2A7CA

On the routine use of soft x-rays in macromolecular crystallography, part iii- the optimal data collection wavelength
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Elastase 1
publication title On the routine use of soft X-rays in macromolecular crystallography. Part III. The optimal data-collection wavelength.
pubmed doi rcsb
total genus 65
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2a7cA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2a7cA01
2FOBA 3SUEA 1ZTJA 2GKVE 5F03A 2VJ1A 1ACBE 2EEKA 2FX4A 4JYUH 1N6YA 1SQAA 3BSQA 4AYYB 1S81A 1YLDA 1AB9C 1FN6A 1YCPK 1D3TB 3JZ2B 4B71A 3M5LA 1TBZH 2WV4A 1O2MA 3SHAH 1LVBA 2HLCA 1GI2A 3URDA 1DSUA 4K5ZA 3T28A 2XC5A 3PV4A 1Y5AT 1G2LA 1EASA 2KAIA 3LC5A 3RXIA 3GCHB 1ABJH 3TH2H 1O3FA 1XUHA 3M35A 4F49A 3PM3A 3RXVA 1MCTA 1KLJH 4GSOA 1NRSH 4DIIH 4JZFH 3UIRA 5JB9S 4CREA 3BTKE 5LPRA 3NWUA 4CHAB 1GHAF 2BDGA 1TOCB 4UFGH 2CHAB 2BD8A 1FIWA 2VWOA 3LGTA 1YF4A 1YPMH 1CBWB 1OP2A 1BITA 1PPBH 4X1PU 2FOMB 5T3HA 3TIUA 1J16A 5A8ZA 1S6HA 7GCHF 4CBOA 5AVDA 1ELTA 5DG6A 1S82A 3E91A 3ENSB 1J17T 2TIOA 1JRSA 3ZVGA 1FZZA 1Q2WA 4ISIH 1GI0A 1CT0E 2A5IA 3T26A 3A88A 2H9EH 3EDXB 1UMAH 1A1RA 4ISNA 3SU5A 5C1XA 5JBAS 2QF3A 1DUAA 2SGFE 1YPHE 2F9PA 2O8TA 3RXRA 4LOYH 1ESAA 2JETB 3OU0A 3E1XB 3MO9A 2GV6A 1C1MA 1HFDA 4AGJA 1ORFA 1YPLH 3EQ0H 4E06H 2NU0E 2PSXA 2IJOB 5A0AE 2O8MA 2ZFQH 2AGEX 2VH0A 3SNDA 5GJ4B 1RIWB 1WU1A 1Y3UA 2ZFTA 5DP3A 5EQQA 2DUCA 1RJXB 2FOGA 4ASHA 1OKXA 1NC6A 3H5CB 1G30B 1V3XA 4YZUA 2AIQA 2BDYA 5L6NH 5GCHG 1ETRH 5EG4A 1XUGA 1C5SA 1SMFE 3VXEH 1C1TA 4AFQA 1YCPM 1GJBB 4UONA 1EAXA 1GVLA 3QTOH 3K6YA 1NU7B 2A5AA 1GHBF 1YP9A 3RU4D 1EPTC 1TABE 5CMXH 4MTBA 1RS0A 1ZHPA 4B2CA 5EW1H 1IAUA 3GY2A 1AO5A 2HWLB 2JH6D 5GIBA 3MU5A 1DLKB 1DY9A 2Z9IA 1VITH 2BOKA 1J9CH 3KF2A 3U8OH 2LPRA 2F9VA 2UWLA 1JWTA 1YPHC 4YT6H 1GGDC 2Z9GA 1HAYB 3E90B 1BMAA 3IG6B 3QX5H 1BA8B 4UD9H 1C1RA 1B5GH 3BIUH 2PKSC 1QNJA 4BOHA 1GBHA 1C2MA 5JBBS 4JZ1A 1C5LH 4I8LA 2J4IA 2UUFB 2YNBA 2GCHF 3TH4H 3H7TA 4HZHA 2A0QB 4D9RA 4I8KA 1P12E 1K21H 1TNJA 1DWDH 1A46H 1GJ7B 1K1NA 2VIWA 2ZDLA 3LGVA 4ABHA 2IPHA 1GI4A 3KHVA 1N6XA 2IN2A 3TJVA 5C3NA 1QHRB 1LKBA 2H9HA 1YM0A 2VGCB 1FPCH 1HDTH 4ZXXH 1AFQB 1WQVH 2FTMA 4CRCA 1AD8H 1ZZZA 1P04A 2UUJB 1A5HA 5HMAA 1Q3XA 1E0FD 1TX7A 2BD9A 4D9QA 2UUYA 1OS8A 2AGGX 3M3TA 3PWCA 3PMBB 1JMOH 1BBRE 6GCHF 1KYNA 2SGQE 3W94A 1HPGA 4CRDA 1LHGH 8GCHF 1BHXF 1SOZA 2B9LA 2P16A 1O3MA 3E0PB 5A0CA 4MDSA 1S0QA 1GHWH 2AERH 5TCCA 1ZR0A 1YPKH 3SU0A 1CGJE 4I31A 2P8OB 2Q6DA 1DS2E 1IQNA 1Y3WA 1BRUP 4B2AA 3PO1C 1YPEH 3MTYA 1UCYH 2TBSA 4D8NA 3E16B 2GZ9A 4CBNA 4JK5A 3RXEA 1PPEE 3A7XA 1XX9A 1GJ4H 1E34B 1EAIA 2NWNA 1SSXA 1HJ9A 1VGCC 4XBCA 5CE1A 2FP7B 1TYNA 1C2HA 2PUXB 3O8CA 2ZIQH 2R0LA 3GCOA 4A1TA 4Y8XA 3R3GB 2A32A 3SZNA 1GDUA 1GJCB 2PKAB 2Z9LA 3S0NA 2ZFRH 1C4Y2 4KTCA 1UCYK 4X8TH 3UR6A 5E0GA 1PYTC 2H9TH 1K9OE 3AASA 1C4V2 1UVPA 4BAMB 1AY6H 2WUBA 3FZZA 3TNSA 2WPJS 2FO9A 2TGAA 8LPRA 5EODA 4GHTA 2V3OH 2ZPSA 8KME2 3ZVBA 1VJ9U 1S5SA 2NU4E 4DCDA 1V2MT 5DP9A 1AMHA 2ZGCA 1MQ6A 4WMEA 4GPGA 1O5AB 2ZQ2A 3DUXH 1HIAB 3SGQE 3VXFH 2XW9A 1OWHA 1C5RA 1PPFE 2OD3B 1LHFH 2J38A 2VB0A 5AHGH 