2A7CA

On the routine use of soft x-rays in macromolecular crystallography, part iii- the optimal data collection wavelength
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
240
structure length
240
Chain Sequence
b'VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elastase 1
publication title On the routine use of soft X-rays in macromolecular crystallography. Part III. The optimal data-collection wavelength.
pubmed doi rcsb
molecule tags Hydrolase
total genus 65
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2a7cA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2a7cA01
1CQQA 5L30H 1O2HA 1TPPA 1O3GA 3I78A 1JOUB 1TOCB 4I8GA 4YTAA 2Q1JA 1TX8A 4XDEA 3QLPH 2FTMA 1D4PB 3GYLB 2O8MA 3M5MA 2ZTZA 2H5CA 2NU1E 1LVOA 1HIAA 1E36B 3RC5A 4X8SH 1UVSH 2UWOA 4DVAU 2FESH 1HAGE 5A09A 2GCHF 1PYTC 3HATH 4XE4A 3OY6U 3PWCA 4NIYA 1O2TA 5F8TA 5J4QA 3TNTA 1Z8JB 3K9XB 1AE5A 5DJ7A 3UUZA 4Y76A 3M61U 4M7GA 2WV5A 3GY2A 5L6NH 3TU7H 4LZ4B 3SZNA 3M7TA 4H6TA 1AFQC 1C2HA 3I77A 1C5QA 3F9FA 1YC0A 2NWNA 1Y3YA 2J94A 3MU0A 1HBTH 1C2LA 1ESTA 1O2UA 3UIRA 3OTJE 1T8LA 2FI3E 2R2WU 2VGCB 2QN5T 3TH4H 1PPBH 2BB4A 1JWTA 3MYWA 1FN8A 2PTCE 4I32A 1GBDA 3LH3A 4BAKB 1XX9A 2JKHA 2PKSC 2FI5E 4E05H 1DS2E 2H9HA 1BTZA 2ZA5A 2YNBA 3A7XA 1TNJA 1V2OT 1AVXA 2BD2A 1QL7A 2A4OA 1G3BA 2GZ9A 4ZKOU 2JETB 3RDZA 1LHGH 2ESTE 1UHBA 1ELEE 5F03A 3T2NA 1MU8B 1ZPZA 4NIVA 4X6MA 1UTLM 2F91A 3T29A 1EZSC 1W2KH 2Z6BD 4I31A 1DLKB 1OP0A 1GI1A 8KME2 1ETSH 5FPYA 2ZEBA 1QGFA 3LGVA 2ZHWH 5JB9S 1PPGE 4X1SU 1DWDH 1NU9A 3VB5A 1C1PA 1TX7A 2R9PA 3RXOA 2ZC9H 4D76A 3UR9A 2O8WA 1HAVB 1XKAC 2BDGA 1MTNB 3QTOH 1THRH 2GDDA 3SJOA 1L1JA 1BDAA 2QAAA 3F6UH 3LU9B 1P11E 4UE7H 1OWJA 1IQIA 1BTUA 4O9VA 3ELAH 4IBLH 1TONA 2ANWA 1OX1A 2ZTYA 1GHWH 4NSYA 4NIWA 3LPRA 1VGCB 2VWMA 5CHAB 1OSSA 2Q6FA 2J95A 1EJNA 1MU6B 3TK5A 1UVUH 3GDSA 1O5EH 1ZTLA 4BXSA 1P04A 2GX4A 4CBOA 3KQEA 4DG4A 3UY9A 1GJ4H 2WYJA 3M3VA 1KXAA 2ZU3A 2ZGHA 3F9EA 5DG6A 2ANYA 1YCPK 2XYAA 1F7ZA 3A82A 1TGCA 4IGDA 4RN6A 1F5LA 2ZCLP 3UNQA 2QC2A 1A46H 1L0ZA 3SU4A 1EQ9A 3HKJB 1HAXB 3QK1A 1IQHA 1W0ZU 1HNEE 2IPHA 1C1WH 1SB1H 4NZLA 1J15A 5FCRA 2QY0B 1VJ9U 4SGBE 3MO6A 1DXPA 1O5CB 1TALA 4IW4E 1ZGVA 1F92A 3BTEE 3IG6B 3U8RH 4DGJA 2FX6A 1RXPA 1QBVH 3ZVGA 2HPPH 1TA6A 1K1LA 4B74A 4HFPB 1BHXF 4BOHA 2Y6TA 1C1TA 3A7VA 2PGBB 3CS0A 1WU1A 1ELAA 1DUEA 1TA2A 1L4ZA 1EZQA 1GHAG 1DSTA 1TGNA 1MZDA 1WSSH 4LXBH 3SUEA 1GJBB 1D9IA 2GZ8A 1ARCA 2BD5A 4FUJA 1SGFG 1GL1A 1M9UA 2OINA 4ABIA 1FI8A 4NA8A 2G8TA 1KLTA 1GJCB 1FJSA 1O34A 1G3CA 1O5FH 4X2VA 4WH6A 1A5GH 1BCUH 4GHQA 3TNSA 1FY5A 4KKDA 2SNVA 5K0HA 1B5GH 2FLBH 2UUKB 1CT4E 2XTTB 1HAIH 3ATKA 4ASHA 1E38B 3P95A 2AS9A 2GT7A 2A4QA 3NK8A 1T4UH 2FOAA 1GPZA 1K1NA 1GHXH 1A0JA 3MNXA 1HIAB 2QXGA 2HWLB 1O30A 2IOTA 1LPKB 1Y5UT 3BG8A 1HAZB 2A31A 1FNIA 4X8UH 1FMGA 1L4DA 4ABJA 3FANA 1AY6H 1FIWA 1C5RA 1G37A 4I8LA 1GGDC 5HYOA 2H9EH 1JRSA 1C1RA 1H9HE 1WAYB 1ANDA 4X6PA 1OYQA 2WV4A 2VIOA 3P70B 4WVPE 2TPIZ 1P0SH 2PFEA 1Z6JH 3PM3A 1OP8A 3AW0A 2G5VA 2ZZUH 1LHDH 5JDUB 1AWFH 1T32A 2UUJB 1AQ7A 1D6WA 1S85A 2ZP0H 3BTFE 3I29A 3P8OA 1TPSA 2F9OA 3S9CA 2ZPQA 2C90B 4UFFH 1YGCH 2D8WA 1PQ8A 1O0DH 1C1VH 7KMEH 3SGBE 5JBCS 1CT0E 1GBBA 2TBSA 4DCDA 1BQYA 2YOLA 1RD3B 1XMNB 1ESBA 1TB6H 1AZ8A 1G32B 3M5NA 3M7UA 4ISNA 3V12A 3S7HB 1ZPBA 3O8RA 1AU8A 1YPGH 2AYWA 5T6GA 1TPOA 1OOKB 2Y5FA 1V2VT 4GLYA 2PGQB 2VU8E 3ZZDA 4D7FA 1AB9B 1D6RA 2A1DB 4K60A 4WJG2 4Y8YA 3TJOA 2FEQH 1TE0A 1C5MD 2SGFE 2V3HH 1QY6A 3GY3A 1EAWA 1C5TA 1GI4A 1UCYK 2ZDNA 1O2SA 2BVXH 1DWCH 2V6NA 1TRNA 1TPAE 1AMHA 2O9QA 1SI5H 2VWOA 3S0NA 4ESTE 3NCLA 2BTCE 1DPOA 1PQAA 3M3TA 1UCYE 5ESTE 1LHFH 2OUAA 1HAPH 4MPXA 4KTCA 1GMDG 2G81E 2Z3DA 1GG6B 1MH0A 2ZHFH 4MDSA 4LZ1H 1YPMH 4J1YA 3TJNA 4KTUA 1L2EA 7GCHG 2YNAA 3IWMA 2M5TA 2BD9A 1DANH 2RDLA 3NPSA 4U30A 3KHVA 2VWLA 3RXTA 4RSPA 1GJ5H 3A8DA 3STJA 1W11U 1BMLA 1GBJA 1T31A 4GPGA 3RXEA 3SORA 2GP9B 3VGCC 1RTKA 3A8AA 3M7QA 3Q3XA 3ZZ6A 1G30B 3PLBA 2Q6DA 2I6QA 4BTTB 1O3IA 4MQAA 1EB2A 2B9LA 2VVCA 1OWHA 2PHBA 1GI0A 5L2YH 1T7CA 3EAJA 4BAHB 4OGXA 4Y79A 3CS7A 4AB8A 2BOKA 2QXHA 2ZIQH 1UTPA 4Y8XA 2A2XH 2ZGXH 1B0FA 2F9UA 1Y3UA 4MNVA 1ZOMA 1QA7A 2P3TB 2GCTC 2FOBA 1AFQB 1OKXA 3ZYDA 1BA8B 4MPUA 1Y8TA 1DDJA 2LNCA 3ENSB 1MBQA 3RXIA 3TVJB 1BMNH 1SLWB 3O8BA 3SJIA 2F83A 2GTBA 1GDNA 1O5AB 1PPCE 1ELBA 1QHRB 4H6SB 4MPWA 1ELVA 2HOBA 3P8GA 2OC0A 4IC6A 2AH4X 1GJ8B 1N8OC 4JCNA 2JH0D 3MI4A 2FXRA 4VGCC 1HCGA 6LPRA 3ZZ7A 5EOKA 1MKWK 3N7OA 2PSXA 2P8OC 1GHBG 1AVWA 1BTPA 5K7RA 5EQQA 3KEEA 1EZXC 1FN6A 2AMDA 5EQRA 2P95A 1FQ3A 4XBBA 3F68H 3ZV8A 2ZU5A 4D7GA 1NFYA 4INHA 1C2JA 5AHGH 2EA3A 3KL6A 2VIPA 2CHAC 4FU8A 3DD2H 5J4SA 1QFKH 2HGTH 4UD9H 1DLEA 1IQJA 2ZGJA 1SGPE 2GV7A 2V0BA 3SUGA 2SNWA 3E16B 1YPKH 6GCHF 8GCHG 3TH3H 4X6OA 3VPKA 2AIQA 4JYUH 1JIRA 4UONA 1L1NA 4ISHH 2SGPE 3SUFA 3MU8A 3HPTB 3ZVFA 2AGEX 4IN1A 3RP2A 2B0FA 2BX3A 1GMHF 1P9UA 3NXPA 2D26C 3KQDA 3OYPA 3EA8A 3RMLH 4AX9H 5E2PA 3JZ1B 1ZYOA 1D3DB 1HUTH 3GY8A 3LKWA 3OY5U 3BTKE 2ZPSA 1UTQA 1H8IH 2XRCA 3UTUH 1IHTH 3TGIE 2G51A 1ZSLA 3D62A 3RXPA 1BTHH 1BUIA 4INKA 4X1RU 3EGKH 1A3BH 4FU9A 2P3UB 1UTOA 