1UJ1A

Crystal structure of sars coronavirus main proteinase (3clpro)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
301
structure length
301
Chain Sequence
b'FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title The crystal structures of severe acute respiratory syndrome virus main protease and its complex with an inhibitor
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 85
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 1uj1A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1uj1A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1uj1A02
1HBTH 1B5GH 2J95A 1AVGH 4ZHAA 2R0KA 1W11U 1NTPA 5E2OA 4ZXXH 4ABGA 4IN2A 4ZXYH 1QQUA 1G9IE 2OC1A 2THFB 3QTOH 2VIDA 3M3TA 2FX4A 3MU1A 1S81A 4A1XA 3QO6A 3V3MA 1PPZA 1PPHE 1TNLA 2ULLA 3BTKE 4ABDA 3PMJA 4FUDA 3FP6E 3I78A 1AVWA 3PLPA 4UFEH 1GJ4H 1E35B 3MO3A 2BDBA 1Y3XA 1GBDA 3VB6A 3PO1B 5DG6A 1FXYA 3TK5A 1O3BA 2I6QA 2DE9A 1GI0A 1ZRBA 5TCCA 1FDPA 4R0IA 3LH1A 2LIZA 2FIRH 3Q3XA 4AGKA 4CHAB 1MTNB 1MZAA 1WTGH 4BAOB 3U8TH 5TJXA 4B2BA 3MO6A 5FBIA 4ABBA 1YCPH 3MWIU 2VVUA 2Z94A 2LPRA 4NGAH 1MKWH 2ZHWH 3RXOA 2HNTF 5JBBS 3Q3YA 5T3HA 2NU0E 3KQCA 1UTJA 2YNBA 3C1KA 3MNCA 1GJ5H 3RXDA 2ZP0H 2GZ7A 1L2EA 2P3UB 3RXPA 1KDQA 4O03A 1JWTA 1NRSH 1TNHA 4D7FA 3MOCA 1NO9H 2AERH 4DIHH 1P04A 4YO9A 2A31A 2BHGA 1ELVA 1UTQA 1SB1H 1O2QA 1BTUA 3ZZAA 4Y0ZE 3KQDA 4A5TS 2Y6TA 1GMDF 3SNAA 2FZZA 4MLFB 2W7UA 3E90B 1SGNE 1EPTB 2GDEH 4FUHA 2EI6A 5E0GA 1BDAA 2D26C 2ZCKP 1ESAA 2FOCA 1AB9C 4AN7A 2TIOA 2XBVA 4H42U 2P3FH 4ZROA 1TPPA 4ISIH 2PUXB 1V2UT 2K1QA 4XBDA 5DP9A 1OP0A 1UVTH 4JZ1A 1UO6A 3GY5A 2FYQA 1Z8JB 3RU4T 3SUFA 3OX7U 1GG6B 4WH6A 2J38A 4ASHA 2GP9B 2BD3A 3EA8A 3A88A 3E3TA 2Z9GA 1K1NA 1K22H 2GX4A 3URDA 2OCVB 1GCDA 1P2JA 1DANH 5C1YA 3TJNA 1HAZB 1BTWA 5EQSA 3FAOA 3SHAH 1ZTJA 2GV7A 1O33A 3FP7E 4B75A 1D3QB 2FOGA 1GI2A 1WSSH 1C2HA 2P8OB 4PROA 2HNTE 3VXFH 5LH8A 3D62A 1GBTA 4H6TA 1NPMA 3LGIA 2BDCA 3ZV8A 1IQKA 2UUJB 2PTCE 4K2YA 5EODA 1GHZA 1AU8A 5EG4A 1C1MA 2HPQH 4HI3A 3NZIA 5C2ZA 3AAUA 2PFEA 2B9LA 2FM2A 1TQ0B 5FAHA 1BTZA 2ZTXA 4NWKA 1AHTH 1H1BA 1Y3VA 6CHAC 3QK1A 1A4WH 4OS1A 2QXJA 2ZECA 4TY6A 1DITH 1TNJA 4IGDA 4U2WA 1C5UA 3MTYA 5HXFA 1YLCA 4KELA 1KXEA 1SFIA 3SU4A 2BVRH 2ZGHA 4WH8A 1ZOMA 4AZ2B 1O2OA 1O3JA 1GBMA 5ESBA 4BOHA 5HGGA 1DS2E 5FXLA 3SNCA 4NFEA 2JETC 4NCYA 4X1PU 1SGYE 2A7CA 3O8RA 1NRRH 2ANWA 2GKVE 2XC0A 2F3CE 1CHOF 2TGAA 5DO4H 2J94A 1O3EA 3PWCA 4NG9H 5EXMA 3EE0B 1MKXK 1EZXC 2EI7A 4NFFA 3VPKA 2SGAA 3A8BA 4DVAU 5I25A 2BVSH 4AOQA 1P2OA 2Z6BD 1QJ1B 1EAUA 1XVMA 1SHHB 4BANB 2ZG0H 1AFQC 2OUAA 1GJ9B 8GCHF 1TA2A 7LPRA 3RXMA 3NWUA 1KLIH 1ELEE 4HZHA 1BB0B 2V6NA 2VU8E 3GYLB 2ZQ2A 3E6PH 7GCHG 4X8TH 1AWHB 2Z3CA 2FYRA 3BTME 6LPRA 3M7QA 4TPIZ 4O97A 3P8NA 2ALVA 1BTXA 2CF9H 1T8MA 4J1YA 2A4GA 3BEFB 2BLWA 1RTLA 3RU4D 1EATA 1QRWA 1KLTA 5E0HA 3PV4A 2ZFQH 1KSNA 1SGQE 4X6PA 1A0HB 1C1RA 2K7XA 1D6WA 2XC5A 3LJOA 4JK5A 1E38B 1NM6A 2BZ6H 2ANYA 1EX3A 3GCTF 2OLGA 1P9UA 2GCHF 1HFDA 2ZHQH 3UPEA 1UVUH 1ZPBA 3LKWA 1GHBF 1V2ST 1SBWA 4GHQA 4BAMB 1KIGH 2B5TB 2STAE 5GCHF 3CS7A 1HPGA 4CR9A 1WUNH 2G81E 3LJJA 1LHDH 1P2QA 4NSYA 4OGYA 3BSQA 1T8OA 4B2AA 1FN8A 4NIYA 1HXFH 5HMAA 1SQAA 1O3GA 2RG3A 4YOJA 1HGTH 1K1LA 3RM0H 4WMEA 5JDUB 1NZQH 3LC3A 4X1NU 3ZZ8A 1ANBA 1GJAB 1G37A 2J9NA 4FUCA 1CU1A 1L1JA 2A5IA 3LT3A 4I33A 1Q31A 3TGKE 4F49A 1O5GH 3ZVEA 4FU7A 1HB0B 1OSSA 1Y8TA 2HLCA 4TPYA 2OTVA 1TBRH 2QXGA 2F9PA 1D9IA 5HM9A 2FOEA 1W8BH 5C1XA 2A5AA 1XUHA 1OKXA 1TMTH 2Z9LA 1ELAA 1JRTA 4YESB 1MD8A 4TYDA 2VIOA 1O2MA 2AEIH 1MD7A 3LDXH 2PGQB 3A7WA 1AUTC 1WU1A 1P2NA 4YM9A 1QBOA 3VB3A 6CHAB 1FY4A 2ZWLH 3ZVFA 2F83A 1QFKH 1QIXB 1DLEA 1T31A 3PYHA 5J4SA 3Q77A 3S69A 2ZQ1A 5F8TA 1GHXH 5ESTE 2GZ8A 4I8LA 3MH4A 1GI7B 7KMEH 3UWIA 2FX6A 1NT1A 1ZZZA 1UVSH 2CJIA 1PPGE 5A8ZA 1QJ6B 1HV7A 2JETB 5JYIA 3K6YA 3RUOA 2ODYB 2ZFTA 5EOKA 1SLVB 3NUMA 4XBCA 4UEHH 4NIWA 2AMPA 1LPZB 2FODA 4DOQA 2ANMH 2O8TA 1SOZA 3TVJB 3RXJA 1BBRE 3RXHA 1W10U 1F0TA 1X7AC 1BJUA 1J16A 4NA9H 4K69A 1BBRH 2KAIB 2BDHA 5DK1A 3DFLA 1AFQB 2A7JA 3MI4A 2CF8H 4CBOA 5EQRA 3ELAH 1GDNA 3HKIB 1SG8B 3PTNA 2IPHA 3TGJE 2BLQA 5CMXH 3SHCH 1FAKH 5DJ7A 1AQ7A 1F2SE 4Q7XA 3JZ2B 1ZYOA 2JKHA 3ATLA 1O2XA 1DXPA 9ESTA 1KXBA 4D9RA 1TABE 2P3TB 3ZZ7A 3KQEA 1GI6A 2A7HA 3M3VA 4B73A 1GHVH 2PGBB 1C2GA 1MKWK 2ZDMA 2XCNA 2P93A 3BTGE 1C2DA 3SV7A 1SGEE 4TY7A 4KKDA 4E7NA 1K1OA 3A85A 2XTTB 3DFJA 2BD7A 1DOJA 2FOBA 2WPHS 1WQVH 1CQQA 5F8XA 3A82A 1TGCA 2ZHDA 4KTCA 1F5RA 1ELGA 1E36B 1OPHB 1ZSLA 1KTTB 5DPAA 4Y0YE 2W3IA 1C1TA 4WF8A 4AB9A 4Z6AH 2AIQA 4ABAA 1DT2A 3MH7A 1H9LB 1GBHA 3S9AA 1LTOA 1G3EA 2AGEX 2VH0A 3PLKA 1ANCA 2R3YA 3QWCH 1MTUA 2PKAA 4AORA 1DSTA 4NIVA 1GI3A 3U8RH 1DUEA 2BD8A 2ESTE 2PSXA 3KCGH 1V2TT 1ARBA 2VWOA 3BTDE 2VVVA 1MTVA 1PYTD 3A7TA 1BTHH 1XUFA 1V2MT 5J4QA 2NU3E 1ZTKA 3ZVAA 2ZFSA 3ODDA 3HATH 3URCA 4MPVA 3BEIB 5A8XA 3A84A 1Y3YA 3UR9A 1G3CA 2Q6FA 2ZGCA 2B7DH 2J92A 4NA7A 2Y5GA 1QY6A 1SPJA 1O2YA 2ANKH 3GDVA 4MTBA 2IN2A 4MG3A 1CBWC 1TPAE 1IOEA 4UE7H 2BB4A 1HAPH 2FLBH 1ZSJA 1KYNA 5JBAS 3ZYDA 3CP7A 3EDXB 1TE0A 2AS9A 1L1GA 1CGIE 3R3GB 3HPTB 4WVPE 3KGPA 1ELTA 1C5NH 