1C5VA

Structural basis for selectivity of a small molecule, s1-binding, sub-micromolar inhibitor of urokinase type plasminogen activator
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TRYPSIN)
publication title Structural basis for selectivity of a small molecule, S1-binding, submicromolar inhibitor of urokinase-type plasminogen activator.
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5vA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5vA02
1CE5A 1NN6A 1A3BH 3LT3A 1P2MA 2P93A 4A5TS 1THRH 3BEIB 4ABAA 1J15A 1A7SA 3TNTA 2G4TA 2DUCA 1O3DA 1E35B 1O3KA 3TNSA 4ABEA 3A84A 1UTMA 2LNCA 3RMLH 3SJKA 2AMDA 3RXAA 1MTVA 2ZQ1A 2OQ5A 1XUKA 5EW1H 4MG3A 5GWZA 3P8FA 3RXEA 3BG4C 1QBOA 4ASHA 3RP2A 2ODYB 1Y3XA 2ZFSA 3PTNA 2FLBH 2GCHG 2W3IA 1A2CH 2QXGA 2C93B 3RDZA 2V3OH 1Q3XA 1T32A 3S69A 2ZHDA 7KMEH 1BMAA 1H8IH 3CS7A 3VEQB 1S85A 1T7CA 5E8EH 1P10A 4GAWA 4YLQH 7ESTE 1BRAA 4MPXA 4X6NA 1A0JA 1MMJN 1ZGVA 5C20A 2JKHA 3G01A 5DP4A 3MNCA 1GCTB 1PQ5A 1HV7A 1H1BA 2HNTE 2GCHF 3PLPA 1XKBC 2BDIA 2BY7X 2NU3E 2P59A 1C1MA 2TBSA 1GMDG 3STJA 1V2NT 1QRXA 5TJXA 3OSYA 5L6NH 3A87A 2BVXH 2GDEH 2QAAA 3QUMP 5EQQA 3KL6A 3PM3A 2PUQH 1O3IA 3BTDE 3DFLA 1EQ9A 1VGCB 3K9XB 3M3TA 1P9SA 5A0BA 1GMDF 2A5KA 2ZI2H 3M7QA 1TRMA 3V12A 2VNTA 2R9PA 4YT6H 1K21H 2FOCA 2NU2E 3T28A 4AFUA 4DGJA 3QLPH 4WMEA 1BT7A 1LPKB 1KDQB 1C1PA 1UTPA 4BAQB 3NUMA 4CBOA 4LK4A 4BAOB 1TGSZ 3D49H 2IJOB 1MKXK 1HFDA 2A4OA 1IQGA 3BN9A 1PJPA 1PPBH 1WU1A 3E0NB 1NT1A 1O3JA 1OX1A 1P9UA 3SV6A 4WH8A 3A7VA 1NZQH 3FZDA 5FX6A 2HNTC 4FUEA 3ZVBA 4D9QA 1E38B 4MNWA 1GHXH 4RN6A 4CRCA 8GCHG 1GHAG 3OTJE 2ZHFH 2QCYA 2QN5T 2ALPA 4YT7H 3A8CA 4GSOA 3EDXB 1P12E 4IN1A 2FTLE 4NIWA 6GCHF 1GCTC 1KDQA 3D23A 1MKXH 1S84A 2Y6TA 5T6DA 5FCKA 1X7AC 1C1NA 2BMGB 1F0RA 3A7YA 5GCHG 1XUGA 3RXHA 1O2WA 2VU8E 1EJNA 2TPIZ 1AKSB 2Y5FA 8GCHF 1MKWH 1GHAF 4ZHLU 2FOFA 4Z6AH 1G36A 2BY5X 3VGCB 1SLVB 2F91A 2BDCA 1NU9A 2BM2A 2HGTH 2XXLA 5LH8A 1IQHA 5DGJA 3FP8E 2BQ6B 4AGKA 3SV2H 5F6MA 1VGCC 3GICB 1QHRB 4FU7A 3QZRA 3K2UA 4GPGA 2AMPA 5GCHF 3S0NA 5ETXA 1FIWA 2BVSH 1BTZA 1C5MD 1HAHH 4CRAA 1F0SA 1TALA 1WCZA 1ZPCA 1AKSA 1BITA 3EA8A 1QRZA 3GCNA 1ID5H 4LZ1H 1XX9A 1E37B 2OD3B 2UWPA 1GBMA 1S0QA 2ZG0H 2PLXA 3ATLA 1K1JA 4ISHH 1WQSA 2HNTF 3LC5A 1O39A 3SU5A 2P16A 5A8ZA 3ODFA 3QZQA 1WSSH 3GY5A 3AW1A 3MU5A 3AASA 5HYOA 2ZGXH 5EGMA 1XKAC 3SHCH 2SGAA 5EXMA 1ZPBA 3S9CA 3DHKH 1MBMA 1OP8A 5LPRA 1TFXA 2O8LA 2FDAA 3MU4A 2Z9IA 2BXTH 1YM0A 1C1WH 4ISIH 3ATKA 3BTTE 1BTXA 5DJ7A 1VCWA 2XWBI 4FUBA 3SV8A 4I7YH 2YNBA 1SQTA 1BRCE 3DFJA 1P57B 1SSXA 3ELAH 4NZQA 1G32B 4CR5A 5DP3A 2A4GA 4U30A 2B8OH 3GY7A 3A7XA 4ZROA 3VGCC 2ZGHA 4Q80A 4BAMB 1TNIA 2F9UA 2Z9GA 1FDPA 3SNBA 1ESAA 1QTFA 3MH5A 3ZVGA 1TYNA 4AYYB 2QIQA 3BEUA 1GGDC 1HLTH 1SGYE 1OS8A 2ZPRA 1AY6H 2RG3A 3BTME 5FXLA 1Z8JB 1WUNH 2F9OA 1BHXB 1C1QA 2A4RA 1LTOA 3ZZ7A 2W3KA 2JH5D 2RA3A 3V13A 1SVPA 1UTNA 2A5IA 4ZXXH 1QJ1B 1EASA 1ZR0A 4NCYA 1J14A 4B71A 1MTSA 1C5XB 1K1OA 4HZHA 1S0RA 2ZCKP 3QTVH 5DK1A 3QWCH 2Q1JA 2Z3CA 4NA7A 1W10U 4WH6A 2ZHEH 2V35A 1V2UT 1ZTLA 1NC6A 2VJ1A 2ZU2A 5F8TA 1UVOA 4NWLA 5E2PA 1O5GH 2BD5A 2ZO3H 1P04A 1YYY1 5EODA 2W7UA 1GBFA 1CHOG 2ZGBH 3UOUA 2VVVA 2TGPZ 1GCDA 1GPZA 1DX5M 2OUAA 2ZDAH 2FEQH 1SLXB 3B9FH 2Y7XA 3M36A 2VIWA 2FOMB 4I8JA 2OINA 1Y8TA 3Q3YA 2GZ7A 1SGCA 3A88A 1QURH 1GJAB 4LXBH 1QA7A 1CHOF 1NFWA 4YM9A 4UD9H 1OOKB 2BHGA 1H9IE 1O33A 3BTKE 4O97A 4AFZA 5BRRE 3O8RA 1L1JA 1S5SA 1P05A 1BOQA 2V3HH 2Z3DA 3U8OH 1CSOE 2FX4A 4FUCA 1ZJDA 1C5UA 2GZ8A 3N7OA 3PMBB 2VINA 1ZTKA 3LJJA 5K0HA 1WQVH 1K28D 1KXBA 4K1SA 1O2UA 4AOQA 3SI4H 1O3PB 3ZZCA 3SU3A 4DVAU 3ZZDA 4WWYA 4ESTE 1GHVH 1P3CA 3HK3B 3A7ZA 1FN8A 1UTLM 1TQ0B 2R2WU 1YGCH 5CHAB 3OU0A 1K9OE 4MVNA 1GJBB 4H6TA 4ABIA 4AB8A 1O3NA 1TRNA 2PKSB 1ELCA 3RU4E 4XOJA 4CBNA 2ANMH 3BIUH 4UEHH 2O8TA 2PR3A 1IQKA 1O3AA 3MYWA 3PMJA 5PTPA 1THSH 2Z9LA 1RGQA 3LPRA 2EC9H 4UDWH 1A5GH 1FJSA 3AW0A 1ETRH 5DP9A 2FI5E 4B73A 1ZMJA 1WTHD 1SC8U 1KLIH 3MH4A 1YPEH 2OQUA 1EAUA 1QY6A 1PPZA 1C2EA 3EQ0H 2BTCE 2XC4A 4BANB 1MQ6A 1KXDA 3MI4A 1GL0E 1LHGH 1QRWA 1NRRH 1Z7KA 3QO6A 3RMMH 4ZKRU 2FP7B 3S9BA 3JZ2B 2GKVE 4B76A 4ZHAA 2HPPH 1DT2A 2WPJS 3IWMA 1S81A 4WXVA 3M3SA 4AG2A 1C5ZB 4OS6A 8LPRA 1W7GH 1C9PA 2QXJA 2WV4A 1K1PA 3ZZ4A 1GI1A 1BMNH 1YP9A 2AGIX 3QX5H 3TK9A 4YOIA 3LONA 1DICA 2PSXA 2Z6BD 2OLGA 4JZ1A 1QL9A 3ATMA 2BD7A 2YNAA 3E6PH 1FPHH 3SN8A 1AMHA 1LHEH 3A83A 3BTHE 2FOGA 1DDJA 2WPMS 1ELDE 2ESTE 2OXSA 2BLOA 2H5CA 4I31A 1AUJA 2PKSC 3SGAE 3SU2A 4IN2A 1TRYA 3C1KA 4ISOA 3RUOA 1VJAU 4HI3A 4Q7YA 1T8NA 5JBBS 5E0GA 2OBOA 3GY2A 3SV7A 3UFAA 1S82A 2ZEBA 4H42U 3W95A 1QQ4A 5JB8S 5IYTA 2NWNA 1GBBA 3RMNH 1ZJKA 1EATA 4ZKSU 1FLEE 1AWFH 2J4IA 3HGNA 1FN6A 1V3XA 3LGVA 1PQAA 2FXRA 1E36B 1ELVA 3QDZB 4D7FA 4AG1A 1NPMA 5CMXH 4ZH8A 1L4DA 3VPKA 1PYTD 5F03A 1C5PA 1K2I1 2SFAA 3PV4A 4DOQA 1EB1H 2BQ7B 1TPAE 4JYUH 3RXVA 5GXPA 5AFYH 3OY5U 1O2GH 2H9EH 4FU9A 4Y0ZE 1GBHA 1F5KU 2WPIS 1V2LT 1ETTH 4Q2KA 3TVJB 3RMOH 2EA3A 1XUIA 3A7TA 3AVZA 1AIXH 1LMWB 4IMZA 3TGIE 4BNRA 1C4V2 5EPYA 3SJOA 1DVAH 3Q3KA 1DUEA 4Y79A 2OC8A 1C5OH 1G3BA 4Y71A 9ESTA 2J94A 5E0JA 1MH0A 