5FHTA 1Y3XA 3SI3H 3TGKE 3F9HA 1F0UA 4UFEH 1ZTKA 4E7RG 1O33A 1GDNA 2BZ6H 2P3UB 1BRCE 2BVSH 1W10U 2ANMH 1QQ4A 3SV9A 1UTNA 1BTXA 1ZHRA 3A8BA 1WQSA 2PW8H 3MNCA 4Y8YA 1GL1A 2CN0H 1O3HA 2OC7A 2VIVA 1O39A 4K3JA 3M5OA 3RXPA 1TRYA 2QXGA 1DXWA 2FOHA 2JH5D 2BDBA 2UWOA 2GD4B 4QT8C 4E7NA 2F3CE 5I46H 3E0NB 3SV6A 3A81A 3DFJA 2ZDAH 4XBDA 1ABIH 1IHTH 1O2NA 1GBLA 1A0HB 4NWKA 1V6DA 1KLIH 1QL8A 2WUCA 4KGAA 3GCHC 1GJ6A 5LPEA 1Z7KA 2G5NA 2STBE 2XBYA 1WAYB 5JPMH 3OYPA 4AX9H 1O3CA 1P11E 3HGPA 1IQLA 3Q76A 4CHAC 3QZQA 3OY5U 1CSOE 2CHAC 3SHCH 2PWXA 3T29A 1P10A 1XXDA 5JYIA 1A7SA 1CBWC 2J2UA 2VU8E 4RSPA 2PTCE 3UQOA 2ZEBA 1TPOA 2ZQ1A 3DA9B 1UK2A 3UWJH 4I8JA 4MNXA 1TALA 1EATA 1W7XH 2OXSA 2VVCA 2G55A 2PGQB 3SV8A 3V12A 2FDAA 2BVXH 2ZGBH 2GT8A 1P02A 2FZZA 1GBFA 1QA7A 1N1LA 2AMPA 3UNSA 1SQTA 4CH8B 1SFIA 3ZZAA 2PKAA 1V2WT 3FAOA 4H6SB 4WWYA 3GCTG 1FAKH 1THSH 2HPPH 4XBBA 3U1IB 2JETC 3URCA 5JBTA 1ESTA 4TPIZ 3KN2A 5HXFA 1DE7H 1LO6A 4AYVB 3KCGH 1Y8TA 2ZWLH 4DY7B 1BTWA 3LPRA 1GG6C 3PTBA 2GZ8A 2W3KA 4ZHMU 2Y5GA 1RIWC 2FYRA 1LTOA 3V7TA 3SOSA 1MU8B 1EZSC 1TONA 3PYHA 1ELCA 4DOQA 1H1BA 1EP5A 2BLWA 1GMCF 1A0JA 4FUCA 3ATKA 1HAOH 1Y5UT 3RXCA 1HIAA 1W11U 1W13U 1ZGIA 2GMTC 5EPYA 2VINA 1HAIH 2FIRH 1GCDA 3B8JA 3WY8A 1GBCA 4X8UH 3UTUH 4IW4E 2QC2A 1ANCA 1ELAA 2ALPA 4ZUHA 3SV2H 1AUJA 2HNTE 3DHKH 5F6MA 4NIWA 1UK4A 4ZKSU 1HAPH 2H2ZA 4Y8ZA 1RTFB 4JMYA 3TITA 3M3SA 3UOUA 4A1VA 1OYQA 2Y80A 1V2RT 4TY6A 3I29A 3QGJA 2Z3DA 1F0TA 2HRVA 3QUMP 1MTNB 4IN2A 3RC5A 4X6PA 1BOQA 1HV7A 4IC5A 2FYQA 3MNXA 3ZVFA 1KXBA 2BDAA 1QBNA 4ZROA 1BJVA 3NZIA 1B7XB 1ELEE 1O3PB 1NFXA 1QRXA 1FJSA 4LZ1H 3C27B 1D3QB 1LPZB 2CJIA 2Y81A 1OYTH 3P6ZB 3LGIA 2ZTYA 2GV7A 4MG3A 3TPIZ 1HAGE 1BB0B 3QN7A 7LPRA 1HXEH 1GBMA 2XNIA 4XFQA 5FPYA 3KNXA 1O2OA 5K0HA 4OS6A 1D4PB 1GCTC 4CR5A 4X1SU 2QYIA 2ZDVH 1XVOA 3ZZ7A 4IMQA 5TJXA 1SB1H 1IQEA 1O3GA 3CS0A 1AFQC 5I25A 4GVUA 3F9GA 2PR3A 4TY7A 3O8BA 4ISOA 2PTNA 3V3MA 3ZZBA 1FY1A 1NESE 2FOAA 9ESTA 1H8DH 3RXAA 1DWBH 2ZHDA 3M7UA 1GHZA 4HTCH 1C5VA 3P95A 2FLRH 2PHBA 3MU8A 1SQOA 2Z6BD 3DFLA 4NZQA 1O2KA 5C5NA 4X2VA 3VB3A 1P2MA 1AQ7A 1P9SA 5PTPA 4BAKB 2A4QA 4DW2U 2FODA 4R8TB 1HAZB 4WXVA 2P8OC 1QB6A 4CRFA 3B23B 1AE5A 3LJOA 1RXPA 1G36A 1C1QA 3AVZA 4NA9H 3SI4H 1GBIA 1H9HE 2XBXA 2BM2A 1GBEA 3Q3YA 2AEIH 1YPJH 1KTSB 4WJG2 4R0IA 2BMGB 3SUFA 2ODYB 5FPSA 2FEQH 3DD2H 1FN8A 4B2BA 3MFJA 4U32A 1LHCH 4YOGA 2TRMA 1PQ5A 4B1TA 1GJ5H 2ZG0H 1OWEA 1EAUA 3RC4A 1TRMA 3OSYA 1Q31A 5BPEA 1S84A 1JOUB 1OX1A 3GISB 1PPGE 5FX5A 1C5NH 1H9LB 2OINA 3F1SB 3ZYEA 1TGNA 3UWIA 2B7DH 4DGJA 4WY3A 1SVPA 4X2YA 1G3CA 4B73A 2R3UA 1QBOA 1VITG 2XC4A 4U01A 3ZZDA 3S7HB 2HALA 1EZQA 4WVPE 1BHXB 3KQBA 2YNAA 3QO6A 2XBVA 1AKSA 1TX6A 1ZMLA 1ZRBA 1L1NA 1SGQE 3R0FA 5DJ7A 4LZ4B 4UEHH 1C5YB 2GDDA 1FY3A 1TBRH 2ZDKA 3LGYA 2BVRH 1O2PA 2ZP0H 2O8UA 1FV9A 1HAHH 1O2ZA 2SGAA 1NZQH 2FI3E 3BG4C 3RMNH 3UNQA 2A45B 3NXPA 4ZKRU 3FZDA 1GI5A 1UTLM 1EX3A 1JIRA 1WOFA 1O3KA 2WV5A 2OC0A 1O5FH 2QCYA 3PMJA 2AMDA 4Q2KA 3V13A 4I33A 1NT1A 4ZKNU 1E37B 1PPCE 3SU3A 2BLOA 1CO7E 4ABAA 1KLTA 1ELFA 1ZYOA 4Y6DA 1P01A 1TGCA 1GDQA 1C2KA 1QCPA 2BOHB 3S9CA 1NY22 1IQKA 3KQDA 3GYLB 3D62A 4UFDH 1DDJA 1W14U 3HKIB 1YC0A 