1UJ1A

Crystal structure of sars coronavirus main proteinase (3clpro)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
301
structure length
301
Chain Sequence
FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3C-like proteinase
publication title The crystal structures of severe acute respiratory syndrome virus main protease and its complex with an inhibitor
pubmed doi rcsb
source organism Sars coronavirus
total genus 85
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 1uj1A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1uj1A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1uj1A02
3TJUA 2O8TA 1NRNH 2FWWA 4BANB 2VIVA 1UTMA 1TGCA 4KTCA 3A7XA 3ZVCA 2FO9A 4ZKOU 2DE8A 3SNDA 3KHVA 3RXHA 3A80A 3MNBA 1ANEA 1CHOG 8GCHF 1SLWB 1GBTA 1GGDC 3DFLA 2AMDA 1NM6A 3PMHB 2NU3E 2BDHA 3SNAA 1GGDB 1W2KH 5EW2H 5G4BA 3P70B 1DWBH 2VH0A 3E8LA 3KQBA 1QRWA 1S83A 5JYIA 1FI8A 3PM3A 1O3NA 1LKAA 5EQSA 2BQ6B 3ELAH 3SU6A 1DANH 4K60A 2V0BA 1FNIA 1F92A 1HV7A 1YKTA 1EASA 5LPEA 4I32A 3BTGE 1OP0A 3ATMA 3T62A 2UUJB 3M5NA 4I8LA 4CBNA 3EYDA 1JIRA 1ANCA 2OC8A 1MTNC 1NRRH 3ENSB 1SB1H 1THPB 3VXFH 1C4V2 2G00A 4A6LA 2ZTXA 4UD9H 2BX4A 1ABJH 3MTYA 1MTNB 3UPEA 1F0SA 3QGNB 5C2ZA 4MPVA 1O3OA 1S81A 2VH6A 4LZ1H 2XBYA 1O2QA 4FUBA 4CHAC 1DXPA 4Z6AH 1TWXB 1O33A 1SSXA 3KQDA 4ABJA 5DK1A 2D2DA 1OXGA 4CHAB 3SOSA 3O8CA 4TY6A 1OYQA 4MG3A 2BY9X 5FCRA 1C2JA 3PROA 3TVJB 1O2TA 4ZKRU 3C1KA 3RXQA 5FCKA 4CRAA 3KGPA 1UCYK 3OSYA 2H5CA 2ULLA 2GZ7A 3ZVFA 3TH3H 1C2HA 5EQRA 1QB1A 3BN9A 3MI4A 3GY7A 2A45B 1FONA 1MU8B 1P2KA 3STJA 1UTJA 4ABBA 1TRYA 1S82A 1VCPA 2GCTC 2P8OC 3URDA 3UOUA 4PROA 1SGIB 1S84A 2CF8H 5GCHF 3TJOA 2GCTB 2P8OB 2PTCE 1LTOA 1MKXK 2P94A 4KP0A 2Q6DA 2BVRH 1V2VT 1B5GH 1KIGH 1MBMA 4U32A 2ZC9H 2PSXA 5LH8A 2ZFRH 2Y80A 3L33A 1H9HE 2AIQA 2JETC 4Y8XA 5J4QA 1KXCA 3M3TA 4X0WU 1QL7A 2JETB 4X8UH 4NSVA 1UTOA 2O8LA 2W26A 1OWKA 3UOPA 1GJ9B 1NFWA 1QFKH 1CT0E 1UO6A 4BTIB 1BB0B 1BBRH 3RXOA 5DO4H 2W5EA 1BIOA 2ZNKH 4SGBE 1VITG 3V0XA 3ZZ5A 3RC4A 4GCHF 4MVNA 3DHKH 1LHFH 1MU6B 1MD7A 2ZDLA 2VIQA 1C1MA 4NA7A 1K1NA 3F9EA 4ZUHA 4INHA 8KME2 2C8YB 3UY9A 4O3UA 4THNH 4B71A 1ETTH 2F9NA 3P95A 2F91A 2ANKH 4D76A 1V6DA 3FP6E 4TY7A 5AFZH 1GHYH 2D8WA 1TPSA 4K2YA 4LK4A 1CHGA 1SQOA 2OC7A 1ID5H 5FBIA 2FS9A 3MWIU 4WXIA 1WQSA 4B74A 2AIPA 1YPJH 1J14A 3F6UH 4MLFB 1K1PA 5K7RA 1OPHB 1MTSA 1O2NA 2F3CE 3IWMA 2FOFA 1O37A 2Q1JA 3M5OA 3A8DA 1V2ST 3BIVH 3E0NB 4HTCH 2A2XH 1YC0A 1NZQH 3TLOA 4B2CA 1S6HA 3EGKH 1UK2A 2C90B 2R3YA 7GCHG 2FZZA 2FI4E 1C9PA 2W3IA 3RXAA 1O3IA 4AG1A 4YZUA 3S9BA 2ZECA 4DW2U 1ELBA 3F9FA 3BEUA 1WV7H 1T4VH 5EW1H 1O2MA 1GJ6A 4ZKNU 4ISOA 1P57B 2GKVE 4NWLA 1QBVH 3BG4C 4Y7AA 4NCYA 1DLKB 2ZGCA 3RP2A 4A1TA 1P9UA 1F0TA 3BG4B 3LGVA 2BOKA 1UMAH 3K2UA 4D9QA 1ETSH 2Z94A 2A31A 4NFEA 3SGBE 1SGTA 1C2LA 1EAUA 3VB4A 1G3DA 2YOLA 3F1SB 1ANDA 4CRCA 1G30B 4NZQA 1SFIA 4X1PU 1L0ZA 1P03A 2QA9E 3RMNH 4BTTB 1OS8A 1HIAB 3STIA 1Z71A 2QY0B 1O2LA 2Y5GA 1YPEH 3SO3A 1A46H 3GY3A 1TBRH 5A0CA 1ESAA 1FXYA 2OUAA 1O5CB 2ODYB 1EOJA 1LPKB 5BPEA 4I8GA 1O3AA 3P6ZB 4K3JA 1EAWA 1SG8B 2ZPRA 4Z0KA 2FOAA 1G36A 1PYTD 2PTNA 1Q31A 2CJIA 5EXMA 1Y5BT 2VVCA 1CBWC 4XSKU 3A84A 1AN1E 4INLA 1TLDA 1GHAF 3GY2A 4AGKA 1CBWB 1HAYB 3ESTA 3LU9B 1PQAA 1C2GA 1NFUA 1BMAA 2J9NA 4FUIA 2XTTB 1GBHA 1E36B 4IGDA 4X1SU 1GJ4H 3MU5A 3UR9A 4IN2A 3SU0A 3A87A 5DP5A 1TB6H 4K69A 4K8BA 1DX5M 1C5VA 1CVWH 1ELGA 1CU1A 1K22H 3LPRA 1QCPA 3VEQB 1H1BA 1ZRKA 2BDBA 3EA7A 2PR3A 1BITA 3Q3XA 1BTXA 1EJMA 1G2MA 1YLCA 3I77A 4B2AA 3UQVA 2BYAX 1A0JA 3TGIE 1FPHH 4A1VA 1TPAE 1NPMA 3U8OH 1MZAA 4BAQB 3SV2H 1C2EA 3MU4A 1TNJA 1ZPZA 5DP7A 1FMGA 3SNEA 1YCPH 1W14U 3RXDA 5DGJA 5SGAE 2HALA 1VJAU 2ALPA 5DG6A 3PO1C 2P95A 1GVKB 2XW9A 1P06A 4WWYA 3E3TA 2G81E 3PO1B 3ITIA 1C1SA 2ZPQA 3MO9A 1BTYA 2VIOA 3A7TA 4MPWA 3RXBA 2ZCHP 1BTWA 1CGIE 1BJVA 1DUEA 1OWIA 4MPXA 1GBEA 5L30H 3LGYA 1FPCH 3EA9A 1O5BB 1BTHH 1O2VA 3RXLA 3HKJB 3UR6A 1ZTJA 4Q7YA 2OQUA 3GCTG 5A0AE 3VFEA 3GY5A 2W7SA 5EU8A 5BRRE 1K9OE 2LIZA 1QIXB 1GDUA 2GP9B 2KAIA 1TQ0B 1C2KA 1F5KU 1GJBB 4X6NA 1QHRB 4AZ2B 3EA8A 1QQUA 3Q3YA 4E7NA 1OP8A 4HFPB 1C5OH 1QA0A 4BAOB 3MH7A 1EZSC 1FY4A 4WXVA 4A1XA 1P2MA 2FX6A 5L6NH 1SLVB 3GCNA 4DJZB 4I8KA 3HGPA 3ATKA 1JIMA 4OS6A 1GHXH 4UDWH 3BTTE 5B6OA 1EZUC 2F9BH 2CF9H 1BTZA 2GT7A 2RDLA 3DFJA 1UK3A 3NWUA 1SGNE 1Y59T 3HATH 5JBTA 1ORFA 4ISLA 5FHTA 1DT2A 1AO5A 1NRPH 3SUGA 2FMJA 3AW0A 3KEEA 1AUJA 1O2XA 5E0HA 2QCYA 1PQ5A 3HK3B 1TRNA 1CGHA 3ZZAA 4RSPA 2ODPA 1YPMH 3MH5A 2BM2A 2XC4A 4AGJA 1GWAA 1V2QT 3QWCH 3ZZ6A 5CMXH 1BHXF 2V3OH 4Y0YE 2XBVA 1IHTH 1L2EA 1BRAA 3MOCA 1EP5A 1NU7B 2HRVA 1RTFB 1Z6EA 2WV5A 1H9LB 3GY4A 3M61U 1GHBG 1AB9C 3JZ1B 3D65E 2PHBA 2Z3CA 1C2DA 1T31A 1OWHA 1W8BH 1AB9B 3B23B 1PJPA 2FOCA 3TH2H 1EATA 2FX4A 1C2FA 2J94A 3JZ2B 3M7TA 2ZQ1A 4HGCA 3ZZ7A 4I31A 2PGQB 2FLRH 3K6YA 1UVOA 3OX7U 4MNYA 5EOKA 1FN8A 1F5LA 3DT0H 2P93A 1XXDA 1FN6A 4B73A 1DM4B 1TNGA 1DXWA 1EB1H 1DWCH 1D6RA 2JH0D 5HM2A 8ESTE 5T6DA 3TJNA 1HAOH 1OP2A 3PLPA 2DUCA 3SJ9A 5A2MH 3E91A 1Y3WA 4BAMB 4H42U 2ZU2A 1BRCE 4IW4E 4NA9H 1P2QA 4O3TA 2B8OH 1QGFA 4MNWA 1AFQC 2A4RA 1G3EA 1FIZA 2UUFB 