1C5VA

Structural basis for selectivity of a small molecule, s1-binding, sub-micromolar inhibitor of urokinase type plasminogen activator
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TRYPSIN)
molecule tags Hydrolase
publication title Structural basis for selectivity of a small molecule, S1-binding, submicromolar inhibitor of urokinase-type plasminogen activator.
pubmed doi rcsb
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5vA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5vA02
4Y8ZA 3VB3A 1O33A 2O8TA 1GI1A 1P2KA 3KGPA 2FOEA 3CP7A 1NU7B 2TGTA 7GCHF 4NWLA 1GG6C 3EA7A 3MU8A 1IQIA 2ANKH 3EA8A 3BIUH 1TOCB 3RXMA 4Y11E 1EZQA 1FIZA 1SQOA 5HXFA 1EQ9A 2D8WA 3MO3A 1FMGA 2C4FH 1AKSB 2W5EA 3ZZBA 2WV5A 4OS7A 1L4ZA 1P9SA 3U8TH 3KEEA 3TLOA 3GY3A 1EAXA 3TGIE 2H1UA 1DOJA 4NA8A 4CRGA 1GDQA 1A3BH 4LZ1H 1MQ6A 1XXDA 5HGGA 2VNTA 3TH2H 1BDAA 1P03A 3P8NA 1NRSH 4K3JA 1BCUH 4OGYA 3HGPA 2HPQH 3UQVA 2A7CA 3RXEA 2A4OA 1O2JA 2TGPZ 2BQ7B 2FZZA 3NZIA 4GCHG 2O8UA 3MHWU 2ZC9H 1HLTH 1TMBH 2Y7XA 4Y76A 5FCKA 4X2XA 1O32A 4H4FA 3AAUA 1TBZH 3S9AA 1TAWA 1TNLA 1MUEB 3M3TA 3RXUA 4X6OA 1YCPK 1QURH 2KAIB 3V0XA 4A1TA 1WTGH 4BNRA 2PGBB 3UIRA 2C3SA 1ZRKA 1YPGH 1YPLH 4X1SU 1O2SA 1ANBA 1V2QT 2IOTA 1XMNB 3MU5A 1FY3A 5A2MH 1MQ5A 1EATA 1IQHA 1HBTH 1MCTA 2ZFFH 2EEKA 3U98H 3RXBA 1O2QA 3VGCB 1V2UT 1PQAA 3S9CA 2UWLA 2ZHEH 1O2PA 1LTOA 2R2WU 3RXCA 2TGDA 2G51A 4TY7A 3GISB 1F0UA 4FUDA 2QF3A 1G36A 1XX9A 1H4WA 1C9TA 1H9IE 2VWMA 1BHXB 1F0TA 2ZDAH 3MWIU 2IN2A 1HNEE 1D3PB 2CF8H 3SZNA 2KAIA 1KDQB 1GDNA 3BV9B 3IWMA 3KQCA 3KHVA 3O8BA 4KTSA 4J1YA 1C2MA 1C5QA 3ZV9A 4D76A 2ZHWH 1BMNH 5A0BA 2FI3E 3GDVA 1W14U 3FZZA 2BDYA 1WQSA 1W3CA 3S7KB 2H9TH 1P2QA 2XC0A 1ZTLA 4IN1A 4DOQA 1C5TA 4WH8A 1F7ZA 2R3YA 2WPMS 4LXBH 2BD3A 3UNQA 2GGVB 2ZDLA 3HKIB 1NESE 2B7DH 1VITF 3EGKH 4K60A 1QY6A 2OQ5A 1O2XA 4Q7ZA 3SU2A 2UUJB 4JYUH 4OS6A 4RN6A 1XUHA 1QHRB 2P59A 3KQEA 1MZDA 5C1YA 1T8OA 1ZOMA 1V2ST 2VIQA 4INKA 1Q31A 1EXFA 4U32A 4JK6A 4UFDH 1C1UH 2A2XH 4MPUA 4UD9H 2OTVA 1S0RA 3BSQA 1SLVB 2P3TB 1A46H 2H5CA 1UTLM 4SGBE 3MOCA 1FAXA 1K1NA 1GI6A 2D26C 3Q76A 3ZVAA 1JXPA 1HAVB 2OXSA 2OINA 1G3EA 4ISOA 1C5XB 3P92A 1OWHA 2PFEA 3SQEE 4CRAA 1SMFE 2BD4A 2D2DA 2ZFQH 3A7VA 1SOZA 1ACBE 1WCZA 1C5LH 1NT1A 2R3UA 2AIQA 2AFQB 3RXJA 2OP9A 1BRAA 1XVMA 5FBEA 3RU4T 4YO9A 4ZHLU 1ZJKA 1A5IA 1OP8A 3BN9A 4D7FA 1K1OA 1YPHE 1JWTA 3SI3H 3BTDE 1PPZA 3RXPA 3KCGH 3B23B 1O3GA 2ANYA 2O8WA 3A86A 5C5OA 3O8DA 1LKBA 1VCPA 2BY7X 1SC8U 1GJAB 5EQRA 2FOCA 3M36A 1FN8A 1NO9H 1DSTA 2GTBA 5FX5A 2SGPE 4A92A 3M5MA 2XBXA 1GHYH 3R3GB 4CREA 1BT7A 2LNCA 1GVKB 1SHHB 2JETB 3NUMA 3E0PB 5EGMA 4RSPA 1ZRBA 2VU8E 3ZYDA 1FUJA 4A7IB 2NWNA 3F6UH 2ZA5A 5L6NH 5TCAA 4JZEH 5EQSA 3PWBA 2GV7A 3BF6H 1A4WH 1SB1H 2PUQH 3TNTA 1RXPA 1SHYA 1TPAE 1ZMNA 3SNCA 2VVCA 3D65E 5DK1A 1SGIB 1TBQH 1KLTA 1O3OA 3FANA 2Y5GA 4BXWA 1SGCA 2BLWA 1AKSA 2VIVA 1O2GH 2VGCB 1GMDF 4OS5A 1UK4A 4X1RU 5F8TA 3A85A 3GY5A 4FXGH 5E0JA 1C5VA 2VIWA 4UFEH 1MKWH 4FUJA 1OP2A 4DCDA 1A2CH 1GJ9B 3W94A 1W8BH 1YLDA 2QCYA 2WPIS 2BXTH 2AS9A 1EB1H 2H9EH 3GY7A 2FIRH 1V2KT 2SNVA 1O3KA 3FP7E 1PQ5A 3HATH 3SUGA 1O39A 4KP0A 4VGCC 2F83A 4ISHH 4NZLA 3DUXH 2ZPQA 1GMHF 5A09A 5GWZA 3A8CA 1OS8A 3MO6A 3RLYH 1O3NA 1C4Y2 4XFQA 3TVJB 3C27B 3E0NB 4A6LA 1RIWB 3SJIA 1BRUP 2A4QA 4MLFB 1DY9A 3RXAA 4WY3A 1IHTH 3PO1C 1FDPA 4NSVA 1IQNA 1PPFE 2OQUA 2GCTB 1F0RA 2WINI 5CMXH 1O3MA 1BJVA 1RIWC 4TWWA 5JB8S 2SFAA 1AZ8A 1ZPZA 2EI7A 1V2MT 3PO1B 1UTQA 3UQOA 1DWEH 3UR9A 2BVRH 4AG2A 1P2IA 1ELBA 4K1EA 4E06H 5EODA 4Y8YA 1TALA 1A5GH 3AAVA 1ZLRA 4DURA 2ZTZA 5FXLA 2BOKA 2OBOA 3LGTA 1O30A 1Z8IB 2ZDMA 1NC6A 1G3DA 1GI9B 2YOLA 4FU9A 5GPIB 4I8LA 1GCDA 3NCLA 1HAYB 2XTTB 1VITH 3GY2A 4MQAA 3E16B 3BEUA 1BRCE 4CRDA 5J4QA 4ZH8A 1IQLA 2BLVA 4GLYA 4I33A 4ESTE 4B74A 1DWBH 1SSXA 2B8OH 4Y71A 2PR3A 2P3UB 1AFEH 5F6MA 1DVAH 2OC8A 1ZYOA 4H42U 4AGJA 2VIDA 4X1NU 4Q80A 3ZVBA 1P8VC 2C8WB 1PYTC 5CHAB 2ALVA 2G4TA 1TNIA 2ANWA 4BAQB 1V2VT 2XCNA 1C5SA 1AE5A 4AX9H 4KKDA 2GCHG 2XRCA 4B71A 5C20A 3HPTB 5IDKA 1MD7A 4YLQH 1UVOA 1Z1JA 2WPKS 2ZEBA 2AGEX 3BTGE 3QLPH 3LJJA 1O2VA 1P57B 3V13A 1LHFH 5E2OA 1O3AA 3A8BA 5E0HA 1P05A 2BVSH 5GIBA 1ARCA 1EX3A 1GHZA 4FU7A 2Z9KA 1T32A 4CHAC 3PMBB 2ZTYA 3VB7A 3M3SA 1J9CH 2G81E 3BTEE 1F2SE 3UNRA 1ID5H 1Z1IA 4FUBA 3CENA 1KSNA 1DWCH 1AHTH 2ALPA 1EUFA 2I6SA 4LZ4B 2BD8A 1C2FA 3UWIA 1GBFA 3UPEA 4ZKSU 1G2MA 1AUTC 2FTMA 1ZSLA 3TIUA 3F9GA 1QBVH 2BDCA 1LDTT 3I29A 2V0BA 4U30A 3TGJE 1RGQA 1C1OA 1MU8B 2Y7ZA 1O2NA 1C1NA 2ZGBH 2OLGA 2JETC 2Z3EA 1QRWA 3PMAB 3RXVA 1C5RA 1FIWA 1C5MD 4NIYA 4Q2KA 1RTLA 1U6QA 2GMTB 2C93B 1S81A 3I77A 3FP6E 2BLQA 2VIOA 1DXPA 2ZCLP 4FVBA 1MTWA 5ESBA 3BG4C 1EAWA 1A0LA 1J17T 2XWBI 1Z71A 1Q3XA 3EA9A 3BTHE 4B73A 1QA0A 1K21H 3JZ1B 2V3HH 1GVLA 1L0ZA 1NS3A 5L30H 1C5NH 4ZKNU 2EA3A 4ZHAA 4X6MA 2Z9IA 4B2AA 3U8RH 1AB9B 4CH2B 1C4V2 2XWAA 4XBBA 1E38B 4I8JA 3UUZA 1UK3A 2AMPA 2GDDA 1D4PB 3E3TA 1IQKA 3ZZ6A 1T31A 1CA0C 1IQJA 3ZZ7A 2YNAA 1TPOA 4YZUA 1AVWA 1O5BB 4ZXXH 1Z6JH 1FV9A 1GGDC 1C5ZB 1SOTA 2Q6DA 2ZGHA 2RG3A 2D1JA 1CGIE 1P06A 1LVMA 1TPSA 1HXEH 1E37B 3LC3A 2Y5FA 3ZZ4A 