4YOJA 2GCTB 1EQ9A 1UK3A 1GVKB 1THPB 2ZU3A 2H5DA 5AF9H 2I6SA 3A82A 1OWIA 3RXSA 4ZHAA 2Z7FE 3LC3A 2ZA5A 1C5QA 3RU4T 1PQAA 1DM4B 1YLCA 1ZSJA 3EA9A 3BTGE 1JIMA 4Y10E 2ASUB 3Q77A 3TLOA 4DJZB 3HATH 4ISHH 3BF6H 2WPIS 1E38B 5F8XA 4FXGH 4INHA 1C5WB 2ZDMA 4CRAA 2AS9A 4Y79A 2ZFSA 4K1SA 3ZVDA 3VB7A 3KIDU 3PMHB 2PSYA 1O36A 3UPEA 1CA0C 1S85A 3ZZCA 2C93B 2W7SA 1V2LT 2C8XB 5C67A 1V2UT 4ZHLU 2WPLS 2DE9A 1QURH 2F91A 4MNVA 4CRGA 3P92A 4GCHG 2VIDA 1H9IE 4FU8A 1NFUA 2EA3A 4GAWA 3IWMA 3A89A 1PPZA 3BN9A 1QA0A 1SGCA 2VVUA 4JZIA 3STIA 2R9PA 3FANA 3A8DA 1BTPA 1A5GH 1N8OB 1O2SA 3GDUA 2BY6X 4GLYA 1ELVA 1O3BA 2PFEA 3A8AA 2EI6A 1G32B 3VGCC 2ZU4A 1D6WA 1AGJA 4U30A 4OGXA 1AVGH 3SNAA 2FI5E 1SPJA 2PV9B 3NK8A 1O35A 1NN6A 3TVJB 1SR5C 1TWXB 1VR1H 1AFEH 3M36A 1HYLA 3BEFB 4GUXA 2BD7A 4BXWA 2THFB 2AMQA 2P3TB 3SUGA 3ESTA 1ANEA 1LKAA 1P2NA 5EQSA 4ESTE 1MD8A 3MWIU 1O2GH 2B0FA 1TQ7B 1C5XB 1THRH 1XKAC 1TMTH 1QGFA 4Y7AA 1XVMA 2AH4X 2VWLA 1LVOA 3BTWE 6CHAC 3ZYDA 4ZXYH 1QQUA 2O8LA 3EYDA 3BTHE 1SGFG 2BDHA 5LH8A 3GCNA 3QTVH 2D1JA 1CHOG 2ZGHA 4AFUA 3ELAH 1WYKA 1BQYA 1DFPA 3B9FH 2F83A 5IDKA 4CR9A 4YESB 3CS7A 1A2CH 4X1NU 1TBQH 4X6NA 5L2YH 1SGNE 1QBVH 2D2DA 3SU1A 3N7OA 3T27A 1UTJA 1T4VH 3HKJB 1CT4E 4HGCA 2GZ7A 1V2VT 4FUIA 5FCKA 1NROH 4K1TA 6ESTA 3RXHA 1UHBB 1GL0E 1ARBA 1UVTH 1LHDH 1TX8A 5DP7A 1FDPA 3V0XA 4ABIA 1TNGA 1SLVB 1BTUA 3A83A 3TK6A 1MTNC 2ZU1A 4WF8A 5E2OA 2Z94A 5FAHA 1PQ7A 5DGJA 1C1NA 4Q80A 3S69A 4ABDA 2QF0A 1IQHA 4YM9A 1ZHMA 2J9NA 3O8DA 5J4QA 5EOKA 1DX5M 2ZCHP 3LDXH 3TGIE 4FVBA 1NPMA 1DWEH 1QJ7B 2Z9KA 2J92A 4WH6A 1G2MA 1TPSA 1DLEA 2OQ5A 4AFZA 1XUJA 1AZZA 1ELBA 1TOMH 4SGAE 2ILNA 1TA6A 1DPOA 3P70B 3SU2A 3UUZA 1SGDE 5T6DA 3PLPA 2JKHA 1O2YA 3ATMA 2BZAA 2ZC9H 1MTVA 1C5ZB 1Z6EA 1PQ8A 1INCA 3QZRA 4AOQA 5EXMA 3GDSA 2VVVA 3L3TA 3VB5A 1H4WA 5LGOA 2XC0A 4X1QU 1G37A 3EGKH 2SGEE 2CV3A 2F9BH 4WH8A 1ZMNA 3KEEA 1F5LA 3QGNB 5DO4H 4FUFA 5H4IB 4Y7BA 1L1JA 4WMFA 2Q6GA 3SGBE 3A7VA 1ZJKA 4NIXA 1GBJA 1HCGA 4YTAA 1TIOA 2ZGXH 3TK9A 3BTEE 3HGNA 1MUEB 1GHAG 3SJOA 2ZHFH 4KTSA 1MKXH 4ISLA 1NRNH 4ABJA 1L1GA 1G3EA 1BMMH 1FONA 1S83A 1SFQB 4O03A 5DKMA 1AIXH 5C2ZA 4X6MA 4OS7A 1KSNA 3RXJA 3PROA 1WCZA 1G9IE 4KKDA 2Y6TA 4D7GA 1GMDF 2A4GA 3NCLA 1BIOA 3LH1A 4NZLA 1C9PA 3PTNA 2BXTH 1QL9A 1MU6B 1O2VA 2UWPA 1WSSH 1NTPA 4AB8A 1MKXK 3RXBA 4A7IB 2VWMA 1TAWA 5FPTA 5GPIB 1SLWB 3LOXA 4NFEA 1DY8A 1P05A 1AVWA 2R0KA 3SN8A 3MI4A 3SUDA 1SGEE 4NIYA 5SGAE 2C8WB 4Z6AH 4FUDA 1C5OH 1P2KA 4BAHB 1OP0A 2R2WU 3BTQE 5E2PA 1SBWA 3OY6U 2ESTE 1Y5BT 1EXFA 2BXUH 3GY4A 1S0RA 1WV7H 1KTTB 2BDIA 2ZGJA 4IMZA 4DIHH 1F0RA 1ANDA 3RXDA 3D23A 1P06A 1P09A 4Y0ZE 2ANWA 4MPWA 2P3FH 3K65B 3GOVB 3TK5A 1P2JA 1K28D 2SNWA 1FNIA 1BT7A 2XTTB 1ZLRA 3U8TH 1IQGA 2FOFA 4F4OC 1MH0A 3CENA 1GI3A 1P2QA 7KMEH 1K1PA 2ZNKH 4ABFA 1C1WH 4M7GA 4NSVA 1EJNA 2HVXA 4INLA 1NFWA 1C2FA 2ANYA 1ELDE 3EAJA 1O30A 1KY9A 1XUFA 1GJDB 3RXMA 1C4U2 4K8YA 3A84A 2ZPQA 3OX7U 4I8HA 5T6GA 1O31A 3MOCA 1O5GH 2BYAX 1GGDB 1CGIE 5L30H 1TGTA 2ODPA 3A7YA 3NPSA 1HNEE 1F5RA 3RXKA 5C1UA 4YLUA 1EOJA 5A2MH 2ODQA 2VH6A 3FP6E 3W95A 2CF9H 3GY3A 2PKSB 2OCVB 1DITH 1K1IA 4BTIB 2G4TA 5TCAA 2GCHG 2Y5FA 1TLDA 4I32A 3K2UA 1GVZA 2W7UA 