1TRMA 2QYIA 1X7AC 1AFQB 5IYTA 4JYTA 2BVSH 4NIVA 4NZLA 1NFYA 3ZZCA 1TGNA 3T29A 2H1UA 1NS3A 2V3HH 1GHVH 1O2OA 1CO7E 3PWCA 1SI5H 3MU1A 2BOHB 1ZTKA 4I33A 1KLTA 1HCGA 2PUQH 3V3MA 1T8OA 3NPSA 2JKHA 1QURH 2A5IA 2PKAB 4Q7XA 1PPBH 2ZHQH 2EC9H 3VB7A 1KXBA 1MAXA 4YT6H 1C1VH 3AAUA 2R2MB 2Y7ZA 2Z9KA 1DDJA 1MQ5A 3P8OA 1QB6A 5I46H 1GJ8B 1GPZA 3SQEE 2NU0E 1C1WH 1LHCH 2A4QA 3LC3A 2OC1A 4XBBA 5FPTA 3PB1E 2CGAA 2Q6GA 1KXDA 1K1IA 1F2SE 1GI3A 2CHAC 1L4ZA 1DLEA 1EZXC 1O2JA 2STAE 2VVUA 1S0RA 4O9VA 3NCLA 3R3GB 4JYVH 1N8OC 2CHAB 1PPEE 1SBWA 1PQ8A 3E0PB 4UEHH 1HAHH 1JWTA 2QXJA 2B7DH 1N8OB 4ZROA 4AB8A 4FUFA 1MH0A 1AVWA 1YCPM 1CT4E 1O3LA 5F8XA 1SMFE 2GX4A 3SGAE 5HM9A 4JZFH 2FOEA 3ZZ8A 1TX6A 3D62A 3MO6A 2QGRA 2R0KA 1EB2A 1V2OT 3BTFE 1QY6A 5H4IB 3QX5H 3SBKA 2LNCA 1CT2E 4OS4A 3BIUH 2HGTH 2ZDVH 1EPTC 1W3CA 1TMTH 1TNKA 5JBCS 3RU4E 4KKDA 3P8GA 1AU8A 1IHSH 2ZHWH 5F6MA 4FU8A 3TNSA 1EPTB 2AMQA 5HMAA 2FS8A 1BRBE 2M5TA 1AZZA 1P3CA 4JMYA 1KDQB 4O97A 4MNXA 3EDXB 1QA7A 2XXLA 1G9IE 1GCTC 4JK6A 5C3NA 4BAHB 3GCHC 1TOMH 2FDAA 3KL6A 1PPFE 4F49A 2SGEE 1GCTB 1O3KA 3GCHB 5T6GA 3LIWA 4Y76A 1O3GA 1YM0A 2GGVB 3SHCH 3UREA 7KMEH 5EODA 1GI6A 1AGJA 1ZZZA 1AMHA 3SU3A 4AX9H 1ZJKA 5A8YA 3SJKA 2I6SA 3RXMA 2IOTA 1C1RA 3LGWA 1RFNA 1ACBE 1O2HA 3VXEH 1SGRE 1A1RA 3RXTA 1TALA 3VPKA 3QTOH 1UVUH 2A5AA 2I6QA 1DWEH 1ZPCA 1CHOF 2BD2A 2BB4A 1O3FA 5EG4A 3TK9A 1GBAA 5LPFA 1GI2A 1YLDA 1HAIH 1UHBB 3PWBA 2H5DA 2ZCLP 4NIWA 4OS1A 4GSOA 5DP8A 2J95A 1UVSH 2P3TB 1SGDE 1O3EA 4JCNA 3FAOA 1P9SA 1YGCH 1YPKH 2PLXA 4ASHA 1PPGE 2ZGXH 4BXWA 4CRFA 2Q6FA 3SV6A 3A8AA 2P3UB 3ZZ4A 1D3PB 1D9IA 3AW1A 1NU9A 4FVDA 5C1YA 1Z1JA 5HXFA 2FPZA 2BD3A 2BVXH 2TGPZ 3ZVAA 1IQIA 2XC5A 1K1JA 1HJ9A 1AE8H 1DOJA 3D49H 3GDSA 4WVPE 5GJ4B 2VB0A 4WH6A 1N1LA 2CXVA 3VB5A 4NFFA 2XYAA 2GZ9A 1ZMNA 3K6ZA 2IJOB 3ODDA 1KTTB 4JZ1A 1LVYA 3U1IB 1INCA 3NK8A 2QF0A 2V35A 2BY7X 1EUFA 2H9EH 3GICB 3M5MA 4R0IA 3Q00A 4LXBH 3T26A 1SVPA 2ZQ2A 1THRH 3RC5A 3RXSA 1HRTH 2CV3A 2OXSA 4DG4A 2EEKA 3M5LA 1C9TA 3GDUA 3P8FA 2UUKB 3HK6B 5DP9A 3LJOA 3FZZA 2SGPE 1LVBA 3I29A 4KGAA 1Q2WA 2QF3A 5DP3A 2WYJA 4AORA 2BLWA 2BTCE 2G4UA 4MPUA 3A88A 4X6PA 7ESTE 3NXPA 1NY22 3M7UA 1FY8E 3B8JA 2PGBB 1HAGE 1QBOA 1VCQA 4WF8A 2STBE 1O2KA 2XNIA 2ZDKA 2H9TH 2VIPA 1O3PB 1S5SA 2D1JA 1FY3A 2P16A 4JZDH 4AYYB 1L1NA 1SGEE 1QJ6B 3M35A 3RXVA 1GJ5H 2FXRA 3UWIA 4Y79A 1BMMH 3P92A 1IQHA 1VITF 5FAHA 4H6TA 3MU0A 4KTSA 1NESE 2QV1A 2TBSA 5DPAA 2EI7A 4CRBA 3E1XB 1THSH 1AWHB 1LCYA 1VITH 2NU4E 1S6FA 2RA0A 3W95A 1Z7KA 2ZFFH 4A92A 2SGDE 1J16A 1WU1A 3A8BA 1GBJA 3ZZDA 1TFXA 1P2NA 1TA2A 2ANYA 1C5QA 1HJAC 1BOQA 1JOUB 1U6QA 2VIDA 1F5RA 1BBRK 4HZHA 3RLYH 3RXKA 1ESTA 9LPRA 2A0QB 4XFQA 1HJAB 5DJ7A 1E35B 3O8BA 4UFEH 1GMHG 1LPZB 1V2TT 3U8TH 2PFEA 1T7CA 1CGJE 4IC5A 3SGQE 3SJOA 3PMJA 2OTVA 3NZIA 5ESBA 4FUCA 1V2MT 1XUFA 1TIOA 1D3DB 1Y8TA 2QXGA 1TQ7B 5FBEA 1GMHF 2QXHA 3C27B 3LH1A 7GCHF 5A0BA 1GHZA 1C1UH 1N6XA 1V2KT 4OS2A 3RXCA 3MNSA 1ZSJA 3T25A 2UWLA 1DITH 3TJVA 5EGMA 3U9AH 2A1DB 2HVXA 4BOHA 1LQEA 3BG8A 3RLWH 4RKOB 4RN6A 2WPLS 3MO3A 4I7YH 1MCTA 1YPGH 4X2YA 1G32B 1QRZA 3NUMA 4ZH8A 3CENA 1O31A 4LZ4B 3EQ0H 2J2UA 2PV9B 2FIRH 4OS7A 3RMMH 2A5KA 4FUJA 3BV9B 2BY6X 2BD8A 3BEFB 1HGTH 1ZHMA 2FESH 1XUKA 3E90B 1KTSB 1FQ3A 1Q3XA 3FP7E 1IQEA 4YO9A 1T8NA 1A61H 4X8SH 4UFGH 2WPKS 1MD8A 4ABFA 5PTPA 1DSUA 1LQDB 2PSYA 4DCDA 1SFQB 2GCHG 5E2OA 1XKBC 2OBOA 4A7IB 3H5CB 1P0SH 1KSNA 5JB9S 1O5EH 1GBDA 1TBZH 3QDZB 4H6SB 2OCVB 1S0QA 3S7KB 3Q77A 1BMNH 1SLUB 4YOJA 4ZXYH 1SQTA 4LOYH 4Y8ZA 3UTUH 1C4Y2 1ELCA 1EKBB 1FAKH 4FUDA 7LPRA 1L1JA 1LKBA 2F9OA 1RRKA 1O38A 1FZZA 4ZHMU 4ABDA 3BF6H 1XMNB 3N7OA 3ZZBA 5ETXA 4GPGA 4CR5A 3UQOA 2ZHDA 4YOGA 4Q7ZA 1RTKA 1C5TA 2PW8H 4K5ZA 2BMGB 2G51A 1LMWB 1ZJDA 2O9QA 3K65B 4CRGA 4UE7H 5CE1A 1LHDH 4X2XA 1FY5A 3R0FA 2BLOA 1TAWA 3SHAH 2C3SA 3SW2B 3KNXA 1BT7A 5F8ZA 1DWDH 3A86A 3BSQA 5DP4A 2WPMS 1NRQH 2ZP0H 4Y10E 1RXPA 1EX3A 1C1NA 1ZRBA 1SOTA 2HNTF 2WV4A 3K9XB 2G4TA 2BX3A 2VJ1A 3AVZA 1PYTC 2AERH 1Y5UT 2W3KA 2A4GA 3Q76A 3KN2A 5C5OA 1PPHE 3RXGA 2F83A 2OLGA 1JRTA 5AFYH 3MYWA 1J8AA 1OWDA 4R8TB 1FJSA 1P05A 2ZZUH 1O3JA 1YCPK 4MTBA 1A5HA 1LHEH 3U69H 3GY6A 2RG3A 3GY8A 2Z3EA 2AMPA 6ESTA 3HKIB 3GCTF 1O2IA 6GCHG 1IQMA 5EXNA 1MMJN 2ZU4A 3TIUA 1ZSLA 3GYMA 3PMAB 4J1YA 1SL3A 2WPIS 4TPIZ 2V6NA 1JRSA 4AN7A 1MAYA 5GXPA 3U1JB 1V2PT 4ZKSU 3RU4T 1TBQH 4JYUH 1BZXE 1GCDA 1EAXA 4ISIH 1O32A 3UNSA 1BHXB 3IG6B 4Q80A 3S69A 3S9CA 1ZPBA 1ETRH 1QL8A 2ZG0H 1LHGH 4TPYA 1O36A 3A82A 3RXIA 2A4OA 3LOXA 1ZMLA 4GLYA 1C5LH 5J4SA 1AKSB 1OSSA 2W7UA 2BDYA 3FZDA 2BQ7B 4NWKA 3QZRA 3QTVH 1W0ZU 2SNVA 1T4UH 4GHQA 1MCVA 2O8MA 1GBCA 1P12E 2C8WB 1WQVH 1T8MA 2ZDAH 4YLQH 1O39A 1NT1A 1KLJH 4ISHH 1H8IH 4OS5A 5LPRA 2XBWA 1RGQA 1T32A 1W7GH 3MNXA 1QTFA 1GBFA 2GDDA 1O3MA 2Z9LA 1GMCG 1TA6A 2AH4X 4Y71A 4AOQA 2FOBA 5EXLA 2C8XB 3RXJA 2GT8A 1XUGA 1ZOMA 4UFFH 1DVAH 1P2JA 1K21H 1GHBF 1FLEE 1MKWH 2BD4A 1ZGVA 3LONA 3SQHE 2R2WU 2OINA 4AFUA 2GTBA 3UUZA 3GOVB 2AGGX 3TH4H 1IQFA 1KLIH 1Z8JB 4B2BA 3U8RH 4ABGA 4FUHA 1O5AB 1C1TA 3KCGH 1TMUH 1C1QA 4K8YA 2PUXB 1O2ZA 1EAIA 1GJAB 2QN5T 1A5GH 1O34A 1P04A 1TYNA 2Z6BD 6CHAC 3LJJA 2FP7B 