1C5VA

Structural basis for selectivity of a small molecule, s1-binding, sub-micromolar inhibitor of urokinase type plasminogen activator
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (TRYPSIN)
publication title Structural basis for selectivity of a small molecule, S1-binding, submicromolar inhibitor of urokinase-type plasminogen activator.
pubmed doi rcsb
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5vA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5vA02
4UONA 2EC9H 3BG4B 3MFJA 3A86A 1SC8U 1H9IE 2OTVA 1NT1A 1OP8A 3V12A 1XUIA 2HALA 3LH1A 5IDKA 1TNKA 1TGTA 1PQAA 2F9BH 2PKAB 4BAQB 1TBRH 2TGPZ 1TOMH 1FY4A 3EAJA 1C2DA 5C1YA 1PYTC 4WXVA 1GHBF 1O3JA 1V2MT 2A0QB 3M5LA 2AMDA 1ID5H 2BD4A 1QFKH 3GY2A 3V0XA 4D9QA 4INLA 3QZQA 1ZHPA 2IJOB 1W7XH 2PSYA 3ELAH 1ACBE 1GMHF 1O2QA 1DT2A 3EA7A 2AGEX 2ZU2A 1DX5M 1WSSH 2DUCA 1E37B 3LJJA 1OYTH 3Q3KA 3DT0H 4IS5A 2G81E 2STAE 5T6FA 1ESTA 1XUHA 4X1RU 1P57B 2P8OC 1CSOE 1ZHRA 1SGEE 5ABWA 1GHAG 6LPRA 1T7CA 1UK4A 1O2ZA 1OKXA 4NG9H 3CS7A 2ZCLP 5EQSA 4ASHA 4Y71A 1O36A 1AO5A 3LGWA 2ZTZA 1P2QA 1D9IA 4B71A 3BEUA 4JZIA 2ZHDA 2GCHG 1C5QA 1O2KA 2ZGHA 4A5TS 1BTZA 3A8AA 2F9UA 1DLKB 1IQIA 1G2LA 1BJVA 1O2VA 1ANDA 2G51A 4K8BA 1SMFE 3QDZB 4AGJA 1D4PB 4FUBA 1BHXF 1ANCA 4ZHLU 3UY9A 2P3UB 4X8SH 3LH3A 1A5IA 4FUFA 5C2ZA 1J15A 1UJ1A 2XXLA 3RXFA 4B73A 1AB9B 1L4ZA 2G8TA 1PJPA 1C5RA 1C4U2 4AFQA 1V2ST 2ZHEH 4BAMB 4RN6A 1OYQA 1J17T 4I8GA 3SUEA 1CA0B 3UNQA 2VGCC 1KDQA 3CS0A 1GHYH 1NN6A 2H9HA 3SU2A 1CBWB 1BZXE 2A5IA 2GCTC 4Y8ZA 3M5MA 1ZR0A 4WY3A 2OC0A 1BIOA 1YPKH 2H9EH 1TBZH 5CMXH 1SGNE 1O2LA 3RXAA 1TGBA 1PPBH 1AKSA 4FUDA 1ZPCA 5L6NH 2JKHA 1GVKB 4B75A 5JBTA 3MO9A 1A2CH 2TGDA 3M5NA 5CHAC 2FTMA 5GWZA 1P12E 1YCPH 1YKTA 4AYVB 4D9RA 3HK3B 3UQVA 4E7RG 1TPPA 2ZFPH 1P2JA 1VCPA 4Q7ZA 5EQRA 1O5CB 1WOFA 2Y5HA 1AUTC 1MKWK 4CREA 2XW9A 4A7IB 1GHZA 2Z9IA 3GOVB 2GZ9A 3A85A 3QTVH 3KQBA 2WPHS 1OWDA 5J4QA 2FYRA 2ASUB 2SFAA 3BTDE 1EZXC 4O9VA 2HNTC 1SGFG 1ZTKA 2A5AA 3SORA 2A2QH 4D7FA 1FDPA 1PPCE 2WUCA 1LO6A 6GCHG 1GL1A 3HKIB 2P94A 1N8OC 4UFFH 2ZDKA 8LPRA 1DUEA 1EAUA 2F9OA 4Y6DA 1A3EH 1BITA 2ZGXH 1ZPBA 3QGJA 1P3CA 1NU7B 1BCUH 5A8ZA 1KLIH 2R3YA 4DY7B 2EI7A 2BOHB 2BDGA 1FXYA 1GCTC 1MU6B 1BHXB 3A82A 5H4IB 1HJAC 2NU2E 2XC0A 1OPHB 4SGBE 4X6OA 1N6YA 4U01A 2OQUA 3ATLA 2B7DH 5A8YA 1MBQA 2Z9KA 1PQ7A 4BXWA 3U69H 1IQHA 1NRSH 3SU1A 3S9BA 2Y6TA 2ZGJA 3MU0A 1ARBA 1W0YH 4XDEA 1HJ8A 1VJ9U 1UTOA 4YLUA 1JIMA 1DUAA 2BLQA 3RMNH 1KXDA 4DVAU 1ANEA 1EX3A 2WPMS 2ZNKH 2B0FA 8GCHG 5FPTA 1SPJA 2GMTC 3FFGA 3H7TA 1BJUA 5DP9A 1V2UT 4A92A 3VB4A 3RXEA 1GI8B 1LPGB 1MTVA 4IW4E 2BY6X 2Z3EA 2J95A 1V2TT 1MD8A 4GCHG 2FXRA 1LHFH 2BZ6H 1CHOG 2CV3A 1V6DA 1Y5UT 3AAVA 4JZFH 2TGTA 1GGDC 1XVOA 2VH6A 3SOSA 1XXFA 1F5LA 1ZZZA 2F3CE 3ATKA 1VGCB 3F6UH 1O2PA 3DA9B 2AYWA 4MPUA 1K1MA 2GGVB 3S7HB 2OINA 1JMOH 1L4DA 2V6NA 2XC4A 4Q80A 1OOKB 1ABIH 1GI2A 2ZG0H 1EOLA 4FU7A 3RXDA 1QA0A 1GMCG 1HRTH 3EYDA 4XBCA 4MQAA 2NWNA 2SGFE 1K1NA 2FEQH 1RGQA 3VGCC 4AFZA 4CRDA 3A8DA 2O8TA 1A5HA 1HIAA 1WV7H 1GJ8B 1D6RA 1YPLH 1A0JA 3SV6A 1GBBA 1OP0A 2EA3A 1TX6A 4I8LA 5LPRA 3E90B 4J1YA 3RXTA 4DT7B 1P8VC 1O2MA 4ZAEA 1ESBA 2XBWA 2SGEE 2VB0A 2UWOA 4HFPB 2CGAA 3QLPH 3BEIB 1SQTA 1B0FA 1O5FH 2EI8A 2HRVA 1C5XB 3SV2H 3M3TA 1O35A 2G00A 5AF9H 5FHTA 3UR6A 4YOJA 2TIOA 2WUBA 1Z8IB 3L3TA 1Z1JA 1HCGA 3BTKE 3TU7H 1UO6A 3T28A 2P93A 4H6TA 3ZYDA 2ZIQH 2XC5A 6CHAB 1ZPZA 4NFEA 3OTJE 1TNHA 4IC5A 2ODQA 4Q7XA 2AFQB 4YOIA 3SNBA 4Y0YE 4YZUA 1GBAA 2R2MB 1WUNH 1CGJE 3U8OH 4DOQA 3KQEA 4LXBH 1GPZA 1YP9A 1G37A 2FOEA 4CRCA 2SNWA 5FCKA 3SHCH 1GBHA 4XSKU 1BTYA 2BTCE 3A84A 3I29A 3SGAE 1JRSA 2SGPE 4DCDA 2PKAA 4X1PU 1RS0A 4AN7A 3TNTA 1SGPE 1T4VH 4AOQA 1KXAA 1AWFH 1GG6B 2QXJA 4ABDA 3MU5A 2ESTE 2ZQ1A 2QIQA 4XOJA 2BDCA 5C20A 5B6OA 1DS2E 4JK5A 5TCAA 1TRYA 1KXEA 5HGGA 1AKSB 3PMJA 3ZZ6A 2YOLA 1QBVH 1YCPM 1KXBA 4TPIZ 2UUYA 2F91A 2A31A 3PLKA 3QGNB 3KEEA 1PYTD 3M7QA 4ZHMU 4K1TA 3IITA 4K1EA 3ZZCA 3LT3A 1FPHH 2QYIA 2Z7FE 2BLOA 1SG8B 1OWJA 1CT4E 1RIWC 1GHAF 4CRBA 1UVTH 1CGIE 2BDHA 4B76A 3RLWH 1LPZB 3HK6B 4QT8C 3B9FH 2FOMB 2ZCKP 3BTME 3UQOA 2VWNA 4K8YA 1SFQB 4K2YA 3MNSA 4MPWA 3ZV9A 1GHWH 3A7WA 5FX6A 2VVCA 5LH8A 1GBCA 1K2I1 2DE9A 2J94A 2ODYB 5LPFA 2FI3E 4X1NU 3TH2H 1FPCH 1B7XB 1C1WH 1ELTA 1O2JA 4OS4A 1MKWH 2ZQ2A 3VEQB 2ZFFH 2GP9B 1DY8A 1XUGA 3BF6H 4A6LA 2ZP0H 3G01A 1PQ5A 1C4V2 4Y79A 1GDQA 1GMDF 4IC6A 1W3CA 1ARCA 4I31A 4I32A 1EJMA 1DITH 1SL3A 3ATIA 3MMGA 3PO1B 1T8LA 3RUOA 2Z6BD 2H5DA 1TYNA 1Y5BT 1Y59T 2SNVA 2ZCHP 4TWYA 3OY5U 4NFFA 3M7UA 3GDUA 1E34B 5DG6A 1TNLA 3LGTA 1VZQH 1VCQA 2Q6FA 2ODPA 1MZDA 2OCVB 3M7TA 1F0UA 3RXHA 1MCVA 4HI3A 3UFAA 3BV9B 2CHAB 1O2UA 1QR3E 3W94A 4E06H 4UFEH 2HWLB 4GHTA 1DM4B 1C5UA 4NZQA 2FM2A 2Y5FA 2M5TA 4UD9H 4Z0KA 5SGAE 1K28D 4VGCB 1EAWA 3TNSA 3RXUA 3SUDA 3K6ZA 5JB8S 2BXUH 1O3CA 3AASA 1C2LA 2Y7ZA 1AVGH 1GI0A 1IQFA 1O3DA 1ZTJA 1IHSH 2FOHA 1QHRB 1BT7A 4I8KA 1D3PB 3SJIA 1RXPA 2P59A 4CR5A 1TQ0B 1AB9C 1DE7H 1QGFA 4YO9A 4ZXXH 1UVSH 2ZWLH 3UUZA 1O3PB 2Y80A 4O3UA 1FMGA 4YTAA 1MMJN 4K3JA 5J4SA 1YPHE 1UTNA 2WPJS 2AMPA 4M7GA 1DDJA 1AZZA 1O2IA 1GJDB 