH 1C5SA 4BAQB 3HATH 1HIAB 1V2ST 1DFPA 3GDUA 3BEIB 5EIYA 3KYGA 1L1NA 2FESH 1XUHA 4XE4A 3ZZCA 3B23B 1C5NH 4ZROA 1BMLA 3LDXH 4CR5A 3F9FA 1ZTKA 5C2ZA 1W11U 1FPCH 2Y82A 4NIWA 2W6ID 1P01A 4O3TA 2C8YB 1WBGB 1Y8TA 5C17A 1O3AA 3ATMA 3KQBA 4TWYA 1EJAA 1XVOA 3GY3A 1BT7A 1TWXB 4DOQA 2EI7A 1KMHB 2FIRH 4OM9A 1TPSA 5F03A 1NBME 3KQDA 1VITF 2VWLA 4K1EA 3GY6A 3KEEA 3SU5A 1C1NA 1W0ZU 1ANCA 3TH3H 4XD7D 2EA3A 4YM9A 1T4UH 1VGCC 2D2DA 1HAYB 1VCWA 2TGDA 2F9OA 2A7JA 3SUDA 1KLIH 1PYTD 4F55A 1YPMH 2CF8H 1RJXB 1UMAH 1V2MT 3BEUA 1G2LA 1LMWB 2J98A 4ABDA 1GDQA 1SFIA 3I78A 2V35A 2BB4A 1V2VT 4AC9A 1HAOH 3GDSA 1CBWB 1FY5A 3DA9B 4WVPE 1EX3A 7GCHG 4X6MA 1K1NA 4ABIA 4CRDA 5JBBS 2PGQB 1D3DB 1RRKA 3A7VA 4WJG2 1V2JT 1QA0A 4H6TA 3P17H 3GOVB 2VIWA 1O3FA 1TBZH 2Z9GA 1AWHB 4X6OA 3LH3A 4YOIA 2ZU3A 2WINI 4X6NA 2JH6D 3OTPA 2P3TB 2OUAA 3PWBA 4U01A 2AMDA 2ZIQH 1QA7A 3DSOA 1NS3A 4WXIA 2XBYA 2VGCB 3EQ0H 2JKHA 2YMSC 2AEIH 4YZUA 5BPEA 2WPKS 2BZAA 1LVYA 3MU4A 4HG6A 2ASUB 2Y80A 1QJ7B 1O2WA 2FMJA 3HPTB 3M7UA 1YLDA 3ZVFA 1T8MA 2TRMA 3BTQE 2Z94A 4HI3A 1GVLA 1S82A 3CENA 1M9UA 3EAJA 1NBMD 1S5SA 1GBLA 2EC9H 1ELGA 3NXPA 3S9CA 1TMBH 2P3FH 3OE7D 2LP6A 1UTMA 2BXTH 2HALA 5B6OA 3LJJA 4X0WU 4D76A 4Z1MD 1EAWA 3SJIA 1UO6A 2BY6X 3G01A 3TJOA 1SI5H 4ISNA 4JZDH 2JH0D 2DE8A 2OC0A 1MH0A 2H1UA 1TB6H 3U1IB 2HWLB 3SHCH 1DDJA 1C1OA 1TFXA 3LGWA 2AMPA 1J15A 4GAWA 4Y11E 5FPSA 2XBVA 1C2KA 1UCYE 2OBOA 3SUFA 5A8YA 1SB1H 3ZZ7A 2PV9B 4P00A 1W3CA 3QWCH 3KF2A 2O8UA 1TGSZ 2KFWA 3EE0B 1C5ZB 2IPHA 1FMGA 2PTCE 4I8JA 3M5LA 4O03A 2SNWA 4FUFA 1O2TA 3GCOA 1WTGH 1ABJH 4CRCA 5E0JA 4B71A 3SQEE 3VGCC 2CV3A 5GCHF 3RXAA 2GX4A 1QFKH 1ESBA 3RXKA 2I6QA 4AG2A 2ZWLH 1WTHD 1O39A 2ULLA 1KDQB 2ZG0H 3AK5A 1S6FA 2J5UA 2ZFFH 2BOHB 3UQOA 3WWFA 1BJVA 2Y6TA 4U30A 5E8EH 4FU8A 1TGTA 3SJKA 1YM0A 3FZZA 3OY6U 1JRTA 4UFFH 2Y7XA 1MAYA 4YTAA 3V7TA 1PJPA 4AB9A 1T32A 3P95A 2FTLE 2KM0A 2ZEBA 3KIDU 2FI5E 1QB6A 2ZFQH 2V3HH 4M7GA 4VGCC 1DWBH 4DT7B 3UAIC 3MH6A 4MTBA 3F0OA 1E35B 3H09A 1G3DA 3U8OH 3P6ZB 4FXGH 1Y3XA 2THFB 2ZI2H 1VCQA 2O8MA 3A7YA 1W12U 3FO8D 1O5DH 4MNVA 1A0LA 1GDNA 2EI8A 2ZCLP 4WF8A 1HXFH 4AFZA 2Y5GA 5DP4A 4GUXA 1LKBA 4RSPA 3AASA 2L74A 4KP0A 2FLBH 3TGKE 1TPPA 3E1XB 2R3YA 1BIOA 1C1TA 1C2MA 1O2LA 1SL3A 2F43B 3UPEA 1P06A 1BMNH 1GJBB 2FYQA 4AORA 5EG4A 2UUFB 3UY9A 4XDEA 1ZSLA 1TPOA 2O8LA 2A4QA 3SI4H 1QQUA 1D6WA 1F2SE 1C9TA 4DG4A 2QXGA 3PMAB 1GL0E 3KQEA 1XUGA 4A92A 1TONA 3E91A 3OX7U 2W3KA 5C3NA 1NO9H 1YCPK 2K0QA 2HPPH 1ZSKA 3SI3H 3MYWA 2SNVA 4CREA 2QV1A 1E38B 2ZF0H 1YY3A 2VWOA 3VB4A 1MZAA 2OXSA 1O2OA 2Z3CA 1A0JA 2A2XH 4Y7BA 1LQDB 4BOHA 5GJ4B 1YKTA 1HNEE 9LPRA 1C1SA 3VG8A 1CQQA 2AGGX 4IS5A 4KTUA 3SV6A 3ENSB 3MU5A 3BN9A 3STJA 