3GOVB 1JRTA 2QXHA 1HB0B 2XWAA 1C4U2 1AN1E 1CHGA 2B5TB 1VCQA 3RXOA 1W3CA 5GIBA 1O5EH 4X8UH 1BBRE 5GJ4B 1EOLA 1KYNA 3CP7A 3SU1A 5EXNA 1ABJH 2A5AA 4U32A 3HK6B 1C9TA 1EXFA 1P3EA 2QGRA 3RXBA 3UUZA 1JMOH 1SPJA 1C2HA 2BDGA 1GDUA 1TNLA 2G8TA 1TONA 1UTOA 3ZVDA 2FS9A 4IC5A 3M7UA 2H6MA 7GCHG 3B8JA 4MPUA 1AE8H 1MTNB 4I8GA 2BD4A 2ZZUH 2WUBA 4MNYA 2SNVA 2PGBB 2VWMA 4JYTA 3NK8A 1GI5A 1YPLH 3T25A 2ASUB 5JBTA 2FESH 2UUYA 4KKDA 2H2ZA 1ANEA 1KSNA 3Q77A 1EUFA 1MTWA 2P3FH 3KIDU 2VH0A 3Q3XA 1O2IA 7GCHF 1C1VH 4H6SB 1B7XB 1N8OB 4OS1A 1ABIH 2XW9A 2XBVA 1AVGH 3ZZAA 1FZZA 3RM0H 5AF9H 1W0YH 4F49A 4DY7B 1YPHC 1EZXC 2QF3A 3NPSA 3TIUA 2FWWA 2BY8X 1HDTH 1HJ8A 1QFKH 2ZFTA 5DP6A 3ZV8A 2PSYA 5A2MH 3RXFA 3SBKA 3RLWH 2J92A 1MU8B 2BDAA 4WVPE 1BJVA 3B23B 3CS0A 5DO4H 2BY9X 3KF2A 3MU1A 5J4SA 1XUHA 1OPHB 1GMCG 3U8RH 4Y6DA 1LKAA 1LPGB 1BB0B 4IMQA 1SGFG 1Y3YA 2ZU3A 4X8SH 1XXFA 3EE0B 4THNH 1K1MA 2P3UB 2BDBA 3DUXH 1CA8B 4INHA 2QF0A 4ABFA 4AN7A 1A46H 1E34B 3PWBA 3V3MA 1C2JA 5HXFA 1AFQB 1AHTH 3SJ9A 6CHAB 3SOSA 1EJMA 2A2QH 3ZVFA 1ZGIA 1MTNC 1ELAA 4X1SU 1NRPH 2J9NA 4ABDA 2C8ZB 3T62A 1TNKA 2OTVA 3ZV9A 2GTBA 4B74A 1P09A 1YC0A 1Y5AT 1GI6A 1UK2A 3ZVAA 1KXAA 1N8OC 4R8TB 1UVTH 4K69A 1A5IA 2J2UA 4YLUA 2Y81A 1HPGA 5HM9A 3VB5A 1N1LA 2SGFE 3E90B 1MAXA 4FVBA 3MWIU 5F8XA 2PTNA 2I6SA 5A8XA 4J1YA 2XC0A 4NIXA 3E0PB 2ZFQH 1V2PT 1ANBA 1TIOA 5GDSH 3SGQE 2WYGA 2JETB 2EEKA 5TCAA 4A1VA 2NU0E 1Z8IB 3BTFE 1CGIE 3FP6E 3RXQA 1FY8E 1DWBH 5C1XA 2XNIA 4K8YA 2SGDE 1OWKA 1O36A 1V2RT 2H5DA 4HTCH 4NFEA 4DT7B 4QT8C 2ZPSA 2ZDNA 2FOAA 2CV3A 2P95A 4UFGH 1SGQE 2GV6A 3P70B 1BIOA 1HBTH 2FODA 2AH4X 1GBEA 5JPMH 1DS2E 2BXUH 2G5NA 1WTGH 5GPIB 1AFQC 6CHAC 5FHTA 1PFXC 3S7HB 1V2TT 1T4VH 1WBGB 1NM6A 3P8OA 4OS5A 1L0ZA 2PV9B 3FANA 4X6OA 1TBQH 2ZP0H 3VB4A 5JBAS 1LVMA 1IQJA 1E0FD 1GBCA 1H9HE 3GISB 2P94A 3M35A 1Y3WA 2BD9A 2GGVB 1UVUH 5DP7A 1NROH 1O2JA 6LPRA 1EAIA 1GBDA 1SGRE 2G81E 2F9VA 4I32A 4MQAA 1SB1H 3UY9A 2XTTB 1TNHA 1O3OA 1ZRKA 4ISLA 4JZDH 1MAYA 2FS8A 1EP5A 1CT0E 1ANCA 3UNQA 1EB2A 4MDSA 2AS9A 1XVMA 1T8MA 2BQWB 2AEIH 1BDAA 1GGDB 1OXGA 1OP0A 1ZHPA 3LC3A 5JBCS 1O2KA 3U1JB 1AB9B 1GDNA 3R3GB 1Z8RA 2GT7A 3TGKE 1FV9A 4Q7ZA 1O5DH 2JETC 2ZCHP 4X1QU 3H5CB 4D9RA 3EAJA 1IQNA 3KQCA 1WV7H 4TY7A 3RC4A 1UO6A 3SJ8A 1OSSA 1M9UA 1O32A 1ZZZA 4ABBA 3I29A 4K8BA 3SGBE 3SU4A 1BA8B 2OC0A 1UTQA 1RRKA 4DIHH 1CT4E 1GBIA 4A92A 3A86A 1GJDB 1BCUH 2A0QB 1P2OA 3VB7A 1JIRA 1TNGA 1O2MA 2STBE 1D6RA 1GDQA 3M5OA 3BIVH 1EZUC 1THPB 1TBZH 1GI4A 2XCFA 4NGAH 5C5OA 1ZSLA 2UUKB 4AGJA 3L33A 2YOLA 1ZYOA 1Y3UA 4FVDA 3KQBA 1EJAA 3E91A 1LVYA 1QQUA 2ZDLA 1CBWB 1GJ9B 3GCOA 4UONA 2C3SA 5C1YA 1HAIH 3A80A 2BX4A 1O2QA 1DWDH 1HAYB 3SORA 2CHAC 2GX4A 3UNRA 1DWCH 1N6XA 3HPTB 3UQVA 8KME2 1GJ4H 1P2QA 1O3FA 3HATH 4I8KA 1GJ7B 2BY6X 1H9LB 5A8YA 4HGCA 4MPWA 3V0XA 5EXLA 4HFPB 1V2OT 2D26C 3T5FH 1TLDA 3JZ1B 2ZQ2A 1Y59T 1AB9C 1V6DA 1QCPA 1D3QB 1UTKA 4ZMAH 1NS3A 4YESB 2BLVA 2H9HA 5B6OA 3EA7A 3GY3A 1P2KA 1Q31A 3LGUA 1NTPA 2FO9A 4JCNA 1C5VA 1GHYH 3P6ZB 4JZFH 1DWEH 3MMGA 1TBRH 2HPQH 1V2QT 1DM4B 2ZECA 4XBCA 2Z9KA 3PMHB 4OS4A 4Z0KA 1FIZA 1P8VC 2XCNA 1T8OA 2O8UA 4UE7H 2R3UA 1GG6B 2OP9A 4FUJA 1SG8B 3RXGA 1C5QA 1Y3VA 3BV9B 2ZNKH 1O2VA 2G52A 1O5AB 1FMGA 4WY3A 3Q76A 5EU8A 4DCDA 1INCA 1AGJA 1C2DA 3BTEE 1D9IA 1C5NH 1W7XH 3SJIA 1CBWC 2ZFRH 2NU1E 4Y0YE 4E7RG 5AVDA 1ZSKA 1IHTH 1MTUA 2OCVB 2J38A 2CXVA 2UWLA 1SBWA 4OGYA 2HWLB 1G2LA 2FOBA 5FPYA 4OGXA 1XVOA 1YPKH 1P2NA 4ZAEA 2Q6GA 2PKAB 1YCPK 1DOJA 2D8WA 1MD7A 3M37A 1CGJE 3M5MA 2A7JA 2AFQB 1BQYA 1C2LA 3D65E 2R2MB 5DPAA 1LCYA 1SR5C 2BYAX 1YF4A 1O2LA 2VIDA 1HXEH 5EQRA 1GI2A 3NKKA 2PTCE 1NFYA 3UQOA 1RTFB 2ZGCA 1YCPH 2G00A 3T29A 5DP8A 1TNJA 5F8ZA 2FIRH 1Z6JH 1GHZA 4ABHA 2PKAA 1GG6C 2GV7A 3PO1C 5C67A 4O3TA 1VR1H 4BTUB 2DE8A 2RDLA 1EP6A 3MH6A 3ZZ9A 1TWXB 2BOKA 2FYQA 3TJUA 1OYTH 4VGCB 3VB6A 2VIPA 3UOPA 3GY8A 3U1IB 1EPTB 4O03A 1YLCA 1LQDB 1V2ST 3BEFB 3F9HA 3SHAH 4JK6A 3RXPA 1EX3A 4CRDA 1ZPZA 1OWJA 1WYKA 3UR6A 2ZF0H 3F6UH 3RXRA 2ALVA 2O8MA 1AWHB 2F3CE 3KGPA 1PQ7A 3GY4A 2QA9E 3HKIB 4A7IB 1YLDA 1C5LH 1SFQB 1ELFA 1LKBA 1UHBB 2VVCA 1EOJA 2VWLA 1K1LA 4UFEH 2PFEA 2Z7FE 4DJZB 1AE5A 1G9IE 1XUJA 3LJOA 4CREA 1KTTB 2BD8A 3BSQA 1N6YA 1NFXA 1O2PA 2RCEA 4K1TA 3MHWU 4XE4A 1BMMH 3KQDA 1UCYE 4FUDA 2WINI 2Q6FA 3P8GA 2WV5A 2F83A 4X1PU 2JH6D 1A0HB 3T27A 1T8LA 1UHBA 3F9FA 2BOHB 4K1EA 1JIMA 1YBWA 1PYTC 1SHHB 1SQOA 4A1XA 1UJ1A 4K3JA 2ZTZA 1IQLA 5FPTA 3TGJE 2CF8H 1C1TA 1W13U 1BBRK 3TK5A 4TWWA 1RFNA 3PTBA 2ZKSA 3D62A 4CR9A 4ABGA 1ZMLA 1O31A 5AFZH 1DLKB 4A1TA 4TPIZ 1F0TA 4VGCC 4FUGA 1EPTC 2M5TA 5ABWA 1TA6A 1D3PB 4XBDA 5DKMA 3I78A 4X1NU 3MU0A 4Y8YA 4DIIH 1ZTJA 3NXPA 2A1DB 2QXIA 2FOHA 3OX7U 3LU9B 3BTGE 1QBNA 3SQHE 4TYDA 4CH2B 1JRSA 4DW2U 1GVKB 3S9AA 1F0UA 1GWAA 2ZU4A 2ZHWH 2IOTA 1ESTA 2H1UA 3SNEA 1YCPM 4KELA 3MH7A 4FU8A 5A0CA 3K6ZA 1Z1JA 4TY6A 4TWYA 4FUFA 5FAHA 4AFSA 4RKJB 5BPEA 3ZYEA 2AGGX 4H4FA 4JYVH 2D2DA 3BF6H 1NRQH 1SLWB 5L2YH 3RU4D 3E16B 5EPNA 2I6QA 1XUFA 1TQ7B 3PWCA 1KLJH 3DD2H 5FX5A 1AU8A 1SGFA 1ARBA 2ULLA 3U8TH 3A7WA 1U6QA 1L4ZA 2WYJA 4JMYA 4X2VA 1HAZB 1W0ZU 1QNJA 2ZDKA 4BOHA 1HJ9A 