1DSTA 8KME2 1SQOA 1YGCH 4X2YA 5A0BA 1HIAB 1HPGA 3PM3A 3P17H 3SJ9A 1CBWC 1BMLA 1C2GA 1P03A 1XMNB 1UVOA 2WPKS 3E6PH 1ETRH 3BSQA 3S9CA 1K22H 1O2TA 3VB7A 1O5AB 1GJ4H 5EPNA 3BG8A 1NRRH 2BY9X 1O34A 2ZHFH 1NFYA 1L2EA 2ZF0H 4WJG2 3DD2H 3V3MA 1V2PT 7KMEH 4X2XA 1AHTH 2FP7B 4KTCA 2NU0E 3ATMA 4FUHA 4O03A 3UWJH 5L2YH 1QB9A 1A3BH 1DFPA 4FUIA 2BD5A 2BLVA 1N1LA 1ZRBA 2GKVE 1YPJH 1HXEH 4INKA 1LVMA 4IMQA 3ZYEA 2A45B 3DHKH 1Q3XA 2BB4A 4MLFB 2PW8H 1RFNA 3Q77A 2B9LA 4ABFA 4D7GA 2H1UA 2VINA 4OS7A 2A1DB 4NSYA 1GI5A 1ZSLA 2W7UA 3PWBA 3SU4A 2FWWA 1U6QA 2BY7X 1UTKA 3FZDA 5LPEA 1DXPA 2W3IA 1LMWB 3VB3A 1FAXA 4CHAC 1GL0E 2ZFQH 4GCHF 1ELBA 2P3FH 4BAKB 1CHOF 4XFQA 1WTHD 1J16A 1LVOA 3ODFA 3ZVAA 4FUEA 1AZ8A 3TK5A 3ZVCA 1IQKA 2AMQA 4GAWA 5AHGH 1P2KA 2GD4B 2H2ZA 1E36B 1V2KT 1QL8A 2A7JA 3SU0A 3W95A 3KN2A 3M3SA 4GPGA 4ABEA 1DY9A 2ZFRH 4FXGH 5EW1H 1AGJA 3A7TA 4AG1A 2PGQB 4AGKA 2GDDA 3K6YA 2THFB 1L1GA 1GMCF 3TJNA 3TK9A 1O37A 5JBCS 2VWMA 1T31A 4NA9H 1IQNA 1O2YA 1P09A 3U98H 1NY22 2FIRH 1ZMNA 1TRNA 2XTTB 2OD3B 3CP7A 4FVBA 2HPQH 1GWAA 1GJAB 1YM0A 1C1RA 1QTFA 2C4FH 3A81A 3TK6A 1HB0B 1K1OA 4O3TA 1RTKA 3PTBA 1SR5C 1XKAC 4R0IA 1P11E 2P3TB 1QL7A 1TX7A 2FOFA 2BDAA 1ELAA 1KLTA 3EGKH 1HYLA 1WCZA 1IQJA 4H4FA 2ZEBA 2D8WA 4FVDA 1GI7B 4NIYA 4E05H 1O39A 3RM2H 4HGCA 2FZZA 5ESTE 4I33A 5DO4H 2PWXA 4CBNA 8ESTE 1GVZA 3ZV8A 5EODA 3RXLA 1H9LB 1KLJH 1Z8RA 2BD7A 1QA7A 1W7GH 1T8NA 1O3LA 5C1UA 1W14U 1M9UA 3SNEA 1EZQA 1KTTB 3LDXH 3I77A 2A4GA 3SBKA 1TABE 1ZGVA 1K1JA 7GCHG 1F92A 1KY9A 5DP3A 3SU5A 1WBGB 1DSUA 1Y3XA 3ZVDA 5JB9S 3UPEA 1ZLRA 3FAOA 1SLVB 1C2EA 2PKSB 5DGJA 1ZJDA 1BMNH 2ZFSA 1MAYA 2C93B 1EKBB 1C5LH 2WINI 1C5SA 4GSOA 1IHTH 1HAVA 3DUXH 5FCRA 2I6SA 1IQLA 3QZRA 1TAWA 2ZECA 1NFWA 1MAXA 3TJOA 4LZ4B 1O5BB 2Q1JA 4J2YB 1QNJA 2GX4A 2C8XB 1O3BA 1FI8A 2PSXA 1GI1A 2W5EA 2OC7A 4ESTE 1WYKA 1O3NA 1Z6JH 4YLQH 5JDUB 1MBMA 2FX4A 1CU1A 1Z8JB 3SU3A 1AFQC 3LGUA 4ISHH 1CA8B 4FUCA 2STBE 2J4IA 3P8FA 3PLBA 5GPIB 5BPEA 1AU8A 5JPMH 2FOCA 1SVPA 4IN1A 3LONA 1ZMLA 3OSYA 4GLYA 2PHBA 3GCTF 4U32A 1FY5A 3GY7A 4OGXA 1O38A 1DPOA 2NU4E 1G32B 3L6PA 1V2JT 5EU8A 2DE8A 4WWYA 3VXFH 1E0FD 4FUJA 1GBMA 2BD9A 3NCLA 1TA2A 1GJ5H 3VB5A 1Y3YA 4BXSA 1SGIB 1C5VA 2OBOA 3TGKE 2ANWA 2IPHA 4SGAE 3RXPA 3F9GA 3D65E 1LCYA 1WQSA 3SU6A 2ZTYA 1XUFA 3MO3A 1TA6A 2QXGA 2W7SA 1F2SE 4AX9H 4NIVA 4ISOA 1F5KU 3GY6A 1KXCA 2F9NA 6ESTA 1C5MD 2OBQA 4F4OC 4NIXA 1QB1A 1SLWB 3MOCA 5I46H 1UCYK 4AB8A 1NC6A 1SLXB 2IN2A 2ZPQA 5EG4A 2J2UA 3ZZAA 1P2IA 1UMAH 1CGHA 2PFEA 3PWCA 4Z6AH 2VVVA 4DJZB 1QCPA 1O2OA 3RM0H 4ZMAH 3E1XB 3GY3A 1AY6H 3T2NA 1HAXB 2JH6D 1O0DH 5F8TA 5FPYA 5C3NA 4MG3A 2AGGX 3ESTA 2P8OB 1OXGA 3HGPA 4ISNA 2FMJA 4K69A 1B0EA 2XRCA 2BY5X 1BTUA 2BQ7B 1OWIA 1SHHB 3AAUA 2UWLA 1A61H 5E0GA 1NROH 1O2NA 1GBIA 3F9EA 1S0RA 3UIRA 2A7CA 1O32A 4CH2B 2PUQH 1CHGA 1YYY1 1QURH 2QCYA 2QN5T 5HYOA 3GDVA 1FUJA 1TB6H 4Q2KA 1TOCB 1PFXC 3ZVBA 2JETC 3FP7E 1S81A 4THNH 3I78A 1FNIA 2UUKB 4XE4A 3ZVGA 3RU4D 1V2WT 1C5NH 4BOHA 2Z9JA 3SJOA 4NSVA 1S5SA 1QRXA 4JZ1A 4MDSA 1GMHG 1H8IH 4DIIH 3E16B 3IWMA 3MU1A 3N7OA 1PPGE 1P05A 1VCWA 2ANMH 3SQHE 5C67A 3MYWA 5F6MA 3URCA 3QWCH 1AD8H 1NO9H 3RXJA 1HAZB 1SB1H 1LVBA 2Z3CA 3QO6A 1G36A 5DP6A 1FQ3A 3SW2B 1YPMH 1TQ7B 3KL6A 1O2XA 2J38A 1Z1IA 4ZKRU 1UK2A 3RXSA 1D3TB 2VGCB 4FU9A 1Y3UA 1BB0B 1O2WA 5IYTA 3QK1A 4Q7YA 3RXGA 1GI6A 4OS5A 1HGTH 2VWOA 1EPTA 2FPZA 3H5CB 4MNXA 1EP6A 2WPIS 4GHQA 1FV9A 3B8JA 1EB1H 1HV7A 1C1SA 1XX9A 3T5FH 2WYJA 4MNWA 1ZSJA 1ELVA 5A09A 1K1LA 1O2GH 5FX5A 1O3EA 2Q6DA 2VIWA 3ZZ5A 1QRWA 5GCHG 3M3VA 2GDEH 4NWLA 1V2LT 1MKXK 3GYLB 5CHAB 5GDSH 1O33A 1UTLM 4TWWA 5FPSA 1ZSKA 2G52A 5CE1A 1FIWA 1S6HA 5GXPA 3E91A 5G4BA 5HMAA 2BD8A 2A5KA 3LGYA 4TYDA 1NS3A 1A1RA 1XKBC 2PLXA 5F8ZA 1P2NA 5E2PA 1ZRKA 4DURA 3DFLA 1C5WB 2ZU5A 3SJ8A 3Q00A 4X1SU 5HM9A 3A80A 5JYIA 1H1BA 3RMOH 1O5EH 2VIOA 3O8BA 1DWEH 4HTCH 2QC2A 1HAVB 2BDYA 4X8UH 5T3HA 1A46H 1LKBA 3KCGH 5E0JA 3GCHC 2IOTA 3GY8A 5EXLA 1C1TA 1EJNA 2J92A 1ABJH 5FBEA 1D6WA 2BM2A 1SGCA 1TNIA 1P06A 1P2MA 2J34A 1WU1A 1SGDE 1NRQH 1QQUA 4UFDH 1EUFA 1GCTB 1LHCH 5K7RA 1HJAB 2BD2A 2SGDE 4AB9A 4JCNA 4AYYB 2AGIX 2TGAA 1A7SA 3SV9A 1P10A 1Z71A 1JOUB 2GT8A 2ZGCA 3GYMA 3OYPA 2A4RA 3VFEA 1AFEH 1IQEA 3STJA 1SGFA 3RC6A 1ESAA 1YBWA 2G4TA 1O3AA 1ZGIA 3A7YA 4WVPE 3K9XB 5F03A 3PYHA 4B74A 3EA9A 3BTHE 4IMZA 3GICB 2ALPA 2OXSA 3LPRA 3MNBA 3BG4C 2BXTH 2H9TH 3MU8A 4PROA 3TJUA 5LGOA 1DWDH 2GCHF 2BZAA 1DLEA 2FS9A 1XM1A 1YLCA 1W13U 1P04A 1V2OT 3BEFB 3GISB 2VH0A 2LNCA 2CN0H 1T8OA 1FJSA 3JZ2B 3S69A 3V13A 2ZU4A 3A88A 3TGJE 1EZSC 1TIOA 4RKJB 1OWHA 1LQEA 2VU8E 1P9UA 3O8DA 5GJ4B 1K1IA 1GGDB 3KGPA 3TPIZ 1BTWA 3SUGA 2XBVA 1Y3VA 3GDSA 1JRTA 2VIDA 1C2KA 1SBWA 1TMUH 3MNXA 1KIGH 4IBLH 2ZC9H 2Z3DA 3O8CA 1ELGA 1C9PA 3UWIA 3LGVA 3ZZ8A 1PPHE 1D3QB 1G3BA 3SNDA 3SV8A 4DW2U 1TX8A 2QY0B 1C1UH 3UR9A 5EPYA 3RXBA 1NESE 1YC0A 5DP7A 1GBFA 5I25A 1J8AA 2OLGA 1GI3A 4BTIB 4NA7A 2BMGB 3VGCB 3ODDA 2FLRH 3A7VA 1G9IE 4B2BA 1FY8E 4X6NA 2ZGBH 2FS8A 1SOTA 3OX7U 4K60A 3BN9A 4GVUA 5A2MH 1MUEB 3S7KB 4Y11E 1FONA 3KIDU 1UCYH 2ZDLA 1C2IA 5C5OA 5E8EH 5HXFA 2R3UA 3E0PB 4B2AA 4X6MA 1EASA 4OGYA 