1C5VA

Structural basis for selectivity of a small molecule, s1-binding, sub-micromolar inhibitor of urokinase type plasminogen activator
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TRYPSIN)
publication title Structural basis for selectivity of a small molecule, S1-binding, submicromolar inhibitor of urokinase-type plasminogen activator.
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5vA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5vA02
1O2HA 1C1WH 1TOMH 1GBDA 1O5EH 1DITH 1HRTH 2J4IA 4UFGH 1PQ7A 2BY8X 1AO5A 5HM9A 1OYQA 2I6SA 2CHAC 3BTME 4HTCH 4OS5A 1LVOA 3RXDA 1ZOMA 1LKBA 3K65B 3NUMA 1Q2WA 1K9OE 4AFQA 2B9LA 1YCPM 2NU1E 2GX4A 5AFYH 5HXFA 1A5HA 1C1QA 1V2PT 2ZQ1A 1P12E 3KHVA 1AU8A 4BNRA 1TPAE 7GCHG 1GBKA 4IMZA 1QRXA 1BBRK 1BTHH 1GMCG 2EI8A 4KKDA 1J17T 2VH6A 1MMJN 1BRAA 2FM2A 1E36B 5EPNA 1U6QA 3BTTE 2XXLA 4K1SA 1A3BH 2OTVA 3PMBB 2G4TA 1J8AA 1Y3YA 7LPRA 3RM2H 1ZPZA 1N6XA 5JBCS 2ZA5A 3D62A 3UR6A 3U98H 2WPHS 3SV7A 4LZ4B 1BRBE 4RKOB 1C5PA 4AGJA 4WH6A 9ESTA 1UCYK 3MNBA 1C2EA 1TBRH 5FX5A 4BXWA 1DWBH 2BVXH 2ULLA 2ZDNA 3RXLA 2FS8A 1O2ZA 1DY8A 1TALA 4K60A 1H9IE 5GWZA 4DGJA 3OY6U 4NIVA 3BG4B 1J14A 2H6MA 2B7DH 2NWNA 1SOTA 1XVOA 1BMNH 4WXIA 1CSOE 4YOJA 2XNIA 2LNCA 1PFXC 2QXIA 4I33A 3SJOA 3GOVB 2FO9A 2FPZA 3BTKE 3MU0A 3A7XA 4ABEA 4A5TS 1ANBA 1O2MA 4R0IA 1EKBB 1EZSC 3M7QA 1BTZA 1P02A 2FYQA 2SGAA 3AW1A 4MG3A 3V12A 4K1TA 3TJNA 3ZVGA 3PTBA 4AB8A 3GY6A 3CP7A 1WOFA 4NWKA 2W3KA 3S9BA 1K2I1 2THFB 2FOBA 5F03A 2STBE 5IYTA 2NU2E 3ESTA 4OGYA 2C90B 5EQSA 1GI1A 5ESBA 1O5AB 3T28A 1L1NA 2C8ZB 1MTWA 1Z1IA 1TNIA 2BQ6B 7ESTE 2BY7X 2ZDKA 2H9TH 3URCA 2ZFFH 2ZTZA 3A8CA 2OINA 2CGAA 1C1NA 1WQVH 1B0FA 4UDWH 3GY7A 1MTNC 1NS3A 1EOLA 1Z6JH 4JK5A 1TYNA 3PB1E 2FX4A 3HKIB 1MU6B 5DP6A 1SLVB 5EW2H 1THPB 1GDQA 3SGQE 5I25A 1BUIA 2QF0A 5E2OA 2A32A 1HLTH 1TMUH 5FPYA 4MVNA 4A1TA 1SSXA 1EPTB 3LU9B 2WPLS 1AQ7A 1ZTJA 1V6DA 2A4QA 2W26A 2R0KA 4K8YA 2ODQA 1SOZA 3UNQA 1C5XB 1NU7B 1ZGIA 3L3TA 1ORFA 4FUDA 3HK6B 4FUHA 3HGPA 1GJDB 5H4IB 5DP7A 1LPGB 1AMHA 1ZLRA 3GCTG 3BV9B 3UFAA 1GJCB 4VGCC 1EASA 1D3PB 1TNLA 3ZVDA 1E37B 2KAIA 1IQFA 2GCTC 2ANMH 1TNKA 2ASUB 2OLGA 2R0LA 2XC4A 1SGNE 1PPCE 5F8ZA 1J15A 1K21H 4NCYA 4FU9A 2Y5HA 3GDSA 1V3XA 2OCVB 5DO4H 1SLWB 8KME2 3FVFB 3Q76A 1IHSH 1LVMA 2FIRH 3SBKA 3DD2H 1PPZA 3BTFE 3TGIE 1KDQB 2BLVA 3GY3A 4B2BA 1QTFA 2ZTXA 3IG6B 2VNTA 2J95A 5C5NA 4ABIA 1C9TA 5GXPA 1WTGH 2HLCA 2Y7XA 3LT3A 1ESBA 4Y10E 4DT7B 4XBBA 1TGCA 2HGTH 1GCDA 2Y7ZA 1O2TA 1ELTA 1O3KA 3LC3A 4E06H 1P2OA 2BMGB 1O38A 1O2PA 2FMJA 3A88A 2GZ8A 3RXCA 4MPVA 1LHEH 2PFEA 2P8OB 1EP5A 2H9EH 3T5FH 2O8TA 3S69A 1MZDA 3TITA 3ENSB 1O5GH 2WUBA 3V0XA 1HJAC 1NC6A 1JRSA 2RA3A 1VGCC 1AFEH 1KXCA 1XUGA 1ZHRA 3QUMP 1A5GH 3TK9A 2IOTA 1O2QA 2FOMB 1G2MA 4M7GA 1RTFB 3SI3H 8LPRA 4FVBA 3ATLA 1HJ8A 1W7GH 5A09A 2BZ6H 3S9CA 2OC7A 2PKSC 2O9QA 3H7TA 2BY9X 4RSPA 2BD9A 4TY7A 2V3OH 1SR5C 4KP0A 2GDDA 1AE8H 3LGUA 1PJPA 1O31A 3Q00A 2VWLA 3K9XB 2BB4A 1XUHA 1SGIB 3V3MA 5EXMA 2SGFE 4U32A 2FOFA 2NU0E 1P2JA 4WJG2 1K28D 2EC9H 4NA8A 1O2UA 1LQEA 2A5IA 1IAUA 1GJAB 5F6MA 1NY22 4ISIH 1THRH 1TPSA 3RXTA 1JRTA 2BYAX 1Z6EA 1GI3A 1NFYA 5T6DA 1OXGA 3RXKA 4CRDA 3D23A 2UUFB 4JYTA 1AGJA 1P01A 4IC5A 4XOJA 5A2MH 3RLWH 4ZKOU 3MU4A 4B1TA 1O3OA 1W7XH 1C5VA 2BDYA 4YT7H 2XWBI 1P10A 2FOGA 1CHOF 2FI3E 1GBAA 4LK4A 2BX4A 3SJKA 4DIHH 2ZQ2A 3GICB 3M5OA 1QL7A 2XTTB 3QZRA 4X6NA 1EJMA 1QY6A 3TLOA 2AGEX 4AG1A 1K1OA 1DVAH 1KXAA 2XCNA 2FOCA 1AZ8A 1AVXA 1G2LA 2FLBH 3BTEE 4TYDA 4A6LA 1C2GA 1YLCA 1RJXB 1SFIA 1M9UA 2BQWB 4JYVH 2VGCB 4ABBA 4CHAC 3MNXA 3SNAA 3SN8A 1ZTKA 2TIOA 1C5YB 1E38B 1F5KU 2QV1A 5EXNA 2J34A 1LTOA 1UK3A 1Z1JA 2ZCHP 3LDXH 4E7RG 1C2JA 2ZC9H 4TY6A 1IOEA 2ZPQA 3GY4A 1GMHF 1E0FD 1WBGB 1S85A 1XKAC 1UTMA 3MMGA 1EUFA 3E16B 1LPKB 2F9NA 2ZGCA 1C5NH 4GHTA 3GDVA 3A8AA 4ZMAH 5LPRA 1ANDA 1HAVA 1LMWB 1IQHA 3ZV9A 1C2HA 1Y5AT 1SGCA 4FUEA 1KLTA 2UUYA 2Z9LA 1V2MT 1DM4B 2BDAA 4ISOA 2GCTB 3ZVAA 1ACBE 3GCOA 3GCNA 3MH7A 1C9PA 1QJ1B 1EXFA 1NFUA 1T8NA 2ZU3A 1JIRA 2AGIX 2Y80A 1AKSB 1L0ZA 1OYTH 1XM1A 1NFXA 2Y5FA 4DURA 5E2PA 1HDTH 1HJ9A 3PV4A 1NRRH 1OWKA 4AFUA 1P09A 3U8OH 3RU4T 3D49H 5GDSH 3T29A 3JZ1B 1S84A 3TJOA 1RTKA 1UTQA 4B74A 5CHAB 3A89A 2C8YB 1UTPA 4AYYB 1VR1H 1HPGA 1WU1A 1RTLA 3RXBA 1LVBA 1VCQA 1LO6A 1HAPH 2CXVA 2A1DB 1ANEA 1A7SA 1F5LA 2ANWA 2SNVA 1FIZA 1ELBA 1A3EH 1SGYE 2F9UA 1C1SA 2BXUH 2ZP0H 2GZ9A 5L30H 4WVPE 4I8KA 3M61U 1V2QT 1C2MA 2ZHDA 3A81A 4AN7A 5DP3A 2GT8A 2BD3A 3EQ0H 1P3CA 3GYMA 2UWPA 4BOHA 1LHFH 1O2NA 4OS7A 3RP2A 1D6RA 1Z71A 5HMAA 5E0GA 3ZZAA 3BSQA 1P9SA 3UWIA 2Z3CA 2FS9A 1GHBF 3UNRA 1GDNA 2WPKS 4D7GA 4MDSA 1WYKA 3BG4C 3T26A 4K5ZA 1TGSZ 2NU3E 2JETB 3U1IB 3LGWA 5A0BA 3LGIA 3PLBA 3K2UA 2P16A 1K1JA 2A2QH 3OYPA 1T32A 1YGCH 3M5MA 4IW4E 1EZXC 3UNSA 3RXGA 1F0RA 1UJ1A 1PQ5A 4ABGA 1GG6B 3CS7A 2ZHEH 2PWXA 4KELA 3NWUA 1CBWB 2D2DA 2FOAA 2UWLA 2OBOA 2P3FH 3W95A 2FI4E 3SU2A 2R2WU 3NPSA 1G3CA 1NRQH 1QA0A 1YYY1 1P11E 1NRNH 2RDLA 4BANB 4I7YH 1C5RA 1O2KA 2ZTYA 3MU8A 1GJ6A 4X2WA 4KGAA 3VPKA 1SLXB 5DP4A 3MO9A 2SGPE 2ZEBA 3SOSA 3F9FA 2GV7A 1V2ST 1V2TT 1O33A 3ATMA 3ODFA 