2RA0A 2SFAA 5GCHF 4O3TA 3SBKA 2XWAA 3BEIB 1GBBA 1W12U 2ULLA 4YLQH 1O3AA 1RFNA 3MU4A 3FFGA 3MYWA 1LVMA 5K7RA 1ZOMA 5DP8A 2C3SA 4TWYA 1FY4A 3G01A 3SNBA 1YKTA 3UY9A 3ZV8A 2WPKS 3ZZ8A 3SNEA 1TB6H 4YT7H 2ZHWH 2G4UA 3LJJA 4IN1A 1T8LA 3BTME 4GCHF 4Q7XA 3UOPA 2KAIB 1TGSZ 3SJ9A 2A7CA 1HGTH 5FCRA 1CA8B 1N8OC 1SL3A 3P8OA 1TA2A 3GYMA 3P17H 6GCHG 4PROA 1A4WH 1UTKA 2SGPE 3S9BA 1QB9A 4ABGA 5C5OA 3S9AA 2OBOA 2BB4A 3I78A 3ZVAA 8GCHG 1ZPCA 1OWKA 2G00A 1JBUH 4FU7A 4Y11E 4RKJB 5ABWA 1YYY1 1D3PB 1T31A 3T5FH 4A5TS 2SGDE 1T32A 3UFAA 1WTHD 4X8SH 3ATIA 5E0HA 3SW2B 1SHHB 2BY8X 1BTYA 2D8WA 2ZFPH 3E8LA 4NIVA 1O2LA 5ESBA 1GJ8B 1BRBE 4Q7YA 1RTLA 5FX6A 3TGJE 1QFKH 5J4SA 2J94A 1DT2A 1D3DB 1AWHB 1SLXB 1UCYE 2P59A 4NA8A 3T25A 5JBCS 1VGCB 5GDSH 1HJ8A 2CMYA 2VGCC 1HAVB 1YGCH 4AG1A 3F6UH 1C1VH 1Z1IA 4I7YH 1O38A 3MH5A 1TE0A 2FS8A 1HRTH 1TQ0B 2FXRA 4DURA 2A4RA 4JYTA 3TH3H 1CU1A 1Z8RA 2W26A 3GY8A 2WYGA 3RXUA 4MQAA 1F2SE 1CVWH 1GMHG 4A1XA 3RMOH 2PLXA 3BV9B 3P8GA 4WXIA 3T2NA 2PGBB 2PUQH 5FBIA 1SI5H 1VJAU 4AG2A 1T4UH 2V3HH 3FP7E 1EP6A 5IYTA 3U9AH 1C5UA 1FQ3A 1MTUA 2QN5T 1EKBB 2H5CA 4BNRA 4E05H 4TPYA 4GHQA 1O3LA 1C2LA 2XXLA 3VPKA 4A92A 1FXYA 1Y3YA 5LPFA 4Y71A 3ODDA 4AN7A 1O3EA 2C8YB 5HM9A 4YOIA 2VIPA 2A7HA 2F9UA 1BMNH 5DP4A 1FIZA 1EJAA 2CGAA 1O3IA 1WBGB 1TFXA 1QY6A 2ZCKP 2OBQA 2C90B 4MVNA 3TNTA 1BDAA 1XUKA 4AB9A 1P57B 1O5DH 4NCYA 1CGHA 3K6ZA 1OPHB 2HGTH 2I6QA 1DANH 1NO9H 3ZV9A 1SG8B 2A7JA 4HFPB 4AZ2B 3VFEA 3KGPA 2ZTXA 1MTWA 1WTGH 5DPAA 3UNRA 1MTSA 2OC8A 3RLWH 1IHSH 4AORA 4AFSA 5BRRE 1GJAB 2XWBI 3RMMH 1QR3E 3PWBA 1U6QA 3RMLH 1FAXA 3MNBA 1D6RA 4XOJA 1NFYA 3RM2H 1PJPA 1IQFA 4OS1A 1V2NT 1P9UA 3RP2A 2GDEH 2WPHS 3LU9B 1QTFA 3QWCH 5A0BA 2GVFA 1O2XA 1AUTC 2ALVA 3T62A 2VIQA 5EXNA 3CP7A 4J1YA 1T8NA 4B75A 1PYTD 1TPAE 2ZECA 3U1JB 3ZVCA 3VB4A 5DP6A 1X7AC 3VEQB 2FX6A 3MO6A 2FS9A 1ARCA 1TMBH 1SGRE 1HAVA 2FWWA 1Y59T 1W2KH 3A86A 1IQIA 1UTOA 3HPTB 1BUIA 1S6FA 1O34A 1QRZA 2TGTA 1MBQA 1TNLA 3QDZB 2Y5HA 1GI9B 2CXVA 4ABBA 1P8VC 4IC6A 1EB2A 1XUIA 2Q6FA 1CQQA 1QRWA 4FVDA 1LMWB 1Z6JH 1GG6B 1ZRKA 1LPGB 5B6OA 4BTUB 4OS4A 4Y76A 3A7WA 1UVUH 2XCNA 1L2EA 5E0JA 1QB1A 3TU7H 1C1PA 4ZMAH 3S7KB 2NU3E 2YOLA 1GMCG 1A0LA 1VCPA 1FMGA 2GMTB 1L0ZA 2OC1A 4KELA 1JXPA 1K22H 2B8OH 2A5KA 3FP8E 3SGAE 3L6PA 5EXLA 4A6LA 1V2TT 3PB1E 1AVXA 4TYDA 2FI4E 2GTBA 3EE0B 1DOJA 4TWWA 1KXDA 3BEUA 1P2IA 1FPHH 4OS2A 1EZXC 3LGUA 1GBTA 3PLBA 3PLKA 3RLYH 4O9VA 1C9TA 1O2QA 2BY7X 5CHAB 2UUKB 4Y0YE 1HLTH 3ZZ5A 1ETTH 2ZKSA 1Z8GA 4X8VH 4AGKA 3H7OA 1UVSH 3GCTF 3RC6A 3AW0A 1RTKA 4KP0A 4XDEA 2P93A 2R3YA 1TRNA 1LQDB 2HPQH 1K1OA 4NGAH 2M5TA 3E6PH 1A3BH 5HYOA 1P03A 1DSTA 2XYAA 1O5CB 2O8WA 3A7ZA 2FPZA 2Z3EA 3A85A 4FU9A 1MD7A 2ZFFH 2ZHQH 1UTQA 2GT7A 1PFXC 1SGTA 5FBEA 1MBMA 1FI8A 2G51A 3LGWA 3MMGA 2BLVA 1C5TA 3RM0H 3E3TA 4FUHA 1KIGH 1MCVA 5HM2A 2STAE 1OP8A 1W3CA 4RKOB 4CRBA 5EQRA 3RDZA 2BY5X 3MO3A 1GWAA 1GCTB 1E36B 2V6NA 3ZVEA 2EI8A 1DICA 1K1LA 3RXFA 3U69H 1O2HA 5A8XA 2QA9E 1SGYE 5JB8S 1AHTH 2FTLE 1UVOA 3D49H 5GXPA 5GWZA 4JZDH 3HK6B 3RXLA 9LPRA 1K1MA 4DT7B 2FMJA 5L2ZH 3SQEE 1XKBC 3ATLA 2XBWA 3SU6A 1TNIA 2NU2E 2A2QH 3L33A 2AIPA 3AAUA 2NU1E 5AFZH 1UJ1A 3U8RH 2F9NA 1DWCH 