1XVMA 1H9HE 4GUXA 1THSH 1GJ7B 3ENSB 3UNSA 1VJAU 1Z6EA 2G4UA 4B1TA 4WMEA 5HM2A 2F9VA 1F7ZA 1EAIA 4F49A 3E8LA 1ZMJA 1TPOA 3GY4A 1AQ7A 2G55A 3PB1E 1DXWA 2W26A 1T4UH 1CA0C 4LOYH 3FP6E 1L1NA 2BX3A 6GCHF 1C2MA 1PPFE 1ZJKA 4BTUB 1LTOA 1BDAA 1PQ8A 1V2NT 3BIUH 3EDXB 4ZKOU 3E3TA 1HUTH 1ETTH 4DIHH 3GY5A 4AFUA 2QXIA 2BQ6B 1XXDA 3U8RH 1G3CA 4CR9A 4X2VA 4UE7H 4X1QU 1J14A 3MH5A 1QBNA 1EPTB 1AVWA 4ZXYH 3SO3A 4E7NA 1GDUA 2PTNA 3B23B 4OS2A 1UTQA 3FZZA 3AW1A 1E35B 3M61U 3UREA 1EB2A 2Y5GA 2ZKSA 1QB6A 1HAPH 1TLDA 3LC5A 3QN7A 2ZDVH 3SGQE 1G3EA 4D8NA 3ZZDA 1C1PA 1GI4A 1YPGH 1F0RA 5EQQA 2SGAA 1C9TA 1DVAH 1TWXB 8GCHF 2GV6A 3S0NA 1UTJA 3P8OA 1BMAA 1C1VH 2KAIA 1HDTH 2V0BA 1N6XA 1P01A 2Z9GA 2TPIZ 2SGQE 2D2DA 1EXFA 1RIWB 2R2WU 4MPXA 3PV4A 1CQQA 3BTEE 4O97A 4ZROA 3LKWA 3LC3A 4NCYA 2PTCE 2W3KA 2TBSA 1TPAE 1UCYE 2QA9E 1UVUH 2BQWB 4NA8A 3FP8E 4U30A 2GZ8A 2H5CA 2VIPA 3UOPA 3UOUA 4A1TA 1GBLA 2FESH 2ILNA 3T29A 1KYNA 5TCCA 1WTGH 1MKXH 2NU3E 2J9NA 1UK3A 2FOAA 1BRBE 3GCNA 2BY8X 2WPLS 3QX5H 1TE0A 1OWEA 4ABBA 1O3HA 3NPSA 1BBRK 2CMYA 1OX1A 2ZFTA 2BD3A 4AG2A 1BQYA 4JK6A 1W2KH 1KXFA 4YM9A 3MH6A 2GTBA 2D1JA 2CF8H 1AN1E 2ZDAH 1G3DA 1MTNB 4AFSA 2C3SA 4HZHA 1LHEH 4KP0A 1C2FA 2FTLE 3RMLH 5ESBA 3RDZA 2XCNA 1F0SA 1MZAA 5JBAS 2WV5A 5BRRE 2YNAA 1VITG 3A7ZA 2O8WA 3O8RA 3WY8A 1RD3B 4WF8A 1V2RT 3AW0A 3T26A 2CF9H 3SJKA 1P3EA 3F1SB 3TLOA 3RXMA 1QL9A 2BVSH 3PMBB 1K21H 3P8GA 3HATH 1VGCC 5T6GA 1LPKB 2RA3A 1Z7KA 1P2OA 3A89A 1TMTH 2RA0A 2GV7A 2BVRH 1ELDE 1GBJA 3NUMA 5DP4A 1L0ZA 4CRGA 3Q3YA 3P70B 4KELA 2R0LA 2WV4A 1W0ZU 3RP2A 5GCHF 1EATA 3RU4T 3M36A 3BTQE 2C90B 2UUJB 3E0NB 4A1XA 4ZKNU 5DP8A 1Y8TA 4KGAA 1GMDG 2F83A 9ESTA 2B8OH 4KKDA 4X8VH 4I8JA 3T25A 4X0WU 1FZZA 4MVNA 1SHYA 1SLUB 1NZQH 1JBUH 1O3MA 1SI5H 5FBIA 4ISIH 1BRUP 3F9HA 4XBBA 1C1QA 1K9OE 4K5ZA 1O3OA 5DK1A 1O2SA 3PMAB 2BDBA 2AS9A 2CJIA 2B5TB 1FLEE 1PPZA 2VWLA 1TALA 5AFYH 1TGCA 3SUFA 3T62A 3EA8A 1T8MA 2PUXB 1GHXH 3ZVEA 1JIRA 5E2OA 1GCDA 4JZEH 1C1NA 2FODA 3LU9B 2HNTE 3SI3H 2P16A 3PMHB 6CHAC 1K1PA 3VB6A 4ABGA 2HOBA 4RSPA 1NFXA 1X7AC 4KTSA 1QBOA 1CO7E 5T6DA 5C1XA 5DJ7A 2HVXA 1GBDA 2HLCA 1O3FA 2Q6GA 1O3KA 3TGIE 1QY6A 2ZPSA 1EZUC 5EOKA 3A87A 1TGNA 3DFJA 2QF3A 4Y76A 1IQGA 3KQCA 1UHBA 2FLBH 1O3GA 1GG6C 3TH4H 2OUAA 5JBBS 2FYQA 4YT7H 1HJ9A 1OSSA 3LIWA 1VR1H 1W11U 2F9PA 4TY7A 5EGMA 1NTPA 4I8HA 1V3XA 2ZTXA 3SV7A 1SOZA 1RJXB 3ITIA 4CHAB 4DG4A 1MU8B 1Z8GA 3R3GB 2OC1A 4H42U 3TITA 1NRPH 3BTGE 3HGNA 3KQDA 4UFGH 1NM6A 3PROA 2ZHWH 4IGDA 3MU4A 2Z94A 3BIVH 3R0FA 4WMDA 1GBEA 3Q76A 1YLDA 3MO6A 1VITH 4ISLA 1O5GH 2O8LA 1EAXA 3VPKA 2XWBI 1A0HB 3PTNA 4ABIA 1S85A 1YPEH 1KSNA 1TRMA 1GHVH 1QIXB 1UVPA 2Y82A 4AORA 1TGSZ 2AEIH 1H4WA 4CBOA 2V3OH 1AVXA 1NRNH 1AIXH 1IQMA 1L1JA 2EEKA 1O2HA 3MHWU 4ABJA 2KAIB 5F8XA 5A8XA 4WXIA 5L30H 4OS6A 2HNTF 5A0AE 1DOJA 1HFDA 4Y8YA 2OC8A 1MH0A 5E0HA 1G2MA 3M35A 3VXEH 1D3DB 3LOXA 4LK4A 2ZPRA 2QXHA 2QF0A 2UWPA 1GJCB 2ZDMA 1Q31A 3MH7A 2QGRA 2LPRA 3U9AH 3TH3H 2P95A 1GDNA 1WAYB 3D23A 1EQ9A 1P02A 3V7TA 3P6ZB 1GHBG 3ZZ3A 4ZH8A 1CT2E 1TONA 3F68H 1JWTA 4JYUH 4WH8A 3EE0B 1PPEE 1O5DH 1LKAA 2XBXA 3RXIA 4CRAA 3BTFE 1Q2WA 5C5NA 3PO1C 1T32A 2XNIA 2FX6A 1W8BH 3SNAA 1BOQA 1MQ5A 2HPPH 4X8TH 3RC4A 1MTUA 5A0CA 3CENA 2BOKA 1C2JA 4ZHAA 2CHAC 3MWIU 4YT6H 1TBQH 1EOJA 2ZU3A 3M5OA 4MPVA 5ETXA 1UTPA 3A83A 5GIBA 3ZZBA 1C5TA 1YF4A 1HAIH 1AUJA 3NWUA 2ULLA 2AH4X 2GCTB 1W12U 1INCA 4X6PA 1C5OH 2A4OA 4VGCC 3U1JB 3BTTE 3HKJB 3UNRA 9LPRA 4Y8XA 2Y7XA 2VJ1A 1BBRH 4ZKSU 2ZI2H 1RTFB 3RLYH 3RMMH 4R8TB 1C5ZB 1GBKA 1S0QA 3NK8A 4INHA 1DANH 4RKOB 4TY6A 3RXRA 3LJOA 1ELEE 3A8CA 1QJ1B 3Q3XA 4Y10E 5FXLA 2A2XH 3KHVA 1LDTT 3ATWA 4WH6A 1HAYB 2Y81A 3D62A 1SGTA 4Y7AA 2FOBA 2BX4A 3QTOH 2ZU1A 3A7XA 3L33A 1AFQB 2BYAX 1DWCH 2UUFB 1MTSA 1O3IA 1OWKA 3MNCA 4MNYA 1ZYOA 3SGBE 2EI6A 1LQDB 3FVFB 1P9SA 4KTUA 1GBTA 1ZHMA 3RC5A 2QAAA 4CRFA 4YESB 5AFZH 3M37A 2FI4E 1HAHH 2FDAA 1V2VT 2FO9A 3NXPA 1EJAA 1THPB 2WYGA 1GJ9B 1N8OB 1BUIA 1J9CH 1FY3A 1GI9B 1ZOMA 2RCEA 2XYAA 4FU8A 1FN8A 7ESTE 1GJBB 2VVUA 3K65B 5EXMA 1KDQB 1BTXA 1GVLA 1CVWH 3T27A 2GVFA 4BAOB 4Y0ZE 4JYVH 1SSXA 3LGIA 1EPTC 1EP5A 4Y7BA 2PGBB 1S84A 1C5PA 4TPYA 3P95A 3FANA 1MCTA 4X2WA 3MH4A 3URDA 1O30A 1S6FA 2FI5E 1QRZA 4XBDA 1LHDH 2XWAA 2PR3A 5K0HA 2ZA5A 4NWKA 1QQ4A 1BRCE 1F0TA 4YOGA 2VIVA 3TJVA 2O8MA 3PLPA 1MQ6A 3RXKA 2O8UA 1NPMA 5PTPA 3KNXA 4WMFA 3IG6B 3GCTG 3AVZA 1CT0E 1G30B 2OP9A 1VITF 2GMTB 1C1MA 1UHBB 3NZIA 5EW2H 4JMYA 1HAOH 3MI4A 5L2ZH 1IAUA 2D26C 2A7HA 1DWBH 1SFIA 1BBRE 2BDIA 3C1KA 4B2CA 3EQ0H 1AMHA 1WQVH 2XCFA 1QJ6B 5TJXA 1HLTH 3ZZ4A 4MTBA 1SGRE 4JZDH 2RDLA 1FN6A 1XUJA 2GZ7A 2TRMA 5FAHA 4LZ1H 1A0LA 2RG3A 3SI4H 1C4Y2 5EXNA 1AE8H 4BNRA 1TNGA 3UTUH 1W10U 2JETB 1V2QT 2ZO3H 7GCHF 4BTTB 1AWHB 2ZDNA 1S83A 1AI8H 2YNBA 2JH5D 3ZZ9A 1YCPK 4DGJA 1ELFA 2AIQA 1MTNC 3MTYA 1BMMH 1H8DH 1CE5A 3RXCA 3P8NA 4AZ2B 5DKMA 2CXVA 2ANYA 1HBTH 4D76A 1C5YB 3S9AA 3RU4E 1C1OA 1A4WH 3RXVA 3H7OA 1FAKH 1E38B 3JZ1B 5DPAA 2HGTH 3C27B 4FUGA 2C8WB 4ABAA 2ZHQH 3RXOA 2GT7A 7LPRA 1THRH 4NIWA 2AIPA 1XUKA 4OS1A 4I7YH 4BANB 4NZLA 3A8BA 3OU0A 2K1QA 2VNTA 3KF2A 3SQEE 1FY1A 3SHAH 2A32A 4ZUHA 1LVYA 4K1SA 1DICA 1MD7A 2QV1A 3SNCA 1HNEE 1OP2A 2NU1E 4IN2A 1QJ7B 2BHGA 2V35A 1S82A 3STIA 5AVDA 1ZTLA 2C8ZB 2AERH 4CH8B 2PKSC 3TIUA 4NGAH 2V3HH 1SGYE 1TNJA 2G5VA 1ANBA 1AE5A 1SGQE 1F5RA 4U2WA 5DP5A 1LHGH 4ABHA 3BTWE 3NKKA 1A5GH 1NU9A 2A4QA 1Y3WA 1JXPA 3SZNA 4UEHH 2C8YB 1Y5AT 1O2RA 4BAHB 1ORFA 1NFUA 1YPHC 2ANKH 2H6MA 1B5GH 1KTSB 2ALVA 3F9FA 1BRAA 1HAGE 1TMBH 2XBYA 3P92A 2JH0D 3GCHB 1TPSA 4MNVA 3TVJB 1RRKA 2R0KA 1BTPA 3ZZ7A 4A1VA 1BTHH 3U1IB 1GJ6A 3D49H 1ETSH 2FOGA 3RXQA 2I6QA 1ELCA 4UDWH 3ZVFA 1UTMA 1MTWA 3QUMP 2PV9B 1BA8B 2R9PA 4H6SB 1OS8A 3K2UA 3HPTB 2VIQA 2Z9LA 3SN8A 1P0SH 1TFXA 2OQ5A 1RTLA 3U8TH 1O31A 1HXFH 2O9QA 4JYTA 2BLWA 3OY6U 2G5NA 2ZZUH 1C2HA 3GCOA 1SQAA 1FIZA 1IOEA 2BVXH