4BTIB 1NT1A 5AF9H 1NPMA 1V2NT 4XDEA 3TNTA 1L1JA 2O8MA 3HATH 3ATKA 1AFQB 5A0AE 1KTTB 4CHAB 4KTSA 1GHAG 4ZKNU 1Q3XA 4ZKRU 1EPTC 1RD3B 1UHBB 5FCRA 5FPTA 1OKXA 2XYAA 1WCZA 2ZHWH 4SGBE 1L4ZA 2ZPRA 3L6PA 3KQEA 2BLWA 4AORA 4NGAH 1ZSKA 2A4GA 1DLEA 1XXDA 3RC6A 2A5AA 2FESH 3M35A 3OSYA 3RXFA 2ZWLH 3K6ZA 3SUEA 1QIXB 1P2NA 4WXVA 1F5RA 1TNHA 3AVZA 1GHWH 4A1XA 1O2JA 1TA2A 1FUJA 3SV2H 1VCWA 5TCCA 2GMTC 1GI4A 1QNJA 3MU1A 2ZU4A 1O3BA 1YCPH 1FDPA 2GZ7A 3F68H 1BITA 1QBNA 1HAIH 1GBTA 2OC0A 3S7KB 2Y5GA 2ESTE 1O3FA 3BTGE 4TPIZ 4XFQA 4JCNA 5FBEA 3SNCA 3SV8A 1ELVA 2FDAA 2Z7FE 1V2LT 2BLQA 5DPAA 1BTUA 1LCYA 2B5TB 2FXRA 3UTUH 2BOHB 1XUKA 2QY0B 4Q80A 3UQVA 4K1EA 4ZXXH 3H5CB 2GDEH 2D26C 2TRMA 1ZRKA 4XSKU 4B75A 2ANYA 2F3CE 3ITIA 1N6YA 2IJOB 1GVZA 4H6TA 4IC6A 5EOKA 2ZGHA 1MTSA 4E05H 1FPHH 1O3EA 4CH8B 5E8EH 3ZVEA 3PROA 1P2KA 2F9VA 3SU1A 2A7CA 4X2XA 1MAYA 1QL9A 1BQYA 1GI6A 2P8OC 1KSNA 2O8LA 4ABJA 3MH5A 3EGKH 2W7UA 4DCDA 1EZUC 1TAWA 4OS2A 2ILNA 1HAOH 4KTUA 2BLOA 3OX7U 2P3TB 2QYIA 1KYNA 1YM0A 4ASHA 1SGDE 1BMAA 1T31A 1LDTT 1LHCH 1MZAA 3KGPA 4ISHH 2R3YA 4PROA 1Y3XA 3SJ9A 2VJ1A 1FAXA 4DG4A 3UIRA 4OS6A 2XC0A 8GCHG 5C1XA 2QCYA 3TGKE 5PTPA 3RMLH 1MQ5A 2J2UA 1MH0A 2SGQE 2A2XH 4WY3A 3RXMA 3MYWA 2BXTH 3PWCA 1XVMA 1GHBG 5T6FA 2XW9A 3RXVA 4H6SB 1S0QA 3ZZCA 1GMDG 5AVDA 1F2SE 3F1SB 2Z9KA 1W13U 1ZPCA 1MQ6A 4BTTB 1QL8A 3VGCB 3QGJA 3R0FA 1O3HA 1YPLH 4AB9A 1SQTA 5EQRA 4AGKA 1QHRB 4CRCA 2ZHQH 2QC2A 2FI5E 3SHCH 1S0RA 1GCTB 2W5EA 3SUDA 1UVSH 3E6PH 1DUEA 1W8BH 2P94A 1W11U 4GUXA 3IITA 4HZHA 1O2LA 3FP8E 1DUAA 1ELGA 1OPHB 2BD2A 4Q7YA 1AUJA 4DOQA 1T4VH 3SGAE 2AIQA 4Y79A 1C5UA 2ANKH 2DE9A 1TRYA 2SGDE 1GBHA 4H4FA 1C2IA 5GCHG 5C67A 3SZNA 3DT0H 3LGYA 3BTDE 2PGQB 2PUXB 5FX6A 2VGCC 2W7SA 1KXBA 2B0FA 1TIOA 3PLKA 1V2JT 1JXPA 1G3BA 1EAUA 3ZZ3A 2BVRH 2BD4A 2O8WA 3UUZA 2GCHF 5T6GA 5HYOA 5K7RA 4D8NA 3ZZ9A 1W0ZU 3P17H 1O30A 3ZZ4A 2QXGA 1O39A 1XUIA 4X1PU 1O2SA 1XXFA 1C1TA 1DSUA 2H5DA 4NIYA 2AFQB 4FUCA 5TCAA 3LGTA 4DY7B 1H8IH 1UO6A 1A61H 1O36A 1O5BB 1G30B 4DW2U 4O97A 3T27A 1DLKB 1V2OT 1DE7H 3VB4A 1P8VC 1ELDE 4ISNA 5EXLA 4UFDH 1YPKH 3NKKA 2WUCA 2C4FH 3A82A 1UTKA 1GHXH 3KIDU 4UONA 1GVKB 1K1LA 4LXBH 3PLPA 1VITH 1EJNA 4JMYA 5FHTA 2GMTB 4JZDH 1SFQB 1GHYH 3M37A 2PR3A 1A5IA 3LH3A 3EAJA 3R3GB 1FLEE 4FU8A 4MNVA 1ZHMA 3TH3H 3QZQA 1AHTH 2XC5A 1OX1A 4U2WA 1C2FA 2FOEA 1C4V2 1GI8B 1KDQA 1JWTA 1OP2A 1AWHB 4CRBA 2ZU2A 1EP6A 4X8UH 1LQDB 1F0UA 2OQ5A 1MKWH 5CHAC 6ESTA 2VIOA 4H42U 1F0SA 1G3EA 2ZPSA 3EE0B 1DXWA 1QBOA 1HCGA 3ZZ5A 4CH2B 2J94A 1G36A 1C2DA 4Y6DA 2BVSH 2OUAA 1W10U 1W14U 2G81E 1GL1A 3M7UA 4HGCA 3MNCA 1S83A 1K1PA 2CN0H 1DWCH 4IGDA 1DDJA 4IBLH 1QR3E 1RS0A 1SMFE 2WPJS 3EYDA 4SGAE 4FUGA 2C8WB 1D9IA 2BM2A 1QBVH 3PYHA 3I78A 3P8GA 1AE5A 1LHDH 2EEKA 1CGHA 1TPPA 1GBLA 2QGRA 1EX3A 3ZYDA 3VXEH 1AVGH 1ELFA 2AS9A 3P70B 1PYTC 2Z9JA 2H2ZA 3KF2A 3RXEA 4BAQB 5SGAE 1O3AA 2GT7A 1A4WH 2ZFPH 2JETC 3DA9B 1G3DA 3C27B 1FNIA 2ZFRH 1BMMH 4KTCA 2ZZUH 3SORA 5JBTA 2P3UB 4AOQA 1O2XA 1O5FH 2Z9GA 1GBEA 3MHWU 5DP8A 2A4OA 4I8HA 2Y6TA 1GWAA 4Y8ZA 4F4OC 1C5MD 3KNXA 1QCPA 1GG6C 3V7TA 2R3UA 3RUOA 3VEQB 5C3NA 1CBWC 1O2OA 4IN2A 3SUFA 2OC1A 1QRWA 2XBVA 1Q31A 1V2RT 3SJ8A 3SU4A 3RLYH 1GJBB 1KXDA 1H9HE 1OWJA 1O3GA 4D7FA 1CT2E 4R8TB 1F92A 1FY1A 4JK6A 5EQQA 1CE5A 3RDZA 1O3JA 2SFAA 5JB8S 1O37A 1UMAH 1D3QB 5DP5A 4MNXA 1SC8U 4UFEH 1TNJA 4GLYA 2D1JA 1TQ7B 3E0PB 5DG6A 3ZV8A 3WY8A 3KCGH 1GI0A 1OWDA 1ZJKA 5ESTE 4ZUHA 1B5GH 1HIAB 4INHA 1TX8A 4WH8A 5A8XA 3PWBA 4INKA 1AFQC 1YP9A 1AB9B 1C5TA 3ELAH 1Y5BT 2WV4A 3F9HA 1CHGA 4GCHF 3MO6A 3KQBA 2FP7B 1TRMA 4JZ1A 2GCHG 2FYRA 2ZDAH 1SHHB 3ZVFA 2BQ7B 1TONA 4ZHMU 2PKAB 3M3VA 3SQHE 4O3TA 2BDGA 1BRUP 3A7TA 1ESAA 5G4BA 2VWNA 1YPEH 1KLIH 1SVPA 3M5LA 4YM9A 2QN5T 2OXSA 4BXSA 3TVJB 1IQKA 1D3TB 2VIWA 2HPQH 1ETSH 3T25A 3RM0H 4YTAA 1GJ8B 1A0HB 3SU6A 4O9VA 1PQ8A 2G5NA 4MPWA 2EI7A 1WTHD 1YC0A 4K3JA 4CRGA 3SQEE 1O5DH 1KTSB 2P59A 3G01A 1QA7A 5GJ4B 3P6ZB 3VB5A 4X2VA 4WMFA 3RMOH 4YOGA 2A4RA 1AKSA 1HAVB 3VB3A 4DJZB 3EA9A 3O8RA 1X7AC 3O8CA 1BJUA 1C4Y2 1DX5M 3ZZDA 3URDA 1MKXK 1UK2A 4BAMB 6GCHF 3S0NA 4NIWA 3P95A 1Z8IB 4IN1A 1O3CA 1WV7H 1E35B 2GV6A 1GVLA 1AY6H 1NRPH 2Y82A 4BTUB 5C5OA 4HFPB 3PMJA 5GPIB 1JMOH 1AUTC 3BIVH 4GAWA 1HB0B 1T7CA 2OP9A 3Q77A 3SUGA 3ZYEA 4UEHH 2Z3DA 2ZFQH 2G55A 1TB6H 4OS1A 4I8JA 1O3DA 7GCHF 4ESTE 1CU1A 3MWIU 3Q3YA 1W2KH 1Y5UT 1MD8A 2VVCA 4LZ1H 4WMDA 1OWHA 1RIWB 2VIQA 1O34A 2EI6A 3P92A 3FFGA 2FZZA 1LHGH 5B6OA 1CGJE 3RMNH 1GGDB 5BPEA 2XRCA 1KY9A 3BEFB 1ZMJA 1O3IA 3IWMA 1LKAA 3KEEA 4NG9H 1UTOA 1O3MA 5L2YH 1IQGA 3E1XB 5JYIA 1MTVA 2QXHA 4Q7ZA 1SGQE 3SV6A 1O3LA 1TX6A 3O8DA 3ZZ6A 3A86A 1C5OH 1DPOA 3ZZ8A 1TBZH 1SQOA 1ELAA 4NFEA 3VGCC 4WWYA 5A0CA 5BRRE 1OP0A 3M3TA 2ZCKP 2VIDA 3NCLA 1XKBC 3VXFH 3LJJA 1H1BA 3NK8A 5CMXH 3PTNA 1YBWA 4MTBA 1GCTC 4CREA 1GPZA 1XX9A 3TNSA 2ODYB 1DS2E 1SGFA 1YPHC 2EA3A 3AASA 2VB0A 3A83A 1ZGVA 2W3IA 2PSXA 1ZJDA 1NTPA 1SGFG 4FUFA 2FTMA 3RXUA 1BA8B 2STAE 3GDUA 2PGBB 1FIWA 3SHAH 3TGJE 1DT2A 1GI7B 5C1UA 2AYWA 2XBYA 4E7NA 1GL0E 2TPIZ 2A7HA 4YOIA 1CHOG 4CRFA 3A7VA 4CRAA 1ABIH 1AVWA 1C1VH 2IN2A 1ARCA 1SL3A 4MLFB 