2ZU5A 4VGCB 2BX4A 1ETSH 1MAYA 3A8CA 3MH7A 1Z71A 3A7TA 3I77A 1SGIB 1AZ8A 1O2IA 1G3BA 2TGPZ 5C1YA 1UO6A 3M3VA 1DVAH 1O2JA 1ZPZA 3RXGA 1QJ6B 4O97A 1BTZA 1ANBA 1HJAB 4YO9A 1OOKB 3LKWA 1LHEH 2G81E 2Y7ZA 2J34A 3A87A 3NKKA 4X1RU 1O3NA 1V2JT 4H4FA 2BD2A 5T6FA 1F0SA 1C2IA 1LPKB 3RUOA 1HUTH 2AGIX 1AB9B 1JRTA 2A2XH 1GI6A 2ZO3H 2ZPRA 4MPUA 3A80A 4DG4A 1KXEA 3BTDE 4IS5A 3RU4E 3NUMA 1T8MA 4NA7A 4H42U 2EI7A 1A61H 3MH4A 1P2OA 1J15A 4LK4A 3SNCA 2HOBA 1O5BB 1FLEE 1V2KT 1YPGH 1LQEA 1ZJDA 2FM2A 3M37A 3SJIA 3SU4A 3M61U 5A8YA 1KDQB 2BD5A 4UDWH 3TJUA 4NSYA 1B0EA 2O9QA 2RCEA 4JYVH 1J14A 1GMHF 2WPMS 4BAQB 1DUEA 2BDCA 1K2I1 1MKWH 4NWLA 1Z8JB 2SNVA 2ZTZA 2F9OA 5DK1A 3ZZ3A 2A1DB 2GP9B 1A3EH 5EGMA 3MU1A 3F9EA 3GY7A 1Z8IB 1J8AA 3VB6A 1Y3VA 5DP5A 1W7GH 1ZSKA 1MQ5A 1MMJN 2QV1A 4K69A 2FLBH 2ZU2A 2OLGA 3DT0H 1RRKA 3FVFB 2QY0B 7GCHG 3U98H 3GICB 4MPXA 3RXOA 1UTPA 3ODFA 2BD4A 3BG4B 2C4FH 2FOCA 1O2RA 4J2YB 4O3UA 3OTJE 5ETXA 2ZHEH 3O8RA 3EA7A 1MKWK 4DVAU 3P8NA 1BCUH 1TNKA 2V35A 3GY5A 3K9XB 1C5PA 4ZH8A 5F8TA 1BZXE 3QK1A 1W8BH 7ESTE 4SGBE 4OGYA 1Z1JA 1GBAA 1PPHE 1V2OT 1AU8A 1EAWA 1C1UH 1WUNH 1ZTLA 1FY5A 1AI8H 4X2XA 1NRQH 1F5KU 2RDLA 3TJNA 1HBTH 1RD3B 2A31A 4X2WA 3GY6A 6LPRA 2BX3A 2D26C 3AW1A 3SJ8A 2IOTA 2AYWA 1VITF 2W5EA 1V2ST 4NG9H 1TPPA 4INKA 4BXSA 2H6MA 1MAXA 1UHBA 2WINI 4U2WA 4XSKU 1GHYH 1EUFA 1C1OA 1T8OA 4WMDA 1GHXH 1ZPBA 3LIWA 3MNSA 1BJUA 4BAOB 4ZKOU 1O32A 1CHGA 4MNWA 1AN1E 1K1JA 3BIVH 4XE4A 4FUGA 1GI1A 1QJ1B 1GBKA 1XMNB 4KTUA 2BTCE 3UREA 2BQ7B 3SO3A 1LCYA 4B74A 1IOEA 1GHBG 1O3OA 1B0FA 1HAXB 1W0ZU 1FUJA 5F8ZA 1BRAA 2BY9X 2QXJA 1EPTB 1W0YH 4THNH 1MZDA 1CA0B 1GPZA 3UR9A 1NRPH 3LONA 4K2YA 2LNCA 4JK6A 1IQJA 3M7QA 1C2EA 1KXAA 1EOLA 3D65E 3F9FA 1AWFH 1V2PT 1C2DA 2AFQB 2A4OA 2C8ZB 1P0SH 3GDVA 2XCFA 2HNTF 1SGPE 1TMUH 4FUJA 1DXPA 3ZZ4A 4RN6A 1V2QT 2R2MB 3M7TA 1BTHH 1EB1H 2GCTC 1OWDA 3ATWA 3Q3KA 3VGCB 3ZZ9A 3QLPH 1O37A 3Q00A 3EA8A 1GI7B 5EW2H 1O3DA 3M5NA 5JDUB 4K8BA 1GHVH 1LDTT 2ZF0H 1KDQA 1EJMA 1L4DA 4K1EA 1FY8E 2BHGA 1ESBA 3MU0A 1H8IH 1P3CA 2V0BA 5ESTE 2G52A 1F7ZA 1ELGA 1KXCA 4MPVA 1LVYA 1HXFH 1NRRH 1O5EH 2P95A 2BLQA 3ZZ6A 2ZI2H 1G3DA 1SLUB 2QXIA 2XRCA 2FOEA 4BANB 6CHAB 1XXFA 4BTTB 4MLFB 2VIOA 5EPNA 4IBLH 2FESH 1C2JA 3F68H 4IGDA 3Q3XA 1OXGA 1SHYA 1C1SA 1O3JA 2ANKH 3BTFE 2WYJA 1ID5H 1RGQA 3BG8A 1QL7A 4NFFA 1SGFA 1D9IA 4B76A 2OP9A 3UQVA 1ZSLA 5CHAC 1O2WA 3AAVA 1AKSB 2RA3A 3KQCA 2Q1JA 3PMAB 1YBWA 2P94A 2QAAA 2OQUA 2ZDNA 3LH3A 3M5MA 3STJA 1TNHA 1AE8H 3PO1B 2GGVB 4ABEA 2J95A 4UE7H 3KL6A 1VZQH 1P3EA 5E8EH 1E35B 1SOTA 2OUAA 1ZGVA 2TPIZ 1M9UA 1UTMA 2BQWB 3SORA 1EZUC 2BQ6B 5FXLA 2VNTA 1C5MD 4FUBA 1NM6A 5A09A 2W3IA 2Z3CA 4CH2B 1A5IA 2QXHA 3HK3B 2G8TA 3C1KA 3IITA 4HI3A 1CHOF 2GX4A 2JH0D 1O2UA 2TGDA 1O2TA 2BD3A 2QGRA 4H6TA 1ZMJA 1QIXB 2B5TB 1BBRH 5C20A 1EPTA 1O0DH 2CF8H 2H1UA 1NU9A 1IQMA 1OWJA 8ESTE 2EC9H 1VCWA 4FUEA 1TGBA 1KXFA 1C2GA 4JCNA 2Y82A 1VCQA 5G4BA 1NS3A 5AFYH 1OSSA 2HNTC 4Z0KA 1GJ9B 2QIQA 4Q7ZA 3SQHE 2ZZUH 4X6OA 1SC8U 4ZAEA 1CT2E 1GBDA 2ZCLP 4JZEH 1BMLA 3ITIA 5EU8A 5HGGA 1F92A 3SJKA 2RG3A 1BBRK 2G5VA 2DE8A 2Z9JA 3JZ1B 1L4ZA 2K1QA 1YCPH 4LXBH 3RXTA 4VGCC 3MH6A 3SV7A 4D7FA 1HB0B 2VWNA 4D76A 2Y7XA 4X0WU 4K60A 4MNYA 1GI8B 3MHWU 1XM1A 4UFFH 1MZAA 4I8GA 3TJOA 1CE5A 3LT3A 3BTTE 3RXQA 3KQEA 1T7CA 1HJAC 4OS5A 2OTVA 1GMDG 3P8FA