chains in the Genus database with same CATH superfamily
4UONA 5HKKD 2EC9H 3BG4B 3MFJA 3A86A 1SC8U 1H9IE 2OTVA 1NT1A 1OP8A 3V12A 1XUIA 5EJLA 2HALA 3LH1A 5IDKA 1TNKA 1TGTA 1W0KD 1PQAA 2F9BH 2PKAB 4BAQB 1TBRH 2TGPZ 1TOMH 3UAIC 1FY4A 4FETA 3EAJA 1C2DA 5C1YA 1PYTC 4WXVA 1GHBF 1O3JA 1V2MT 2A0QB 3M5LA 2AMDA 1ID5H 2BD4A 2HVYB 1QFKH 3GY2A 4XD7D 3V0XA 4D9QA 4INLA 3QZQA 1ZHPA 2IJOB 1W7XH 2PSYA 2XNDD 3ELAH 1ACBE 1GMHF 1O2QA 1DT2A 3EA7A 1OHHD 2AGEX 2ZU2A 1DX5M 1WSSH 2DUCA 1E37B 3LJJA 1OYTH 3Q3KA 3DT0H 4IS5A 2G81E 2STAE 5T6FA 1ESTA 1XUHA 4X1RU 1P57B 2P8OC 1CSOE 1ZHRA 1SGEE 5ABWA 1GHAG 6LPRA 1T7CA 1UK4A 1O2ZA 1OKXA 4NG9H 3CS7A 2ZCLP 5EQSA 4ASHA 4Y71A 1O36A 1AO5A 3LGWA 2ZTZA 1P2QA 1D9IA 4B71A 3BEUA 4JZIA 2ZHDA 2GCHG 1C5QA 1O2KA 2ZGHA 4A5TS 1BTZA 3A8AA 2F9UA 1DLKB 1IQIA 1G2LA 1BJVA 1E79D 5EIYA 1O2VA 1ANDA 2G51A 4K8BA 1SMFE 3QDZB 4AGJA 1D4PB 3F2GA 4FUBA 1BHXF 1ANCA 4ZHLU 3UY9A 2P3UB 4X8SH 3LH3A 1A5IA 4FUFA 5C2ZA 1J15A 1UJ1A 2XXLA 3RXFA 4B73A 1AB9B 1L4ZA 2G8TA 1PJPA 1C5RA 1C4U2 4AFQA 1V2ST 2IJD1 2ZHEH 3N7DA 4BAMB 4RN6A 2KM0A 1OYQA 1J17T 4I8GA 3SUEA 1CA0B 3UNQA 2VGCC 1KDQA 3CS0A 1GHYH 1NN6A 2H9HA 3SU2A 1CBWB 2YMSB 1BZXE 2A5IA 2GCTC 4Y8ZA 3M5MA 1ZR0A 4WY3A 2CK3D 2OC0A 1BIOA 1YPKH 2H9EH 1TBZH 5CMXH 1SGNE 1O2LA 3RXAA 1TGBA 1PPBH 3W1EA 1AKSA 4FUDA 1ZPCA 5L6NH 2JKHA 1GVKB 4B75A 5JBTA 3FOAA 3MO9A 1A2CH 2TGDA 3M5NA 5CHAC 2FTMA 5GWZA 1P12E 1YCPH 1YKTA 4AYVB 4D9RA 3HK3B 3UQVA 4E7RG 1TPPA 2ZFPH 1P2JA 1VCPA 4Q7ZA 5EQRA 1O5CB 1WOFA 2Y5HA 1AUTC 1MKWK 4CREA 2XW9A 4A7IB 1GHZA 2Z9IA 3GOVB 2GZ9A 3A85A 3QTVH 3KQBA 2WPHS 1OWDA 5J4QA 2FYRA 2ASUB 2SFAA 3BTDE 1EZXC 4O9VA 2HNTC 1SGFG 1ZTKA 2A5AA 3SORA 2A2QH 4D7FA 1FDPA 1PPCE 5KEDA 2WUCA 1LO6A 6GCHG 1GL1A 3HKIB 2P94A 1N8OC 4UFFH 2ZDKA 8LPRA 1DUEA 1EAUA 2F9OA 4Y6DA 1A3EH 1BITA 2ZGXH 1ZPBA 3QGJA 1P3CA 1NU7B 1BCUH 2HLDD 5A8ZA 1KLIH 2R3YA 4DY7B 2EI7A 2BOHB 2BDGA 1FXYA 1GCTC 1MU6B 1BHXB 3A82A 5H4IB 1HJAC 2J5UA 2NU2E 2XC0A 1OPHB 4SGBE 4X6OA 1N6YA 4U01A 2OQUA 3ATLA 3N99A 2B7DH 5A8YA 1MBQA 2Z9KA 1PQ7A 4BXWA 3U69H 1IQHA 1NRSH 3SU1A 3DSPA 3S9BA 2Y6TA 2ZGJA 3MU0A 1ARBA 1W0YH 4XDEA 1HJ8A 1VJ9U 1UTOA 4YLUA 1JIMA 1DUAA 2BLQA 3RMNH 1KXDA 4DVAU 1ANEA 1EX3A 2WPMS 2ZNKH 3H09A 2B0FA 8GCHG 5FPTA 1SPJA 2GMTC 3FFGA 3H7TA 1BJUA 5DP9A 1V2UT 4A92A 3VB4A 3RXEA 1GI8B 1LPGB 2F4LA 1MTVA 1BMFD 3PV2A 4IW4E 2BY6X 2Z3EA 2J95A 1V2TT 1MD8A 4GCHG 2FXRA 1LHFH 2BZ6H 1CHOG 2CV3A 1V6DA 1Y5UT 3AAVA 4JZFH 2TGTA 1GGDC 1XVOA 2VH6A 3SOSA 1XXFA 1F5LA 1ZZZA 2F3CE 3ATKA 1VGCB 3F6UH 1QZ8A 1O2PA 3DA9B 2AYWA 4MPUA 1K1MA 2GGVB 3S7HB 2OINA 1JMOH 4RT0A 1L4DA 2V6NA 2XC4A 4Q80A 1OOKB 1ABIH 1GI2A 2ZG0H 1EOLA 4FU7A 3RXDA 1QA0A 1GMCG 1HRTH 2WV9A 3EYDA 4XBCA 4MQAA 2NWNA 3FKSD 2SGFE 1K1NA 2KCYA 2FEQH 1RGQA 3VGCC 4AFZA 4CRDA 3A8DA 2O8TA 1A5HA 5CDFE 1HIAA 1WV7H 1GJ8B 1D6RA 1YPLH 5HIZA 1A0JA 3SV6A 1GBBA 1OP0A 2EA3A 1TX6A 4I8LA 5LPRA 3E90B 4J1YA 3RXTA 4DT7B 1P8VC 1O2MA 4ZAEA 1ESBA 1S6LA 2SGEE 2VB0A 2UWOA 2XBWA 2CGAA 4HFPB 5EJ1A 3QLPH 2QF4A 3BEIB 1SQTA 1B0FA 1O5FH 2EI8A 2HRVA 1C5XB 3SV2H 3M3TA 1O35A 2G00A 5AF9H 5FHTA 3UR6A 4YOJA 2TIOA 2WUBA 1Z8IB 3L3TA 1Z1JA 1HCGA 3BTKE 3TU7H 1UO6A 3T28A 2P93A 4H6TA 3ZYDA 2ZIQH 2XC5A 6CHAB 1ZPZA 4NFEA 3OTJE 1TNHA 4IC5A 2ODQA 4Q7XA 3WWFA 3F2HA 2AFQB 4YOIA 3SNBA 4Y0YE 4YZUA 1GBAA 2R2MB 3SZEA 1WUNH 1CGJE 3U8OH 4DOQA 3KQEA 4LXBH 1GPZA 1YWUA 1YP9A 1G37A 2FOEA 4CRCA 2SNWA 5FCKA 3SHCH 1GBHA 4XSKU 1BTYA 2BTCE 3A84A 3I29A 3SGAE 1JRSA 2SGPE 4DCDA 2PKAA 4X1PU 1RS0A 4AN7A 3TNTA 1SGPE 1T4VH 4F48B 4AOQA 1KXAA 1AWFH 1GG6B 2QXJA 4ABDA 3MU5A 2ESTE 2ZQ1A 2QIQA 4XOJA 2BDCA 2KZ4A 5C20A 5B6OA 1DS2E 4JK5A 5TCAA 1TRYA 1KXEA 5HGGA 1AKSB 3PMJA 3ZZ6A 2YOLA 1QBVH 1YCPM 2AHME 1KXBA 4TPIZ 2UUYA 2F91A 2A31A 3PLKA 3QGNB 3KEEA 1PYTD 3M7QA 4ZHMU 4K1TA 3IITA 4K1EA 3ZZCA 3LT3A 1FPHH 2QYIA 2Z7FE 2BLOA 1SG8B 1OWJA 1CT4E 1RIWC 1GHAF 4CRBA 1UVTH 1CGIE 2BDHA 4B76A 3RLWH 1LPZB 3HK6B 4QT8C 3B9FH 2FOMB 2ZCKP 3BTME 3UQOA 2VWNA 4K8YA 1SFQB 4K2YA 3MNSA 4MPWA 3ZV9A 1GHWH 3A7WA 5FX6A 2VVCA 5LH8A 1GBCA 1K2I1 2J98B 2DE9A 2J94A 2ODYB 3AK5A 5LPFA 2FI3E 2EY4C 5KGOA 4X1NU 3TH2H 5IK2D 1FPCH 4YXWD 1B7XB 1C1WH 1ELTA 1O2JA 4OS4A 1MKWH 2ZQ2A 3VEQB 2ZFFH 2GP9B 1DY8A 1XUGA 1WDIA 3BF6H 4A6LA 2ZP0H 3G01A 1PQ5A 1C4V2 4Y79A 1GDQA 1GMDF 1KMHB 4IC6A 1W3CA 1ARCA 4I31A 4I32A 1EJMA 1DITH 1SL3A 3ATIA 3MMGA 3PO1B 1T8LA 3RUOA 2Z6BD 2H5DA 1TYNA 