1YF4A 1BB0B 3BN9A 3MTYA 1P2IA 3E90B 1TA6A 4Y76A 1NRSH 4NFFA 2TBSA 1BTPA 2NU4E 1BBRH 4Y0ZE 3Q3XA 5JPMH 1SBWA 1BCUH 4NWLA 4YLUA 3PMHB 2FX6A 2WPIS 4X1NU 5EU8A 1PYTD 3NZIA 4BAHB 1PPHE 1IQEA 2ALPA 3MU5A 1EQ9A 3SNEA 1UVOA 3AAUA 4GCHG 2A0QB 3DFLA 4GPGA 3SW2B 2ZFSA 1T8LA 4AZ2B 3V13A 1GBJA 4TWYA 3DUXH 3GY2A 1VITF 9LPRA 1ANCA 6CHAB 3RXIA 1GMHG 3B8JA 1BDAA 1HV7A 3N7OA 1C5LH 1DFPA 1UCYH 2ZHFH 3HGNA 5FBIA 1P57B 2OC8A 1BTWA 1ZSJA 8ESTE 1TMBH 1MUEB 1UCYE 3CS0A 3RU4D 1KLJH 2AMDA 3GCTF 3O8BA 1Y59T 2Z3EA 4X8SH 2FWWA 1WQSA 2ALVA 4RN6A 2VVVA 2V0BA 3MFJA 4ZAEA 3KQCA 3UPEA 1UVPA 4B2AA 2UUKB 2YNBA 1Z8RA 3QTVH 1CA0B 1EJAA 1MCTA 5C20A 4JZIA 4YZUA 3VFEA 1A46H 1NFWA 1QJ7B 4CBOA 3E3TA 3B9FH 4B73A 2ZI2H 2AIPA 4Z6AH 3SNDA 3RMMH 1P2QA 1BHXB 1C5QA 1FY3A 2AMQA 2PTNA 4RKJB 1FQ3A 1NZQH 6GCHG 2ODPA 1EZQA 3QGNB 5K0HA 1OP8A 1GI2A 2K1QA 2LPRA 4X1QU 4I31A 4ABFA 3SV9A 3LJOA 1J16A 1F7ZA 1P04A 3A7WA 1TX7A 3P8NA 4B2CA 2ZFTA 1JOUB 2Q1JA 3PO1C 2RA0A 3F6UH 2A7JA 2IPHA 2HALA 4X6OA 2TGDA 4X2YA 2ZDLA 1A0JA 5F8XA 3K6YA 1C2KA 1Y3UA 3UWJH 1MBQA 1LVYA 2H1UA 3S7HB 4NZLA 3GY8A 4I32A 1J9CH 1PQAA 3FAOA 1BJVA 4U30A 3U1JB 5ETXA 1ZR0A 5DK1A 5I46H 2PUQH 3DFJA 1GHZA 5L6NH 4A1VA 1N8OC 3TJVA 4XBDA 1Y8TA 4IMQA 2BZAA 2GTBA 1TOCB 2VVUA 2XCFA 2XBXA 1BZXE 2TGAA 1OSSA 1Y3WA 4ZHAA 4CR5A 1O2RA 2SGEE 3RXQA 1HGTH 4DVAU 1C4U2 3UY9A 1NU9A 1TPOA 1YCPK 1T4UH 2VWMA 3T2NA 5EGMA 3U8RH 5FPSA 4X6PA 2OQUA 1T8OA 3U8TH 3A87A 2HNTC 6LPRA 2HNTF 2G4UA 3I29A 4A92A 1S6HA 1CVWH 2V6NA 4Y7AA 1ZMLA 2JH5D 1TGBA 2RG3A 4OGXA 1S6FA 5EODA 3E0NB 3EA8A 2FOHA 4FUIA 3SGBE 1EB1H 1TE0A 5DKMA 2BDHA 2ZF0H 5EG4A 4MPUA 1EATA 1ZMNA 1CA8B 2CF8H 4O03A 3RXJA 1UTNA 1YPHE 3QX5H 2J92A 2ZO3H 3I77A 3BTHE 1IHTH 2H5CA 1D6WA 1HAHH 4I8GA 4BAKB 3QLPH 1AB9C 1H4WA 1P0SH 1KXEA 1RFNA 4MQAA 5T3HA 2ZIQH 4Z0KA 1T8MA 1KIGH 2PHBA 2I6QA 2GVFA 3STJA 3LPRA 3RXPA 3TU7H 1S5SA 2PW8H 4ZXYH 3SO3A 2ZGXH 4TWWA 2VINA 1BT7A 2F9PA 4UFFH 4GHQA 1FN8A 2FTLE 1BRCE 4NIXA 1TABE 3LH1A 3T62A 1EPTA 1O5CB 2H9HA 1FN6A 1ELEE 1SG8B 3OY5U 3QDZB 4YESB 3LONA 4AX9H 3S9AA 2A31A 2YOLA 2ZGJA 2OD3B 3ODDA 1FI8A 1TRNA 1C1OA 1FMGA 5FCKA 1HYLA 1ZZZA 3KQDA 4ISLA 1ELCA 3LIWA 2G5VA 1GBFA 1VITG 1UTLM 2BDBA 1E34B 1GBMA 5AHGH 2M5TA 2BY5X 3GYLB 3BTWE 1ARBA 1GI5A 1MU8B 3GCHB 3LC5A 1O0DH 1OWEA 1LPZB 1XUFA 3QO6A 1BMLA 3AW0A 2CMYA 3EA7A 5C2ZA 4IS5A 4MNWA 3TH4H 1EB2A 3ZZ7A 3A7YA 1RRKA 3SNBA 3Q3KA 1TGNA 3OTJE 5TJXA 2KAIB 2C93B 1HUTH 1Z7KA 2Q6FA 5F8TA 1SB1H 5FAHA 1W0YH 4Y11E 1AI8H 3L33A 1C1PA 2AGGX 1UTJA 3QTOH 3QWCH 5J4QA 2R2MB 2BOKA 2AEIH 1S81A 3E91A 1OS8A 4X6MA 1DSTA 3CENA 3GY5A 1V2WT 4Y71A 3FANA 1QB1A 4FVDA 2G00A 1UVUH 3M5NA 2CHAB 1FY5A 1MD7A 1RIWC 4F49A 5A8ZA 1HNEE 1THSH 3PO1B 1MTUA 1GGDC 4AFZA 5J4SA 3TPIZ 4WF8A 1QFKH 1GI9B 1O2VA 4I8LA 1PPGE 3PM3A 3F9GA 1FY4A 3MH6A 1HAXB 1TWXB 2BD7A 1BTXA 2BD8A 5E0JA 1QQ4A 1ZTLA 2ZECA 1VJAU 4D76A 1TNGA 2GD4B 2C8XB 1GJ4H 1P05A 1L2EA 3STIA 1CGIE 1EAWA 4XE4A 3QN7A 1N8OB 2FLRH 5HM2A 4K69A 1A1RA 3M3SA 1HAGE 2JH6D 1S82A 4YLQH 1ID5H 1GBBA 1AD8H 1QGFA 1CO7E 2HRVA 2D8WA 3HKJB 1DOJA 4Q7XA 1IQJA 1B7XB 1P9UA 1P2MA 2BTCE 4ABHA 1HXFH 2V3HH 1YKTA 2PLXA 1CT0E 3M7TA 4AYVB 4B71A 3RC5A 1TQ0B 2DE8A 4MPXA 2F9OA 1YLDA 4X1RU 2ZU5A 3VB6A 1FPCH 2VU8E 2P93A 4INLA 3SU3A 3TK5A 1MKWK 1O2GH 1V2VT 1SI5H 1EAIA 5CE1A 1MKXH 3SJIA 3U9AH 2HNTE 4UE7H 1HIAA 2AMPA 2QXJA 1H9LB 5JBAS 1RXPA 1HBTH 2ZDVH 1TMTH 3P8FA 3ZZBA 5LGOA 1OWIA 2VH0A 2J38A 1IQMA 3M36A 3BIUH 2WYJA 3LKWA 1C5WB 1TGTA 4FU7A 2Y81A 4JZEH 3NXPA 1NO9H 4AG2A 2HPPH 4FXGH 3KN2A 3OU0A 1EOJA 2V35A 4NA7A 2A45B 3A84A 5L2ZH 2F9BH 7KMEH 1B0EA 2PKAA 2ZGBH 1PPFE 3UREA 1GHAF 2RCEA 4LOYH 6CHAC 5E0HA 4A7IB 1MTNB 3RXHA 3HPTB 4NSVA 5LPFA 2SNWA 2C3SA 1FONA 2GGVB 2BY6X 1XMNB 3FZZA 1OOKB 5EPYA 4YT6H 1JIMA 3VB7A 1QB6A 3BG8A 1FV9A 4DIIH 2F91A 1GDUA 1G32B 3FP6E 2GP9B 4Q2KA 1O35A 4ZH8A 3D65E 1SGEE 1HFDA 1DY9A 4TPYA 3BEIB 3MOCA 1FXYA 1H8DH 1CA0C 1Z8JB 2JKHA 1XUJA 3A8DA 4O3UA 2PTCE 4B76A 4VGCB 2F83A 1HAZB 1NESE 4Y8XA 4ZHLU 3MH4A 1O2IA 3TJUA 1UVTH 1BHXF 2BHGA 2ZNKH 3A7ZA 4ABAA 1P03A 3BEUA 1WAYB 1SGRE 1WUNH 1F0TA 1K1IA 3FP7E 1ABJH 2Z9IA 4GSOA 2FODA 3RC4A 4FUBA 1L1GA 4J2YB 1QURH 5GIBA 2Q6GA 1TFXA 5IDKA 1C2LA 4ZKSU 4FUJA 4X1SU 1WSSH 1C1UH 4Y8YA 3RXOA 3TIUA 2WPMS 3A80A 1IQLA 1GBCA 1C1RA 1ZPBA 4Y0YE 1GMCF 1MAXA 1ETRH 2ZU1A 1CT4E 1A2CH 5DJ7A 2CV3A 1K1NA 1ESTA 5DGJA 1O2YA 1C1MA 1V2KT 1SPJA 2Z6BD 2QIQA 2BDCA 2WYGA 2ZKSA 3SI4H 1GJ9B 3DHKH 5LPEA 1ZHPA 3JZ2B 4JYUH 1SGPE 1QJ6B 5FXLA 1GBIA 2JH0D 2B8OH 1GJ7B 2UUJB 1QQUA 4ABDA 8GCHF 2HVXA 3UR9A 2FEQH 1TLDA 4YO9A 1GJ5H 1A0LA 1HJAB 3AAVA 3A8BA 2O8UA 3RXAA 1VGCB 5JB9S 4X0WU 3EDXB 1IQIA 1GMDF 1FY8E 2Z94A 1AZZA 2PV9B 3BF6H 1IQNA 2PKSB 2ZCLP 5EW1H 1PPEE 3ZVBA 1ZYOA 4JZFH 5A8YA 3TH2H 2G8TA 1K1MA 3TK6A 3HK3B 2PSYA 1MBMA 1P3EA 1ZSLA 1INCA 4NZQA 1BOQA 1TBQH 3RU4E 4D9RA 1V2UT 1BIOA 2AH4X 4Y7BA 1Y3VA 5HGGA 3B23B 1C5SA 2XBWA 1O3NA 5JBBS 2CJIA 5LH8A 5ABWA 1MCVA 3BTQE 3ATIA 1AWFH 1DWEH 3UOPA 3FZDA 1JBUH 2UWOA 3RXRA 2TGPZ 1K22H 2WINI 1QRZA 1HXEH 5JDUB 1PPBH 2Q6DA 4U01A 4THNH 4X8TH 1W3CA 5GCHF 4AFSA 3P8OA 3QK1A 3A85A 2TGTA 2WV5A 1W12U 2BD5A 3LGVA 3SU5A 2VIVA 1YPMH 3E8LA 3LOXA 1O32A 3KL6A 4ZROA 1BBRE 1UHBA 3C1KA 4CBNA 3PMAB 4J1YA 2AERH 3H7OA 1HAYB 4HI3A 5DP9A 1SLUB 1AIXH 1UK4A 1QB9A 3MNSA 4XBCA 3UQOA 1VJ9U 3MO3A 4K8BA 1RGQA 5C1YA 3RXSA 1NM6A 1CQQA 1ETTH 1SQAA 1YPGH 1G9IE 2YNAA 3U69H 1DANH 2HOBA 2J9NA 2HWLB 5AFZH 2G51A 2BDIA 1SGTA 3GISB 1DWDH 1KXFA 3SU0A 1AN1E 1N1LA 1FJSA 2CF9H 1FZZA 1O2WA 2BX3A 2XWAA 3UOUA 1DXPA 1L4DA 1G37A 3GCHC 1SHYA 1EAXA 2ZG0H 1DICA 2VIPA 1YPJH 1D3DB 3ZVCA 4GVUA 3W94A 4BAOB 1P06A 1GHVH 3F9EA 2OBQA 2GKVE 2QA9E 4NSYA 4UD9H 4OS4A 2DUCA 1C5ZB 4D9QA 1Z8GA 4NA9H 1NROH 4X8VH 4K2YA 4QT8C 1VCPA 1NN6A 1O3PB 2QAAA 4MNYA 1ZRBA 1VZQH 1FAKH 4CR9A 1D4PB 2VWOA 2R9PA 3ATWA 1BTYA 2P95A 3MI4A 2ZDMA 4WMEA 2QF3A 2G52A 2A5KA