1MH0A 3A80A 1FNIA 1O32A 2QYIA 1HAVB 1ZJKA 1O3MA 5IDKA 1GBLA 1Z8IB 1WTHD 2ZTYA 4OS4A 1BQYA 3TNTA 1Y3UA 5LGOA 3GISB 3RXSA 1IAUA 1LKBA 2TBSA 2VIWA 1LDTT 3IWMA 1O5AB 1B7XB 4LXBH 1C2FA 4LZ1H 3FANA 1Y5UT 3UQVA 2ODPA 4ESTE 5A0BA 3UWJH 2C90B 2F9NA 1GJ8B 3SN8A 3GCHC 2BM2A 3P17H 1P01A 2A4OA 2A45B 3BIUH 3TJOA 4OS5A 5PTPA 3Q76A 4WXVA 1MAYA 1VR1H 2QY0B 3HK3B 1SFQB 2ZFFH 6GCHG 3MNBA 1BRBE 1V2JT 3BV9B 4I31A 3KF2A 3SU1A 3K9XB 4E05H 4FUIA 2ASUB 7GCHF 1ZR0A 2V0BA 1G3BA 4MNVA 3OYPA 3BEUA 3SJIA 1S0RA 1BT7A 4D9QA 1C1WH 1O2LA 3I29A 2OINA 1EZSC 5EXLA 1TRMA 1MQ5A 4FUBA 1AGJA 2XRCA 4IC5A 2A1DB 2NU4E 3ZZ6A 3E0NB 2VVCA 1F5KU 3D23A 1UTPA 1V2WT 2STBE 3QX5H 1GJCB 1FZZA 4XOJA 3RDZA 4UD9H 1ETTH 3S9BA 1DWCH 1YLDA 3SV2H 1CGHA 2G00A 3KEEA 4MDSA 5DP6A 4Y71A 4I32A 3RP2A 1C5OH 1MTWA 3NKKA 5FPYA 1D3DB 4ABJA 4YT7H 1BUIA 2AYWA 4MNXA 3H5CB 3L3TA 2NU2E 1MCTA 5FPTA 1QBNA 1IHSH 1DY9A 3MNSA 3V12A 4D76A 3A87A 1GI9B 3ZZ3A 3RMNH 1KXFA 2BX4A 1TNGA 1THSH 3F9EA 1T4UH 5CHAC 1RIWC 4GSOA 2FOHA 3TH3H 3V7TA 3MH5A 2IOTA 4ZUHA 4GUXA 2OC7A 1O5EH 1N6YA 1YP9A 2BDYA 3M5LA 5EW1H 4SGAE 4Y79A 1FY3A 1D4PB 1SGRE 2G55A 1UJ1A 3AAVA 3ZZ4A 1TGBA 1BTYA 1GBCA 1P3EA 1ZGIA 3BTTE 3M7UA 1DSUA 1RTFB 2XW9A 1ZGVA 4D8NA 1F5LA 2A4QA 4YZUA 3S7KB 1O2TA 1VITF 5L2ZH 1L0ZA 1THPB 1OWIA 5FCKA 2ZDVH 2ZTZA 4IMQA 1MBMA 3SV9A 1BRUP 1IQHA 1O3LA 4CRAA 3MU8A 1JXPA 1A61H 4OGXA 3E0PB 2SFAA 5DP7A 2AH4X 1CBWB 1O3KA 3SUDA 1O0DH 1TRNA 1Y5AT 1AIXH 1GJ7B 2QF3A 1O2NA 2R0LA 1DWDH 1D3TB 1QTFA 2D1JA 5H4IB 2BQWB 1DWBH 1SGPE 1XX9A 1O3CA 4ABIA 1BMLA 4RN6A 1CSOE 4GAWA 2OBOA 1O2KA 1PPEE 5EU8A 4K1EA 1LQEA 2HVXA 1NC6A 3ESTA 3LGUA 1ZHRA 4ABFA 2BY6X 1EAWA 1FAXA 4GPGA 2GV6A 1XKAC 2FXRA 1CHGA 2Z9KA 2NU1E 2Q1JA 3SORA 4Y7BA 5FCRA 3IG6B 3T28A 1K2I1 3EA9A 2VINA 3GCHB 1IQJA 3SV8A 1P3CA 4TWWA 1AY6H 2AGGX 1ORFA 2ZHFH 4X2WA 2GCTC 2PLXA 2I6SA 3LU9B 1Z7KA 5A0AE 1BMNH 2WPLS 2YNAA 3BG4C 2W3KA 5DGJA 2TGDA 3QDZB 3ATMA 3RC4A 3VGCC 4FUJA 4Y6DA 2VJ1A 3O8CA 1NFUA 3HGNA 3T26A 1DLKB 1VITH 1FY1A 1ZMNA 3GY8A 2P95A 3ITIA 1BCUH 1DFPA 1Z6EA 2BQ6B 2Y80A 2BOHB 1HUTH 5A2MH 2BY9X 1BMMH 1GHWH 4UFGH 3M35A 1GI5A 3G01A 1MAXA 3RXTA 1NESE 1UCYE 3GY2A 2BDIA 1ZTLA 1S0QA 1V3XA 2ZHEH 3D65E 2Y7XA 4FUEA 1TGNA 2ZI2H 3SGAE 1BBRK 2UUFB 4O3TA 3TIUA 2PHBA 1UCYH 2PWXA 2HRVA 3BTHE 4UFDH 1FPCH 1NRQH 1SLWB 1O35A 2G5VA 1H8IH 3RXCA 2B0FA 1O5BB 1UTOA 4FUGA 4WJG2 2ILNA 1K1JA 1GGDC 3PMAB 4ZKNU 2VGCC 2TPIZ 3SU0A 3RXQA 4JCNA 1F0SA 1WV7H 1GMCF 5FBEA 4XFQA 1OWKA 4CRDA 3RC5A 1BMAA 1VCPA 1C5RA 1TALA 1RIWB 4YLQH 2ZDNA 2EA3A 5EPYA 4XE4A 2D8WA 4BAKB 1S83A 1TMBH 1W2KH 3OSYA 4K5ZA 1C2EA 2VIQA 1VCWA 1C2JA 5BRRE 1KTSB 1CT0E 4ZMAH 3RMLH 3TU7H 3AVZA 1AE5A 2XYAA 3GICB 4MNYA 1V2PT 2Y5HA 1W0ZU 1WCZA 4Y8YA 4A7IB 4I8JA 1TGSZ 3A86A 1TA6A 1WQSA 2ZEBA 3RXEA 1TIOA 5FPSA 4B76A 1C2KA 4ZHLU 3SGQE 3T27A 3U8OH 1DY8A 5JBCS 3M5OA 1WBGB 4A6LA 2ZFPH 3ZZ9A 5GDSH 3A7XA 4CR5A 4WMDA 5HM2A 4Q7YA 2CHAC 2PW8H 3A8AA 2FLRH 2J4IA 4DJZB 2BDGA 1P03A 2JH0D 2XXLA 3A8DA 1DDJA 1S82A 1CO7E 2ZGXH 2H2ZA 3IITA 1OYTH 1SGFA 2W26A 3TGIE 4INLA 1E34B 1A7SA 1AB9B 5GXPA 1MQ6A 3TITA 1O3HA 3PWBA 1VJ9U 5EXNA 2BYAX 2AMDA 3F68H 2CV3A 3VEQB 2ZCLP 3RXBA 2J34A 3QTVH 5JB8S 2O8MA 4CH8B 3VB5A 1HRTH 1QL9A 2VWNA 3ENSB 4I8KA 4DW2U 3SNEA 2HOBA 1HYLA 3O8DA 1CT2E 1NY22 2ZA5A 3T29A 2XBWA 1EASA 2C4FH 2F9BH 4NA8A 1J15A 1O5DH 1QL7A 1C4U2 2BD4A 3RXVA 1V2NT 2ZGJA 1HAHH 3UOPA 1T8LA 1TOMH 3SQEE 5A8YA 1TAWA 1SLXB 3KL6A 4H4FA 4YTAA 1GBFA 1GVKB 3FVFB 1OWJA 2Q6GA 3SZNA 2YOLA 3GOVB 1OXGA 1V2RT 2FI5E 1H4WA 2GCTB 4LOYH 1NU9A 2ZZUH 1N1LA 3SJKA 2ZCHP 3GY7A 3BG4B 3UREA 1GBBA 1HNEE 3M3SA 4U30A 4K60A 4KTSA 4RKJB 2PKSC 1O3FA 1YPEH 1ELCA 2EC9H 3OY6U 4CBNA 3S9CA 1O2GH 2RCEA 3PROA 1YPKH 1O2ZA 3SV6A 5A0CA 3GY4A 2A32A 1LO6A 3MO9A 1O38A 1AZZA 1NFWA 5GPIB 1P57B 2RA3A 1KXCA 1OWDA 2CGAA 2R2WU 5C67A 5ABWA 1QB1A 1AKSB 1C5MD 1WOFA 3LPRA 1QB6A 1S6FA 1MMJN 1LHCH 2PSYA 4B71A 1OP2A 1DWEH 1TX8A 2FPZA 3EA7A 4J2YB 4DURA 4INHA 1O5FH 1GGDB 1RJXB 1TRYA 3MFJA 3ZV9A 1QCPA 2VGCB 1K1IA 4D7GA 2M5TA 2ZU2A 1ANDA 4MQAA 1C9TA 1UHBB 1QQ4A 3E1XB 4NZLA 1ELDE 3KIDU 2KAIA 2J2UA 1A0JA 1RFNA 1T8NA 4IW4E 3D49H 1C1NA 1KXAA 1O2JA 3B9FH 5FHTA 1LVMA 3M36A 4O9VA 1GDUA 1PQ5A 4GVUA 4JZIA 1UK4A 5ETXA 3ZVGA 5LPFA 2F9OA 1ZRKA 2FO9A 2A2QH 1FIWA 1K28D 3SOSA 3STJA 3MYWA 4CRFA 5CE1A 1FLEE 1C1PA 5K0HA 1XUKA 2BD9A 3SU2A 3A81A 4BTIB 2OQUA 1AN1E 1V2LT 1KLJH 2ZFRH 1MU8B 2BXTH 3GCOA 1IQFA 1AE8H 1EKBB 1TQ7B 2CHAB 2VWMA 1BIOA 1FY5A 1TGTA 1Z6JH 2UWOA 3LGYA 4SGBE 4B2CA 2BY7X 3SUGA 3BTWE 1LPKB 1YCPK 4DT7B 3BN9A 4AX9H 5T6FA 1G2LA 2C8XB 1W7GH 3GDSA 2V35A 4XBBA 3K65B 1KY9A 1P02A 4X2XA 2RA0A 1K1MA 5TCAA 1YPLH 1P9SA 1CVWH 1MKXH 1UTNA 1GVZA 2GT8A 1C5XB 5L6NH 2BQ7B 4UONA 1NFYA 3KNXA 1N6XA 3PMHB 3GDUA 4IBLH 2OD3B 3GCNA 4YOGA 7ESTE 1CA0C 2GDDA 1EAIA 1DE7H 1C5LH 1Z1JA 2WYGA 1J8AA 1BHXF 2BLOA 3LGVA 3RXGA 3PM3A 3PMBB 1FIZA 4Y8ZA 3JZ1B 1C2IA 1S6HA 1CHOG 4OS2A 4KP0A 3MU5A 4Q7ZA 2GMTC 2PKSB 4MPWA 2XBXA 3EYDA 2H5DA 3VFEA 3F9HA 4HGCA 4Q80A 1JBUH 1VCQA 1QRXA 1HAVA 1BHXB 5C3NA 3P92A 3U1IB 2UUYA 3DA9B 2FI4E 4BAQB 2ZO3H 1IQNA 4MPUA 1C5YB 2TGPZ 4CRBA 2OC8A 5EQQA 1T32A 1L4DA 3HK6B 1QURH 