chains in the Genus database with same CATH superfamily
2FOBA 3SUEA 1ZTJA 2GKVE 5F03A 2VJ1A 1ACBE 2EEKA 2FX4A 4JYUH 1N6YA 1SQAA 3BSQA 4AYYB 1S81A 1YLDA 1AB9C 1FN6A 1YCPK 1D3TB 3JZ2B 4B71A 1YWUA 3M5LA 1TBZH 2WV4A 3F0OA 1O2MA 3SHAH 1OHHD 1LVBA 2HLCA 1GI2A 3URDA 1DSUA 4K5ZA 3T28A 2XC5A 3PV4A 1Y5AT 1G2LA 1EASA 2KAIA 3LC5A 3RXIA 3GCHB 1ABJH 3TH2H 1O3FA 1XUHA 3M35A 4F49A 2KCYA 3PM3A 3RXVA 1MCTA 1KLJH 4GSOA 1NRSH 5KECA 2WV9A 4JZFH 3UIRA 4DIIH 5JB9S 4CREA 3BTKE 5LPRA 3NWUA 4CHAB 1GHAF 2BDGA 1TOCB 4UFGH 2CHAB 2BD8A 1FIWA 2VWOA 3LGTA 1YF4A 1YPMH 1CBWB 1OP2A 1BITA 1PPBH 4X1PU 2FOMB 5T3HA 3TIUA 1J16A 5A8ZA 1S6HA 7GCHF 4CBOA 5AVDA 1ELTA 5DG6A 1S82A 3E91A 3ENSB 1J17T 2TIOA 1JRSA 3ZVGA 1FZZA 1Q2WA 4ISIH 1GI0A 1CT0E 2A5IA 3T26A 3A88A 2H9EH 3EDXB 1UMAH 1A1RA 4ISNA 3SU5A 5C1XA 5JBAS 2QF3A 2QF4A 1DUAA 2SGFE 1YPHE 2F9PA 2O8TA 3RXRA 4LOYH 1ESAA 2JETB 3OU0A 3E1XB 3MO9A 2GV6A 4B6EA 1C1MA 1HFDA 4AGJA 1ORFA 1YPLH 3EQ0H 4E06H 2NU0E 2PSXA 2IJOB 5A0AE 2O8MA 2ZFQH 3F0PA 2AGEX 2VH0A 3SNDA 2WZQA 5GJ4B 1RIWB 1WU1A 1Y3UA 2ZFTA 5DP3A 5EQQA 2DUCA 1RJXB 2FOGA 4ASHA 1OKXA 1NC6A 3H5CB 1G30B 1V3XA 4YZUA 2AIQA 2BDYA 5L6NH 5GCHG 1ETRH 5EG4A 1XUGA 1C5SA 1SMFE 3VXEH 1C1TA 4AFQA 1YCPM 1GJBB 4UONA 1EAXA 1GVLA 3QTOH 3K6YA 1NU7B 2A5AA 1GHBF 1YP9A 3RU4D 1EPTC 1TABE 5CMXH 4MTBA 1RS0A 1ZHPA 4B2CA 5EW1H 1IAUA 3GY2A 1AO5A 2HWLB 2JH6D 5GIBA 3MU5A 1DLKB 1DY9A 2J98B 2Z9IA 1VITH 2BOKA 1J9CH 3KF2A 3U8OH 2LPRA 2F9VA 2UWLA 1JWTA 2IPQX 1YPHC 4YT6H 1GGDC 2Z9GA 1HAYB 3E90B 1BMAA 3IG6B 3QX5H 1BA8B 4UD9H 1C1RA 1B5GH 1NBMD 2PKSC 3BIUH 1QNJA 4BOHA 1GBHA 1C2MA 5JBBS 4JZ1A 1C5LH 4I8LA 5EIYA 2J4IA 2UUFB 2YNBA 2GCHF 2WSSD 3TH4H 3H7TA 4HZHA 2A0QB 4D9RA 1VKYA 4I8KA 1P12E 1K21H 1TNJA 1DWDH 1A46H 1GJ7B 1K1NA 1WDIA 2VIWA 2ZDLA 3LGVA 4ABHA 2IPHA 1GI4A 3KHVA 5DN6D 1N6XA 2IN2A 3TJVA 5C3NA 1QHRB 1LKBA 2H9HA 1YM0A 2VGCB 1FPCH 1HDTH 4ZXXH 1AFQB 1WQVH 2FTMA 2KX4A 3PV2A 4CRCA 1AD8H 1ZZZA 1P04A 2UUJB 1A5HA 5HMAA 3N7DA 1Q3XA 1E0FD 1TX7A 2BD9A 4D9QA 2UUYA 1OS8A 2AGGX 3M3TA 3PWCA 3PMBB 1JMOH 1BBRE 6GCHF 1KYNA 2SGQE 3W94A 1HPGA 4CRDA 1LHGH 8GCHF 1BHXF 1SOZA 2B9LA 2P16A 1O3MA 3E0PB 5A0CA 4MDSA 1S0QA 1GHWH 2AERH 5TCCA 1ZR0A 1YPKH 3SU0A 1CGJE 4I31A 2P8OB 2Q6DA 1DS2E 1IQNA 1Y3WA 1BRUP 4B2AA 3PO1C 1YPEH 3MTYA 1UCYH 2TBSA 4D8NA 3E16B 1H8ED 2GZ9A 4CBNA 4JK5A 3RXEA 1PPEE 3A7XA 1XX9A 3PV5A 1GJ4H 5HIYA 1E34B 1EAIA 2NWNA 1SSXA 1HJ9A 1VGCC 4XBCA 5CE1A 2FP7B 1TYNA 1C2HA 2PUXB 3O8CA 2ZIQH 2R0LA 3GCOA 4A1TA 4Y8XA 3R3GB 2A32A 4B6FA 3SZNA 1GDUA 3PRDA 1GJCB 2PKAB 2Z9LA 3S0NA 2ZFRH 1C4Y2 5HIZA 4KTCA 1UCYK 4X8TH 3DCLA 3UR6A 5E0GA 2KM0A 1PYTC 2H9TH 1K9OE 3AASA 1C4V2 1UVPA 4BAMB 1AY6H 2J98A 2WUBA 3SZEA 3FZZA 3TNSA 2WPJS 1NBME 2FO9A 1S6LA 2TGAA 5EODA 8LPRA 4GHTA 2V3OH 2ZPSA 4AC9A 8KME2 3ZVBA 1VJ9U 1S5SA 2NU4E 4DCDA 1V2MT 5DP9A 1AMHA 2ZGCA 1MQ6A 4WMEA 4GPGA 1O5AB 2ZQ2A 3DUXH 1HIAB 3SGQE 3VXFH 2XW9A 3KYGA 1OWHA 1C5RA 1PPFE 2OD3B 1LHFH 2J38A 2VB0A 5AHGH 5FHTA 1Y3XA 3SI3H 3TGKE 3F9HA 1F0UA 4UFEH 1ZTKA 4E7RG 3KQ5A 1O33A 1GDNA 2BZ6H 