1ZHRA 1H8DH 2AMPA 1ELGA 5I46H 1V2KT 3TJVA 1BT7A 4X6NA 3ZZ9A 1ETTH 1O2QA 2BY5X 1RTFB 2QYIA 5F8ZA 4OS7A 1BITA 1BJUA 1A4WH 4XFQA 4JZDH 5A0CA 1C5UA 3E6PH 1V2UT 2QXJA 5C5NA 1FXYA 2PTNA 2ZPRA 1TRMA 3SU2A 1RGQA 4Y0YE 1JBUH 4ABDA 1KXBA 5GIBA 3BTWE 3R0FA 1PFXC 3FZDA 3ZZBA 1H1BA 1EB1H 1T8MA 4XOJA 5T3HA 4DIIH 1V2QT 2A4GA 3BTME 4IMZA 1DSUA 3MHWU 5LPRA 1S0RA 1MBMA 3UPEA 2BHGA 2A5IA 1KDQA 3A87A 3TK6A 1SPJA 1YM0A 1K2I1 1ZHMA 1MQ6A 2FLRH 1DOJA 2XCNA 3MNBA 1T8NA 3GISB 4WY3A 5GCHF 1MKXK 1SVPA 5FX6A 5GDSH 1SOZA 1BOQA 1SL3A 4A92A 2D1JA 2GKVE 2ZDAH 4ZUHA 1C5OH 1DFPA 2O8UA 2R3YA 3SU1A 2WYGA 1Z1IA 3RU4E 1YLCA 2R3UA 2B5TB 7GCHF 3ZZ8A 3FVFB 5C1UA 5HGGA 1Y3WA 5T6FA 1O2XA 2G55A 1XKBC 2A32A 3QN7A 4ABAA 2ZGCA 1IQFA 2V3OH 2VWNA 4O3UA 3RXVA 3L6PA 1JRTA 1TMUH 2TRMA 3AVZA 4NCYA 1A1RA 1SGRE 4JZ1A 1A2CH 2G4TA 9LPRA 2ZFRH 4QT8C 4YLQH 1MCTA 1KSNA 1ZLRA 2RCEA 3SGQE 1EOLA 1DY8A 4FU7A 1LHEH 1DUAA 4MLFB 1GHVH 1LVMA 1RRKA 5DO4H 1EAXA 3RXCA 1P12E 1YLDA 1GGDB 2BLVA 5I25A 1PQ5A 1AFEH 3GY5A 1ARBA 1EP6A 3E90B 1AGJA 1C9TA 3BTHE 4DOQA 1ZTKA 1IQEA 1YKTA 1K1PA 3PB1E 4U32A 2ZG0H 5HMAA 1O3PB 1YPLH 2PV9B 1V2WT 3PYHA 2XC5A 2ALVA 1VITG 2ZDLA 2B7DH 1WQVH 1CBWC 1O3NA 1TYNA 3A83A 1C5XB 3GCTF 4Y11E 3RXRA 3SN8A 1AKSA 3U9AH 1DWEH 2F9NA 3HGNA 2Q6GA 3MMGA 3D49H 2EI7A 4ZAEA 4CBNA 1PPZA 1LKBA 5DGJA 5E0HA 2J34A 5DKMA 1OWKA 3QZQA 2H6MA 1QURH 1TMTH 1K1JA 3PROA 3RUOA 4A1VA 2FOHA 1GCTC 1P01A 4AYYB 1E37B 3MU5A 1Q3XA 2A7CA 3UNRA 1GHBF 5E8EH 1A7SA 1CA8B 1GJ7B 2KAIB 1RS0A 1HRTH 2ALPA 3SOSA 4ABEA 1P2OA 1B0EA 1PQ7A 3TGJE 4JYTA 1SGCA 2XWBI 4INLA 1FAKH 2W7SA 4OS4A 1HYLA 2W7UA 1QA0A 3FAOA 1GVZA 2OBQA 4A1TA 4AORA 4K8BA 1W0YH 1CT2E 1WTHD 1DVAH 4GCHF 1TQ0B 1SQAA 1EOJA 2THFB 1C1NA 3M37A 4X0WU 2FO9A 2PLXA 4B2AA 5C20A 3PTBA 2VIVA 3UR6A 3UFAA 4AGKA 1EJMA 4WF8A 2ZWLH 1CGIE 5T6DA 4I7YH 1QTFA 5DP3A 1MTWA 1MMJN 3SV2H 1BTYA 1CHOG 1KTSB 2R0KA 1GJ9B 2ZO3H 2K1QA 2EEKA 3GOVB 2FS8A 2Y5GA 1O2NA 2PUXB 1EX3A 1BHXB 1Y59T 2OQ5A 1C5VA 1GBLA 4AOQA 3ZVAA 3V3MA 3VGCB 1QIXB 5F6MA 3LGYA 2ODYB 3SI3H 1DE7H 5E0JA 3P17H 4MPVA 2QIQA 4GSOA 4IN2A 2UUYA 4XBDA 3TIUA 4F49A 1U6QA 2J2UA 1E34B 1S0QA 5A8XA 3KGPA 1DY9A 2BD8A 5FAHA 1OP2A 3F9HA 1XXDA 1BRUP 2W5EA 1VCWA 2W3IA 3RM2H 2GCTB 1OWDA 5GXPA 2XC4A 5AFZH 1KYNA 1DICA 8ESTE 2P93A 4R8TB 3KIDU 3LC3A 3LC5A 5DK1A 3VFEA 3ZVBA 1O3EA 3A8CA 1C9PA 1HXFH 4AN7A 2WPJS 1FDPA 3BTDE 2BD7A 3P6ZB 3P8FA 4K69A 1P2KA 2W26A 3SU0A 3MOCA 2C93B 7LPRA 4ZHMU 1N8OB 1C1MA 1NT1A 4NZQA 1LCYA 4X8VH 2BQWB 1CA0C 3VB3A 1QL9A 1HXEH 5EW1H 4I8JA 4CREA 4E06H 1P3CA 2W3KA 1O5DH 2P8OB 1TFXA 3GCHC 3SW2B 3E0PB 4NIXA 1S84A 2P59A 3GY6A 2GDEH 3U69H 2NU3E 4K1SA 2FP7B 3VB6A 1P05A 2GD4B 1C1OA 1HDTH 3SJ9A 2VH0A 1FV9A 2CF8H 1SQOA 2C8YB 5CMXH 2IJOB 1IQGA 1C2DA 1QRXA 3AAVA 1ZRKA 1KXFA 2VIQA 3MNCA 1P09A 4K3JA 5E0GA 3Q76A 4O97A 1O2WA 1GL0E 4CRFA 3HKIB 5FBIA 4XBCA 2BY9X 2QA9E 1FONA 3EE0B 4JK5A 2PR3A 1ZTJA 5A8YA 4AFQA 5AF9H 4HGCA 4CRDA 1QJ6B 2P3FH 1C1QA 3D65E 1P9SA 4IC5A 3A7TA 3URDA 1OS8A 2WUCA 4FVDA 3RXJA 1TGSZ 2PSYA 1V2TT 2XBWA 3RXUA 4WMEA 2CF9H 1HB0B 1GBEA 1THSH 2FIRH 1HPGA 4YOGA 3SV8A 4XSKU 1AUJA 2GMTC 1MCVA 1AIXH 3LT3A 2I6SA 5ABWA 4AG1A 1VITF 3LIWA 3UQVA 3EA7A 1BMMH 3NZIA 4B1TA 3NKKA 2AGIX 1HAYB 1OWIA 5H4IB 1SMFE 4FUFA 3DT0H 1IQLA 1C2GA 2WPMS 1UJ1A 1IHSH 3GY4A 1SLXB 1FPHH 1W12U 2XBXA 2JH6D 3SUDA 1O3BA 1BTXA 1RTLA 1TNGA 5EPYA 3AW1A 3D23A 3MO9A 1RIWC 1P02A 3ZZ5A 1VR1H 4CR5A 1N6XA 1TX6A 1A5IA 3SV6A 4I33A 5A0BA 3SQHE 1VJAU 1A0HB 5AVDA 3SJKA 1UHBB 1FPCH 3SV7A 5EG4A 1N1LA 1F2SE 1TBQH 3SGAE 1TOMH 1WOFA 1G3DA 2TGDA 2FOEA 3KN2A 3FP6E 3BIUH 2BMGB 1KXEA 4E7NA 2PUQH 1MQ5A 1C2IA 4NGAH 1NFWA 5EXLA 4R0IA 5TCAA 1LPGB 4BTIB 4JZIA 1YCPH 1TQ7B 5LGOA 5FX5A 3Q77A 4WXIA 1YPEH 1C1SA 4CRGA 1F5KU 2HNTF 1YP9A 3ATWA 1LMWB 4MVNA 1PJPA 1O3KA 1GBMA 5BRRE 1DXWA 4YLUA 1IOEA 2XBYA 1ZMJA 4O03A 1TAWA 1CHOF 3QO6A 3V0XA 1BBRK 2BLOA 2SGEE 1HLTH 1SQTA 1WBGB 2NU4E 4Z0KA 4K5ZA 4AG2A 4GAWA 2XCFA 1LHCH 3QX5H 1CE5A 2ZFFH 1BBRE 1QBOA 1UVOA 1P2MA 2BVSH 4OS6A 2WPIS 3GY7A 3E0NB 5BPEA 2VIWA 1LTOA 3H7OA 1HAHH 1GVKB 2ASUB 5JYIA 1QNJA 2FPZA 2WPHS 1V2RT 1F0RA 3BV9B 3GCOA 2BVRH 1B7XB 4B2BA 3SU3A 1AI8H 4OS1A 1TBRH 2OQUA 1XXFA 3UQOA 3TH2H 1ANEA 1SGYE 1WUNH 1ID5H 1AUTC 1CBWB 2GCHG 2QCYA 2H2ZA 3ODFA 5C67A 8LPRA 2STBE 4LOYH 3DUXH 1O2YA 1NTPA 1H9IE 1KLJH 2BXUH 3S7KB 3SV9A 3E1XB 4K8YA 2ODQA 1EP5A 2PKSB 3U8OH 1GCTB 1MD8A 3ZZ3A 5DP9A 1SR5C 4Y7BA 1GHAF 5JB8S 4Y10E 1ZSKA 2EI6A 2IN2A 2Z9IA 4JZFH 4Q2KA 4DIHH 1F0SA 2ZKSA 3U1IB 1HJAC 1V2MT 4K1TA 4X2WA 4X8TH 2XNIA 4ZKNU 3LGUA 2WPKS 4WWYA 3E8LA 3UOUA 1O3JA 3GDUA 3P8NA 5TCCA 2F3CE 1XVOA 4D9QA 1C2EA 3RXFA 1O36A 2Y80A 2Y7XA 1O3AA 1KIGH 1W7XH 5FHTA 4O3TA 1QB6A 2RG3A 6ESTA 2BOHB 1HAOH 4FUDA 1JIMA 4TWWA 1XUKA 2GV6A 1FLEE 3C1KA 2BM2A 1CHGA 2QF3A 5DP8A 1QQ4A 1EPTC 1GJDB 4JYVH 1GJ6A 3A89A 1O38A 3WY8A 2FWWA 2BDHA 5GPIB 1V2ST 3RC6A 1QBNA 3BEFB 2ODPA 3ZVDA 5EXNA 2J92A 2J4IA 2GVFA 1S81A 4TPIZ 1V2PT 1MUEB 4X1QU 4AZ2B 1P2IA 1CU1A 3SNEA 1O2LA 1EXFA 2XBVA 1UCYH 2DUCA 1H4WA 1LQDB 4YOIA 4ABBA 1TMBH 5A2MH 1GI8B 5E2OA 1O2PA 3ATMA 4RKJB 1GI9B 1TGBA 3JZ2B 1C5SA 2FZZA 1HAVA 3AAUA 1K9OE 1EKBB 3GCNA 1O2RA 