3GY4A 4FUIA 1SLXB 1HAVA 2Z3DA 3NKKA 1GHBG 4CR9A 3RDZA 1K1PA 2PV9B 5TCCA 1SGNE 1ELVA 4DIHH 1C1SA 2Q1JA 2WUCA 1BA8B 1LMWB 4I31A 4K1SA 2GMTC 2BX4A 1H1BA 1V2RT 1HAZB 1TRNA 3TK9A 2STBE 1O2LA 1UVTH 1KXCA 2ZHDA 3D49H 1GJCB 3EQ0H 2H2ZA 5DGJA 2OC7A 5HMAA 2HVXA 3H5CB 3QZQA 4YM9A 3A87A 4X8UH 3SV6A 3FZDA 2F9VA 1MMJN 5EXLA 1AQ7A 2A5AA 2FOMB 3A8AA 1XUFA 5HYOA 4MNXA 1Y3XA 2P8OB 4H6SB 4JYVH 3OX7U 4X8SH 3F9EA 3LOXA 2Y80A 5DO4H 1YC0A 1DSUA 1XKAC 4WF8A 2Q6FA 1NY22 1S6FA 1TB6H 1CT2E 1P2MA 1AGJA 2J92A 2RDLA 3EDXB 5A0AE 3VPKA 2CXVA 4DGJA 1LVYA 4XBDA 2QXHA 1TGNA 2A5KA 4K69A 1ELEE 3RU4D 1OP0A 1DS2E 4MPVA 1A3EH 4NSYA 4WXVA 1C4U2 5HM2A 1ESAA 5DP5A 2FS9A 1P04A 2BY8X 4A5TS 3FFGA 1YCPM 4BAKB 4DG4A 4NG9H 4BOHA 1XUKA 3E1XB 3RXLA 4UFGH 3MNXA 4ABEA 3E91A 1ARBA 1DXWA 1AZZA 3MH7A 3TNSA 5A8XA 1HGTH 3W95A 3T28A 1GCTC 3U9AH 5SGAE 1AMHA 1MD8A 3AVZA 3CS7A 3OY6U 4D9QA 2FI4E 1GI4A 3QO6A 4WMDA 1FN6A 4YOIA 1GCTB 2BM2A 1FY4A 4BAHB 1A0JA 2OD3B 3SU4A 1BMAA 3LDXH 1Z8GA 1GJ6A 1HUTH 2PKAB 4GCHF 1SGRE 3AW0A 2W3IA 4X6NA 1N8OC 2ZI2H 4YOGA 7ESTE 1HB0B 4Q7XA 1HJAC 3ZVDA 4BXSA 1BBRK 2G4UA 1T8MA 3A84A 3EAJA 5EPYA 5F8XA 2H9HA 1ELAA 2JH0D 3TPIZ 1FNIA 1BBRH 5GDSH 3M7TA 1EPTB 1IAUA 5FPTA 1ZTKA 3FVFB 1QRXA 2GVFA 2J4IA 1P2OA 2Z9GA 3ESTA 4ABAA 5K0HA 1BTHH 1GJ8B 2J38A 3GDSA 3A82A 1JIRA 1G30B 5DG6A 1O2RA 2ZPSA 3DD2H 3LGYA 2F9OA 5LPRA 2FM2A 2F91A 1AWFH 2J95A 1AFQC 2SGDE 1E36B 3K9XB 3LGVA 5H4IB 3KNXA 2ZU2A 5DP3A 1O5EH 4F4OC 2BY9X 5C67A 4INLA 1DPOA 2ODQA 5C5NA 1K1LA 3PTNA 1S6HA 1V2WT 1AO5A 1V2JT 4OS4A 5AFYH 3TH4H 1EP5A 1VCQA 2C90B 3R0FA 3MFJA 1C2JA 5FBIA 1Y3UA 4WMFA 1MBQA 2PLXA 1TGTA 1O3CA 4CBNA 2EI6A 4AB9A 3RMOH 3UOUA 4UDWH 5JBCS 1IQMA 2ZCKP 5ABWA 1WV7H 4DIIH 3KIDU 1WYKA 1Z8JB 1MTSA 2R0LA 3RLWH 2NU3E 1TNJA 2ZGCA 1UJ1A 3O8CA 1HDTH 3TK6A 2OCVB 2WYJA 4WJG2 3ATKA 4MG3A 1YPMH 3V7TA 1HAXB 3PWCA 3SORA 1MH0A 5K7RA 4WMEA 2PW8H 3SV8A 1OXGA 2FLRH 1TRMA 2PTCE 3H7OA 4IC6A 3LGUA 1QGFA 2XXLA 6CHAC 3SHAH 2A4RA 2NU1E 4GPGA 1SGDE 3SGQE 1B0FA 3ZZ3A 5C2ZA 1ANCA 2QIQA 2CHAB 4WVPE 1ZGIA 1BTXA 2FO9A 1FQ3A 4CRCA 3SV9A 1H8DH 4ABGA 3Q3YA 2J94A 3GYMA 1GMDG 3GCOA 3U69H 5EG4A 3CS0A 1QR3E 1NPMA 1GMHG 4ZAEA 4B75A 1TQ7B 1BIOA 1BTZA 3LJOA 1O37A 4Y6DA 2WPHS 2VGCC 2HLCA 1O3BA 3Q00A 1ZTJA 4JZ1A 1RFNA 3RC6A 5FCRA 3A7YA 4A1XA 5JDUB 2ZQ2A 3ZZCA 1P11E 2BDIA 1GBHA 2FESH 3ZVGA 1LVBA 1FONA 2FWWA 1L1GA 4Y0ZE 3T62A 3SO3A 1KYNA 3A83A 1YCPH 3GDUA 4RKOB 8ESTE 4FUHA 1QL7A 3QN7A 4ZKRU 4CBOA 1TNGA 1TBRH 3UFAA 3RXRA 3ZZ8A 1L2EA 1NFXA 1KXBA 2ZZUH 3RC5A 1BTWA 4MNYA 1LCYA 1H9HE 3MU4A 3Q3XA 3MNBA 3A89A 2F3CE 6CHAB 1SFIA 1W11U 5FAHA 2YNBA 1VJ9U 5JB9S 2BD2A 2O9QA 3LH3A 3BG8A 2HNTC 5C3NA 1PQ8A 3SV2H 1J14A 1HAGE 1VGCB 2F9NA 2HWLB 2VJ1A 3K6ZA 1Y3WA 1BJUA 1C5OH 1W7GH 1O3LA 5JBAS 3T5FH 5I25A 1GPZA 1LHGH 3ZZ9A 1G37A 1PPEE 4E7RG 1XKBC 1WTHD 1HPGA 1EB2A 9LPRA 2G8TA 3KF2A 3SJKA 1SGQE 4MPWA 2FX4A 1TA6A 2ZQ1A 2P93A 1MAYA 2HRVA 4KTUA 3URCA 1YPHC 1UTPA 1B7XB 2Y81A 1AFQB 3SUFA 4ABDA 1N1LA 5E0GA 1C5UA 1FY5A 1GHAG 2QA9E 1EOJA 3QX5H 2ULLA 2GKVE 2BD7A 2ZU3A 4FUCA 4XSKU 1GJBB 3TK5A 1CVWH 2ZP0H 5EW2H 3LGIA 4ABJA 5G4BA 1EZUC 3KL6A 2FYQA 1KTSB 1AWHB 1NRNH 5DKMA 1AUJA 3DFLA 4E7NA 3M7UA 1ZMJA 3MU0A 3O8RA 1S0QA 3ZZ5A 4NA9H 4IW4E 3L33A 3OTJE 5ESTE 1AN1E 1A0HB 3T25A 1C5YB 1MBMA 1QRZA 5JPMH 1EPTC 4ABIA 3ZVCA 1JMOH 1PPCE 1GHBF 4Z6AH 2FTLE 4BTTB 1J15A 5JBBS 1DDJA 1FAKH 3LIWA 1NFUA 1UTKA 1BB0B 4NFFA 2VWOA 2BB4A 4Z0KA 3B8JA 1HJAB 1EZSC 1Y5UT 1BZXE 3TJOA 3E6PH 1RTFB 1GJDB 4FUEA 4DW2U 1SGFA 1QB1A 3LPRA 4GHQA 3VB6A 1T8LA 1IQGA 4AYVB 1EASA 1P10A 1P2NA 4U01A 2C8ZB 3SNAA 1J16A 1SGEE 3NWUA 1JOUB 1S84A 1SQAA 4OS2A 1VITG 3GCHC 1H8IH 2Z9LA 2PKAA 1F0SA 2ZPRA 5EW1H 1SLUB 1UHBA 4X0WU 1AVGH 2IPHA 2BZ6H 2AGGX 4AN7A 3UTUH 1LO6A 5FHTA 3BTWE 2OC0A 3Q3KA 3RMMH 3ZZDA 1LVOA 4O97A 2P3FH 1GBMA 2FDAA 1ELTA 2HPPH 2PKSB 1CE5A 3ZVEA 5E2PA 3MI4A 1O2YA 1G3CA 2UWPA 1GJ5H 3RXTA 4B2CA 5HM9A 1QL8A 3T27A 1ZGVA 1C1WH 1QQ4A 3NXPA 3DHKH 3PLKA 1O2ZA 4NIVA 1PFXC 2ZGJA 1SBWA 4K8BA 3N7OA 4YTAA 2QV1A 2P95A 2A31A 3PMHB 1D6WA 2R9PA 1F92A 5EQQA 3ZYEA 2BZAA 2PTNA 4BAMB 2BQ6B 4BAOB 2VIPA 1C1VH 1GL0E 3Q77A 1BBRE 1EJMA 1P3CA 1W10U 2HGTH 2QXJA 1DE7H 3LT3A 2CN0H 3P6ZB 1UCYE 1Y8TA 3QZRA 3A7XA 1K2I1 4ISIH 1BQYA 1TMUH 2A4GA 2PSXA 1DX5M 3SUEA 1VR1H 5EXMA 3OYPA 3RC4A 2JH5D 1PPBH 4NFEA 1BTPA 1EP6A 1HV7A 2A0QB 2QYIA 1OSSA 3AW1A 1DM4B 1LHDH 2FODA 1C1RA 1T4UH 2BLOA 2WPLS 1KIGH 5I46H 3A7TA 2AGIX 2ODYB 2XYAA 3SQHE 3DFJA 1TFXA 1MAXA 1P09A 3ENSB 4JYTA 1HFDA 1C2IA 1GHVH 1N6YA 2QAAA 1B0EA 1IOEA 1D6RA 2J9NA 1YPKH 5IYTA 2ZHQH 1O38A 1NTPA 3URDA 1O35A 1RTKA 3FP8E 3LGWA 3OU0A 1HXFH 4AG1A 2GCTC 1AU8A 1DUAA 1P0SH 5T6GA 3GCTF 1YGCH 5JYIA 2DUCA 2A7HA 3PM3A 8KME2 2ZDVH 1KXAA 1D3DB 1D9IA 1G32B 3RXIA 1KLIH 3SJOA 2W7SA 1THPB 1SI5H 2LPRA 1CBWB 3PTBA 4TPIZ 2CJIA 4FVDA 3VB4A 1UTMA 3KQDA 2HOBA 4H6TA 2GD4B 1UCYK 5LPEA 6LPRA 1OOKB 4CRFA 3M35A 3QDZB 1O31A 4TWYA 2TRMA 2SGAA 1CU1A 2ZU5A 2CV3A 5DP6A 1KY9A 1PQ7A 1C2HA 3UR6A 1XUGA 1YLCA 1GBJA 4UE7H 2FYRA 1LPZB 2QY0B 2WPJS 1WQVH 4CRBA 1ETTH 3RM2H 3T26A 5EXNA 1CHOG 3STJA 9ESTA 3MNSA 1SL3A 4JZFH 1O36A 2PUXB 3SGBE 1HJ9A 3VB5A 