4E06H 3S0NA 1GBJA 3B23B 5F8ZA 1TX7A 1GDQA 2HPPH 3AASA 3U98H 1QA7A 1DXWA 1O2HA 2ZPQA 3MU0A 2BY5X 1XUJA 4I8GA 1JIRA 4ISOA 4ZHMU 4BXSA 4CH2B 2VH6A 1SGFG 2SGPE 1AFEH 4WXIA 1ZMLA 5L2YH 4OS6A 3SJ9A 2ZU5A 1YPGH 1O37A 1GJDB 1ZPCA 1ZHPA 4YLUA 1QRZA 1B0FA 1V2OT 2ZDAH 5BPEA 2AIPA 4IS5A 1JOUB 2P16A 2G4UA 3V0XA 1ACBE 4DIIH 1H9HE 2ODQA 4F4OC 2BMGB 1Y3WA 4AYVB 1HJ9A 1PYTC 1P2IA 1O3IA 3GCTG 1H8DH 1C5TA 3UQOA 3RU4E 3FZZA 1GHBG 1C2LA 1HIAB 3A89A 1Y59T 1PQ7A 1DPOA 4K8YA 5GCHG 4AFZA 1ARCA 2G52A 2XWAA 5DP4A 4WWYA 1O2WA 4WY3A 1Z8RA 2A0QB 3ZVDA 4JZDH 1V2KT 3STIA 2AMQA 5C5OA 2BLVA 5B6OA 3SNBA 1PQAA 3H7TA 3QZRA 3PTBA 4GLYA 1QNJA 2VWLA 2OP9A 3U9AH 1RS0A 1AZ8A 4DCDA 2QV1A 2Z7FE 3RM2H 1CE5A 4BXWA 1F92A 2WPIS 1A0LA 2R2MB 5C20A 3UR6A 3BTFE 1DVAH 4X6OA 1BA8B 3FZDA 1CGJE 1O30A 1VGCC 3TK9A 3OTJE 3QLPH 3P8OA 1SGTA 2AFQB 1SQTA 1TFXA 2LNCA 5JB9S 2ZU3A 1P2KA 3QZQA 1OP8A 1W14U 4BTUB 2ZGBH 4UFFH 3ATIA 4X8UH 3ZZCA 2BX3A 3EQ0H 1LVBA 4NIXA 1CA0B 2GZ9A 1SGIB 4X2YA 5K7RA 1YF4A 1FPHH 2WUCA 2QC2A 3E16B 1GCTC 2G8TA 1EXFA 2HWLB 4H6SB 2ALPA 3SO3A 4NWLA 2GD4B 2ZU4A 4MPXA 4NZQA 2BD5A 1EPTA 1EB1H 1FI8A 1NN6A 1UVPA 1GHAG 1QA0A 3O8BA 4FVBA 1NRNH 1FUJA 2VIVA 3HGPA 2GMTB 4ZKRU 1YYY1 1XXFA 2F91A 4K1SA 3WY8A 4AFUA 2FEQH 2VIPA 3GYMA 3P8GA 1L1NA 4TWYA 5A09A 9LPRA 2TRMA 1PFXC 1YPMH 1P09A 1C1VH 4X8SH 5SGAE 3TLOA 2R9PA 1Z8GA 1JRSA 5I46H 1CA8B 5E0JA 3ATKA 3KQBA 1ANEA 1E0FD 2Y82A 5AF9H 2ZDKA 2SGQE 4Y76A 1S85A 3MHWU 3DUXH 3TJUA 3LC5A 3UNQA 2VNTA 1ABIH 5E2PA 1AI8H 1KDQB 1XKBC 4XSKU 2QXHA 3SGBE 1O5CB 2NWNA 1HXEH 1UTMA 1H9IE 4I7YH 3TH2H 2Z3EA 1LKAA 1QGFA 1C5VA 3PB1E 2HGTH 1RXPA 2WV4A 1PJPA 3SU3A 1LVOA 3LOXA 1EJMA 2HALA 4HFPB 5GWZA 3R0FA 1TMUH 1ZMJA 4RSPA 1C5QA 5AFZH 1QHRB 4ABEA 1BJVA 2BZAA 4X6MA 2G5NA 1FQ3A 3P95A 1SHYA 3RXAA 1N8OC 2QA9E 4X1QU 1FN6A 2QAAA 2WINI 1TPSA 1BITA 2Z9IA 1MCVA 1ZJDA 2BVXH 1UK2A 5AFYH 1MUEB 2SGEE 3RXLA 1F0UA 2V3HH 3A7VA 1LVYA 4QT8C 1GWAA 1C5ZB 3P70B 3A83A 2BXUH 3T62A 1G30B 3L33A 4Y7AA 3NCLA 1GPZA 1O3AA 2FMJA 3E8LA 3SUEA 3KHVA 1WAYB 3VB4A 4RKOB 3RXKA 1OWHA 5C1UA 1GL0E 1AWFH 2BDAA 1GJ6A 2FDAA 4ZAEA 5FX6A 5T6DA 1GMHG 1AUJA 5T6GA 1V2QT 1MBQA 2BOKA 3BF6H 2CN0H 1EJNA 4AFQA 1NU7B 1A2CH 1THRH 5DP3A 5EW2H 4X8VH 1T7CA 4KTUA 2FTLE 1PPFE 3VB7A 1VGCB 2RDLA 2Y81A 4KGAA 1A5HA 1AVXA 1MU6B 3ZZ5A 1C2MA 4NSVA 3DT0H 2UWPA 1BRAA 2Y5FA 2AGIX 4JYVH 3RLYH 2C3SA 1ID5H 2FS8A 2PR3A 1FV9A 4ZH8A 5CHAB 1C1UH 4AYYB 1S84A 1MTSA 1D3PB 4R8TB 2XNIA 2H5CA 2QGRA 4GCHG 1LMWB 3SQHE 4DGJA 2QCYA 3P6ZB 5EGMA 5F6MA 4UDWH 1Y5BT 5JBTA 5LPEA 5IYTA 1A1RA 1PPBH 5DP5A 1GCTB 1P05A 4DY7B 4A92A 1JMOH 4Q2KA 3LIWA 1BZXE 1T4VH 3KN2A 5AHGH 1DICA 1A5GH 1W0YH 1SOTA 1UTLM 1Q3XA 1FY8E 3TNSA 4Y10E 1P10A 4WMFA 2WPMS 1AMHA 3F6UH 4JMYA 2WYJA 1D6RA 4HTCH 1HLTH 5GIBA 1GL1A 2DE8A 3RLWH 1LQDB 1M9UA 4JYUH 2XCFA 1S5SA 2F9VA 4U32A 2ZDLA 2FOMB 1O3OA 1ETRH 1XMNB 2OQ5A 3LGWA 3UIRA 2JH5D 1HAGE 1EZUC 3BTEE 2ZF0H 1VZQH 1SVPA 3CENA 2SNWA 2SGDE 1O3PB 1MZDA 1QR3E 4AFSA 1V2VT 3GY3A 3RXIA 1OWEA 3BIVH 4IMZA 2Z9JA 3RMOH 2O8UA 2EI8A 3QGJA 3QGNB 1GBKA 4A1VA 3RMMH 1YGCH 1IHTH 1O3NA 4MVNA 1EOJA 1E37B 1TPOA 3PLBA 1VJAU 3UY9A 2B8OH 5AVDA 1B0EA 1OOKB 1P8VC 2UUKB 6GCHF 4K1TA 1G2MA 1SC8U 2QXIA 1NRPH 2FS9A 5LPRA 1HDTH 3H7OA 3ZZBA 1N8OB 2VB0A 1EUFA 1P06A 3QUMP 2PV9B 1HAIH 4FUFA 1TNKA 1IQEA 4B1TA 3EGKH 2QN5T 3VGCB 1TB6H 3P8FA 1AKSA 1HAYB 1C4Y2 2P94A 3A7YA 2BY8X 1EQ9A 1BRCE 1IQIA 1F0RA 1O2VA 2PUQH 3U1JB 3MMGA 4E7RG 3B8JA 1Z1IA 1YPHC 2FESH 1XUGA 2ZU1A 3FFGA 1J17T 1L4ZA 1TX6A 4MNWA 4AB8A 2WV5A 4X1SU 1VITG 2JH6D 1RD3B 1O3DA 3UUZA 4ABHA 3SI3H 1NROH 1UK3A 1UHBA 2W7SA 3OU0A 4ISLA 3VXEH 1XUIA 1GMDG 1G32B 2ZPRA 3A7ZA 2R3UA 5DKMA 1ELBA 3TPIZ 3EAJA 1SSXA 5GJ4B 3K6ZA 4IN1A 3MU4A 4FVDA 3L6PA 1SGDE 1ZLRA 2V3OH 1AO5A 4VGCC 1C1SA 1IQMA 4K3JA 1IQLA 3M7TA 3DD2H 2GVFA 1AD8H 2FTMA 4JK6A 1BTPA 1WYKA 2XWBI 3SJ8A 3AW1A 1SGCA 1HJAC 1O31A 1INCA 4CRGA 2IJOB 2OC0A 3TH4H 1GI1A 2SNVA 1TBZH 1GHAF 3SJOA 1XXDA 1OS8A 3RXRA 3T5FH 4JZFH 8KME2 4K8BA 4X0WU 1LCYA 1U6QA 1BOQA 4Y8XA 2W5EA 1ETSH 4B74A 4LZ4B 3SU5A 2C93B 4O3UA 4ZKOU 4M7GA 1C5WB 3ZYEA 3UTUH 1QB9A 3LGTA 1DM4B 4A1TA 2GT7A 2Z3DA 1ABJH 1NS3A 4X2VA 1YM0A 1TONA 1LHEH 3UNSA 1RGQA 2GGVB 2WPKS 5FX5A 1Q2WA 2QF0A 3UOUA 4ISHH 4THNH 1DX5M 1GJBB 2FP7B 2QIQA 3A8CA 1A5IA 2H9TH 3SI4H 1FMGA 1XM1A 5G4BA 1YBWA 1UVOA 4ZKSU 1P12E 3NK8A 3NXPA 3TK6A 1W7XH 1IQGA 1HCGA 1W12U 2H6MA 2OBQA 4OS7A 1C1QA 2SGFE 1PQ8A 1O2IA 3UNRA 1P0SH 2CXVA 4FU9A 1K21H 1Z71A 2H1UA 4BTTB 3RC6A 1EAXA 3U69H 4I8HA 1O2RA 1QJ7B 1TBQH 1SR5C 1W3CA 1TLDA 3CS0A 3FP8E 3SU6A 3F9FA 3RXUA 2C8YB 3T2NA 4DG4A 2FWWA 2BD2A 5DP8A 4FU8A 1PPCE 4JZEH 3BG8A 1ELFA 1NFXA 1O2SA 1O39A 3PO1C 4BNRA 3EBNA 3F1SB 4ISNA 3I77A 4FXGH 2UWLA 2ZC9H 5EPNA 1GMCG 2ZIQH 3T25A 4CHAC 1MTNC 1HAOH 1G3DA 2P59A 1EP6A 1KXDA 4XDEA 2D2DA 1C5SA 1UTKA 1QBVH 2A2XH 3NPSA 2EEKA 1F7ZA 4AGJA 2O8LA 2O8WA 5L30H 2C8ZB 3SNDA 3ODFA 4INKA 4JYTA 1YPJH 3C27B 1ZHMA 1GBIA 2G51A 1SQOA 2WUBA 2PKAB 3K2UA 1JIMA 1GMHF 2OXSA 3M61U 2BTCE 2FOFA 1TNIA 4CREA 1GVLA 2XBYA 1GBEA 8GCHG 2F9UA 3LONA 1CT4E 2WPJS 3ZVBA 1LHFH 3W94A 5F03A 3S7HB 2O9QA 1V6DA 1XVOA 1O2UA 1C1OA 3AW0A 1QL8A 