1XUHA 4CR9A 3RXHA 2BQ7B 1JXPA 2TGTA 3RU4D 1O2GH 2WPLS 5LPEA 2HNTE 2VNTA 1YBWA 3P92A 1C5ZB 1EASA 1FY8E 1XVMA 3A85A 4CHAC 1LVYA 1GWAA 4NFFA 2ILNA 4Q7YA 3RXQA 4ZMAH 2EI8A 4A1XA 1O3DA 2BDCA 1BZXE 2STAE 3MH4A 3O8CA 1P03A 3SNAA 2FOCA 3SNDA 1D3QB 3EYDA 1V2NT 4F4OC 5HM9A 2XWAA 3RMMH 1GI6A 1YPHE 1BIOA 1O3HA 1GVLA 3UOPA 3BTTE 2G4UA 4E7RG 3QGJA 2ZU4A 1CA0B 1P2QA 4YM9A 5EXMA 9ESTA 5EW2H 1AWHB 4MTBA 1XUFA 1P8VC 1C5LH 3Q3YA 3GCHB 1GMDF 3KQCA 1THPB 2FYRA 1FAXA 1GBHA 3F9GA 1TRYA 1NRPH 3MWIU 5GJ4B 1YCPM 1A3EH 1A0LA 2QXIA 4HZHA 3ATIA 1OXGA 1C2KA 2ZDVH 1GBTA 1J8AA 4ZHAA 2TIOA 4UFDH 4MNWA 3B9FH 1ZJDA 1LQEA 1O32A 2P94A 5FPTA 2AGGX 2ZU2A 3PMJA 1Z8RA 1CVWH 4UEHH 1SGTA 4X2YA 3G01A 3MU1A 1W13U 1SGIB 1QRZA 1UVPA 4Y7AA 3FP7E 1ELDE 1T4VH 1TGTA 3BTGE 5B6OA 1G3EA 1C5NH 1EPTA 2Z7FE 4GVUA 1WV7H 2OC8A 2G52A 4JZEH 1MKWH 5JBBS 3RXDA 4WMFA 1BRCE 4WMDA 2ZNKH 4BAQB 4FUCA 3UREA 3QGNB 4Q7XA 1G2LA 1TBZH 2PW8H 3M5OA 1HGTH 3GDVA 2D2DA 1NO9H 2GMTB 3V7TA 3VB7A 3R3GB 1HJ8A 1O2OA 4OGYA 3TLOA 2DE9A 3RXLA 1E35B 4J2YB 2FDAA 3MH7A 3VEQB 3SNBA 3S9AA 1SFQB 1GI5A 1SHYA 5FXLA 4ABHA 1UO6A 3DHKH 3A7YA 1O33A 4U01A 2ZDKA 2FODA 2F9PA 3ZZ4A 1OYTH 3SQEE 3B8JA 1K28D 3E3TA 4I8HA 5G4BA 1ZMNA 3A86A 1RIWB 1O2MA 4A7IB 1D3TB 1HFDA 4NA9H 2Y82A 1J9CH 1C5YB 1XUGA 1Y5BT 2PKAA 1LDTT 2A7HA 3L33A 2ZHQH 3ATLA 1XM1A 3EQ0H 4X1NU 2FI4E 4BTUB 2UWPA 4THNH 4FUIA 4X1PU 1V6DA 1C5WB 2C8ZB 3FFGA 3K65B 1GI2A 3BN9A 1DITH 1XUJA 2F9BH 8GCHF 2BDAA 3SI4H 1ABIH 1Z8GA 3RXKA 4DY7B 2BD4A 1NZQH 3DFLA 1K1MA 1TNKA 2H1UA 1ZRBA 4NWLA 3MO3A 1O37A 2OCVB 3A8BA 4IS5A 1NFXA 4ABFA 4BNRA 3H7TA 2FOFA 1QB1A 5EGMA 1Z7KA 2AERH 3NUMA 4TWYA 2ZTXA 4NSVA 1DX5M 5EU8A 3KF2A 4FUGA 1S5SA 4AFUA 1JMOH 4DJZB 4DURA 2BX4A 2HLCA 4WXVA 5EODA 4D8NA 1FY1A 1INCA 4A5TS 1J17T 1ABJH 2RA0A 1C4U2 2GT8A 3RXBA 5DP4A 4NG9H 4Y8ZA 3PTNA 3RXSA 4YOJA 1IQKA 4UFGH 3U98H 1MKXH 1MZAA 2C8WB 1FZZA 1GHZA 1W14U 1Z1JA 2ZI2H 2BDYA 1LO6A 1DWBH 1O2KA 1SGFA 1GBIA 2TGAA 1GI7B 1BTWA 2SGQE 1SG8B 1T8OA 1NRQH 1ZPCA 3LONA 5C3NA 4ZKRU 1Z71A 1NS3A 1CSOE 3A84A 3PLPA 2ZECA 1W8BH 3SNCA 6CHAC 3PMAB 1O2ZA 2OC7A 3A80A 4JK6A 1C4Y2 1QJ1B 1K22H 1KDQB 1C4V2 1EUFA 2FYQA 4FXGH 3TK9A 3W95A 4Z6AH 3LOXA 4MNXA 2Z9GA 4YT7H 4CRBA 1MTSA 2A45B 2BLQA 4RKOB 2AMQA 1EZUC 3VXEH 4VGCB 2BDIA 3LGTA 4NWKA 4CH8B 1GMCG 1P2JA 3MTYA 5IYTA 3RM0H 3GICB 1S6FA 1GHYH 4Y6DA 2A4RA 4JMYA 2VINA 1TLDA 5C1XA 1HJAB 1XUIA 4CH2B 1F0UA 4UDWH 2ZQ2A 2HRVA 2FOMB 4D9RA 1UK3A 2DE8A 4PROA 3OSYA 3KQBA 3ESTA 2CHAB 4H42U 4ISIH 1AE8H 4FUEA 2ZHDA 3VB4A 3PO1C 3BG4C 1O39A 3M3SA 4ABGA 1O35A 4FVBA 4GHTA 1PPEE 4KP0A 3RLWH 1MD7A 3A7ZA 1EPTB 1RJXB 2P16A 2HVXA 1EAUA 1NM6A 3W94A 2Y7ZA 1O3LA 5JBTA 1X7AC 4ISLA 1C2MA 2BD3A 4SGAE 3UWJH 1UTNA 2VVUA 1WTGH 1SC8U 5GWZA 3LDXH 3QTVH 2CJIA 1SGEE 1SHHB 2A5AA 3E91A 6GCHG 2ZFPH 1QL8A 5EQSA 2OD3B 5FPSA 1P10A 1TNLA 2ZCHP 4TYDA 1F0TA 2A0QB 1NPMA 3T27A 3MH6A 3TGKE 1GMHG 3TPIZ 2QF0A 3ITIA 2ZDMA 1AKSB 1A61H 2Z94A 1DT2A 1FY3A 2VIDA 4TY7A 5DP5A 1UK4A 1NFUA 3QDZB 1O3MA 1SGQE 3A81A 1MAYA 4MG3A 4CRCA 1YPJH 2A5KA 4Q7ZA 3A88A 3ODDA 1LPZB 5FBEA 1BRAA 1S6HA 3BF6H 3BSQA 2ZFTA 4AFSA 3SHCH 3AASA 1MAXA 1G2MA 4CHAB 1L1GA 2PKAB 3MFJA 2CN0H 1UTKA 3CENA 1HV7A 3DA9B 3MU4A 1GBKA 2FX4A 1S82A 1SOTA 3SBKA 1P3EA 2Y81A 1AVGH 1PPHE 4B2CA 1SGNE 3EDXB 1SFIA 1NN6A 2FM2A 2VGCC 3H5CB 5DP7A 2R2MB 2C3SA 3PMBB 2OC1A 1SLVB 3RMNH 4YZUA 1BJVA 1PPFE 2H9TH 2QGRA 2AEIH 3B23B 1ZR0A 1NROH 1IQNA 3CP7A 3QWCH 3BIVH 2Z9KA 2J9NA 1N6YA 1LKAA 2JETC 2FOGA 1ZZZA 2OP9A 3DFJA 1CGJE 1G9IE 2G00A 3QZRA 3Q00A 4B76A 5DPAA 3RC4A 3PLKA 4KTSA 4NA7A 4ISOA 1AHTH 5GCHG 1Y5AT 1BB0B 4I8KA 1SLUB 3SHAH 2XW9A 2UWLA 2Z3CA 5ETXA 1S83A 1O2JA 1TIOA 2UUFB 1ORFA 1ETRH 1VZQH 5C5OA 1SBWA 2ANMH 4ZKSU 3SU6A 5FCKA 4HTCH 3U1JB 3K6YA 2Z3EA 5CE1A 5EPNA 2SFAA 2ULLA 4AGJA 1W10U 1MTNC 2BY7X 3SJ8A 3STIA 1K21H 1ZJKA 2AFQB 3ZYEA 1CGHA 3PWBA 1YF4A 3LGWA 2C8XB 1KTTB 1WYKA 1ZGIA 2CXVA 1YYY1 1O5BB 2HALA 3OX7U 1P06A 4YT6H 1HJ9A 2BZAA 2OXSA 1VGCC 1Q31A 2BY6X 5CHAC 2CV3A 5LH8A 1GBCA 1Z8IB 1BRBE 1NC6A 1ELCA 3EA9A 4FUHA 1J14A 2A7JA 2XXLA 1GI3A 4ZROA 4B75A 5C1YA 1ELFA 2OLGA 1AZZA 1SGDE 1F5RA 4YO9A 3T26A 2QV1A 3T62A 2OBOA 1NY22 2F9VA 2C4FH 1TNIA 1NRSH 5LPFA 1GJAB 1SSXA 3MH5A 3F1SB 2B8OH 1VCPA 3ZZCA 2O8TA 1QCPA 3UNSA 3HGPA 1V3XA 2Z9JA 2FTLE 3SO3A 3M36A 3T25A 2BDBA 1GDUA 1UTMA 1Q2WA 5C2ZA 4TPYA 4BXWA 1GMCF 4B71A 2ZFSA 2O8LA 1OPHB 1TNHA 3GCTG 2ZCKP 4NFEA 1D3PB 4DT7B 3M35A 2BXTH 1QRWA 1GBAA 1TABE 4H4FA 4YESB 2BQ6B 2VVVA 4AB9A 5PTPA 1CO7E 2FMJA 3MNSA 4ZH8A 4AYVB 1OWEA 3BTQE 3L3TA 2ANKH 4A6LA 2RA3A 4X2XA 3T5FH 1V2LT 1W3CA 3ZVEA 2Z9LA 1A5HA 1EAIA 1KY9A 4B73A 4FUBA 1WCZA 3FZZA 3RU4T 1IAUA 1FY4A 5F8XA 1AO5A 5IDKA 1C2FA 4DW2U 3O8DA 4U2WA 2EC9H 3Q3KA 5L2ZH 1ZMLA 4Y0ZE 1O31A 1FUJA 2KAIA 3HK6B 1UMAH 3S69A 5HM2A 5TJXA 2TGPZ 3K6ZA 3ZVCA 4KGAA 2PWXA 3FP8E 3PMHB 1NESE 3GYMA 3RXGA 3UWIA 1UVTH 5HXFA 4ZXYH 2CMYA 4TY6A 4GCHG 3BEIB 3KCGH 4AFZA 3M5LA 1ZSJA 3LJJA 2ZF0H 2GGVB 4OS2A 5SGAE 1DM4B 2VB0A 3C27B 2ZHEH 1P2NA 2BY8X 1KXCA 3RXMA 4Q80A 3TITA 1QQUA 2BLWA 2JH5D 3ZV9A 3HK3B 3LGIA 4K1EA 4KELA 2BZ6H 3QUMP 1EJAA 3IITA 2AIPA 2G5NA 1GDQA 1VCQA 3T28A 1C5PA 1C1UH 