3F9HA 3BTKE 1AWFH 4X8TH 3T27A 3UNRA 6CHAB 1E34B 1DPOA 2C93B 3RXRA 2LPRA 1K2I1 1P10A 3WY8A 2GD4B 4F4OC 1XUJA 4WJG2 2P3FH 1W7XH 1ZGIA 5A8ZA 5IDKA 3SN8A 4GVUA 3RXUA 1QJ1B 3RM2H 5EQQA 1BTPA 3SU2A 1F7ZA 1QJ7B 3A89A 2WPHS 3A7YA 1UTPA 1P2IA 5K0HA 1TPPA 3SORA 4MQAA 1W12U 5JB8S 1ZSKA 2FODA 1MQ6A 4JK5A 1GL0E 2BD9A 1SGQE 4ABEA 3ZYDA 5FPYA 1WBGB 4FVBA 1GMDG 1KYNA 1EP6A 4DT7B 4GHTA 3TNTA 1Z8IB 4OGXA 1BCUH 5L2YH 2Z9JA 3SV8A 2Z7FE 3DD2H 1HPGA 4B75A 4M7GA 2B5TB 1D3QB 1EQ9A 2O8UA 1IQGA 2VWMA 1DY9A 2AFQB 3MNCA 1ARBA 2J34A 1IAUA 2TRMA 2PWXA 2IPHA 1D3TB 3SU1A 1QR3E 3BTME 3MU8A 1J17T 2R3UA 4X2WA 1UK4A 2ZDNA 3EBNA 3FVFB 3GDVA 3SUFA 4I8JA 4IC6A 2OBQA 3S9AA 4IMQA 2YNAA 2SNWA 3V12A 3ZVBA 1TONA 3V7TA 2PKSB 3SU4A 5AF9H 5GDSH 1E37B 1O2SA 1C5NH 3SI4H 5JDUB 1XM1A 2YNBA 2GDEH 2C8ZB 1A3EH 1B7XB 4D9RA 4BNRA 1W11U 1P2OA 1TX7A 1YYY1 1HAZB 1YF4A 4SGAE 3TPIZ 1HNEE 1P02A 2Y5HA 4MDSA 3VGCC 4D7GA 1O30A 4D7FA 8GCHG 3H7TA 4Y7BA 1LDTT 3ZZ3A 3VGCB 1DY8A 1AHTH 1SC8U 3TITA 3LC5A 4DY7B 1GBBA 3CS0A 1A5IA 1HAXB 1K28D 1C4U2 2A32A 2Y5FA 5TJXA 1TABE 1TOCB 4ABAA 1Y3UA 3PTBA 4AFSA 1UTQA 1WTGH 2C4FH 2VNTA 3ZVDA 2B0FA 1OOKB 1HAVB 1SHHB 1BTUA 1NROH 4XBDA 4WMFA 3RXFA 6LPRA 1A7SA 1L1GA 4K1EA 4XBCA 1C1PA 1HYLA 2EI6A 1GI8B 4KELA 1O3CA 3A83A 1XUHA 3ZZ9A 2BHGA 2ANWA 5C1UA 4YTAA 4H4FA 4FU7A 2HOBA 1HAPH 2R9PA 1WSSH 1UCYH 1AVGH 4YESB 1VJ9U 1J15A 8LPRA 3V13A 1F0RA 4CR9A 4AFZA 3UNQA 2OD3B 2NWNA 1BUIA 2WUBA 3E6PH 2ZHFH 2BLQA 1O2UA 1IQJA 3PLKA 2UWOA 4GUXA 1ELEE 1MKXH 1O3DA 1SPJA 3TU7H 2FI5E 4MNVA 2BY5X 2VWNA 3OY5U 4WMDA 4TWYA 3S0NA 1OWEA 1ZR0A 1GDNA 2A7HA 2A7CA 1MZDA 1C2IA 1Z8GA 1GDQA 1L4DA 2Y81A 1F0UA 2UUYA 1A0HB 2ZHEH 5JBAS 3F9GA 3QK1A 1G2LA 3GCOA 3ATIA 5GCHG 1O3BA 1O0DH 2GMTC 4NIXA 5T6FA 2WUCA 1A4WH 3GYLB 2GMTB 1IQLA 2THFB 2ZF0H 2H6MA 2VWLA 1M9UA 1AZ8A 2GV6A 1KXFA 2J92A 2FTMA 1E0FD 3FANA 4JZEH 3D23A 1ANBA 3O8DA 2B9LA 4E05H 1O2PA 2GZ8A 5A09A 1V2UT 1GJDB 1TGSZ 1ZHRA 1CA0C 3RC6A 4ZHLU 1HIAA 5AVDA 4Q2KA 1NRSH 2Y6TA 1CA0B 5TCCA 4YOIA 1AY6H 2SFAA 4ISNA 4GCHG 3VB3A 3KIDU 3LH3A 2EA3A 3TGJE 1ELDE 4FUEA 3A85A 1K1OA 3ZVEA 1HLTH 2SGAA 2WINI 4BXSA 3RXEA 3QZQA 3EAJA 2NU1E 1GVZA 1GJ7B 1LPGB 3TK6A 1FY1A 3BTEE 5E8EH 1Y3YA 2F9VA 4K1SA 3SJIA 1XVMA 1ELVA 2BDCA 3SUDA 3VB6A 1IOEA 4CBOA 1YPLH 2ASUB 3QUMP 1PPZA 4D8NA 2Z3DA 1C5RA 2G52A 5GIBA 1LVOA 3SUEA 4DIHH 3QO6A 4Y11E 4DVAU 3DA9B 5GPIB 4A5TS 1QRXA 1VZQH 3DUXH 4IMZA 1J9CH 1K1LA 5T3HA 1P01A 4Y6DA 2TPIZ 5C5NA 2XBXA 4OGYA 2HNTE 2FYRA 2A2QH 1P3EA 1QL9A 4BTUB 4ZAEA 1MUEB 1WYKA 4B1TA 1IQNA 3EE0B 2RCEA 2AGEX 2GVFA 1C5UA 5L2ZH 1O2WA 4U2WA 4TWWA 4ABIA 4X2VA 1BQYA 1EJAA 1C5SA 4ZXXH 2G8TA 4O03A 5E0JA 1D6WA 1IQKA 4TYDA 1GL1A 4X1NU 2ZFPH 1O2YA 3T28A 2ZU3A 1OX1A 1RJXB 1GVLA 3LGUA 1P09A 3ZV9A 1QQ4A 1DFPA 4DOQA 1C5MD 3O8RA 2Z9IA 3UFAA 4NSYA 4IS5A 2J38A 1YBWA 4U30A 1GHWH 1WCZA 1VGCC 2D26C 4AYVB 1CA8B 1VGCB 2Z9GA 1T8LA 1RIWC 2VINA 2ZTZA 1HB0B 1SGYE 1D4PB 5A8XA 1XXFA 1RIWB 3RUOA 1BDAA 1Y5AT 3BTDE 1H4WA 3Q3KA 5FXLA 1PPCE 4HI3A 1TMBH 1GHAG 1GBMA 1KXEA 4WMEA 1GI5A 1JXPA 1N6YA 2G5NA 2UWPA 1O35A 4VGCC 2QAAA 3PYHA 3BEIB 4VGCB 4J2YB 3RDZA 4UONA 3LT3A 1UVTH 2HPQH 3F68H 2ESTE 3G01A 4XE4A 3TK5A 2R0LA 3BTWE 2GCHF 1C2MA 3HPTB 1EJNA 1AUTC 4X1QU 2ALVA 5GWZA 1SGCA 5FX5A 2BQWB 4ABHA 5I25A 1TNIA 3TGKE 1AKSA 5E0GA 3M7QA 3OY6U 3CS7A 2HNTC 5C67A 1JBUH 2JH6D 2ANMH 4FXGH 5AHGH 1DE7H 2XCFA 2DE9A 5TCAA 2TIOA 3A8CA 3LGTA 2XC0A 4IN1A 3A7VA 5E2PA 1G3CA 2BLVA 3PTNA 4QT8C 1CSOE 4Y8YA 1YPHE 2HWLB 1GI0A 3T2NA 1B0FA 1MTVA 1RD3B 1TGBA 1SQAA 4INKA 4CH2B 1GI4A 2FI3E 1PFXC 1GI7B 1AVXA 4NIYA 1EXFA 4GAWA 4YLUA 5C20A 1G3BA 1ZTLA 2HLCA 3SV7A 1NFXA 1FV9A 2BDAA 2OP9A 3LGIA 4CH8B 1GI9B 3P8NA 1GG6C 1MTWA 1HUTH 1V2RT 1EOLA 1VCWA 2F9UA 1PQ7A 1MTUA 1Y3XA 1GG6B 5ABWA 3SJ8A 2Y82A 3RXPA 2VIWA 4XDEA 2SGQE 2BD7A 1AE5A 3QLPH 3OU0A 1NN6A 2RA3A 2ZEBA 2K7XA 3RMOH 1LVMA 2FYQA 4AFQA 2WYGA 1B0EA 1QNJA 2AYWA 3M36A 1O2GH 1C5ZB 2ZWLH 4FU9A 2FOMB 1HXEH 2G5VA 4X6MA 3SZNA 2FM2A 3IITA 3LKWA 2G55A 4WY3A 1KY9A 2FEQH 2QIQA 3MHWU 3W94A 4I8HA 3MH4A 1HBTH 1AI8H 6GCHF 3FFGA 5DP6A 2JH5D 1SGFA 2CN0H 2PKAA 1XVOA 2ZIQH 1UVPA 2ODQA 1GJCB 2XWAA 4CREA 1ELFA 3SNCA 1K1MA 2ZGHA 1BA8B 2FLBH 4DURA 1G37A 4FUGA 2ZCKP 3AAVA 3PLBA 3UIRA 2FOGA 3MH6A 2ILNA 1O5DH 4NA8A 2TGTA 1DICA 3RMLH 1Z6JH 1ELAA 1FUJA 1OKXA 3A81A 4IBLH 3S7HB 4X8VH 1UTLM 1FDPA 5HYOA 1WAYB 2ZU5A 2NU2E 2XRCA 4RKJB 5CHAC 1ESBA 3SU5A 4UFDH 1RTLA 1DUAA 5CHAB 1V3XA 3SV9A 1YPHC 4CRDA 2EI8A 4AB9A 1O5GH 1WUNH 1HFDA 4ZHAA 3PV4A 2F9PA 1WOFA 1H8DH 3SI3H 1XKAC 2Y7XA 1DS2E 2VVVA 3BTQE 3U98H 2QC2A 1TX8A 3E16B 4K1TA 1S85A 2AGIX 1ZHPA 5JBBS 1UTKA 1EPTA 1GMCF 3M37A 3P17H 2AS9A 5EPNA 2SGFE 3ODFA 5FX6A 1VR1H 1SHYA 3M3SA 3LDXH 2FTLE 2ZGJA 1W10U 2ZGBH 2ZO3H 4E7RG 1GBKA 1QB9A 3ZVGA 1KDQA 3QN7A 1Z8RA 2O8WA 1C5WB 2TGAA 2ZKSA 1ABIH 1BMLA 1SOZA 2AEIH 1DSTA 1KXAA 2BDGA 1GBLA 5DKMA 4B76A 1EZQA 1FAXA 4JZIA 4E06H 1SR5C 4X1RU 1NC6A 2KAIB 1RS0A 1WTHD 4ZMAH 3ZYEA 1W13U 1XX9A 1AQ7A 4NG9H 2BY8X 1O3HA 1AD8H 1CQQA 3OTJE 1GBIA 1TGTA 4Y0ZE 3ATWA 3PMBB 1HDTH 1MKWK 3UWJH 1LO6A 3GISB 3A7ZA 2ZDMA 1BJUA 1NO9H 1V2LT 1UCYE 5FPSA 1UTNA 1OYTH 5HGGA 4X6OA 2ZI2H 