2K7XA 2PKAB 3S7HB 1G3EA 2JJ2D 2W7SA 4BTUB 3K6YA 3T62A 1C1PA 1AD8H 2LNCA 5JB8S 3QK1A 3T29A 1WYKA 2VJ1A 1ELCA 1C5TA 4K69A 1W0JD 3O8BA 5E0GA 5EJZA 2HNTE 2JH5D 7KMEH 4NIYA 1K1PA 3BTME 4MLFB 4RT1A 3A8DA 4I7YH 4IC6A 1KTSB 3GY2A 2ZGBH 1AZZA 3A84A 1HCGA 2JDID 5FHTA 1CT2E 4MG3A 4O9VA 1O5GH 4JYUH 4M9FA 3O8CA 1C5UA 3SJ9A 3F0PA 2V7QD 1F92A 2LPRA 2GKVE 5ESBA 5LPFA 1SGCA 4A5TS 2ZP0H 1GMDF 1NRPH 3A89A 1GMHG 4NWLA 4UFDH 1N6YA 1TX6A 1E36B 1C5PA 1T31A 3HKIB 4JYVH 4ACAA 4UEHH 4Y6DA 1UW7A 4WH6A 3P70B 1FDPA 5E2PA 4JYTA 2GZ7A 1FPHH 1HAXB 2AIQA 4DVAU 1ZRBA 4Q63A 1QJ1B 1MABB 4X2YA 1EP5A 1BTYA 1P12E 4FUBA 1P09A 3E6PH 2BMGB 1DS2E 4I33A 4Y0ZE 3FP6E 2BVRH 1W8BH 1DUAA 4FVDA 3F2GA 5EJ1A 3PTNA 4E7NA 3RXJA 3S9BA 2CHAB 5C1UA 3ZZDA 8GCHG 4RKOB 2FOAA 1GGDC 2Q6FA 3SQHE 3ATKA 4ZKNU 2QN5T 3TNTA 4LK4A 4CBNA 2G55A 2NU3E 1MMJN 1HJ8A 2D8WA 2QF0A 2FOBA 4AN7A 1C2FA 3BTKE 1C2EA 1N8OC 4ZKOU 1C5XB 2Z3DA 1O36A 2QF3A 4OS4A 5DP6A 4D8NA 1GBKA 4NZLA 5CDFE 2B5TB 2SGPE 5E0HA 2VWMA 1NN6A 3UNRA 3CS7A 1VCPA 1EATA 3K65B 4MPXA 1C2IA 3KL6A 1MKXK 1O2VA 3GY8A 4OS5A 4E06H 2AHME 1HYLA 1VJ9U 1ZSJA 4RKJB 4MNXA 4X1SU 1OHHD 2KCPA 3RXCA 4DW2U 2XWBI 1SOTA 4B75A 3LH1A 1O2GH 2BYAX 5C5NA 2CK3D 2WPJS 1SGPE 3LC3A 1YYY1 4GHQA 2BDIA 2Y81A 4FUCA 1YGCH 3D62A 1YPHC 4E05H 2BDBA 1SKYE 1ZRKA 1SHYA 1ZGIA 1DPOA 1UVTH 2ANYA 3EA8A 2W26A 5HM2A 4JZ1A 1QB1A 1BRBE 4QT8C 3OSYA 2HNTF 3BIUH 2BVXH 4INLA 4WXVA 1HDTH 2ODQA 2ZC9H 4GVUA 3IWMA 3ZVGA 5HIYA 1BHXF 5FPYA 4Y7AA 2J38A 1EAIA 1O2XA 2EI6A 1A61H 2PUQH 4TY7A 1DOJA 1BBRK 2FX6A 3ATIA 3R0FA 1T8LA 2QXJA 1IQMA 1C2JA 5K7RA 2C93B 1O2NA 2PTNA 4F48B 2A2QH 1LHFH 2F9BH 3M5OA 3RXUA 1EB2A 1O3DA 3F2FA 3ZZAA 2ZO3H 3MO9A 3E0NB 1E1RD 4MPVA 1QY6A 2GCHF 2AS9A 4NGAH 1W14U 1TPAE 1SGIB 2ZU2A 1K21H 1ORFA 1AWFH 1BRCE 4ZUHA 4FETA 1HAPH 4JZFH 4INKA 1BMMH 4GSOA 1ETTH 1AY6H 2ALPA 2OD3B 2BX4A 3MWIU 1H9HE 4XSKU 1GBFA 1PYTC 2VBCA 2XC4A 2IPQX 3A82A 4THNH 1MD8A 1IQEA 3Q77A 5T1VA 5FAHA 5A2MH 4P02A 4JZEH 4Q7YA 3MH7A 3MH5A 4TSFD 2Q6GA 1TNKA 4K5ZA 3T2NA 1TOCB 3UNSA 5JBTA 3N7EA 1F0RA 2PKSC 2IN2A 3K9XB 3S9AA 3A86A 1Y5BT 5PTPA 1AO5A 3MO6A 6ESTA 3WW7A 1CHOF 3T25A 1SGRE 2C8ZB 1GHWH 2R2MB 3BTTE 5EW2H 2FI4E 2H9HA 4LOYH 2GMTC 2ESTE 1DITH 3QTVH 1TMTH 1BMFD 3ATWA 2G81E 4Y10E 5HIZA 3MQKC 2GTBA 4D9QA 1P2KA 2JIZD 1SC8U 4B74A 1W7XH 4ISLA 4ABGA 1H4WA 3S69A 1WU1A 3ZZ4A 1E37B 1O33A 1V2LT 3F68H 1L1JA 3V13A 5GDSH 2PWXA 3LJOA 2P3UB 3VEQB 1QTFA 3EGKH 1FY8E 1P2JA 2R9PA 1C4Y2 1VR1H 4Q7ZA 2J92A 1VGCB 2VIPA 1SLWB 1IQGA 4D7GA 1PPEE 1ELFA 1UTNA 2FOFA 3NKKA 3N99A 1V2UT 3GCHC 1FUJA 4IC5A 5I25A 1A4WH 4K8YA 2BOKA 3BTGE 4Q80A 3DCLA 1QURH 1C1QA 2OK5A 4RT0A 2A7HA 1SR5C 1AE8H 5AF9H 2AYWA 4AZ2B 4BAMB 1F0TA 