1Y5BT 1Y59T 2SNVA 2ZCHP 4TWYA 3OY5U 4NFFA 3M7UA 3GDUA 1E34B 5DG6A 1TNLA 3LGTA 1VZQH 1VCQA 2Q6FA 2ODPA 1MZDA 2OCVB 3M7TA 1F0UA 3RXHA 1MCVA 4HI3A 3UFAA 3BV9B 2CHAB 1O2UA 1QR3E 2W6ID 3W94A 4E06H 4UFEH 2HWLB 4GHTA 2RFKC 1DM4B 1C5UA 4NZQA 2FM2A 2Y5FA 2M5TA 4UD9H 4Z0KA 5SGAE 1K28D 3OEED 4VGCB 1EAWA 3TNSA 3RXUA 3SUDA 3K6ZA 5JB8S 2BXUH 3FO8D 1O3CA 3AASA 1C2LA 2Y7ZA 1AVGH 1GI0A 1IQFA 1O3DA 3OEHD 1ZTJA 1IHSH 2FOHA 1QHRB 1BT7A 4I8KA 1D3PB 3SJIA 1RXPA 2P59A 4CR5A 1TQ0B 1AB9C 1DE7H 1QGFA 4YO9A 4ZXXH 2JJ1D 1UVSH 2ZWLH 3UUZA 1O3PB 2Y80A 4O3UA 1FMGA 4YTAA 1MMJN 4K3JA 5J4SA 1YPHE 1UTNA 2WPJS 2OK5A 2AMPA 4M7GA 1DDJA 5C0TA 1AZZA 1O2IA 1GJDB 1DSTA 8KME2 1SQOA 1YGCH 4X2YA 5A0BA 1HIAB 1HPGA 3PM3A 3P17H 3SJ9A 1CBWC 1BMLA 1C2GA 1P03A 1XMNB 1UVOA 2KFWA 2WPKS 1ETRH 3BSQA 3E6PH 4OM9A 3S9CA 1K22H 1O2TA 3VB7A 5KECA 1O5AB 4B6FA 1GJ4H 5EPNA 2L74A 1NRRH 3BG8A 2BY9X 4ZCNA 1O34A 2ZHFH 1NFYA 1L2EA 2ZF0H 4WJG2 3DD2H 2K8IA 3V3MA 3N7EA 1V2PT 7KMEH 4X2XA 1AHTH 2FP7B 2M2AA 4KTCA 2NU0E 3ATMA 4FUHA 4O03A 3UWJH 5B6LA 5L2YH 1QB9A 1A3BH 1DFPA 4FUIA 2BD5A 2BLVA 1N1LA 1ZRBA 2GKVE 1YPJH 1HXEH 4INKA 1LVMA 4IMQA 3ZYEA 2A45B 3DHKH 1Q3XA 2BB4A 4MLFB 2PW8H 1RFNA 2LELA 2B9LA 3Q77A 4ABFA 4D7GA 2H1UA 2VINA 4OS7A 2A1DB 4NSYA 1GI5A 1ZSLA 2W7UA 3PWBA 3SU4A 2FWWA 1U6QA 2BY7X 1UTKA 3FZDA 5LPEA 1DXPA 2W3IA 1LMWB 3VB3A 1FAXA 4CHAC 1GL0E 2ZFQH 4GCHF 1ELBA 2P3FH 4BAKB 1CHOF 4XFQA 1WTHD 1J16A 1LVOA 3ODFA 3ZVAA 4FUEA 1AZ8A 3TK5A 3ZVCA 1IQKA 2AMQA 4GAWA 5AHGH 1W0JD 1P2KA 2GD4B 2H2ZA 1E36B 1V2KT 1QL8A 2A7JA 3SU0A 3W95A 3KN2A 3M3SA 4GPGA 4ABEA 1DY9A 2ZFRH 4FXGH 5EW1H 1AGJA 3A7TA 4AG1A 2PGQB 4AGKA 2GDDA 3K6YA 2THFB 1L1GA 1GMCF 3TJNA 3TK9A 3OAAD 1O37A 5JBCS 2VWMA 1T31A 4NA9H 1IQNA 1O2YA 1P09A 3U98H 1NY22 2FIRH 1ZMNA 1TRNA 2XTTB 2OD3B 3CP7A 4FVBA 2HPQH 1GWAA 3PRDA 1GJAB 1YM0A 1C1RA 1QTFA 2C4FH 3A81A 3TK6A 1HB0B 1K1OA 4O3TA 1RTKA 3PTBA 1SR5C 1XKAC 4R0IA 1P11E 2P3TB 1QL7A 1TX7A 2FOFA 1UW7A 2BDAA 2EQNA 1ELAA 1KLTA 3EGKH 1HYLA 1WCZA 1IQJA 4H4FA 2ZEBA 2D8WA 4FVDA 1GI7B 4NIYA 4E05H 1O39A 3RM2H 4HGCA 2FZZA 5ESTE 4I33A 5DO4H 2PWXA 4CBNA 1H8ED 8ESTE 1GVZA 3ZV8A 5EODA 3RXLA 1H9LB 1KLJH 1Z8RA 2BD7A 1QA7A 1W7GH 1T8NA 1O3LA 1NBME 5C1UA 1W14U 1M9UA 3SNEA 3MQKC 1EZQA 3F0OA 1KTTB 3OFND 3LDXH 3I77A 2A4GA 3SBKA 1TABE 1ZGVA 1K1JA 7GCHG 1F92A 2K0QA 1KY9A 5DP3A 3SU5A 1WBGB 1DSUA 1Y3XA 3ZVDA 5JB9S 3UPEA 1ZLRA 3FAOA 1SLVB 1C2EA 2PKSB 1VKYA 5DGJA 1ZJDA 1BMNH 2ZFSA 1MAYA 2C93B 1EKBB 1C5LH 2WINI 1C5SA 4GSOA 1IHTH 1HAVA 3DUXH 5FCRA 2I6SA 1IQLA 3QZRA 1TAWA 4XRNA 2ZECA 1NFWA 1MAXA 3TJOA 4LZ4B 1O5BB 2Q1JA 4J2YB 1QNJA 2GX4A 2C8XB 1O3BA 1FI8A 1E1QD 1GI1A 2PSXA 2W5EA 2OC7A 4ESTE 1WYKA 1O3NA 1Z6JH 4YLQH 5JDUB 1MBMA 2FX4A 1CU1A 1Z8JB 3SU3A 1AFQC 3LGUA 4ISHH 1CA8B 4FUCA 2STBE 2J4IA 3P8FA 3PLBA 5GPIB 5BPEA 1AU8A 5JPMH 2FOCA 1SVPA 4IN1A 3LONA 1ZMLA 3OSYA 4GLYA 2PHBA 3GCTF 2KCAA 4U32A 1FY5A 3GY7A 4OGXA 1O38A 1DPOA 2NU4E 1G32B 3L6PA 1V2JT 5EU8A 2DE8A 4WWYA 3VXFH 1E0FD 4FUJA 1GBMA 2BD9A 2J98A 3NCLA 1TA2A 1GJ5H 3VB5A 1Y3YA 4BXSA 1SGIB 1C5VA 2OBOA 3TGKE 2ANWA 2IPHA 4SGAE 3RXPA 3F9GA 3D65E 1LCYA 1WQSA 3SU6A 2ZTYA 1XUFA 3MO3A 1TA6A 2QXGA 2W7SA 1F2SE 2GJGA 4NIVA 4AX9H 4ISOA 1F5KU 3GY6A 1KXCA 2F9NA 6ESTA 1C5MD 2OBQA 4F4OC 4NIXA 1QB1A 1SLWB 3MOCA 5I46H 1UCYK 4AB8A 1NC6A 1SLXB 2IN2A 2ZPQA 5EG4A 2J2UA 3ZZAA 1P2IA 1UMAH 1CGHA 2PFEA 3PWCA 4Z6AH 2VVVA 4DJZB 3F3BA 1QCPA 1O2OA 3RM0H 4ZMAH 3E1XB 3GY3A 1AY6H 3T2NA 1HAXB 2JH6D 1O0DH 5F8TA 5FPYA 5DN6D 5C3NA 4MG3A 2AGGX 3ESTA 2P8OB 1OXGA 3HGPA 4ISNA 2FMJA 4K69A 1B0EA 2XRCA 2BY5X 1BTUA 2BQ7B 1OWIA 2WPDD 1SHHB 3AAUA 2UWLA 1A61H 5E0GA 2J97A 1NROH 1O2NA 1GBIA 2XOKD 3F9EA 1S0RA 3UIRA 2A7CA 1O32A 4CH2B 2PUQH 1CHGA 1YYY1 1QURH 2QCYA 2QN5T 5HYOA 3GDVA 1FUJA 1TB6H 4Q2KA 1TOCB 1PFXC 3ZVBA 2JETC 3FP7E 1S81A 4THNH 3I78A 1FNIA 2UUKB 4XE4A 3ZVGA 3RU4D 1V2WT 1C5NH 4BOHA 2Z9JA 3SJOA 4NSVA 1S5SA 1QRXA 4JZ1A 4MDSA 4Z1MD 3DSOA 1GMHG 1H8IH 4DIIH 3E16B 3IWMA 3MU1A 3N7OA 1PPGE 1P05A 1VCWA 2ANMH 3SQHE 5C67A 3MYWA 5F6MA 5EJZA 3URCA 3QWCH 1AD8H 1NO9H 3RXJA 1HAZB 1SB1H 1LVBA 2Z3CA 3QO6A 1G36A 5DP6A 1FQ3A 3DSGA 3SW2B 1YPMH 1TQ7B 3KL6A 1O2XA 2J38A 1Z1IA 4HG6A 4ZKRU 1UK2A 3RXSA 1D3TB 2VGCB 4FU9A 1Y3UA 1BB0B 1O2WA 3SYJA 5IYTA 3QK1A 4Q7YA 3RXGA 1GI6A 4ACAA 4OS5A 1HGTH 2VWOA 1EPTA 2FPZA 3H5CB 4MNXA 1EP6A 2WPIS 4GHQA 1FV9A 3B8JA 1EB1H 1HV7A 1C1SA 1XX9A 3T5FH 2WYJA 2KX4A 4MNWA 1ZSJA 1ELVA 5A09A 1K1LA 1O2GH 5FX5A 4TSFD 1O3EA 2Q6DA 2VIWA 3ZZ5A 1QRWA 5GCHG 3M3VA 2GDEH 4NWLA 1V2LT 1MKXK 3GYLB 5CHAB 5GDSH 1O33A 1UTLM 4TWWA 5FPSA 1ZSKA 2G52A 5CE1A 1FIWA 1S6HA 5GXPA 3E91A 5G4BA 5HMAA 1YLNA 2BD8A 2A5KA 3LGYA 4TYDA 1NS3A 1A1RA 1XKBC 2PLXA 5F8ZA 1P2NA 5E2PA 1ZRKA 4DURA 3DFLA 1C5WB 2ZU5A 3SJ8A 3Q00A 4X1SU 5HM9A 1K0HA 3A80A 5JYIA 1H1BA 3RMOH 5F53A 1O5EH 2VIOA 3O8BA 1DWEH 4HTCH 2QC2A 1HAVB 2BDYA 4X8UH 5T3HA 1A46H 1LKBA 3KCGH 5E0JA 3GCHC 2IOTA 3GY8A 5EXLA 1C1TA 1EJNA 2J92A 1ABJH 5FBEA 1D6WA 2BM2A 4TT3D 1SGCA 1TNIA 1P06A 1P2MA 2J34A 1WU1A 1FX0B 1SGDE 1NRQH 1QQUA 4UFDH 1EUFA 1GCTB 1LHCH 4Q63A 5K7RA 1HJAB 2BD2A 2SGDE 4AB9A 4JCNA 4AYYB 2AGIX 1COWD 2TGAA 