chains in the Genus database with same CATH superfamily
1O2HA 1C1WH 1TOMH 1GBDA 1O5EH 1DITH 1HRTH 2J4IA 4UFGH 1PQ7A 2BY8X 1AO5A 5HM9A 1OYQA 2I6SA 2CHAC 3BTME 4HTCH 4OS5A 1LVOA 3RXDA 1ZOMA 1LKBA 3DSOA 3K65B 1Q2WA 1K9OE 3NUMA 5F53A 4AFQA 2B9LA 1YCPM 2NU1E 2GX4A 5AFYH 5HXFA 1A5HA 1C1QA 1V2PT 2ZQ1A 1P12E 3KHVA 1AU8A 2LP6A 4BNRA 1TPAE 7GCHG 1GBKA 4IMZA 1QRXA 1BBRK 1BTHH 1GMCG 2EI8A 4KKDA 1J17T 2VH6A 1MMJN 1BRAA 2FM2A 1E36B 5EPNA 1U6QA 3BTTE 2XXLA 1S6LA 4K1SA 1A3BH 2OTVA 3PMBB 1YY3A 2G4TA 1J8AA 1Y3YA 7LPRA 3RM2H 1ZPZA 1N6XA 5JBCS 2ZA5A 3D62A 3UR6A 3U98H 2WPHS 3SV7A 4LZ4B 1BRBE 4RKOB 1C5PA 4AGJA 4WH6A 9ESTA 1UCYK 3MNBA 1C2EA 1TBRH 5FX5A 4BXWA 1DWBH 2BVXH 2ULLA 2ZDNA 3RXLA 2FS8A 1O2ZA 1DY8A 1TALA 4K60A 1H9IE 5GWZA 4DGJA 3OY6U 4NIVA 3BG4B 1J14A 2H6MA 2B7DH 2NWNA 1SOTA 1XVOA 1BMNH 4WXIA 1CSOE 4YOJA 2XNIA 2LNCA 1PFXC 2QXIA 4I33A 3SJOA 1OHHD 3GOVB 2FO9A 2FPZA 3BTKE 3MU0A 3A7XA 4ABEA 4A5TS 3N7DA 1ANBA 1O2MA 4R0IA 1EKBB 1EZSC 5FL7D 3M7QA 1BTZA 1P02A 2FYQA 2SGAA 3AW1A 4MG3A 3V12A 4K1TA 3TJNA 3ZVGA 3PTBA 1H8ED 4AB8A 3GY6A 1E1RD 1WOFA 3CP7A 4NWKA 2W3KA 3S9BA 1K2I1 2THFB 2FOBA 5F03A 2STBE 5IYTA 2NU2E 3ESTA 4OGYA 2C90B 5EQSA 1GI1A 5ESBA 1O5AB 3T28A 1L1NA 2C8ZB 1MTWA 1Z1IA 5C0UA 1TNIA 2BQ6B 7ESTE 2BY7X 2ZDKA 2H9TH 3URCA 2ZFFH 2ZTZA 3A8CA 2OINA 2CGAA 1C1NA 1WQVH 1B0FA 4UDWH 3GY7A 1MTNC 1NS3A 1EOLA 1Z6JH 4JK5A 1TYNA 3PB1E 2FX4A 3HKIB 4ZCNA 1MU6B 5DP6A 1SLVB 5EW2H 1THPB 1GDQA 3SGQE 5I25A 1BUIA 2QF0A 5E2OA 2A32A 1HLTH 1TMUH 5FPYA 4MVNA 2JDID 3OAAD 4XRNA 4A1TA 1SSXA 1EPTB 3LU9B 2WPLS 1AQ7A 1ZTJA 1V6DA 2A4QA 2W26A 2R0KA 4K8YA 2ODQA 1SOZA 3UNQA 1C5XB 1NU7B 1ZGIA 3L3TA 1ORFA 4FUDA 3HK6B 4FUHA 3HGPA 1GJDB 5H4IB 5DP7A 1LPGB 1AMHA 1ZLRA 3GCTG 3BV9B 3UFAA 1GJCB 4VGCC 1EASA 1D3PB 1TNLA 3ZVDA 1E37B 2KAIA 1IQFA 2GCTC 2ANMH 4XD7D 3F2FA 2XOKD 1TNKA 2ASUB 2OLGA 2R0LA 2KCYA 2XC4A 1SGNE 1PPCE 5F8ZA 2OK5A 1J15A 1K21H 4NCYA 4FU9A 2Y5HA 3GDSA 1V3XA 2OCVB 5DO4H 1SLWB 8KME2 3FVFB 3Q76A 1IHSH 1LVMA 2FIRH 3SBKA 3DD2H 1PPZA 3BTFE 3TGIE 1KDQB 2BLVA 3GY3A 4B2BA 1QTFA 2ZTXA 1EFRD 3IG6B 2WPDD 2VNTA 2J95A 3ZIAD 5C5NA 4ABIA 1C9TA 5GXPA 3KYFA 1WTGH 2HLCA 2Y7XA 3LT3A 1ESBA 2EQNA 4Y10E 4DT7B 4XBBA 1TGCA 2HGTH 1GCDA 2Y7ZA 1O2TA 1ELTA 1O3KA 3LC3A 4E06H 1P2OA 2BMGB 1O38A 1O2PA 2FMJA 3A88A 2GZ8A 4M9FA 3RXCA 4MPVA 1LHEH 2PFEA 2P8OB 1EP5A 2H9EH 3T5FH 3UB0A 2O8TA 3S69A 1MZDA 3TITA 3ENSB 1O5GH 2WUBA 3V0XA 1HJAC 1NC6A 1JRSA 2RA3A 1VGCC 1AFEH 1KXCA 1XUGA 1ZHRA 3QUMP 1A5GH 3TK9A 2IOTA 1O2QA 2FOMB 1G2MA 4M7GA 1RTFB 3SI3H 8LPRA 4FVBA 3ATLA 1HJ8A 1W7GH 5A09A 2BZ6H 3S9CA 2OC7A 2PKSC 2O9QA 3H7TA 2BY9X 4RSPA 2BD9A 4TY7A 2V3OH 1SR5C 2CK3D 4KP0A 2GDDA 1AE8H 3LGUA 1PJPA 1O31A 3Q00A 2VWLA 3K9XB 2BB4A 1XUHA 1SGIB 3V3MA 5EXMA 2SGFE 4U32A 2FOFA 2NU0E 1P2JA 4WJG2 1K28D 2EC9H 4NA8A 1O2UA 1LQEA 2A5IA 1IAUA 1GJAB 5F6MA 1NY22 4ISIH 1THRH 1TPSA 3RXTA 1JRTA 2BYAX 1Z6EA 1GI3A 1NFYA 5T6DA 1OXGA 3RXKA 4CRDA 3D23A 2UUFB 4JYTA 1AGJA 1P01A 4IC5A 4XOJA 2JIZD 5A2MH 3RLWH 4ZKOU 3MU4A 4B1TA 1O3OA 1W7XH 1C5VA 2BDYA 2L6OA 4YT7H 2XWBI 1P10A 2FOGA 1CHOF 2FI3E 1GBAA 4LK4A 2BX4A 3SJKA 4DIHH 2ZQ2A 3GICB 3M5OA 5EJLA 1QL7A 2XTTB 3QZRA 4X6NA 1EJMA 1QY6A 3TLOA 2AGEX 4AG1A 1K1OA 1DVAH 1KXAA 2XCNA 2FOCA 1AZ8A 1AVXA 1G2LA 2FLBH 3BTEE 4Q63A 4TYDA 4A6LA 1C2GA 1YLCA 1RJXB 1SFIA 1M9UA 2BQWB 4JYVH 2VGCB 4ABBA 4CHAC 1KMHB 3F0PA 3MNXA 3SNAA 3SN8A 1ZTKA 2TIOA 1C5YB 1E38B 1F5KU 2QV1A 5EXNA 2J34A 1LTOA 1UK3A 1Z1JA 2ZCHP 3LDXH 4E7RG 1C2JA 2ZC9H 4TY6A 1IOEA 2ZPQA 3GY4A 1GMHF 1E0FD 1WBGB 1S85A 1XKAC 1UTMA 3MMGA 1EUFA 3E16B 1LPKB 2F9NA 2ZGCA 1C5NH 4GHTA 3GDVA 3A8AA 4ZMAH 5LPRA 1ANDA 1HAVA 1LMWB 1IQHA 3ZV9A 5DN6D 1C2HA 1Y5AT 1SGCA 4FUEA 1KLTA 2UUYA 2Z9LA 1V2MT 1DM4B 2BDAA 4ISOA 2GCTB 3ZVAA 1ACBE 3GCOA 3GCNA 3MH7A 1C9PA 1QJ1B 1EXFA 1NFUA 1T8NA 2ZU3A 1JIRA 2AGIX 2Y80A 1AKSB 1L0ZA 1OYTH 1XM1A 1NFXA 2Y5FA 4DURA 5E2PA 1HDTH 1HJ9A 3PV4A 1NRRH 1OWKA 4AFUA 1P09A 3U8OH 3RU4T 3D49H 5GDSH 3T29A 3JZ1B 1S84A 3TJOA 1RTKA 1UTQA 4ASUD 4B74A 5CHAB 3A89A 2C8YB 1UTPA 4AYYB 1VR1H 1HPGA 1WU1A 1RTLA 3RXBA 1LVBA 1VCQA 1LO6A 2J98B 1HAPH 2CXVA 2A1DB 1ANEA 1A7SA 1YLNA 1F5LA 2ANWA 2SNVA 1FIZA 1ELBA 1A3EH 1SGYE 2F9UA 1C1SA 2BXUH 2ZP0H 2GZ9A 5L30H 4WVPE 4I8KA 3M61U 1V2QT 1C2MA 2ZHDA 3A81A 4AN7A 5DP3A 2GT8A 2BD3A 3EQ0H 1P3CA 3GYMA 2UWPA 4BOHA 1LHFH 1O2NA 4OS7A 3RP2A 1D6RA 1Z71A 5HMAA 5E0GA 3ZZAA 3BSQA 1P9SA 