2Y5HA 4HFPB 4GCHG 2Z7FE 1NY22 2ZTYA 5AVDA 5HKKD 5F8TA 1NT1A 4AB8A 1CE5A 1GCTC 1TA2A 3GY4A 1V2QT 1TGBA 1SHHB 4AGKA 1UVSH 2OC7A 5EU8A 2WYGA 4ZMAH 3A7ZA 3MNXA 1MQ6A 1T8OA 4BAOB 1G2MA 3ELAH 1Z8IB 1VITG 2YMSB 1NRRH 1Y5AT 2HVYB 2WV4A 1E79D 1TLDA 3MMGA 4MNWA 4Y8YA 2ZDMA 1AFQC 2ZDVH 4HTCH 2ZHEH 2V3OH 3UOUA 2AH4X 4ZHMU 2ZGHA 3RMOH 4FUEA 5DP8A 1KXEA 2BLWA 2BQWB 3RXQA 2YNAA 1AMHA 3S7KB 1RGQA 1WUNH 4AFQA 3SV2H 1O3NA 1OP2A 1OKXA 1Z7KA 1XUFA 1SGTA 2XWAA 1QCPA 3BIVH 1MTNC 4ISOA 2J94A 3ITIA 4B2CA 3PMBB 1NESE 3RU4E 5I46H 3DT0H 1P9SA 1DXPA 5CHAC 5DP9A 5GNDA 2OLGA 3PLPA 1ACBE 3IITA 3OEHD 3SV7A 2GP9B 5AHGH 1OP0A 1P02A 4ACBA 2BD8A 2XW9A 2GV6A 1S84A 1E34B 2WSSD 3M7QA 1C2DA 3ODDA 2BDHA 3KGPA 5GPIB 3L3TA 1ZZZA 2J2UA 1O2SA 1UVOA 3M7TA 3GCTG 2XC5A 2GDEH 1HPGA 4NSVA 1O5AB 1XX9A 5KECA 5TCAA 5EXNA 3MHWU 2PSYA 1AUTC 1FIWA 5EGMA 5EW1H 7GCHF 5LPEA 4X2WA 2A7CA 3D49H 1EPTC 1EOLA 4YLUA 3VGCB 2NU1E 3PV2A 1EJMA 4X2XA 1A7SA 2A4RA 1GBCA 1V2PT 1GDUA 2FLRH 2LELA 2VNTA 1EJNA 3DFLA 1MCTA 1EFRD 2Z9IA 1MBQA 1TX7A 1HLTH 1Y3UA 4Y8ZA 5AFZH 4AX9H 2EQNA 3PLBA 4JCNA 4OS7A 1QJ6B 2EEKA 1B0FA 3L6PA 1BZXE 3L33A 3KQ5A 2KX4A 5DP7A 3V12A 1A2CH 2TIOA 3URDA 1DSTA 1AHTH 3TK6A 1H8DH 3RXHA 3RU4D 2GCTC 1HAVB 2BD7A 1P04A 2W5EA 1O37A 1CVWH 1O2KA 3PO1C 4IW4E 1PQ5A 3VB5A 4VGCB 2P8OC 4YT6H 1RXPA 1NRQH 3M35A 1ZOMA 3LONA 2BDGA 1S0RA 3SGQE 2PR3A 2VU8E 1Z8RA 4OS2A 1JIRA 1MZDA 5T6FA 2ZGCA 1Z1JA 3ZZ8A 4ZKRU 1TIOA 2QYIA 1UK2A 1GI7B 1NM6A 3PROA 1WXRA 1JMOH 1XXFA 4YO9A 4NZQA 1XUKA 1IHTH 1QBOA 1PFXC 2G5NA 5LGOA 2B8OH 4WMFA 1P10A 1FV9A 1GI6A 1TE0A 3GDVA 4ABJA 1SMFE 2H6MA 3OTJE 3ZV8A 2AGEX 1W0YH 4Y71A 4LXBH 4ZXYH 3I77A 3E0PB 1F5LA 1QRXA 2WPIS 1LDTT 1TOMH 1GWAA 1TMUH 4IBLH 3U28C 1BITA 1Z8JB 2VVVA 3ZYDA 6GCHG 1ID5H 3A7TA 1YPGH 2WHXA 2GVFA 1A5HA 1GJ5H 1S85A 3I29A 4YT7H 3RXLA 5G4BA 4KKDA 1ETRH 1AN1E 3RUOA 4X1NU 1HIAA 1ELTA 1ARCA 1MCVA 3QX5H 2H9EH 3SYJA 1V3XA 1TYNA 1HBTH 2VH6A 4B73A 1HRTH 2SGQE 3T27A 1Y3WA 3SJ8A 3DFJA 2Y7ZA 3JZ1B 3BTFE 5JBAS 3TU7H 2ZHFH 1AB9C 1EQ9A 1LKAA 3W1EA 4XBBA 1GJCB 1L0ZA 3BF6H 1UK4A 1V2KT 1OP8A 4CHAC 3FVFB 3RDZA 5FBIA 1CGIE 1GBHA 4ZKSU 1C1WH 3BEFB 2FOMB 2OC8A 2YNBA 3GISB 4NFEA 5T6GA 1Z1IA 1MQ5A 5FX6A 1V2RT 2A31A 1N6XA 3SU0A 2J34A 4KTSA 4K60A 3FOAA 4WH8A 2P59A 4AFSA 5DPAA 3MTYA 1WCZA 2GT8A 5IDKA 1C5LH 1WOFA 2P16A 4BNRA 3RXBA 3LU9B 1V2WT 1GI1A 3F3BA 3TJNA 3UNQA 2WYJA 5DGJA 2B7DH 2ZHWH 5EODA 2A4GA 2FZZA 1LTOA 4BTTB 3SHAH 2ZKSA 1G30B 1DVAH 5F6MA 1VITH 4DGJA 3A8CA 2ZNKH 1V2TT 4IN2A 2Z9LA 1V6DA 2Z3EA 4NIXA 5FCKA 2ANKH 4FUJA 2QF5A 2PLXA 3WY8A 1FJSA 4DURA 2K8IA 1SLXB 3TNSA 5T6DA 4RN6A 1TALA 1Y3YA 1INCA 1BUIA 1MU6B 1K1OA 4UDWH 1OX1A 3V0XA 5A0BA 1QL9A 3LPRA 1TNHA 5C0TA 