2PHBA 2FI4E 1AFEH 4GHQA 3ATWA 1O3EA 1CU1A 3ATIA 4U01A 3DA9B 3FFGA 1OP2A 1UK4A 3SW2B 1D4PB 1SGEE 4UFDH 2Y80A 4NFFA 5T6FA 3TJNA 5C2ZA 4E06H 1MZAA 2C8XB 3QN7A 1V2MT 3PB1E 4NA8A 5T3HA 1ESBA 1GBJA 4NIYA 3LDXH 2TGDA 4CRBA 4BXSA 3O8BA 1T4UH 1VITG 3RXDA 1PPHE 1SGPE 1K22H 1HAVB 1BTUA 1FAKH 1SHYA 1Z1IA 2QYIA 1ZHMA 3RXJA 3SQEE 4ZKOU 5A0AE 1ORFA 2J34A 1QGFA 3LH1A 4LOYH 3SUEA 1F92A 2GMTB 1C1OA 1SOZA 1DE7H 3UNSA 5C1UA 3R0FA 4X6PA 4K60A 4DG4A 1H8DH 1TPSA 3BTQE 2ZTYA 1HYLA 3RC5A 3F68H 3RXIA 1VITF 2A32A 3RXCA 2W5EA 4O3UA 3FAOA 4NA9H 1RS0A 4KTUA 1LDTT 2STAE 4KGAA 1Y5UT 1HAVA 1TA2A 4GLYA 5K7RA 1O3MA 3ZZ8A 2P3TB 4Y76A 3GY6A 2PW8H 1HUTH 3KHVA 1IQFA 1A1RA 2SGPE 1OWDA 3RM2H 1V2JT 3A89A 1D3DB 1GI9B 1SL3A 1W8BH 4D76A 1PPEE 1O34A 1TGTA 4M7GA 5FBIA 4IC6A 1DSTA 1YPGH 1O2ZA 1XXDA 3H7TA 4FUHA 3WY8A 3RXKA 2G4UA 4YTAA 5JDUB 2C4FH 5DG6A 1AZZA 4NIVA 1PPFE 2ZCLP 1ELEE 1A61H 1GMCF 1VCPA 1FQ3A 3STIA 4B2BA 5LGOA 1C5WB 2Q6DA 3A82A 4X2XA 4CH8B 1C2GA 3QGNB 1ZMNA 1TMUH 1QB1A 2EI8A 1PPCE 2AGEX 4BTTB 1OWEA 2BVRH 4F4OC 1CVWH 1G2MA 3U69H 2UUFB 2XRCA 1MZDA 2Y5GA 4ZUHA 2GMTC 2XYAA 1DITH 1CQQA 1NU7B 3AAUA 4MLFB 4LZ4B 1RIWB 3EYDA 4BXWA 1DUAA 4NSYA 4JK5A 4NSVA 3UIRA 2TGTA 3GYMA 1O30A 2ZC9H 5JB9S 5LPEA 1NRNH 1O0DH 1EAXA 3VXEH 1TX6A 2GZ9A 1L1NA 1LPZB 3LIWA 2W26A 1JOUB 3E8LA 2IPHA 4X2WA 1QBVH 1ELGA 4YOGA 2A7CA 1P2JA 1QA0A 1FXYA 5HM2A 3ENSB 1BTWA 5CE1A 1GBLA 3O8CA 1TB6H 3T2NA 3RXMA 4ZXYH 1Z8GA 2ZHQH 1W11U 1FY4A 1YPJH 3LGIA 2F9BH 2QY0B 1O2HA 1C5YB 2BZAA 3ZZ5A 1DFPA 3M5LA 4CRFA 1O2OA 3L3TA 4O9VA 3MO9A 1TMTH 4ZHMU 6GCHG 4B1TA 3LGWA 1D6WA 1JWTA 2FOEA 1HJAB 1RJXB 3TK6A 2BB4A 2Z94A 5J4QA 1O37A 1DANH 4CHAB 3E3TA 1J16A 2W7SA 1GBAA 1BMLA 3URCA 1KXCA 1GL1A 4FXGH 1B0EA 3QGJA 1MKWK 4TPYA 2CHAB 1BZXE 1LQEA 1HRTH 3AAVA 2OBQA 1OKXA 1SQAA 3QK1A 2G5VA 2RA0A 3ZZBA 3DT0H 4X1RU 4A6LA 1RIWC 1O3GA 3KNXA 1BTHH 1NESE 3RXUA 1JBUH 5SGAE 1DY8A 1OWIA 2CMYA 1TX7A 2A7HA 5JYIA 2XC5A 1UVPA 1QB6A 2XBWA 2ZU5A 2VWNA 1VZQH 3SUDA 2SGEE 3FP7E 1BRUP 1DSUA 1UMAH 2A45B 4XDEA 4IW4E 2FYRA 1TOMH 1ETSH 2ZIQH 2GCTB 1FY1A 1TX8A 2BD3A 3VFEA 1LVOA 5L30H 2AMQA 1G37A 4Y11E 3GDUA 2PWXA 1C5RA 5I25A 1DY9A 2TIOA 4I8HA 4INKA 1TGBA 4Q7XA 1O35A 2VIVA 1UK3A 4U2WA 2CGAA 5HGGA 3P17H 4WMFA 4BAKB 1F5LA 4Y10E 1QL8A 1HJAC 1GI7B 3I77A 3M5NA 3SU0A 3U98H 1J17T 1UVSH 2XBXA 1O2RA 1WAYB 1DXWA 4CHAC 5G4BA 3F9EA 3UREA 3V7TA 1IQEA 1K1IA 2O8WA 2O9QA 1B0FA 4X2YA 4WJG2 3P95A 1XM1A 5EG4A 1ZLRA 1O38A 1P06A 1YKTA 4BAHB 4I8LA 2BDYA 5DP5A 2HOBA 4I33A 3UPEA 2ODPA 2BLWA 3SNDA 4XFQA 4D7GA 1SLUB 4B2AA 2AIPA 1HCGA 1ZRBA 4GCHG 1GI8B 1HXFH 1IHSH 3MNBA 3LH3A 1C2FA 2PUXB 3TLOA 2V0BA 3L6PA 7LPRA 2A31A 1QIXB 3MO3A 1F2SE 4X8VH 3TJVA 1AUTC 5ESBA 4E05H 4RSPA 1CGHA 2FI3E 1QR3E 3TH4H 1IQIA 1TPOA 1DPOA 4E7NA 3RXLA 1TMBH 1O3BA 4GCHF 2D1JA 1G3DA 2GCTC 1L2EA 1CT2E 5HMAA 1EKBB 1V2KT 1TABE 1LO6A 3FVFB 6ESTA 1C4Y2 3VXFH 4CRGA 5LPFA 1SGTA 3MNSA 3PO1B 2ZDVH 3VB3A 2WPLS 1HAPH 1A0LA 1SMFE 4IGDA 1FNIA 3PMAB 1ELTA 3U9AH 4NWKA 1SGDE 3MU8A 2G51A 3PLBA 3KQEA 1AO5A 4MTBA 2SNWA 4JZIA 1AZ8A 5A09A 8ESTE 1AQ7A 3TU7H 1G30B 1C5TA 3CENA 5ESTE 4KP0A 1LVBA 1PQ8A 2FX6A 5IDKA 1O3LA 1KY9A 4GUXA 2K1QA 1LHFH 1GVZA 3UR9A 3SUGA 3RC6A 2B7DH 1BUIA 1MCVA 3UWJH 2HLCA 2R3YA 2ZDMA 3GCTG 4B75A 2OC7A 3GDVA 9LPRA 3SI3H 1TPPA 1QJ6B 1V2VT 1T31A 3HKJB 4Y8XA 4AORA 4BTIB 1MD8A 2C8WB 3KCGH 4FUIA 1P02A 3SO3A 1G3EA 2QC2A 3K65B 3M3VA 1QJ7B 2VVUA 1RD3B 4Y7AA 1C1UH 3SNAA 3TPIZ 1D3TB 1C1RA 1MCTA 5T6GA 1BRBE 1SGIB 1UCYK 3A81A 2AIQA 4OS7A 1KIGH 2R0KA 3GCTF 1HAXB 3IITA 3OY6U 5EW2H 4AX9H 1DXPA 2ANYA 3NWUA 2Y7ZA 1RTLA 2TGAA 1O3CA 2FLRH 2EI6A 4R0IA 1IQMA 3SNCA 2C8YB 3ESTA 2ZA5A 2CF9H 2IN2A 1GJ5H 1LHDH 2F9NA 2ZFPH 4X6MA 2FZZA 5L2ZH 1KLTA 1C2IA 2GDDA 3O8DA 3LOXA 4J2YB 2BLQA 1NO9H 1UCYH 1CA0B 1B5GH 3F9GA 3ZYDA 1O2XA 4MNXA 4MPVA 4SGBE 2GP9B 4YO9A 4X0WU 2WUCA 3MNXA 1O2NA 1P01A 4RKOB 3PROA 1HAGE 1MUEB 4OS2A 2ZTXA 1A4WH 3P8NA 1J9CH 1P0SH 1XMNB 3RXSA 1GMHG 1RXPA 2FM2A 1VITH 2AERH 2TRMA 3M61U 1FAXA 1TOCB 4X8TH 5EQSA 1V2WT 2HALA 1O5CB 5I46H 1K1NA 2BX3A 4AZ2B 5FCRA 4WF8A 1HGTH 1KTSB 3HGPA 3QTOH 3P92A 4XBBA 2JH0D 3ZZ3A 1P2IA 1NFUA 3RXTA 1GI3A 1S6FA 3OYPA 4IS5A 1W2KH 1Z6EA 4YZUA 3KN2A 2VIOA 4DURA 1EPTA 1H4WA 3M7TA 1WOFA 2HVXA 1GMHF 4NZLA 1GBTA 2P8OB 1GHWH 4Y7BA 5AHGH 1HAOH 1P11E 3ODDA 1SOTA 2H9TH 1ELBA 4GHTA 1JXPA 1KXEA 3SUFA 2WPHS 4PROA 4WXIA 5FBEA 2UWOA 4ISNA 3FZZA 2C90B 4IBLH 1BHXF 5C5NA 2VB0A 3TH2H 2FMJA 5FPSA 2G55A 1RTKA 2SGQE 2V6NA 1A5HA 1O2TA 2FPZA 2R0LA 2ANKH 3MO6A 3UTUH 2GT8A 3T26A 1MQ5A 2CJIA 4WMDA 4XSKU 3C27B 1FI8A 2XBYA 1CA0C 2ZFFH 2VGCB 2Z3EA 3IG6B 4SGAE 3S7KB 1FUJA 1L1GA 1YPMH 2THFB 2LPRA 2ANWA 2ZGJA 1ACBE 1J8AA 3MOCA 3W94A 1HNEE 1S6HA 4JZEH 1Z71A 3URDA 1VJ9U 2F9PA 5CHAC 3SZNA 3K6YA 3GYLB 2ZU1A 3GCHB 4MNVA 2QV1A 2BZ6H 1UTJA 1MU6B 1BBRH 3RU4T 1CO7E 4KTSA 5EOKA 3ZZ6A 1NRSH 2J95A 5TCCA 1EAWA 2CN0H 1IAUA 2FTMA 1FY5A 2NU4E 1MBQA 1C5SA 2VWOA 1AVXA 1O2YA 3EGKH 1TGCA 1W12U 1HIAB 4D8NA 1C2MA 1AD8H 3ZVCA 1LHCH 2P8OC 3SV9A 3LGTA 3NZIA 3A85A 1DLEA 1KXFA 2BD2A 1GI0A 3EA9A 1FONA 1QL7A 3TITA 4ABJA 1FPCH 3BG8A 2KAIB 4KTCA 4AYVB 3KEEA 1F7ZA 1PPGE 1IOEA 1EZQA 2BDHA 1HIAA 1ARCA 3PYHA 3NCLA 1A3EH 4YOJA 2HRVA 1SGNE 1ZSJA 1GBKA 2AYWA 2VGCC 3MTYA 1BTPA 1GHBG 5C3NA 2OC1A 3TJOA 1EZSC 4B2CA 1F5RA 4GVUA 1O3HA 1YPHE 2ZPQA 3ZVEA 1O5FH 2DE9A 3E1XB 1P03A 4K2YA 3BG4B 4K5ZA 4UFFH 1OWHA 3PLKA 1BTYA 2ODQA 1W14U 3A8BA 2B9LA 2KAIA 1GJ6A 4Y8ZA 4AFQA 3GCHC 5E0HA 4INLA 2ILNA 2GVFA 3H7OA 3F1SB 4ZKNU 4AB9A 3Q00A 1AI8H 1Y5BT 2A2XH 2Y5HA 1ZOMA 1G3CA 1GHBF 2Z9JA 3A8DA 3SU6A 3LGYA 1GJCB 1ZHRA 2B0FA 1GVLA 2A4QA 5E2OA 3GDSA 3RLYH 3LKWA 3BTWE 1NY22 1Q2WA 1O2SA 1C2KA 2GD4B 1C1SA 2VIQA 5H4IB 1ANDA 1TAWA 1S83A 3A8AA 4NG9H 3UWIA 1O5BB 2ZWLH 3MFJA 3ITIA 3TH3H 2Y82A 1AVWA 1TE0A 1SFIA 1BJUA 1OYQA 1FY3A 1GJ8B 2EI7A 2WPKS 1QB9A 2UUJB 2VH6A 1SI5H 1TGNA 2PGQB