4NGAH 4ZHMU 1TYNA 5CHAC 2RA3A 3SGAE 1WBGB 1GI5A 2BDGA 2BY5X 3ZVFA 3GCHB 4INHA 1W7XH 4I32A 1BMMH 1C2KA 3A81A 8GCHF 4NCYA 2VVUA 4R8TB 1ZPBA 2ZWLH 3FAOA 1W2KH 2JH6D 2ZFRH 2HALA 1NRQH 4X2VA 1TONA 2ZFPH 3VXFH 1C1PA 1GBKA 1Z7KA 5FPSA 3SJ9A 3STIA 1UVSH 1C1TA 3PMJA 3RP2A 2IJOB 1EJNA 1W0YH 1OYQA 1V2LT 1HIAB 3KN2A 4NIXA 3A80A 2CHAC 1M9UA 1OKXA 1QJ7B 1BMLA 5DJ7A 2STAE 4LOYH 1GBCA 1H9LB 2F9PA 1CQQA 1ABIH 2NU0E 4ZUHA 2FI5E 4GUXA 4IBLH 4JZDH 4DJZB 4AORA 1A7SA 2J2UA 2QXGA 2EC9H 1THSH 4JZIA 1Y5AT 1RJXB 3VXEH 1OX1A 2ZU1A 3BTQE 1W13U 5BPEA 2A2QH 5PTPA 3HK6B 1QBOA 1V3XA 3K2UA 1ZHRA 3T29A 3L6PA 1LHCH 3F9HA 3NK8A 4MVNA 3SU5A 2ZNKH 2EI8A 2FLBH 4X2WA 3BEIB 1JRSA 1UCYH 1LPGB 3MMGA 5L2ZH 2F9UA 1DFPA 3GCNA 1WAYB 4DT7B 1SGYE 1E35B 1SR5C 2V35A 2VH6A 3SNEA 1O5DH 2ZDNA 3SU0A 3D23A 2WV4A 2AH4X 2H5DA 3L3TA 2BYAX 2QF0A 2XC5A 1HAPH 4RKJB 3P95A 1XUIA 1DLKB 1YP9A 2WUBA 3TJVA 2FPZA 1W12U 1O2TA 1CT0E 3M3VA 4O9VA 1OWKA 4HFPB 2BY6X 4X8TH 8GCHG 1CSOE 1YPEH 4ABFA 3P70B 1UHBB 4ABHA 3GOVB 1CA0B 2XW9A 3AASA 3K6YA 4I8HA 5L2YH 4I8GA 1A61H 5GXPA 3ATMA 4YESB 3VGCC 3MTYA 1UK2A 4D8NA 1ABJH 1YF4A 2Z7FE 1DT2A 4GSOA 3PB1E 1FXYA 1KTTB 1O3HA 1QFKH 2RCEA 3C1KA 4Y10E 4XBCA 4K8YA 1VCWA 4D7GA 2PKSC 5A0CA 3P8OA 1FJSA 4OS1A 4X2YA 2AMQA 4AFUA 5BRRE 1UVUH 1P2JA 2Y82A 2DE9A 2ZFSA 3RXFA 4IN2A 1QTFA 1TABE 1Y5BT 1O5FH 1YBWA 1CA8B 2SGFE 3EE0B 3ELAH 2ZU4A 1IHSH 5DP7A 2RA0A 3BEFB 2I6QA 2G5NA 1RRKA 3E8LA 4VGCB 1GHAF 4PROA 2VH0A 3P8FA 4WWYA 3V12A 1V2TT 3E90B 2OC1A 1UMAH 4JMYA 1T7CA 3SV7A 3M5NA 1O5GH 1QNJA 1QL9A 3RXGA 4BTIB 3OSYA 3PLPA 5GCHG 6GCHG 5A8YA 1MKXK 1P9UA 1QIXB 1FI8A 1A5HA 4CH8B 1QQUA 1O2MA 2TPIZ 5T3HA 1OPHB 1KLJH 1OWIA 5FPYA 7LPRA 1V2PT 2Z94A 1O0DH 4TPYA 2M5TA 2TBSA 1B5GH 1FZZA 1GHWH 2WYGA 4Y79A 1MCVA 1ELGA 1SGTA 1F5RA 2BXUH 3A8DA 2FOGA 2GV6A 1GHXH 4IS5A 1TWXB 2Y6TA 2GT7A 5AFZH 1O5CB 1X7AC 2SGQE 1THRH 1MKXH 1WOFA 5DP8A 4X8VH 5J4SA 1ELCA 1QJ1B 4FUFA 1EOLA 2ILNA 1QA7A 2GDEH 1Y59T 2P8OC 1V6DA 2G55A 4BANB 1EPTA 1BHXF 2THFB 1TQ0B 2ANMH 2GZ8A 4CR5A 1RD3B 3S0NA 4ABBA 1MZAA 1TOMH 2PSYA 1S82A 4KELA 1MKWK 3K65B 3QTVH 4HGCA 2BD5A 4DVAU 1FPCH 3ATWA 5DP4A 2B0FA 2AYWA 2CGAA 5EU8A 1SLWB 1V2OT 3NPSA 3DT0H 2UUKB 3M5OA 3BTME 3MNCA 1UTNA 2GCHF 3BTFE 4NIWA 3SU6A 3GY6A 4X1PU 1GBAA 1MTUA 4XE4A 1PJPA 3OY5U 1OWJA 1CHOF 2HNTE 1O2OA 3SNDA 2UUYA 1YM0A 4MPXA 1QB6A 1QJ6B 2BTCE 1ZZZA 1NRRH 3P17H 5LPFA 2ZDKA 4JCNA 4IMQA 2AEIH 2Q6GA 3UY9A 3JZ2B 4GAWA 3A7WA 2GZ7A 5T6FA 3HGNA 4NZQA 3D62A 1UTJA 2G52A 3QGJA 4GHTA 2A5IA 4B2BA 1DANH 4FU8A 3IG6B 3SHCH 1DUEA 2AIPA 1NN6A 1O3PB 4Y7AA 1ESTA 1O5AB 2VINA 1GWAA 1N6XA 2BOHB 1C1QA 4O3UA 2B9LA 3GY8A 1JBUH 1NRPH 1SG8B 4AGKA 1P12E 4WXIA 3TITA 1QB9A 3SW2B 1BITA 4K1TA 1ZPCA 3SOSA 1Z8RA 1EAIA 1DLEA 3F1SB 4FUGA 1FY8E 1S5SA 1NROH 1VZQH 1CT4E 1Q2WA 4YT6H 1C2GA 1FPHH 1ZSKA 3ODDA 1FY1A 2FEQH 1AD8H 1K1IA 4R0IA 1YPJH 2FXRA 3P8GA 4ISLA 3RUOA 2ODPA 3EYDA 1K22H 1D3QB 3HK3B 1DICA 4Y7BA 4ZKOU 4MNWA 4LK4A 1Y3YA 3SJ8A 5C1XA 2VWLA 1LPKB 4UFFH 1C2EA 1SVPA 1O2WA 3MH4A 2UWOA 1O34A 4OGXA 4IMZA 4U2WA 4ZXYH 1UO6A 2V3OH 1KXEA 3MH5A 4HZHA 1PYTD 1W0ZU 3M7QA 2ASUB 2R0KA 2ZIQH 1E34B 4HTCH 1ETRH 2BX3A 4WH6A 4NA7A 1HCGA 3H7TA 3GICB 1GI8B 1KDQA 2XC4A 1GI0A 1HAHH 2O8LA 6ESTA 4A1VA 1FLEE 1S83A 3MO9A 1TRYA 2ZKSA 3TJNA 3U1JB 1XXFA 1VGCC 2G00A 3PV4A 3RXDA 2DE8A 4IC5A 2P94A 2BQWB 1GMCF 4E05H 3S7HB 3M37A 5F03A 2BMGB 2AMDA 1G3BA 4M7GA 1K1MA 3TU7H 4BTUB 1V2NT 1GBDA 1KXFA 4TY6A 1NU9A 4K5ZA 1DY8A 1IQEA 3ZV8A 1AE8H 1OYTH 2UUFB 1TNHA 1HAOH 2F9BH 1TPPA 1ETSH 3GYLB 2ZTXA 1NFYA 2NU2E 2ZO3H 6GCHF 2FOFA 2Y5HA 1AVXA 4Y0YE 3U8OH 4Y8XA 2GZ9A 1A1RA 1ELDE 2A7JA 5C1UA 2XCFA 2XNIA 1GG6B 2TIOA 2C8YB 1ELFA 4HI3A 3LONA 1C5PA 1JIMA 2R2MB 1TGBA 2FS8A 2BD9A 7KMEH 1GI7B 1TGSZ 3T2NA 1YYY1 5B6OA 1HRTH 1ZHMA 2VB0A 1O2UA 3ATIA 1PPHE 4XOJA 1AY6H 3MH6A 5A8ZA 1NFWA 2B5TB 3LKWA 4AYYB 3A7ZA 3WY8A 2VVVA 3RMLH 3SU1A 2GP9B 2PGQB 1SGPE 1TLDA 5CE1A 5E8EH 1C2LA 1LQDB 4NWKA 3A88A 4ZMAH 2Z6BD 3RXKA 4JK5A 5FX6A 1GBLA 5F8ZA 2ZF0H 3BIVH 1LHEH 2PHBA 2BDHA 2O8MA 1JRTA 3BTTE 3HKJB 3UNSA 1NM6A 1GBTA 1TX8A 2A1DB 2SGEE 2Z3CA 2QGRA 4TYDA 2FOAA 1SGFG 4XDEA 1S85A 3PROA 3UREA 3ZZAA 2PWXA 2FMJA 3IITA 4X6PA 1QBNA 2C8XB 3RMNH 4J2YB 2ZECA 3TH3H 4QT8C 4AFSA 4MDSA 1CGHA 3BG4B 3VFEA 2ZFTA 1EZXC 4MNVA 1P01A 1BTYA 3KQBA 1WU1A 1TGCA 5AHGH 4AOQA 1BOQA 1EJAA 1K9OE 1MU6B 1GJ4H 1OWEA 2A45B 2ZCHP 2OUAA 2H6MA 1O2HA 4ZROA 3TGKE 4YT7H 4UEHH 1XUJA 1C2DA 1LKAA 2FP7B 1AB9C 3BTKE 3QTOH 4AFZA 2ZHFH 5AF9H 4IGDA 3RXQA 1E0FD 1WSSH 1UVPA 4D9RA 2CMYA 2CF9H 1BUIA 1NZQH 1TX7A 3QK1A 2BVXH 1G2LA 1GI2A 2ESTE 2J34A 2GT8A 1P02A 8LPRA 4O03A 2JKHA 2GX4A 4K2YA 2VWNA 1UTOA 5GJ4B 1D3TB 3MU1A 1T8NA 3LH1A 3QWCH 1F5KU 3M61U 5AVDA 1IQFA 1ESBA 3G01A 4KTCA 3SU3A 1VJAU 1O3EA 3F9FA 4AZ2B 1L1NA 2W26A 2BHGA 3TJUA 3MYWA 3PYHA 1EKBB 1ANDA 2BDBA 1LQEA 3LU9B 4SGAE 4ASHA 1ZHPA 1J8AA 4CHAB 1GBBA 1K1JA 1ZJDA 1CGJE 1ORFA 1AI8H 1Y3VA 1TNKA 1OWDA 1GL1A 3S69A 1C1MA 2XBYA 1DITH 2NU4E 2Z9JA 3ATLA 3VEQB 4MTBA 2K1QA 2G5VA 1SPJA 3GCTG 4YLUA 2OBQA 3LC5A 1ZMLA 1HAIH 7GCHG 1O3IA 1L1JA 2HNTF 5DPAA 3SBKA 3V3MA 4F49A 1F5LA 4ISNA 1GBIA 1SFQB 2TGAA 1N8OB 1SQTA 3F68H 1G9IE 4AB8A 1C9PA 1YKTA 3RXSA 1RS0A 3RXHA 2AERH 2FOHA 2FOBA 2FX6A 1HYLA 1CBWC 2QN5T 2P16A 2W7UA 1TMTH 5EOKA 1EAUA 3B9FH 1P3EA 4DY7B 4O3TA 1BRBE 3QUMP 4I7YH 3SNBA 1XVOA 1T4VH 1KXDA 1GMCG 1TX6A 3U1IB 2BDAA 4Q7YA 3I78A 1TIOA 1GVZA 1MTNC 1O2KA 1ANEA 4THNH 2ZGXH 2ZG0H 5LGOA 1Z6EA 3ODFA 1DWDH 3QGNB 5ETXA 5EPNA 3RU4E 5DP9A 1PPGE 1ZR0A 1HIAA 1C5WB 4X1QU 4AFQA 1CO7E 1GJ7B 1L4DA 3S9BA 3M5LA 3SN8A 3ITIA 2A32A 4UONA 3UWJH 1O2IA 1O3JA 4B1TA 2QXIA 1TE0A 1INCA 2W3KA 1QCPA 1GI3A 1GGDB 5LH8A 5TJXA 1CHGA 1ZSJA 2V6NA 3SI4H 4I8KA 1HJ8A 1GDUA 1XM1A 5GCHF 1TA2A 4GVUA 4KGAA 3PLBA 1BTUA 2QC2A 3RM0H 3DA9B 3UOPA 1AIXH 5T6DA 3RXOA 1WUNH 1O3DA 4B76A 1GBEA 2XBVA 2XBWA 1O3FA 1MTNB 1K28D 1MTVA 3SUDA 4YOJA 2SNWA 5JBTA