1C4U2 1H8HD 1BMAA 1V2OT 3MU1A 5JBCS 1O2JA 1GHYH 2BLQA 1O2HA 1EB1H 1GMCF 2H2ZA 1EZQA 1ZMJA 1PPCE 4O3UA 2Y5FA 4AYVB 3TGIE 2BD3A 1SQAA 3LGVA 1GGDB 1SGFG 3A7WA 4FOUC 5L2ZH 5C0UA 1SGDE 1HAVA 2CGAA 3FP8E 3RM0H 3BTDE 2BD2A 4YXWD 6CHAC 1O0DH 1Y59T 2UUYA 3FKSD 1AUJA 1QNJA 1T7CA 2UUJB 1MD7A 5EXMA 3FANA 1VJAU 3UOPA 3LT3A 2ZPQA 3SGAE 1HB0B 1K28D 1S81A 2CMYA 1CA8B 1KXDA 2FOEA 1HJ9A 2FDAA 1HV7A 1PPHE 2G5VA 9ESTA 5DKMA 2ODPA 1V2NT 1FAKH 1THRH 1EZXC 4NWKA 3NUMA 1GHBG 1SQOA 1DWDH 2XYAA 3R3GB 3W94A 2ZGJA 2XOKD 4H6SB 4FUDA 5JB9S 1YCPH 3HKJB 2C8WB 1J14A 2FX4A 1ZLRA 5EXLA 1K1IA 3FN8A 1O35A 2WPHS 1K1MA 1KXCA 1VKYA 1KDQA 3T5FH 1DWEH 1J16A 1RFNA 2UUKB 3RLYH 3RLWH 2ZPSA 2QCYA 3RC6A 1A3EH 4GHTA 5GWZA 3K2UA 4UE7H 1GMHF 1AE5A 3AW0A 1FAXA 2TGTA 8ESTE 3TVJB 2QC2A 1JRSA 3TITA 1NRSH 3KHVA 3GICB 1ANBA 3NK8A 4TPYA 2KCOA 1BTXA 2P94A 2W6JD 3U1JB 1CA0C 3O8RA 2NU4E 2RCEA 3ZYEA 1A5GH 1Z6JH 1O3BA 2C90B 2BDYA 4ZHAA 1FZZA 1CGJE 5J4SA 1IQJA 1C2HA 2GD4B 1C5MD 2FOGA 1TRNA 4Y76A 4DY7B 1H1BA 2XBWA 1ETSH 3OU0A 2WUBA 2RA0A 1E1QD 1ELVA 2VWNA 3A87A 3F1SB 2XC0A 4D9RA 8LPRA 1QL8A 3FFGA 8GCHF 3BG8A 3GS9A 4Z0KA 2SGAA 3Q00A 5EQSA 1SLUB 3UB0A 1RTKA 3TK9A 2G8TA 2ZCKP 4OS6A 3NRLA 1P03A 3RXDA 5A0AE 3BSQA 1UCYK 2RDLA 3BV9B 1PQAA 4X8SH 3NZIA 1O2PA 4ABAA 1P2QA 1D6RA 2QY0B 1DICA 2ANMH 4Y8XA 1RD3B 1BTHH 1HFDA 3MH4A 1BDAA 3EYDA 5FX5A 1KLJH 5FPTA 5BRRE 1SVPA 2O8TA 3MNSA 2PKSB 1JXPA 1BTWA 1NFYA 2I6SA 3QUMP 3RMNH 4K3JA 1BRUP 5FBEA 3U98H 2A5AA 1VZQH 2Z9KA 1C4V2 1ANDA 3F9EA 4XBCA 1EZUC 1FIZA 1DUEA 3C1KA 1KXAA 5HXFA 2BXUH 3URCA 1DY9A 1KYNA 1TX8A 2OQUA 5LH8A 3H7OA 3SV8A 2G52A 4Q2KA 3VXFH 4NSYA 2FPZA 2WZQA 2PGBB 1A0HB 2F9NA 2LIZA 1TA6A 3V3MA 3TK5A 1GI8B 1NRNH 2PKAA 2XNDD 1AVGH 3AW1A 2RA3A 4B6FA 1GJ6A 2PP6A 4ABHA 2QAAA 4CH2B 4ASHA 1G9IE 2KAIB 3PB1E 1DE7H 1FX0B 1OWHA 2PHBA 2BDAA 4AG1A 5DJ7A 3UR6A 1P05A 3A83A 1TNLA 1J9CH 3PMHB 5FCRA 1O5FH 1GBAA 1P2MA 1G3CA 1AU8A 1TNGA 3BG4C 2H5DA 2WV9A 4Z6AH 1GJ8B 2G4TA 2JETC 4X1RU 3M37A 1GG6B 1MKXH 1YP9A 3GCHB 5DO4H 4B2BA 1CHOG 1BQYA 2WPLS 2Q6DA 3TGJE 3SUEA 1TBRH 2BLVA 2BLOA 2FYRA 4BXWA 3B9FH 1AKSB 1MTVA 3RC4A 1QL7A 2NWNA 1WAYB 1H8IH 1Z8GA 2WPMS 4ISIH 1LHDH 5FXLA 3T28A 1YPHE 4F4OC 4I86A 1ANEA 4YOJA 1CSOE 1XKBC 2RFKC 1GCTB 1BA8B 1YF4A 5JYIA 1KIGH 1IOEA 5L6NH 1Y3VA 2V3MA 3DUXH 7LPRA 2F4LA 1OWIA 2V6NA 2FODA 1W10U 4XBDA 4TWWA 3NPSA 3RXGA 1T4VH 1L2EA 2EY4C 2XBXA 2J95A 1AFQB 1GCDA 1P3CA 1JIMA 1BBRH 2ZECA 2QIQA 3EDXB 1LHGH 2ODYB 1ZTJA 3PV4A 5LPRA 1GHAF 4OGYA 2F91A 4GPGA 4MNYA 4R8TB 2ZFPH 5DG6A 2UWLA 2GJGA 2VVCA 1SSXA 1MTNB 2R3UA 1ZYOA 1Q2WA 3N7DA 1H9IE 4INHA 3TLOA 2HOBA 4BAHB 3K6ZA 2ZA5A 5CHAB 1O3MA 1A5IA 1GJ7B 1NU7B 5HGGA 1B5GH 3SN8A 1MAXA 3VB6A 