chains in the Genus database with same CATH superfamily
1CE5A 1NN6A 1A3BH 3LT3A 1P2MA 2P93A 4A5TS 1THRH 3BEIB 4ABAA 1J15A 1A7SA 3TNTA 2G4TA 2DUCA 1O3DA 1E35B 1O3KA 3TNSA 4ABEA 3A84A 1UTMA 2LNCA 3RMLH 3SJKA 2AMDA 3RXAA 1MTVA 2ZQ1A 2OQ5A 1XUKA 5EW1H 4MG3A 5GWZA 3P8FA 3RXEA 3BG4C 1QBOA 4ASHA 3RP2A 2ODYB 1Y3XA 2ZFSA 3PTNA 2FLBH 2GCHG 2W3IA 1A2CH 2QXGA 2C93B 3RDZA 2V3OH 1Q3XA 1T32A 3S69A 2ZHDA 5HIZA 7KMEH 1BMAA 1H8IH 3CS7A 3VEQB 1S85A 1T7CA 4ASUD 5E8EH 1P10A 4GAWA 4YLQH 7ESTE 1BRAA 4MPXA 1BMFD 1A0JA 4X6NA 1MMJN 1ZGVA 5C20A 2JKHA 3G01A 5DP4A 3MNCA 1GCTB 1PQ5A 1HV7A 1H1BA 2HNTE 2GCHF 3DSGA 3PLPA 4F55A 1XKBC 2BDIA 2BY7X 2NU3E 2P59A 1C1MA 2TBSA 1GMDG 3STJA 1V2NT 1QRXA 5TJXA 3OSYA 5L6NH 3A87A 3DCLA 2BVXH 2GDEH 2QAAA 3QUMP 5EQQA 3KL6A 3PV5A 3PM3A 5KEDA 2PUQH 1O3IA 3BTDE 3DFLA 1EQ9A 1VGCB 3K9XB 3M3TA 1P9SA 5A0BA 1GMDF 2A5KA 1YWUA 2ZI2H 3M7QA 3FOAA 1TRMA 3V12A 2VNTA 2R9PA 4YT6H 1K21H 2FOCA 2NU2E 3T28A 4AFUA 4DGJA 3QLPH 4WMEA 5DN6D 1BT7A 1LPKB 1KDQB 1C1PA 1UTPA 4BAQB 3NUMA 4CBOA 4LK4A 4BAOB 1TGSZ 3U28C 3D49H 2IJOB 1MKXK 1HFDA 2A4OA 1IQGA 3BN9A 1PJPA 1PPBH 1WU1A 3E0NB 1NT1A 1O3JA 1OX1A 1P9UA 3SV6A 4WH8A 3A7VA 1NZQH 3FZDA 5FX6A 1NBME 2HNTC 4FUEA 3ZVBA 4D9QA 1E38B 4MNWA 1GHXH 4RN6A 4CRCA 8GCHG 1GHAG 3OTJE 2ZHFH 2QCYA 2QN5T 2ALPA 4YT7H 3A8CA 4GSOA 3EDXB 1P12E 4IN1A 2FTLE 4FOUC 4NIWA 6GCHF 1GCTC 1KDQA 3D23A 1MKXH 1S84A 2Y6TA 5T6DA 3N7DA 5FCKA 2F4LA 1X7AC 1C1NA 2BMGB 1F0RA 3A7YA 5GCHG 1XUGA 3RXHA 1O2WA 2VU8E 1EJNA 2TPIZ 3CNRA 1AKSB 2Y5FA 8GCHF 1MKWH 1GHAF 4ZHLU 2FOFA 4Z6AH 1G36A 2BY5X 3VGCB 1SLVB 2F91A 2BDCA 1NU9A 2BM2A 2HGTH 2XXLA 5LH8A 1IQHA 5DGJA 3FP8E 2BQ6B 4AGKA 3SV2H 5F6MA 1VGCC 3GICB 1QHRB 4FU7A 3QZRA 3K2UA 4GPGA 2AMPA 5GCHF 3S0NA 5ETXA 1FIWA 2BVSH 1BTZA 1C5MD 1HAHH 3FN8A 4CRAA 1F0SA 1TALA 1WCZA 1ZPCA 1AKSA 1BITA 3EA8A 1QRZA 3GCNA 1ID5H 4LZ1H 1XX9A 1E37B 2OD3B 2UWPA 1GBMA 1S0QA 2ZG0H 2PLXA 3ATLA 1K1JA 4ISHH 1WQSA 2HNTF 3LC5A 1O39A 3SU5A 2P16A 5A8ZA 3ODFA 3QZQA 1WSSH 3GY5A 3AW1A 3MU5A 3AASA 5HYOA 2ZGXH 5EGMA 1MABB 1XKAC 3SHCH 2SGAA 5EXMA 1ZPBA 3S9CA 3DHKH 1MBMA 1OP8A 5LPRA 1TFXA 2O8LA 2FDAA 3MU4A 2Z9IA 2BXTH 1YM0A 2LP6A 1C1WH 2KFWA 4ISIH 3ATKA 3BTTE 1BTXA 5DJ7A 1VCWA 2XWBI 4FUBA 3SV8A 4I7YH 2YNBA 1SQTA 1BRCE 3DFJA 1P57B 1SSXA 3ELAH 4NZQA 1G32B 4CR5A 5DP3A 2A4GA 4U30A 2B8OH 3GY7A 3A7XA 4ZROA 3VGCC 2ZGHA 4Q80A 4BAMB 1H8HD 1TNIA 2F9UA 2Z9GA 2QF5A 1FDPA 3SNBA 1ESAA 1QTFA 3MH5A 3ZVGA 1TYNA 4AYYB 2QIQA 3BEUA 1GGDC 1HLTH 1SGYE 1OS8A 2ZPRA 1AY6H 2RG3A 3BTME 5FXLA 1Z8JB 1WUNH 2F9OA 1BHXB 1C1QA 2A4RA 1LTOA 3ZZ7A 2W3KA 2JH5D 2RA3A 3V13A 1SVPA 1UTNA 2A5IA 1K0HA 4ZXXH 1QJ1B 1EASA 1ZR0A 4Z1MD 4NCYA 3WWFA 1J14A 4B71A 1MTSA 1C5XB 1K1OA 2HLDD 1S0RA 2KCPA 2ZCKP 4HZHA 3QTVH 1OHHD 5DK1A 3QWCH 2Q1JA 2Z3CA 4NA7A 1W10U 4WH6A 2ZHEH 2V35A 3FO8D 1V2UT 1ZTLA 1NC6A 2VJ1A 2OK5A 2ZU2A 5F8TA 1VKYA 1UVOA 3DSOA 1S6LA 4NWLA 5E2PA 1O5GH 2BD5A 2ZO3H 1P04A 1YYY1 5EODA 2W7UA 1GBFA 1CHOG 2ZGBH 3UOUA 2VVVA 2TGPZ 1GCDA 1GPZA 1DX5M 2OUAA 2ZDAH 2FEQH 1SLXB 3B9FH 2Y7XA 3M36A 2VIWA 2FOMB 4I8JA 2OINA 1Y8TA 3Q3YA 2GZ7A 1SGCA 3A88A 1QURH 1GJAB 4LXBH 1YY3A 1QA7A 1CHOF 1NFWA 4YM9A 4UD9H 1OOKB 2BHGA 1H9IE 1O33A 3BTKE 4O97A 4AFZA 5BRRE 3O8RA 1L1JA 1S5SA 1P05A 1BOQA 2V3HH 2Z3DA 3U8OH 1CSOE 2FX4A 4FUCA 1ZJDA 1C5UA 2GZ8A 3N7OA 3PMBB 2VINA 4TSFD 1ZTKA 3LJJA 5K0HA 1WQVH 1K28D 1KXBA 4K1SA 1O2UA 4AOQA 3SI4H 1O3PB 3ZZCA 3SU3A 4AC9A 4DVAU 3ZZDA 4WWYA 4ESTE 1GHVH 1P3CA 3HK3B 3A7ZA 1FN8A 1UTLM 1TQ0B 2R2WU 1YGCH 5CHAB 3OU0A 1K9OE 4MVNA 1GJBB 4H6TA 4ABIA 4AB8A 1O3NA 1TRNA 2PKSB 1ELCA 3RU4E 4XOJA 4CBNA 2ANMH 3BIUH 4UEHH 2O8TA 2PR3A 1IQKA 1O3AA 3MYWA 3PMJA 5PTPA 1THSH 2Z9LA 1RGQA 3LPRA 2EC9H 4UDWH 1A5GH 3ZIAD 1FJSA 3AW0A 1ETRH 5DP9A 2FI5E 4B73A 1ZMJA 1WTHD 1SC8U 1KLIH 3MH4A 1YPEH 2OQUA 1EAUA 1QY6A 1PPZA 1C2EA 3EQ0H 2BTCE 2XC4A 2M2AA 4BANB 1MQ6A 1KXDA 3MI4A 1GL0E 1LHGH 1QRWA 1NRRH 1Z7KA 3QO6A 3RMMH 2J98B 4ZKRU 2FP7B 3S9BA 3JZ2B 2GKVE 4B76A 4ZHAA 2HPPH 1DT2A 2WPJS 3IWMA 1S81A 4WXVA 3M3SA 4AG2A 1COWD 3OAAD 1C5ZB 4OS6A 8LPRA 1W7GH 1C9PA 3OEHD 2QXJA 2WV4A 1K1PA 3ZZ4A 5FL7D 1GI1A 1BMNH 1YP9A 2AGIX 3QX5H 3TK9A 4YOIA 3LONA 1DICA 2PSXA 2Z6BD 2OLGA 4JZ1A 1QL9A 3ATMA 2BD7A 2YNAA 3E6PH 2J98A 3U1JB 1FPHH 3SN8A 1AMHA 1LHEH 3A83A 2J97A 3BTHE 2FOGA 1DDJA 2WPMS 1ELDE 2ESTE 2OXSA 2BLOA 2H5CA 4I31A 1AUJA 2PKSC 3SGAE 3SU2A 2YMSD 4IN2A 5DSFA 1TRYA 3C1KA 