3UWIA 2Z3CA 2FS9A 1GHBF 3UNRA 1GDNA 2WPKS 4D7GA 4MDSA 1WYKA 3BG4C 3T26A 4K5ZA 1TGSZ 2NU3E 2JETB 3U1IB 3LGWA 5A0BA 3LGIA 3PLBA 3K2UA 2P16A 1K1JA 2A2QH 3OYPA 1T32A 1YGCH 3M5MA 4IW4E 1EZXC 3UNSA 3RXGA 2QE7D 1F0RA 1UJ1A 4P00A 1PQ5A 4ABGA 1GG6B 3CS7A 2ZHEH 2PWXA 4KELA 3NWUA 1CBWB 2D2DA 2FOAA 2UWLA 2OBOA 2P3FH 3W95A 2FI4E 3SU2A 2R2WU 3NPSA 1G3CA 3OEHD 1NRQH 1QA0A 1YYY1 1P11E 1NRNH 2RDLA 4BANB 4I7YH 1C5RA 2KFWA 1O2KA 2ZTYA 3MU8A 1GJ6A 4X2WA 4KGAA 3VPKA 1SLXB 5DP4A 3MO9A 2SGPE 2ZEBA 3SOSA 3F9FA 2GV7A 1V2ST 1V2TT 5EIYA 1O33A 3ATMA 3ODFA 4BTIB 1NT1A 5AF9H 1NPMA 1V2NT 4XDEA 3TNTA 1L1JA 2O8MA 3HATH 3ATKA 1AFQB 5A0AE 3FOAA 1KTTB 4CHAB 4KTSA 1GHAG 4ZKNU 1Q3XA 4ZKRU 1EPTC 1RD3B 1UHBB 5FCRA 5FPTA 1OKXA 2XYAA 1WCZA 2ZHWH 4SGBE 1L4ZA 2ZPRA 3L6PA 3KQEA 2KZ4A 2BLWA 4AORA 4NGAH 1ZSKA 2WV9A 2A4GA 1DLEA 1XXDA 3RC6A 2A5AA 2FESH 3M35A 3OSYA 3RXFA 2ZWLH 3K6ZA 3SUEA 2RFKC 1QIXB 1P2NA 4WXVA 1F5RA 1TNHA 3AVZA 1GHWH 4A1XA 1O2JA 1TA2A 1FUJA 3SV2H 1VCWA 3MQKC 5TCCA 2GMTC 1GI4A 1QNJA 3MU1A 4P02A 2ZU4A 1O3BA 1YCPH 1FDPA 2GZ7A 3F68H 1BITA 1QBNA 1HAIH 1GBTA 2OC0A 3S7KB 2Y5GA 2ESTE 1O3FA 3BTGE 4TPIZ 4XFQA 4JCNA 5FBEA 4ACAA 3SNCA 1COWD 1ELVA 2FDAA 1NBME 3SV8A 2Z7FE 1V2LT 2BLQA 3FKSD 5DPAA 1BTUA 1LCYA 2B5TB 2FXRA 3UTUH 2BOHB 1XUKA 2QY0B 4Q80A 3UQVA 3WW7A 4K1EA 4ZXXH 3H5CB 3KYGA 5KGOA 2GDEH 2D26C 2TRMA 1ZRKA 4XSKU 4B75A 2ANYA 2F3CE 3ITIA 1YWUA 1N6YA 2IJOB 1GVZA 4H6TA 4IC6A 5EOKA 4DT4A 2ZGHA 1MTSA 4E05H 1FPHH 1O3EA 4CH8B 5E8EH 3ZVEA 3PROA 1P2KA 2F9VA 3SU1A 3EE7A 2A7CA 4X2XA 1MAYA 1QL9A 1BQYA 1GI6A 2P8OC 2L74A 1KSNA 2O8LA 4ABJA 3MH5A 3EGKH 2W7UA 2J5UA 4DCDA 1EZUC 1TAWA 4OS2A 2ILNA 1HAOH 4KTUA 5C0TA 2BLOA 3OX7U 2P3TB 2QYIA 1KYNA 1YM0A 4ASHA 1SGDE 1BMAA 1T31A 1LDTT 1LHCH 1MZAA 3KGPA 2HLDD 4ISHH 2R3YA 4PROA 1Y3XA 3SJ9A 2VJ1A 1FAXA 4DG4A 3UIRA 4OS6A 2XC0A 8GCHG 5C1XA 2QCYA 3TGKE 5PTPA 3RMLH 1MQ5A 1NBMD 2J2UA 1MH0A 2SGQE 2A2XH 4WY3A 3RXMA 3MYWA 2BXTH 3PWCA 1XVMA 1GHBG 5T6FA 2XW9A 3RXVA 4H6SB 1S0QA 3ZZCA 1GMDG 5AVDA 1F2SE 3F1SB 2Z9KA 1W13U 1ZPCA 1MQ6A 4BTTB 1QL8A 3VGCB 3QGJA 3R0FA 1O3HA 2KCPA 1YPLH 4AB9A 1SQTA 5EQRA 4AGKA 1QHRB 4CRCA 2ZHQH 2QC2A 2FI5E 1SKYE 3SHCH 1S0RA 1GCTB 2W5EA 3SUDA 1UVSH 3E6PH 1DUEA 1W8BH 2P94A 1W11U 4GUXA 3IITA 4HZHA 1O2LA 3FP8E 1DUAA 1ELGA 1OPHB 2BD2A 4Q7YA 1AUJA 4DOQA 1T4VH 3SGAE 2AIQA 4Y79A 1C5UA 2ANKH 2DE9A 1TRYA 2SGDE 5C94A 1GBHA 4H4FA 1C2IA 5GCHG 5C67A 3SZNA 3DT0H 3LGYA 1QZ8A 3BTDE 2PGQB 2PUXB 5FX6A 3PV2A 2VGCC 4F55A 3H09A 2W7SA 1KXBA 2B0FA 1TIOA 3PLKA 1V2JT 3OTPA 1JXPA 1G3BA 5CHBA 1EAUA 3ZZ3A 2BVRH 2BD4A 2O8WA 3UUZA 2GCHF 5T6GA 5HYOA 5K7RA 4D8NA 3ZZ9A 1W0ZU 3P17H 1O30A 3ZZ4A 2QXGA 1O39A 1XUIA 4X1PU 1O2SA 1XXFA 1C1TA 1DSUA 2QF4A 2H5DA 4NIYA 2AFQB 4FUCA 5TCAA 3LGTA 4DY7B 1H8IH 1UO6A 1A61H 1O36A 1O5BB 1G30B 4DW2U 4O97A 3T27A 1DLKB 1V2OT 1DE7H 2YMSB 3VB4A 1P8VC 1ELDE 4ISNA 5EXLA 4UFDH 1YPKH 3NKKA 2WUCA 2C4FH 3A82A 1UTKA 1GHXH 3KIDU 4UONA 1GVKB 1K1LA 4LXBH 3PLPA 2WSSD 1VITH 1EJNA 4JMYA 5FHTA 2GMTB 4JZDH 1SFQB 1GHYH 3M37A 2PR3A 1A5IA 3LH3A 3EAJA 5C17A 3R3GB 1FLEE 4FU8A 4MNVA 1ZHMA 3TH3H 3QZQA 1AHTH 2XC5A 1OX1A 4U2WA 1C2FA 2FOEA 1C4V2 1GI8B 1KDQA 1JWTA 1OP2A 1AWHB 4CRBA 2ZU2A 1EP6A 4X8UH 1LQDB 1F0UA 2OQ5A 1MKWH 5CHAC 3F2HA 6ESTA 2VIOA 4H42U 1F0SA 1G3EA 2ZPSA 3EE0B 1DXWA 1QBOA 1HCGA 3ZZ5A 4CH2B 2J94A 1G36A 1C2DA 2KX4A 4Y6DA 2BVSH 2OUAA 4RI0A 1W10U 1W14U 2G81E 1GL1A 3M7UA 4HGCA 3MNCA 1S83A 1K1PA 2CN0H 1DWCH 4IGDA 3F2GA 1DDJA 4IBLH 1QR3E 1RS0A 1K0HA 1SMFE 2WPJS 3EYDA 4SGAE 4FUGA 3WWBA 2C8WB 1D9IA 2BM2A 1QBVH 3PYHA 3I78A 3P8GA 1AE5A 1LHDH 2EEKA 3AK5A 1CGHA 1TPPA 1GBLA 2QGRA 1EX3A 3ZYDA 3VXEH 1VKYA 1AVGH 1ELFA 2AS9A 3P70B 1PYTC 2Z9JA 2H2ZA 3KF2A 3RXEA 4BAQB 5SGAE 1O3AA 2GT7A 5HIZA 1A4WH 2ZFPH 2JETC 3DA9B 1G3DA 3C27B 1FNIA 2ZFRH 1BMMH 4KTCA 2V3MA 2ZZUH 3SORA 5JBTA 2P3UB 4AOQA 1O2XA 1O5FH 2Z9GA 1GBEA 3MHWU 5DP8A 2A4OA 4I8HA 2Y6TA 1GWAA 4Y8ZA 4F4OC 1C5MD 3KNXA 1QCPA 1GG6C 1UW7A 3V7TA 2R3UA 3RUOA 3VEQB 5C3NA 1CBWC 1O2OA 4IN2A 3SUFA 2OC1A 2XNDD 1QRWA 2XBVA 1Q31A 1V2RT 3SJ8A 3SU4A 3RLYH 2KM0A 1GJBB 1KXDA 1H9HE 1OWJA 1O3GA 4D7FA 1CT2E 4R8TB 4ACBA 1F92A 1FY1A 4JK6A 5EQQA 1CE5A 3RDZA 1O3JA 2SFAA 5JB8S 1O37A 1UMAH 1D3QB 5DP5A 4MNXA 1SC8U 4UFEH 5GNDA 1TNJA 4GLYA 2D1JA 1TQ7B 3E0PB 5DG6A 3ZV8A 3WY8A 3KCGH 1GI0A 4B6EA 1OWDA 1ZJKA 5ESTE 4ZUHA 1B5GH 1HIAB 4INHA 1TX8A 4WH8A 5A8XA 3PWBA 4INKA 1AFQC 1YP9A 1AB9B 1C5TA 3ELAH 1Y5BT 2WV4A 3F9HA 1CHGA 4GCHF 3MO6A 3KQBA 2FP7B 1TRMA 4JZ1A 2GCHG 2FYRA 2ZDAH 1FX0B 1SHHB 2IJD1 3ZVFA 2BQ7B 1TONA 4ZHMU 2PKAB 3M3VA 3SQHE 4O3TA 2BDGA 1BRUP 3A7TA 1ESAA 5G4BA 2VWNA 1YPEH 1KLIH 1SVPA 3M5LA 4YM9A 2QN5T 2OXSA 4BXSA 3TVJB 1IQKA 1D3TB 2VIWA 2HPQH 1ETSH 3T25A 3RM0H 4YTAA 1GJ8B 1A0HB 3SU6A 4O9VA 1PQ8A 2G5NA 4MPWA 2EI7A 1WTHD 1YC0A 4K3JA 4CRGA 3SQEE 1O5DH 1KTSB 2P59A 3G01A 1QA7A 5GJ4B 3P6ZB 3VB5A 4X2VA 4WMFA 3RMOH 2JJ1D 4YOGA 2A4RA 1AKSA 1HAVB 3VB3A 4DJZB 3EA9A 3O8RA 1X7AC 3O8CA 1BJUA 1C4Y2 1DX5M 3ZZDA 3URDA 1MKXK 1UK2A 4BAMB 6GCHF 3S0NA 4NIWA 3P95A 1Z8IB 4IN1A 1O3CA 1WV7H 1E35B 2GV6A 1GVLA 1AY6H 1NRPH 2Y82A 4BTUB 5C5OA 3PRDA 4HFPB 3PMJA 5GPIB 1JMOH 