3VXEH 4I8KA 3STIA 4LZ1H 3A8AA 1P2IA 4TT3D 2ZTZA 2BY8X 1C5OH 3LGUA 3BTHE 1EUFA 3FP7E 4NIVA 3F9GA 1WQSA 4NA9H 2OINA 5A09A 1DANH 1EAUA 5FL7D 1KXBA 2AGIX 2IOTA 1CO7E 2A5KA 1DT2A 1MUEB 2FP7B 2IJOB 3QGJA 2W7UA 1BB0B 1TGCA 1W13U 2F9VA 1TNJA 5DK1A 1XUIA 3MU8A 3RXSA 1MTSA 2UWOA 5TJXA 5HMAA 1H9LB 1QRWA 4FVBA 1GI0A 3MFJA 2A45B 2ZHQH 3SU4A 1LVOA 1EPTB 3MOCA 2HRVA 5IYTA 4GCHF 4BANB 1UHBB 1DM4B 1TRMA 1SPJA 1S0QA 1UTPA 5EPYA 1IQIA 1FLEE 3UTUH 3QN7A 1UK3A 3A8BA 4MPUA 4ABBA 2RG3A 1U6QA 4AYYB 4CRBA 2C8XB 2GCTB 1XKAC 4OGXA 3SNEA 3RXRA 1A1RA 1K22H 1F0SA 3PO1B 2CF9H 4YLQH 4H4FA 1KLTA 4NFFA 3MU0A 2P8OB 4D7FA 2CJIA 3F2HA 1T8NA 3SNAA 1LPKB 2HLCA 1OPHB 4I31A 2KAIA 2BD9A 2QGRA 1NROH 4KTCA 4I32A 1CGHA 3WWBA 3TH2H 4Y0YE 2R0KA 3MNBA 1SQTA 2QXHA 3ZZ6A 1HJAC 1RIWC 4XOJA 3TJVA 3PTBA 4B2AA 1SGNE 4X1QU 1BOQA 1UTLM 1C5RA 3GY5A 2CN0H 1FXYA 1W0KD 3TJUA 1OXGA 2V0BA 4MPWA 1ZHMA 1UTOA 3U69H 2XCFA 4A6LA 5C1YA 1O31A 2J9NA 3SU2A 2OC1A 3GCNA 3ZVCA 1D3PB 1S6HA 2DUCA 2C4FH 3M3TA 3SORA 1C2LA 3RMLH 3U8RH 1AFEH 1AKSA 3PLKA 3C27B 5F8XA 3RC5A 4H42U 1ZMLA 3H7TA 1RTLA 3SU3A 1LQEA 4KGAA 3RXTA 2A4OA 3SOSA 4FUGA 1HGTH 1O5CB 1HAHH 4BAKB 1GBTA 3PMJA 2BVSH 1P3EA 4JK6A 3UR9A 2AMQA 1C5VA 3GCTF 2D26C 1NPMA 3HGPA 2GZ8A 2BQ7B 3SNBA 1UVPA 1ZPBA 2FM2A 3CS0A 3ZVAA 5CMXH 3F9HA 2PSXA 1ZPZA 2AERH 3OY5U 1S83A 1D4PB 1YCPM 1SGEE 1AB9B 1SOZA 4Q4LA 2ZU4A 5ESTE 2QF4A 1BTPA 3TIUA 1YBWA 2ANWA 5CE1A 1S6LA 4CHAB 1AVXA 1FI8A 4X2VA 1AVWA 1TQ7B 1PQ8A 4IMQA 1CBWC 4ABFA 1KY9A 1GHXH 8KME2 1O2UA 3D65E 5T3HA 3H5CB 7ESTE 5GCHG 1J17T 4I8HA 2STAE 1FQ3A 2XTTB 1HUTH 1L1GA 3UIRA 1D3TB 1BJUA 1EOJA 4I8LA 3ESTA 3M5MA 3DHKH 4J2YB 1GVZA 3W95A 1P57B 1P0SH 1LVBA 2BY7X 3SV9A 2ZFRH 2BX3A 1GI3A 1ZPCA 1BHXB 2FEQH 2ZGXH 2VH0A 1FN8A 2VGCC 1TQ0B 2W3IA 2VVUA 3M3VA 1OYQA 1A46H 2ZQ2A 3N7OA 1P8VC 3KN2A 1QHRB 3ZVEA 2AFQB 2QE7D 1MKWK 1O5BB 1FY3A 2BM2A 4TYDA 4NCYA 5B6LA 1SQRA 5IK2D 3RXOA 1H8ED 3PRDA 4X8UH 1THPB 1PPBH 1TAWA 3OFND 3P8FA 1FONA 2XXLA 2A1DB 4A1VA 1NZQH 1RS0A 1BBRE 3EA9A 1YPJH 1C1VH 3ZV9A 1OS8A 4X6PA 2PUXB 5HYOA 1CT0E 5A0CA 4R0IA 1EPTA 4TY6A 4UONA 1ELAA 1QRZA 1HAZB 1O3HA 1C2GA 2FOHA 3QTOH 1O34A 1PQ7A 1LO6A 1UHBA 3Q3KA 4CH8B 3A85A 1DLKB 1AZ8A 1G3BA 4TPIZ 6GCHF 2F9UA 1OOKB 5ETXA 3UREA 3OYPA 4A7IB 1WQVH 1GBJA 1GBBA 1P2NA 1SGFA 2O8WA 3A88A 3U9AH 4DIIH 3UWIA 3VB7A 5AFYH 1ZHPA 5DP3A 1ELEE 3VB3A 4FU9A 3QZQA 2HNTC 5F53A 3CNRA 4E7RG 6CHAB 3IG6B 3FZDA 3DD2H 2GGVB 4MQAA 1AI8H 2A0QB 4SGAE 2A5IA 3RXVA 2YMSD 2BY5X 3UQVA 1IAUA 4CBOA 1O3JA 1B0EA 3SNDA 3FAOA 3LGTA 1GHVH 2TBSA 1ZHRA 3SO3A 3ZZ3A 4PROA 2OCVB 3PYHA 2BDCA 2G00A 1ZMNA 1OWKA 1NTPA 3P92A 1YPKH 3Q3YA 1RTFB 4MDSA 2BTCE 2HVXA 1FY1A 2FS9A 1UVUH 4WMEA 1GJAB 1G32B 1MKWH 1Q31A 1D9IA 3ZZ9A 4NA8A 1E0FD 1GMCG 1ZJDA 2ZZUH 2KCYA 5SGAE 3QGNB 1A3BH 2KCAA 2PFEA 1C5QA 1DX5M 3M5NA 4ZAEA 1WV7H 1OWJA