2BYAX 2HNTC 1O2VA 3URCA 2J38A 2LPRA 4BANB 1V2JT 2CGAA 4LK4A 3RLYH 2SGDE 4CRAA 6CHAB 4ZHLU 4GUXA 3LH1A 2H5DA 1IQMA 1MTUA 1BMAA 1O5GH 3TJUA 1Y3XA 2VJ1A 1BBRH 1K1OA 3BEUA 3PV4A 1YPHC 2FS9A 1O3FA 1ELTA 1ESAA 1QR3E 2NU0E 4BAMB 1O3CA 2ZU1A 7ESTE 1LVBA 2HPQH 4K2YA 1O2IA 1Y3VA 4Y71A 3V13A 3S9BA 4OS5A 5JPMH 1O3OA 1AD8H 3SU5A 2ZQ1A 2ZGBH 1AB9C 4WH8A 3VXFH 1QJ7B 1KXDA 2VH6A 1NRRH 3OU0A 5ESBA 2WINI 2NU2E 4ZXXH 1TWXB 3NWUA 3ZZAA 1RFNA 3U8TH 4BAOB 5JBAS 1UTJA 1MTVA 4UFEH 1PYTD 1GCDA 1KLIH 3RXAA 2OTVA 4HI3A 2V35A 5A8ZA 1NRNH 3KNXA 2WUBA 1H9LB 3A7WA 3LJOA 1ZHPA 1AN1E 1WQSA 1GBFA 1ACBE 1P57B 3BG4B 3PO1B 3RMOH 2GZ7A 1NU7B 2SGAA 1ANBA 2XC0A 1GG6C 2ZFQH 1QB9A 1EATA 2A2QH 5A0AE 1E0FD 5AFYH 3K2UA 1Z6EA 1ANCA 1G36A 4IMQA 4MNYA 1J16A 5DP6A 1UK2A 1VITH 1K1IA 1FIZA 2Y5HA 2R0LA 1W7GH
chains in the Genus database with same CATH superfamily
1CQQA 5L30H 1O2HA 1TPPA 1O3GA 3I78A 1JOUB 1TOCB 4I8GA 4YTAA 2Q1JA 1TX8A 4XDEA 3QLPH 2FTMA 1D4PB 3GYLB 2O8MA 3M5MA 2ZTZA 2H5CA 2NU1E 1LVOA 1HIAA 1E36B 3RC5A 5B6LA 4X8SH 1UVSH 2UWOA 4DVAU 2FESH 1HAGE 5A09A 2GCHF 1PYTC 3HATH 4XE4A 3OY6U 3PWCA 4NIYA 1O2TA 5F8TA 5J4QA 3TNTA 1Z8JB 3K9XB 1AE5A 5DJ7A 3UUZA 4Y76A 3M61U 2KFWA 4M7GA 2WV5A 3GY2A 5L6NH 3TU7H 4LZ4B 3SZNA 3M7TA 3UB0A 4H6TA 4Q4LA 1AFQC 1C2HA 3I77A 1C5QA 3F9FA 1YC0A 2NWNA 1Y3YA 2J94A 3MU0A 1HBTH 1C2LA 1ESTA 1O2UA 3UIRA 3OTJE 1T8LA 2FI3E 2R2WU 2VGCB 2QN5T 3TH4H 1PPBH 2BB4A 1JWTA 3MYWA 1FN8A 2PTCE 4I32A 1GBDA 3F0OA 3LH3A 4BAKB 4I86A 1XX9A 2JKHA 2PKSC 5F53A 2FI5E 4E05H 1DS2E 1BMFD 1BTZA 2H9HA 2ZA5A 2YNBA 3A7XA 3F2GA 2J5UA 1TNJA 1V2OT 1AVXA 2BD2A 1QL7A 2A4OA 1G3BA 2GZ9A 4ZKOU 2JETB 3RDZA 1LHGH 1YY3A 2ESTE 1UHBA 1ELEE 5F03A 3T2NA 1MU8B 1ZPZA 4NIVA 4X6MA 1UTLM 2F91A 3T29A 1EZSC 1W2KH 2Z6BD 4I31A 1DLKB 1OP0A 1GI1A 8KME2 1ETSH 5FPYA 2ZEBA 1QGFA 3LGVA 2ZHWH 5JB9S 1PPGE 4X1SU 1DWDH 1NU9A 2V3MA 3VB5A 1C1PA 1TX7A 2R9PA 3RXOA 2ZC9H 4D76A 3UR9A 2O8WA 1HAVB 1XKAC 2BDGA 1MTNB 3QTOH 1THRH 2GDDA 3SJOA 1L1JA 1BDAA 2QAAA 3F6UH 3LU9B 1P11E 4UE7H 1OWJA 1IQIA 3W1EA 1BTUA 4O9VA 3ELAH 4IBLH 1TONA 2ANWA 1OX1A 2ZTYA 1GHWH 4NSYA 4NIWA 3LPRA 1VGCB 2CK3D 2VWMA 1OSSA 5CHAB 2Q6FA 2J95A 1EJNA 1MU6B 3TK5A 1UVUH 5C0TA 3GDSA 1O5EH 1ZTLA 4BXSA 1P04A 2GX4A 4CBOA 3KQEA 4DG4A 3OFND 3UY9A 1GJ4H 2WYJA 3M3VA 1KXAA 2ZU3A 2ZGHA 3F9EA 5DG6A 2ANYA 1YCPK 2XYAA 1F7ZA 3A82A 1TGCA 4IGDA 4RN6A 1F5LA 2ZCLP 3UNQA 2QC2A 1A46H 1L0ZA 3SU4A 1EQ9A 3HKJB 1HAXB 3QK1A 1IQHA 1W0ZU 1HNEE 2IPHA 1C1WH 1SB1H 4NZLA 1J15A 5FCRA 2QY0B 1VJ9U 4SGBE 3MO6A 1DXPA 1O5CB 1E1QD 1TALA 4IW4E 1ZGVA 1F92A 3BTEE 3IG6B 3U8RH 4DGJA 2FX6A 3DSOA 1RXPA 1QBVH 3ZVGA 2HPPH 3GS9A 1TA6A 1K1LA 4B74A 4HFPB 1BHXF 4BOHA 2Y6TA 3WW7A 1C1TA 3A7VA 5C0UA 4AC9A 2PGBB 3CS0A 1WU1A 1ELAA 1DUEA 4ASUD 1TA2A 1L4ZA 1EZQA 1GHAG 1DSTA 1TGNA 3U28C 1MZDA 1WSSH 4LXBH 3SUEA 1GJBB 1D9IA 2GZ8A 1ARCA 2BD5A 4FUJA 2JDID 1SGFG 1GL1A 1M9UA 2OINA 4ABIA 1FI8A 4NA8A 2G8TA 1KLTA 1GJCB 1FJSA 2V7QD 1O34A 1G3CA 1O5FH 4X2VA 4WH6A 1A5GH 1BCUH 4YXWD 4GHQA 3TNSA 1FY5A 4KKDA 2SNVA 5K0HA 1B5GH 2FLBH 2UUKB 1CT4E 2XTTB 1HAIH 3ATKA 4ASHA 1E38B 3P95A 2AS9A 2GT7A 2A4QA 3NK8A 1T4UH 2FOAA 1GPZA 1K1NA 1GHXH 2M2AA 1A0JA 3MNXA 3F3BA 1HIAB 2QXGA 2HWLB 1O30A 2IOTA 1LPKB 1Y5UT 3BG8A 1HAZB 2A31A 1FNIA 3OE7D 4X8UH 1FMGA 1L4DA 4ABJA 3FANA 1AY6H 1FIWA 1C5RA 1G37A 4I8LA 1GGDC 5HYOA 2H9EH 1JRSA 1C1RA 1H9HE 1WAYB 1ANDA 4X6PA 1OYQA 2WV4A 2VIOA 3P70B 4WVPE 5C17A 2TPIZ 1P0SH 2PFEA 1Z6JH 3PM3A 1OP8A 1K0HA 3AW0A 3N7EA 2G5VA 2ZZUH 1LHDH 5JDUB 1AWFH 1T32A 2UUJB 1AQ7A 1D6WA 1S85A 2ZP0H 3BTFE 3I29A 3P8OA 1TPSA 2F9OA 3S9CA 2ZPQA 2C90B 4UFFH 1YGCH 2D8WA 1PQ8A 1O0DH 1C1VH 3KYFA 3SGBE 7KMEH 5JBCS 1CT0E 1GBBA 2TBSA 4DCDA 1BQYA 2YOLA 1RD3B 1XMNB 1ESBA 1TB6H 1AZ8A 1G32B 3M5NA 3M7UA 4ISNA 3V12A 3S7HB 1ZPBA 3O8RA 2K0QA 1AU8A 1YPGH 2AYWA 5T6GA 1TPOA 1OOKB 2Y5FA 1V2VT 4GLYA 2PGQB 2VU8E 3ZZDA 4D7FA 1AB9B 1D6RA 2A1DB 4K60A 4WJG2 4Y8YA 3TJOA 2FEQH 1TE0A 1C5MD 2SGFE 2V3HH 2HVYB 1QY6A 3GY3A 1EAWA 1C5TA 1GI4A 1UCYK 2ZDNA 1O2SA 2BVXH 1DWCH 2V6NA 1TRNA 1TPAE 1AMHA 2O9QA 1SI5H 2VWOA 3S0NA 4ESTE 3NCLA 2BTCE 1DPOA 1PQAA 3M3TA 1UCYE 5ESTE 1LHFH 2OUAA 1HAPH 4MPXA 4KTCA 1GMDG 2G81E 2Z3DA 1GG6B 1MH0A 2ZHFH 4MDSA 4LZ1H 1YPMH 4J1YA 3TJNA 4KTUA 1L2EA 7GCHG 2YNAA 3IWMA 2M5TA 2BD9A 1DANH 2RDLA 3NPSA 4U30A 3KHVA 2VWLA 2RDEA 3RXTA 4RSPA 1GJ5H 3A8DA 3STJA 1W11U 1BMLA 1GBJA 1T31A 4GPGA 3RXEA 3SORA 2L74A 2GP9B 3VGCC 1RTKA 3A8AA 3M7QA 3Q3XA 3ZZ6A 1G30B 3PLBA 2JJ2D 2Q6DA 2I6QA 4BTTB 1O3IA 2VBCA 4MQAA 1EB2A 2B9LA 2VVCA 1OWHA 2PHBA 1GI0A 5L2YH 1T7CA 3EAJA 4BAHB 4OGXA 4Y79A 3CS7A 4AB8A 2BOKA 2QXHA 1E79D 2ZIQH 1UTPA 4Y8XA 2A2XH 2ZGXH 1B0FA 2F9UA 1Y3UA 4MNVA 1ZOMA 1QA7A 2P3TB 2GCTC 2FOBA 1AFQB 1OKXA 5EJZA 3ZYDA 1BA8B 4MPUA 1Y8TA 1DDJA 1W0KD 2LNCA 1MBQA 3ENSB 3RXIA 3TVJB 1BMNH 1SLWB 3O8BA 3SJIA 2F83A 2GTBA 1GDNA 1O5AB 1PPCE 1ELBA 1QHRB 4H6SB 4B6FA 4MPWA 1ELVA 2HOBA 3P8GA 2OC0A 4IC6A 2AH4X 1GJ8B 1N8OC 4JCNA 2JH0D 3MI4A 2FXRA 4VGCC 1HCGA 6LPRA 3ZZ7A 5EOKA 4F55A 1MKWK 3N7OA 2PSXA 1COWD 2P8OC 4Q63A 1GHBG 1AVWA 1BTPA 2WSSD 5K7RA 5EQQA 3KEEA 1EZXC 1FN6A 2AMDA 5EQRA 2P95A 1FQ3A 4XBBA 3F68H 3ZV8A 