1SQRA 1AUTC 3BIVH 4GAWA 1HB0B 1T7CA 2OP9A 3Q77A 3SUGA 3ZYEA 4UEHH 2Z3DA 2ZFQH 2G55A 1TB6H 3PV5A 4OS1A 4I8JA 1O3DA 7GCHF 4ESTE 1E1QD 1CU1A 3MWIU 3Q3YA 1W2KH 1Y5UT 1MD8A 2VVCA 4LZ1H 4WMDA 1OWHA 1RIWB 2VIQA 1O34A 2EI6A 3P92A 3FFGA 2FZZA 1LHGH 5B6OA 1CGJE 3DCLA 3RMNH 1GGDB 5BPEA 2XRCA 1KY9A 3BEFB 1ZMJA 1O3IA 3IWMA 1LKAA 3KEEA 4NG9H 1UTOA 1O3MA 2GJGA 5L2YH 1IQGA 3E1XB 5JYIA 1MTVA 2QXHA 4Q7ZA 1SGQE 3SV6A 1O3LA 1TX6A 3O8DA 3ZZ6A 3A86A 4RT1A 1C5OH 1DPOA 3ZZ8A 1TBZH 1SQOA 1ELAA 4NFEA 3VGCC 4WWYA 5A0CA 5BRRE 1OP0A 3M3TA 2RDEA 2VIDA 2ZCKP 3NCLA 1XKBC 3VXFH 3LJJA 1H1BA 3DSGA 3NK8A 5CMXH 3PTNA 1YBWA 4MTBA 1GCTC 4CREA 1GPZA 1XX9A 3KQ5A 3TNSA 2ODYB 1DS2E 1SGFA 1YPHC 2EA3A 3AASA 2VB0A 3A83A 1ZGVA 2W3IA 2PSXA 1ZJDA 1NTPA 1SGFG 4FUFA 2FTMA 3RXUA 1BA8B 2STAE 3GDUA 3WWFA 2KCAA 2PGBB 1FIWA 3SHAH 3TGJE 1DT2A 1GI7B 5C1UA 2AYWA 2XBYA 4E7NA 1GL0E 2TPIZ 2A7HA 4YOIA 1WXRA 1CHOG 4CRFA 3A7VA 4CRAA 1ABIH 1AVWA 1C1VH 2IN2A 1ARCA 1SL3A 4MLFB 1YF4A 1BB0B 3BN9A 3MTYA 1P2IA 3E90B 1TA6A 4Y76A 1NRSH 4NFFA 2TBSA 1BTPA 2NU4E 1BBRH 4Y0ZE 3Q3XA 5JPMH 1SBWA 1BCUH 4NWLA 4YLUA 3PMHB 2FX6A 2WPIS 4X1NU 5EU8A 1PYTD 3NZIA 4BAHB 1PPHE 1IQEA 2ALPA 3MU5A 1EQ9A 3SNEA 1UVOA 3AAUA 4GCHG 2A0QB 3DFLA 4GPGA 3SW2B 2ZFSA 1T8LA 2YMSC 4AZ2B 3V13A 1GBJA 4TWYA 3DUXH 3GY2A 1VITF 9LPRA 1ANCA 6CHAB 3RXIA 1GMHG 4F48B 3B8JA 1BDAA 1HV7A 3N7OA 1C5LH 1DFPA 1UCYH 2ZHFH 3HGNA 5FBIA 1P57B 2OC8A 1BTWA 1ZSJA 8ESTE 1TMBH 1MUEB 1UCYE 3CS0A 3RU4D 1KLJH 1MABB 2AMDA 3GCTF 3O8BA 1Y59T 2Z3EA 4X8SH 2FWWA 1WQSA 2ALVA 4RN6A 2VVVA 3W1EA 2V0BA 3MFJA 4ZAEA 3DSPA 3KQCA 3UPEA 1UVPA 4B2AA 2UUKB 2YNBA 1Z8RA 3QTVH 1CA0B 1EJAA 1MCTA 3OE7D 5C20A 4JZIA 4YZUA 3VFEA 1A46H 1NFWA 1QJ7B 4CBOA 3E3TA 3B9FH 4B73A 2ZI2H 2AIPA 4Z6AH 3SNDA 3RMMH 1P2QA 1BHXB 1C5QA 1FY3A 2AMQA 2PTNA 4RKJB 1FQ3A 1NZQH 6GCHG 2ODPA 1EZQA 3QGNB 5K0HA 1OP8A 1GI2A 2K1QA 2LPRA 4X1QU 4I31A 4ABFA 3SV9A 3LJOA 1J16A 1F7ZA 1P04A 3A7WA 1TX7A 3P8NA 4B2CA 2ZFTA 1JOUB 2Q1JA 3PO1C 2RA0A 3F6UH 2A7JA 2IPHA 2HALA 4X6OA 2TGDA 4X2YA 2ZDLA 1A0JA 5F8XA 3K6YA 1C2KA 1Y3UA 3UWJH 1MBQA 1LVYA 2H1UA 3S7HB 4NZLA 3GY8A 4I32A 1J9CH 1PQAA 3FAOA 1BJVA 4U30A 3U1JB 5ETXA 1ZR0A 5DK1A 5I46H 2PUQH 3DFJA 2KR7A 1GHZA 5L6NH 4A1VA 1N8OC 3TJVA 4XBDA 1Y8TA 4IMQA 2BZAA 2GTBA 1TOCB 2VVUA 2XCFA 2XBXA 1BZXE 2TGAA 1OSSA 1Y3WA 4ZHAA 4CR5A 1W0KD 1O2RA 2SGEE 3RXQA 1HGTH 3CNRA 4DVAU 2KCOA 1C4U2 3UY9A 2K0QA 1NU9A 3OEED 1TPOA 2EY4C 5CDFE 1YCPK 3OFND 1T4UH 2VWMA 3T2NA 5EGMA 3U8RH 5FPSA 4X6PA 2OQUA 1T8OA 3U8TH 3A87A 3PRBA 4HG6A 2HNTC 6LPRA 2IPQX 2HNTF 2G4UA 2WHXA 3I29A 4A92A 1S6HA 1CVWH 2V6NA 4Y7AA 1ZMLA 2JH5D 1TGBA 2RG3A 4OGXA 1S6FA 5EODA 2PP6A 3E0NB 3EA8A 2FOHA 4FUIA 3SGBE 1EB1H 1TE0A 5DKMA 2BDHA 2ZF0H 5EG4A 4MPUA 1EATA 1ZMNA 1CA8B 2CF8H 4O03A 3RXJA 1YPHE 1UTNA 3QX5H 2J92A 2ZO3H 3I77A 3BTHE 1IHTH 2H5CA 1D6WA 1HAHH 4I8GA 4BAKB 3QLPH 1AB9C 1H4WA 1P0SH 1KXEA 1RFNA 4MQAA 5T3HA 2ZIQH 4Z0KA 1T8MA 1KIGH 2PHBA 2I6QA 2GVFA 3STJA 2AHME 3LPRA 3FO8D 3RXPA 3TU7H 1S5SA 2PW8H 4ZXYH 3SO3A 2ZGXH 5EJZA 4TWWA 2VINA 5T1VA 1BT7A 2F9PA 4UFFH 4GHQA 1FN8A 2FTLE 1BRCE 4NIXA 1TABE 3LH1A 3T62A 1EPTA 1O5CB 2H9HA 1FN6A 1ELEE 1SG8B 3OY5U 3QDZB 4YESB 3LONA 4AX9H 3S9AA 2A31A 2YOLA 2ZGJA 2OD3B 3ODDA 1FI8A 1TRNA 1C1OA 1FMGA 5FCKA 1HYLA 1ZZZA 3KQDA 4ISLA 1ELCA 3LIWA 2G5VA 1GBFA 1VITG 1UTLM 2BDBA 1E34B 1GBMA 2W6ID 5AHGH 2M5TA 2BY5X 3GYLB 3BTWE 1ARBA 1GI5A 1W0JD 1MU8B 3GCHB 3LC5A 1O0DH 1OWEA 1LPZB 1XUFA 3QO6A 1BMLA 3AW0A 2CMYA 3EA7A 5C2ZA 4IS5A 4MNWA 3TH4H 1EB2A 3ZZ7A 3A7YA 1RRKA 3SNBA 3Q3KA 1TGNA 3OTJE 5TJXA 4FOUC 2KAIB 2C93B 1HUTH 1Z7KA 2Q6FA 5F8TA 1SB1H 5FAHA 1W0YH 4Y11E 1AI8H 3L33A 1C1PA 2AGGX 1UTJA 3QTOH 3QWCH 4TT3D 5DSFA 5J4QA 2R2MB 2BOKA 2AEIH 1S81A 3E91A 1OS8A 2M2AA 4X6MA 1DSTA 3CENA 3GY5A 1V2WT 4Y71A 3FANA 1QB1A 4FVDA 2G00A 1UVUH 3M5NA 2CHAB 1FY5A 1MD7A 1RIWC 4F49A 5A8ZA 1HNEE 1THSH 3PO1B 1MTUA 1GGDC 4AFZA 5J4SA 3TPIZ 5EJ1A 4WF8A 1QFKH 1GI9B 2LELA 2YMSD 1O2VA 4I8LA 1PPGE 3PM3A 3F9GA 1FY4A 2WZQA 3MH6A 1HAXB 1TWXB 2BD7A 1BTXA 2BD8A 5E0JA 1QQ4A 1ZTLA 2ZECA 1VJAU 4D76A 1TNGA 2GD4B 2C8XB 1GJ4H 1P05A 1L2EA 2F43B 3STIA 1CGIE 1EAWA 4XE4A 3QN7A 1N8OB 2FLRH 5HM2A 4K69A 1A1RA 3M3SA 1HAGE 3U28C 2JH6D 1S82A 4YLQH 1ID5H 1GBBA 3GS9A 1AD8H 1QGFA 1CO7E 4YXWD 2HRVA 2D8WA 3HKJB 1DOJA 4Q7XA 1IQJA 1B7XB 1P9UA 1P2MA 2BTCE 4ABHA 1HXFH 2V3HH 1YKTA 2PLXA 1CT0E 3M7TA 4AYVB 4B71A 3RC5A 1TQ0B 2DE8A 4MPXA 2F9OA 1YLDA 4X1RU 2ZU5A 2F4LA 3VB6A 1FPCH 2VU8E 2P93A 4INLA 3SU3A 3TK5A 1MKWK 1O2GH 1V2VT 1SI5H 1EAIA 5CE1A 1MKXH 3SJIA 3U9AH 2HNTE 4UE7H 1HIAA 2AMPA 2QXJA 1H9LB 5JBAS 1RXPA 1HBTH 2ZDVH 1TMTH 3P8FA 3ZZBA 5LGOA 1OWIA 2VH0A 2J38A 1IQMA 3M36A 3BIUH 2WYJA 3LKWA 1C5WB 1TGTA 4FU7A 2Y81A 4JZEH 3NXPA 1NO9H 4AG2A 2HVYB 2HPPH 4FXGH 3KN2A 3OU0A 1EOJA 2V35A 4NA7A 2A45B 3A84A 5L2ZH 2F9BH 7KMEH 1B0EA 2PKAA 2ZGBH 1PPFE 3UREA 1GHAF 2RCEA 4LOYH 6CHAC 5E0HA 4A7IB 1MTNB 4TSFD 3RXHA 3NRLA 3HPTB 4NSVA 5LPFA 2SNWA 2C3SA 2VBCA 1FONA 2GGVB 2BY6X 1XMNB 3FZZA 1OOKB 5EPYA 4YT6H 1JIMA 3VB7A 1QB6A 3BG8A 1FV9A 4DIIH 2F91A 1GDUA 1G32B 3FP6E 1WDIA 2GP9B 4Q2KA 1O35A 4ZH8A 3D65E 1SGEE 1HFDA 