3BTHE 1AFEH 1TNHA 1TNLA 2BDIA 1JMOH 1ZMJA 2WPJS 3AASA 5C1XA 4NGAH 1C5XB 2BZ6H 1UJ1A 1ELTA 2ZFTA 4XOJA 3URCA 5F03A 1OWJA 1UHBA 1HAVA 2QXIA 3ZV8A 1GI1A 1H9IE 1SGFG 2HPPH 5F8TA 3CP7A 2TGDA 1QBNA 3QGJA 2VU8E 5EPYA 1E38B 2A7JA 4WH8A 3KQCA 2ZFSA 2J4IA 3MFJA 1XUIA 2K1QA 2GV7A 4YM9A 1SLXB 3H7OA 3RM0H 4YT7H 1V2WT 2XWBI 3M3VA 4BAKB 2ZPSA 1V2NT 1GMDF 3MMGA 1CE5A 1TE0A 2OC0A 3NKKA 1W0YH 5JPMH 3HGNA 3KQEA 2P59A 2XCNA 1Z1IA 1AIXH 1P8VC 1P11E 1ARCA 2BXUH 2FOHA 4KTUA 1Y3VA 4DIIH 4ESTE 1FIWA 5LGOA 2BZAA 1O5FH 1TPOA 2H9HA 2ZA5A 3L6PA 3ATLA 1ZLRA 2PKSC 9ESTA 1SGPE 2VGCC 2ZU1A 2BD5A 1HXFH 1NTPA 1C5PA 3A7WA 2VGCB 1ZYOA 3FP8E 3KF2A 4AG2A 2BXTH 4U01A 3I78A 1MBQA 1A2CH 5ESTE 2IN2A 2ZFQH 3L3TA 3T5FH 1A3BH 2OQ5A 3OYPA 3B9FH 1BRUP 1C5YB 3RU4D 1O2RA 1YP9A 2CMYA 1BBRE 1C1OA 1HJ8A 3SNBA 1A0LA 2VWOA 1V2JT 2H2ZA 4DGJA 2ZTYA
chains in the Genus database with same CATH superfamily
3TJUA 2O8TA 1NRNH 2FWWA 4BANB 2VIVA 1UTMA 1TGCA 4KTCA 3A7XA 3ZVCA 2FO9A 4ZKOU 2DE8A 3SNDA 3KHVA 3RXHA 3A80A 3MNBA 1ANEA 1CHOG 8GCHF 1SLWB 1GBTA 1GGDC 1UW7A 3DFLA 2AMDA 1NM6A 3OE7D 3PMHB 2NU3E 2BDHA 3SNAA 1GGDB 1W2KH 5EW2H 5G4BA 3P70B 1DWBH 2VH0A 3E8LA 3KQBA 1QRWA 1S83A 5JYIA 1FI8A 3PM3A 1O3NA 1LKAA 5EQSA 2BQ6B 3ELAH 3SU6A 1DANH 4K60A 2V0BA 2J98A 1FNIA 1F92A 1HV7A 1YKTA 1EASA 5LPEA 4I32A 1FX0B 3BTGE 1OP0A 3ATMA 3T62A 2UUJB 3M5NA 4I8LA 4CBNA 3EYDA 1JIRA 1ANCA 2OC8A 1MTNC 1NRRH 3ENSB 1SB1H 1THPB 3VXFH 1C4V2 2G00A 4A6LA 2ZTXA 4UD9H 2BX4A 1ABJH 3MTYA 1MTNB 3UPEA 1F0SA 3QGNB 5C2ZA 4MPVA 1O3OA 1S81A 2VH6A 4LZ1H 2J5UA 2XBYA 1O2QA 2KCOA 4FUBA 4CHAC 1DXPA 4Z6AH 1TWXB 1O33A 1SSXA 3KQDA 4ABJA 5DK1A 2D2DA 1OXGA 4CHAB 3SOSA 3O8CA 4TY6A 1OYQA 4MG3A 2BY9X 5FCRA 1C2JA 3PROA 3TVJB 1O2TA 4ZKRU 3VG8A 3C1KA 3RXQA 5FCKA 4CRAA 3KGPA 1UCYK 3OSYA 2H5CA 2ULLA 2GZ7A 3ZVFA 3TH3H 1C2HA 5EQRA 1QB1A 3BN9A 3MI4A 3GY7A 2A45B 1FONA 1MU8B 1P2KA 3STJA 1UTJA 4ABBA 1TRYA 1S82A 1VCPA 2GCTC 2P8OC 3URDA 3UOUA 4PROA 1SGIB 1S84A 2CF8H 1OHHD 5GCHF 3TJOA 2GCTB 2P8OB 2PTCE 1LTOA 1MKXK 2P94A 4KP0A 2Q6DA 2BVRH 1V2VT 1B5GH 1KIGH 1MBMA 3SZEA 4U32A 2ZC9H 2PSXA 5LH8A 2ZFRH 2Y80A 3L33A 1H9HE 2AIQA 2JETC 4Y8XA 5J4QA 1KXCA 3M3TA 4X0WU 2AHME 1QL7A 2JETB 4X8UH 4NSVA 1UTOA 2O8LA 2W26A 1OWKA 3UOPA 1GJ9B 1NFWA 1QFKH 1CT0E 1UO6A 4BTIB 1BB0B 1BBRH 3RXOA 5DO4H 2W5EA 1BIOA 2ZNKH 4SGBE 1VITG 3V0XA 3ZZ5A 3RC4A 4GCHF 4MVNA 3DHKH 1K0HA 1LHFH 1MU6B 1MD7A 2ZDLA 2VIQA 3W1EA 1C1MA 4NA7A 1K1NA 3F9EA 4ZUHA 4INHA 8KME2 2C8YB 3UY9A 4O3UA 4THNH 4B71A 1ETTH 2F9NA 3P95A 2F91A 2ANKH 4D76A 1V6DA 3FP6E 4TY7A 5AFZH 1GHYH 2D8WA 1TPSA 4K2YA 4LK4A 1CHGA 1SQOA 2OC7A 1ID5H 5FBIA 2FS9A 3MWIU 4WXIA 1WQSA 4B74A 2AIPA 1YPJH 2XNDD 5CHBA 1J14A 3F6UH 4MLFB 1K1PA 5K7RA 1OPHB 1MTSA 1O2NA 2F3CE 3IWMA 2FOFA 1O37A 2Q1JA 3M5OA 3A8DA 1V2ST 3BIVH 3E0NB 4HTCH 2A2XH 1YC0A 1NZQH 3TLOA 4XRNA 4B2CA 2WV9A 1S6HA 5KECA 3EGKH 1UK2A 2C90B 2R3YA 7GCHG 2FZZA 2FI4E 1C9PA 2W3IA 3RXAA 1O3IA 4AG1A 4YZUA 3S9BA 2ZECA 4DW2U 1ELBA 3F9FA 3BEUA 1WV7H 1T4VH 5EW1H 1O2MA 1GJ6A 4ZKNU 4ISOA 1P57B 2GKVE 4NWLA 1QBVH 3BG4C 4Y7AA 4NCYA 1DLKB 2ZGCA 3RP2A 4A1TA 1P9UA 4Q4LA 1F0TA 2F4LA 3BG4B 3LGVA 2BOKA 2K0QA 4F55A 1UMAH 3K2UA 4D9QA 1ETSH 2Z94A 2A31A 4NFEA 3SGBE 1SGTA 1C2LA 1EAUA 3VB4A 2YMSD 1G3DA 2YOLA 3DSPA 3F1SB 1ANDA 4CRCA 1G30B 4NZQA 1SFIA 4X1PU 1L0ZA 1P03A 2QA9E 3RMNH 4BTTB 1OS8A 1HIAB 3STIA 1Z71A 2QY0B 1O2LA 2Y5GA 1YPEH 3SO3A 1A46H 3GY3A 1TBRH 5A0CA 1ESAA 2EQNA 1FXYA 2OUAA 1O5CB 2ODYB 1EOJA 1LPKB 5BPEA 4I8GA 3NRLA 1O3AA 3P6ZB 4K3JA 1EAWA 1SG8B 2ZPRA 4Z0KA 1WDIA 2FOAA 1G36A 1PYTD 2PTNA 1Q31A 2CJIA 5EXMA 1Y5BT 2VVCA 1CBWC 4XSKU 3A84A 1AN1E 4INLA 1TLDA 1GHAF 3GY2A 4AGKA 1CBWB 2WHXA 1HAYB 1SKYE 3ESTA 3LU9B 1PQAA 1C2GA 1NFUA 1BMAA 3GS9A 2J9NA 4FUIA 2XTTB 1GBHA 1E36B 4IGDA 4TT3D 4X1SU 1GJ4H 3MU5A 3UR9A 4IN2A 3SU0A 3A87A 5DP5A 1TB6H 4K69A 4K8BA 1DX5M 1C5VA 1CVWH 1ELGA 1CU1A 1K22H 3LPRA 1QCPA 3VEQB 1H1BA 1ZRKA 2BDBA 3EA7A 2PR3A 1BITA 3Q3XA 1BTXA 1EJMA 1G2MA 1YLCA 3I77A 4B2AA 3UQVA 3F0PA 2BYAX 1A0JA 3TGIE 1FPHH 4A1VA 1TPAE 1NPMA 3U8OH 1MZAA 4BAQB 3SV2H 1C2EA 3MU4A 1TNJA 1ZPZA 4RI0A 1FMGA 5DP7A 3SNEA 1YCPH 1W14U 3RXDA 5DGJA 5SGAE 2HALA 1VJAU 2ALPA 5DG6A 3PO1C 2P95A 1GVKB 2XW9A 1P06A 4WWYA 3E3TA 3OAAD 2G81E 3PO1B 3ITIA 1C1SA 2ZPQA 3MO9A 1BTYA 2VIOA 3A7TA 4MPWA 3RXBA 2ZCHP 1BTWA 1CGIE 1BJVA 1DUEA 1OWIA 4MPXA 1GBEA 5L30H 3LGYA 1FPCH 3EA9A 1O5BB 4TSFD 1BTHH 5DN6D 1O2VA 3RXLA 3HKJB 3UR6A 1ZTJA 4Q7YA 2OQUA 3GCTG 5A0AE 3VFEA 3GY5A 2W7SA 5EU8A 5BRRE 1K9OE 2LIZA 1QIXB 1GDUA 2GP9B 2KAIA 1TQ0B 1C2KA 1F5KU 1GJBB 4X6NA 1QHRB 4AZ2B 3EA8A 1QQUA 3Q3YA 4E7NA 1OP8A 4HFPB 1C5OH 1QA0A 4BAOB 3MH7A 1EZSC 1FY4A 4WXVA 4A1XA 1P2MA 2FX6A 1BMFD 5L6NH 1SLVB 3GCNA 4DJZB 4I8KA 3HGPA 3ATKA 1JIMA 4OS6A 1GHXH 4UDWH 3BTTE 5B6OA 1EZUC 2F9BH 2CF9H 1BTZA 2GT7A 2RDLA 3DFJA 1UK3A 3NWUA 1SGNE 1Y59T 3HATH 5JBTA 1ORFA 4ISLA 5FHTA 1DT2A 1AO5A 1NRPH 3SUGA 2FMJA 3AW0A 3F0OA 3KEEA 1AUJA 1O2XA 5E0HA 2QCYA 4ACBA 1PQ5A 3HK3B 1TRNA 3WW7A 1CGHA 4I86A 3ZZAA 4RSPA 2ODPA 1YPMH 3MH5A 2BM2A 2XC4A 2F43B 4AGJA 1GWAA 1V2QT 3QWCH 3ZZ6A 5CMXH 1BHXF 2V3OH 4Y0YE 2XBVA 1IHTH 1L2EA 1BRAA 3MOCA 1EP5A 