chains in the Genus database with same CATH superfamily
4Y8ZA 3VB3A 1O33A 2O8TA 1GI1A 1P2KA 3KGPA 2FOEA 3CP7A 1NU7B 2TGTA 7GCHF 4NWLA 1GG6C 3EA7A 3MU8A 1IQIA 2ANKH 3EA8A 3BIUH 1TOCB 3RXMA 4Y11E 1EZQA 4P00A 1FIZA 1SQOA 5HXFA 1EQ9A 2D8WA 3MO3A 1FMGA 2C4FH 1AKSB 2W5EA 3ZZBA 2WV5A 4OM9A 4OS7A 1L4ZA 1BMFD 1P9SA 2WHXA 3U8TH 3KEEA 3TLOA 3GY3A 1EAXA 3TGIE 2H1UA 1DOJA 1E1QD 4NA8A 4CRGA 1GDQA 1A3BH 4LZ1H 1MQ6A 1XXDA 5HGGA 2VNTA 3TH2H 1BDAA 1P03A 3P8NA 1NRSH 3F2GA 4K3JA 1BCUH 4OGYA 3HGPA 2HPQH 3UQVA 2A7CA 3RXEA 2A4OA 1O2JA 2TGPZ 2BQ7B 2FZZA 3NZIA 4GCHG 2O8UA 3MHWU 2ZC9H 1HLTH 1TMBH 2Y7XA 4Y76A 5FCKA 4X2XA 1O32A 4H4FA 3AAUA 1TBZH 3S9AA 1TAWA 1TNLA 1MUEB 3M3TA 3RXUA 4X6OA 1YCPK 1QURH 2KAIB 3V0XA 4A1TA 1WTGH 4BNRA 2PGBB 3UIRA 2C3SA 1ZRKA 1YPGH 1YPLH 4X1SU 1O2SA 1ANBA 1V2QT 1WXRA 2IOTA 1XMNB 3MU5A 1FY3A 5A2MH 1MQ5A 1EATA 1IQHA 1HBTH 1MCTA 2ZFFH 2EEKA 3U98H 3RXBA 1O2QA 2GJGA 1V2UT 1PQAA 3VGCB 3S9CA 2UWLA 3F0OA 5HIZA 2ZHEH 1O2PA 1LTOA 2R2WU 3RXCA 3OAAD 2TGDA 2G51A 4TY7A 3GISB 1F0UA 4FUDA 2QF3A 1G36A 1XX9A 1H4WA 1C9TA 1H9IE 2VWMA 1BHXB 1F0TA 2ZDAH 3MWIU 2IN2A 1HNEE 1D3PB 3PRDA 2CF8H 2KZ4A 3SZNA 2KAIA 1KDQB 3F0PA 4RT0A 1GDNA 3BV9B 3IWMA 3KQCA 3KHVA 3O8BA 4KTSA 4J1YA 1C2MA 1C5QA 3ZV9A 4D76A 2ZHWH 1BMNH 5A0BA 2FI3E 3GDVA 1W14U 3FZZA 2BDYA 1WQSA 1W3CA 3S7KB 2H9TH 1P2QA 1ZTLA 2XC0A 4IN1A 4DOQA 1C5TA 4WH8A 1F7ZA 2R3YA 2WPMS 4LXBH 2BD3A 3UNQA 2GGVB 2ZDLA 3HKIB 1NESE 2B7DH 1VITF 3EGKH 4K60A 1QY6A 2OQ5A 1O2XA 4Q7ZA 3SU2A 1E79D 2UUJB 4JYUH 4OS6A 1XUHA 4RN6A 1QHRB 2P59A 3KQEA 1MZDA 5C1YA 1T8OA 1ZOMA 1V2ST 2VIQA 4INKA 1Q31A 4TSFD 1EXFA 4U32A 4JK6A 4UFDH 1C1UH 2A2XH 4MPUA 4UD9H 4XD7D 2OTVA 4Q63A 1S0RA 3BSQA 1SLVB 2P3TB 1A46H 2H5CA 1UTLM 4SGBE 3MOCA 1FAXA 1K1NA 1GI6A 2D26C 3Q76A 3ZVAA 1JXPA 1HAVB 2OXSA 2OINA 1G3EA 4ISOA 4Z1MD 1C5XB 3P92A 1OWHA 2PFEA 3SQEE 4CRAA 1SMFE 2BD4A 2D2DA 2ZFQH 3A7VA 2HVYB 3FKSD 1SOZA 1ACBE 1WCZA 1C5LH 1NT1A 2R3UA 2AIQA 2AFQB 3RXJA 2OP9A 4DT4A 1BRAA 1XVMA 5FBEA 3RU4T 4YO9A 4ZHLU 1ZJKA 1A5IA 1OP8A 3BN9A 4D7FA 1K1OA 1YPHE 1JWTA 3SI3H 3BTDE 1PPZA 3RXPA 3KCGH 3B23B 1O3GA 2ANYA 2O8WA 3A86A 5C5OA 3O8DA 1LKBA 1VCPA 2BY7X 1SC8U 1GJAB 5EQRA 2FOCA 3M36A 1FN8A 1NO9H 1DSTA 2GTBA 3FOAA 5FX5A 2SGPE 4A92A 3M5MA 2XBXA 1GHYH 3R3GB 1QZ8A 4CREA 1BT7A 2LNCA 1GVKB 1SHHB 2JETB 3NUMA 3E0PB 5EGMA 4RSPA 5HKKD 1ZRBA 2VU8E 3ZYDA 1FUJA 4A7IB 2NWNA 3F6UH 2ZA5A 5L6NH 5TCAA 4JZEH 5EQSA 3PWBA 2GV7A 3BF6H 1A4WH 1SB1H 2PUQH 3TNTA 1RXPA 1SHYA 1TPAE 1ZMNA 3SNCA 2VVCA 3D65E 5DK1A 1SGIB 1TBQH 1KLTA 1O3OA 3FANA 2Y5GA 4BXWA 1SGCA 2BLWA 1AKSA 2VIVA 1O2GH 2VGCB 1GMDF 4OS5A 1UK4A 4X1RU 5F8TA 3A85A 3GY5A 4FXGH 5E0JA 1C5VA 2VIWA 4UFEH 1MKWH 4FUJA 1OP2A 4DCDA 1A2CH 1GJ9B 1KMHB 3W94A 1W8BH 1YLDA 2QCYA 2WPIS 2BXTH 2AS9A 1EB1H 2H9EH 3GY7A 2FIRH 1V2KT 2SNVA 1O3KA 3FP7E 1PQ5A 2K8IA 3HATH 3SUGA 1O39A 4KP0A 4VGCC 2F83A 4ISHH 4NZLA 3DUXH 2ZPQA 1GMHF 5A09A 5GWZA 3A8CA 1OS8A 3MO6A 3RLYH 1O3NA 1C4Y2 4XFQA 3TVJB 3C27B 3E0NB 4A6LA 1RIWB 3SJIA 1BRUP 2A4QA 4MLFB 1DY9A 3RXAA 4WY3A 2WPDD 1IHTH 3PO1C 1FDPA 4NSVA 1IQNA 1PPFE 2OQUA 2GCTB 1F0RA 2WINI 5CMXH 1O3MA 1BJVA 1RIWC 4TWWA 5JB8S 5B6LA 2SFAA 1AZ8A 1ZPZA 2EI7A 4HG6A 1V2MT 3PO1B 1UTQA 5C94A 3UQOA 1DWEH 3UR9A 2BVRH 4AG2A 1P2IA 1ELBA 4K1EA 4E06H 5EODA 4Y8YA 1TALA 1A5GH 3AAVA 1ZLRA 4DURA 2ZTZA 5FXLA 2BOKA 2OBOA 3LGTA 4AC9A 1O30A 1Z8IB 2ZDMA 1NC6A 1G3DA 1GI9B 2YOLA 4FU9A 5GPIB 4I8LA 1GCDA 3NCLA 1HAYB 2XTTB 1VITH 3GY2A 4MQAA 3E16B 3BEUA 1BRCE 3VG8A 4CRDA 5J4QA 2AHME 4ZH8A 1IQLA 2BLVA 4GLYA 4I33A 3DCLA 4ESTE 4B74A 1DWBH 1SSXA 2B8OH 1K0HA 3W1EA 4Y71A 2PR3A 2P3UB 1AFEH 5F6MA 1DVAH 2OC8A 1ZYOA 4H42U 4AGJA 2VIDA 4X1NU 4Q80A 3ZVBA 1P8VC 2C8WB 1PYTC 5CHAB 2ALVA 5C17A 2G4TA 1TNIA 2ANWA 4BAQB 1V2VT 3OTPA 2XCNA 1C5SA 1AE5A 4AX9H 4KKDA 2F43B 2GCHG 2XRCA 3UAIC 4B71A 5C20A 3HPTB 5IDKA 1MD7A 4YLQH 1UVOA 3CNRA 1Z1JA 2WPKS 2ZEBA 2AGEX 3BTGE 3QLPH 3LJJA 1O2VA 1P57B 3V13A 1LHFH 5E2OA 1O3AA 1YLNA 3A8BA 5E0HA 1P05A 2BVSH 5GIBA 1ARCA 1EX3A 1GHZA 4FU7A 2Z9KA 1T32A 4CHAC 3PMBB 2ZTYA 3VB7A 3M3SA 1J9CH 2G81E 3BTEE 1F2SE 3UNRA 1ID5H 1Z1IA 4FUBA 3CENA 1KSNA 1DWCH 1AHTH 2ALPA 1EUFA 2I6SA 4LZ4B 2BD8A 1C2FA 3UWIA 1GBFA 3UPEA 4ZKSU 1G2MA 1W0KD 1AUTC 2FTMA 1ZSLA 3TIUA 3F9GA 1QBVH 2BDCA 1LDTT 3I29A 2V0BA 4U30A 3TGJE 1RGQA 1C1OA 1MU8B 2Y7ZA 1O2NA 5C0UA 1C1NA 2ZGBH 2OLGA 2JETC 2Z3EA 1QRWA 3WWBA 