chains in the Genus database with same CATH topology
2QXIA 3RXFA 2O9QA 1O5EH 1OWEA 1J8AA 2DE9A 2TGPZ 4ZH8A 2NU2E 3T26A 1NFXA 1N1LA 2FOCA 5JDUB 2ZU5A 3LC5A 5GXPA 3M3SA 1IQKA 3NCLA 3MI4A 4YOGA 1P11E 2BY9X 3RM2H 4ESTE 4GLYA 1O3EA 3D23A 4BXSA 1KTTB 3B8JA 2STBE 1G37A 2F83A 4FUHA 1GMDG 1KSNA 3RU4T 1SGQE 1OWDA 3KQCA 1CA0B 5DP5A 1THSH 1N8OB 5C5OA 1DY8A 1UTQA 2FO9A 2CXVA 2ZCHP 4OS1A 1HXEH 2FI3E 2ZDLA 1O3GA 3GYMA 3NWUA 1GBDA 4DJZB 4WMDA 3UFAA 2J4IA 1EKBB 5C1XA 1O2ZA 1C5WB 1JBUH 3CP7A 1C1MA 1ZTLA 1YLCA 3SGBE 4WWYA 1GBIA 3LKWA 1YC0A 1W2KH 2K1QA 3UUZA 2F9PA 1L4DA 5A8ZA 1EXFA 2C3SA 1O3LA 3PWCA 4A1XA 3E8LA 1F5KU 4K1SA 4JZIA 1SGYE 1ELDE 3UWJH 1C9PA 1LPGB 2R2WU 3AAUA 3RXMA 4ISHH 1GI5A 1GJDB 5H4IB 1AGJA 1TGNA 4MVNA 4HGCA 3KCGH 2Z9JA 3LGIA 5A8XA 3ATLA 2A32A 3RXIA 1ABIH 2TPIZ 4I8GA 3SW2B 2BD5A 1GHZA 1MBMA 1SFQB 3TH4H 1DSUA 1Z71A 4LZ4B 3GYLB 5E2OA 1GJ9B 1LVMA 5L2YH 1QBNA 1GHBF 1LCYA 1EP6A 5TCCA 1AIXH 2FXRA 4CRGA 1JOUB 4AGJA 3RP2A 4JMYA 1NC6A 3BTEE 1OYTH 2H9TH 2B0FA 3RMMH 4UFEH 2BZ6H 2YOLA 2ALVA 1PPGE 4HZHA 3E3TA 4UD9H 1IQHA 1XVMA 4CRAA 1Z6EA 5GIBA 2M5TA 3LIWA 3ZZBA 2OBQA 2ZDNA 1XXDA 2VINA 3ZVDA 2FS8A 4XFQA 5EOKA 2GT7A 3VFEA 1G36A 3BG4B 3SBKA 1X7AC 2JETB 5F8ZA 4U2WA 1EZSC 1QQ4A 3QZRA 3VPKA 1IQFA 1FNIA 2F3CE 2ZPRA 1BCUH 3E16B 3GY7A 2Z6BD 2ZHDA 4X1PU 3EBNA 1O2RA 1O3KA 1QB9A 1CU1A 1AQ7A 2SFAA 1D3QB 3SU6A 4IN1A 1MU8B 1CT4E 1NFUA 2SGEE 3QO6A 1GI2A 3A80A 4SGBE 2UWPA 3MNCA 4NG9H 3ZZ5A 5K0HA 1GBEA 3E90B 3ODFA 1HAIH 1TNIA 4IGDA 1FN6A 1NFWA 4X8TH 2GMTB 3M61U 2TGAA 3A81A 1TABE 1GI9B 1O2YA 1BRAA 4AOQA 4ZHLU 2B9LA 1ZGVA 3JZ2B 3BTWE 1PPFE 4DIHH 1ZR0A 2GCHG 5EQRA 5J4QA 2H5CA 2CHAC 1QBVH 1SBWA 2P93A 1CHGA 3SU1A 2ZDKA 4CR9A 1EAXA 2WV5A 1HAGE 2HGTH 4BTIB 1QIXB 3P8GA 3RXEA 1OSSA 2R0LA 4UFGH 1L4ZA 1DXWA 1C1RA 4CRFA 1UTJA 4WY3A 1GJ4H 1O30A 4K8BA 1ZJKA 3P8OA 5C20A 4AFUA 1C5YB 4F49A 1GVKB 1TRYA 3HGNA 4ZXXH 1WSSH 5ABWA 1O38A 1O3CA 2P95A 1O3PB 1B7XB 3O8DA 1O2MA 2GDDA 2G4UA 4O97A 1O2IA 3SZNA 1QGFA 1XMNB 3KNXA 1F0UA 1GL1A 3U8TH 3S0NA 2SGFE 1W7GH 2VIDA 1PPZA 4FU7A 1QR3E 4ABEA 2VIQA 1KXFA 1UCYH 1O3OA 3M36A 1P2OA 1FY4A 5EQQA 4JK5A 2NU0E 3PM3A 1LHEH 3LGYA 4K1TA 1P9UA 4NA7A 3RXPA 2ZFTA 3TPIZ 2XCNA 2WUCA 3HK6B 1BTZA 1GPZA 2OTVA 3QLPH 3SNCA 1NU9A 3MO3A 1O2QA 2GZ9A 1EASA 1K1LA 1K2I1 1IQNA 2QA9E 4B76A 4K2YA 3SJOA 1YPEH 2BD4A 2PW8H 1GHAG 1UJ1A 2BQ6B 4IMZA 1IHSH 2ZTXA 2ZQ1A 3Q76A 3ZVBA 1O32A 2XRCA 3P8NA 2BHGA 5EPNA 1ELBA 2GV7A 1K9OE 3F6UH 3QDZB 5C67A 2XNIA 4B1TA 1JWTA 2ZU1A 5JPMH 4YESB 5HM9A 4FUIA 2SGDE 2VIVA 3EA7A 4DCDA 1IQLA 1ESAA 