1NU7B 2HRVA 1RTFB 1Z6EA 2WV5A 1H9LB 3GY4A 3M61U 1GHBG 2J97A 1AB9C 3JZ1B 3D65E 2PHBA 2Z3CA 1C2DA 1T31A 1OWHA 1W8BH 1AB9B 3B23B 1PJPA 2FOCA 3TH2H 1EATA 2FX4A 1C2FA 2J94A 3JZ2B 3M7TA 2ZQ1A 4HGCA 3ZZ7A 4I31A 2PGQB 2FLRH 2W6ID 3K6YA 1UVOA 3OX7U 4MNYA 5EOKA 1FN8A 1F5LA 3DT0H 2P93A 1XXDA 1FN6A 4B73A 1DM4B 1TNGA 1DXWA 1EB1H 1DWCH 1D6RA 2JH0D 5HM2A 8ESTE 5T6DA 3TJNA 1HAOH 1OP2A 3PLPA 2DUCA 3SJ9A 5A2MH 5KEDA 3E91A 1Y3WA 4BAMB 4H42U 2ZU2A 1BRCE 4IW4E 4NA9H 1P2QA 4O3TA 3PRBA 2B8OH 1QGFA 4MNWA 1AFQC 2A4RA 1G3EA 1FIZA 2UUFB 2M2AA 1TRMA 5B6LA 2QYIA 1X7AC 1AFQB 5IYTA 4JYTA 2BVSH 4NIVA 4NZLA 1NFYA 3ZZCA 1TGNA 3T29A 5C17A 2H1UA 1NS3A 2V3HH 1GHVH 1O2OA 1CO7E 2K8IA 3PWCA 1SI5H 3MU1A 4AC9A 1VKYA 2BOHB 1ZTKA 4I33A 1KLTA 1HCGA 2PUQH 3V3MA 1T8OA 3NPSA 2JKHA 1QURH 2A5IA 2PKAB 3F2HA 4Q7XA 2VBCA 1PPBH 2ZHQH 2EC9H 3VB7A 1KXBA 1MAXA 4YT6H 1E79D 1C1VH 3AAUA 2R2MB 2Y7ZA 2Z9KA 1DDJA 1MQ5A 3P8OA 1QB6A 5I46H 1GJ8B 1GPZA 3SQEE 2NU0E 1C1WH 4HG6A 1LHCH 2A4QA 3LC3A 2OC1A 4XBBA 5FPTA 3PB1E 2CGAA 2Q6GA 1KXDA 3UAIC 1K1IA 1F2SE 1GI3A 2CHAC 1L4ZA 1DLEA 1EZXC 1O2JA 2STAE 2VVUA 1S0RA 4O9VA 3NCLA 3R3GB 4JYVH 1N8OC 2CHAB 1PPEE 1SBWA 1PQ8A 3E0PB 4UEHH 1HAHH 1JWTA 2QXJA 2B7DH 1N8OB 4ZROA 3N7DA 4AB8A 4FUFA 1MH0A 1AVWA 1YCPM 1CT4E 1O3LA 5F8XA 1SMFE 2GX4A 3SGAE 2KZ4A 5HM9A 4JZFH 2FOEA 3ZZ8A 1TX6A 3D62A 3MO6A 2QGRA 2R0KA 1EB2A 1V2OT 3BTFE 1QY6A 5H4IB 3QX5H 3SBKA 2LNCA 1CT2E 4OS4A 3BIUH 2HGTH 2ZDVH 1EPTC 1W3CA 1TMTH 1TNKA 5JBCS 3RU4E 4KKDA 3P8GA 1AU8A 1IHSH 2ZHWH 5F6MA 4FU8A 3TNSA 1EPTB 2AMQA 5HMAA 2FS8A 2IJD1 1BRBE 2M5TA 1AZZA 1KMHB 1P3CA 4JMYA 1KDQB 4O97A 4MNXA 5DSFA 2KCAA 3EDXB 1QA7A 2XXLA 1G9IE 1GCTC 4JK6A 5C3NA 4BAHB 5C94A 2GJGA 3GCHC 3OEED 1TOMH 2FDAA 3KL6A 1PPFE 4F49A 2SGEE 1GCTB 1O3KA 3GCHB 5T6GA 3LIWA 4Y76A 1O3GA 1YM0A 2GGVB 3SHCH 3UREA 7KMEH 5EODA 1GI6A 1AGJA 1ZZZA 1AMHA 3SU3A 4AX9H 3KYGA 1ZJKA 5A8YA 3SJKA 2I6SA 3RXMA 2IOTA 3FOAA 1C1RA 3LGWA 1RFNA 1ACBE 1O2HA 3VXEH 1SGRE 1A1RA 3RXTA 1TALA 3VPKA 3QTOH 3H09A 1UVUH 2A5AA 2I6QA 1MABB 1DWEH 1ZPCA 1CHOF 2BD2A 2BB4A 4Z1MD 1O3FA 5EG4A 3TK9A 1GBAA 5LPFA 1GI2A 1YLDA 1HAIH 1UHBB 3PWBA 2H5DA 2ZCLP 4NIWA 4OS1A 4GSOA 5DP8A 2J95A 4RT0A 1UVSH 2P3TB 1SGDE 1O3EA 4JCNA 3FAOA 4YXWD 1P9SA 1YGCH 1YPKH 2PLXA 4ASHA 1PPGE 2ZGXH 4BXWA 4CRFA 2Q6FA 3SV6A 3A8AA 2P3UB 3ZZ4A 1D3PB 1D9IA 3AW1A 1NU9A 4FVDA 5C1YA 1Z1JA 5HXFA 2FPZA 1NBMD 2BD3A 2BVXH 2TGPZ 3ZVAA 1IQIA 2XC5A 1K1JA 1HJ9A 1AE8H 1DOJA 3D49H 3GDSA 4WVPE 5GJ4B 2VB0A 4WH6A 1N1LA 2CXVA 3VB5A 4NFFA 2XYAA 2GZ9A 1ZMNA 3K6ZA 2IJOB 3ODDA 1KTTB 4JZ1A 1LVYA 3U1IB 1INCA 3NK8A 2QF5A 2QF0A 2V35A 2BY7X 1EUFA 2H9EH 3GICB 3M5MA 4R0IA 3OEHD 3Q00A 4LXBH 3T26A 1SVPA 2ZQ2A 1THRH 3RC5A 3RXSA 1HRTH 4Q63A 2CV3A 2OXSA 4DG4A 2EEKA 3M5LA 1C9TA 2RFKC 3GDUA 3P8FA 2UUKB 3HK6B 5DP9A 3LJOA 3FZZA 2SGPE 1LVBA 3I29A 4KGAA 5EJLA 1Q2WA 2QF3A 2KCPA 5DP3A 2WYJA 4AORA 2BLWA 2BTCE 2G4UA 4MPUA 3A88A 4X6PA 7ESTE 3NXPA 1NY22 3M7UA 1FY8E 3B8JA 1W0JD 2PGBB 1HAGE 1QBOA 1VCQA 4WF8A 2STBE 1O2KA 2XNIA 2ZDKA 1H8HD 2H9TH 2VIPA 1O3PB 1S5SA 3WWBA 2D1JA 1FY3A 2P16A 4JZDH 4AYYB 1L1NA 1SGEE 1QJ6B 3M35A 3RXVA 1GJ5H 2FXRA 3UWIA 4Y79A 2PP6A 1BMMH 3P92A 1IQHA 1VITF 5FAHA 4H6TA 3MU0A 4KTSA 1NESE 2J98B 2QV1A 2TBSA 5DPAA 2EI7A 4CRBA 3E1XB 1THSH 1AWHB 1LCYA 1VITH 2NU4E 1S6FA 2RA0A 3W95A 1Z7KA 2ZFFH 2KCYA 4A92A 2SGDE 1J16A 1WU1A 3A8BA 1GBJA 3ZZDA 1TFXA 1P2NA 1TA2A 2ANYA 1EFRD 1C5QA 1HJAC 1BOQA 1JOUB 1U6QA 2VIDA 1F5RA 1BBRK 4HZHA 3RLYH 3RXKA 1ESTA 9LPRA 2A0QB 4XFQA 1HJAB 5DJ7A 1E35B 3O8BA 4UFEH 2L6OA 1GMHG 1LPZB 1V2TT 3U8TH 2PFEA 1T7CA 1CGJE 4IC5A 3SGQE 3SJOA 3PMJA 2OTVA 3NZIA 5ESBA 4FUCA 1V2MT 1XUFA 5C0UA 1TIOA 1D3DB 1Y8TA 2QXGA 1TQ7B 5FBEA 1GMHF 2QXHA 3C27B 3LH1A 7GCHF 5A0BA 1GHZA 1C1UH 1N6XA 1V2KT 4OS2A 3RXCA 3MNSA 1ZSJA 3T25A 2UWLA 1DITH 3TJVA 5EGMA 3U9AH 2A1DB 2HVXA 4BOHA 1LQEA 3BG8A 3AK5A 3RLWH 4RKOB 4RN6A 2WPLS 3MO3A 1YY3A 4I7YH 1MCTA 1YPGH 4P00A 4X2YA 1G32B 1QRZA 3ZIAD 3NUMA 4ZH8A 3CENA 1O31A 4LZ4B 3EQ0H 2J2UA 2PV9B 2FIRH 4OS7A 3RMMH 2JDID 2A5KA 4FUJA 3BV9B 2BY6X 2BD8A 3BEFB 1HGTH 1ZHMA 2FESH 1XUKA 3E90B 1KTSB 1FQ3A 1Q3XA 3FP7E 5IK2D 1IQEA 4YO9A 2CK3D 1T8NA 1A61H 4X8SH 4UFGH 2WPKS 1MD8A 4ABFA 5PTPA 1DSUA 1LQDB 2PSYA 4DCDA 1SFQB 2GCHG 5E2OA 1XKBC 2OBOA 4A7IB 3H5CB 1P0SH 1KSNA 5JB9S 1O5EH 1GBDA 1TBZH 3QDZB 4H6SB 2OCVB 1S0QA 2WZQA 3S7KB 3Q77A 1BMNH 1SLUB 4YOJA 4ZXYH 1SQTA 4LOYH 4Y8ZA 3UTUH 1C4Y2 1ELCA 1EKBB 1FAKH 4FUDA 7LPRA 1L1JA 1LKBA 2F9OA 5EJ1A 1RRKA 1O38A 1FZZA 4ZHMU 4ABDA 1YWUA 3BF6H 1XMNB 3N7OA 3ZZBA 5ETXA 4GPGA 4CR5A 3UQOA 2ZHDA 4YOGA 4Q7ZA 1RTKA 1C5TA 2PW8H 4K5ZA 2BMGB 2G51A 1LMWB 1ZJDA 2O9QA 3K65B 4CRGA 4UE7H 5CE1A 1LHDH 4X2XA 1FY5A 3R0FA 2BLOA 2YMSC 1TAWA 3SHAH 2C3SA 3SW2B 3KNXA 1BT7A 5F8ZA 1DWDH 2YMSB 3A86A 3BSQA 5DP4A 2WPMS 1NRQH 2LP6A 2ZP0H 4Y10E 1RXPA 1EX3A 1C1NA 1ZRBA 5KGOA 1SOTA 2HNTF 2WV4A 3K9XB 2G4TA 2BX3A 5T1VA 2VJ1A 3AVZA 1PYTC 2AERH 1Y5UT 2W3KA 2A4GA 3Q76A 3KN2A 5C5OA 1PPHE 3RXGA 2F83A 2OLGA 1JRTA 5AFYH 3MYWA 1J8AA 1OWDA 4R8TB 1FJSA 1P05A 2ZZUH 1O3JA 1YCPK 4MTBA 4ASUD 1A5HA 1LHEH 1QZ8A 3GY6A 2RG3A 3GY8A 3U69H 2Z3EA 2AMPA 6ESTA 3HKIB 3GCTF 1O2IA 