1A3BH 4YOIA 5C5NA 1ESTA 1ZPZA 1O34A 1RRKA 3UFAA 3V13A 1GHYH 4X1RU 4IC6A 1C9PA 1C5PA 2HNTC 1EPTC 4CRCA 4AG1A 1YKTA 3N7OA 1SLUB 2TGTA 1A3EH 3Q00A 5JPMH 1TWXB 1SMFE 2Y7ZA 8LPRA 4X6NA 4GCHF 4VGCB 3W95A 3F9GA 2FI3E 1HIAA 1YCPM 3DHKH 1O36A 1GI4A 2H9EH 5HYOA 2DUCA 1EP5A 1W13U 1P11E 2ZNKH 3BTQE 2H9HA 1K1PA 3RXFA 2CMYA 1A46H 3GY6A 1K9OE 1HJ8A 6ESTA 1GG6C 1FJSA 3ZVCA 2G4TA 2GCHG 4Z0KA 3M5MA 1EZQA 1HJAB 1UCYK 5E8EH 3TJVA 2PTNA 1TOCB 2Q6DA 1UMAH 1YPHE 1EJAA 1O2PA 3MNXA 4GHTA 2GTBA 3LH3A 2XC4A 1HAXB 4U01A 3QN7A 1DUAA 3E91A 1ZSKA 3ATWA 3M5NA 1EOLA 1J14A 2A5KA 4AG2A 3M37A 8ESTE 3SBKA 2P8OC 1C4V2 3ZZDA 1SI5H 1RTKA 1P2MA 2C8WB 1SL3A 2FOAA 3SW2B 3MH6A 1OYQA 1FONA 4LK4A 1J9CH 4BAHB 1EB2A 1ESBA 1TYNA 2ZPSA 2ZKSA 3OY5U 1GBAA 1LHGH 3HKJB 1YC0A 1GI8B 4Y11E 2A4RA 1LPGB 4YT6H 1G36A 3Q3KA 1OX1A
chains in the Genus database with same CATH superfamily
1HBTH 1B5GH 2J95A 1AVGH 4ZHAA 2R0KA 1W11U 1NTPA 5E2OA 4ZXXH 4ABGA 5C94A 4IN2A 4ZXYH 1QQUA 1G9IE 2OC1A 2THFB 3QTOH 2VIDA 3M3TA 2FX4A 3MU1A 4FOUC 1S81A 4A1XA 3QO6A 3V3MA 1PPZA 1PPHE 1TNLA 1VKYA 2ULLA 3BTKE 4ABDA 3PMJA 4FUDA 3FP6E 3I78A 1AVWA 3PLPA 4UFEH 4F48B 1GJ4H 1E35B 3MO3A 2BDBA 1Y3XA 1GBDA 3VB6A 3PO1B 5DG6A 1FXYA 3TK5A 1O3BA 2I6QA 2DE9A 1GI0A 1ZRBA 5TCCA 1FDPA 1SQRA 3F0PA 4R0IA 3LH1A 2LIZA 2FIRH 3Q3XA 4AGKA 4CHAB 1MTNB 2JJ1D 1MZAA 1WTGH 4BAOB 3U8TH 5TJXA 4B2BA 3MO6A 5FBIA 4ABBA 1YCPH 3MWIU 2VVUA 4RI0A 2Z94A 2LPRA 4NGAH 1MKWH 2ZHWH 3RXOA 3DSGA 2HNTF 5JBBS 3Q3YA 5T3HA 2NU0E 3KQCA 1UTJA 2YNBA 3C1KA 2QF4A 3MNCA 1GJ5H 3RXDA 2ZP0H 2GZ7A 1L2EA 2P3UB 3RXPA 1KDQA 4O03A 1JWTA 1NRSH 1TNHA 4D7FA 3MOCA 1NO9H 2AERH 4DIHH 1P04A 4YO9A 2A31A 2BHGA 1ELVA 1UTQA 1SB1H 1O2QA 3H09A 1BTUA 3ZZAA 4Y0ZE 3KQDA 4A5TS 2Y6TA 1GMDF 3SNAA 2FZZA 4MLFB 2W7UA 3E90B 1SGNE 1EPTB 2GDEH 4FUHA 2EI6A 5E0GA 1BDAA 2D26C 2ZCKP 1ESAA 2FOCA 1AB9C 4AN7A 2TIOA 2XBVA 4H42U 2P3FH 4ZROA 1TPPA 4ISIH 2PUXB 1V2UT 2K1QA 4XBDA 5DP9A 1OP0A 1UVTH 4JZ1A 1UO6A 3GY5A 2FYQA 1Z8JB 3RU4T 4B6EA 3SUFA 3OX7U 1GG6B 4WH6A 2J38A 4ASHA 2GP9B 2BD3A 3EA8A 3A88A 3E3TA 2Z9GA 1K1NA 1K22H 2GX4A 3URDA 2OCVB 1GCDA 1P2JA 1DANH 5C1YA 3TJNA 1HAZB 1BTWA 5EQSA 2QF5A 3FAOA 3SHAH 1ZTJA 2GV7A 1O33A 3FP7E 4B75A 1D3QB 2FOGA 1GI2A 1WSSH 1C2HA 2P8OB 4PROA 2HNTE 3VXFH 5LH8A 3D62A 1GBTA 4H6TA 1NPMA 3LGIA 2BDCA 3ZV8A 1IQKA 2WSSD 2UUJB 2PTCE 4K2YA 5EODA 1GHZA 1AU8A 5EG4A 1C1MA 2HPQH 4HI3A 3NZIA 5C2ZA 3AAUA 2PFEA 2B9LA 2FM2A 1TQ0B 5DN6D 5FAHA 1BTZA 2ZTXA 4NWKA 1AHTH 1H1BA 1Y3VA 6CHAC 3QK1A 3FKSD 1A4WH 4OS1A 2QXJA 2ZECA 4TY6A 1DITH 1TNJA 4IGDA 4U2WA 1C5UA 3MTYA 5HXFA 1YLCA 4KELA 1KXEA 1SFIA 3SU4A 2BVRH 2ZGHA 4WH8A 1ZOMA 4AZ2B 1O2OA 1O3JA 1GBMA 5ESBA 3PV2A 4BOHA 5HGGA 1DS2E 5FXLA 3SNCA 4NFEA 2JETC 4NCYA 4X1PU 1SGYE 2A7CA 5FL7D 3O8RA 1NRRH 2ANWA 3UB0A 2GKVE 2XC0A 3DSPA 2F3CE 1CHOF 2TGAA 5DO4H 2J94A 1O3EA 3PWCA 4NG9H 5EXMA 3EE0B 1MKXK 1EZXC 2EI7A 4NFFA 3VPKA 2SGAA 3A8BA 4DVAU 5I25A 2BVSH 4AOQA 1P2OA 2Z6BD 1QJ1B 1EAUA 1XVMA 1SHHB 2HLDD 4BANB 2ZG0H 1AFQC 2OUAA 1GJ9B 8GCHF 1TA2A 7LPRA 3RXMA 3NWUA 1KLIH 1ELEE 4HZHA 1BB0B 2V6NA 2VU8E 3GYLB 2ZQ2A 3E6PH 7GCHG 4X8TH 1AWHB 2Z3CA 2FYRA 3BTME 6LPRA 3M7QA 4TPIZ 4O97A 3P8NA 2ALVA 1BTXA 2CF9H 1T8MA 4J1YA 2A4GA 3BEFB 2BLWA 1RTLA 3RU4D 1EATA 1QRWA 1KLTA 2RFKC 5E0HA 3PV4A 2ZFQH 1KSNA 1SGQE 4X6PA 1A0HB 1C1RA 2K7XA 1D6WA 2XC5A 3LJOA 4JK5A 5HIYA 1E38B 1NM6A 2BZ6H 2ANYA 1EX3A 1WDIA 2YMSC 3GCTF 2OLGA 1P9UA 2GCHF 1HFDA 2ZHQH 3UPEA 1UVUH 1ZPBA 3LKWA 1GHBF 1V2ST 1SBWA 4GHQA 4BAMB 1KIGH 2B5TB 2STAE 5GCHF 3CS7A 1HPGA 4CR9A 1WUNH 2G81E 3LJJA 1LHDH 1P2QA 4NSYA 4OGYA 3BSQA 1T8OA 4B2AA 1FN8A 4NIYA 1HXFH 5HMAA 1SQAA 1O3GA 2RG3A 4YOJA 1HGTH 1K1LA 4Q63A 4WMEA 3RM0H 1NZQH 5JDUB 3LC3A 4X1NU 3ZZ8A 1ANBA 1GJAB 1G37A 2J9NA 3PRDA 4FUCA 1CU1A 1L1JA 2A5IA 3LT3A 4I33A 1Q31A 3TGKE 4F49A 1O5GH 3ZVEA 2LELA 4FU7A 1HB0B 1OSSA 1Y8TA 2HLCA 4TPYA 2OTVA 1TBRH 2QXGA 2F9PA 1D9IA 5HM9A 2FOEA 1W8BH 5C1XA 2A5AA 1XUHA 1OKXA 1TMTH 2Z9LA 1ELAA 1JRTA 4YESB 1MD8A 4TYDA 2VIOA 1O2MA 2AEIH 1MD7A 3LDXH 2PGQB 3A7WA 1AUTC 1WU1A 1P2NA 4YM9A 1QBOA 3VB3A 6CHAB 1FY4A 2ZWLH 3ZVFA 2F83A 2V7QD 1QFKH 1QIXB 1DLEA 1T31A 3PYHA 5J4SA 3Q77A 3S69A 2ZQ1A 5F8TA 1GHXH 5ESTE 2GZ8A 4I8LA 3MH4A 1GI7B 7KMEH 3UWIA 2FX6A 1NT1A 1ZZZA 1UVSH 2CJIA 1COWD 1PPGE 5A8ZA 1QJ6B 1HV7A 2JETB 5JYIA 3K6YA 3RUOA 2ODYB 2ZFTA 5EOKA 1SLVB 1NBMD 3NUMA 4XBCA 4UEHH 4NIWA 2AMPA 1LPZB 2FODA 4DOQA 2ANMH 2O8TA 1SOZA 3TVJB 3RXJA 3GS9A 1BBRE 3RXHA 1W10U 1F0TA 1X7AC 1BJUA 1J16A 4NA9H 4K69A 4XRNA 1BBRH 2KAIB 2BDHA 5DK1A 3DFLA 1AFQB 2A7JA 3MI4A 2CF8H 4CBOA 5EQRA 3ELAH 1GDNA 3HKIB 3OE7D 1SG8B 3PTNA 2IPHA 3TGJE 2BLQA 5CMXH 3SHCH 1FAKH 5DJ7A 1AQ7A 1F2SE 4Q7XA 2KCOA 3JZ2B 1ZYOA 2JKHA 3ATLA 1O2XA 1DXPA 9ESTA 1KXBA 4D9RA 1TABE 2P3TB 3ZZ7A 3KQEA 1GI6A 2A7HA 3M3VA 4B73A 1GHVH 2PGBB 1C2GA 2KM0A 3SZEA 1MKWK 2J5UA 2ZDMA 2XCNA 2P93A 3BTGE 1C2DA 3SV7A 1SGEE 4TY7A 4KKDA 2KCAA 4E7NA 1K1OA 3A85A 2XTTB 4ACBA 3DFJA 2BD7A 1DOJA 2FOBA 2YMSB 2WPHS 1WQVH 1CQQA 5F8XA 3A82A 2F43B 1TGCA 2ZHDA 4KTCA 1F5RA 1ELGA 1E36B 1OPHB 1ZSLA 1KTTB 5DPAA 4Y0YE 2W3IA 1C1TA 4WF8A 4AB9A 4Z6AH 2AIQA 4ABAA 1DT2A 3MH7A 1H9LB 