2ZU5A 4D7GA 1NFYA 4INHA 1C2JA 5AHGH 2EA3A 3KL6A 2VIPA 2CHAC 4FU8A 1MABB 3DD2H 5J4SA 1QFKH 2HGTH 4UD9H 1DLEA 1IQJA 2ZGJA 1SGPE 2GV7A 2V0BA 3SUGA 2SNWA 3E16B 1YPKH 6GCHF 8GCHG 3TH3H 4X6OA 3VPKA 2AIQA 4JYUH 1JIRA 4UONA 1L1NA 4ISHH 2SGPE 3SUFA 3MU8A 3HPTB 3ZVFA 2AGEX 2AHME 4IN1A 3RP2A 2B0FA 2BX3A 1GMHF 5KECA 1P9UA 3NXPA 2D26C 3KQDA 3OYPA 3EA8A 3RMLH 1SQRA 4AX9H 5E2PA 3JZ1B 1ZYOA 1D3DB 1HUTH 3GY8A 3SYJA 3LKWA 3OY5U 3SZEA 3BTKE 2ZPSA 1UTQA 1H8IH 2XRCA 3UTUH 1IHTH 3TGIE 2G51A 1ZSLA 3D62A 3RXPA 1BTHH 1BUIA 4INKA 4X1RU 3EGKH 1A3BH 4FU9A 3FOAA 2P3UB 1UTOA 1ZHRA 1H8DH 2AMPA 1ELGA 5I46H 1V2KT 3TJVA 1BT7A 4X6NA 3ZZ9A 1ETTH 1NBMD 1O2QA 2BY5X 1RTFB 2QYIA 5F8ZA 4OS7A 1BITA 1BJUA 1A4WH 4XFQA 4JZDH 5A0CA 1C5UA 3E6PH 1V2UT 1W0JD 2QXJA 5C5NA 1FXYA 2PTNA 5KEDA 2ZPRA 1TRMA 3SU2A 1RGQA 4Y0YE 1JBUH 4ABDA 1KXBA 5GIBA 3BTWE 3R0FA 1PFXC 3FZDA 3ZZBA 1H1BA 1EB1H 1T8MA 4XOJA 5T3HA 4DIIH 1V2QT 2A4GA 3BTME 4IMZA 1DSUA 3MHWU 5LPRA 1S0RA 1MBMA 3UPEA 2QE7D 2BHGA 2A5IA 1KDQA 3A87A 3TK6A 1SPJA 1YM0A 1K2I1 1ZHMA 1MQ6A 2FLRH 1DOJA 2XCNA 3MNBA 1T8NA 3GISB 4WY3A 5GCHF 1MKXK 1SVPA 5FX6A 5GDSH 1SOZA 1BOQA 1SL3A 4A92A 2D1JA 2GKVE 2ZDAH 4ZUHA 1C5OH 1DFPA 2O8UA 2R3YA 4RI0A 3SU1A 2WYGA 1Z1IA 3RU4E 1YLCA 2R3UA 2B5TB 4RT1A 7GCHF 3ZZ8A 3FVFB 5C1UA 5HGGA 1Y3WA 5T6FA 1O2XA 2G55A 1XKBC 2A32A 3QN7A 4ABAA 2ZGCA 1IQFA 2V3OH 2VWNA 4O3UA 3RXVA 3L6PA 1JRTA 1TMUH 2TRMA 3AVZA 4NCYA 1A1RA 1SGRE 4JZ1A 1A2CH 2G4TA 9LPRA 2ZFRH 4QT8C 4YLQH 1MCTA 1KSNA 1ZLRA 2RCEA 3SGQE 1EOLA 1DY8A 1QZ8A 4FU7A 1LHEH 1DUAA 4MLFB 1GHVH 1LVMA 1RRKA 5DO4H 1EAXA 4TSFD 3RXCA 1P12E 2HLDD 4FETA 1YLDA 1GGDB 2BLVA 3DCLA 5I25A 2YMSC 1PQ5A 1AFEH 3GY5A 2K8IA 1ARBA 1EP6A 3E90B 1AGJA 1C9TA 3BTHE 4DOQA 1ZTKA 1IQEA 1OHHD 1YKTA 1K1PA 3PB1E 4U32A 2ZG0H 5HMAA 1O3PB 1YPLH 2PV9B 1V2WT 3PYHA 2XC5A 2ALVA 1VITG 2ZDLA 2B7DH 1WQVH 1CBWC 1O3NA 1TYNA 3A83A 1C5XB 3GCTF 4Y11E 3RXRA 3SN8A 1AKSA 3U9AH 1DWEH 2F9NA 3HGNA 2Q6GA 3MMGA 3D49H 2EI7A 4ZAEA 3F0PA 4CBNA 5DN6D 1PPZA 1LKBA 5DGJA 5E0HA 2J34A 5DKMA 1OWKA 3QZQA 2H6MA 1QURH 1TMTH 1K1JA 3PROA 3RUOA 4A1VA 2FOHA 1GCTC 1P01A 4AYYB 1E37B 3N7DA 3MU5A 1Q3XA 2A7CA 3UNRA 3OAAD 1GHBF 5E8EH 1A7SA 1CA8B 1GJ7B 2KAIB 2KZ4A 1RS0A 1HRTH 2ALPA 3SOSA 4ABEA 1P2OA 1B0EA 1PQ7A 3TGJE 4JYTA 1SGCA 2L6OA 2XWBI 4TT3D 4INLA 1FAKH 2W7SA 4OS4A 1HYLA 2W7UA 1QA0A 3FAOA 1GVZA 2OBQA 4A1TA 2WPDD 4AORA 4K8BA 1W0YH 1CT2E 1E1RD 1WTHD 1DVAH 4GCHF 1TQ0B 1SQAA 1EOJA 2THFB 1C1NA 3M37A 4X0WU 2FO9A 2PLXA 4B2AA 5C20A 3PTBA 2VIVA 3UR6A 3UFAA 4AGKA 1EJMA 4WF8A 2ZWLH 1CGIE 5T6DA 4I7YH 1QTFA 1WDIA 5DP3A 1MTWA 1MMJN 3SV2H 1BTYA 1CHOG 1KTSB 2R0KA 1GJ9B 2ZO3H 2K1QA 2EEKA 3GOVB 2FS8A 2Y5GA 1O2NA 2PUXB 1EX3A 1BHXB 5CDFE 1Y59T 2OQ5A 1C5VA 1GBLA 4AOQA 3ZVAA 3V3MA 3VGCB 1QIXB 5F6MA 3LGYA 2ODYB 3SI3H 5DSFA 4Z1MD 1DE7H 5E0JA 3P17H 4MPVA 2QIQA 4GSOA 4IN2A 2UUYA 4XBDA 3TIUA 4F49A 1U6QA 2J2UA 1E34B 1S0QA 3AK5A 5A8XA 3KGPA 1DY9A 2BD8A 5FAHA 1OP2A 3F9HA 1XXDA 1BRUP 5T1VA 2W5EA 1VCWA 2W3IA 3RM2H 2GCTB 1OWDA 5GXPA 2XC4A 5AFZH 1KYNA 1DICA 8ESTE 2P93A 4R8TB 3KIDU 3LC3A 3LC5A 5DK1A 3VFEA 3ZVBA 1O3EA 3A8CA 1C9PA 1HXFH 4AN7A 2WPJS 1FDPA 3BTDE 2BD7A 3P6ZB 3P8FA 4K69A 1P2KA 2W26A 3SU0A 3MOCA 2C93B 7LPRA 4ZHMU 1N8OB 1C1MA 1NT1A 4NZQA 1LCYA 4X8VH 2BQWB 1CA0C 3VB3A 1QL9A 1HXEH 5EW1H 4I8JA 4CREA 4E06H 1P3CA 2W3KA 1O5DH 2P8OB 1TFXA 3GCHC 3SW2B 3E0PB 4NIXA 1S84A 2P59A 3GY6A 2GDEH 3U69H 2NU3E 4K1SA 2FP7B 3VB6A 1P05A 2GD4B 1C1OA 1HDTH 3SJ9A 2VH0A 5C94A 1FV9A 2CF8H 1SQOA 2C8YB 5CMXH 2IJOB 1IQGA 1C2DA 1QRXA 3AAVA 1ZRKA 1KXFA 2VIQA 3MNCA 1P09A 4K3JA 5E0GA 3Q76A 4O97A 1O2WA 1GL0E 4CRFA 3HKIB 5FBIA 4XBCA 2BY9X 2QA9E 1FONA 3EE0B 4JK5A 2PR3A 1ZTJA 5A8YA 4AFQA 5HIYA 5AF9H 4HGCA 4CRDA 1QJ6B 2P3FH 1C1QA 3D65E 1P9SA 4IC5A 3A7TA 3URDA 3PV5A 1OS8A 2WUCA 4FVDA 3RXJA 1TGSZ 2PSYA 1V2TT 2XBWA 3RXUA 4WMEA 2CF9H 1HB0B 1GBEA 1THSH 2FIRH 1HPGA 4YOGA 3SV8A 4XSKU 1AUJA 2GMTC 1MCVA 1AIXH 3LT3A 2I6SA 5ABWA 4AG1A 1VITF 3LIWA 3UQVA 3EA7A 1BMMH 3NZIA 4B1TA 3NKKA 2AGIX 1HAYB 1OWIA 5H4IB 1SMFE 4FUFA 3DT0H 1IQLA 1C2GA 2WPMS 1UJ1A 1IHSH 3GY4A 1SLXB 1FPHH 1W12U 2XBXA 2JH6D 3SUDA 1O3BA 1BTXA 2GJGA 1RTLA 1TNGA 3AW1A 3D23A 5EPYA 3MO9A 1RIWC 1P02A 3ZZ5A 1VR1H 3CNRA 1N6XA 1TX6A 1A5IA 4CR5A 3SV6A 4I33A 5A0BA 3SQHE 1VJAU 1A0HB 5AVDA 3SJKA 1UHBB 3PRDA 1FPCH 3SV7A 1S6LA 5EG4A 2J98A 1N1LA 1F2SE 1TBQH 3SGAE 1TOMH 1WOFA 4B6EA 1G3DA 2TGDA 2FOEA 3KN2A 3FP6E 3BIUH 2BMGB 1KXEA 4E7NA 2PUQH 1MQ5A 1C2IA 4NGAH 1NFWA 5EXLA 3PV2A 4R0IA 5TCAA 1LPGB 4BTIB 4JZIA 1YCPH 1TQ7B 5LGOA 5FX5A 3Q77A 4WXIA 1YPEH 1C1SA 4CRGA 1F5KU 2WV9A 2HNTF 1YP9A 3ATWA 1LMWB 4MVNA 2OK5A 1PJPA 1O3KA 1GBMA 5BRRE 1DXWA 4YLUA 1IOEA 2XBYA 1ZMJA 4O03A 1TAWA 1CHOF 3QO6A 3V0XA 1BBRK 2BLOA 2SGEE 1HLTH 1SQTA 1WBGB 2NU4E 4Z0KA 4K5ZA 3EE7A 4AG2A 4GAWA 2XCFA 1LHCH 3QX5H 1CE5A 2ZFFH 1BBRE 1QBOA 1UVOA 4P02A 1P2MA 2BVSH 4OS6A 2WPIS 3GY7A 3E0NB 5BPEA 2VIWA 1LTOA 3H7OA 1HAHH 1GVKB 2ASUB 3FN8A 5JYIA 1QNJA 2FPZA 2WPHS 1V2RT 1F0RA 3BV9B 3GCOA 2BVRH 1B7XB 4B2BA 3SU3A 1AI8H 4OS1A 1TBRH 2OQUA 1XXFA 3UQOA 3TH2H 1ANEA 1SGYE 4DT4A 1WUNH 1ID5H 1AUTC 2WHXA 1CBWB 2GCHG 2QCYA 3ZIAD 2H2ZA 3ODFA 