1DY9A 4TPYA 5KECA 3BEIB 3MOCA 1FXYA 1H8DH 1CA0C 1Z8JB 2JKHA 1XUJA 3A8DA 4AC9A 4O3UA 2PTCE 4B76A 4VGCB 2F83A 1HAZB 1NESE 5IK2D 4Y8XA 4ZHLU 5HIYA 3MH4A 1O2IA 3TJUA 1UVTH 1BHXF 2BHGA 2ZNKH 3A7ZA 4ABAA 1P03A 3BEUA 1WAYB 1SGRE 1WUNH 1F0TA 1K1IA 3FP7E 2J98A 1ABJH 2Z9IA 4GSOA 2FODA 3RC4A 4FUBA 1L1GA 4J2YB 1QURH 5GIBA 2Q6GA 1TFXA 5IDKA 1C2LA 4ZKSU 4FUJA 4X1SU 5HKKD 1WSSH 1C1UH 4Y8YA 3RXOA 3TIUA 2WPMS 3A80A 1IQLA 1GBCA 1C1RA 1ZPBA 4Y0YE 1GMCF 1MAXA 1ETRH 2ZU1A 1CT4E 1A2CH 5DJ7A 2CV3A 1K1NA 1ESTA 4FETA 2W6JD 5DGJA 1O2YA 1C1MA 1V2KT 1SPJA 2Z6BD 2QIQA 2BDCA 2WYGA 2ZKSA 3SI4H 1GJ9B 3DHKH 5LPEA 1ZHPA 3JZ2B 4JYUH 1SGPE 1QJ6B 2K8IA 5FXLA 1GBIA 4OM9A 3SZEA 2JH0D 2B8OH 1GJ7B 2UUJB 1QQUA 4ABDA 8GCHF 2HVXA 3UR9A 2FEQH 1TLDA 4YO9A 1GJ5H 1A0LA 1HJAB 3AAVA 3A8BA 2O8UA 3RXAA 1VGCB 5JB9S 3N7EA 4X0WU 3EDXB 1IQIA 2V7QD 1GMDF 1FY8E 2Z94A 1AZZA 2PV9B 3BF6H 1IQNA 2PKSB 2ZCLP 5EW1H 1PPEE 3ZVBA 1ZYOA 4JZFH 5A8YA 3F3BA 3TH2H 3FN8A 2G8TA 1K1MA 1E79D 3F0OA 3TK6A 3HK3B 2PSYA 1MBMA 1P3EA 1ZSLA 1INCA 4NZQA 1BOQA 1TBQH 3RU4E 4D9RA 1V2UT 1BIOA 2AH4X 4Y7BA 1Y3VA 5HGGA 3B23B 1BMFD 1C5SA 2XBWA 1O3NA 5JBBS 2CJIA 5LH8A 5ABWA 1MCVA 3BTQE 3ATIA 1AWFH 1DWEH 3UOPA 3FZDA 1JBUH 2UWOA 3RXRA 2TGPZ 1K22H 2WINI 1QRZA 1HXEH 2QF5A 1PPBH 2Q6DA 5JDUB 4U01A 4THNH 4X8TH 1W3CA 5GCHF 4AFSA 3P8OA 3QK1A 3A85A 2TGTA 2WV5A 1W12U 2BD5A 3LGVA 5B6LA 3SU5A 2VIVA 1YPMH 3E8LA 3LOXA 1O32A 3KL6A 4ZROA 1BBRE 1UHBA 3C1KA 4CBNA 3N99A 4RT0A 3PMAB 4J1YA 3UAIC 2AERH 3H7OA 1HAYB 4HI3A 5DP9A 2JJ2D 1SLUB 1AIXH 3SYJA 1UK4A 1QB9A 3MNSA 4XBCA 3UQOA 1VJ9U 3MO3A 4K8BA 1RGQA 5C1YA 3RXSA 1NM6A 1CQQA 1ETTH 1SQAA 1YPGH 1G9IE 2YNAA 3U69H 1DANH 2HOBA 2J9NA 2HWLB 5AFZH 2G51A 2BDIA 1SGTA 3GISB 1DWDH 1KXFA 3SU0A 4Z1MD 1AN1E 1H8HD 1N1LA 1FJSA 2CF9H 1FZZA 1O2WA 2BX3A 2XWAA 3UOUA 1DXPA 1L4DA 1G37A 3GCHC 1SHYA 1EAXA 2ZG0H 1DICA 2VIPA 1YPJH 1D3DB 3ZVCA 4GVUA 3W94A 4BAOB 1P06A 1GHVH 3F9EA 2OBQA 2GKVE 2QA9E 4NSYA 4UD9H 4OS4A 2DUCA 3VG8A 1C5ZB 4D9QA 1Z8GA 4NA9H 1NROH 4X8VH 4K2YA 4QT8C 1VCPA 1NN6A 1O3PB 2QAAA 4MNYA 5KEDA 1ZRBA 1VZQH 1FAKH 4CR9A 4B6FA 1D4PB 2VWOA 2R9PA 2J97A 3ATWA 1BTYA 2P95A 3MI4A 2ZDMA 4Q4LA 4WMEA 2QF3A 4I86A 2G52A 2A5KA
chains in the Genus database with same CATH topology
1O2HA 1C1WH 1TOMH 1GBDA 1O5EH 1DITH 1HRTH 2J4IA 4UFGH 1PQ7A 2BY8X 1AO5A 5HM9A 1OYQA 2I6SA 2CHAC 3BTME 4HTCH 4OS5A 1LVOA 3RXDA 1ZOMA 1LKBA 3K65B 3NUMA 1Q2WA 1K9OE 4AFQA 2B9LA 1YCPM 2NU1E 2GX4A 5AFYH 5HXFA 1A5HA 1C1QA 1V2PT 2ZQ1A 1P12E 3KHVA 1AU8A 4BNRA 1TPAE 7GCHG 1GBKA 4IMZA 1QRXA 1BBRK 1BTHH 1GMCG 2EI8A 4KKDA 1J17T 2VH6A 1MMJN 1BRAA 2FM2A 1E36B 5EPNA 1U6QA 3BTTE 2XXLA 4K1SA 1A3BH 2OTVA 3PMBB 2G4TA 1J8AA 1Y3YA 7LPRA 3RM2H 1ZPZA 1N6XA 5JBCS 2ZA5A 3D62A 3UR6A 3U98H 2WPHS 3SV7A 4LZ4B 1BRBE 4RKOB 1C5PA 4AGJA 4WH6A 9ESTA 1UCYK 3MNBA 1C2EA 1TBRH 5FX5A 4BXWA 1DWBH 2BVXH 2ULLA 2ZDNA 3RXLA 2FS8A 1O2ZA 1DY8A 1TALA 4K60A 1H9IE 5GWZA 4DGJA 3OY6U 4NIVA 3BG4B 1J14A 2H6MA 2B7DH 2NWNA 1SOTA 1XVOA 1BMNH 4WXIA 1CSOE 4YOJA 2XNIA 2LNCA 1PFXC 2QXIA 4I33A 3SJOA 3GOVB 2FO9A 2FPZA 3BTKE 3MU0A 3A7XA 4ABEA 4A5TS 1ANBA 1O2MA 4R0IA 1EKBB 1EZSC 3M7QA 1BTZA 1P02A 2FYQA 2SGAA 3AW1A 4MG3A 3V12A 4K1TA 3TJNA 3ZVGA 3PTBA 4AB8A 3GY6A 3CP7A 1WOFA 4NWKA 2W3KA 3S9BA 1K2I1 2THFB 2FOBA 5F03A 2STBE 5IYTA 2NU2E 3ESTA 4OGYA 2C90B 5EQSA 1GI1A 5ESBA 1O5AB 3T28A 1L1NA 2C8ZB 1MTWA 1Z1IA 1TNIA 2BQ6B 7ESTE 2BY7X 2ZDKA 2H9TH 3URCA 2ZFFH 2ZTZA 3A8CA 2OINA 2CGAA 1C1NA 1WQVH 1B0FA 4UDWH 3GY7A 1MTNC 1NS3A 1EOLA 1Z6JH 4JK5A 1TYNA 3PB1E 2FX4A 3HKIB 1MU6B 5DP6A 1SLVB 5EW2H 1THPB 1GDQA 3SGQE 5I25A 1BUIA 2QF0A 5E2OA 2A32A 1HLTH 1TMUH 5FPYA 4MVNA 4A1TA 1SSXA 1EPTB 3LU9B 2WPLS 1AQ7A 1ZTJA 1V6DA 2A4QA 2W26A 2R0KA 4K8YA 2ODQA 1SOZA 3UNQA 1C5XB 1NU7B 1ZGIA 3L3TA 1ORFA 4FUDA 3HK6B 4FUHA 3HGPA 1GJDB 5H4IB 5DP7A 1LPGB 1AMHA 1ZLRA 3GCTG 3BV9B 3UFAA 1GJCB 4VGCC 1EASA 1D3PB 1TNLA 3ZVDA 1E37B 2KAIA 1IQFA 2GCTC 2ANMH 1TNKA 2ASUB 2OLGA 2R0LA 2XC4A 1SGNE 1PPCE 5F8ZA 1J15A 1K21H 4NCYA 4FU9A 2Y5HA 3GDSA 1V3XA 2OCVB 5DO4H 1SLWB 8KME2 3FVFB 3Q76A 1IHSH 1LVMA 2FIRH 3SBKA 3DD2H 1PPZA 3BTFE 3TGIE 1KDQB 2BLVA 3GY3A 4B2BA 1QTFA 2ZTXA 3IG6B 2VNTA 2J95A 5C5NA 4ABIA 1C9TA 5GXPA 1WTGH 2HLCA 2Y7XA 3LT3A 1ESBA 4Y10E 4DT7B 4XBBA 1TGCA 2HGTH 1GCDA 2Y7ZA 1O2TA 1ELTA 1O3KA 3LC3A 4E06H 1P2OA 2BMGB 1O38A 1O2PA 2FMJA 3A88A 2GZ8A 3RXCA 4MPVA 1LHEH 2PFEA 2P8OB 1EP5A 2H9EH 3T5FH 2O8TA 3S69A 1MZDA 3TITA 3ENSB 1O5GH 2WUBA 3V0XA 1HJAC 1NC6A 1JRSA 2RA3A 1VGCC 1AFEH 1KXCA 1XUGA 1ZHRA 3QUMP 1A5GH 3TK9A 2IOTA 1O2QA 2FOMB 1G2MA 4M7GA 1RTFB 3SI3H 8LPRA 4FVBA 3ATLA 1HJ8A 1W7GH 5A09A 2BZ6H 3S9CA 2OC7A 2PKSC 2O9QA 3H7TA 2BY9X 4RSPA 2BD9A 4TY7A 2V3OH 1SR5C 4KP0A 2GDDA 1AE8H 3LGUA 1PJPA 1O31A 3Q00A 2VWLA 3K9XB 2BB4A 1XUHA 1SGIB 3V3MA 5EXMA 2SGFE 4U32A 2FOFA 2NU0E 1P2JA 4WJG2 1K28D 2EC9H 4NA8A 1O2UA 1LQEA 2A5IA 1IAUA 1GJAB 5F6MA 1NY22 4ISIH 1THRH 1TPSA 3RXTA 1JRTA 2BYAX 1Z6EA 1GI3A 1NFYA 5T6DA 1OXGA 3RXKA 4CRDA 3D23A 2UUFB 4JYTA 1AGJA 1P01A 4IC5A 4XOJA 5A2MH 3RLWH 4ZKOU 3MU4A 4B1TA 1O3OA 1W7XH 1C5VA 2BDYA 4YT7H 2XWBI 1P10A 2FOGA 1CHOF 2FI3E 1GBAA 4LK4A 