2P3UB 1BRCE 2BVSH 1W10U 2ANMH 1QQ4A 3SV9A 1UTNA 1BTXA 1ZHRA 3A8BA 1WQSA 2PW8H 3MNCA 4Y8YA 1EFRD 1GL1A 1W0JD 3OFND 2CN0H 1O3HA 2OC7A 1KMHB 2VIVA 3N99A 1O39A 4K3JA 3M5OA 3RXPA 1TRYA 2QXGA 1DXWA 2FOHA 2JH5D 2BDBA 2UWOA 2GD4B 4QT8C 4E7NA 2F3CE 5I46H 3E0NB 3SV6A 3A81A 3DFJA 2ZDAH 4XBDA 1ABIH 1IHTH 1O2NA 1GBLA 1A0HB 4NWKA 1V6DA 1KLIH 1QL8A 2WUCA 4KGAA 2M2AA 3GCHC 1GJ6A 5LPEA 3F2FA 1Z7KA 2G5NA 3OEHD 2STBE 2XBYA 1WAYB 5JPMH 3OYPA 4AX9H 1O3CA 1P11E 3HGPA 1IQLA 3Q76A 4CHAC 3QZQA 3OY5U 2CHAC 2QF5A 1YLNA 3SHCH 2PWXA 3T29A 1P10A 1XXDA 5JYIA 5KGOA 1A7SA 1CBWC 2J2UA 2VU8E 4RSPA 2PTCE 3UQOA 2ZEBA 2W6ID 1TPOA 4RT1A 2ZQ1A 3DA9B 1UK2A 3UWJH 4I8JA 4MNXA 1TALA 1EATA 1W7XH 2OXSA 2VVCA 2G55A 2PGQB 3FOAA 3SV8A 3V12A 2FDAA 3W1EA 2BVXH 2ZGBH 2GT8A 1P02A 2FZZA 1GBFA 1QA7A 1N1LA 2AMPA 3F2GA 3UNSA 1SQTA 4CH8B 1SFIA 3ZZAA 2PKAA 1V2WT 3FAOA 4H6SB 4WWYA 3GCTG 1FAKH 1THSH 2HPPH 4XBBA 3U1IB 2JETC 3H09A 3URCA 1ESTA 4TPIZ 3KN2A 5HXFA 1DE7H 5JBTA 1LO6A 4AYVB 3KCGH 1Y8TA 2ZWLH 4DY7B 1BTWA 2KR7A 3LPRA 1GG6C 4ACBA 3PTBA 2KCAA 2GZ8A 2YMSB 2W3KA 4ZHMU 2Y5GA 1RIWC 2FYRA 1LTOA 2HVYB 3V7TA 3SOSA 1MU8B 1EZSC 1TONA 3PYHA 1ELCA 4DOQA 1H1BA 1EP5A 2BLWA 1GMCF 1A0JA 4FUCA 3ATKA 1HAOH 1Y5UT 3RXCA 1HIAA 1W11U 1W13U 1ZGIA 2GMTC 5EPYA 2VINA 1HAIH 2FIRH 1GCDA 3B8JA 3WY8A 1GBCA 4X8UH 3OE7D 3UTUH 4IW4E 2QC2A 1ANCA 1ELAA 2ALPA 4ZUHA 3SV2H 1AUJA 2HNTE 3DHKH 5F6MA 4NIWA 1UK4A 4ZKSU 3OEED 1HAPH 2H2ZA 4Y8ZA 1RTFB 4JMYA 3TITA 3M3SA 1COWD 3UOUA 4A1VA 1OYQA 2J5UA 1BMFD 2Y80A 1V2RT 4TY6A 3I29A 3QGJA 2Z3DA 1F0TA 2HRVA 3QUMP 1MTNB 4IN2A 3RC5A 4X6PA 2KCOA 1BOQA 1HV7A 4IC5A 2FYQA 3MNXA 3ZVFA 1KXBA 2BDAA 2AHME 1QBNA 4ZROA 1BJVA 3NZIA 1B7XB 1ELEE 1O3PB 1NFXA 1QRXA 5KEDA 1FJSA 4LZ1H 3C27B 1D3QB 1LPZB 2CJIA 2Y81A 1OYTH 3P6ZB 3LGIA 2ZTYA 2GV7A 4MG3A 3TPIZ 1HAGE 1BB0B 3QN7A 4Q63A 7LPRA 2K8IA 1HXEH 1GBMA 2XNIA 4XFQA 5FPYA 3KNXA 1O2OA 5K0HA 4OS6A 1D4PB 1GCTC 4CR5A 4X1SU 2QYIA 2ZDVH 1XVOA 3ZZ7A 4IMQA 5TJXA 1SB1H 1IQEA 1O3GA 3CS0A 1AFQC 5I25A 4GVUA 3F9GA 2PR3A 4TY7A 3O8BA 4ISOA 2PTNA 3V3MA 3CNRA 3ZZBA 1FY1A 1NESE 2FOAA 9ESTA 1H8HD 1H8DH 3RXAA 1DWBH 2ZHDA 3M7UA 1GHZA 4HTCH 1C5VA 3P95A 2FLRH 2PHBA 3MU8A 1SQOA 2Z6BD 3DFLA 4DT4A 4NZQA 1O2KA 2RFKC 5C5NA 4X2VA 3VB3A 1P2MA 1AQ7A 1P9SA 5PTPA 4BAKB 2A4QA 4DW2U 2FODA 4R8TB 1HAZB 4WXVA 2P8OC 1QB6A 4CRFA 3B23B 1AE5A 2OK5A 3LJOA 1RXPA 1G36A 1SKYE 1C1QA 3AVZA 4NA9H 3SI4H 1GBIA 1H9HE 2XBXA 2BM2A 1GBEA 3Q3YA 2AEIH 1YPJH 1KTSB 4WJG2 4R0IA 2BMGB 3SUFA 2ODYB 5FPSA 2FEQH 3DD2H 1FN8A 4B2BA 3MFJA 4U32A 1LHCH 4YOGA 2TRMA 1PQ5A 4B1TA 1GJ5H 2ZG0H 1OWEA 1EAUA 3RC4A 1TRMA 1SQRA 3OSYA 1Q31A 5BPEA 1S84A 1JOUB 1OX1A 3GISB 1PPGE 5FX5A 1C5NH 1H9LB 2OINA 3F1SB 3ZYEA 1TGNA 3UWIA 2B7DH 4DGJA 4WY3A 3AK5A 1SVPA 4X2YA 1G3CA 4B73A 2R3UA 1QBOA 1VITG 2XC4A 4U01A 3ZZDA 2CK3D 2KZ4A 3S7HB 2HALA 1EZQA 4WVPE 1BHXB 3KQBA 2YNAA 3QO6A 2XBVA 1AKSA 1TX6A 1ZMLA 1ZRBA 1L1NA 1SGQE 3R0FA 5DJ7A 4LZ4B 4UEHH 1C5YB 2GDDA 1FY3A 1TBRH 2ZDKA 3LGYA 2BVRH 1O2PA 2ZP0H 2O8UA 1FV9A 1HAHH 1O2ZA 2SGAA 1NZQH 2FI3E 3BG4C 3RMNH 3UNQA 2A45B 3NXPA 4ZKRU 3FZDA 1GI5A 5CHBA 2F4LA 1UTLM 1EX3A 1JIRA 1WOFA 1O3KA 2WV5A 2OC0A 1O5FH 2QCYA 3PMJA 2AMDA 4Q2KA 