1GI4A 3HK3B 5L30H 1C1UH 2ZFSA 2VB0A 3AVZA 2D1JA 1DLEA 3A7XA 2OP9A 3LOXA 1MTWA 4U32A 2ILNA 2VIOA 4X8VH 1LHCH 2Q1JA 1F7ZA 4KELA 3AAVA 1GG6C 1Y5UT 4Q7XA 2FTMA 1ARBA 6LPRA 1XM1A 1GBMA 1DWCH 1K1JA 1HJAB 1RIWB 2FWWA 2AIPA 1F5RA 2OQ5A 1O3IA 1SG8B 1TBQH 4J1YA 1SLVB 2ZDAH 1YPLH 2G51A 4A1TA 1MTUA 1XUJA 3SUGA 4Y79A 1BTUA 3Q3XA 1LPZB 1UTKA 1Q3XA 1ESTA 2HPQH 1C5SA 4BAQB 3HATH 1HIAB 1V2ST 1DFPA 3GDUA 3BEIB 1L1NA 2FESH 1XUHA 4XE4A 3ZZCA 3B23B 1C5NH 4ZROA 1BMLA 3LDXH 4CR5A 3F9FA 1ZTKA 5C2ZA 1W11U 1FPCH 2Y82A 4NIWA 1P01A 4O3TA 2C8YB 1WBGB 1Y8TA 1O3AA 3ATMA 3KQBA 4TWYA 1EJAA 1XVOA 3GY3A 1BT7A 1TWXB 4DOQA 2EI7A 2FIRH 1TPSA 5F03A 3KQDA 1VITF 2VWLA 4K1EA 3GY6A 3KEEA 3SU5A 1C1NA 1W0ZU 1ANCA 3TH3H 4YM9A 2EA3A 1T4UH 1VGCC 2D2DA 1HAYB 1VCWA 2TGDA 2F9OA 2A7JA 3SUDA 1KLIH 1PYTD 1YPMH 2CF8H 1RJXB 1UMAH 1V2MT 3BEUA 1G2LA 1LMWB 4ABDA 1GDQA 1SFIA 3I78A 2V35A 2BB4A 1V2VT 1HAOH 3GDSA 1CBWB 1FY5A 3DA9B 4WVPE 1EX3A 7GCHG 4X6MA 1K1NA 4ABIA 4CRDA 5JBBS 2PGQB 1D3DB 1RRKA 3A7VA 4WJG2 1V2JT 1QA0A 4H6TA 3P17H 3GOVB 2VIWA 1O3FA 1TBZH 2Z9GA 1AWHB 4X6OA 3LH3A 4YOIA 2ZU3A 2WINI 4X6NA 2JH6D 2P3TB 2OUAA 3PWBA 4U01A 2AMDA 2ZIQH 1QA7A 1NS3A 4WXIA 2XBYA 2VGCB 3EQ0H 2JKHA 2AEIH 4YZUA 5BPEA 2WPKS 2BZAA 1LVYA 3MU4A 2ASUB 2Y80A 1QJ7B 1O2WA 2FMJA 3HPTB 3M7UA 1YLDA 3ZVFA 1T8MA 2TRMA 3BTQE 2Z94A 4HI3A 1GVLA 1S82A 3CENA 1M9UA 3EAJA 1S5SA 1GBLA 2EC9H 1ELGA 3NXPA 3S9CA 1TMBH 2P3FH 1UTMA 2BXTH 2HALA 5B6OA 3LJJA 4X0WU 4D76A 1EAWA 3SJIA 1UO6A 2BY6X 3G01A 3TJOA 1SI5H 4ISNA 4JZDH 2JH0D 2DE8A 2OC0A 1MH0A 2H1UA 1TB6H 3U1IB 2HWLB 3SHCH 1DDJA 1C1OA 1TFXA 3LGWA 2AMPA 1J15A 4GAWA 4Y11E 5FPSA 2XBVA 1C2KA 1UCYE 2OBOA 3SUFA 5A8YA 1SB1H 3ZZ7A 2PV9B 1W3CA 3QWCH 3KF2A 2O8UA 1TGSZ 3EE0B 1C5ZB 2IPHA 1FMGA 2PTCE 4I8JA 3M5LA 4O03A 2SNWA 4FUFA 1O2TA 3GCOA 1WTGH 1ABJH 4CRCA 5E0JA 4B71A 3SQEE 3VGCC 2CV3A 5GCHF 3RXAA 2GX4A 1QFKH 1ESBA 3RXKA 2I6QA 4AG2A 2ZWLH 1WTHD 1O39A 2ULLA 1KDQB 2ZG0H 1S6FA 2ZFFH 2BOHB 3UQOA 1BJVA 2Y6TA 4U30A 5E8EH 4FU8A 1TGTA 3SJKA 1YM0A 3FZZA 3OY6U 1JRTA 4UFFH 2Y7XA 1MAYA 4YTAA 3V7TA 1PJPA 4AB9A 1T32A 3P95A 2FTLE 2ZEBA 3KIDU 2FI5E 1QB6A 2ZFQH 2V3HH 4M7GA 4VGCC 1DWBH 4DT7B 3MH6A 4MTBA 1E35B 3U8OH 1G3DA 3P6ZB 4FXGH 1Y3XA 2THFB 2ZI2H 1VCQA 2O8MA 3A7YA 1W12U 1O5DH 4MNVA 1A0LA 1GDNA 2EI8A 2ZCLP 4WF8A 1HXFH 4AFZA 2Y5GA 5DP4A 4GUXA 1LKBA 4RSPA 3AASA 4KP0A 2FLBH 3TGKE 1TPPA 3E1XB 2R3YA 1BIOA 1C1TA 1C2MA 1O2LA 1SL3A 3UPEA 1P06A 1BMNH 1GJBB 2FYQA 4AORA 5EG4A 2UUFB 3UY9A 4XDEA 1ZSLA 1TPOA 2O8LA 2A4QA 3SI4H 1QQUA 1D6WA 1F2SE 1C9TA 4DG4A 2QXGA 3PMAB 1GL0E 3KQEA 1XUGA 4A92A 1TONA 3E91A 3OX7U 2W3KA 5C3NA 1NO9H 1YCPK 2HPPH 1ZSKA 3SI3H 3MYWA 2SNVA 4CREA 2QV1A 1E38B 2ZF0H 2VWOA 