1A7SA 3SV9A 1P10A 1Z71A 1JOUB 2GT8A 2ZGCA 3GYMA 3OYPA 2A4RA 3VFEA 1AFEH 1IQEA 3STJA 1SGFA 3RC6A 1ESAA 1YBWA 2G4TA 1O3AA 1ZGIA 3A7YA 4WVPE 3K9XB 5F03A 3PYHA 4B74A 3EA9A 3BTHE 4IMZA 5C17A 3GICB 2ALPA 2OXSA 3LPRA 3MNBA 2RDEA 3BG4C 2BXTH 2H9TH 3KYFA 3MU8A 4PROA 3TJUA 1DWDH 5LGOA 2GCHF 2BZAA 1DLEA 2FS9A 1XM1A 1YLCA 1W13U 1P04A 1V2OT 3BEFB 3GISB 2VH0A 2LNCA 2CN0H 1T8OA 1FJSA 4I86A 3JZ2B 3S69A 3V13A 2ZU4A 3A88A 3TGJE 1EZSC 1TIOA 4RKJB 1OWHA 1LQEA 2VU8E 1P9UA 3O8DA 5GJ4B 1K1IA 1GGDB 3KGPA 3TPIZ 1BTWA 3SUGA 2XBVA 1Y3VA 3GDSA 1JRTA 2VIDA 1C2KA 1SBWA 1TMUH 3MNXA 2V7QD 1KIGH 4IBLH 2ZC9H 2Z3DA 3O8CA 1ELGA 3NRLA 1C9PA 3UWIA 3LGVA 3ZZ8A 1PPHE 1D3QB 1G3BA 3SNDA 3SV8A 4DW2U 1TX8A 2QY0B 1C1UH 3UR9A 5EPYA 3RXBA 1NESE 1YC0A 5DP7A 1GBFA 5I25A 1J8AA 2OLGA 2WZQA 1GI3A 1E1RD 4ACBA 4BTIB 4NA7A 2BMGB 3VGCB 3ODDA 2FLRH 3A7VA 1G9IE 4B2BA 1FY8E 4X6NA 2ZGBH 2FS8A 1SOTA 3OX7U 2VBCA 4K60A 3BN9A 4GVUA 5A2MH 1MUEB 3S7KB 4Y11E 1FONA 3KIDU 1UCYH 2WSSD 2ZDLA 1C2IA 3KYGA 5C5OA 5E8EH 5HXFA 2R3UA 3E0PB 4B2AA 4X6MA 1EASA 4OGYA 1XVMA 1H9HE 4GUXA 1THSH 1GJ7B 3ENSB 3UNSA 1VJAU 1Z6EA 2G4UA 2LP6A 4B1TA 4WMEA 5HM2A 2F9VA 1F7ZA 1EAIA 4F49A 3E8LA 1ZMJA 1TPOA 3GY4A 1AQ7A 2G55A 3PB1E 1DXWA 2W26A 1T4UH 1CA0C 4LOYH 3FP6E 1L1NA 2BX3A 6GCHF 1C2MA 2YMSC 1PPFE 1ZJKA 4BTUB 1LTOA 1BDAA 1SKYE 1PQ8A 1V2NT 3BIUH 3EDXB 4ZKOU 3E3TA 1HUTH 3PV5A 1ETTH 4DIHH 3GY5A 4AFUA 2QXIA 2BQ6B 1XXDA 3U8RH 1G3CA 4CR9A 4X2VA 4UE7H 4X1QU 2WHXA 1J14A 3MH5A 1EFRD 1QBNA 1EPTB 1AVWA 4ZXYH 3SO3A 4E7NA 1GDUA 2PTNA 3B23B 4OS2A 1UTQA 3FZZA 3AW1A 1E35B 3M61U 3UREA 1EB2A 2Y5GA 2KCPA 2ZKSA 1QB6A 1HAPH 1TLDA 3LC5A 3QN7A 2ZDVH 3SGQE 1G3EA 4D8NA 3ZZDA 1C1PA 1GI4A 1YPGH 1F0RA 5EQQA 2SGAA 1C9TA 1DVAH 1TWXB 8GCHF 2GV6A 3S0NA 1UTJA 3P8OA 1BMAA 2KR7A 1C1VH 2KAIA 1HDTH 2V0BA 1N6XA 1P01A 2Z9GA 2TPIZ 2SGQE 2D2DA 1EXFA 1RIWB 2R2WU 4MPXA 3PV4A 1CQQA 3BTEE 4O97A 4ZROA 3LKWA 3LC3A 4NCYA 2PTCE 2W3KA 2TBSA 1TPAE 1UCYE 2QA9E 1UVUH 2BQWB 4NA8A 3FP8E 4U30A 2GZ8A 2H5CA 2VIPA 3UOPA 3UOUA 4A1TA 1GBLA 2FESH 2ILNA 3T29A 1KYNA 5TCCA 1WTGH 1MKXH 2NU3E 2J9NA 1UK3A 2FOAA 1BRBE 3GCNA 2BY8X 5C94A 2WPLS 3QX5H 1TE0A 1OWEA 4ABBA 1O3HA 3GS9A 3NPSA 1BBRK 2CMYA 1OX1A 4DT4A 2ZFTA 2BD3A 2QE7D 4AG2A 1BQYA 4JK6A 1W2KH 1KXFA 4YM9A 3MH6A 2GTBA 2D1JA 2CF8H 1AN1E 2ZDAH 1G3DA 1MTNB 4AFSA 2C3SA 4HZHA 1LHEH 4KP0A 1C2FA 4P02A 2FTLE 3RMLH 5ESBA 1YY3A 3RDZA 2XCNA 1F0SA 1MZAA 5JBAS 2WV5A 5BRRE 2YNAA 1VITG 3U28C 3A7ZA 2O8WA 3O8RA 3WY8A 1RD3B 4WF8A 1V2RT 3AW0A 3T26A 2CF9H 3SJKA 1P3EA 3F1SB 3TLOA 3RXMA 4AC9A 1QL9A 2BVSH 3PMBB 1K21H 3P8GA 3HATH 1VGCC 5T6GA 1LPKB 2RA3A 1Z7KA 1P2OA 3A89A 1TMTH 3KQ5A 2RA0A 2GV7A 2BVRH 1ELDE 1GBJA 3NUMA 5DP4A 1L0ZA 4CRGA 3Q3YA 3P70B 4KELA 2R0LA 2WV4A 1W0ZU 3RP2A 5GCHF 1EATA 3RU4T 3M36A 3BTQE 2C90B 2UUJB 3E0NB 4A1XA 4ZKNU 5DP8A 1Y8TA 4KGAA 1GMDG 2F83A 9ESTA 2B8OH 5GNDA 4KKDA 4X8VH 4I8JA 3T25A 4X0WU 1FZZA 4MVNA 1SHYA 1SLUB 1NZQH 1JBUH 1O3MA 1SI5H 5FBIA 1SQRA 4ISIH 1BRUP 3F9HA 4XBBA 1C1QA 1K9OE 3OE7D 4K5ZA 1O3OA 5DK1A 1O2SA 3PMAB 2BDBA 2AS9A 3VG8A 2CJIA 2B5TB 1FLEE 1PPZA 2VWLA 1TALA 5AFYH 1TGCA 3SUFA 3T62A 3EA8A 1T8MA 2PUXB 1GHXH 3ZVEA 1JIRA 5E2OA 1GCDA 4JZEH 1C1NA 2FODA 3LU9B 2HNTE 5C0UA 3SI3H 2P16A 3PMHB 3OTPA 6CHAC 1K1PA 3VB6A 4ABGA 2HOBA 4RSPA 1NFXA 4B6EA 1X7AC 4KTSA 1QBOA 1CO7E 5T6DA 5C1XA 5DJ7A 2HVXA 1GBDA 2HLCA 1O3FA 2Q6GA 1O3KA 3TGIE 5CHBA 1QY6A 2ZPSA 1EZUC 5EOKA 3A87A 1TGNA 3DFJA 2QF3A 4Y76A 1IQGA 3KQCA 1UHBA 2FLBH 1O3GA 5DSFA 1GG6C 3TH4H 4FOUC 2OUAA 5JBBS 2FYQA 4YT7H 1HJ9A 1OSSA 3LIWA 1VR1H 1W11U 2F9PA 4TY7A 5EGMA 1NTPA 4I8HA 1V3XA 2ZTXA 3SV7A 1SOZA 1RJXB 3ITIA 4CHAB 4DG4A 1MU8B 1Z8GA 3R3GB 2OC1A 4H42U 3TITA 1NRPH 3BTGE 3HGNA 3KQDA 4UFGH 1NM6A 3PROA 2ZHWH 4IGDA 3MU4A 2Z94A 3BIVH 3R0FA 4WMDA 1GBEA 3Q76A 1YLDA 3MO6A 1VITH 4ISLA 1O5GH 2O8LA 1EAXA 3VPKA 2XWBI 1A0HB 3PTNA 4ABIA 1S85A 1YPEH 1KSNA 1TRMA 1GHVH 1QIXB 1UVPA 2Y82A 4AORA 1TGSZ 2AEIH 1H4WA 4CBOA 2V3OH 1AVXA 1NRNH 1AIXH 1IQMA 1L1JA 2EEKA 1O2HA 3MHWU 4ABJA 2KAIB 5F8XA 5A8XA 4WXIA 5L30H 4OS6A 2HNTF 5A0AE 1DOJA 1HFDA 4Y8YA 2OC8A 1MH0A 5E0HA 1G2MA 3M35A 3VXEH 1D3DB 3LOXA 4LK4A 2ZPRA 2QXHA 2QF0A 2UWPA 1GJCB 2ZDMA 1Q31A 3MH7A 2QGRA 2LPRA 3U9AH 3TH3H 2P95A 1GDNA 1WAYB 3D23A 1EQ9A 1P02A 3V7TA 3P6ZB 1GHBG 3ZZ3A 4ZH8A 1CT2E 1TONA 3F68H 1JWTA 4JYUH 4WH8A 1H8HD 3EE0B 1PPEE 1O5DH 1LKAA 2XBXA 3RXIA 4CRAA 3BTFE 1Q2WA 5C5NA 3PO1C 1T32A 2XNIA 2FX6A 1W8BH 3SNAA 1BOQA 5T1VA 1MQ5A 2HPPH 4X8TH 3RC4A 1MTUA 5A0CA 3CENA 2BOKA 1C2JA 4ZHAA 2CHAC 3MWIU 4YT6H 1TBQH 1EOJA 2ZU3A 3M5OA 4MPVA 5ETXA 1UTPA 3A83A 5GIBA 2PP6A 3ZZBA 1C5TA 1YF4A 1HAIH 2IPQX 1AUJA 2KCOA 2ULLA 3NWUA 2L6OA 2AH4X 2GCTB 1W12U 1INCA 4X6PA 1C5OH 2A4OA 4VGCC 2YMSD 3U1JB 3BTTE 3HKJB 3UNRA 9LPRA 4Y8XA 3WWBA 2Y7XA 2VJ1A 1BBRH 4ZKSU 2ZI2H 1RTFB 3RLYH 3RMMH 4R8TB 1C5ZB 1GBKA 1S0QA 3NK8A 4INHA 1DANH 4RKOB 4TY6A 3RXRA 3LJOA 1ELEE 3A8CA 1QJ1B 3Q3XA 4Y10E 5FXLA 2A2XH 3KHVA 1LDTT 3ATWA 4WH6A 1HAYB 2Y81A 3D62A 1SGTA 4Y7AA 2FOBA 2BX4A 3QTOH 2ZU1A 3A7XA 3L33A 1AFQB 2BYAX 1DWCH 2UUFB 1MTSA 1O3IA 1OWKA 3MNCA 4MNYA 1ZYOA 3SGBE 2EI6A 1LQDB 3FVFB 1P9SA 4KTUA 1GBTA 