1GBHA 3S9AA 1LTOA 1G3EA 2AGEX 2VH0A 3PLKA 1ANCA 2R3YA 3QWCH 1MTUA 2PKAA 4AORA 1DSTA 4NIVA 1GI3A 3U8RH 1DUEA 2BD8A 2ESTE 2PSXA 3KCGH 1V2TT 1ARBA 2VWOA 3BTDE 2VVVA 1MTVA 1PYTD 3A7TA 1BTHH 1XUFA 1V2MT 5J4QA 2NU3E 1ZTKA 3ZVAA 2ZFSA 3ODDA 3HATH 3URCA 4MPVA 3BEIB 5A8XA 3A84A 1Y3YA 3UR9A 4ASUD 1G3CA 2Q6FA 2ZGCA 2B7DH 2J92A 4TT3D 4NA7A 2Y5GA 1QY6A 2W6ID 1SPJA 1O2YA 2ANKH 3GDVA 4MTBA 1OHHD 2IN2A 4MG3A 1CBWC 1TPAE 1IOEA 4UE7H 2BB4A 2J98B 1HAPH 2FLBH 1ZSJA 1KYNA 5JBAS 4B6FA 3ZYDA 3CP7A 3EDXB 1TE0A 2AS9A 1L1GA 1CGIE 3R3GB 3HPTB 4WVPE 3KGPA 1ELTA 1C5NH 5EJZA 3KYGA 1MH0A 3A80A 1FNIA 1O32A 2QYIA 1HAVB 1ZJKA 1O3MA 5IDKA 1GBLA 1Z8IB 1WTHD 3AK5A 2ZTYA 4OS4A 1BQYA 3TNTA 1Y3UA 5LGOA 3GISB 3RXSA 1IAUA 1LKBA 2TBSA 2VIWA 1LDTT 3IWMA 1O5AB 1B7XB 4LXBH 1C2FA 4LZ1H 3FANA 1Y5UT 3UQVA 2KCYA 2ODPA 4ESTE 5A0BA 3UWJH 2C90B 2F9NA 1GJ8B 3N7EA 3SN8A 3GCHC 2BM2A 3P17H 1P01A 2A4OA 2A45B 3BIUH 3TJOA 4OS5A 5PTPA 3Q76A 4WXVA 1MAYA 1VR1H 1YY3A 2QY0B 3HK3B 1SFQB 2ZFFH 6GCHG 4XD7D 3MNBA 1BRBE 1V2JT 3BV9B 4I31A 3KF2A 3SU1A 3K9XB 4E05H 4FUIA 2ASUB 3PRBA 1ZR0A 7GCHF 2V0BA 1G3BA 4MNVA 1SKYE 3OYPA 3BEUA 3SJIA 1S0RA 1BT7A 4D9QA 1C1WH 1O2LA 3I29A 2OINA 1EZSC 5EXLA 1TRMA 2RDEA 1MQ5A 4FUBA 3WW7A 1AGJA 2XRCA 4IC5A 2A1DB 2NU4E 3ZZ6A 3E0NB 2VVCA 1F5KU 3D23A 1UTPA 1V2WT 2STBE 3QX5H 1GJCB 1FZZA 4XOJA 5EJLA 3RDZA 4UD9H 1ETTH 3S9BA 1DWCH 1YLDA 3SV2H 1CGHA 2G00A 3KEEA 4MDSA 5DP6A 4Y71A 4I32A 3RP2A 1C5OH 1MTWA 2IPQX 3NKKA 5FPYA 4P02A 1D3DB 4ABJA 4YT7H 1BUIA 2AYWA 4MNXA 3H5CB 3L3TA 2NU2E 1MCTA 4F55A 5FPTA 1QBNA 1IHSH 1DY9A 3MNSA 3V12A 4D76A 3A87A 1GI9B 3ZZ3A 3RMNH 1KXFA 2BX4A 2IJD1 1TNGA 1THSH 3F9EA 1T4UH 5CHAC 1RIWC 4GSOA 2FOHA 5CHBA 3TH3H 3V7TA 3MH5A 2IOTA 1W0JD 4ZUHA 4GUXA 2OC7A 1O5EH 4YXWD 1N6YA 1YP9A 2BDYA 3M5LA 5EW1H 4SGAE 4Y79A 1FY3A 1D4PB 1SGRE 2G55A 1UJ1A 3AAVA 3ZZ4A 1TGBA 1BTYA 1GBCA 1P3EA 1ZGIA 3BTTE 3M7UA 1DSUA 1RTFB 2XW9A 1ZGVA 4D8NA 1F5LA 2A4QA 4YZUA 3S7KB 1O2TA 1VITF 5L2ZH 1L0ZA 1THPB 1OWIA 5FCKA 2ZDVH 2ZTZA 4IMQA 1MBMA 3SV9A 1BRUP 1IQHA 1O3LA 4CRAA 4Q4LA 3MU8A 1JXPA 1A61H 4OGXA 3E0PB 2SFAA 5DP7A 2AH4X 1CBWB 1O3KA 3SUDA 1O0DH 2CK3D 1TRNA 3F2FA 1Y5AT 1AIXH 1GJ7B 2QF3A 1O2NA 2R0LA 1DWDH 1D3TB 1QTFA 2D1JA 5H4IB 2BQWB 1DWBH 1SGPE 1XX9A 1O3CA 4ABIA 1BMLA 4RN6A 1CSOE 4GAWA 2OBOA 1O2KA 1PPEE 5EU8A 4K1EA 1LQEA 2HVXA 1NC6A 3ESTA 3LGUA 1ZHRA 4ABFA 2F4LA 2BY6X 1EAWA 1FAXA 4GPGA 2GV6A 1XKAC 2FXRA 1CHGA 2Z9KA 2NU1E 2Q1JA 3SORA 4Y7BA 5FCRA 3IG6B 3T28A 1K2I1 3EA9A 2VINA 3GCHB 1IQJA 3SV8A 1P3CA 4TWWA 1AY6H 2AGGX 1ORFA 2ZHFH 4X2WA 2GCTC 2PLXA 2I6SA 3LU9B 1KMHB 1Z7KA 5A0AE 1BMNH 2WPLS 2YNAA 3BG4C 2W3KA 5DGJA 2TGDA 3QDZB 3ATMA 3RC4A 3VGCC 3VG8A 4FUJA 4Y6DA 3UAIC 2VJ1A 3O8CA 1NFUA 3HGNA 3T26A 1DLKB 1VITH 1FY1A 1ZMNA 3GY8A 3N99A 2P95A 5B6LA 3ITIA 1BCUH 1DFPA 1Z6EA 2BQ6B 2Y80A 2BOHB 1HUTH 5A2MH 2BY9X 1BMMH 3OFND 1GHWH 5KEDA 4UFGH 3M35A 1GI5A 3G01A 1MAXA 3RXTA 1NESE 1UCYE 3GY2A 2BDIA 1ZTLA 1S0QA 1V3XA 2ZHEH 1S6LA 3D65E 2Y7XA 4FUEA 1TGNA 2ZI2H 3SGAE 1BBRK 2UUFB 4O3TA 3TIUA 2PHBA 1UCYH 2PWXA 2HRVA 3BTHE 4UFDH 1FPCH 1NRQH 1SLWB 1O35A 2G5VA 1H8IH 3RXCA 2B0FA 1O5BB 1UTOA 4FUGA 4WJG2 2ILNA 1K1JA 1GGDC 3PMAB 4ZKNU 2VGCC 2TPIZ 3SU0A 3RXQA 4JCNA 1F0SA 1WV7H 1GMCF 5FBEA 4XFQA 1OWKA 4CRDA 3RC5A 1BMAA 1VCPA 1C5RA 1TALA 1RIWB 4YLQH 2ZDNA 2EA3A 5EPYA 4XE4A 5KGOA 2D8WA 4BAKB 3SYJA 1S83A 1TMBH 1W2KH 3OSYA 2KR7A 4K5ZA 1C2EA 3F0OA 1E1RD 2VIQA 1VCWA 1C2JA 5BRRE 1KTSB 1CT0E 4ZMAH 3RMLH 3TU7H 3AVZA 1AE5A 2XYAA 3GICB 4MNYA 1V2PT 2Y5HA 1W0ZU 1WCZA 4Y8YA 4A7IB 4I8JA 1TGSZ 3A86A 1TA6A 1WQSA 1QZ8A 2ZEBA 3RXEA 1TIOA 5FPSA 4B76A 1C2KA 4ZHLU 3SGQE 3T27A 3U8OH 1DY8A 5JBCS 3M5OA 1WBGB 4A6LA 2ZFPH 3ZZ9A 5GDSH 3A7XA 4CR5A 4WMDA 5HM2A 4Q7YA 2CHAC 2PW8H 4OM9A 3A8AA 2FLRH 2J4IA 4DJZB 2BDGA 1P03A 2JH0D 2XXLA 3A8DA 1DDJA 1S82A 1E79D 1CO7E 2ZGXH 2H2ZA 3IITA 1OYTH 1SGFA 2W26A 3TGIE 1YWUA 4INLA 1E34B 1A7SA 1AB9B 5GXPA 1MQ6A 3TITA 1O3HA 3PWBA 1VJ9U 5EXNA 2BYAX 2AMDA 3F68H 2CV3A 3VEQB 2ZCLP 3RXBA 2J34A 3QTVH 5JB8S 2O8MA 4CH8B 3VB5A 1HRTH 1QL9A 2VWNA 3ENSB 4I8KA 3OAAD 4DW2U 3SNEA 2HOBA 1HYLA 3O8DA 1CT2E 1NY22 2LP6A 2ZA5A 3T29A 2XBWA 1EASA 2W6JD 2C4FH 2F9BH 4NA8A 1J15A 1O5DH 1QL7A 1C4U2 2BD4A 3RXVA 1V2NT 2ZGJA 1HAHH 3UOPA 1T8LA 1TOMH 3SQEE 5A8YA 1TAWA 1SLXB 3KL6A 4H4FA 4YTAA 1GBFA 1GVKB 3FVFB 1OWJA 2Q6GA 3SZNA 2YOLA 3GOVB 1OXGA 1V2RT 2FI5E 1H4WA 2GCTB 4LOYH 5IK2D 1NU9A 2ZZUH 1N1LA 3SJKA 2ZCHP 3GY7A 3BG4B 3UREA 1GBBA 1HNEE 3M3SA 4U30A 4K60A 4KTSA 4RKJB 2PKSC 1O3FA 1YPEH 1ELCA 2EC9H 3OY6U 4CBNA 3S9CA 1O2GH 2RCEA 3PROA 1YPKH 1O2ZA 3SV6A 5A0CA 3GY4A 2A32A 1LO6A 3MO9A 1O38A 1AZZA 1NFWA 5GPIB 1P57B 2RA3A 1KXCA 1OWDA 2CGAA 2R2WU 5C67A 5ABWA 1QB1A 1AKSB 1C5MD 1WOFA 3LPRA 1QB6A 1S6FA 1MMJN 1LHCH 2PSYA 4B71A 1OP2A 1DWEH 1TX8A 2FPZA 3EA7A 4J2YB 4DURA 4INHA 1O5FH 1GGDB 1RJXB 1TRYA 3MFJA 3ZV9A 1QCPA 2VGCB 1K1IA 4D7GA 2M5TA 2ZU2A 1ANDA 4MQAA 1C9TA 1UHBB 1QQ4A 3E1XB 4NZLA 1ELDE 3KIDU 2KAIA 2J2UA 1A0JA 1RFNA 1T8NA 2L74A 4IW4E 3D49H 1C1NA 1KXAA 1O2JA 3B9FH 5FHTA 1LVMA 3M36A 4O9VA 1GDUA 1PQ5A 4GVUA 4JZIA 1UK4A 5ETXA 3ZVGA 5LPFA 2F9OA 1ZRKA 4HG6A 2FO9A 2A2QH 1FIWA 