3PMAB 3RXVA 1C5RA 1FIWA 1C5MD 4NIYA 4Q2KA 5HIYA 1RTLA 1U6QA 2GMTB 2C93B 1S81A 3I77A 4TT3D 4F55A 3FP6E 2BLQA 2KR7A 2VIOA 1DXPA 2ZCLP 4FVBA 1MTWA 5ESBA 3BG4C 1EAWA 1A0LA 1J17T 2XWBI 1Z71A 1Q3XA 3EA9A 3BTHE 4B73A 1QA0A 1K21H 3JZ1B 2V3HH 1GVLA 1L0ZA 1NS3A 5L30H 1C5NH 4ZKNU 2KCAA 2EA3A 4ZHAA 4X6MA 2Z9IA 4B2AA 3U8RH 2KCPA 1AB9B 4CH2B 1C4V2 2XWAA 4XBBA 1E38B 1NBME 4I8JA 3UUZA 1UK3A 2AMPA 2GDDA 1D4PB 3E3TA 1IQKA 3ZZ6A 1T31A 1CA0C 1IQJA 3ZZ7A 2YNAA 1TPOA 4YZUA 1AVWA 1O5BB 4ZXXH 1Z6JH 1FV9A 1GGDC 1C5ZB 1SOTA 2Q6DA 2ZGHA 2RG3A 2D1JA 1CGIE 1P06A 1LVMA 1TPSA 1HXEH 1E37B 3LC3A 2Y5FA 3ZZ4A 3GY4A 4FUIA 1SLXB 1HAVA 2Z3DA 3NKKA 1GHBG 4CR9A 3RDZA 1K1PA 2PV9B 5TCCA 1SGNE 1ELVA 4DIHH 1C1SA 2Q1JA 2WUCA 1BA8B 1LMWB 4I31A 4K1SA 2GMTC 2BX4A 1H1BA 1V2RT 1HAZB 1TRNA 3TK9A 2STBE 1O2LA 1UVTH 1KXCA 2ZHDA 3D49H 1GJCB 3EQ0H 2H2ZA 5DGJA 2OC7A 5HMAA 2HVXA 2J98A 3H5CB 3QZQA 4YM9A 3A87A 4X8UH 3SV6A 3FZDA 4XRNA 2F9VA 1MMJN 5EXLA 1AQ7A 2A5AA 2FOMB 3A8AA 1XUFA 5HYOA 4MNXA 1Y3XA 2P8OB 4H6SB 4JYVH 2V3MA 3OX7U 4X8SH 3F9EA 2K0QA 3LOXA 2Y80A 5DO4H 1YC0A 1DSUA 1XKAC 4WF8A 2Q6FA 1NY22 1S6FA 1TB6H 1CT2E 1P2MA 2RDLA 1AGJA 2J92A 2JDID 2JJ1D 3EDXB 3VPKA 5A0AE 2CXVA 3DSGA 4DGJA 1LVYA 4XBDA 2QXHA 1TGNA 2A5KA 4K69A 1ELEE 3RU4D 4I86A 1OP0A 1DS2E 2KCYA 4MPVA 1A3EH 4NSYA 1H8ED 4WXVA 1C4U2 5HM2A 1ESAA 5DP5A 2FS9A 1P04A 2BY8X 4A5TS 3FFGA 1YCPM 3FN8A 4BAKB 4DG4A 4NG9H 4BOHA 1XUKA 3E1XB 3RXLA 4UFGH 3MNXA 4ABEA 3E91A 1ARBA 1DXWA 1AZZA 3MH7A 2EY4C 3TNSA 5A8XA 1HGTH 3W95A 3T28A 1GCTC 3U9AH 5SGAE 1AMHA 1MD8A 3AVZA 3CS7A 3OY6U 4D9QA 2FI4E 1GI4A 3QO6A 4WMDA 1FN6A 4YOIA 1GCTB 2BM2A 1FY4A 4BAHB 1A0JA 2OD3B 3SU4A 1BMAA 3LDXH 1Z8GA 1GJ6A 1HUTH 2PKAB 4GCHF 1SGRE 3AW0A 2W3IA 4X6NA 1N8OC 2ZI2H 4YOGA 7ESTE 1HB0B 4Q7XA 1HJAC 3ZVDA 4BXSA 1BBRK 2G4UA 1T8MA 2M2AA 3A84A 3EAJA 5EPYA 5F8XA 2H9HA 1ELAA 2JH0D 3TPIZ 1FNIA 4Q4LA 1BBRH 5GDSH 3M7TA 1EPTB 1IAUA 5FPTA 1ZTKA 2LP6A 3FVFB 1QRXA 2GVFA 2J4IA 1P2OA 2Z9GA 3ESTA 4ABAA 5K0HA 1BTHH 1GJ8B 2J38A 1UW7A 3GDSA 3A82A 1JIRA 1SQRA 1G30B 3WWFA 1OHHD 5DG6A 1O2RA 2ZPSA 3U28C 3DD2H 3LGYA 2F9OA 5LPRA 2FM2A 2F91A 1AWFH 2J95A 1AFQC 2SGDE 1E36B 3K9XB 3LGVA 2JIZD 5H4IB 3KNXA 2ZU2A 5DP3A 1O5EH 4F4OC 2BY9X 5C67A 4INLA 1DPOA 2ODQA 2YMSC 1K1LA 3PTNA 5C5NA 1S6HA 1V2WT 1AO5A 1V2JT 4OS4A 5AFYH 3TH4H 1EP5A 1VCQA 2C90B 3R0FA 3MFJA 1C2JA 5FBIA 1Y3UA 4WMFA 1MBQA 1VKYA 2PLXA 1TGTA 1O3CA 4CBNA 2EI6A 4AB9A 3RMOH 3UOUA 4ASUD 3KYGA 4UDWH 5JBCS 1IQMA 2ZCKP 5ABWA 4M9FA 3SYJA 1WV7H 4DIIH 3KIDU 1WYKA 1Z8JB 1MTSA 2R0LA 3RLWH 2NU3E 1TNJA 2ZGCA 1UJ1A 3O8CA 1HDTH 5CHBA 3TK6A 2OCVB 2WYJA 4WJG2 3ATKA 4MG3A 1YPMH 3V7TA 1HAXB 3SZEA 3PWCA 3SORA 1MH0A 5K7RA 4WMEA 2PW8H 3FO8D 3SV8A 1COWD 1OXGA 2FLRH 1TRMA 5F53A 2PTCE 3H7OA 4IC6A 3LGUA 1QGFA 2XXLA 4YXWD 6CHAC 3SHAH 2A4RA 2NU1E 4GPGA 1SGDE 3SGQE 1B0FA 3ZZ3A 5C2ZA 1ANCA 2QIQA 3PV5A 2KX4A 2CHAB 2QE7D 4WVPE 1ZGIA 1BTXA 2FO9A 2L74A 1FQ3A 3NRLA 4CRCA 3SV9A 1H8DH 4ABGA 3Q3YA 2J94A 3GYMA 1GMDG 3GCOA 3U69H 5EG4A 3CS0A 1QR3E 1NPMA 1GMHG 4ZAEA 3H09A 4B75A 1TQ7B 1BIOA 1BTZA 5KEDA 3LJOA 1O37A 4Y6DA 2WPHS 2VGCC 2HLCA 1O3BA 3Q00A 1ZTJA 4JZ1A 1RFNA 3RC6A 5FCRA 3A7YA 4A1XA 5JDUB 2ZQ2A 3ZZCA 1P11E 2BDIA 1GBHA 2FESH 3ZVGA 1LVBA 1FONA 2FWWA 1L1GA 4Y0ZE 3T62A 3SO3A 1KYNA 3A83A 1YCPH 3GDUA 4RKOB 8ESTE 4FUHA 1QL7A 3OFND 3QN7A 4ZKRU 4CBOA 2WZQA 1TNGA 1TBRH 3UFAA 3RXRA 3ZZ8A 1L2EA 1NFXA 1KXBA 2ZZUH 3RC5A 1BTWA 4MNYA 1LCYA 1H9HE 3MU4A 3Q3XA 3MNBA 3A89A 2F3CE 6CHAB 1SFIA 1W11U 5FAHA 2YNBA 1VJ9U 5JB9S 2BD2A 2O9QA 3LH3A 3BG8A 2HNTC 5C3NA 1PQ8A 3SV2H 1J14A 1HAGE 1VGCB 2F9NA 2HWLB 2VJ1A 3K6ZA 1Y3WA 1BJUA 1C5OH 1W7GH 1O3LA 5JBAS 3T5FH 5I25A 1GPZA 1LHGH 3ZZ9A 1G37A 2PP6A 1PPEE 4E7RG 1XKBC 1WTHD 1HPGA 1EB2A 9LPRA 2G8TA 3KF2A 3SJKA 1SGQE 4MPWA 2FX4A 1TA6A 2ZQ1A 2P93A 1MAYA 2HRVA 4KTUA 3URCA 1YPHC 1UTPA 1B7XB 2Y81A 1AFQB 5EJLA 3SUFA 1N1LA 4ABDA 5E0GA 1C5UA 1FY5A 1GHAG 2QA9E 1EOJA 3QX5H 2ULLA 2GKVE 2BD7A 2ZU3A 4FUCA 4XSKU 1GJBB 3TK5A 1CVWH 2ZP0H 5EW2H 3LGIA 4ABJA 5G4BA 1EZUC 3KL6A 2FYQA 1KTSB 1AWHB 1NRNH 5DKMA 1AUJA 3DFLA 2XOKD 4E7NA 3M7UA 1ZMJA 3MU0A 3O8RA 1S0QA 3ZZ5A 4NA9H 4IW4E 3L33A 3OTJE 5ESTE 1AN1E 1A0HB 3T25A 1C5YB 1MBMA 1QRZA 5JPMH 1EPTC 4ABIA 3ZVCA 1JMOH 1PPCE 1GHBF 4Z6AH 2FTLE 4BTTB 1J15A 5JBBS 1DDJA 1FAKH 3LIWA 1NFUA 1UTKA 1BB0B 4NFFA 2VWOA 2BB4A 4Z0KA 3B8JA 1HJAB 1EZSC 1Y5UT 1BZXE 3TJOA 3E6PH 1RTFB 1GJDB 4FUEA 4DW2U 5EJ1A 1SGFA 1QB1A 3LPRA 4GHQA 3VB6A 1T8LA 1IQGA 4AYVB 1EASA 1P10A 1P2NA 4U01A 2C8ZB 3SNAA 1J16A 1SGEE 3NWUA 1JOUB 1S84A 1SQAA 3UB0A 4OS2A 1VITG 3GCHC 1H8IH 2Z9LA 2PKAA 1F0SA 2ZPRA 5EW1H 1SLUB 1UHBA 4X0WU 1AVGH 2IPHA 2BZ6H 2AGGX 4AN7A 3UTUH 1LO6A 5FHTA 3BTWE 2OC0A 3Q3KA 3ZIAD 3RMMH 3ZZDA 1LVOA 4O97A 2P3FH 1GBMA 2FDAA 1ELTA 2HPPH 2PKSB 1CE5A 3ZVEA 5E2PA 3MI4A 1O2YA 1G3CA 2UWPA 1GJ5H 3RXTA 4B2CA 5HM9A 1QL8A 3T27A 1ZGVA 1C1WH 1QQ4A 3NXPA 3DHKH 5T1VA 3PLKA 1O2ZA 4NIVA 1PFXC 2ZGJA 1SBWA 4K8BA 3N7OA 4YTAA 2QV1A 2P95A 2A31A 3PMHB 1D6WA 2R9PA 1F92A 5EQQA 3ZYEA 2BZAA 2PTNA 4BAMB 2BQ6B 4BAOB 2VIPA 1C1VH 1GL0E 3Q77A 1BBRE 1EJMA 1P3CA 1W10U 1SKYE 2HGTH 2QXJA 1DE7H 3LT3A 2CN0H 3P6ZB 