6GCHG 1IQMA 5EXNA 1MMJN 2ZU4A 3TIUA 1ZSLA 3F2FA 3GYMA 3PMAB 4J1YA 1SL3A 2WPIS 4TPIZ 2V6NA 1JRSA 4AN7A 1MAYA 5GXPA 3U1JB 1V2PT 4ZKSU 3RU4T 1TBQH 4JYUH 1BZXE 1GCDA 1EAXA 4ISIH 1O32A 3UNSA 1BHXB 3IG6B 4Q80A 3S69A 5HKKD 3S9CA 1ZPBA 1ETRH 1QL8A 2ZG0H 1LHGH 5FL7D 4TPYA 1O36A 3A82A 3RXIA 2A4OA 3LOXA 1ZMLA 4GLYA 1C5LH 5J4SA 1AKSB 1OSSA 2W7UA 2BDYA 3FZDA 2BQ7B 4NWKA 3QZRA 3QTVH 1W0ZU 2SNVA 1T4UH 4GHQA 1MCVA 2O8MA 1GBCA 1P12E 2C8WB 3OTPA 1WQVH 1T8MA 2ZDAH 4YLQH 1O39A 1NT1A 1KLJH 4ISHH 1H8IH 4OS5A 5LPRA 2XBWA 1RGQA 1T32A 1W7GH 3MNXA 1QTFA 1GBFA 2GDDA 1O3MA 2Z9LA 1GMCG 1TA6A 2AH4X 4Y71A 4AOQA 2FOBA 2QE7D 5EXLA 2C8XB 3RXJA 2GT8A 1XUGA 1ZOMA 4UFFH 1DVAH 1P2JA 1K21H 1GHBF 4OM9A 1FLEE 1MKWH 2BD4A 1ZGVA 3LONA 3SQHE 2R2WU 2OINA 4AFUA 2GTBA 3UUZA 3GOVB 2AGGX 3TH4H 1IQFA 1KLIH 1Z8JB 4B2BA 5CDFE 3U8RH 4ABGA 4FUHA 1O5AB 1C1TA 3KCGH 1TMUH 1C1QA 2L74A 4K8YA 2PUXB 1O2ZA 1EAIA 1GJAB 2QN5T 1A5GH 1O34A 1P04A 1TYNA 2Z6BD 6CHAC 3LJJA 2FP7B 3F9HA 3BTKE 1AWFH 4X8TH 3T27A 3UNRA 6CHAB 1E34B 1DPOA 2C93B 3RXRA 2LPRA 1K2I1 1P10A 3WY8A 2GD4B 4F4OC 1XUJA 4WJG2 2P3FH 1W7XH 1ZGIA 5A8ZA 5IDKA 3SN8A 4GVUA 3RXUA 1QJ1B 3FN8A 3RM2H 5EQQA 1BTPA 3SU2A 1F7ZA 3DSGA 1QJ7B 3A89A 2WPHS 3A7YA 1UTPA 3PV2A 3CNRA 1P2IA 5K0HA 1TPPA 3SORA 4MQAA 1W12U 5JB8S 1ZSKA 2FODA 1MQ6A 4JK5A 1GL0E 2BD9A 1SGQE 4ABEA 3DCLA 3ZYDA 5FPYA 1WBGB 4FVBA 1GMDG 1KYNA 1EP6A 4DT7B 4GHTA 3TNTA 1Z8IB 4OGXA 1BCUH 5L2YH 2Z9JA 3SV8A 2Z7FE 3DD2H 1HPGA 4B75A 4M7GA 2B5TB 1D3QB 1EQ9A 2O8UA 1IQGA 2VWMA 1DY9A 2AFQB 3MNCA 1ARBA 2J34A 1IAUA 2TRMA 2PWXA 2IPHA 1D3TB 3SU1A 1QR3E 3BTME 3MU8A 1J17T 3PRDA 2R3UA 4X2WA 1UK4A 2ZDNA 3EBNA 3FVFB 3GDVA 3SUFA 3EE7A 4I8JA 4IC6A 2OBQA 3S9AA 4IMQA 2YNAA 2SNWA 3V12A 3ZVBA 1TONA 3V7TA 2PKSB 3SU4A 5AF9H 5GDSH 1E37B 2W6JD 1SQRA 1O2SA 1C5NH 3SI4H 5JDUB 1XM1A 2YNBA 2GDEH 2C8ZB 1A3EH 1B7XB 4D9RA 1W0KD 4BNRA 1W11U 1P2OA 1TX7A 1YYY1 1HAZB 1YF4A 4SGAE 3TPIZ 1HNEE 1P02A 2Y5HA 4MDSA 3VGCC 4D7GA 1O30A 4D7FA 8GCHG 3H7TA 4Y7BA 1LDTT 3ZZ3A 3VGCB 1DY8A 1AHTH 1SC8U 3TITA 3LC5A 4DY7B 3KQ5A 1GBBA 3CS0A 1A5IA 1HAXB 1K28D 1C4U2 2A32A 2Y5FA 5TJXA 3UB0A 5HIYA 1S6LA 1TABE 1TOCB 4ABAA 1Y3UA 3PTBA 4AFSA 1UTQA 1WTGH 2C4FH 2VNTA 2JIZD 3ZVDA 2B0FA 1OOKB 1HAVB 1SHHB 1BTUA 1NROH 4XBDA 4WMFA 3RXFA 1NBME 6LPRA 1A7SA 1L1GA 2JJ2D 4K1EA 4XBCA 1C1PA 1HYLA 2EI6A 1GI8B 4KELA 1O3CA 3A83A 1XUHA 3ZZ9A 2BHGA 2ANWA 5C1UA 4YTAA 3N99A 4H4FA 4FU7A 2HOBA 1HAPH 2R9PA 1WSSH 1UCYH 1AVGH 4YESB 1VJ9U 1J15A 8LPRA 3V13A 1F0RA 4CR9A 4AFZA 3UNQA 2OD3B 2NWNA 1BUIA 2WUBA 5EIYA 3E6PH 2ZHFH 3DSOA 2BLQA 1O2UA 1IQJA 3PLKA 2UWOA 4GUXA 1ELEE 1MKXH 1O3DA 1SPJA 3TU7H 2FI5E 4MNVA 2BY5X 2VWNA 3OY5U 4WMDA 4TWYA 3S0NA 1OWEA 1ZR0A 1GDNA 2A7HA 2A7CA 1MZDA 1C2IA 1Z8GA 1GDQA 1L4DA 2Y81A 1F0UA 2UUYA 1A0HB 2ZHEH 5JBAS 3F9GA 3QK1A 1G2LA 3GCOA 3ATIA 5GCHG 1O3BA 4P02A 1O0DH 2GMTC 4NIXA 5T6FA 2WUCA 1A4WH 3GYLB 2GMTB 1IQLA 2THFB 2ZF0H 2H6MA 2VWLA 1M9UA 1AZ8A 2GV6A 1KXFA 2J92A 2FTMA 1E0FD 3FANA 4JZEH 3D23A 1ANBA 3O8DA 2B9LA 2RDEA 4E05H 2WPDD 1O2PA 2GZ8A 5A09A 1V2UT 1GJDB 1TGSZ 1ZHRA 1CA0C 3RC6A 4ZHLU 1HIAA 5AVDA 4Q2KA 1NRSH 2Y6TA 1CA0B 5TCCA 4YOIA 1AY6H 2SFAA 3KYFA 4ISNA 4GCHG 3VB3A 3KIDU 3LH3A 2EA3A 3TGJE 1ELDE 4FUEA 4F48B 3A85A 1K1OA 3ZVEA 1HLTH 2SGAA 2WINI 4BXSA 3RXEA 3QZQA 3EAJA 2NU1E 1GVZA 1GJ7B 1LPGB 3TK6A 1FY1A 3BTEE 5C0TA 3PV5A 5E8EH 1Y3YA 2F9VA 4K1SA 3SJIA 1XVMA 1ELVA 2BDCA 3SUDA 3VB6A 4B6EA 1IOEA 4CBOA 1YPLH 2ASUB 3QUMP 1PPZA 4D8NA 2Z3DA 1C5RA 2LELA 2G52A 5GIBA 1LVOA 3SUEA 4DIHH 3QO6A 4Y11E 4DVAU 3DA9B 5GPIB 4A5TS 1QRXA 1VZQH 3DUXH 4IMZA 5F53A 1J9CH 1K1LA 5T3HA 1P01A 4Y6DA 2TPIZ 5C5NA 2XBXA 4OGYA 2HNTE 2FYRA 2A2QH 3SYJA 1P3EA 1QL9A 4BTUB 4ZAEA 1MUEB 1WYKA 4B1TA 1IQNA 3EE0B 2RCEA 2AGEX 2GVFA 1C5UA 5L2ZH 1O2WA 4U2WA 4TWWA 3OFND 4ABIA 4X2VA 1BQYA 1EJAA 1C5SA 4ZXXH 2G8TA 4O03A 5E0JA 1D6WA 1IQKA 4TYDA 1GL1A 4X1NU 2ZFPH 1O2YA 3T28A 2ZU3A 1OX1A 1RJXB 1GVLA 3LGUA 1P09A 3ZV9A 1QQ4A 1DFPA 4DOQA 1C5MD 3O8RA 2Z9IA 2IPQX 3UFAA 4NSYA 4IS5A 2J38A 1YBWA 4U30A 1GHWH 1WCZA 1VGCC 2D26C 4AYVB 2KR7A 4XD7D 1CA8B 1VGCB 2Z9GA 1T8LA 1RIWC 2VINA 2ZTZA 1HB0B 1SGYE 1D4PB 5A8XA 1XXFA 1RIWB 2KM0A 3RUOA 1BDAA 1Y5AT 3BTDE 1H4WA 3Q3KA 5FXLA 1PPCE 4HI3A 1TMBH 1GHAG 1GBMA 1KXEA 4WMEA 1GI5A 1JXPA 1N6YA 2G5NA 2UWPA 1O35A 4VGCC 2QAAA 3PYHA 3BEIB 4VGCB 4J2YB 3RDZA 4UONA 3LT3A 1UVTH 2HPQH 3F68H 2ESTE 3G01A 4XE4A 3TK5A 2R0LA 3BTWE 2GCHF 1C2MA 3HPTB 1EJNA 1AUTC 4X1QU 2ALVA 5GWZA 1SGCA 5FX5A 2BQWB 4ABHA 5I25A 1TNIA 3TGKE 1AKSA 5E0GA 3M7QA 3OY6U 3CS7A 2HNTC 5C67A 1JBUH 2JH6D 2JJ1D 2ANMH 4FXGH 5AHGH 5HIZA 1DE7H 2XCFA 2DE9A 5TCAA 4ZCNA 2TIOA 3A8CA 3LGTA 2XC0A 4IN1A 3A7VA 5E2PA 1G3CA 2BLVA 3PTNA 4QT8C 1CSOE 4Y8YA 1WXRA 1YPHE 2HWLB 1GI0A 3T2NA 1B0FA 1MTVA 1RD3B 1TGBA 1SQAA 4INKA 4CH2B 1GI4A 2FI3E 1PFXC 1GI7B 1AVXA 4NIYA 1EXFA 4GAWA 4YLUA 5C20A 1G3BA 1ZTLA 2HLCA 2HLDD 3SV7A 1NFXA 1FV9A 2BDAA 2OP9A 3LGIA 4CH8B 1GI9B 3P8NA 1GG6C 1MTWA 1HUTH 1V2RT 1EOLA 1VCWA 2F9UA 1PQ7A 1MTUA 1Y3XA 1GG6B 5ABWA 3SJ8A 2Y82A 3RXPA 2VIWA 4XDEA 2SGQE 2BD7A 1AE5A 3QLPH 3OU0A 1NN6A 2RA3A 2ZEBA 2K7XA 3RMOH 1LVMA 2FYQA 4M9FA 4AFQA 2WYGA 1B0EA 