4ISOA 3RUOA 1VJAU 4HI3A 4Q7YA 1T8NA 5JBBS 5E0GA 2OBOA 3GY2A 2RFKC 3SV7A 3UFAA 1S82A 2ZEBA 4H42U 3W95A 1QQ4A 5JB8S 5IYTA 2NWNA 1GBBA 2IPQX 3RMNH 1ZJKA 1EATA 4ZKSU 1FLEE 1AWFH 2J4IA 3HGNA 1FN6A 1SQRA 1V3XA 3LGVA 5EIYA 2JDID 1PQAA 2FXRA 1E36B 1ELVA 3QDZB 4D7FA 4AG1A 1NPMA 5CMXH 4ZH8A 1L4DA 3VPKA 1PYTD 5F03A 1C5PA 1K2I1 2SFAA 3PV4A 2KCOA 4DOQA 1EB1H 2BQ7B 1TPAE 4JYUH 3RXVA 5GXPA 5AFYH 3OY5U 5C0TA 1O2GH 2H9EH 4FU9A 4Y0ZE 1GBHA 1F5KU 2WPIS 1V2LT 1ETTH 4Q2KA 3TVJB 3RMOH 2EA3A 1XUIA 3A7TA 3AVZA 1AIXH 1LMWB 4IMZA 3TGIE 4BNRA 1C4V2 5EPYA 3SJOA 2JIZD 1DVAH 3Q3KA 1DUEA 4Y79A 2OC8A 1C5OH 1G3BA 4Y71A 9ESTA 5HIYA 2J94A 5E0JA 1MH0A 3GOVB 1JRTA 2QXHA 1HB0B 2XWAA 1C4U2 1AN1E 1CHGA 2B5TB 1VCQA 3RXOA 1W3CA 5GIBA 3KYFA 1O5EH 4X8UH 1BBRE 3KQ5A 1EOLA 1KYNA 3CP7A 5GJ4B 3SU1A 5EXNA 1ABJH 2A5AA 4U32A 1KMHB 3HK6B 1C9TA 1EXFA 1P3EA 2QGRA 4XRNA 3RXBA 3UUZA 1JMOH 1SPJA 1C2HA 2BDGA 1GDUA 1TNLA 2G8TA 1TONA 1UTOA 3ZVDA 2FS9A 4IC5A 3M7UA 2H6MA 7GCHG 3B8JA 4MPUA 1AE8H 1MTNB 4I8GA 2BD4A 2ZZUH 2WUBA 4MNYA 2SNVA 3F3BA 2PGBB 2VWMA 4JYTA 3NK8A 1GI5A 1YPLH 3T25A 2ASUB 5JBTA 2FESH 2UUYA 4KKDA 2L74A 2H2ZA 1ANEA 1KSNA 3Q77A 1EUFA 1MTWA 2P3FH 3KIDU 2VH0A 3Q3XA 1O2IA 7GCHF 1C1VH 4H6SB 1B7XB 1N8OB 4OS1A 1ABIH 2XW9A 2XBVA 1AVGH 3ZZAA 1FZZA 3RM0H 5AF9H 1W0YH 4F49A 4DY7B 1YPHC 1EZXC 2QF3A 3MQKC 3NPSA 3TIUA 2FWWA 2BY8X 1HDTH 1HJ8A 1QFKH 3AK5A 2ZFTA 5DP6A 3ZV8A 2PSYA 5A2MH 3RXFA 3SBKA 3RLWH 2J92A 1MU8B 2BDAA 4YXWD 4WVPE 1BJVA 3B23B 3CS0A 5DO4H 2BY9X 3KF2A 3MU1A 5J4SA 1XUHA 1OPHB 1GMCG 3U8RH 4Y6DA 1LKAA 1LPGB 1BB0B 4IMQA 1SGFG 1Y3YA 2ZU3A 4X8SH 1XXFA 3EE0B 4THNH 1K1MA 2P3UB 2BDBA 3DUXH 1CA8B 4INHA 2QF0A 4ABFA 4AN7A 1A46H 1E34B 3PWBA 3V3MA 1C2JA 5HXFA 1AFQB 1AHTH 3SJ9A 6CHAB 3SOSA 1EJMA 2A2QH 3ZVFA 1ZGIA 1MTNC 1ELAA 4X1SU 1NRPH 2J9NA 4ABDA 2C8ZB 4ZCNA 3T62A 1TNKA 2OTVA 3ZV9A 3PV2A 2GTBA 4B74A 1P09A 1YC0A 1Y5AT 5IK2D 1GI6A 1UK2A 3ZVAA 1KXAA 1N8OC 4ACAA 4R8TB 1UVTH 4K69A 1A5IA 2J2UA 4YLUA 2Y81A 1HPGA 5HM9A 3VB5A 1N1LA 2SGFE 3E90B 1MAXA 4FVBA 3MWIU 5F8XA 2PTNA 2I6SA 5A8XA 4J1YA 2XC0A 4NIXA 3E0PB 2ZFQH 1V2PT 1ANBA 1TIOA 5GDSH 3SGQE 2WYGA 2JETB 2EEKA 5TCAA 4A1VA 2NU0E 1Z8IB 3BTFE 1CGIE 3FP6E 3RXQA 1FY8E 1DWBH 5C1XA 2XNIA 4K8YA 2SGDE 1OWKA 1O36A 1V2RT 2H5DA 4HTCH 4NFEA 4DT7B 4QT8C 2ZPSA 2ZDNA 2FOAA 2CV3A 2P95A 4UFGH 1SGQE 2GV6A 3P70B 1BIOA 1HBTH 2FODA 2AH4X 1GBEA 5JPMH 1DS2E 2BXUH 2G5NA 1WTGH 5GPIB 1AFQC 6CHAC 5FHTA 1PFXC 3S7HB 1V2TT 1T4VH 3N99A 1WBGB 5C94A 1NM6A 3P8OA 4OS5A 1L0ZA 2PV9B 3FANA 4X6OA 1TBQH 2ZP0H 3VB4A 5JBAS 1LVMA 1IQJA 1E0FD 1GBCA 1H9HE 3GISB 2P94A 3M35A 1Y3WA 2BD9A 2GGVB 1UVUH 5DP7A 1NROH 1O2JA 6LPRA 1EAIA 1GBDA 1SGRE 2G81E 2F9VA 4I32A 4MQAA 1SB1H 3UY9A 2XTTB 1TNHA 3UAIC 1O3OA 1ZRKA 4ISLA 4JZDH 1MAYA 1EFRD 2FS8A 1EP5A 1CT0E 1ANCA 3UNQA 1EB2A 4MDSA 2AS9A 1XVMA 1T8MA 2BQWB 2AEIH 1BDAA 1GGDB 1OXGA 1OP0A 1ZHPA 3LC3A 2XOKD 1O2KA 5JBCS 1AB9B 1GDNA 3R3GB 1Z8RA 2GT7A 3TGKE 1FV9A 4Q7ZA 1O5DH 2JETC 2ZCHP 4X1QU 3H5CB 4D9RA 3EAJA 1IQNA 3KQCA 1WV7H 4TY7A 3RC4A 1UO6A 3SJ8A 1OSSA 1M9UA 1O32A 1ZZZA 4ABBA 3I29A 4K8BA 3SGBE 3SU4A 1BA8B 2OC0A 1UTQA 1RRKA 4DIHH 1CT4E 1GBIA 4A92A 3A86A 1GJDB 1BCUH 2A0QB 1P2OA 2PP6A 3VB7A 1JIRA 1TNGA 1O2MA 2STBE 1D6RA 1GDQA 3M5OA 3BIVH 1EZUC 1THPB 1TBZH 1GI4A 2XCFA 4NGAH 5C5OA 1ZSLA 2UUKB 4AGJA 3L33A 2YOLA 1ZYOA 1Y3UA 4FVDA 4TT3D 3KQBA 1EJAA 3E91A 1LVYA 1QQUA 2ZDLA 1CBWB 1GJ9B 3GCOA 4UONA 2C3SA 5C1YA 1HAIH 3A80A 3H09A 2BX4A 1O2QA 1DWDH 1HAYB 3SORA 2CHAC 2GX4A 3UNRA 1DWCH 1N6XA 1W0KD 3HPTB 3UQVA 3F0PA 8KME2 1GJ4H 1P2QA 1O3FA 2CK3D 3HATH 4I8KA 1GJ7B 2BY6X 1H9LB 5A8YA 4HGCA 4MPWA 3V0XA 5EXLA 4HFPB 1V2OT 2D26C 3T5FH 1TLDA 3JZ1B 2ZQ2A 1Y59T 1AB9C 1V6DA 1QCPA 1E1RD 1D3QB 1UTKA 4ZMAH 1NS3A 1NBMD 4YESB 2BLVA 2H9HA 5B6OA 3EA7A 3GY3A 1P2KA 1Q31A 1WDIA 3LGUA 1NTPA 2FO9A 4JCNA 2XNDD 1C5VA 1GHYH 3P6ZB 4JZFH 1DWEH 3MMGA 1TBRH 2HPQH 3FKSD 1V2QT 1DM4B 2ZECA 4XBCA 2Z9KA 3PMHB 4OS4A 4Z0KA 1FIZA 1P8VC 2KCYA 2XCNA 1T8OA 2O8UA 4UE7H 2R3UA 1GG6B 2OP9A 4FUJA 1SG8B 2V3MA 3RXGA 1C5QA 1Y3VA 3BV9B 2ZNKH 1O2VA 2G52A 1O5AB 1FMGA 4WY3A 3Q76A 4HG6A 2EY4C 5EU8A 4DCDA 1INCA 1AGJA 1C2DA 3BTEE 1D9IA 1C5NH 1W7XH 3SJIA 1CBWC 2ZFRH 2NU1E 4Y0YE 4E7RG 2WV9A 5AVDA 1ZSKA 1IHTH 1MTUA 2OCVB 2J38A 2CXVA 2UWLA 1SBWA 4OGYA 2HWLB 1G2LA 2FOBA 5FPYA 4OGXA 5HKKD 1XVOA 1YPKH 1P2NA 4ZAEA 2Q6GA 2PKAB 1YCPK 1DOJA 2D8WA 1MD7A 3M37A 1CGJE 3M5MA 2A7JA 2AFQB 1BQYA 1C2LA 4OM9A 4B6EA 3D65E 2R2MB 5DPAA 1LCYA 1SR5C 2BYAX 1YF4A 1O2LA 2VIDA 2JJ2D 1HXEH 5EQRA 1GI2A 3NKKA 2PTCE 1NFYA 3UQOA 1RTFB 2ZGCA 1YCPH 2G00A 3T29A 5DP8A 1TNJA 5F8ZA 2FIRH 1Z6JH 1GHZA 4ABHA 3PRDA 2PKAA 1GG6C 2GV7A 3PO1C 5C67A 4O3TA 1VR1H 4BTUB 2DE8A 2RDLA 1EP6A 3MH6A 3ZZ9A 5C17A 1TWXB 2BOKA 2FYQA 3TJUA 1OYTH 4VGCB 3VB6A 2VIPA 3UOPA 3GY8A 3U1IB 1EPTB 4O03A 1YLCA 1LQDB 1V2ST 3BEFB 3F9HA 3SHAH 4JK6A 2V7QD 3RXPA 1EX3A 4CRDA 1ZPZA 1OWJA 1WYKA 3UR6A 2ZF0H 3F6UH 3RXRA 2ALVA 2O8MA 1AWHB 2F3CE 3KGPA 1PQ7A 3GY4A 2QA9E 3HKIB 4A7IB 1YLDA 1C5LH 1SFQB 1ELFA 1LKBA 1UHBB 2VVCA 1EOJA 2VWLA 1K1LA 4UFEH 2PFEA 2Z7FE 4DJZB 1AE5A 1G9IE 1XUJA 3LJOA 4CREA 1KTTB 2BD8A 3BSQA 1N6YA 