1ZHMA 3RC5A 2QAAA 4CRFA 4YESB 5AFZH 3M37A 3UB0A 2F43B 2FI4E 1HAHH 2FDAA 1V2VT 2FO9A 3NXPA 1EJAA 1THPB 2WYGA 1GJ9B 1N8OB 1BUIA 1J9CH 1FY3A 1GI9B 1ZOMA 2RCEA 2XYAA 4FU8A 1FN8A 7ESTE 1GJBB 2VVUA 3K65B 2JIZD 5EXMA 1KDQB 1BTXA 1GVLA 1CVWH 2V3MA 3T27A 2GVFA 4BAOB 4Y0ZE 4JYVH 1SSXA 4F55A 3LGIA 1EPTC 3FN8A 1EP5A 4Y7BA 2PGBB 1S84A 1C5PA 4TPYA 3P95A 3FANA 1MCTA 4X2WA 3MH4A 3URDA 1O30A 1S6FA 2FI5E 1QRZA 4XBDA 1LHDH 2XWAA 2PR3A 5K0HA 2ZA5A 4NWKA 1QQ4A 1BRCE 1F0TA 4YOGA 4ASUD 2VIVA 3TJVA 2O8MA 3PLPA 1MQ6A 3RXKA 2JDID 2O8UA 1NPMA 2QF5A 5PTPA 3KNXA 4WMFA 3IG6B 3GCTG 3AVZA 1CT0E 1G30B 2OP9A 3DCLA 1VITF 2GMTB 1C1MA 1UHBB 3NZIA 3F2FA 5EW2H 4JMYA 1HAOH 3MI4A 5L2ZH 1IAUA 2D26C 2A7HA 1DWBH 1SFIA 1BBRE 2BDIA 3C1KA 4B2CA 3EQ0H 1AMHA 1WQVH 2XCFA 1QJ6B 5TJXA 1HLTH 3ZZ4A 4MTBA 1SGRE 4JZDH 2RDLA 1FN6A 1XUJA 2GZ7A 2TRMA 5FAHA 4LZ1H 1A0LA 2RG3A 3SI4H 1C4Y2 5EXNA 1AE8H 4BNRA 1TNGA 3UTUH 1W10U 2JETB 1V2QT 3PRBA 2ZO3H 7GCHF 4BTTB 1AWHB 2ZDNA 3WW7A 1S83A 1AI8H 2YNBA 2JH5D 3ZZ9A 1YCPK 4DGJA 1ELFA 2AIQA 1MTNC 3MTYA 1BMMH 1H8DH 1CE5A 3RXCA 3P8NA 4AZ2B 5DKMA 2CXVA 2ANYA 1HBTH 4D76A 3ZIAD 1C5YB 4P00A 3S9AA 3RU4E 1C1OA 1A4WH 4RI0A 3RXVA 3CNRA 3H7OA 1FAKH 1E38B 3JZ1B 2W6JD 5DPAA 2HGTH 3C27B 4FUGA 2C8WB 4ABAA 2ZHQH 3RXOA 2GT7A 7LPRA 1NBMD 1THRH 4NIWA 2AIPA 1XUKA 4M9FA 4OS1A 4I7YH 4BANB 4NZLA 3A8BA 3OU0A 2K1QA 2VNTA 4RT1A 3KF2A 3SQEE 1FY1A 3SHAH 2A32A 3F0PA 3EE7A 4ZUHA 1LVYA 4K1SA 1DICA 1MD7A 2QV1A 3SNCA 1HNEE 1OP2A 2NU1E 4IN2A 1QJ7B 2BHGA 2V35A 5HIYA 1S82A 5FL7D 3STIA 5AVDA 1ZTLA 2C8ZB 2AERH 4CH8B 2PKSC 3TIUA 4NGAH 2V3HH 1SGYE 1TNJA 2G5VA 1ANBA 4Q4LA 1AE5A 1SGQE 1F5RA 4U2WA 5DP5A 1LHGH 4ABHA 3BTWE 3NKKA 1A5GH 1NU9A 2A4QA 1Y3WA 1JXPA 3SZNA 1WXRA 1MABB 4UEHH 2C8YB 1Y5AT 1O2RA 4BAHB 1ORFA 1NFUA 1YPHC 2ANKH 2H6MA 1B5GH 1KTSB 2ALVA 3F9FA 1BRAA 1HAGE 1TMBH 2XBYA 3P92A 2JH0D 3GCHB 1TPSA 4MNVA 3TVJB 1RRKA 2R0KA 1BTPA 3ZZ7A 4A1VA 1BTHH 3U1IB 1GJ6A 3D49H 2JJ2D 1ETSH 2FOGA 3RXQA 2I6QA 1ELCA 4UDWH 3ZVFA 1UTMA 1MTWA 3QUMP 2PV9B 1BA8B 2R9PA 4H6SB 1OS8A 3K2UA 3HPTB 2VIQA 2Z9LA 3SN8A 1P0SH 1TFXA 2OQ5A 1RTLA 3U8TH 1O31A 1HXFH 2O9QA 4JYTA 2BLWA 3OY6U 2G5NA 2ZZUH 1C2HA 3GCOA 1SQAA 1FIZA 1IOEA 2BVXH
chains in the Genus database with same CATH topology
4UONA 2EC9H 3BG4B 3MFJA 3A86A 1SC8U 1H9IE 2OTVA 1NT1A 1OP8A 3V12A 1XUIA 2HALA 3LH1A 5IDKA 1TNKA 1TGTA 1PQAA 2F9BH 2PKAB 4BAQB 1TBRH 2TGPZ 1TOMH 1FY4A 3EAJA 1C2DA 5C1YA 1PYTC 4WXVA 1GHBF 1O3JA 1V2MT 2A0QB 3M5LA 2AMDA 1ID5H 2BD4A 1QFKH 3GY2A 3V0XA 4D9QA 4INLA 3QZQA 1ZHPA 2IJOB 1W7XH 2PSYA 3ELAH 1ACBE 1GMHF 1O2QA 1DT2A 3EA7A 2AGEX 2ZU2A 1DX5M 1WSSH 2DUCA 1E37B 3LJJA 1OYTH 3Q3KA 3DT0H 4IS5A 2G81E 2STAE 5T6FA 1ESTA 1XUHA 4X1RU 1P57B 2P8OC 1CSOE 1ZHRA 1SGEE 5ABWA 1GHAG 6LPRA 1T7CA 1UK4A 1O2ZA 1OKXA 4NG9H 3CS7A 2ZCLP 5EQSA 4ASHA 4Y71A 1O36A 1AO5A 3LGWA 2ZTZA 1P2QA 1D9IA 4B71A 3BEUA 4JZIA 2ZHDA 2GCHG 1C5QA 1O2KA 2ZGHA 4A5TS 1BTZA 3A8AA 2F9UA 1DLKB 1IQIA 1G2LA 1BJVA 1O2VA 1ANDA 2G51A 4K8BA 1SMFE 3QDZB 4AGJA 1D4PB 4FUBA 1BHXF 1ANCA 4ZHLU 3UY9A 2P3UB 4X8SH 3LH3A 1A5IA 4FUFA 5C2ZA 1J15A 1UJ1A 2XXLA 3RXFA 4B73A 1AB9B 1L4ZA 2G8TA 1PJPA 1C5RA 1C4U2 4AFQA 1V2ST 2ZHEH 4BAMB 4RN6A 1OYQA 1J17T 4I8GA 3SUEA 1CA0B 3UNQA 2VGCC 1KDQA 3CS0A 1GHYH 1NN6A 2H9HA 3SU2A 1CBWB 1BZXE 2A5IA 2GCTC 4Y8ZA 3M5MA 1ZR0A 4WY3A 2OC0A 1BIOA 1YPKH 2H9EH 1TBZH 5CMXH 1SGNE 1O2LA 3RXAA 1TGBA 1PPBH 1AKSA 4FUDA 1ZPCA 5L6NH 2JKHA 1GVKB 4B75A 5JBTA 3MO9A 1A2CH 2TGDA 3M5NA 5CHAC 2FTMA 5GWZA 1P12E 1YCPH 1YKTA 4AYVB 4D9RA 3HK3B 3UQVA 4E7RG 1TPPA 2ZFPH 1P2JA 1VCPA 4Q7ZA 5EQRA 1O5CB 1WOFA 2Y5HA 1AUTC 1MKWK 4CREA 2XW9A 4A7IB 1GHZA 2Z9IA 3GOVB 2GZ9A 3A85A 3QTVH 3KQBA 2WPHS 1OWDA 5J4QA 2FYRA 2ASUB 2SFAA 3BTDE 1EZXC 4O9VA 2HNTC 1SGFG 1ZTKA 2A5AA 3SORA 2A2QH 4D7FA 1FDPA 1PPCE 2WUCA 1LO6A 6GCHG 1GL1A 3HKIB 2P94A 1N8OC 4UFFH 2ZDKA 8LPRA 1DUEA 1EAUA 2F9OA 4Y6DA 1A3EH 1BITA 2ZGXH 1ZPBA 3QGJA 1P3CA 1NU7B 1BCUH 5A8ZA 1KLIH 2R3YA 4DY7B 2EI7A 2BOHB 2BDGA 1FXYA 1GCTC 1MU6B 1BHXB 3A82A 5H4IB 1HJAC 2NU2E 2XC0A 1OPHB 4SGBE 4X6OA 1N6YA 4U01A 2OQUA 3ATLA 2B7DH 5A8YA 1MBQA 2Z9KA 1PQ7A 4BXWA 3U69H 1IQHA 1NRSH 3SU1A 3S9BA 2Y6TA 2ZGJA 3MU0A 1ARBA 1W0YH 4XDEA 1HJ8A 1VJ9U 1UTOA 4YLUA 1JIMA 1DUAA 2BLQA 3RMNH 1KXDA 4DVAU 1ANEA 1EX3A 2WPMS 2ZNKH 2B0FA 8GCHG 5FPTA 1SPJA 2GMTC 3FFGA 3H7TA 1BJUA 5DP9A 1V2UT 4A92A 3VB4A 3RXEA 1GI8B 1LPGB 1MTVA 4IW4E 2BY6X 2Z3EA 2J95A 1V2TT 1MD8A 4GCHG 2FXRA 1LHFH 2BZ6H 1CHOG 2CV3A 1V6DA 1Y5UT 3AAVA 4JZFH 2TGTA 1GGDC 1XVOA 2VH6A 3SOSA 1XXFA 1F5LA 1ZZZA 2F3CE 3ATKA 1VGCB 3F6UH 1O2PA 3DA9B 2AYWA 4MPUA 1K1MA 2GGVB 3S7HB 2OINA 1JMOH 1L4DA 2V6NA 2XC4A 4Q80A 1OOKB 1ABIH 1GI2A 2ZG0H 1EOLA 4FU7A 3RXDA 1QA0A 1GMCG 1HRTH 3EYDA 4XBCA 4MQAA 2NWNA 2SGFE 1K1NA 2FEQH 1RGQA 3VGCC 4AFZA 4CRDA 3A8DA 2O8TA 1A5HA 1HIAA 1WV7H 1GJ8B 1D6RA 1YPLH 1A0JA 3SV6A 1GBBA 1OP0A 2EA3A 1TX6A 4I8LA 5LPRA 3E90B 4J1YA 3RXTA 4DT7B 1P8VC 1O2MA 4ZAEA 1ESBA 2XBWA 2SGEE 2VB0A 2UWOA 4HFPB 2CGAA 3QLPH 3BEIB 1SQTA 1B0FA 1O5FH 2EI8A 2HRVA 1C5XB 3SV2H 3M3TA 1O35A 2G00A 5AF9H 5FHTA 3UR6A 4YOJA 2TIOA 2WUBA 1Z8IB 3L3TA 1Z1JA 1HCGA 3BTKE 