1UCYE 1Y8TA 3QZRA 3A7XA 2YMSB 1K2I1 4ISIH 1BQYA 1TMUH 2A4GA 2PSXA 1DX5M 3SUEA 1VR1H 5EXMA 3OYPA 3RC4A 2JH5D 1PPBH 1WDIA 4NFEA 1BTPA 1EP6A 1HV7A 2A0QB 2QYIA 1OSSA 3AW1A 1DM4B 1LHDH 2FODA 1C1RA 1T4UH 2BLOA 2WPLS 1KIGH 5I46H 2J98B 2AGIX 3A7TA 2ODYB 2XYAA 3SQHE 3DFJA 1TFXA 1MAXA 1P09A 3ENSB 4JYTA 1HFDA 1C2IA 1GHVH 1N6YA 2QAAA 1B0EA 1IOEA 1D6RA 2J9NA 1YPKH 5IYTA 2ZHQH 1O38A 1NTPA 3URDA 1O35A 1RTKA 3FP8E 3LGWA 3OU0A 1HXFH 4AG1A 2GCTC 1AU8A 2LELA 1DUAA 1P0SH 4FETA 5T6GA 3GCTF 1YGCH 5JYIA 2DUCA 2A7HA 3PM3A 8KME2 2ZDVH 1KXAA 1D3DB 1D9IA 1G32B 3RXIA 1KLIH 3SJOA 2W7SA 1THPB 1SI5H 2LPRA 1CBWB 3PTBA 4TPIZ 2CJIA 4FVDA 3VB4A 1UTMA 3KQDA 2HOBA 4H6TA 2GD4B 1UCYK 5LPEA 3PV2A 6LPRA 1OOKB 4CRFA 3M35A 3QDZB 1O31A 4TWYA 3EE7A 2TRMA 2SGAA 1CU1A 2ZU5A 5DSFA 2CV3A 5DP6A 1KY9A 1PQ7A 1C2HA 5IK2D 3UR6A 1XUGA 1YLCA 1GBJA 4UE7H 2FYRA 1LPZB 2QY0B 2WPJS 1WQVH 4CRBA 4FOUC 1ETTH 3RM2H 3T26A 5EXNA 1CHOG 3STJA 9ESTA 3MNSA 1SL3A 4JZFH 1YY3A 1O36A 5GNDA 2PUXB 3SGBE 1HJ9A 3VB5A 4NGAH 4ZHMU 1TYNA 3N7EA 5CHAC 2RA3A 3SGAE 1WBGB 1GI5A 2BDGA 2BY5X 3ZVFA 3GCHB 4INHA 1W7XH 4I32A 1BMMH 1C2KA 3A81A 8GCHF 4NCYA 2OK5A 2VVUA 4R8TB 1ZPBA 2ZWLH 3FAOA 1W2KH 2JH6D 2ZFRH 2HALA 1NRQH 4X2VA 1TONA 2ZFPH 3VXFH 1C1PA 1GBKA 1Z7KA 5FPSA 3SJ9A 3STIA 1UVSH 1C1TA 3PMJA 3RP2A 2IJOB 1EJNA 1W0YH 1OYQA 1V2LT 1HIAB 3KN2A 4NIXA 3A80A 2CHAC 1M9UA 1OKXA 1QJ7B 1BMLA 5DJ7A 2STAE 3MQKC 4LOYH 1GBCA 1H9LB 2F9PA 1CQQA 1ABIH 2NU0E 4ZUHA 2FI5E 4GUXA 4IBLH 4JZDH 4DJZB 4AORA 1A7SA 2J2UA 2QXGA 2EC9H 1THSH 4JZIA 1Y5AT 1RJXB 3VXEH 1OX1A 2ZU1A 3BTQE 1W13U 5BPEA 2A2QH 5PTPA 3HK6B 1QBOA 1V3XA 3K2UA 1ZHRA 3T29A 3L6PA 1LHCH 3F9HA 3NK8A 4MVNA 2J97A 3SU5A 2ZNKH 2EI8A 2FLBH 4X2WA 3BEIB 4ZCNA 1JRSA 1UCYH 1LPGB 3MMGA 5L2ZH 2F9UA 1DFPA 3GCNA 3PRBA 1WAYB 4DT7B 1SGYE 1E35B 1SR5C 2V35A 2VH6A 2W6JD 3SNEA 1O5DH 2ZDNA 3SU0A 3D23A 2WV4A 2AH4X 2H5DA 2IJD1 3L3TA 2BYAX 2JJ2D 2QF0A 2XC5A 1HAPH 4RKJB 3P95A 1XUIA 1DLKB 1FX0B 1YP9A 2WUBA 3TJVA 2FPZA 1W12U 1O2TA 1CT0E 3M3VA 4O9VA 1OWKA 4HFPB 2BY6X 4X8TH 8GCHG 1CSOE 1YPEH 4ABFA 3P70B 1UHBB 4ABHA 3GOVB 1CA0B 2XW9A 3AASA 3K6YA 4I8HA 5L2YH 4I8GA 1A61H 5GXPA 3ATMA 4YESB 3VGCC 3MTYA 1UK2A 4D8NA 1ABJH 1YF4A 2Z7FE 1DT2A 4GSOA 3AK5A 3PB1E 1FXYA 1KTTB 1O3HA 1QFKH 1YWUA 2RCEA 3C1KA 4Y10E 4XBCA 4K8YA 1VCWA 4D7GA 2PKSC 5A0CA 3P8OA 1FJSA 4OS1A 4X2YA 3OE7D 2AMQA 4AFUA 5BRRE 1UVUH 1P2JA 2Y82A 2DE9A 2ZFSA 3RXFA 4IN2A 1QTFA 1TABE 1Y5BT 1O5FH 1YBWA 1CA8B 2SGFE 3EE0B 2KM0A 2ZU4A 3ELAH 1IHSH 5DP7A 2RA0A 3BEFB 2I6QA 2G5NA 1RRKA 3E8LA 4VGCB 1GHAF 4PROA 2VH0A 3P8FA 4WWYA 3V12A 1V2TT 3E90B 2OC1A 1UMAH 4JMYA 1T7CA 3SV7A 3M5NA 1O5GH 1QNJA 1QL9A 3RXGA 4BTIB 3OSYA 3PLPA 5GCHG 6GCHG 5A8YA 3F2FA 1MKXK 1P9UA 5EIYA 1QIXB 1FI8A 1A5HA 4CH8B 3N99A 1QQUA 1O2MA 2TPIZ 5T3HA 1OPHB 1KLJH 1OWIA 1S6LA 5FPYA 7LPRA 1V2PT 2Z94A 1O0DH 3F2HA 4TPYA 2M5TA 2TBSA 1B5GH 1FZZA 1GHWH 2WYGA 4Y79A 1MCVA 1ELGA 1SGTA 1F5RA 2BXUH 3KYFA 3A8DA 2FOGA 2GV6A 1GHXH 4IS5A 1TWXB 2Y6TA 2GT7A 5AFZH 1O5CB 1X7AC 2SGQE 1THRH 2YMSD 1MKXH 1WOFA 5DP8A 4X8VH 5J4SA 1ELCA 1QJ1B 4FUFA 1EOLA 2ILNA 1QA7A 2GDEH 1Y59T 1MABB 2P8OC 1V6DA 2EQNA 2G55A 4BANB 1EPTA 1BHXF 2THFB 1TQ0B 2ANMH 2GZ8A 4CR5A 1RD3B 3S0NA 4ABBA 1MZAA 1TOMH 2PSYA 1S82A 4KELA 2L6OA 1MKWK 2KCOA 3K65B 3QTVH 4HGCA 2BD5A 3DSPA 4DVAU 1FPCH 3ATWA 5DP4A 2B0FA 2AYWA 2CGAA 5EU8A 1SLWB 1V2OT 3NPSA 3DT0H 2UUKB 3M5OA 3BTME 5KGOA 3MNCA 4RT1A 1UTNA 2GCHF 3BTFE 4NIWA 3SU6A 3GY6A 4X1PU 1GBAA 1MTUA 4XE4A 1PJPA 3OY5U 1OWJA 1CHOF 2HNTE 3N7DA 1O2OA 3SNDA 2UUYA 1YM0A 4MPXA 1QB6A 1QJ6B 2BTCE 1ZZZA 1NRRH 3P17H 5LPFA 2ZDKA 4JCNA 4IMQA 2AEIH 2Q6GA 2QF5A 3UY9A 3JZ2B 4GAWA 2F4LA 2WV9A 4B6EA 3A7WA 2GZ7A 5T6FA 3HGNA 4NZQA 3D62A 1UTJA 2G52A 3QGJA 4GHTA 2A5IA 4B2BA 1DANH 4FU8A 3IG6B 3SHCH 1DUEA 2AIPA 1NN6A 1O3PB 4Y7AA 1ESTA 1O5AB 3WW7A 2VINA 1GWAA 1N6XA 2BOHB 1C1QA 4O3UA 2B9LA 3GY8A 1JBUH 1NRPH 1SG8B 4AGKA 1P12E 4WXIA 3TITA 1QB9A 3SW2B 1BITA 4K1TA 1ZPCA 5DN6D 3SOSA 1Z8RA 1EAIA 1DLEA 5C0TA 3F1SB 4FUGA 1FY8E 1S5SA 1NROH 1VZQH 1CT4E 1Q2WA 4YT6H 1C2GA 1FPHH 1ZSKA 3ODDA 1FY1A 2FEQH 1AD8H 1K1IA 2XNDD 4R0IA 1YPJH 2FXRA 3P8GA 4ISLA 3RUOA 2ODPA 5EJZA 3EYDA 1K22H 1D3QB 3HK3B 1DICA 4Y7BA 4ZKOU 4MNWA 4LK4A 1Y3YA 3SJ8A 5C1XA 2VWLA 1LPKB 4UFFH 1C2EA 1SVPA 3OEHD 1O2WA 3MH4A 2UWOA 1O34A 4OGXA 4IMZA 4U2WA 4ZXYH 1UO6A 2V3OH 1KXEA 3MH5A 4HZHA 1PYTD 1W0ZU 3M7QA 2J5UA 2ASUB 2R0KA 2ZIQH 1E34B 4HTCH 1ETRH 2BX3A 4WH6A 4NA7A 1HCGA 3H7TA 3GICB 1GI8B 1KDQA 2XC4A 1GI0A 1HAHH 2O8LA 6ESTA 4A1VA 1FLEE 1S83A 3MO9A 5FL7D 1TRYA 2ZKSA 3TJNA 3U1JB 1XXFA 1VGCC 2G00A 3PV4A 3RXDA 2DE8A 4IC5A 2P94A 2BQWB 1GMCF 4E05H 3S7HB 3M37A 5F03A 2BMGB 2AMDA 1E1RD 1G3BA 4M7GA 1K1MA 3TU7H 4BTUB 1V2NT 1GBDA 1KXFA 4TY6A 1NU9A 4K5ZA 1DY8A 1IQEA 3ZV8A 1AE8H 1OYTH 2UUFB 1TNHA 1HAOH 2F9BH 1TPPA 1ETSH 3GYLB 2ZTXA 1NFYA 2NU2E 2ZO3H 6GCHF 2FOFA 2Y5HA 1AVXA 4Y0YE 3U8OH 4Y8XA 2GZ9A 1A1RA 1ELDE 2A7JA 5CDFE 5C1UA 2XCFA 2XNIA 1GG6B 2IPQX 2C8YB 2TIOA 1ELFA 4HI3A 3LONA 1C5PA 3GS9A 1JIMA 2R2MB 1TGBA 2FS8A 2BD9A 7KMEH 1GI7B 1TGSZ 2V7QD 3T2NA 1YYY1 5B6OA 1HRTH 1ZHMA 2VB0A 1O2UA 3ATIA 1PPHE 4XOJA 1AY6H 3MH6A 