1E1QD 1NFXA 1O2PA 2RCEA 4K1TA 2QE7D 3MHWU 4XE4A 1BMMH 3KQDA 1UCYE 4FUDA 2WINI 2Q6FA 3P8GA 2WV5A 2F83A 4X1PU 2JH6D 1A0HB 3T27A 1T8LA 1UHBA 3F9FA 4P02A 2BOHB 4K1EA 1JIMA 1YBWA 1PYTC 1SHHB 1SQOA 4A1XA 1UJ1A 4K3JA 2ZTZA 1IQLA 5FPTA 3TGJE 2CF8H 1C1TA 1W13U 1BBRK 3TK5A 4TWWA 1RFNA 3PTBA 2ZKSA 3D62A 4CR9A 4ABGA 1ZMLA 1O31A 5AFZH 3DSPA 1DLKB 4A1TA 4TPIZ 1F0TA 4VGCC 4FUGA 2K0QA 1EPTC 2M5TA 5ABWA 1TA6A 1D3PB 4XBDA 5DKMA 3I78A 4X1NU 3MU0A 4Y8YA 4DIIH 2W6JD 5EJZA 1ZTJA 3WWBA 3NXPA 2A1DB 2QXIA 2FOHA 3OX7U 3LU9B 3BTGE 1QBNA 3SQHE 4TYDA 4CH2B 1JRSA 1YLNA 4DW2U 1GVKB 3S9AA 1F0UA 1GWAA 2ZU4A 2ZHWH 2IOTA 2JJ1D 1ESTA 2H1UA 3SNEA 1YCPM 4KELA 3MH7A 4FU8A 5A0CA 3K6ZA 1Z1JA 4TY6A 4TWYA 4FUFA 5FAHA 4AFSA 4RKJB 5BPEA 3ZYEA 2AGGX 4H4FA 2WSSD 4JYVH 2D2DA 3BF6H 1NRQH 1SLWB 5L2YH 3RU4D 3E16B 5EPNA 2I6QA 1XUFA 1TQ7B 3PWCA 1KLJH 3DD2H 5FX5A 1AU8A 1SGFA 1ARBA 2ULLA 3U8TH 3A7WA 1U6QA 1L4ZA 1QZ8A 2WYJA 4JMYA 4X2VA 1HAZB 1W0ZU 1QNJA 2ZDKA 4BOHA 1HJ9A 2PHBA 2FI4E 1AFEH 4GHQA 3ATWA 1O3EA 1CU1A 3ATIA 4U01A 3DA9B 3FFGA 1OP2A 1UK4A 3SW2B 1D4PB 1SGEE 4UFDH 2Y80A 4NFFA 5T6FA 3TJNA 5C2ZA 4E06H 1MZAA 2C8XB 3QN7A 1V2MT 2KM0A 3PB1E 4NA8A 5T3HA 1ESBA 1GBJA 3W1EA 4NIYA 3LDXH 2TGDA 4CRBA 3OFND 4BXSA 3O8BA 1T4UH 2AHME 1VITG 3RXDA 1PPHE 1SGPE 1K22H 1HAVB 5C0UA 1BTUA 1FAKH 3OTPA 1SHYA 1Z1IA 2QYIA 1ZHMA 3RXJA 3SQEE 4ZKOU 5A0AE 1ORFA 2J34A 1QGFA 3LH1A 4LOYH 3SUEA 1F92A 2GMTB 1C1OA 1SOZA 1DE7H 3UNSA 5C1UA 3R0FA 4X6PA 4K60A 4DG4A 1H8DH 1TPSA 3BTQE 2ZTYA 1HYLA 3RC5A 3F68H 3RXIA 1VITF 2A32A 3RXCA 2W5EA 4O3UA 3FAOA 4NA9H 1RS0A 4KTUA 1LDTT 2STAE 4KGAA 5CHBA 1Y5UT 1HAVA 1TA2A 2J5UA 4GLYA 5K7RA 3NRLA 1O3MA 3ZZ8A 2HVYB 2P3TB 4Y76A 3GY6A 2PW8H 1HUTH 3KHVA 1IQFA 1A1RA 2SGPE 1OWDA 3RM2H 1V2JT 3A89A 1D3DB 1GI9B 1SL3A 1W8BH 4D76A 1PPEE 3KYGA 1O34A 1TGTA 4M7GA 5FBIA 4IC6A 1DSTA 1YPGH 1O2ZA 1XXDA 3H7TA 4FUHA 3WY8A 3RXKA 2G4UA 4YTAA 5JDUB 2C4FH 5DG6A 1AZZA 4NIVA 1PPFE 2ZCLP 1ELEE 1A61H 1GMCF 1VCPA 1FQ3A 3STIA 4B2BA 5LGOA 1C5WB 2Q6DA 3A82A 4X2XA 4CH8B 1C2GA 3QGNB 1ZMNA 1TMUH 1QB1A 2EI8A 1PPCE 2AGEX 4BTTB 1OWEA 2K8IA 2BVRH 4F4OC 1CVWH 1G2MA 3U69H 2UUFB 2XRCA 1MZDA 2Y5GA 4ZUHA 2GMTC 2XYAA 1DITH 1CQQA 1NU7B 1WXRA 3AAUA 4MLFB 4LZ4B 1RIWB 3EYDA 4BXWA 1DUAA 4NSYA 4JK5A 4NSVA 3UIRA 2TGTA 4Q63A 3GYMA 1O30A 2ZC9H 5JB9S 5LPEA 1NRNH 1O0DH 1EAXA 3VXEH 1TX6A 2GZ9A 1L1NA 1LPZB 3LIWA 2W26A 1JOUB 3E8LA 2IPHA 4X2WA 1QBVH 1ELGA 2WPDD 4YOGA 2A7CA 1P2JA 1QA0A 1FXYA 5HM2A 3ENSB 1BTWA 5CE1A 1GBLA 3O8CA 1TB6H 3T2NA 3RXMA 4ZXYH 1Z8GA 2ZHQH 1W11U 1FY4A 1YPJH 3LGIA 2F9BH 2QY0B 1O2HA 1C5YB 2BZAA 3ZZ5A 1DFPA 3M5LA 4CRFA 1O2OA 3L3TA 4Q4LA 4O9VA 3MO9A 1TMTH 4ZHMU 6GCHG 4B1TA 3LGWA 2F43B 1D6WA 1JWTA 2FOEA 1HJAB 1RJXB 3TK6A 2BB4A 2Z94A 5J4QA 1O37A 1DANH 4CHAB 3E3TA 1J16A 1E79D 2W7SA 1GBAA 1BMLA 3URCA 1KXCA 1GL1A 4FXGH 1B0EA 3QGJA 1MKWK 4TPYA 2CHAB 1BZXE 1LQEA 2IJD1 1HRTH 3AAVA 3UB0A 2OBQA 1OKXA 1SQAA 3QK1A 2G5VA 2RA0A 3ZZBA 3DT0H 4X1RU 4A6LA 1RIWC 1O3GA 3KNXA 1BTHH 1NESE 3RXUA 1JBUH 5SGAE 1DY8A 1OWIA 2CMYA 5KECA 1TX7A 2A7HA 5JYIA 2XC5A 1UVPA 1QB6A 2XBWA 2ZU5A 2VWNA 2KZ4A 1VZQH 3SUDA 1FX0B 2SGEE 5B6LA 3FP7E 1BRUP 1DSUA 1UMAH 2A45B 4XDEA 4IW4E 2FYRA 1TOMH 1ETSH 2ZIQH 2GCTB 1FY1A 1TX8A 2BD3A 3VFEA 1LVOA 5L30H 2AMQA 1G37A 4Y11E 3GDUA 2PWXA 1C5RA 5EJLA 3EE7A 5CDFE 1DY9A 5I25A 2TIOA 4I8HA 4INKA 1TGBA 4Q7XA 1O35A 2VIVA 1UK3A 4U2WA 2CGAA 5HGGA 3P17H 4WMFA 4BAKB 1F5LA 4Y10E 1QL8A 1HJAC 1GI7B 3I77A 3M5NA 3SU0A 3U98H 1J17T 4RT0A 4DT4A 1UVSH 2XBXA 1O2RA 4P00A 1WAYB 1DXWA 4CHAC 5G4BA 3F9EA 4XD7D 3UREA 3V7TA 1IQEA 1K1IA 2O8WA 1UW7A 2O9QA 1B0FA 5F53A 4X2YA 4WJG2 3P95A 1XM1A 5EG4A 3F2HA 1ZLRA 1O38A 1P06A 1YKTA 3SZEA 4I8LA 4BAHB 2BDYA 5DP5A 2HOBA 4I33A 3UPEA 2ODPA 2BLWA 3SNDA 4XFQA 4D7GA 1SLUB 4B2AA 2AIPA 1HCGA 1ZRBA 4GCHG 1GI8B 1HXFH 1IHSH 3MNBA 3LH3A 1C2FA 2PUXB 3TLOA 2V0BA 3L6PA 3VG8A 3F2GA 2KX4A 7LPRA 2A31A 1QIXB 3MO3A 1F2SE 4X8VH 3TJVA 1AUTC 5ESBA 4E05H 4RSPA 1CGHA 2FI3E 1QR3E 3TH4H 1IQIA 1TPOA 1DPOA 4E7NA 2GJGA 3RXLA 1TMBH 1O3BA 4I86A 4GCHF 2D1JA 1G3DA 2GCTC 1L2EA 1CT2E 5HMAA 2WZQA 1EKBB 1V2KT 1TABE 1LO6A 3FVFB 6ESTA 1C4Y2 2VBCA 3VXFH 4CRGA 5LPFA 1SGTA 3MNSA 3PO1B 2ZDVH 3VB3A 2WPLS 1HAPH 1A0LA 2W6ID 1SMFE 1W0JD 4IGDA 4RT1A 1FNIA 3PMAB 1ELTA 3U9AH 4NWKA 1SGDE 3MU8A 2G51A 3PLBA 3KQEA 1AO5A 4MTBA 2SNWA 4JZIA 1AZ8A 5A09A 8ESTE 1AQ7A 3TU7H 1G30B 1C5TA 3CENA 5ESTE 4KP0A 1LVBA 1PQ8A 2FX6A 5IDKA 1O3LA 1KY9A 4GUXA 2K1QA 1LHFH 1GVZA 3UR9A 3SUGA 3RC6A 2B7DH 3WW7A 1BUIA 1MCVA 3UWJH 2HLCA 4FETA 2R3YA 2ZDMA 3GCTG 4B75A 2OC7A 3GDVA 9LPRA 3SI3H 1TPPA 1QJ6B 1V2VT 1T31A 3HKJB 4Y8XA 4AORA 4BTIB 1MD8A 2C8WB 3KCGH 4FUIA 1P02A 2YMSB 1G3EA 3SO3A 2QC2A 3K65B 3M3VA 1QJ7B 2VVUA 1RD3B 2QF4A 4Y7AA 1C1UH 3SNAA 3TPIZ 1D3TB 1C1RA 1MCTA 5T6GA 3SYJA 5EJ1A 1BRBE 1SGIB 1UCYK 4F48B 3A81A 2AIQA 4OS7A 1KIGH 2R0KA 3GCTF 1HAXB 3IITA 3OY6U 5EW2H 4AX9H 1DXPA 2ANYA 3NWUA 2Y7ZA 1RTLA 2TGAA 1O3CA 2FLRH 2EI6A 4R0IA 1IQMA 3SNCA 2C8YB 3ESTA 2ZA5A 2CF9H 2IN2A 1GJ5H 1LHDH 2F9NA 2ZFPH 4X6MA 2FZZA 5L2ZH 1KLTA 1C2IA 2EQNA 2GDDA 3O8DA 1H8ED 3GS9A 3LOXA 4J2YB 2BLQA 1NO9H 1UCYH 1CA0B 1B5GH 