1QNJA 2AYWA 3F2GA 3M36A 1O2GH 1C5ZB 2ZWLH 4FU9A 2FOMB 1COWD 1HXEH 2G5VA 4X6MA 3SZNA 2FM2A 3IITA 3LKWA 2G55A 4WY3A 1KY9A 2FEQH 2WSSD 2QIQA 3MHWU 3W94A 4I8HA 3MH4A 1HBTH 1AI8H 6GCHF 3FFGA 5DP6A 2JH5D 1SGFA 2CN0H 2PKAA 1XVOA 2ZIQH 1UVPA 2QF4A 2ODQA 1GJCB 2XWAA 4CREA 1ELFA 3SNCA 1K1MA 2ZGHA 1BA8B 2FLBH 4DURA 1G37A 4FUGA 2ZCKP 3AAVA 3PLBA 3UIRA 2FOGA 3MH6A 1YLNA 2ILNA 1O5DH 4NA8A 2TGTA 1DICA 3RMLH 1Z6JH 1ELAA 1FUJA 1OKXA 3A81A 4IBLH 3S7HB 4X8VH 1UTLM 1FDPA 5HYOA 1WAYB 2ZU5A 2NU2E 2XRCA 4RKJB 5CHAC 1ESBA 3SU5A 4UFDH 1RTLA 1DUAA 5CHAB 1V3XA 3SV9A 1YPHC 2V3MA 4CRDA 2EI8A 4AB9A 1O5GH 1WUNH 1HFDA 4ZHAA 3PV4A 2F9PA 1WOFA 3FO8D 3U28C 1H8DH 3SI3H 1XKAC 2Y7XA 2OK5A 4DT4A 1DS2E 2VVVA 3BTQE 3U98H 2QC2A 1TX8A 3E16B 4K1TA 1S85A 2AGIX 1ZHPA 5JBBS 1UTKA 1EPTA 1GMCF 3M37A 3P17H 2AS9A 5EPNA 2SGFE 3ODFA 5FX6A 1VR1H 1SHYA 3M3SA 3LDXH 2FTLE 2ZGJA 1W10U 2ZGBH 2ZO3H 4E7RG 1GBKA 4ACAA 1QB9A 3ZVGA 1KDQA 3QN7A 1Z8RA 2O8WA 2EY4C 1C5WB 2TGAA 2ZKSA 1ABIH 1BMLA 1SOZA 2AEIH 1DSTA 1KXAA 2BDGA 1GBLA 5DKMA 4B76A 1EZQA 1FAXA 4JZIA 4E06H 1SR5C 4X1RU 1NC6A 2KAIB 1RS0A 1WTHD 4ZMAH 3ZYEA 1W13U 1XX9A 1AQ7A 4NG9H 2BY8X 1E1RD 1O3HA 1AD8H 1CQQA 3OTJE 1GBIA 1TGTA 4Y0ZE 3ATWA 3PMBB 1HDTH 1MKWK 3UWJH 1LO6A 3GISB 3A7ZA 2ZDMA 1BJUA 1NO9H 1V2LT 1UCYE 5FPSA 1UTNA 1OYTH 5HGGA 4X6OA 2ZI2H 3BTHE 1AFEH 1TNHA 1TNLA 2BDIA 1JMOH 1ZMJA 2WPJS 3AASA 5C1XA 4NGAH 1C5XB 2BZ6H 1UJ1A 1ELTA 2ZFTA 4XOJA 3URCA 3N7EA 5F03A 1OWJA 1UHBA 1HAVA 2QXIA 3ZV8A 1GI1A 1H9IE 1SGFG 2HPPH 2HVYB 5F8TA 3CP7A 2TGDA 1QBNA 3QGJA 4B6FA 2VU8E 5EPYA 3FKSD 1E38B 2KX4A 2A7JA 4WH8A 3KQCA 2ZFSA 2J4IA 2KFWA 3MFJA 1XUIA 2K1QA 2GV7A 4YM9A 1SLXB 3H7OA 3RM0H 4YT7H 1V2WT 2XWBI 3M3VA 4BAKB 3MQKC 2ZPSA 2XOKD 1V2NT 1GMDF 3MMGA 1CE5A 1TE0A 2OC0A 3NKKA 1W0YH 5JPMH 3HGNA 5GNDA 3KQEA 2P59A 2XCNA 1Z1IA 1AIXH 1P8VC 1P11E 2V7QD 1ARCA 2BXUH 2FOHA 4KTUA 4FOUC 1Y3VA 4DIIH 4ESTE 1FIWA 5LGOA 2BZAA 1O5FH 1TPOA 2H9HA 2ZA5A 4FETA 3L6PA 3ATLA 1ZLRA 2PKSC 9ESTA 1SGPE 2VGCC 2ZU1A 2BD5A 1HXFH 1NTPA 1C5PA 3A7WA 3F3BA 2VGCB 1ZYOA 3FP8E 3KF2A 4AG2A 5EJZA 2BXTH 1H8ED 4U01A 3I78A 1MBQA 1A2CH 5ESTE 3WWFA 2IN2A 2ZFQH 4RT1A 3L3TA 3T5FH 1A3BH 2OQ5A 3OYPA 3B9FH 1BRUP 1C5YB 3RU4D 1O2RA 1E1QD 1YP9A 2CMYA 1BBRE 1C1OA 1HJ8A 3SNBA 1A0LA 2VWOA 1V2JT 2H2ZA 4DGJA 2ZTYA
chains in the Genus database with same CATH topology
3TJUA 2O8TA 1NRNH 2FWWA 4BANB 2VIVA 1UTMA 1TGCA 4KTCA 3A7XA 3ZVCA 2FO9A 4ZKOU 2DE8A 3SNDA 3KHVA 3RXHA 3A80A 3MNBA 1ANEA 1CHOG 8GCHF 1SLWB 1GBTA 1GGDC 3DFLA 2AMDA 1NM6A 3PMHB 2NU3E 2BDHA 3SNAA 1GGDB 1W2KH 5EW2H 5G4BA 3P70B 1DWBH 2VH0A 3E8LA 3KQBA 1QRWA 1S83A 5JYIA 1FI8A 3PM3A 1O3NA 1LKAA 5EQSA 2BQ6B 3ELAH 3SU6A 1DANH 4K60A 2V0BA 1FNIA 1F92A 1HV7A 1YKTA 1EASA 5LPEA 4I32A 3BTGE 1OP0A 3ATMA 3T62A 2UUJB 3M5NA 4I8LA 4CBNA 3EYDA 1JIRA 1ANCA 2OC8A 1MTNC 1NRRH 3ENSB 1SB1H 1THPB 3VXFH 1C4V2 2G00A 4A6LA 2ZTXA 4UD9H 2BX4A 1ABJH 3MTYA 1MTNB 3UPEA 1F0SA 3QGNB 5C2ZA 4MPVA 1O3OA 1S81A 2VH6A 4LZ1H 2XBYA 1O2QA 4FUBA 4CHAC 1DXPA 4Z6AH 1TWXB 1O33A 1SSXA 3KQDA 4ABJA 5DK1A 2D2DA 1OXGA 4CHAB 3SOSA 3O8CA 4TY6A 1OYQA 4MG3A 2BY9X 5FCRA 1C2JA 3PROA 3TVJB 1O2TA 4ZKRU 3C1KA 3RXQA 5FCKA 4CRAA 3KGPA 1UCYK 3OSYA 2H5CA 2ULLA 2GZ7A 3ZVFA 3TH3H 1C2HA 5EQRA 1QB1A 3BN9A 3MI4A 3GY7A 2A45B 1FONA 1MU8B 1P2KA 3STJA 1UTJA 4ABBA 1TRYA 1S82A 1VCPA 2GCTC 2P8OC 3URDA 3UOUA 4PROA 1SGIB 1S84A 2CF8H 5GCHF 3TJOA 2GCTB 2P8OB 2PTCE 1LTOA 1MKXK 2P94A 4KP0A 2Q6DA 2BVRH 1V2VT 1B5GH 1KIGH 1MBMA 4U32A 2ZC9H 2PSXA 5LH8A 2ZFRH 2Y80A 3L33A 1H9HE 2AIQA 2JETC 4Y8XA 5J4QA 1KXCA 3M3TA 4X0WU 1QL7A 2JETB 4X8UH 4NSVA 1UTOA 2O8LA 2W26A 1OWKA 3UOPA 1GJ9B 1NFWA 1QFKH 1CT0E 1UO6A 4BTIB 1BB0B 1BBRH 3RXOA 5DO4H 2W5EA 1BIOA 2ZNKH 4SGBE 1VITG 3V0XA 3ZZ5A 3RC4A 4GCHF 4MVNA 3DHKH 1LHFH 1MU6B 1MD7A 2ZDLA 2VIQA 1C1MA 4NA7A 1K1NA 3F9EA 4ZUHA 4INHA 8KME2 2C8YB 3UY9A 4O3UA 4THNH 4B71A 1ETTH 2F9NA 3P95A 2F91A 2ANKH 4D76A 1V6DA 3FP6E 4TY7A 5AFZH 1GHYH 2D8WA 1TPSA 4K2YA 4LK4A 1CHGA 1SQOA 2OC7A 1ID5H 5FBIA 2FS9A 3MWIU 4WXIA 1WQSA 4B74A 2AIPA 1YPJH 1J14A 3F6UH 4MLFB 1K1PA 5K7RA 1OPHB 1MTSA 1O2NA 2F3CE 3IWMA 2FOFA 1O37A 2Q1JA 3M5OA 3A8DA 1V2ST 3BIVH 3E0NB 4HTCH 2A2XH 1YC0A 1NZQH 3TLOA 4B2CA 1S6HA 3EGKH 1UK2A 2C90B 2R3YA 7GCHG 2FZZA 2FI4E 1C9PA 2W3IA 3RXAA 1O3IA 4AG1A 4YZUA 3S9BA 2ZECA 4DW2U 1ELBA 3F9FA 3BEUA 1WV7H 1T4VH 5EW1H 1O2MA 1GJ6A 4ZKNU 4ISOA 1P57B 2GKVE 4NWLA 1QBVH 3BG4C 4Y7AA 4NCYA 1DLKB 2ZGCA 3RP2A 4A1TA 1P9UA 1F0TA 3BG4B 3LGVA 2BOKA 1UMAH 3K2UA 4D9QA 1ETSH 2Z94A 2A31A 4NFEA 3SGBE 1SGTA 1C2LA 1EAUA 3VB4A 1G3DA 2YOLA 3F1SB 1ANDA 4CRCA 1G30B 4NZQA 1SFIA 4X1PU 1L0ZA 1P03A 2QA9E 3RMNH 4BTTB 1OS8A 1HIAB 3STIA 1Z71A 2QY0B 1O2LA 2Y5GA 1YPEH 3SO3A 1A46H 3GY3A 1TBRH 5A0CA 1ESAA 1FXYA 2OUAA 1O5CB 2ODYB 1EOJA 1LPKB 5BPEA 4I8GA 1O3AA 3P6ZB 4K3JA 1EAWA 1SG8B 2ZPRA 4Z0KA 2FOAA 1G36A 1PYTD 2PTNA 1Q31A 2CJIA 5EXMA 1Y5BT 2VVCA 1CBWC 4XSKU 3A84A 1AN1E 4INLA 1TLDA 1GHAF 3GY2A 4AGKA 1CBWB 1HAYB 3ESTA 3LU9B 1PQAA 1C2GA 1NFUA 1BMAA 2J9NA 4FUIA 2XTTB 1GBHA 1E36B 4IGDA 4X1SU 1GJ4H 3MU5A 3UR9A 4IN2A 3SU0A 3A87A 5DP5A 1TB6H 4K69A 4K8BA 1DX5M 1C5VA 1CVWH 1ELGA 1CU1A 