1K28D 3SOSA 3STJA 3MYWA 4CRFA 5CE1A 1FLEE 1C1PA 5K0HA 1XUKA 2BD9A 3SU2A 3A81A 4BTIB 2OQUA 5C17A 2EQNA 1AN1E 1V2LT 1KLJH 2ZFRH 1MU8B 2BXTH 3GCOA 1IQFA 1AE8H 1EKBB 1TQ7B 2CHAB 2VWMA 1BIOA 1FY5A 1W0KD 1TGTA 1Z6JH 2UWOA 3LGYA 2WHXA 4SGBE 4B2CA 2BY7X 3SUGA 3BTWE 1LPKB 1YCPK 4DT7B 3BN9A 4AX9H 2VBCA 5T6FA 1G2LA 2C8XB 1W7GH 3GDSA 2V35A 4XBBA 3K65B 1KY9A 1P02A 4X2XA 2RA0A 1K1MA 5TCAA 1YPLH 1P9SA 1CVWH 1MKXH 1UTNA 1GVZA 3F3BA 2GT8A 1C5XB 5L6NH 2BQ7B 4UONA 1NFYA 1FX0B 3EE7A 3KNXA 1N6XA 3PMHB 3GDUA 4IBLH 2OD3B 1BMFD 3GCNA 4YOGA 7ESTE 1CA0C 2GDDA 1EAIA 1K0HA 1DE7H 1C5LH 2EY4C 1Z1JA 2WYGA 1J8AA 1BHXF 2BLOA 3LGVA 3RXGA 3CNRA 3PM3A 3PMBB 1FIZA 4Y8ZA 3JZ1B 2WZQA 2J98A 1C2IA 1S6HA 2KFWA 1CHOG 4OS2A 4KP0A 3MU5A 4Q7ZA 2GMTC 2PKSB 4MPWA 2XBXA 3EYDA 2PP6A 2H5DA 2L6OA 3VFEA 3F9HA 3PV5A 4HGCA 4Q80A 1JBUH 1VCQA 1QRXA 1HAVA 1BHXB 5C3NA 3P92A 3U1IB 2UUYA 3DA9B 2FI4E 5GNDA 4BAQB 2ZO3H 1IQNA 4MPUA 1C5YB 2TGPZ 2WV9A 4CRBA 2OC8A 5EQQA 1T32A 1L4DA 3HK6B 1QURH 4E06H 3S0NA 1GBJA 3B23B 5F8ZA 1TX7A 1GDQA 2HPPH 5CDFE 2V3MA 3AASA 3U98H 1QA7A 1DXWA 1O2HA 2ZPQA 3MU0A 2BY5X 1XUJA 4I8GA 1JIRA 4ISOA 4ZHMU 4BXSA 4CH2B 2VH6A 1SGFG 2SGPE 1AFEH 4WXIA 1ZMLA 5L2YH 4OS6A 3SJ9A 2ZU5A 1YPGH 1O37A 1GJDB 1ZPCA 1ZHPA 4YLUA 1QRZA 1B0FA 1V2OT 2ZDAH 5BPEA 2AIPA 4IS5A 1JOUB 2P16A 3F2HA 2G4UA 3V0XA 1ACBE 2XNDD 4DIIH 1H9HE 2ODQA 4F4OC 2BMGB 1Y3WA 4AYVB 1HJ9A 1PYTC 1P2IA 1O3IA 3GCTG 1H8DH 1C5TA 3UQOA 3RU4E 3FZZA 4DT4A 1GHBG 1C2LA 1HIAB 3A89A 5C0TA 1Y59T 1PQ7A 1DPOA 4K8YA 5GCHG 4AFZA 1ARCA 2G52A 2XWAA 5DP4A 2GJGA 3KQ5A 4WWYA 1O2WA 4WY3A 1Z8RA 2A0QB 3ZVDA 2J97A 1V2KT 4JZDH 3STIA 2AMQA 5C5OA 2BLVA 5B6OA 3SNBA 1PQAA 3H7TA 3QZRA 3PTBA 4GLYA 1QNJA 2VWLA 2OP9A 3U9AH 1RS0A 1AZ8A 4DCDA 2QV1A 2Z7FE 3RM2H 1CE5A 4BXWA 2KCPA 1F92A 1H8ED 2WPIS 1A0LA 2R2MB 2M2AA 5C20A 3UR6A 3BTFE 1DVAH 4X6OA 1BA8B 3FZDA 1CGJE 1O30A 1VGCC 3TK9A 3OTJE 3QLPH 3P8OA 1SGTA 2AFQB 1SQTA 1TFXA 2LNCA 5JB9S 2ZU3A 1P2KA 3QZQA 1OP8A 1W14U 4BTUB 2ZGBH 4UFFH 3ATIA 4X8UH 3ZZCA 2BX3A 3EQ0H 1LVBA 4RT0A 5EIYA 4NIXA 1CA0B 2GZ9A 1SGIB 4X2YA 5K7RA 1YF4A 3MQKC 1FPHH 2WUCA 2QC2A 5T1VA 3E16B 3WWBA 1GCTC 4RT1A 2G8TA 1EXFA 2HWLB 4H6SB 2ALPA 3SO3A 4NWLA 2GD4B 2ZU4A 4MPXA 4NZQA 2BD5A 1EPTA 1EB1H 1FI8A 1NN6A 1UVPA 1GHAG 2KZ4A 1QA0A 3O8BA 4FVBA 1NRNH 1FUJA 2VIVA 3HGPA 2GMTB 4ZKRU 1YYY1 1XXFA 2F91A 4K1SA 3WY8A 4AFUA 2FEQH 2VIPA 3GYMA 3P8GA 1L1NA 4TWYA 5A09A 9LPRA 2TRMA 1PFXC 1YPMH 1P09A 1C1VH 5KECA 4X8SH 3OEHD 5SGAE 3F2GA 3TLOA 2R9PA 1Z8GA 1JRSA 5I46H 1CA8B 1NBME 3ATKA 3KQBA 5E0JA 1ANEA 1E0FD 3FOAA 2Y82A 5AF9H 2ZDKA 2SGQE 4Y76A 1S85A 3MHWU 3DUXH 3TJUA 3LC5A 3UNQA 2VNTA 1ABIH 5E2PA 1AI8H 1KDQB 1XKBC 4XSKU 2QXHA 3SGBE 1O5CB 1EFRD 2NWNA 1HXEH 1UTMA 1H9IE 4I7YH 3TH2H 2Z3EA 1LKAA 1QGFA 1C5VA 3PB1E 2HGTH 1RXPA 2WV4A 1PJPA 3SU3A 1LVOA 3LOXA 1EJMA 2HALA 4HFPB 5GWZA 3R0FA 4P00A 1TMUH 1ZMJA 4RSPA 1C5QA 5AFZH 1QHRB 4ABEA 1BJVA 2BZAA 1WXRA 4X6MA 2G5NA 1FQ3A 3P95A 1SHYA 3RXAA 2JIZD 1N8OC 2QA9E 4X1QU 1FN6A 2QAAA 2WINI 1TPSA 1BITA 2Z9IA 2HVYB 1MCVA 1ZJDA 2BVXH 1UK2A 4I86A 5AFYH 1MUEB 2SGEE 3RXLA 1F0UA 3DSOA 2V3HH 3A7VA 1LVYA 4QT8C 1GWAA 1C5ZB 3P70B 2K8IA 2BXUH 3A83A 3T62A 1G30B 3L33A 4Y7AA 3NCLA 2KX4A 1GPZA 1O3AA 2FMJA 3E8LA 3SUEA 3KHVA 1WAYB 3VB4A 4RKOB 3RXKA 3W1EA 2XOKD 1OWHA 5C1UA 1GL0E 1AWFH 2BDAA 1GJ6A 2FDAA 4ZAEA 5FX6A 5T6DA 1GMHG 1AUJA 5T6GA 1V2QT 1MBQA 2BOKA 3BF6H 2CN0H 1EJNA 4AFQA 1NU7B 1A2CH 1THRH 5DP3A 5EW2H 4X8VH 1T7CA 4KTUA 2FTLE 1PPFE 3VB7A 1VGCB 2RDLA 2Y81A 4KGAA 1A5HA 1AVXA 5F53A 1MU6B 3ZZ5A 1C2MA 4NSVA 3DT0H 2UWPA 1BRAA 2Y5FA 2AGIX 4JYVH 3RLYH 2C3SA 1ID5H 2FS8A 2PR3A 3KYFA 1FV9A 4ZH8A 5CHAB 1C1UH 4AYYB 1S84A 1MTSA 1D3PB 4R8TB 2XNIA 2H5CA 2QGRA 4GCHG 1LMWB 3SQHE 4DGJA 2QCYA 3P6ZB 2YMSD 5EGMA 5F6MA 2QE7D 4UDWH 1Y5BT 4ACAA 5JBTA 5LPEA 3FO8D 3ZIAD 5IYTA 1A1RA 1PPBH 5DP5A 1GCTB 1P05A 4DY7B 4A92A 1JMOH 4Q2KA 3LIWA 1BZXE 1T4VH 3KN2A 5AHGH 1DICA 1A5GH 1W0YH 1SOTA 3DCLA 1UTLM 1Q3XA 1FY8E 3TNSA 1UW7A 4Y10E 1P10A 4WMFA 2WPMS 1AMHA 3NRLA 3F6UH 4JMYA 2WYJA 1D6RA 4HTCH 1HLTH 5GIBA 2K0QA 1GL1A 2DE8A 3RLWH 1LQDB 1M9UA 4JYUH 2XCFA 4FETA 1S5SA 2F9VA 4U32A 2ZDLA 2FOMB 1O3OA 1ETRH 1XMNB 2OQ5A 3LGWA 3UIRA 2JH5D 1HAGE 1EZUC 3BTEE 2ZF0H 1VZQH 1SVPA 3CENA 2SNWA 1YLNA 2SGDE 1O3PB 1MZDA 1QR3E 4AFSA 1V2VT 3GY3A 3RXIA 1OWEA 3BIVH 4IMZA 2Z9JA 2JDID 3RMOH 2O8UA 2EI8A 3QGJA 3QGNB 1GBKA 4A1VA 3RMMH 1YGCH 1IHTH 1O3NA 4MVNA 4AC9A 1EOJA 1E37B 1TPOA 4Z1MD 3PLBA 1VJAU 3UY9A 2B8OH 5AVDA 1B0EA 1OOKB 1P8VC 2UUKB 3OEED 6GCHF 4K1TA 1G2MA 1SC8U 2QXIA 1NRPH 2FS9A 5LPRA 1HDTH 3H7OA 3ZZBA 1N8OB 2VB0A 1EUFA 1P06A 3QUMP 2PV9B 1HAIH 4FUFA 1TNKA 1IQEA 4B1TA 3EGKH 2QN5T 3VGCB 1TB6H 3P8FA 1AKSA 1HAYB 1C4Y2 2P94A 3A7YA 2BY8X 1EQ9A 1BRCE 1IQIA 1F0RA 1O2VA 2PUQH 3U1JB 3MMGA 4E7RG 3B8JA 1Z1IA 1YPHC 2FESH 1XUGA 1E1QD 2ZU1A 3FFGA 1J17T 1L4ZA 1TX6A 4MNWA 4AB8A 2WV5A 4X1SU 1VITG 2JH6D 1RD3B 1O3DA 3UUZA 4TSFD 3SI3H 1NROH 4ABHA 1UK3A 1UHBA 2W7SA 3OU0A 4ISLA 3VXEH 1XUIA 1GMDG 1G32B 2ZPRA 3A7ZA 2R3UA 5DKMA 1ELBA 3TPIZ 3EAJA 1SSXA 5GJ4B 3K6ZA 4IN1A 3MU4A 4FVDA 3L6PA 1SGDE 1ZLRA 2V3OH 1AO5A 4VGCC 1C1SA 1IQMA 4K3JA 1IQLA 