3VB4A 1MZAA 2OXSA 1O2OA 2Z3CA 1A0JA 2A2XH 4Y7BA 1LQDB 4BOHA 5GJ4B 1YKTA 1HNEE 9LPRA 1C1SA 1CQQA 2AGGX 4IS5A 4KTUA 3SV6A 3ENSB 3MU5A 3BN9A 3STJA 2K7XA 2PKAB 3S7HB 1G3EA 2W7SA 4BTUB 3K6YA 3T62A 1C1PA 1AD8H 2LNCA 5JB8S 3QK1A 3T29A 1WYKA 2VJ1A 1ELCA 1C5TA 4K69A 3O8BA 5E0GA 2HNTE 2JH5D 7KMEH 4NIYA 1K1PA 3BTME 4MLFB 3A8DA 4I7YH 4IC6A 1KTSB 3GY2A 2ZGBH 1AZZA 3A84A 1HCGA 5FHTA 1CT2E 4MG3A 4O9VA 1O5GH 4JYUH 3O8CA 1C5UA 3SJ9A 1F92A 2LPRA 2GKVE 5ESBA 5LPFA 1SGCA 4A5TS 2ZP0H 1GMDF 1NRPH 3A89A 1GMHG 4NWLA 4UFDH 1N6YA 1TX6A 1E36B 1C5PA 1T31A 3HKIB 4JYVH 4UEHH 4Y6DA 4WH6A 3P70B 1FDPA 5E2PA 4JYTA 2GZ7A 1FPHH 1HAXB 2AIQA 4DVAU 1ZRBA 1QJ1B 4X2YA 1EP5A 1BTYA 1P12E 4FUBA 1P09A 3E6PH 2BMGB 1DS2E 4I33A 4Y0ZE 3FP6E 2BVRH 1W8BH 1DUAA 4FVDA 3PTNA 4E7NA 3RXJA 3S9BA 2CHAB 5C1UA 3ZZDA 8GCHG 4RKOB 2FOAA 1GGDC 2Q6FA 3SQHE 3ATKA 4ZKNU 2QN5T 3TNTA 4LK4A 4CBNA 2G55A 2NU3E 1MMJN 1HJ8A 2D8WA 2QF0A 2FOBA 4AN7A 1C2FA 3BTKE 1C2EA 1N8OC 4ZKOU 1C5XB 2Z3DA 1O36A 2QF3A 4OS4A 5DP6A 4D8NA 1GBKA 4NZLA 2B5TB 2SGPE 5E0HA 2VWMA 1NN6A 3UNRA 3CS7A 1VCPA 1EATA 3K65B 4MPXA 1C2IA 3KL6A 1MKXK 1O2VA 3GY8A 4OS5A 4E06H 1HYLA 1VJ9U 1ZSJA 4RKJB 4MNXA 4X1SU 3RXCA 4DW2U 2XWBI 1SOTA 4B75A 3LH1A 1O2GH 2BYAX 5C5NA 2WPJS 1SGPE 3LC3A 1YYY1 4GHQA 2BDIA 2Y81A 4FUCA 1YGCH 3D62A 1YPHC 4E05H 2BDBA 1ZRKA 1SHYA 1ZGIA 1DPOA 1UVTH 2ANYA 3EA8A 2W26A 5HM2A 4JZ1A 1QB1A 1BRBE 4QT8C 3OSYA 2HNTF 3BIUH 2BVXH 4INLA 4WXVA 1HDTH 2ODQA 2ZC9H 4GVUA 3IWMA 3ZVGA 1BHXF 5FPYA 4Y7AA 2J38A 1EAIA 1O2XA 2EI6A 1A61H 2PUQH 4TY7A 1DOJA 1BBRK 2FX6A 3ATIA 3R0FA 1T8LA 2QXJA 1IQMA 1C2JA 5K7RA 2C93B 1O2NA 2PTNA 2A2QH 1LHFH 2F9BH 3M5OA 3RXUA 1EB2A 1O3DA 3ZZAA 2ZO3H 3MO9A 3E0NB 4MPVA 1QY6A 2GCHF 2AS9A 4NGAH 1W14U 1TPAE 1SGIB 2ZU2A 1K21H 1ORFA 1AWFH 1BRCE 4ZUHA 1HAPH 4JZFH 4INKA 1BMMH 4GSOA 1ETTH 1AY6H 2ALPA 2OD3B 2BX4A 3MWIU 1H9HE 4XSKU 1GBFA 1PYTC 2XC4A 3A82A 4THNH 1MD8A 1IQEA 3Q77A 5FAHA 5A2MH 4JZEH 4Q7YA 3MH7A 3MH5A 2Q6GA 1TNKA 4K5ZA 3T2NA 1TOCB 3UNSA 5JBTA 1F0RA 2PKSC 2IN2A 3K9XB 3S9AA 3A86A 1Y5BT 5PTPA 1AO5A 3MO6A 6ESTA 1CHOF 3T25A 1SGRE 2C8ZB 1GHWH 2R2MB 3BTTE 5EW2H 2FI4E 2H9HA 4LOYH 2GMTC 2ESTE 1DITH 3QTVH 1TMTH 3ATWA 2G81E 4Y10E 2GTBA 4D9QA 1P2KA 1SC8U 4B74A 1W7XH 4ISLA 4ABGA 1H4WA 3S69A 1WU1A 3ZZ4A 1E37B 1O33A 1V2LT 3F68H 1L1JA 3V13A 5GDSH 2PWXA 3LJOA 2P3UB 3VEQB 1QTFA 3EGKH 1FY8E 1P2JA 2R9PA 1C4Y2 1VR1H 4Q7ZA 2J92A 1VGCB 2VIPA 1SLWB 1IQGA 4D7GA 1PPEE 1ELFA 1UTNA 2FOFA 3NKKA 1V2UT 3GCHC 1FUJA 4IC5A 5I25A 1A4WH 4K8YA 2BOKA 3BTGE 4Q80A 1QURH 1C1QA 2A7HA 1SR5C 1AE8H 5AF9H 2AYWA 4AZ2B 4BAMB 1F0TA 2Y5HA 4HFPB 4GCHG 2Z7FE 1NY22 2ZTYA 5AVDA 5F8TA 1NT1A 4AB8A 1CE5A 1GCTC 1TA2A 3GY4A 1V2QT 1TGBA 1SHHB