5A8ZA 1NFWA 2RDEA 2B5TB 3LKWA 4AYYB 3A7ZA 3WY8A 2VVVA 3RMLH 3SU1A 2GP9B 2PGQB 2HLDD 1SGPE 1TLDA 5CE1A 5E8EH 1C2LA 1LQDB 4NWKA 3A88A 5KECA 4ZMAH 2Z6BD 3RXKA 4JK5A 5FX6A 1GBLA 4P02A 5F8ZA 2ZF0H 3BIVH 1LHEH 2PHBA 2BDHA 2O8MA 1JRTA 3BTTE 3HKJB 3UNSA 1NM6A 1GBTA 1TX8A 2A1DB 2SGEE 2Z3CA 2QGRA 4TYDA 2FOAA 3OEED 1SGFG 4F48B 4XDEA 1S85A 3PROA 3UREA 1NBMD 3ZZAA 2PWXA 2CK3D 2FMJA 3IITA 4X6PA 1QBNA 2C8XB 3RMNH 2KFWA 4J2YB 2ZECA 3TH3H 4QT8C 4AFSA 4MDSA 1CGHA 3BG4B 3VFEA 2ZFTA 1EZXC 4MNVA 1P01A 1BTYA 3KQBA 1WU1A 4RI0A 1TGCA 5AHGH 4AOQA 1BOQA 1EJAA 1K9OE 1MU6B 1GJ4H 1OWEA 2A45B 2ZCHP 2OUAA 2H6MA 1O2HA 4ZROA 3TGKE 4YT7H 4UEHH 1XUJA 1C2DA 3DSOA 1LKAA 2FP7B 1AB9C 3BTKE 3QTOH 4AFZA 2ZHFH 5AF9H 4IGDA 3RXQA 1E0FD 1WSSH 1UVPA 4D9RA 2CMYA 2CF9H 1BUIA 2RFKC 1NZQH 1TX7A 1W0JD 2BVXH 1G2LA 1GI2A 2ESTE 2J34A 3QK1A 2GT8A 1P02A 8LPRA 4O03A 2JKHA 2GX4A 4K2YA 2VWNA 1UTOA 5GJ4B 1D3TB 3MU1A 3KQ5A 1T8NA 3LH1A 3QWCH 1F5KU 3M61U 5AVDA 1IQFA 1ESBA 3G01A 4KTCA 3SU3A 1VJAU 1O3EA 3F9FA 4AZ2B 1L1NA 2W26A 2BHGA 3TJUA 3MYWA 3PYHA 1EKBB 1ANDA 2BDBA 1LQEA 3LU9B 4SGAE 4ASHA 1ZHPA 1J8AA 4CHAB 1GBBA 4ACAA 1K1JA 1ZJDA 1CGJE 1ORFA 1AI8H 1Y3VA 2WSSD 1TNKA 1OWDA 1GL1A 3S69A 1C1MA 3F3BA 2XBYA 1DITH 2NU4E 2Z9JA 3ATLA 3VEQB 4MTBA 2K1QA 2G5VA 1SPJA 3GCTG 4YLUA 2OBQA 3LC5A 1ZMLA 1HAIH 7GCHG 1O3IA 1L1JA 2HNTF 5DPAA 3SBKA 3V3MA 4F49A 1F5LA 4ISNA 1GBIA 1SFQB 2TGAA 1N8OB 1SQTA 3F68H 1G9IE 4AB8A 1C9PA 1YKTA 3RXSA 1RS0A 3RXHA 2AERH 2FOHA 2FOBA 2FX6A 1HYLA 1CBWC 2QN5T 2P16A 2W7UA 1TMTH 5EOKA 1EAUA 3B9FH 1P3EA 4DY7B 4O3TA 1BRBE 3QUMP 4I7YH 3SNBA 1XVOA 1T4VH 1KXDA 1GMCG 1TX6A 3U1IB 2BDAA 2W6ID 4Q7YA 3I78A 1TIOA 1GVZA 1MTNC 1O2KA 1ANEA 4THNH 2ZGXH 2ZG0H 5LGOA 1Z6EA 3ODFA 1DWDH 3QGNB 5ETXA 5EPNA 3RU4E 5DP9A 1PPGE 1ZR0A 1HIAA 1C5WB 4X1QU 4AFQA 1CO7E 1GJ7B 1L4DA 3S9BA 3M5LA 3SN8A 3ITIA 2VBCA 2A32A 4UONA 3UWJH 1O2IA 1O3JA 4B1TA 2QXIA 1TE0A 1INCA 2W3KA 1QCPA 1GI3A 1GGDB 5LH8A 5TJXA 1CHGA 1ZSJA 2V6NA 3SI4H 4I8KA 1HJ8A 1GDUA 1XM1A 5GCHF 1TA2A 4GVUA 4KGAA 3PLBA 1EFRD 4B6FA 1BTUA 2QC2A 3RM0H 4ACBA 3DA9B 3UOPA 1AIXH 5T6DA 3RXOA 1WUNH 1O3DA 4B76A 1GBEA 2XBVA 2XBWA 1O3FA 1MTNB 1K28D 1MTVA 2QF4A 1H8HD 3SUDA 4YOJA 2SNWA 5JBTA
chains in the Genus database with same CATH topology
4Y8ZA 3VB3A 1O33A 2O8TA 1GI1A 1P2KA 3KGPA 2FOEA 3CP7A 1NU7B 2TGTA 7GCHF 4NWLA 1GG6C 3EA7A 3MU8A 1IQIA 2ANKH 3EA8A 3BIUH 1TOCB 3RXMA 4Y11E 1EZQA 1FIZA 1SQOA 5HXFA 1EQ9A 2D8WA 3MO3A 1FMGA 2C4FH 1AKSB 2W5EA 3ZZBA 2WV5A 4OS7A 1L4ZA 1P9SA 3U8TH 3KEEA 3TLOA 3GY3A 1EAXA 3TGIE 2H1UA 1DOJA 4NA8A 4CRGA 1GDQA 1A3BH 4LZ1H 1MQ6A 1XXDA 5HGGA 2VNTA 3TH2H 1BDAA 1P03A 3P8NA 1NRSH 4K3JA 1BCUH 4OGYA 3HGPA 2HPQH 3UQVA 2A7CA 3RXEA 2A4OA 1O2JA 2TGPZ 2BQ7B 2FZZA 3NZIA 4GCHG 2O8UA 3MHWU 2ZC9H 1HLTH 1TMBH 2Y7XA 4Y76A 5FCKA 4X2XA 1O32A 4H4FA 3AAUA 1TBZH 3S9AA 1TAWA 1TNLA 1MUEB 3M3TA 3RXUA 4X6OA 1YCPK 1QURH 2KAIB 3V0XA 4A1TA 1WTGH 4BNRA 2PGBB 3UIRA 2C3SA 1ZRKA 1YPGH 1YPLH 4X1SU 1O2SA 1ANBA 1V2QT 2IOTA 1XMNB 3MU5A 1FY3A 5A2MH 1MQ5A 1EATA 1IQHA 1HBTH 1MCTA 2ZFFH 2EEKA 3U98H 3RXBA 1O2QA 3VGCB 1V2UT 1PQAA 3S9CA 2UWLA 2ZHEH 1O2PA 1LTOA 2R2WU 3RXCA 2TGDA 2G51A 4TY7A 3GISB 1F0UA 4FUDA 2QF3A 1G36A 1XX9A 1H4WA 1C9TA 1H9IE 2VWMA 1BHXB 1F0TA 2ZDAH 3MWIU 2IN2A 1HNEE 1D3PB 2CF8H 3SZNA 2KAIA 1KDQB 1GDNA 3BV9B 3IWMA 3KQCA 3KHVA 3O8BA 4KTSA 4J1YA 1C2MA 1C5QA 3ZV9A 4D76A 2ZHWH 1BMNH 5A0BA 2FI3E 3GDVA 1W14U 3FZZA 2BDYA 1WQSA 1W3CA 3S7KB 2H9TH 1P2QA 2XC0A 1ZTLA 4IN1A 4DOQA 1C5TA 4WH8A 1F7ZA 2R3YA 2WPMS 4LXBH 2BD3A 3UNQA 2GGVB 2ZDLA 3HKIB 1NESE 2B7DH 1VITF 3EGKH 4K60A 1QY6A 2OQ5A 1O2XA 4Q7ZA 3SU2A 2UUJB 4JYUH 4OS6A 4RN6A 1XUHA 1QHRB 2P59A 3KQEA 1MZDA 5C1YA 1T8OA 1ZOMA 1V2ST 2VIQA 4INKA 1Q31A 1EXFA 4U32A 4JK6A 4UFDH 1C1UH 2A2XH 4MPUA 4UD9H 2OTVA 1S0RA 3BSQA 1SLVB 2P3TB 1A46H 2H5CA 1UTLM 4SGBE 3MOCA 1FAXA 1K1NA 1GI6A 2D26C 3Q76A 3ZVAA 1JXPA 1HAVB 2OXSA 2OINA 1G3EA 4ISOA 1C5XB 3P92A 1OWHA 2PFEA 3SQEE 4CRAA 1SMFE 2BD4A 2D2DA 2ZFQH 3A7VA 1SOZA 1ACBE 1WCZA 1C5LH 1NT1A 2R3UA 2AIQA 2AFQB 3RXJA 2OP9A 1BRAA 1XVMA 5FBEA 3RU4T 4YO9A 4ZHLU 1ZJKA 1A5IA 1OP8A 3BN9A 4D7FA 1K1OA 1YPHE 1JWTA 3SI3H 3BTDE 1PPZA 3RXPA 3KCGH 3B23B 1O3GA 2ANYA 2O8WA 3A86A 5C5OA 3O8DA 1LKBA 1VCPA 2BY7X 1SC8U 1GJAB 5EQRA 2FOCA 3M36A 1FN8A 1NO9H 1DSTA 2GTBA 5FX5A 2SGPE 4A92A 3M5MA 2XBXA 1GHYH 3R3GB 4CREA 1BT7A 2LNCA 1GVKB 1SHHB 2JETB 3NUMA 3E0PB 5EGMA 4RSPA 1ZRBA 2VU8E 3ZYDA 1FUJA 4A7IB 2NWNA 3F6UH 2ZA5A 5L6NH 5TCAA 4JZEH 5EQSA 3PWBA 2GV7A 3BF6H 1A4WH 1SB1H 2PUQH 3TNTA 1RXPA 1SHYA 1TPAE 1ZMNA 3SNCA 2VVCA 3D65E 5DK1A 1SGIB 1TBQH 1KLTA 1O3OA 3FANA 2Y5GA 4BXWA 1SGCA 2BLWA 1AKSA 2VIVA 1O2GH 2VGCB 1GMDF 4OS5A 1UK4A 4X1RU 5F8TA 3A85A 3GY5A 4FXGH 5E0JA 1C5VA 2VIWA 4UFEH 1MKWH 4FUJA 1OP2A 4DCDA 1A2CH 1GJ9B 3W94A 1W8BH 1YLDA 2QCYA 2WPIS 2BXTH 2AS9A 1EB1H 2H9EH 3GY7A 2FIRH 1V2KT 2SNVA 1O3KA 3FP7E 1PQ5A 3HATH 3SUGA 1O39A 4KP0A 4VGCC 2F83A 4ISHH 4NZLA 3DUXH 2ZPQA 1GMHF 5A09A 5GWZA 3A8CA 1OS8A 3MO6A 3RLYH 1O3NA 1C4Y2 4XFQA 3TVJB 3C27B 3E0NB 4A6LA 1RIWB 3SJIA 1BRUP 2A4QA 4MLFB 1DY9A 3RXAA 4WY3A 1IHTH 3PO1C 1FDPA 4NSVA 1IQNA 1PPFE 2OQUA 