3M7TA 3DD2H 3N7DA 2GVFA 1AD8H 2FTMA 4JK6A 1BTPA 1WYKA 2XWBI 3SJ8A 3AW1A 1SGCA 1HJAC 1O31A 2WPDD 1INCA 4CRGA 2IJOB 2OC0A 3TH4H 5DSFA 5HKKD 1GI1A 2SNVA 1TBZH 1GHAF 3SJOA 1XXDA 1OS8A 3RXRA 3T5FH 4JZFH 8KME2 4K8BA 4X0WU 1LCYA 1U6QA 1BOQA 4Y8XA 2W5EA 1ETSH 4B74A 4LZ4B 3SU5A 2C93B 4O3UA 4ZKOU 4M7GA 1C5WB 3ZYEA 3UTUH 1QB9A 3LGTA 1DM4B 4A1TA 2GT7A 2Z3DA 1ABJH 1NS3A 4X2VA 1YM0A 1TONA 1LHEH 3UNSA 1RGQA 2GGVB 2WPKS 5FX5A 1Q2WA 2QF0A 3UOUA 4ISHH 1H8HD 1DX5M 4THNH 1GJBB 2FP7B 2QIQA 3A8CA 1A5IA 2H9TH 3SI4H 1FMGA 1XM1A 5G4BA 2JJ2D 1YBWA 1UVOA 4ZKSU 1P12E 3NK8A 3NXPA 3TK6A 1W7XH 1IQGA 1HCGA 1W12U 2H6MA 2OBQA 4OS7A 1C1QA 2SGFE 1PQ8A 1O2IA 3UNRA 1P0SH 2CXVA 4FU9A 1K21H 1Z71A 2H1UA 4BTTB 3RC6A 1EAXA 3U69H 4I8HA 1O2RA 1QJ7B 1TBQH 1SR5C 1W3CA 1TLDA 3CS0A 3FP8E 3SU6A 3F9FA 3RXUA 2C8YB 3T2NA 4DG4A 2FWWA 2BD2A 5DP8A 4FU8A 3WWFA 1PPCE 4JZEH 3BG8A 1ELFA 1NFXA 1O2SA 1O39A 3PO1C 4BNRA 3EBNA 3F1SB 4ISNA 3I77A 4FXGH 2UWLA 2ZC9H 5EPNA 2AHME 1GMCG 2ZIQH 3T25A 4CHAC 1MTNC 1HAOH 1G3DA 2P59A 1EP6A 1KXDA 4XDEA 2D2DA 1C5SA 1UTKA 1QBVH 2A2XH 3NPSA 2EEKA 1F7ZA 4AGJA 2O8LA 2O8WA 5L30H 2C8ZB 3SNDA 3ODFA 4INKA 4JYTA 1YPJH 3C27B 1ZHMA 1GBIA 2G51A 1SQOA 2WUBA 2PKAB 3K2UA 1JIMA 1GMHF 2OXSA 3M61U 2BTCE 2FOFA 1TNIA 4CREA 1GVLA 2XBYA 1GBEA 8GCHG 2F9UA 3LONA 1CT4E 2WPJS 3ZVBA 1LHFH 3W94A 5F03A 3S7HB 2O9QA 1V6DA 1XVOA 1O2UA 1C1OA 3AW0A 1QL8A 1A3BH 4YOIA 5C5NA 1ESTA 1ZPZA 1O34A 1RRKA 3UFAA 3V13A 1GHYH 5EJ1A 4X1RU 4IC6A 1C9PA 3U28C 1C5PA 2HNTC 1EPTC 4CRCA 4AG1A 1YKTA 3N7OA 1SLUB 2TGTA 4ZCNA 1A3EH 3Q00A 5JPMH 1TWXB 1SMFE 2Y7ZA 8LPRA 5C0UA 4X6NA 5HIZA 4GCHF 4VGCB 3W95A 3F9GA 2FI3E 1HIAA 1YCPM 3DHKH 1O36A 1GI4A 2H9EH 5HYOA 2DUCA 1EP5A 1W13U 1P11E 2ZNKH 3BTQE 2H9HA 1K1PA 2OK5A 3RXFA 2CMYA 1A46H 3GY6A 1K9OE 1HJ8A 6ESTA 1GG6C 1FJSA 3ZVCA 2G4TA 2GCHG 4Z0KA 3M5MA 1EZQA 1HJAB 1UCYK 5E8EH 3TJVA 2PTNA 1TOCB 2Q6DA 1UMAH 1YPHE 3FN8A 1EJAA 1O2PA 3MNXA 4GHTA 2GTBA 3LH3A 2XC4A 1HAXB 4U01A 3QN7A 1DUAA 3E91A 1ZSKA 3ATWA 3M5NA 1EOLA 1J14A 2A5KA 4AG2A 3M37A 8ESTE 3SBKA 2P8OC 1C4V2 3ZZDA 1SI5H 1RTKA 1P2MA 2C8WB 1SL3A 2FOAA 3SW2B 3MH6A 1OYQA 1FONA 4LK4A 1J9CH 4BAHB 1EB2A 1ESBA 1TYNA 1MABB 2ZPSA 4M9FA 2ZKSA 3OY5U 1GBAA 1LHGH 3HKJB 1YC0A 1GI8B 4Y11E 2A4RA 1LPGB 4YT6H 1G36A 3Q3KA 1OX1A 3OTPA
chains in the Genus database with same CATH topology
1HBTH 1B5GH 2J95A 1AVGH 4ZHAA 2R0KA 1W11U 1NTPA 5E2OA 4ZXXH 4ABGA 4IN2A 4ZXYH 1QQUA 1G9IE 2OC1A 2THFB 3QTOH 2VIDA 3M3TA 2FX4A 3MU1A 1S81A 4A1XA 3QO6A 3V3MA 1PPZA 1PPHE 1TNLA 2ULLA 3BTKE 4ABDA 3PMJA 4FUDA 3FP6E 3I78A 1AVWA 3PLPA 4UFEH 1GJ4H 1E35B 3MO3A 2BDBA 1Y3XA 1GBDA 3VB6A 3PO1B 5DG6A 1FXYA 3TK5A 1O3BA 2I6QA 2DE9A 1GI0A 1ZRBA 5TCCA 1FDPA 4R0IA 3LH1A 2LIZA 2FIRH 3Q3XA 4AGKA 4CHAB 1MTNB 1MZAA 1WTGH 4BAOB 3U8TH 5TJXA 4B2BA 3MO6A 5FBIA 4ABBA 1YCPH 3MWIU 2VVUA 2Z94A 2LPRA 4NGAH 1MKWH 2ZHWH 3RXOA 2HNTF 5JBBS 3Q3YA 5T3HA 2NU0E 3KQCA 1UTJA 2YNBA 3C1KA 3MNCA 1GJ5H 3RXDA 2ZP0H 2GZ7A 1L2EA 2P3UB 3RXPA 1KDQA 4O03A 1JWTA 1NRSH 1TNHA 4D7FA 3MOCA 1NO9H 2AERH 4DIHH 1P04A 4YO9A 2A31A 2BHGA 1ELVA 1UTQA 1SB1H 1O2QA 1BTUA 3ZZAA 4Y0ZE 3KQDA 4A5TS 2Y6TA 1GMDF 3SNAA 2FZZA 4MLFB 2W7UA 3E90B 1SGNE 1EPTB 2GDEH 4FUHA 2EI6A 5E0GA 1BDAA 2D26C 2ZCKP 1ESAA 2FOCA 1AB9C 4AN7A 2TIOA 2XBVA 4H42U 2P3FH 4ZROA 1TPPA 4ISIH 2PUXB 1V2UT 2K1QA 4XBDA 5DP9A 1OP0A 1UVTH 4JZ1A 1UO6A 3GY5A 2FYQA 1Z8JB 3RU4T 3SUFA 3OX7U 1GG6B 4WH6A 2J38A 4ASHA 2GP9B 2BD3A 3EA8A 3A88A 3E3TA 2Z9GA 1K1NA 1K22H 2GX4A 3URDA 2OCVB 1GCDA 1P2JA 1DANH 5C1YA 3TJNA 1HAZB 1BTWA 5EQSA 3FAOA 3SHAH 1ZTJA 2GV7A 1O33A 3FP7E 4B75A 1D3QB 2FOGA 1GI2A 1WSSH 1C2HA 2P8OB 4PROA 2HNTE 3VXFH 5LH8A 3D62A 1GBTA 4H6TA 1NPMA 3LGIA 2BDCA 3ZV8A 1IQKA 2UUJB 2PTCE 4K2YA 5EODA 1GHZA 1AU8A 5EG4A 1C1MA 2HPQH 4HI3A 3NZIA 5C2ZA 3AAUA 2PFEA 2B9LA 2FM2A 1TQ0B 5FAHA 1BTZA 2ZTXA 4NWKA 1AHTH 1H1BA 1Y3VA 6CHAC 3QK1A 1A4WH 4OS1A 2QXJA 2ZECA 4TY6A 1DITH 1TNJA 4IGDA 4U2WA 1C5UA 3MTYA 5HXFA 1YLCA 4KELA 1KXEA 1SFIA 3SU4A 2BVRH 2ZGHA 4WH8A 1ZOMA 4AZ2B 1O2OA 1O3JA 1GBMA 5ESBA 4BOHA 5HGGA 1DS2E 5FXLA 3SNCA 4NFEA 2JETC 4NCYA 4X1PU 1SGYE 2A7CA 3O8RA 1NRRH 2ANWA 2GKVE 2XC0A 2F3CE 1CHOF 2TGAA 5DO4H 2J94A 1O3EA 3PWCA 4NG9H 5EXMA 3EE0B 1MKXK 1EZXC 2EI7A 4NFFA 3VPKA 2SGAA 3A8BA 4DVAU 5I25A 2BVSH 4AOQA 1P2OA 2Z6BD 1QJ1B 1EAUA 1XVMA 1SHHB 4BANB 2ZG0H 1AFQC 2OUAA 1GJ9B 8GCHF 1TA2A 7LPRA 3RXMA 3NWUA 1KLIH 1ELEE 4HZHA 1BB0B 2V6NA 2VU8E 3GYLB 2ZQ2A 3E6PH 7GCHG 4X8TH 1AWHB 2Z3CA 2FYRA 3BTME 6LPRA 3M7QA 4TPIZ 4O97A 3P8NA 2ALVA 1BTXA 2CF9H 1T8MA 4J1YA 2A4GA 3BEFB 2BLWA 1RTLA 3RU4D 1EATA 1QRWA 1KLTA 5E0HA 3PV4A 2ZFQH 1KSNA 1SGQE 4X6PA 1A0HB 1C1RA 2K7XA 1D6WA 2XC5A 3LJOA 4JK5A 1E38B 1NM6A 2BZ6H 2ANYA 1EX3A 3GCTF 2OLGA 1P9UA 2GCHF 1HFDA 2ZHQH 3UPEA 1UVUH 1ZPBA 3LKWA 1GHBF 1V2ST 1SBWA 4GHQA 4BAMB 1KIGH 2B5TB 2STAE 5GCHF 3CS7A 1HPGA 4CR9A 1WUNH 2G81E 3LJJA 1LHDH 1P2QA 4NSYA 4OGYA 3BSQA 1T8OA 4B2AA 1FN8A 4NIYA 1HXFH 5HMAA 1SQAA 1O3GA 2RG3A 4YOJA 1HGTH 1K1LA 3RM0H 4WMEA 5JDUB 1NZQH 3LC3A 4X1NU 3ZZ8A 1ANBA 1GJAB 1G37A 2J9NA 4FUCA 1CU1A 1L1JA 2A5IA 3LT3A 4I33A 1Q31A 3TGKE 4F49A 1O5GH 3ZVEA 4FU7A 1HB0B 1OSSA 