5C67A 8LPRA 2STBE 4LOYH 3DUXH 1O2YA 1NTPA 1H9IE 1KLJH 2KCYA 2BXUH 3S7KB 3SV9A 3E1XB 4K8YA 2ODQA 1EP5A 2PKSB 3U8OH 1GCTB 1MD8A 3ZZ3A 5DP9A 1SR5C 4Y7BA 1GHAF 5JB8S 4Y10E 1ZSKA 2EI6A 2IN2A 2Z9IA 4JZFH 4Q2KA 4DIHH 1F0SA 3WWFA 2ZKSA 3U1IB 1HJAC 2WZQA 1V2MT 4K1TA 4X2WA 4X8TH 2XNIA 4ZKNU 3LGUA 2WPKS 4WWYA 3E8LA 3UOUA 1O3JA 2KCPA 3GDUA 3P8NA 5TCCA 2F3CE 1XVOA 4D9QA 1C2EA 3RXFA 1O36A 2Y80A 2Y7XA 1O3AA 1KIGH 1W7XH 5FHTA 4O3TA 5KGOA 1QB6A 2RG3A 6ESTA 2BOHB 1HAOH 4FUDA 1JIMA 4TWWA 1XUKA 2GV6A 3WWBA 1FLEE 3C1KA 2BM2A 1CHGA 2QF3A 5DP8A 1QQ4A 1EPTC 1GJDB 4JYVH 1GJ6A 4M9FA 3A89A 1O38A 3WY8A 2FWWA 2BDHA 5GPIB 1V2ST 3RC6A 1QBNA 2IJD1 3BEFB 2ODPA 3ZVDA 5EXNA 4FOUC 2J92A 2QF4A 2J4IA 2GVFA 1S81A 4TPIZ 1V2PT 1MUEB 4X1QU 4AZ2B 1P2IA 1CU1A 3SNEA 1O2LA 1EXFA 2XBVA 1UCYH 2DUCA 1H4WA 1LQDB 4YOIA 4ABBA 1TMBH 5A2MH 1GI8B 5E2OA 1O2PA 3ATMA 4RKJB 1GI9B 1TGBA 3JZ2B 1C5SA 2FZZA 1HAVA 3AAUA 1K9OE 1EKBB 3GCNA 1KMHB 1O2RA 1XUHA 1YLNA 4CR9A 3RXHA 2BQ7B 1JXPA 2TGTA 3RU4D 1O2GH 2WPLS 5LPEA 2HNTE 2VNTA 1YBWA 3P92A 1C5ZB 1EASA 5HIZA 4XRNA 1FY8E 1XVMA 3A85A 4CHAC 1LVYA 1GWAA 4NFFA 2ILNA 4Q7YA 3RXQA 4ZMAH 2EI8A 2LELA 4A1XA 1O3DA 2BDCA 1BZXE 2STAE 3MH4A 3O8CA 1P03A 3SNAA 2J98B 2FOCA 3SNDA 1D3QB 3EYDA 1V2NT 4F4OC 5HM9A 2XWAA 3RMMH 1GI6A 1YPHE 1BIOA 1O3HA 1GVLA 3UOPA 3BTTE 5HKKD 2G4UA 4E7RG 3QGJA 2ZU4A 3OTPA 1CA0B 2YMSD 1P2QA 4YM9A 5EXMA 9ESTA 5EW2H 1AWHB 4MTBA 1XUFA 1P8VC 1C5LH 3Q3YA 4P00A 3GCHB 1GMDF 3KQCA 1THPB 2FYRA 1FAXA 1GBHA 3F9GA 1TRYA 1NRPH 3MWIU 5GJ4B 1YCPM 1A3EH 1A0LA 2QXIA 4HZHA 3ATIA 1OXGA 1C2KA 2ZDVH 1GBTA 1J8AA 4ZHAA 2TIOA 4UFDH 4MNWA 3B9FH 1ZJDA 1LQEA 1O32A 2P94A 5FPTA 2AGGX 2ZU2A 3PMJA 1Z8RA 1CVWH 1WXRA 2J97A 4UEHH 1SGTA 4X2YA 3G01A 2KM0A 3MU1A 1W13U 1SGIB 1QRZA 1UVPA 4Y7AA 3FP7E 1ELDE 1T4VH 1TGTA 3BTGE 5B6OA 1G3EA 1C5NH 1EPTA 2Z7FE 4GVUA 1WV7H 2OC8A 3DSPA 2G52A 4JZEH 1MKWH 5JBBS 5IK2D 2W6JD 3RXDA 4WMFA 1BRCE 4WMDA 2ZNKH 4BAQB 4FUCA 3UREA 3QGNB 4Q7XA 1G2LA 1TBZH 2PW8H 3M5OA 1HGTH 3GDVA 2D2DA 1NO9H 2GMTB 3V7TA 3VB7A 3R3GB 1HJ8A 1O2OA 4OGYA 3TLOA 2DE9A 2KR7A 3RXLA 1E35B 4J2YB 2FDAA 3MH7A 3VEQB 3SNBA 3S9AA 1SFQB 1GI5A 1SHYA 5FXLA 3FKSD 4ABHA 1UO6A 3DHKH 3A7YA 1O33A 4U01A 2ZDKA 2FODA 2F9PA 3ZZ4A 1OYTH 2KCOA 3SQEE 3B8JA 1K28D 3E3TA 4I8HA 5G4BA 1ZMNA 3A86A 1RIWB 3PRBA 1O2MA 4A7IB 1D3TB 1HFDA 4NA9H 3VG8A 2Y82A 1J9CH 1C5YB 1XUGA 1Y5BT 2PKAA 1LDTT 2A7HA 3L33A 2ZHQH 3ATLA 1XM1A 3EQ0H 4X1NU 3MQKC 2FI4E 4BTUB 2UWPA 4THNH 4FUIA 4X1PU 1V6DA 1C5WB 2C8ZB 3FFGA 3K65B 3UAIC 1VKYA 1GI2A 3BN9A 1DITH 1XUJA 2F9BH 8GCHF 2BDAA 3SI4H 1ABIH 1Z8GA 3RXKA 4DY7B 2BD4A 1NZQH 3DFLA 1K1MA 1TNKA 2H1UA 1ZRBA 4NWLA 3MO3A 1O37A 2XNDD 2OCVB 3A8BA 4IS5A 1NFXA 4ABFA 4BNRA 3H7TA 2FOFA 1QB1A 5EGMA 1Z7KA 2AERH 3NUMA 5EJ1A 4TWYA 2ZTXA 4NSVA 1DX5M 5EU8A 3KF2A 4HG6A 4FUGA 3KYGA 1S5SA 4AFUA 1JMOH 4DJZB 4DURA 4XD7D 2BX4A 3OEED 2HLCA 4WXVA 5EODA 4D8NA 1FY1A 1INCA 4A5TS 1J17T 1ABJH 2RA0A 1C4U2 2GT8A 3RXBA 5DP4A 4NG9H 4Y8ZA 3PTNA 3RXSA 4YOJA 1IQKA 4UFGH 3U98H 1MKXH 1MZAA 2C8WB 1FZZA 1GHZA 1W14U 1Z1JA 2ZI2H 2BDYA 1LO6A 1DWBH 1O2KA 1EFRD 1SGFA 1GBIA 2TGAA 4RT0A 1GI7B 1BTWA 2SGQE 1SG8B 1T8OA 1NRQH 1ZPCA 3LONA 5C3NA 4ZKRU 1Z71A 1NS3A 1CSOE 3A84A 3PLPA 2ZECA 1W8BH 3SNCA 6CHAC 3PMAB 1O2ZA 2OC7A 3A80A 4JK6A 4ACBA 1C4Y2 1QJ1B 4ACAA 1K22H 1H8ED 1KDQB 1C4V2 1EUFA 2FYQA 4FXGH 3TK9A 3W95A 4Z6AH 3LOXA 4MNXA 2Z9GA 4YT7H 4CRBA 1MTSA 2A45B 2BLQA 4RKOB 2XOKD 3OEHD 2AMQA 1EZUC 3VXEH 4VGCB 5CHBA 2BDIA 3LGTA 4NWKA 4CH8B 1GMCG 1P2JA 3MTYA 5IYTA 3RM0H 3GICB 1S6FA 1GHYH 4Y6DA 2A4RA 4JMYA 2VINA 1TLDA 5C1XA 1HJAB 1XUIA 4CH2B 1F0UA 4UDWH 2ZQ2A 2HRVA 2FOMB 4D9RA 1UK3A 2DE8A 4PROA 3OSYA 3KQBA 3ESTA 2KCAA 2CHAB 4H42U 4ISIH 1AE8H 4FUEA 2ZHDA 3VB4A 3PO1C 3BG4C 1O39A 3M3SA 4ABGA 1O35A 4FVBA 4GHTA 1PPEE 4KP0A 3RLWH 1MD7A 3A7ZA 1EPTB 1RJXB 2P16A 2HVXA 1EAUA 1NM6A 3W94A 2Y7ZA 1O3LA 5JBTA 1X7AC 4ISLA 1C2MA 2BD3A 4SGAE 3UWJH 2PP6A 1UTNA 1H8HD 2VVUA 1WTGH 1SC8U 5GWZA 1UW7A 3LDXH 3QTVH 2CJIA 1SGEE 1SHHB 2A5AA 3E91A 6GCHG 2ZFPH 1QL8A 5EQSA 2OD3B 5FPSA 1SKYE 1YWUA 1P10A 1TNLA 2ZCHP 4TYDA 1F0TA 2A0QB 1NPMA 3T27A 3MH6A 3TGKE 1GMHG 3TPIZ 2QF0A 3ITIA 2ZDMA 1AKSB 1A61H 2F43B 2Z94A 1DT2A 1FY3A 2VIDA 4TY7A 5DP5A 1UK4A 1NFUA 3QDZB 1O3MA 1SGQE 3A81A 1MAYA 4MG3A 4CRCA 1YPJH 2A5KA 4Q7ZA 3A88A 3ODDA 1LPZB 5FBEA 1BRAA 1S6HA 3F2HA 3BF6H 3BSQA 2ZFTA 4AFSA 3SHCH 3AASA 1MAXA 1G2MA 4CHAB 1L1GA 2PKAB 3MFJA 2CN0H 1UTKA 3CENA 1HV7A 3DA9B 3MU4A 1GBKA 2FX4A 1S82A 1SOTA 3SBKA 1P3EA 2Y81A 1AVGH 1PPHE 4B2CA 1SGNE 3EDXB 1SFIA 1NN6A 2FM2A 2VGCC 3H5CB 5DP7A 2R2MB 2C3SA 3PMBB 2OC1A 1SLVB 3RMNH 4YZUA 1BJVA 1PPFE 2H9TH 2QGRA 2AEIH 3B23B 1ZR0A 1NROH 1IQNA 2QF5A 3CP7A 2KX4A 3QWCH 3BIVH 2Z9KA 2J9NA 1N6YA 1LKAA 3N99A 2JETC 2FOGA 1ZZZA 2OP9A 3DFJA 1CGJE 1G9IE 2G00A 3QZRA 3Q00A 4B76A 5DPAA 3RC4A 3PLKA 4KTSA 4NA7A 4ISOA 1AHTH 5GCHG 1Y5AT 1BB0B 4I8KA 1SLUB 3SHAH 2XW9A 2UWLA 2Z3CA 5ETXA 1S83A 1O2JA 1TIOA 2UUFB 1ORFA 1ETRH 1VZQH 5C5OA 1SBWA 2ANMH 2W6ID 4ZKSU 3SU6A 5FCKA 4HTCH 3U1JB 3K6YA 2Z3EA 5CE1A 5EPNA 2SFAA 2ULLA 4AGJA 1W10U 1MTNC 2BY7X 3KQ5A 3SJ8A 3STIA 1K21H 1ZJKA 2AFQB 2YMSB 3ZYEA 1CGHA 3PWBA 