2GCTB 1F0RA 2WINI 5CMXH 1O3MA 1BJVA 1RIWC 4TWWA 5JB8S 2SFAA 1AZ8A 1ZPZA 2EI7A 1V2MT 3PO1B 1UTQA 3UQOA 1DWEH 3UR9A 2BVRH 4AG2A 1P2IA 1ELBA 4K1EA 4E06H 5EODA 4Y8YA 1TALA 1A5GH 3AAVA 1ZLRA 4DURA 2ZTZA 5FXLA 2BOKA 2OBOA 3LGTA 1O30A 1Z8IB 2ZDMA 1NC6A 1G3DA 1GI9B 2YOLA 4FU9A 5GPIB 4I8LA 1GCDA 3NCLA 1HAYB 2XTTB 1VITH 3GY2A 4MQAA 3E16B 3BEUA 1BRCE 4CRDA 5J4QA 4ZH8A 1IQLA 2BLVA 4GLYA 4I33A 4ESTE 4B74A 1DWBH 1SSXA 2B8OH 4Y71A 2PR3A 2P3UB 1AFEH 5F6MA 1DVAH 2OC8A 1ZYOA 4H42U 4AGJA 2VIDA 4X1NU 4Q80A 3ZVBA 1P8VC 2C8WB 1PYTC 5CHAB 2ALVA 2G4TA 1TNIA 2ANWA 4BAQB 1V2VT 2XCNA 1C5SA 1AE5A 4AX9H 4KKDA 2GCHG 2XRCA 4B71A 5C20A 3HPTB 5IDKA 1MD7A 4YLQH 1UVOA 1Z1JA 2WPKS 2ZEBA 2AGEX 3BTGE 3QLPH 3LJJA 1O2VA 1P57B 3V13A 1LHFH 5E2OA 1O3AA 3A8BA 5E0HA 1P05A 2BVSH 5GIBA 1ARCA 1EX3A 1GHZA 4FU7A 2Z9KA 1T32A 4CHAC 3PMBB 2ZTYA 3VB7A 3M3SA 1J9CH 2G81E 3BTEE 1F2SE 3UNRA 1ID5H 1Z1IA 4FUBA 3CENA 1KSNA 1DWCH 1AHTH 2ALPA 1EUFA 2I6SA 4LZ4B 2BD8A 1C2FA 3UWIA 1GBFA 3UPEA 4ZKSU 1G2MA 1AUTC 2FTMA 1ZSLA 3TIUA 3F9GA 1QBVH 2BDCA 1LDTT 3I29A 2V0BA 4U30A 3TGJE 1RGQA 1C1OA 1MU8B 2Y7ZA 1O2NA 1C1NA 2ZGBH 2OLGA 2JETC 2Z3EA 1QRWA 3PMAB 3RXVA 1C5RA 1FIWA 1C5MD 4NIYA 4Q2KA 1RTLA 1U6QA 2GMTB 2C93B 1S81A 3I77A 3FP6E 2BLQA 2VIOA 1DXPA 2ZCLP 4FVBA 1MTWA 5ESBA 3BG4C 1EAWA 1A0LA 1J17T 2XWBI 1Z71A 1Q3XA 3EA9A 3BTHE 4B73A 1QA0A 1K21H 3JZ1B 2V3HH 1GVLA 1L0ZA 1NS3A 5L30H 1C5NH 4ZKNU 2EA3A 4ZHAA 4X6MA 2Z9IA 4B2AA 3U8RH 1AB9B 4CH2B 1C4V2 2XWAA 4XBBA 1E38B 4I8JA 3UUZA 1UK3A 2AMPA 2GDDA 1D4PB 3E3TA 1IQKA 3ZZ6A 1T31A 1CA0C 1IQJA 3ZZ7A 2YNAA 1TPOA 4YZUA 1AVWA 1O5BB 4ZXXH 1Z6JH 1FV9A 1GGDC 1C5ZB 1SOTA 2Q6DA 2ZGHA 2RG3A 2D1JA 1CGIE 1P06A 1LVMA 1TPSA 1HXEH 1E37B 3LC3A 2Y5FA 3ZZ4A 3GY4A 4FUIA 1SLXB 1HAVA 2Z3DA 3NKKA 1GHBG 4CR9A 3RDZA 1K1PA 2PV9B 5TCCA 1SGNE 1ELVA 4DIHH 1C1SA 2Q1JA 2WUCA 1BA8B 1LMWB 4I31A 4K1SA 2GMTC 2BX4A 1H1BA 1V2RT 1HAZB 1TRNA 3TK9A 2STBE 1O2LA 1UVTH 1KXCA 2ZHDA 3D49H 1GJCB 3EQ0H 2H2ZA 5DGJA 2OC7A 5HMAA 2HVXA 3H5CB 3QZQA 4YM9A 3A87A 4X8UH 3SV6A 3FZDA 2F9VA 1MMJN 5EXLA 1AQ7A 2A5AA 2FOMB 3A8AA 1XUFA 5HYOA 4MNXA 1Y3XA 2P8OB 4H6SB 4JYVH 3OX7U 4X8SH 3F9EA 3LOXA 2Y80A 5DO4H 1YC0A 1DSUA 1XKAC 4WF8A 2Q6FA 1NY22 1S6FA 1TB6H 1CT2E 1P2MA 1AGJA 2J92A 2RDLA 3EDXB 5A0AE 3VPKA 2CXVA 4DGJA 1LVYA 4XBDA 2QXHA 1TGNA 2A5KA 4K69A 1ELEE 3RU4D 1OP0A 1DS2E 4MPVA 1A3EH 4NSYA 4WXVA 1C4U2 5HM2A 1ESAA 5DP5A 2FS9A 1P04A 2BY8X 4A5TS 3FFGA 1YCPM 4BAKB 4DG4A 4NG9H 4BOHA 1XUKA 3E1XB 3RXLA 4UFGH 3MNXA 4ABEA 3E91A 1ARBA 1DXWA 1AZZA 3MH7A 3TNSA 5A8XA 1HGTH 3W95A 3T28A 1GCTC 3U9AH 5SGAE 1AMHA 1MD8A 3AVZA 3CS7A 3OY6U 4D9QA 2FI4E 1GI4A 3QO6A 4WMDA 1FN6A 4YOIA 1GCTB 2BM2A 1FY4A 4BAHB 1A0JA 2OD3B 3SU4A 1BMAA 3LDXH 1Z8GA 1GJ6A 1HUTH 2PKAB 4GCHF 1SGRE 3AW0A 2W3IA 4X6NA 1N8OC 2ZI2H 4YOGA 7ESTE 1HB0B 4Q7XA 1HJAC 3ZVDA 4BXSA 1BBRK 2G4UA 1T8MA 3A84A 3EAJA 5EPYA 5F8XA 2H9HA 1ELAA 2JH0D 3TPIZ 1FNIA 1BBRH 5GDSH 3M7TA 1EPTB 1IAUA 5FPTA 1ZTKA 3FVFB 1QRXA 2GVFA 2J4IA 1P2OA 2Z9GA 3ESTA 4ABAA 5K0HA 1BTHH 1GJ8B 2J38A 3GDSA 3A82A 1JIRA 1G30B 5DG6A 1O2RA 2ZPSA 3DD2H 3LGYA 2F9OA 5LPRA 2FM2A 2F91A 1AWFH 2J95A 1AFQC 2SGDE 1E36B 3K9XB 3LGVA 5H4IB 3KNXA 2ZU2A 5DP3A 1O5EH 4F4OC 2BY9X 5C67A 4INLA 1DPOA 2ODQA 5C5NA 1K1LA 3PTNA 1S6HA 1V2WT 1AO5A 1V2JT 4OS4A 5AFYH 3TH4H 1EP5A 1VCQA 2C90B 3R0FA 3MFJA 1C2JA 5FBIA 1Y3UA 4WMFA 1MBQA 2PLXA 1TGTA 1O3CA 4CBNA 2EI6A 4AB9A 3RMOH 3UOUA 4UDWH 5JBCS 1IQMA 2ZCKP 5ABWA 1WV7H 4DIIH 3KIDU 1WYKA 1Z8JB 1MTSA 2R0LA 3RLWH 2NU3E 1TNJA 2ZGCA 1UJ1A 3O8CA 1HDTH 3TK6A 2OCVB 2WYJA 4WJG2 3ATKA 4MG3A 1YPMH 3V7TA 1HAXB 3PWCA 3SORA 1MH0A 5K7RA 4WMEA 2PW8H 3SV8A 1OXGA 2FLRH 1TRMA 2PTCE 3H7OA 4IC6A 3LGUA 1QGFA 2XXLA 6CHAC 3SHAH 2A4RA 2NU1E 4GPGA 1SGDE 3SGQE 1B0FA 3ZZ3A 5C2ZA 1ANCA 2QIQA 2CHAB 4WVPE 1ZGIA 1BTXA 2FO9A 1FQ3A 4CRCA 3SV9A 1H8DH 4ABGA 3Q3YA 2J94A 3GYMA 1GMDG 3GCOA 3U69H 5EG4A 3CS0A 1QR3E 1NPMA 1GMHG 4ZAEA 4B75A 1TQ7B 1BIOA 1BTZA 3LJOA 1O37A 4Y6DA 2WPHS 2VGCC 2HLCA 1O3BA 3Q00A 1ZTJA 4JZ1A 1RFNA 3RC6A 5FCRA 3A7YA 4A1XA 5JDUB 2ZQ2A 3ZZCA 1P11E 2BDIA 1GBHA 2FESH 3ZVGA 1LVBA 1FONA 2FWWA 1L1GA 4Y0ZE 3T62A 3SO3A 1KYNA 3A83A 1YCPH 3GDUA 4RKOB 8ESTE 4FUHA 1QL7A 3QN7A 4ZKRU 4CBOA 1TNGA 1TBRH 3UFAA 3RXRA 3ZZ8A 1L2EA 1NFXA 1KXBA 2ZZUH 3RC5A 1BTWA 4MNYA 1LCYA 1H9HE 3MU4A 3Q3XA 3MNBA 3A89A 2F3CE 6CHAB 1SFIA 1W11U 5FAHA 2YNBA 1VJ9U 5JB9S 2BD2A 2O9QA 3LH3A 3BG8A 2HNTC 5C3NA 1PQ8A 3SV2H 1J14A 1HAGE 1VGCB 2F9NA 2HWLB 2VJ1A 3K6ZA 1Y3WA 1BJUA 1C5OH 1W7GH 1O3LA 5JBAS 3T5FH 5I25A 1GPZA 1LHGH 3ZZ9A 1G37A 1PPEE 4E7RG 1XKBC 1WTHD 1HPGA 1EB2A 9LPRA 2G8TA 3KF2A 3SJKA 1SGQE 4MPWA 2FX4A 1TA6A 2ZQ1A 2P93A 1MAYA 2HRVA 4KTUA 3URCA 1YPHC 1UTPA 1B7XB 2Y81A 1AFQB 3SUFA 4ABDA 1N1LA 5E0GA 1C5UA 1FY5A 1GHAG 2QA9E 1EOJA 3QX5H 2ULLA 2GKVE 2BD7A 2ZU3A 4FUCA 4XSKU 1GJBB 3TK5A 1CVWH 2ZP0H 5EW2H 3LGIA 4ABJA 5G4BA 1EZUC 3KL6A 2FYQA 1KTSB 1AWHB 1NRNH 5DKMA 1AUJA 3DFLA 4E7NA 3M7UA 1ZMJA 3MU0A 3O8RA 1S0QA 3ZZ5A 4NA9H 4IW4E 3L33A 3OTJE 5ESTE 1AN1E 1A0HB 3T25A 1C5YB 1MBMA 1QRZA 5JPMH 1EPTC 4ABIA 3ZVCA 1JMOH 1PPCE 1GHBF 4Z6AH 2FTLE 4BTTB 1J15A 5JBBS 1DDJA 1FAKH 3LIWA 1NFUA </