2BX4A 3SJKA 4DIHH 2ZQ2A 3GICB 3M5OA 1QL7A 2XTTB 3QZRA 4X6NA 1EJMA 1QY6A 3TLOA 2AGEX 4AG1A 1K1OA 1DVAH 1KXAA 2XCNA 2FOCA 1AZ8A 1AVXA 1G2LA 2FLBH 3BTEE 4TYDA 4A6LA 1C2GA 1YLCA 1RJXB 1SFIA 1M9UA 2BQWB 4JYVH 2VGCB 4ABBA 4CHAC 3MNXA 3SNAA 3SN8A 1ZTKA 2TIOA 1C5YB 1E38B 1F5KU 2QV1A 5EXNA 2J34A 1LTOA 1UK3A 1Z1JA 2ZCHP 3LDXH 4E7RG 1C2JA 2ZC9H 4TY6A 1IOEA 2ZPQA 3GY4A 1GMHF 1E0FD 1WBGB 1S85A 1XKAC 1UTMA 3MMGA 1EUFA 3E16B 1LPKB 2F9NA 2ZGCA 1C5NH 4GHTA 3GDVA 3A8AA 4ZMAH 5LPRA 1ANDA 1HAVA 1LMWB 1IQHA 3ZV9A 1C2HA 1Y5AT 1SGCA 4FUEA 1KLTA 2UUYA 2Z9LA 1V2MT 1DM4B 2BDAA 4ISOA 2GCTB 3ZVAA 1ACBE 3GCOA 3GCNA 3MH7A 1C9PA 1QJ1B 1EXFA 1NFUA 1T8NA 2ZU3A 1JIRA 2AGIX 2Y80A 1AKSB 1L0ZA 1OYTH 1XM1A 1NFXA 2Y5FA 4DURA 5E2PA 1HDTH 1HJ9A 3PV4A 1NRRH 1OWKA 4AFUA 1P09A 3U8OH 3RU4T 3D49H 5GDSH 3T29A 3JZ1B 1S84A 3TJOA 1RTKA 1UTQA 4B74A 5CHAB 3A89A 2C8YB 1UTPA 4AYYB 1VR1H 1HPGA 1WU1A 1RTLA 3RXBA 1LVBA 1VCQA 1LO6A 1HAPH 2CXVA 2A1DB 1ANEA 1A7SA 1F5LA 2ANWA 2SNVA 1FIZA 1ELBA 1A3EH 1SGYE 2F9UA 1C1SA 2BXUH 2ZP0H 2GZ9A 5L30H 4WVPE 4I8KA 3M61U 1V2QT 1C2MA 2ZHDA 3A81A 4AN7A 5DP3A 2GT8A 2BD3A 3EQ0H 1P3CA 3GYMA 2UWPA 4BOHA 1LHFH 1O2NA 4OS7A 3RP2A 1D6RA 1Z71A 5HMAA 5E0GA 3ZZAA 3BSQA 1P9SA 3UWIA 2Z3CA 2FS9A 1GHBF 3UNRA 1GDNA 2WPKS 4D7GA 4MDSA 1WYKA 3BG4C 3T26A 4K5ZA 1TGSZ 2NU3E 2JETB 3U1IB 3LGWA 5A0BA 3LGIA 3PLBA 3K2UA 2P16A 1K1JA 2A2QH 3OYPA 1T32A 1YGCH 3M5MA 4IW4E 1EZXC 3UNSA 3RXGA 1F0RA 1UJ1A 1PQ5A 4ABGA 1GG6B 3CS7A 2ZHEH 2PWXA 4KELA 3NWUA 1CBWB 2D2DA 2FOAA 2UWLA 2OBOA 2P3FH 3W95A 2FI4E 3SU2A 2R2WU 3NPSA 1G3CA 1NRQH 1QA0A 1YYY1 1P11E 1NRNH 2RDLA 4BANB 4I7YH 1C5RA 1O2KA 2ZTYA 3MU8A 1GJ6A 4X2WA 4KGAA 3VPKA 1SLXB 5DP4A 3MO9A 2SGPE 2ZEBA 3SOSA 3F9FA 2GV7A 1V2ST 1V2TT 1O33A 3ATMA 3ODFA 4BTIB 1NT1A 5AF9H 1NPMA 1V2NT 4XDEA 3TNTA 1L1JA 2O8MA 3HATH 3ATKA 1AFQB 5A0AE 1KTTB 4CHAB 4KTSA 1GHAG 4ZKNU 1Q3XA 4ZKRU 1EPTC 1RD3B 1UHBB 5FCRA 5FPTA 1OKXA 2XYAA 1WCZA 2ZHWH 4SGBE 1L4ZA 2ZPRA 3L6PA 3KQEA 2BLWA 4AORA 4NGAH 1ZSKA 2A4GA 1DLEA 1XXDA 3RC6A 2A5AA 2FESH 3M35A 3OSYA 3RXFA 2ZWLH 3K6ZA 3SUEA 1QIXB 1P2NA 4WXVA 1F5RA 1TNHA 3AVZA 1GHWH 4A1XA 1O2JA 1TA2A 1FUJA 3SV2H 1VCWA 5TCCA 2GMTC 1GI4A 1QNJA 3MU1A 2ZU4A 1O3BA 1YCPH 1FDPA 2GZ7A 3F68H 1BITA 1QBNA 1HAIH 1GBTA 2OC0A 3S7KB 2Y5GA 2ESTE 1O3FA 3BTGE 4TPIZ 4XFQA 4JCNA 5FBEA 3SNCA 3SV8A 1ELVA 2FDAA 2Z7FE 1V2LT 2BLQA 5DPAA 1BTUA 1LCYA 2B5TB 2FXRA 3UTUH 2BOHB 1XUKA 2QY0B 4Q80A 3UQVA 4K1EA 4ZXXH 3H5CB 2GDEH 2D26C 2TRMA 1ZRKA 4XSKU 4B75A 2ANYA 2F3CE 3ITIA 1N6YA 2IJOB 1GVZA 4H6TA 4IC6A 5EOKA 2ZGHA 1MTSA 4E05H 1FPHH 1O3EA 4CH8B 5E8EH 3ZVEA 3PROA 1P2KA 2F9VA 3SU1A 2A7CA 4X2XA 1MAYA 1QL9A 1BQYA 1GI6A 2P8OC 1KSNA 2O8LA 4ABJA 3MH5A 3EGKH 2W7UA 4DCDA 1EZUC 1TAWA 4OS2A 2ILNA 1HAOH 4KTUA 2BLOA 3OX7U 2P3TB 2QYIA 1KYNA 1YM0A 4ASHA 1SGDE 1BMAA 1T31A 1LDTT 1LHCH 1MZAA 3KGPA 4ISHH 2R3YA 4PROA 1Y3XA 3SJ9A 2VJ1A 1FAXA 4DG4A 3UIRA 4OS6A 2XC0A 8GCHG 5C1XA 2QCYA 3TGKE 5PTPA 3RMLH 1MQ5A 2J2UA 1MH0A 2SGQE 2A2XH 4WY3A 3RXMA 3MYWA 2BXTH 3PWCA 1XVMA 1GHBG 5T6FA 2XW9A 3RXVA 4H6SB 1S0QA 3ZZCA 1GMDG 5AVDA 1F2SE 3F1SB 2Z9KA 1W13U 1ZPCA 1MQ6A 4BTTB 1QL8A 3VGCB 3QGJA 3R0FA 1O3HA 1YPLH 4AB9A 1SQTA 5EQRA 4AGKA 1QHRB 4CRCA 2ZHQH 2QC2A 2FI5E 3SHCH 1S0RA 1GCTB 2W5EA 3SUDA 1UVSH 3E6PH 1DUEA 1W8BH 2P94A 1W11U 4GUXA 3IITA 4HZHA 1O2LA 3FP8E 1DUAA 1ELGA 1OPHB 2BD2A 4Q7YA 1AUJA 4DOQA 1T4VH 3SGAE 2AIQA 4Y79A 1C5UA 2ANKH 2DE9A 1TRYA 2SGDE 1GBHA 4H4FA 1C2IA 5GCHG 5C67A 3SZNA 3DT0H 3LGYA 3BTDE 2PGQB 2PUXB 5FX6A 2VGCC 2W7SA 1KXBA 2B0FA 1TIOA 3PLKA 1V2JT 1JXPA 1G3BA 1EAUA 3ZZ3A 2BVRH 2BD4A 2O8WA 3UUZA 2GCHF 5T6GA 5HYOA 5K7RA 4D8NA 3ZZ9A 1W0ZU 3P17H 1O30A 3ZZ4A 2QXGA 1O39A 1XUIA 4X1PU 1O2SA 1XXFA 1C1TA 1DSUA 2H5DA 4NIYA 2AFQB 4FUCA 5TCAA 3LGTA 4DY7B 1H8IH 1UO6A 1A61H 1O36A 1O5BB 1G30B 4DW2U 4O97A 3T27A 1DLKB 1V2OT 1DE7H 3VB4A 1P8VC 1ELDE 4ISNA 5EXLA 4UFDH 1YPKH 3NKKA 2WUCA 2C4FH 3A82A 1UTKA 1GHXH 3KIDU 4UONA 1GVKB 1K1LA 4LXBH 3PLPA 1VITH 1EJNA 4JMYA 5FHTA 2GMTB 4JZDH 1SFQB 1GHYH 3M37A 2PR3A 1A5IA 3LH3A 3EAJA 3R3GB 1FLEE 4FU8A 4MNVA 1ZHMA 3TH3H 3QZQA 1AHTH 2XC5A 1OX1A 4U2WA 1C2FA 2FOEA 1C4V2 1GI8B 1KDQA 1JWTA 1OP2A 1AWHB 4CRBA 2ZU2A 1EP6A 4X8UH 1LQDB 1F0UA 2OQ5A 1MKWH 5CHAC 6ESTA 2VIOA 4H42U 1F0SA 1G3EA 2ZPSA 3EE0B 1DXWA 1QBOA 1HCGA 3ZZ5A 4CH2B 2J94A 1G36A 1C2DA 4Y6DA 2BVSH 2OUAA 1W10U 1W14U 2G81E 1GL1A 3M7UA 4HGCA 3MNCA 1S83A 1K1PA 2CN0H 1DWCH 4IGDA 1DDJA 4IBLH 1QR3E 1RS0A 1SMFE 2WPJS 3EYDA 4SGAE 4FUGA 2C8WB 1D9IA 2BM2A 1QBVH 3PYHA 3I78A 3P8GA 1AE5A 1LHDH 2EEKA 1CGHA 1TPPA 1GBLA 2QGRA 1EX3A 3ZYDA 3VXEH 1AVGH 1ELFA 2AS9A 3P70B 1PYTC 2Z9JA 2H2ZA 3KF2A 3RXEA 4BAQB 5SGAE 1O3AA 2GT7A 1A4WH 2ZFPH 2JETC 3DA9B 1G3DA 3C27B 1FNIA 2ZFRH 1BMMH 4KTCA 2ZZUH 3SORA 5JBTA 2P3UB 4AOQA 1O2XA 1O5FH 2Z9GA 1GBEA 3MHWU 5DP8A 2A4OA 4I8HA 2Y6TA 1GWAA 4Y8ZA 4F4OC 1C5MD 3KNXA 1QCPA 1GG6C 3V7TA 2R3UA 3RUOA 3VEQB 5C3NA 1CBWC 1O2OA 4IN2A 3SUFA 2OC1A 1QRWA 2XBVA 1Q31A 1V2RT 3SJ8A 3SU4A 3RLYH 1GJBB 1KXDA 1H9HE 1OWJA 1O3GA 4D7FA 1CT2E 4R8TB 1F92A 1FY1A 4JK6A 5EQQA 1CE5A 3RDZA 1O3JA 2SFAA 5JB8S 1O37A 1UMAH 1D3QB 5DP5A 4MNXA 1SC8U 4UFE