1YF4A 3LGWA 2C8XB 1KTTB 1WYKA 1ZGIA 2CXVA 1YYY1 1O5BB 2HALA 3OX7U 1P06A 4YT6H 1HJ9A 2BZAA 2OXSA 3DSGA 1VGCC 1Q31A 2BY6X 5CHAC 2CV3A 5LH8A 1GBCA 1Z8IB 1BRBE 1NC6A 1ELCA 3EA9A 4FUHA 1J14A 2A7JA 2F4LA 2XXLA 1GI3A 4ZROA 4B75A 5C1YA 1ELFA 2OLGA 1AZZA 1SGDE 2EQNA 1F5RA 4YO9A 3T26A 2QV1A 3T62A 2OBOA 2C4FH 2F9VA 1NY22 1TNIA 1NRSH 5LPFA 1GJAB 1SSXA 3MH5A 3F1SB 2B8OH 1VCPA 3ZZCA 2O8TA 1QCPA 3UNSA 3HGPA 1V3XA 2Z9JA 2FTLE 3SO3A 3M36A 3T25A 2BDBA 1GDUA 1UTMA 1Q2WA 5C2ZA 3F2FA 4TPYA 4BXWA 1GMCF 4B71A 2ZFSA 2O8LA 1OPHB 1TNHA 3GCTG 2ZCKP 4NFEA 1D3PB 4DT7B 3M35A 2BXTH 1QRWA 1GBAA 1TABE 4H4FA 4YESB 3NRLA 2BQ6B 2JJ1D 2VVVA 4AB9A 5PTPA 1CO7E 2FMJA 3MNSA 4ZH8A 4AYVB 1OWEA 3BTQE 3L3TA 2ANKH 4A6LA 2RA3A 4X2XA 3T5FH 1V2LT 4OM9A 1W3CA 3ZVEA 2Z9LA 1A5HA 1EAIA 1KY9A 4B73A 4FUBA 1WCZA 3FZZA 3RU4T 1IAUA 1FY4A 5F8XA 1AO5A 5IDKA 1C2FA 4DW2U 3O8DA 4U2WA 2EC9H 3Q3KA 5L2ZH 1ZMLA 4Y0ZE 1O31A 1FUJA 2KAIA 3HK6B 1UMAH 3S69A 5HM2A 5TJXA 2TGPZ 3K6ZA 3ZVCA 4KGAA 2PWXA 3FP8E 3PMHB 1NESE 3GYMA 3RXGA 3UWIA 1UVTH 5HXFA 4ZXYH 2CMYA 5GNDA 4TY6A 4GCHG 2EY4C 3BEIB 3FO8D 3KCGH 4AFZA 3M5LA 1ZSJA 3LJJA 2ZF0H 2GGVB 4OS2A 5SGAE 1DM4B 2VB0A 3C27B 2ZHEH 1P2NA 2BY8X 1KXCA 3RXMA 4Q80A 3TITA 1QQUA 2BLWA 2JH5D 3ZV9A 3HK3B 3LGIA 4K1EA 4KELA 2BZ6H 3QUMP 1EJAA 3IITA 5EJLA 2AIPA 2G5NA 1GDQA 1VCQA 3T28A 1C5PA 1C1UH 2BYAX 2HNTC 1O2VA 3URCA 2J38A 2LPRA 4BANB 1V2JT 2CGAA 4LK4A 3RLYH 2SGDE 1FX0B 4CRAA 6CHAB 5FL7D 4ZHLU 4GUXA 3LH1A 2H5DA 1IQMA 1MTUA 1BMAA 1O5GH 3TJUA 1Y3XA 2VJ1A 4F48B 1BBRH 1K1OA 3BEUA 3PV4A 1YPHC 2FS9A 1O3FA 1ELTA 1ESAA 1QR3E 2NU0E 4BAMB 1O3CA 2ZU1A 7ESTE 1LVBA 2HPQH 2IPQX 4K2YA 1O2IA 1Y3VA 4Y71A 3V13A 3S9BA 4OS5A 5JPMH 1O3OA 1AD8H 3SU5A 2ZQ1A 2ZGBH 5EIYA 1AB9C 4WH8A 3VXFH 1QJ7B 2LP6A 1KXDA 2VH6A 1NRRH 3OU0A 5ESBA 2WINI 2NU2E 4ZXXH 1TWXB 3NWUA 3ZZAA 1RFNA 3U8TH 4BAOB 5JBAS 1UTJA 1MTVA 4UFEH 4ZCNA 1PYTD 1GCDA 1KLIH 3RXAA 2OTVA 4HI3A 2V35A 5A8ZA 1NRNH 3KNXA 2WUBA 1H9LB 3A7WA 3LJOA 1ZHPA 1AN1E 1NBME 1GBFA 1ACBE 1P57B 1WQSA 3BG4B 3PO1B 3RMOH 2GZ7A 1NU7B 2SGAA 1ANBA 2XC0A 1GG6C 2ZFQH 2RFKC 1QB9A 1EATA 2A2QH 5A0AE 1E0FD 5AFYH 3K2UA 1Z6EA 1ANCA 1G36A 3H09A 4IMQA 4MNYA 1J16A 5DP6A 1UK2A 2JIZD 1VITH 1K1IA 1FIZA 2Y5HA 2R0LA 1W7GH
chains in the Genus database with same CATH topology
1CQQA 5L30H 1O2HA 1TPPA 1O3GA 3I78A 1JOUB 1TOCB 4I8GA 4YTAA 2Q1JA 1TX8A 4XDEA 3QLPH 2FTMA 1D4PB 3GYLB 2O8MA 3M5MA 2ZTZA 2H5CA 2NU1E 1LVOA 1HIAA 1E36B 3RC5A 4X8SH 1UVSH 2UWOA 4DVAU 2FESH 1HAGE 5A09A 2GCHF 1PYTC 3HATH 4XE4A 3OY6U 3PWCA 4NIYA 1O2TA 5F8TA 5J4QA 3TNTA 1Z8JB 3K9XB 1AE5A 5DJ7A 3UUZA 4Y76A 3M61U 4M7GA 2WV5A 3GY2A 5L6NH 3TU7H 4LZ4B 3SZNA 3M7TA 4H6TA 1AFQC 1C2HA 3I77A 1C5QA 3F9FA 1YC0A 2NWNA 1Y3YA 2J94A 3MU0A 1HBTH 1C2LA 1ESTA 1O2UA 3UIRA 3OTJE 1T8LA 2FI3E 2R2WU 2VGCB 2QN5T 3TH4H 1PPBH 2BB4A 1JWTA 3MYWA 1FN8A 2PTCE 4I32A 1GBDA 3LH3A 4BAKB 1XX9A 2JKHA 2PKSC 2FI5E 4E05H 1DS2E 2H9HA 1BTZA 2ZA5A 2YNBA 3A7XA 1TNJA 1V2OT 1AVXA 2BD2A 1QL7A 2A4OA 1G3BA 2GZ9A 4ZKOU 2JETB 3RDZA 1LHGH 2ESTE 1UHBA 1ELEE 5F03A 3T2NA 1MU8B 1ZPZA 4NIVA 4X6MA 1UTLM 2F91A 3T29A 1EZSC 1W2KH 2Z6BD 4I31A 1DLKB 1OP0A 1GI1A 8KME2 1ETSH 5FPYA 2ZEBA 1QGFA 3LGVA 2ZHWH 5JB9S 1PPGE 4X1SU 1DWDH 1NU9A 3VB5A 1C1PA 1TX7A 2R9PA 3RXOA 2ZC9H 4D76A 3UR9A 2O8WA 1HAVB 1XKAC 2BDGA 1MTNB 3QTOH 1THRH 2GDDA 3SJOA 1L1JA 1BDAA 2QAAA 3F6UH 3LU9B 1P11E 4UE7H 1OWJA 1IQIA 1BTUA 4O9VA 3ELAH 4IBLH 1TONA 2ANWA 1OX1A 2ZTYA 1GHWH 4NSYA 4NIWA 3LPRA 1VGCB 2VWMA 5CHAB 1OSSA 2Q6FA 2J95A 1EJNA 1MU6B 3TK5A 1UVUH 3GDSA 1O5EH 1ZTLA 4BXSA 1P04A 2GX4A 4CBOA 3KQEA 4DG4A 3UY9A 1GJ4H 2WYJA 3M3VA 1KXAA 2ZU3A 2ZGHA 3F9EA 5DG6A 2ANYA 1YCPK 2XYAA 1F7ZA 3A82A 1TGCA 4IGDA 4RN6A 1F5LA 2ZCLP 3UNQA 2QC2A 1A46H 1L0ZA 3SU4A 1EQ9A 3HKJB 1HAXB 3QK1A 1IQHA 1W0ZU 1HNEE 2IPHA 1C1WH 1SB1H 4NZLA 1J15A 5FCRA 2QY0B 1VJ9U 4SGBE 3MO6A 1DXPA 1O5CB 1TALA 4IW4E 1ZGVA 1F92A 3BTEE 3IG6B 3U8RH 4DGJA 2FX6A 1RXPA 1QBVH 3ZVGA 2HPPH 1TA6A 1K1LA 4B74A 4HFPB 1BHXF 4BOHA 2Y6TA 1C1TA 3A7VA 2PGBB 3CS0A 1WU1A 1ELAA 1DUEA 1TA2A 1L4ZA 1EZQA 1GHAG 1DSTA 1TGNA 1MZDA 1WSSH 4LXBH 3SUEA 1GJBB 1D9IA 2GZ8A 1ARCA 2BD5A 4FUJA 1SGFG 1GL1A 1M9UA 2OINA 4ABIA 1FI8A 4NA8A 2G8TA 1KLTA 1GJCB 1FJSA 1O34A 1G3CA 1O5FH 4X2VA 4WH6A 1A5GH 1BCUH 4GHQA 3TNSA 1FY5A 4KKDA 2SNVA 5K0HA 1B5GH 2FLBH 2UUKB 1CT4E 2XTTB 1HAIH 3ATKA 4ASHA 1E38B 3P95A 2AS9A 2GT7A 2A4QA 3NK8A 1T4UH 2FOAA 1GPZA 1K1NA 1GHXH 1A0JA 3MNXA 1HIAB 2QXGA 2HWLB 1O30A 2IOTA 1LPKB 1Y5UT 3BG8A 1HAZB 2A31A 1FNIA 4X8UH 1FMGA 1L4DA 4ABJA 3FANA 1AY6H 1FIWA 1C5RA 1G37A 4I8LA 1GGDC 5HYOA 2H9EH 1JRSA 1C1RA 1H9HE 1WAYB 1ANDA 4X6PA 1OYQA 2WV4A 2VIOA 3P70B 4WVPE 2TPIZ 1P0SH 2PFEA 1Z6JH 3PM3A 1OP8A 3AW0A 2G5VA 2ZZUH 1LHDH 5JDUB 1AWFH 1T32A 2UUJB 1AQ7A 1D6WA 1S85A 2ZP0H 3BTFE 3I29A 3P8OA 1TPSA 2F9OA 3S9CA 2ZPQA 2C90B 4UFFH 1YGCH 2D8WA 1PQ8A 1O0DH 1C1VH 7KMEH 3SGBE 5JBCS 1CT0E 1GBBA 2TBSA 4DCDA 1BQYA 2YOLA 1RD3B 1XMNB 1ESBA 1TB6H 1AZ8A 1G32B 3M5NA 3M7UA 4ISNA 3V12A 3S7HB 1ZPBA 3O8RA 1AU8A 1YPGH 2AYWA 5T6GA 1TPOA 1OOKB 2Y5FA 1V2VT 4GLYA 2PGQB 2VU8E 3ZZDA 4D7FA 1AB9B 1D6RA 2A1DB 4K60A 4WJG2 4Y8YA 3TJOA 2FEQH 1TE0A 