3TU7H 1UO6A 3T28A 2P93A 4H6TA 3ZYDA 2ZIQH 2XC5A 6CHAB 1ZPZA 4NFEA 3OTJE 1TNHA 4IC5A 2ODQA 4Q7XA 2AFQB 4YOIA 3SNBA 4Y0YE 4YZUA 1GBAA 2R2MB 1WUNH 1CGJE 3U8OH 4DOQA 3KQEA 4LXBH 1GPZA 1YP9A 1G37A 2FOEA 4CRCA 2SNWA 5FCKA 3SHCH 1GBHA 4XSKU 1BTYA 2BTCE 3A84A 3I29A 3SGAE 1JRSA 2SGPE 4DCDA 2PKAA 4X1PU 1RS0A 4AN7A 3TNTA 1SGPE 1T4VH 4AOQA 1KXAA 1AWFH 1GG6B 2QXJA 4ABDA 3MU5A 2ESTE 2ZQ1A 2QIQA 4XOJA 2BDCA 5C20A 5B6OA 1DS2E 4JK5A 5TCAA 1TRYA 1KXEA 5HGGA 1AKSB 3PMJA 3ZZ6A 2YOLA 1QBVH 1YCPM 1KXBA 4TPIZ 2UUYA 2F91A 2A31A 3PLKA 3QGNB 3KEEA 1PYTD 3M7QA 4ZHMU 4K1TA 3IITA 4K1EA 3ZZCA 3LT3A 1FPHH 2QYIA 2Z7FE 2BLOA 1SG8B 1OWJA 1CT4E 1RIWC 1GHAF 4CRBA 1UVTH 1CGIE 2BDHA 4B76A 3RLWH 1LPZB 3HK6B 4QT8C 3B9FH 2FOMB 2ZCKP 3BTME 3UQOA 2VWNA 4K8YA 1SFQB 4K2YA 3MNSA 4MPWA 3ZV9A 1GHWH 3A7WA 5FX6A 2VVCA 5LH8A 1GBCA 1K2I1 2DE9A 2J94A 2ODYB 5LPFA 2FI3E 4X1NU 3TH2H 1FPCH 1B7XB 1C1WH 1ELTA 1O2JA 4OS4A 1MKWH 2ZQ2A 3VEQB 2ZFFH 2GP9B 1DY8A 1XUGA 3BF6H 4A6LA 2ZP0H 3G01A 1PQ5A 1C4V2 4Y79A 1GDQA 1GMDF 4IC6A 1W3CA 1ARCA 4I31A 4I32A 1EJMA 1DITH 1SL3A 3ATIA 3MMGA 3PO1B 1T8LA 3RUOA 2Z6BD 2H5DA 1TYNA 1Y5BT 1Y59T 2SNVA 2ZCHP 4TWYA 3OY5U 4NFFA 3M7UA 3GDUA 1E34B 5DG6A 1TNLA 3LGTA 1VZQH 1VCQA 2Q6FA 2ODPA 1MZDA 2OCVB 3M7TA 1F0UA 3RXHA 1MCVA 4HI3A 3UFAA 3BV9B 2CHAB 1O2UA 1QR3E 3W94A 4E06H 4UFEH 2HWLB 4GHTA 1DM4B 1C5UA 4NZQA 2FM2A 2Y5FA 2M5TA 4UD9H 4Z0KA 5SGAE 1K28D 4VGCB 1EAWA 3TNSA 3RXUA 3SUDA 3K6ZA 5JB8S 2BXUH 1O3CA 3AASA 1C2LA 2Y7ZA 1AVGH 1GI0A 1IQFA 1O3DA 1ZTJA 1IHSH 2FOHA 1QHRB 1BT7A 4I8KA 1D3PB 3SJIA 1RXPA 2P59A 4CR5A 1TQ0B 1AB9C 1DE7H 1QGFA 4YO9A 4ZXXH 1UVSH 2ZWLH 3UUZA 1O3PB 2Y80A 4O3UA 1FMGA 4YTAA 1MMJN 4K3JA 5J4SA 1YPHE 1UTNA 2WPJS 2AMPA 4M7GA 1DDJA 1AZZA 1O2IA 1GJDB 1DSTA 8KME2 1SQOA 1YGCH 4X2YA 5A0BA 1HIAB 1HPGA 3PM3A 3P17H 3SJ9A 1CBWC 1BMLA 1C2GA 1P03A 1XMNB 1UVOA 2WPKS 3E6PH 1ETRH 3BSQA 3S9CA 1K22H 1O2TA 3VB7A 1O5AB 1GJ4H 5EPNA 3BG8A 1NRRH 2BY9X 1O34A 2ZHFH 1NFYA 1L2EA 2ZF0H 4WJG2 3DD2H 3V3MA 1V2PT 7KMEH 4X2XA 1AHTH 2FP7B 4KTCA 2NU0E 3ATMA 4FUHA 4O03A 3UWJH 5L2YH 1QB9A 1A3BH 1DFPA 4FUIA 2BD5A 2BLVA 1N1LA 1ZRBA 2GKVE 1YPJH 1HXEH 4INKA 1LVMA 4IMQA 3ZYEA 2A45B 3DHKH 1Q3XA 2BB4A 4MLFB 2PW8H 1RFNA 3Q77A 2B9LA 4ABFA 4D7GA 2H1UA 2VINA 4OS7A 2A1DB 4NSYA 1GI5A 1ZSLA 2W7UA 3PWBA 3SU4A 2FWWA 1U6QA 2BY7X 1UTKA 3FZDA 5LPEA 1DXPA 2W3IA 1LMWB 3VB3A 1FAXA 4CHAC 1GL0E 2ZFQH 4GCHF 1ELBA 2P3FH 4BAKB 1CHOF 4XFQA 1WTHD 1J16A 1LVOA 3ODFA 3ZVAA 4FUEA 1AZ8A 3TK5A 3ZVCA 1IQKA 2AMQA 4GAWA 5AHGH 1P2KA 2GD4B 2H2ZA 1E36B 1V2KT 1QL8A 2A7JA 3SU0A 3W95A 3KN2A 3M3SA 4GPGA 4ABEA 1DY9A 2ZFRH 4FXGH 5EW1H 1AGJA 3A7TA 4AG1A 2PGQB 4AGKA 2GDDA 3K6YA 2THFB 1L1GA 1GMCF 3TJNA 3TK9A 1O37A 5JBCS 2VWMA 1T31A 4NA9H 1IQNA 1O2YA 1P09A 3U98H 1NY22 2FIRH 1ZMNA 1TRNA 2XTTB 2OD3B 3CP7A 4FVBA 2HPQH 1GWAA 1GJAB 1YM0A 1C1RA 1QTFA 2C4FH 3A81A 3TK6A 1HB0B 1K1OA 4O3TA 1RTKA 3PTBA 1SR5C 1XKAC 4R0IA 1P11E 2P3TB 1QL7A 1TX7A 2FOFA 2BDAA 1ELAA 1KLTA 3EGKH 1HYLA 1WCZA 1IQJA 4H4FA 2ZEBA 2D8WA 4FVDA 1GI7B 4NIYA 4E05H 1O39A 3RM2H 4HGCA 2FZZA 5ESTE 4I33A 5DO4H 2PWXA 4CBNA 8ESTE 1GVZA 3ZV8A 5EODA 3RXLA 1H9LB 1KLJH 1Z8RA 2BD7A 1QA7A 1W7GH 1T8NA 1O3LA 5C1UA 1W14U 1M9UA 3SNEA 1EZQA 1KTTB 3LDXH 3I77A 2A4GA 3SBKA 1TABE 1ZGVA 1K1JA 7GCHG 1F92A 1KY9A 5DP3A 3SU5A 1WBGB 1DSUA 1Y3XA 3ZVDA 5JB9S 3UPEA 1ZLRA 3FAOA 1SLVB 1C2EA 2PKSB 5DGJA 1ZJDA 1BMNH 2ZFSA 1MAYA 2C93B 1EKBB 1C5LH 2WINI 1C5SA 4GSOA 1IHTH 1HAVA 3DUXH 5FCRA 2I6SA 1IQLA 3QZRA 1TAWA 2ZECA 1NFWA 1MAXA 3TJOA 4LZ4B 1O5BB 2Q1JA 4J2YB 1QNJA 2GX4A 2C8XB 1O3BA 1FI8A 2PSXA 1GI1A 2W5EA 2OC7A 4ESTE 1WYKA 1O3NA 1Z6JH 4YLQH 5JDUB 1MBMA 2FX4A 1CU1A 1Z8JB 3SU3A 1AFQC 3LGUA 4ISHH 1CA8B 4FUCA 2STBE 2J4IA 3P8FA 3PLBA 5GPIB 5BPEA 1AU8A 5JPMH 2FOCA 1SVPA 4IN1A 3LONA 1ZMLA 3OSYA 4GLYA 2PHBA 3GCTF 4U32A 1FY5A 3GY7A 4OGXA 1O38A 1DPOA 2NU4E 1G32B 3L6PA 1V2JT 5EU8A 2DE8A 4WWYA 3VXFH 1E0FD 4FUJA 1GBMA 2BD9A 3NCLA 1TA2A 1GJ5H 3VB5A 1Y3YA 4BXSA 1SGIB 1C5VA 2OBOA 3TGKE 2ANWA 2IPHA 4SGAE 3RXPA 3F9GA 3D65E 1LCYA 1WQSA 3SU6A 2ZTYA 1XUFA 3MO3A 1TA6A 2QXGA 2W7SA 1F2SE 4AX9H 4NIVA 4ISOA 1F5KU 3GY6A 1KXCA 2F9NA 6ESTA 1C5MD 2OBQA 4F4OC 4NIXA 1QB1A 1SLWB 3MOCA 5I46H 1UCYK 4AB8A 1NC6A 1SLXB 2IN2A 2ZPQA 5EG4A 2J2UA 3ZZAA 1P2IA 1UMAH 1CGHA 2PFEA 3PWCA 4Z6AH 2VVVA 4DJZB 1QCPA 1O2OA 3RM0H 4ZMAH 3E1XB 3GY3A 1AY6H 3T2NA 1HAXB 2JH6D 1O0DH 5F8TA 5FPYA 5C3NA 4MG3A 2AGGX 3ESTA 2P8OB 1OXGA 3HGPA 4ISNA 2FMJA 4K69A 1B0EA 2XRCA 2BY5X 1BTUA 2BQ7B 1OWIA 1SHHB 3AAUA 2UWLA 1A61H 5E0GA 1NROH 1O2NA 1GBIA 3F9EA 1S0RA 3UIRA 2A7CA 1O32A 4CH2B 2PUQH 1CHGA 1YYY1 1QURH 2QCYA 2QN5T 5HYOA 3GDVA 1FUJA 1TB6H 4Q2KA 1TOCB 1PFXC 3ZVBA 2JETC 3FP7E 1S81A 4THNH 3I78A 1FNIA 2UUKB 4XE4A 3ZVGA 3RU4D 1V2WT 1C5NH 4BOHA 2Z9JA 3SJOA 4NSVA 1S5SA 1QRXA 4JZ1A 4MDSA 1GMHG 1H8IH 4DIIH 3E16B 3IWMA 3MU1A 3N7OA 1PPGE 1P05A 1VCWA 2ANMH 3SQHE 5C67A 3MYWA 5F6MA 3URCA 3QWCH 1AD8H 1NO9H 3RXJA 1HAZB 1SB1H 1LVBA 2Z3CA 3QO6A 1G36A 5DP6A 1FQ3A 3SW2B 1YPMH 1TQ7B 3KL6A 1O2XA 2J38A 1Z1IA 4ZKRU 1UK2A 3RXSA 1D3TB 2VGCB 4FU9A 1Y3UA 1BB0B 1O2WA 5IYTA 3QK1A 4Q7YA 3RXGA 1GI6A 4OS5A 1HGTH 2VWOA