1K22H 3LPRA 1QCPA 3VEQB 1H1BA 1ZRKA 2BDBA 3EA7A 2PR3A 1BITA 3Q3XA 1BTXA 1EJMA 1G2MA 1YLCA 3I77A 4B2AA 3UQVA 2BYAX 1A0JA 3TGIE 1FPHH 4A1VA 1TPAE 1NPMA 3U8OH 1MZAA 4BAQB 3SV2H 1C2EA 3MU4A 1TNJA 1ZPZA 5DP7A 1FMGA 3SNEA 1YCPH 1W14U 3RXDA 5DGJA 5SGAE 2HALA 1VJAU 2ALPA 5DG6A 3PO1C 2P95A 1GVKB 2XW9A 1P06A 4WWYA 3E3TA 2G81E 3PO1B 3ITIA 1C1SA 2ZPQA 3MO9A 1BTYA 2VIOA 3A7TA 4MPWA 3RXBA 2ZCHP 1BTWA 1CGIE 1BJVA 1DUEA 1OWIA 4MPXA 1GBEA 5L30H 3LGYA 1FPCH 3EA9A 1O5BB 1BTHH 1O2VA 3RXLA 3HKJB 3UR6A 1ZTJA 4Q7YA 2OQUA 3GCTG 5A0AE 3VFEA 3GY5A 2W7SA 5EU8A 5BRRE 1K9OE 2LIZA 1QIXB 1GDUA 2GP9B 2KAIA 1TQ0B 1C2KA 1F5KU 1GJBB 4X6NA 1QHRB 4AZ2B 3EA8A 1QQUA 3Q3YA 4E7NA 1OP8A 4HFPB 1C5OH 1QA0A 4BAOB 3MH7A 1EZSC 1FY4A 4WXVA 4A1XA 1P2MA 2FX6A 5L6NH 1SLVB 3GCNA 4DJZB 4I8KA 3HGPA 3ATKA 1JIMA 4OS6A 1GHXH 4UDWH 3BTTE 5B6OA 1EZUC 2F9BH 2CF9H 1BTZA 2GT7A 2RDLA 3DFJA 1UK3A 3NWUA 1SGNE 1Y59T 3HATH 5JBTA 1ORFA 4ISLA 5FHTA 1DT2A 1AO5A 1NRPH 3SUGA 2FMJA 3AW0A 3KEEA 1AUJA 1O2XA 5E0HA 2QCYA 1PQ5A 3HK3B 1TRNA 1CGHA 3ZZAA 4RSPA 2ODPA 1YPMH 3MH5A 2BM2A 2XC4A 4AGJA 1GWAA 1V2QT 3QWCH 3ZZ6A 5CMXH 1BHXF 2V3OH 4Y0YE 2XBVA 1IHTH 1L2EA 1BRAA 3MOCA 1EP5A 1NU7B 2HRVA 1RTFB 1Z6EA 2WV5A 1H9LB 3GY4A 3M61U 1GHBG 1AB9C 3JZ1B 3D65E 2PHBA 2Z3CA 1C2DA 1T31A 1OWHA 1W8BH 1AB9B 3B23B 1PJPA 2FOCA 3TH2H 1EATA 2FX4A 1C2FA 2J94A 3JZ2B 3M7TA 2ZQ1A 4HGCA 3ZZ7A 4I31A 2PGQB 2FLRH 3K6YA 1UVOA 3OX7U 4MNYA 5EOKA 1FN8A 1F5LA 3DT0H 2P93A 1XXDA 1FN6A 4B73A 1DM4B 1TNGA 1DXWA 1EB1H 1DWCH 1D6RA 2JH0D 5HM2A 8ESTE 5T6DA 3TJNA 1HAOH 1OP2A 3PLPA 2DUCA 3SJ9A 5A2MH 3E91A 1Y3WA 4BAMB 4H42U 2ZU2A 1BRCE 4IW4E 4NA9H 1P2QA 4O3TA 2B8OH 1QGFA 4MNWA 1AFQC 2A4RA 1G3EA 1FIZA 2UUFB 1TRMA 2QYIA 1X7AC 1AFQB 5IYTA 4JYTA 2BVSH 4NIVA 4NZLA 1NFYA 3ZZCA 1TGNA 3T29A 2H1UA 1NS3A 2V3HH 1GHVH 1O2OA 1CO7E 3PWCA 1SI5H 3MU1A 2BOHB 1ZTKA 4I33A 1KLTA 1HCGA 2PUQH 3V3MA 1T8OA 3NPSA 2JKHA 1QURH 2A5IA 2PKAB 4Q7XA 1PPBH 2ZHQH 2EC9H 3VB7A 1KXBA 1MAXA 4YT6H 1C1VH 3AAUA 2R2MB 2Y7ZA 2Z9KA 1DDJA 1MQ5A 3P8OA 1QB6A 5I46H 1GJ8B 1GPZA 3SQEE 2NU0E 1C1WH 1LHCH 2A4QA 3LC3A 2OC1A 4XBBA 5FPTA 3PB1E 2CGAA 2Q6GA 1KXDA 1K1IA 1F2SE 1GI3A 2CHAC 1L4ZA 1DLEA 1EZXC 1O2JA 2STAE 2VVUA 1S0RA 4O9VA 3NCLA 3R3GB 4JYVH 1N8OC 2CHAB 1PPEE 1SBWA 1PQ8A 3E0PB 4UEHH 1HAHH 1JWTA 2QXJA 2B7DH 1N8OB 4ZROA 4AB8A 4FUFA 1MH0A 1AVWA 1YCPM 1CT4E 1O3LA 5F8XA 1SMFE 2GX4A 3SGAE 5HM9A 4JZFH 2FOEA 3ZZ8A 1TX6A 3D62A 3MO6A 2QGRA 2R0KA 1EB2A 1V2OT 3BTFE 1QY6A 5H4IB 3QX5H 3SBKA 2LNCA 1CT2E 4OS4A 3BIUH 2HGTH 2ZDVH 1EPTC 1W3CA 1TMTH 1TNKA 5JBCS 3RU4E 4KKDA 3P8GA 1AU8A 1IHSH 2ZHWH 5F6MA 4FU8A 3TNSA 1EPTB 2AMQA 5HMAA 2FS8A 1BRBE 2M5TA 1AZZA 1P3CA 4JMYA 1KDQB 4O97A 4MNXA 3EDXB 1QA7A 2XXLA 1G9IE 1GCTC 4JK6A 5C3NA 4BAHB 3GCHC 1TOMH 2FDAA 3KL6A 1PPFE 4F49A 2SGEE 1GCTB 1O3KA 3GCHB 5T6GA 3LIWA 4Y76A 1O3GA 1YM0A 2GGVB 3SHCH 3UREA 7KMEH 5EODA 1GI6A 1AGJA 1ZZZA 1AMHA 3SU3A 4AX9H 1ZJKA 5A8YA 3SJKA 2I6SA 3RXMA 2IOTA 1C1RA 3LGWA 1RFNA 1ACBE 1O2HA 3VXEH 1SGRE 1A1RA 3RXTA 1TALA 3VPKA 3QTOH 1UVUH 2A5AA 2I6QA 1DWEH 1ZPCA 1CHOF 2BD2A 2BB4A 1O3FA 5EG4A 3TK9A 1GBAA 5LPFA 1GI2A 1YLDA 1HAIH 1UHBB 3PWBA 2H5DA 2ZCLP 4NIWA 4OS1A 4GSOA 5DP8A 2J95A 1UVSH 2P3TB 1SGDE 1O3EA 4JCNA 3FAOA 1P9SA 1YGCH 1YPKH 2PLXA 4ASHA 1PPGE 2ZGXH 4BXWA 4CRFA 2Q6FA 3SV6A 3A8AA 2P3UB 3ZZ4A 1D3PB 1D9IA 3AW1A 1NU9A 4FVDA 5C1YA 1Z1JA 5HXFA 2FPZA 2BD3A 2BVXH 2TGPZ 3ZVAA 1IQIA 2XC5A 1K1JA 1HJ9A 1AE8H 1DOJA 3D49H 3GDSA 4WVPE 5GJ4B 2VB0A 4WH6A 1N1LA 2CXVA 3VB5A 4NFFA 2XYAA 2GZ9A 1ZMNA 3K6ZA 2IJOB 3ODDA 1KTTB 4JZ1A 1LVYA 3U1IB 1INCA 3NK8A 2QF0A 2V35A 2BY7X 1EUFA 2H9EH 3GICB 3M5MA 4R0IA 3Q00A 4LXBH 3T26A 1SVPA 2ZQ2A 1THRH 3RC5A 3RXSA 1HRTH 2CV3A 2OXSA 4DG4A 2EEKA 3M5LA 1C9TA 3GDUA 3P8FA 2UUKB 3HK6B 5DP9A 3LJOA 3FZZA 2SGPE 1LVBA 3I29A 4KGAA 1Q2WA 2QF3A 5DP3A 2WYJA 4AORA 2BLWA 2BTCE 2G4UA 4MPUA 3A88A 4X6PA 7ESTE 3NXPA 1NY22 3M7UA 1FY8E 3B8JA 2PGBB 1HAGE 1QBOA 1VCQA 4WF8A 2STBE 1O2KA 2XNIA 2ZDKA 2H9TH 2VIPA 1O3PB 1S5SA 2D1JA 1FY3A 2P16A 4JZDH 4AYYB 1L1NA 1SGEE 1QJ6B 3M35A 3RXVA 1GJ5H 2FXRA 3UWIA 4Y79A 1BMMH 3P92A 1IQHA 1VITF 5FAHA 4H6TA 3MU0A 4KTSA 1NESE 2QV1A 2TBSA 5DPAA 2EI7A 4CRBA 3E1XB 1THSH 1AWHB 1LCYA 1VITH 2NU4E 1S6FA 2RA0A 3W95A 1Z7KA 2ZFFH 4A92A 2SGDE 1J16A 1WU1A 3A8BA 1GBJA 3ZZDA 1TFXA 1P2NA 1TA2A 2ANYA 1C5QA 1HJAC 1BOQA 1JOUB 1U6QA 2VIDA 1F5RA 1BBRK 4HZHA 3RLYH 3RXKA 1ESTA 9LPRA 2A0QB 4XFQA 1HJAB 5DJ7A 1E35B 3O8BA 4UFEH 1GMHG 1LPZB 1V2TT 3U8TH 2PFEA 1T7CA 1CGJE 4IC5A 3SGQE 3SJOA 3PMJA 2OTVA 3NZIA 5ESBA 4FUCA 1V2MT 1XUFA 1TIOA 1D3DB 1Y8TA 2QXGA 1TQ7B 5FBEA 1GMHF 2QXHA 3C27B 3LH1A 7GCHF 5A0BA 1GHZA 1C1UH 1N6XA 1V2KT 4OS2A 3RXCA 3MNSA 1ZSJA 3T25A 2UWLA 1DITH 3TJVA 5EGMA 3U9AH 2A1DB 2HVXA 4BOHA 1LQEA 3BG8A 3RLWH 4RKOB 4RN6A 2WPLS 3MO3A 4I7YH 1MCTA 1YPGH 4X2YA 1G32B 1QRZA 3NUMA 4ZH8A 3CENA 1O31A 4LZ4B 3EQ0H 2J2UA 2PV9B 2FIRH 4OS7A 3RMMH 2A5KA 4FUJA 3BV9B 2BY6X 2BD8A 3BEFB 1HGTH 1ZHMA 2FESH 1XUKA 3E90B 1KTSB 1FQ3A 1Q3XA 3FP7E 1IQEA 4YO9A 1T8NA 1A61H 4X8SH 4UFGH 2WPKS 1MD8A 4ABFA 5PTPA 1DSUA 1LQDB 2PSYA 4DCDA 1SFQB 2GCHG 5E2OA 1XKBC 2OBOA 4A7IB 3H5CB 1P0SH 1KSNA 5JB9S 1O5EH