1Y8TA 2HLCA 4TPYA 2OTVA 1TBRH 2QXGA 2F9PA 1D9IA 5HM9A 2FOEA 1W8BH 5C1XA 2A5AA 1XUHA 1OKXA 1TMTH 2Z9LA 1ELAA 1JRTA 4YESB 1MD8A 4TYDA 2VIOA 1O2MA 2AEIH 1MD7A 3LDXH 2PGQB 3A7WA 1AUTC 1WU1A 1P2NA 4YM9A 1QBOA 3VB3A 6CHAB 1FY4A 2ZWLH 3ZVFA 2F83A 1QFKH 1QIXB 1DLEA 1T31A 3PYHA 5J4SA 3Q77A 3S69A 2ZQ1A 5F8TA 1GHXH 5ESTE 2GZ8A 4I8LA 3MH4A 1GI7B 7KMEH 3UWIA 2FX6A 1NT1A 1ZZZA 1UVSH 2CJIA 1PPGE 5A8ZA 1QJ6B 1HV7A 2JETB 5JYIA 3K6YA 3RUOA 2ODYB 2ZFTA 5EOKA 1SLVB 3NUMA 4XBCA 4UEHH 4NIWA 2AMPA 1LPZB 2FODA 4DOQA 2ANMH 2O8TA 1SOZA 3TVJB 3RXJA 1BBRE 3RXHA 1W10U 1F0TA 1X7AC 1BJUA 1J16A 4NA9H 4K69A 1BBRH 2KAIB 2BDHA 5DK1A 3DFLA 1AFQB 2A7JA 3MI4A 2CF8H 4CBOA 5EQRA 3ELAH 1GDNA 3HKIB 1SG8B 3PTNA 2IPHA 3TGJE 2BLQA 5CMXH 3SHCH 1FAKH 5DJ7A 1AQ7A 1F2SE 4Q7XA 3JZ2B 1ZYOA 2JKHA 3ATLA 1O2XA 1DXPA 9ESTA 1KXBA 4D9RA 1TABE 2P3TB 3ZZ7A 3KQEA 1GI6A 2A7HA 3M3VA 4B73A 1GHVH 2PGBB 1C2GA 1MKWK 2ZDMA 2XCNA 2P93A 3BTGE 1C2DA 3SV7A 1SGEE 4TY7A 4KKDA 4E7NA 1K1OA 3A85A 2XTTB 3DFJA 2BD7A 1DOJA 2FOBA 2WPHS 1WQVH 1CQQA 5F8XA 3A82A 1TGCA 2ZHDA 4KTCA 1F5RA 1ELGA 1E36B 1OPHB 1ZSLA 1KTTB 5DPAA 4Y0YE 2W3IA 1C1TA 4WF8A 4AB9A 4Z6AH 2AIQA 4ABAA 1DT2A 3MH7A 1H9LB 1GBHA 3S9AA 1LTOA 1G3EA 2AGEX 2VH0A 3PLKA 1ANCA 2R3YA 3QWCH 1MTUA 2PKAA 4AORA 1DSTA 4NIVA 1GI3A 3U8RH 1DUEA 2BD8A 2ESTE 2PSXA 3KCGH 1V2TT 1ARBA 2VWOA 3BTDE 2VVVA 1MTVA 1PYTD 3A7TA 1BTHH 1XUFA 1V2MT 5J4QA 2NU3E 1ZTKA 3ZVAA 2ZFSA 3ODDA 3HATH 3URCA 4MPVA 3BEIB 5A8XA 3A84A 1Y3YA 3UR9A 1G3CA 2Q6FA 2ZGCA 2B7DH 2J92A 4NA7A 2Y5GA 1QY6A 1SPJA 1O2YA 2ANKH 3GDVA 4MTBA 2IN2A 4MG3A 1CBWC 1TPAE 1IOEA 4UE7H 2BB4A 1HAPH 2FLBH 1ZSJA 1KYNA 5JBAS 3ZYDA 3CP7A 3EDXB 1TE0A 2AS9A 1L1GA 1CGIE 3R3GB 3HPTB 4WVPE 3KGPA 1ELTA 1C5NH 1MH0A 3A80A 1FNIA 1O32A 2QYIA 1HAVB 1ZJKA 1O3MA 5IDKA 1GBLA 1Z8IB 1WTHD 2ZTYA 4OS4A 1BQYA 3TNTA 1Y3UA 5LGOA 3GISB 3RXSA 1IAUA 1LKBA 2TBSA 2VIWA 1LDTT 3IWMA 1O5AB 1B7XB 4LXBH 1C2FA 4LZ1H 3FANA 1Y5UT 3UQVA 2ODPA 4ESTE 5A0BA 3UWJH 2C90B 2F9NA 1GJ8B 3SN8A 3GCHC 2BM2A 3P17H 1P01A 2A4OA 2A45B 3BIUH 3TJOA 4OS5A 5PTPA 3Q76A 4WXVA 1MAYA 1VR1H 2QY0B 3HK3B 1SFQB 2ZFFH 6GCHG 3MNBA 1BRBE 1V2JT 3BV9B 4I31A 3KF2A 3SU1A 3K9XB 4E05H 4FUIA 2ASUB 7GCHF 1ZR0A 2V0BA 1G3BA 4MNVA 3OYPA 3BEUA 3SJIA 1S0RA 1BT7A 4D9QA 1C1WH 1O2LA 3I29A 2OINA 1EZSC 5EXLA 1TRMA 1MQ5A 4FUBA 1AGJA 2XRCA 4IC5A 2A1DB 2NU4E 3ZZ6A 3E0NB 2VVCA 1F5KU 3D23A 1UTPA 1V2WT 2STBE 3QX5H 1GJCB 1FZZA 4XOJA 3RDZA 4UD9H 1ETTH 3S9BA 1DWCH 1YLDA 3SV2H 1CGHA 2G00A 3KEEA 4MDSA 5DP6A 4Y71A 4I32A 3RP2A 1C5OH 1MTWA 3NKKA 5FPYA 1D3DB 4ABJA 4YT7H 1BUIA 2AYWA 4MNXA 3H5CB 3L3TA 2NU2E 1MCTA 5FPTA 1QBNA 1IHSH 1DY9A 3MNSA 3V12A 4D76A 3A87A 1GI9B 3ZZ3A 3RMNH 1KXFA 2BX4A 1TNGA 1THSH 3F9EA 1T4UH 5CHAC 1RIWC 4GSOA 2FOHA 3TH3H 3V7TA 3MH5A 2IOTA 4ZUHA 4GUXA 2OC7A 1O5EH 1N6YA 1YP9A 2BDYA 3M5LA 5EW1H 4SGAE 4Y79A 1FY3A 1D4PB 1SGRE 2G55A 1UJ1A 3AAVA 3ZZ4A 1TGBA 1BTYA 1GBCA 1P3EA 1ZGIA 3BTTE 3M7UA 1DSUA 1RTFB 2XW9A 1ZGVA 4D8NA 1F5LA 2A4QA 4YZUA 3S7KB 1O2TA 1VITF 5L2ZH 1L0ZA 1THPB 1OWIA 5FCKA 2ZDVH 2ZTZA 4IMQA 1MBMA 3SV9A 1BRUP 1IQHA 1O3LA 4CRAA 3MU8A 1JXPA 1A61H 4OGXA 3E0PB 2SFAA 5DP7A 2AH4X 1CBWB 1O3KA 3SUDA 1O0DH 1TRNA 1Y5AT 1AIXH 1GJ7B 2QF3A 1O2NA 2R0LA 1DWDH 1D3TB 1QTFA 2D1JA 5H4IB 2BQWB 1DWBH 1SGPE 1XX9A 1O3CA 4ABIA 1BMLA 4RN6A 1CSOE 4GAWA 2OBOA 1O2KA 1PPEE 5EU8A 4K1EA 1LQEA 2HVXA 1NC6A 3ESTA 3LGUA 1ZHRA 4ABFA 2BY6X 1EAWA 1FAXA 4GPGA 2GV6A 1XKAC 2FXRA 1CHGA 2Z9KA 2NU1E 2Q1JA 3SORA 4Y7BA 5FCRA 3IG6B 3T28A 1K2I1 3EA9A 2VINA 3GCHB 1IQJA 3SV8A 1P3CA 4TWWA 1AY6H 2AGGX 1ORFA 2ZHFH 4X2WA 2GCTC 2PLXA 2I6SA 3LU9B 1Z7KA 5A0AE 1BMNH 2WPLS 2YNAA 3BG4C 2W3KA 5DGJA 2TGDA 3QDZB 3ATMA 3RC4A 3VGCC 4FUJA 4Y6DA 2VJ1A 3O8CA 1NFUA 3HGNA 3T26A 1DLKB 1VITH 1FY1A 1ZMNA 3GY8A 2P95A 3ITIA 1BCUH 1DFPA 1Z6EA 2BQ6B 2Y80A 2BOHB 1HUTH 5A2MH 2BY9X 1BMMH 1GHWH 4UFGH 3M35A 1GI5A 3G01A 1MAXA 3RXTA 1NESE 1UCYE 3GY2A 2BDIA 1ZTLA 1S0QA 1V3XA 2ZHEH 3D65E 2Y7XA 4FUEA 1TGNA 2ZI2H 3SGAE 1BBRK 2UUFB 4O3TA 3TIUA 2PHBA 1UCYH 2PWXA 2HRVA 3BTHE 4UFDH 1FPCH 1NRQH 1SLWB 1O35A 2G5VA 1H8IH 3RXCA 2B0FA 1O5BB 1UTOA 4FUGA 4WJG2 2ILNA 1K1JA 1GGDC 3PMAB 4ZKNU 2VGCC 2TPIZ 3SU0A 3RXQA 4JCNA 1F0SA 1WV7H 1GMCF 5FBEA 4XFQA 1OWKA 4CRDA 3RC5A 1BMAA 1VCPA 1C5RA 1TALA 1RIWB 4YLQH 2ZDNA 2EA3A 5EPYA 4XE4A 2D8WA 4BAKB 1S83A 1TMBH 1W2KH 3OSYA 4K5ZA 1C2EA 2VIQA 1VCWA 1C2JA 5BRRE 1KTSB 1CT0E 4ZMAH 3RMLH 3TU7H 3AVZA 1AE5A 2XYAA 3GICB 4MNYA 1V2PT 2Y5HA 1W0ZU 1WCZA 4Y8YA 4A7IB 4I8JA 1TGSZ 3A86A 1TA6A 1WQSA 2ZEBA 3RXEA 1TIOA 5FPSA 4B76A 1C2KA 4ZHLU 3SGQE 3T27A 3U8OH 1DY8A 5JBCS 3M5OA 1WBGB 4A6LA 2ZFPH 3ZZ9A 5GDSH 3A7XA 4CR5A 4WMDA 5HM2A 4Q7YA 2CHAC 2PW8H 3A8AA 2FLRH 2J4IA 4DJZB 2BDGA 1P03A 2JH0D 2XXLA 3A8DA 1DDJA 1S82A 1CO7E 2ZGXH 2H2ZA 3IITA 1OYTH 1SGFA 2W26A 3TGIE 4INLA 1E34B 1A7SA 1AB9B 5GXPA 1MQ6A 3TITA 1O3HA 3PWBA 1VJ9U 5EXNA 2BYAX 2AMDA 3F68H 2CV3A 3VEQB 2ZCLP 3RXBA 2J34A 3QTVH 5JB8S 2O8MA 4CH8B 3VB5A 1HRTH 1QL9A 2VWNA 3ENSB 4I8KA 4DW2U 3SNEA 2HOBA 1HYLA 3O8DA 1CT2E 1NY22 2ZA5A 3T29A 2XBWA 1EASA 2C4FH 2F9BH 4NA8A 1J15A 1O5DH 1QL7A 1C4U2 2BD4A 3RXVA 1V2NT 2ZGJA 1HAHH 3UOPA 1T8LA 1TOMH