3F9GA 3ZYDA 1O2XA 4MNXA 4MPVA 4SGBE 2GP9B 1SKYE 4YO9A 4X0WU 2WUCA 3MNXA 1O2NA 1P01A 4RKOB 3PROA 4RI0A 4ACBA 1HAGE 1MUEB 4OS2A 2ZTXA 1A4WH 3P8NA 1J9CH 1P0SH 1XMNB 3RXSA 1GMHG 1RXPA 2FM2A 1VITH 2AERH 2TRMA 3M61U 1FAXA 1TOCB 4X8TH 5EQSA 1V2WT 2HALA 1O5CB 5I46H 1K1NA 2BX3A 4AZ2B 5FCRA 4WF8A 1HGTH 1KTSB 3HGPA 3QTOH 3P92A 4XBBA 2JH0D 3ZZ3A 1P2IA 1NFUA 3RXTA 1GI3A 1S6FA 3OYPA 4IS5A 1W2KH 1Z6EA 2YMSC 4YZUA 3KN2A 2L6OA 2VIOA 4DURA 1EPTA 1H4WA 3M7TA 1WOFA 2HVXA 1GMHF 4NZLA 3OEED 1GBTA 2P8OB 1GHWH 4Y7BA 5AHGH 1HAOH 1P11E 3ODDA 1SOTA 2H9TH 1ELBA 4GHTA 1JXPA 1KXEA 3SUFA 2WPHS 4PROA 4WXIA 5FBEA 2UWOA 4ISNA 3FZZA 2C90B 4IBLH 4M9FA 5GNDA 1BHXF 5C5NA 2VB0A 3TH2H 2FMJA 5FPSA 2G55A 1RTKA 2SGQE 2V6NA 1A5HA 1O2TA 2FPZA 2R0LA 2ANKH 3MO6A 3PRBA 3UTUH 2GT8A 3T26A 1MQ5A 2CJIA 4WMDA 4XSKU 3C27B 1FI8A 2WHXA 2XBYA 1CA0C 2ZFFH 2VGCB 2Z3EA 3IG6B 4SGAE 3S7KB 1FUJA 1L1GA 1YPMH 2THFB 2LPRA 3OE7D 2ANWA 2ZGJA 1ACBE 1J8AA 3MOCA 3W94A 1HNEE 1S6HA 4JZEH 1Z71A 3URDA 1VJ9U 2F9PA 5CHAC 3SZNA 3K6YA 3GYLB 2ZU1A 3GCHB 4MNVA 2QV1A 2BZ6H 1UTJA 1MU6B 1BBRH 3N7EA 3RU4T 1CO7E 4KTSA 5EOKA 3ZZ6A 1NRSH 2J95A 5TCCA 1EAWA 2CN0H 1IAUA 2FTMA 1FY5A 2NU4E 1MBQA 1C5SA 2VWOA 1AVXA 1O2YA 3EGKH 1TGCA 1W12U 1HIAB 4D8NA 1C2MA 1AD8H 3ZVCA 1LHCH 2P8OC 3SV9A 3LGTA 3NZIA 3A85A 1DLEA 2LELA 1KXFA 2KR7A 2BD2A 1GI0A 3EA9A 1FONA 1QL7A 3TITA 4ABJA 1FPCH 3BG8A 2KAIB 4KTCA 4AYVB 3KEEA 1F7ZA 1PPGE 1IOEA 1EZQA 2BDHA 1HIAA 1ARCA 3PYHA 5T1VA 3NCLA 1A3EH 4YOJA 2HRVA 1SGNE 1ZSJA 1GBKA 2AYWA 2VGCC 3MTYA 1BTPA 1GHBG 5KGOA 2OC1A 5C3NA 3TJOA 1EZSC 4B2CA 1F5RA 4GVUA 1O3HA 1YPHE 2ZPQA 3ZVEA 3F0OA 1O5FH 2DE9A 3E1XB 1P03A 4K2YA 3BG4B 4K5ZA 4UFFH 1OWHA 3PLKA 1BTYA 1W14U 2ODQA 3A8BA 2B9LA 2KAIA 1GJ6A 4Y8ZA 4AFQA 3GCHC 5E0HA 4INLA 2ILNA 2GVFA 3H7OA 4B6FA 3F1SB 4ZKNU 4AB9A 3Q00A 1AI8H 1Y5BT 2A2XH 2Y5HA 1ZOMA 1G3CA 1GHBF 2Z9JA 3A8DA 3SU6A 3LGYA 1GJCB 1ZHRA 2B0FA 1GVLA 2A4QA 5E2OA 3GDSA 3F2FA 3RLYH 3LKWA 3BTWE 1NY22 1Q2WA 1O2SA 1C2KA 2GD4B 1C1SA 2VIQA 5H4IB 1ANDA 1TAWA 1S83A 3A8AA 2RDEA 4NG9H 3UWIA 1O5BB 2ZWLH 3MFJA 3ITIA 3TH3H 2Y82A 1AVWA 1TE0A 1SFIA 1BJUA 1OYQA 1FY3A 1GJ8B 2EI7A 2KCAA 2WPKS 1QB9A 2UUJB 2VH6A 1SI5H 1TGNA 2PGQB
chains in the Genus database with same CATH topology
1CE5A 1NN6A 1A3BH 3LT3A 1P2MA 2P93A 4A5TS 1THRH 3BEIB 4ABAA 1J15A 1A7SA 3TNTA 2G4TA 2DUCA 1O3DA 1E35B 1O3KA 3TNSA 4ABEA 3A84A 1UTMA 2LNCA 3RMLH 3SJKA 2AMDA 3RXAA 1MTVA 2ZQ1A 2OQ5A 1XUKA 5EW1H 4MG3A 5GWZA 3P8FA 3RXEA 3BG4C 1QBOA 4ASHA 3RP2A 2ODYB 1Y3XA 2ZFSA 3PTNA 2FLBH 2GCHG 2W3IA 1A2CH 2QXGA 2C93B 3RDZA 2V3OH 1Q3XA 1T32A 3S69A 2ZHDA 7KMEH 1BMAA 1H8IH 3CS7A 3VEQB 1S85A 1T7CA 5E8EH 1P10A 4GAWA 4YLQH 7ESTE 1BRAA 4MPXA 4X6NA 1A0JA 1MMJN 1ZGVA 5C20A 2JKHA 3G01A 5DP4A 3MNCA 1GCTB 1PQ5A 1HV7A 1H1BA 2HNTE 2GCHF 3PLPA 1XKBC 2BDIA 2BY7X 2NU3E 2P59A 1C1MA 2TBSA 1GMDG 3STJA 1V2NT 1QRXA 5TJXA 3OSYA 5L6NH 3A87A 2BVXH 2GDEH 2QAAA 3QUMP 5EQQA 3KL6A 3PM3A 2PUQH 1O3IA 3BTDE 3DFLA 1EQ9A 1VGCB 3K9XB 3M3TA 1P9SA 5A0BA 1GMDF 2A5KA 2ZI2H 3M7QA 1TRMA 3V12A 2VNTA 2R9PA 4YT6H 1K21H 2FOCA 2NU2E 3T28A 4AFUA 4DGJA 3QLPH 4WMEA 1BT7A 1LPKB 1KDQB 1C1PA 1UTPA 4BAQB 3NUMA 4CBOA 4LK4A 4BAOB 1TGSZ 3D49H 2IJOB 1MKXK 1HFDA 2A4OA 1IQGA 3BN9A 1PJPA 1PPBH 1WU1A 3E0NB 1NT1A 1O3JA 1OX1A 1P9UA 3SV6A 4WH8A 3A7VA 1NZQH 3FZDA 5FX6A 2HNTC 4FUEA 3ZVBA 4D9QA 1E38B 4MNWA 1GHXH 4RN6A 4CRCA 8GCHG 1GHAG 3OTJE 2ZHFH 2QCYA 2QN5T 2ALPA 4YT7H 3A8CA 4GSOA 3EDXB 1P12E 4IN1A 2FTLE 4NIWA 6GCHF 1GCTC 1KDQA 3D23A 1MKXH 1S84A 2Y6TA 5T6DA 5FCKA 1X7AC 1C1NA 2BMGB 1F0RA 3A7YA 5GCHG 1XUGA 3RXHA 1O2WA 2VU8E 1EJNA 2TPIZ 1AKSB 2Y5FA 8GCHF 1MKWH 1GHAF 4ZHLU 2FOFA 4Z6AH 1G36A 2BY5X 3VGCB 1SLVB 2F91A 2BDCA 1NU9A 2BM2A 2HGTH 2XXLA 5LH8A 1IQHA 5DGJA 3FP8E 2BQ6B 4AGKA 3SV2H 5F6MA 1VGCC 3GICB 1QHRB 4FU7A 3QZRA 3K2UA 4GPGA 2AMPA 5GCHF 3S0NA 5ETXA 1FIWA 2BVSH 1BTZA 1C5MD 1HAHH 4CRAA 1F0SA 1TALA 1WCZA 1ZPCA 1AKSA 1BITA 3EA8A 1QRZA 3GCNA 1ID5H 4LZ1H 1XX9A 1E37B 2OD3B 2UWPA 1GBMA 1S0QA 2ZG0H 2PLXA 3ATLA 1K1JA 4ISHH 1WQSA 2HNTF 3LC5A 1O39A 3SU5A 2P16A 5A8ZA 3ODFA 3QZQA 1WSSH 3GY5A 3AW1A 3MU5A 3AASA 5HYOA 2ZGXH 5EGMA 1XKAC 3SHCH 2SGAA 5EXMA 1ZPBA 3S9CA 3DHKH 1MBMA 1OP8A 5LPRA 1TFXA 2O8LA 2FDAA 3MU4A 2Z9IA 2BXTH 1YM0A 1C1WH 4ISIH 3ATKA 3BTTE 1BTXA 5DJ7A 1VCWA 2XWBI 4FUBA 3SV8A 4I7YH 2YNBA 1SQTA 1BRCE 3DFJA 1P57B 1SSXA 3ELAH 4NZQA 1G32B 4CR5A 5DP3A 2A4GA 4U30A 2B8OH 3GY7A 3A7XA 4ZROA 3VGCC 2ZGHA 4Q80A 4BAMB 1TNIA 2F9UA 2Z9GA 1FDPA 3SNBA 1ESAA 1QTFA 3MH5A 3ZVGA 1TYNA 4AYYB 2QIQA 3BEUA 1GGDC 1HLTH 1SGYE 1OS8A 2ZPRA 1AY6H 2RG3A 3BTME 5FXLA 1Z8JB 1WUNH 2F9OA 1BHXB 1C1QA 2A4RA 1LTOA 3ZZ7A 2W3KA 2JH5D 2RA3A 3V13A 1SVPA 1UTNA 2A5IA 4ZXXH 1QJ1B 1EASA 1ZR0A 4NCYA 1J14A 4B71A 1MTSA 1C5XB 1K1OA 4HZHA 1S0RA 2ZCKP 3QTVH 5DK1A 3QWCH 2Q1JA 2Z3CA 4NA7A 1W10U 4WH6A 2ZHEH 2V35A 1V2UT 1ZTLA 1NC6A 2VJ1A 2ZU2A 5F8TA 1UVOA 4NWLA 5E2PA 1O5GH 2BD5A 2ZO3H 1P04A 1YYY1 5EODA 2W7UA 1GBFA 1CHOG 2ZGBH 3UOUA 2VVVA 2TGPZ 1GCDA 1GPZA 1DX5M 2OUAA 2ZDAH 2FEQH 1SLXB 3B9FH 2Y7XA 3M36A 2VIWA 2FOMB 4I8JA 2OINA 1Y8TA 3Q3YA 2GZ7A 1SGCA 3A88A 1QURH 1GJAB 4LXBH 1QA7A 