1C5MD 2SGFE 2V3HH 1QY6A 3GY3A 1EAWA 1C5TA 1GI4A 1UCYK 2ZDNA 1O2SA 2BVXH 1DWCH 2V6NA 1TRNA 1TPAE 1AMHA 2O9QA 1SI5H 2VWOA 3S0NA 4ESTE 3NCLA 2BTCE 1DPOA 1PQAA 3M3TA 1UCYE 5ESTE 1LHFH 2OUAA 1HAPH 4MPXA 4KTCA 1GMDG 2G81E 2Z3DA 1GG6B 1MH0A 2ZHFH 4MDSA 4LZ1H 1YPMH 4J1YA 3TJNA 4KTUA 1L2EA 7GCHG 2YNAA 3IWMA 2M5TA 2BD9A 1DANH 2RDLA 3NPSA 4U30A 3KHVA 2VWLA 3RXTA 4RSPA 1GJ5H 3A8DA 3STJA 1W11U 1BMLA 1GBJA 1T31A 4GPGA 3RXEA 3SORA 2GP9B 3VGCC 1RTKA 3A8AA 3M7QA 3Q3XA 3ZZ6A 1G30B 3PLBA 2Q6DA 2I6QA 4BTTB 1O3IA 4MQAA 1EB2A 2B9LA 2VVCA 1OWHA 2PHBA 1GI0A 5L2YH 1T7CA 3EAJA 4BAHB 4OGXA 4Y79A 3CS7A 4AB8A 2BOKA 2QXHA 2ZIQH 1UTPA 4Y8XA 2A2XH 2ZGXH 1B0FA 2F9UA 1Y3UA 4MNVA 1ZOMA 1QA7A 2P3TB 2GCTC 2FOBA 1AFQB 1OKXA 3ZYDA 1BA8B 4MPUA 1Y8TA 1DDJA 2LNCA 3ENSB 1MBQA 3RXIA 3TVJB 1BMNH 1SLWB 3O8BA 3SJIA 2F83A 2GTBA 1GDNA 1O5AB 1PPCE 1ELBA 1QHRB 4H6SB 4MPWA 1ELVA 2HOBA 3P8GA 2OC0A 4IC6A 2AH4X 1GJ8B 1N8OC 4JCNA 2JH0D 3MI4A 2FXRA 4VGCC 1HCGA 6LPRA 3ZZ7A 5EOKA 1MKWK 3N7OA 2PSXA 2P8OC 1GHBG 1AVWA 1BTPA 5K7RA 5EQQA 3KEEA 1EZXC 1FN6A 2AMDA 5EQRA 2P95A 1FQ3A 4XBBA 3F68H 3ZV8A 2ZU5A 4D7GA 1NFYA 4INHA 1C2JA 5AHGH 2EA3A 3KL6A 2VIPA 2CHAC 4FU8A 3DD2H 5J4SA 1QFKH 2HGTH 4UD9H 1DLEA 1IQJA 2ZGJA 1SGPE 2GV7A 2V0BA 3SUGA 2SNWA 3E16B 1YPKH 6GCHF 8GCHG 3TH3H 4X6OA 3VPKA 2AIQA 4JYUH 1JIRA 4UONA 1L1NA 4ISHH 2SGPE 3SUFA 3MU8A 3HPTB 3ZVFA 2AGEX 4IN1A 3RP2A 2B0FA 2BX3A 1GMHF 1P9UA 3NXPA 2D26C 3KQDA 3OYPA 3EA8A 3RMLH 4AX9H 5E2PA 3JZ1B 1ZYOA 1D3DB 1HUTH 3GY8A 3LKWA 3OY5U 3BTKE 2ZPSA 1UTQA 1H8IH 2XRCA 3UTUH 1IHTH 3TGIE 2G51A 1ZSLA 3D62A 3RXPA 1BTHH 1BUIA 4INKA 4X1RU 3EGKH 1A3BH 4FU9A 2P3UB 1UTOA 1ZHRA 1H8DH 2AMPA 1ELGA 5I46H 1V2KT 3TJVA 1BT7A 4X6NA 3ZZ9A 1ETTH 1O2QA 2BY5X 1RTFB 2QYIA 5F8ZA 4OS7A 1BITA 1BJUA 1A4WH 4XFQA 4JZDH 5A0CA 1C5UA 3E6PH 1V2UT 2QXJA 5C5NA 1FXYA 2PTNA 2ZPRA 1TRMA 3SU2A 1RGQA 4Y0YE 1JBUH 4ABDA 1KXBA 5GIBA 3BTWE 3R0FA 1PFXC 3FZDA 3ZZBA 1H1BA 1EB1H 1T8MA 4XOJA 5T3HA 4DIIH 1V2QT 2A4GA 3BTME 4IMZA 1DSUA 3MHWU 5LPRA 1S0RA 1MBMA 3UPEA 2BHGA 2A5IA 1KDQA 3A87A 3TK6A 1SPJA 1YM0A 1K2I1 1ZHMA 1MQ6A 2FLRH 1DOJA 2XCNA 3MNBA 1T8NA 3GISB 4WY3A 5GCHF 1MKXK 1SVPA 5FX6A 5GDSH 1SOZA 1BOQA 1SL3A 4A92A 2D1JA 2GKVE 2ZDAH 4ZUHA 1C5OH 1DFPA 2O8UA 2R3YA 3SU1A 2WYGA 1Z1IA 3RU4E 1YLCA 2R3UA 2B5TB 7GCHF 3ZZ8A 3FVFB 5C1UA 5HGGA 1Y3WA 5T6FA 1O2XA 2G55A 1XKBC 2A32A 3QN7A 4ABAA 2ZGCA 1IQFA 2V3OH 2VWNA 4O3UA 3RXVA 3L6PA 1JRTA 1TMUH 2TRMA 3AVZA 4NCYA 1A1RA 1SGRE 4JZ1A 1A2CH 2G4TA 9LPRA 2ZFRH 4QT8C 4YLQH 1MCTA 1KSNA 1ZLRA 2RCEA 3SGQE 1EOLA 1DY8A 4FU7A 1LHEH 1DUAA 4MLFB 1GHVH 1LVMA 1RRKA 5DO4H 1EAXA 3RXCA 1P12E 1YLDA 1GGDB 2BLVA 5I25A 1PQ5A 1AFEH 3GY5A 1ARBA 1EP6A 3E90B 1AGJA 1C9TA 3BTHE 4DOQA 1ZTKA 1IQEA 1YKTA 1K1PA 3PB1E 4U32A 2ZG0H 5HMAA 1O3PB 1YPLH 2PV9B 1V2WT 3PYHA 2XC5A 2ALVA 1VITG 2ZDLA 2B7DH 1WQVH 1CBWC 1O3NA 1TYNA 3A83A 1C5XB 3GCTF 4Y11E 3RXRA 3SN8A 1AKSA 3U9AH 1DWEH 2F9NA 3HGNA 2Q6GA 3MMGA 3D49H 2EI7A 4ZAEA 4CBNA 1PPZA 1LKBA 5DGJA 5E0HA 2J34A 5DKMA 1OWKA 3QZQA 2H6MA 1QURH 1TMTH 1K1JA 3PROA 3RUOA 4A1VA 2FOHA 1GCTC 1P01A 4AYYB 1E37B 3MU5A 1Q3XA 2A7CA 3UNRA 1GHBF 5E8EH 1A7SA 1CA8B 1GJ7B 2KAIB 1RS0A 1HRTH 2ALPA 3SOSA 4ABEA 1P2OA 1B0EA 1PQ7A 3TGJE 4JYTA 1SGCA 2XWBI 4INLA 1FAKH 2W7SA 4OS4A 1HYLA 2W7UA 1QA0A 3FAOA 1GVZA 2OBQA 4A1TA 4AORA 4K8BA 1W0YH 1CT2E 1WTHD 1DVAH 4GCHF 1TQ0B 1SQAA 1EOJA 2THFB 1C1NA 3M37A 4X0WU 2FO9A 2PLXA 4B2AA 5C20A 3PTBA 2VIVA 3UR6A 3UFAA 4AGKA 1EJMA 4WF8A 2ZWLH 1CGIE 5T6DA 4I7YH 1QTFA 5DP3A 1MTWA 1MMJN 3SV2H 1BTYA 1CHOG 1KTSB 2R0KA 1GJ9B 2ZO3H 2K1QA 2EEKA 3GOVB 2FS8A 2Y5GA 1O2NA 2PUXB 1EX3A 1BHXB 1Y59T 2OQ5A 1C5VA 1GBLA 4AOQA 3ZVAA 3V3MA 3VGCB 1QIXB 5F6MA 3LGYA 2ODYB 3SI3H 1DE7H 5E0JA 3P17H 4MPVA 2QIQA 4GSOA 4IN2A 2UUYA 4XBDA 3TIUA 4F49A 1U6QA 2J2UA 1E34B 1S0QA 5A8XA 3KGPA 1DY9A 2BD8A 5FAHA 1OP2A 3F9HA 1XXDA 1BRUP 2W5EA 1VCWA 2W3IA 3RM2H 2GCTB 1OWDA 5GXPA 2XC4A 5AFZH 1KYNA 1DICA 8ESTE 2P93A 4R8TB 3KIDU 3LC3A 3LC5A 5DK1A 3VFEA 3ZVBA 1O3EA 3A8CA 1C9PA 1HXFH 4AN7A 2WPJS 1FDPA 3BTDE 2BD7A 3P6ZB 3P8FA 4K69A 1P2KA 2W26A 3SU0A 3MOCA 2C93B 7LPRA 4ZHMU 1N8OB 1C1MA 1NT1A 4NZQA 1LCYA 4X8VH 2BQWB 1CA0C 3VB3A 1QL9A 1HXEH 5EW1H 4I8JA 4CREA 4E06H 1P3CA 2W3KA 1O5DH 2P8OB 1TFXA 3GCHC 3SW2B 3E0PB 4NIXA 1S84A 2P59A 3GY6A 2GDEH 3U69H 2NU3E 4K1SA 2FP7B 3VB6A 1P05A 2GD4B 1C1OA 1HDTH 3SJ9A 2VH0A 1FV9A 2CF8H 1SQOA 2C8YB 5CMXH 2IJOB 1IQGA 1C2DA 1QRXA 3AAVA 1ZRKA 1KXFA 2VIQA 3MNCA 1P09A 4K3JA 5E0GA 3Q76A 4O97A 1O2WA 1GL0E 4CRFA 3HKIB 5FBIA 4XBCA 2BY9X 2QA9E 1FONA 3EE0B 4JK5A 2PR3A 1ZTJA 5A8YA 4AFQA 5AF9H 4HGCA 4CRDA 1QJ6B 2P3FH 1C1QA 3D65E 1P9SA 4IC5A 3A7TA 3URDA 1OS8A 2WUCA 4FVDA 3RXJA 1TGSZ 2PSYA 1V2TT 2XBWA 3RXUA 4WMEA 2CF9H 1HB0B 1GBEA 1THSH 2FIRH 1HPGA 4YOGA 3SV8A 4XSKU 1AUJA 2GMTC 1MCVA 1AIXH 3LT3A 2I6SA 5ABWA 4AG1A 1VITF 3LIWA 3UQVA 3EA7A 1BMMH 3NZIA 4B1TA 3NKKA 2AGIX 1HAYB 1OWIA 5H4IB 1SMFE 4FUFA 3DT0H 1IQLA 1C2GA 2WPMS 1UJ1A 1IHSH 3GY4A 1SLXB 1FPHH 1W12U 2XBXA 2JH6D 3SUDA 1O3BA 1BTXA 1RTLA 1TNGA 5EPYA 3AW1A 3D23A 3MO9A 1RIWC 1P02A 3ZZ5A 1VR1H 4CR5A 1N6XA 1TX6A 1A5IA 3SV6A 4I33A 5A0BA 3SQHE 1VJAU 1A0HB 5AVDA 3