1CHOF 1NFWA 4YM9A 4UD9H 1OOKB 2BHGA 1H9IE 1O33A 3BTKE 4O97A 4AFZA 5BRRE 3O8RA 1L1JA 1S5SA 1P05A 1BOQA 2V3HH 2Z3DA 3U8OH 1CSOE 2FX4A 4FUCA 1ZJDA 1C5UA 2GZ8A 3N7OA 3PMBB 2VINA 1ZTKA 3LJJA 5K0HA 1WQVH 1K28D 1KXBA 4K1SA 1O2UA 4AOQA 3SI4H 1O3PB 3ZZCA 3SU3A 4DVAU 3ZZDA 4WWYA 4ESTE 1GHVH 1P3CA 3HK3B 3A7ZA 1FN8A 1UTLM 1TQ0B 2R2WU 1YGCH 5CHAB 3OU0A 1K9OE 4MVNA 1GJBB 4H6TA 4ABIA 4AB8A 1O3NA 1TRNA 2PKSB 1ELCA 3RU4E 4XOJA 4CBNA 2ANMH 3BIUH 4UEHH 2O8TA 2PR3A 1IQKA 1O3AA 3MYWA 3PMJA 5PTPA 1THSH 2Z9LA 1RGQA 3LPRA 2EC9H 4UDWH 1A5GH 1FJSA 3AW0A 1ETRH 5DP9A 2FI5E 4B73A 1ZMJA 1WTHD 1SC8U 1KLIH 3MH4A 1YPEH 2OQUA 1EAUA 1QY6A 1PPZA 1C2EA 3EQ0H 2BTCE 2XC4A 4BANB 1MQ6A 1KXDA 3MI4A 1GL0E 1LHGH 1QRWA 1NRRH 1Z7KA 3QO6A 3RMMH 4ZKRU 2FP7B 3S9BA 3JZ2B 2GKVE 4B76A 4ZHAA 2HPPH 1DT2A 2WPJS 3IWMA 1S81A 4WXVA 3M3SA 4AG2A 1C5ZB 4OS6A 8LPRA 1W7GH 1C9PA 2QXJA 2WV4A 1K1PA 3ZZ4A 1GI1A 1BMNH 1YP9A 2AGIX 3QX5H 3TK9A 4YOIA 3LONA 1DICA 2PSXA 2Z6BD 2OLGA 4JZ1A 1QL9A 3ATMA 2BD7A 2YNAA 3E6PH 1FPHH 3SN8A 1AMHA 1LHEH 3A83A 3BTHE 2FOGA 1DDJA 2WPMS 1ELDE 2ESTE 2OXSA 2BLOA 2H5CA 4I31A 1AUJA 2PKSC 3SGAE 3SU2A 4IN2A 1TRYA 3C1KA 4ISOA 3RUOA 1VJAU 4HI3A 4Q7YA 1T8NA 5JBBS 5E0GA 2OBOA 3GY2A 3SV7A 3UFAA 1S82A 2ZEBA 4H42U 3W95A 1QQ4A 5JB8S 5IYTA 2NWNA 1GBBA 3RMNH 1ZJKA 1EATA 4ZKSU 1FLEE 1AWFH 2J4IA 3HGNA 1FN6A 1V3XA 3LGVA 1PQAA 2FXRA 1E36B 1ELVA 3QDZB 4D7FA 4AG1A 1NPMA 5CMXH 4ZH8A 1L4DA 3VPKA 1PYTD 5F03A 1C5PA 1K2I1 2SFAA 3PV4A 4DOQA 1EB1H 2BQ7B 1TPAE 4JYUH 3RXVA 5GXPA 5AFYH 3OY5U 1O2GH 2H9EH 4FU9A 4Y0ZE 1GBHA 1F5KU 2WPIS 1V2LT 1ETTH 4Q2KA 3TVJB 3RMOH 2EA3A 1XUIA 3A7TA 3AVZA 1AIXH 1LMWB 4IMZA 3TGIE 4BNRA 1C4V2 5EPYA 3SJOA 1DVAH 3Q3KA 1DUEA 4Y79A 2OC8A 1C5OH 1G3BA 4Y71A 9ESTA 2J94A 5E0JA 1MH0A 3GOVB 1JRTA 2QXHA 1HB0B 2XWAA 1C4U2 1AN1E 1CHGA 2B5TB 1VCQA 3RXOA 1W3CA 5GIBA 1O5EH 4X8UH 1BBRE 5GJ4B 1EOLA 1KYNA 3CP7A 3SU1A 5EXNA 1ABJH 2A5AA 4U32A 3HK6B 1C9TA 1EXFA 1P3EA 2QGRA 3RXBA 3UUZA 1JMOH 1SPJA 1C2HA 2BDGA 1GDUA 1TNLA 2G8TA 1TONA 1UTOA 3ZVDA 2FS9A 4IC5A 3M7UA 2H6MA 7GCHG 3B8JA 4MPUA 1AE8H 1MTNB 4I8GA 2BD4A 2ZZUH 2WUBA 4MNYA 2SNVA 2PGBB 2VWMA 4JYTA 3NK8A 1GI5A 1YPLH 3T25A 2ASUB 5JBTA 2FESH 2UUYA 4KKDA 2H2ZA 1ANEA 1KSNA 3Q77A 1EUFA 1MTWA 2P3FH 3KIDU 2VH0A 3Q3XA 1O2IA 7GCHF 1C1VH 4H6SB 1B7XB 1N8OB 4OS1A 1ABIH 2XW9A 2XBVA 1AVGH 3ZZAA 1FZZA 3RM0H 5AF9H 1W0YH 4F49A 4DY7B 1YPHC 1EZXC 2QF3A 3NPSA 3TIUA 2FWWA 2BY8X 1HDTH 1HJ8A 1QFKH 2ZFTA 5DP6A 3ZV8A 2PSYA 5A2MH 3RXFA 3SBKA 3RLWH 2J92A 1MU8B 2BDAA 4WVPE 1BJVA 3B23B 3CS0A 5DO4H 2BY9X 3KF2A 3MU1A 5J4SA 1XUHA 1OPHB 1GMCG 3U8RH 4Y6DA 1LKAA 1LPGB 1BB0B 4IMQA 1SGFG 1Y3YA 2ZU3A 4X8SH 1XXFA 3EE0B 4THNH 1K1MA 2P3UB 2BDBA 3DUXH 1CA8B 4INHA 2QF0A 4ABFA 4AN7A 1A46H 1E34B 3PWBA 3V3MA 1C2JA 5HXFA 1AFQB 1AHTH 3SJ9A 6CHAB 3SOSA 1EJMA 2A2QH 3ZVFA 1ZGIA 1MTNC 1ELAA 4X1SU 1NRPH 2J9NA 4ABDA 2C8ZB 3T62A 1TNKA 2OTVA 3ZV9A 2GTBA 4B74A 1P09A 1YC0A 1Y5AT 1GI6A 1UK2A 3ZVAA 1KXAA 1N8OC 4R8TB 1UVTH 4K69A 1A5IA 2J2UA 4YLUA 2Y81A 1HPGA 5HM9A 3VB5A 1N1LA 2SGFE 3E90B 1MAXA 4FVBA 3MWIU 5F8XA 2PTNA 2I6SA 5A8XA 4J1YA 2XC0A 4NIXA 3E0PB 2ZFQH 1V2PT 1ANBA 1TIOA 5GDSH 3SGQE 2WYGA 2JETB 2EEKA 5TCAA 4A1VA 2NU0E 1Z8IB 3BTFE 1CGIE 3FP6E 3RXQA 1FY8E 1DWBH 5C1XA 2XNIA 4K8YA 2SGDE 1OWKA 1O36A 1V2RT 2H5DA 4HTCH 4NFEA 4DT7B 4QT8C 2ZPSA 2ZDNA 2FOAA 2CV3A 2P95A 4UFGH 1SGQE 2GV6A 3P70B 1BIOA 1HBTH 2FODA 2AH4X 1GBEA 5JPMH 1DS2E 2BXUH 2G5NA 1WTGH 5GPIB 1AFQC 6CHAC 5FHTA 1PFXC 3S7HB 1V2TT 1T4VH 1WBGB 1NM6A 3P8OA 4OS5A 1L0ZA 2PV9B 3FANA 4X6OA 1TBQH 2ZP0H 3VB4A 5JBAS 1LVMA 1IQJA 1E0FD 1GBCA 1H9HE 3GISB 2P94A 3M35A 1Y3WA 2BD9A 2GGVB 1UVUH 5DP7A 1NROH 1O2JA 6LPRA 1EAIA 1GBDA 1SGRE 2G81E 2F9VA 4I32A 4MQAA 1SB1H 3UY9A 2XTTB 1TNHA 1O3OA 1ZRKA 4ISLA 4JZDH 1MAYA 2FS8A 1EP5A 1CT0E 1ANCA 3UNQA 1EB2A 4MDSA 2AS9A 1XVMA 1T8MA 2BQWB 2AEIH 1BDAA 1GGDB 1OXGA 1OP0A 1ZHPA 3LC3A 5JBCS 1O2KA 3U1JB 1AB9B 1GDNA 3R3GB 1Z8RA 2GT7A 3TGKE 1FV9A 4Q7ZA 1O5DH 2JETC 2ZCHP 4X1QU 3H5CB 4D9RA 3EAJA 1IQNA 3KQCA 1WV7H 4TY7A 3RC4A 1UO6A 3SJ8A 1OSSA 1M9UA 1O32A 1ZZZA 4ABBA 3I29A 4K8BA 3SGBE 3SU4A 1BA8B 2OC0A 1UTQA 1RRKA 4DIHH 1CT4E 1GBIA 4A92A 3A86A 1GJDB 1BCUH 2A0QB 1P2OA 3VB7A 1JIRA 1TNGA 1O2MA 2STBE 1D6RA 1GDQA 3M5OA 3BIVH 1EZUC 1THPB 1TBZH 1GI4A 2XCFA 4NGAH 5C5OA 1ZSLA 2UUKB 4AGJA 3L33A 2YOLA 1ZYOA 1Y3UA 4FVDA 3KQBA 1EJAA 3E91A 1LVYA 1QQUA 2ZDLA 1CBWB 1GJ9B 3GCOA 4UONA 2C3SA 5C1YA 1HAIH 3A80A 2BX4A 1O2QA 1DWDH 1HAYB 3SORA 2CHAC 2GX4A 3UNRA 1DWCH 1N6XA 3HPTB 3UQVA 8KME2 1GJ4H 1P2QA 1O3FA 3HATH 4I8KA 1GJ7B 2BY6X 1H9LB 5A8YA 4HGCA 4MPWA 3V0XA 5EXLA 4HFPB 1V2OT 2D26C 3T5FH 1TLDA 3JZ1B 2ZQ2A 1Y59T 1AB9C 1V6DA 1QCPA 1D3QB 1UTKA 4ZMAH 1NS3A 4YESB 2BLVA 2H9HA 5B6OA 3EA7A 3GY3A 1P2KA 1Q31A 3LGUA 1NTPA 2FO9A 4JCNA 1C5VA 1GHYH 3P6ZB 4JZFH 1DWEH 3MMGA 1TBRH 2HPQH 1V2QT 1DM4B 2ZECA 4XBCA 2Z9KA 3PMHB 4OS4A 4Z0KA 1FIZA 1P8VC 2XCNA 1T8OA 2O8UA 4UE7H 2R3UA 1GG6B 2OP9A 4FUJA 1SG8B 3RXGA 1C5QA 1Y3VA 3BV9B 2ZNKH 1O2VA 2G52A 1O5AB 1FMGA 4WY3A 3Q76A 5EU8A 4DCDA 1INCA 1AGJA 1C2DA 3BTEE 1D9IA 1C5NH 1W7XH 3SJIA 1CBWC 2ZFRH 2NU1E 4Y0YE 4E7RG 5AVDA 1ZSKA 1IHT