3V13A 4I33A 1NT1A 4ZKNU 5C0TA 1E37B 1PPCE 3SU3A 2BLOA 1CO7E 3OTPA 4ABAA 1KLTA 1ELFA 1ZYOA 4Y6DA 1P01A 1TGCA 1GDQA 1C2KA 1QCPA 2BOHB 3S9CA 1NY22 1IQKA 3KQDA 3GYLB 3D62A 4UFDH 1DDJA 1W14U 3HKIB 1YC0A 4YOJA 2GCTB 1EQ9A 1UK3A 1GVKB 1THPB 2ZU3A 2H5DA 5AF9H 2I6SA 3A82A 1OWIA 3RXSA 4ZHAA 2Z7FE 3LC3A 2ZA5A 1C5QA 3RU4T 1PQAA 1DM4B 1YLCA 1ZSJA 3EA9A 3BTGE 1JIMA 4Y10E 2ASUB 2EQNA 3Q77A 3TLOA 4DJZB 3HATH 4ISHH 1YY3A 3BF6H 2WPIS 1E38B 5F8XA 4FXGH 4INHA 3KYFA 1C5WB 2ZDMA 3PRBA 4CRAA 2AS9A 4Y79A 2ZFSA 4K1SA 3ZVDA 2PP6A 3VB7A 3KIDU 3PMHB 2PSYA 1O36A 5C0UA 3UPEA 1CA0C 1S85A 1E1QD 3ZZCA 2C93B 2W7SA 1V2LT 2C8XB 5C67A 1V2UT 4ZHLU 2WPLS 2DE9A 1QURH 2F91A 4MNVA 4P00A 4CRGA 3P92A 4GCHG 2VIDA 1H9IE 4FU8A 1NFUA 2EA3A 4GAWA 3IWMA 3A89A 1PPZA 3BN9A 1QA0A 1SGCA 2VVUA 4JZIA 3STIA 2R9PA 3FANA 3A8DA 1BTPA 1A5GH 1N8OB 1O2SA 3GDUA 2BY6X 4GLYA 1ELVA 1O3BA 2PFEA 3A8AA 2EI6A 1G32B 3VGCC 2ZU4A 1D6WA 1AGJA 4U30A 4OGXA 1AVGH 3SNAA 2FI5E 1SPJA 2PV9B 3NK8A 1O35A 1NN6A 3TVJB 1SR5C 1TWXB 1VR1H 1AFEH 3M36A 1HYLA 3BEFB 4GUXA 2BD7A 4BXWA 2THFB 2AMQA 3UAIC 2P3TB 3SUGA 3ESTA 1ANEA 2OTVA 1LKAA 1P2NA 5EQSA 4ESTE 1MD8A 3MWIU 1O2GH 2B0FA 1TQ7B 1C5XB 2YMSC 4M9FA 1THRH 1XKAC 1TMTH 1QGFA 4Y7AA 1XVMA 2AH4X 2VWLA 1LVOA 3BTWE 6CHAC 3ZYDA 4ZXYH 1QQUA 2O8LA 3EYDA 3BTHE 1SGFG 2BDHA 5LH8A 3GCNA 3QTVH 2D1JA 1CHOG 2ZGHA 4TT3D 4AFUA 3ELAH 1WYKA 1BQYA 1DFPA 3B9FH 2F83A 5IDKA 4CR9A 2GJGA 4YESB 3CS7A 1A2CH 4X1NU 1TBQH 4X6NA 5L2YH 1SGNE 1QBVH 3U28C 2D2DA 3SU1A 3N7OA 3T27A 1UTJA 1T4VH 3HKJB 1CT4E 4HGCA 2GZ7A 1V2VT 4FUIA 5FCKA 1NROH 4K1TA 6ESTA 3RXHA 1UHBB 1GL0E 2QE7D 1ARBA 1UVTH 3DSPA 1LHDH 1TX8A 5DP7A 1FDPA 3V0XA 4ABIA 1TNGA 1SLVB 1BTUA 2L6OA 3A83A 3TK6A 1MTNC 2ZU1A 4WF8A 5E2OA 2Z94A 5FAHA 1PQ7A 5DGJA 1C1NA 4Q80A 3S69A 4ABDA 2QF0A 1IQHA 4YM9A 1ZHMA 2KFWA 2J9NA 3O8DA 5J4QA 5EOKA 1DX5M 2ZCHP 3LDXH 3TGIE 4FVBA 1NPMA 1DWEH 1QJ7B 2Z9KA 2J92A 4WH6A 1G2MA 1TPSA 1DLEA 2OQ5A 4AFZA 1XUJA 1AZZA 1ELBA 1TOMH 4SGAE 2ILNA 1TA6A 1DPOA 3P70B 3SU2A 3UUZA 1SGDE 5T6DA 3PLPA 2JKHA 1O2YA 3ATMA 2BZAA 2ZC9H 1MTVA 1C5ZB 5EJZA 2JDID 1Z6EA 1PQ8A 1INCA 3QZRA 4AOQA 5EXMA 3GDSA 2VVVA 3L3TA 3VB5A 1H4WA 5LGOA 2XC0A 4X1QU 1G37A 3EGKH 2SGEE 2CV3A 2F9BH 4WH8A 1ZMNA 3DSOA 3KEEA 1F5LA 3QGNB 5DO4H 4FUFA 5H4IB 4Y7BA 1L1JA 4WMFA 2Q6GA 3SGBE 3A7VA 1ZJKA 4NIXA 1GBJA 1HCGA 4YTAA 1TIOA 2ZGXH 3TK9A 3BTEE 3HGNA 1MUEB 1GHAG 3SJOA 2ZHFH 4KTSA 1MKXH 4ISLA 1NRNH 4ABJA 1L1GA 1G3EA 1BMMH 1FONA 1S83A 5C17A 1SFQB 4O03A 5DKMA 1AIXH 5C2ZA 4X6MA 4OS7A 1KSNA 3RXJA 3PROA 1WCZA 1G9IE 4KKDA 2Y6TA 4D7GA 1GMDF 2A4GA 3NCLA 3WWFA 3ZIAD 1BIOA 3LH1A 4NZLA 1C9PA 3PTNA 4XD7D 2BXTH 1K0HA 1QL9A 1MU6B 1O2VA 2UWPA 1WSSH 1NTPA 4AB8A 1MKXK 3RXBA 4A7IB 1E1RD 2VWMA 1TAWA 5FPTA 5GPIB 1SLWB 3LOXA 4F55A 4NFEA 1W0KD 1DY8A 1P05A 1AVWA 2R0KA 3SN8A 3MI4A 3SUDA 1SGEE 4NIYA 5SGAE 2C8WB 4Z6AH 2VBCA 4FUDA 1C5OH 1P2KA 4BAHB 1OP0A 2R2WU 3BTQE 5E2PA 1SBWA 3OY6U 2ESTE 1Y5BT 1EXFA 2BXUH 3GY4A 1S0RA 4ZCNA 1WV7H 1KTTB 2BDIA 2ZGJA 4IMZA 4DIHH 1F0RA 1ANDA 3RXDA 3D23A 1P06A 1P09A 4Y0ZE 2ANWA 4MPWA 2P3FH 3K65B 3GOVB 3TK5A 2JJ1D 1P2JA 1K28D 2SNWA 2IJD1 1FNIA 1BT7A 2XTTB 2JIZD 1ZLRA 3U8TH 1IQGA 4P02A 2FOFA 4F4OC 1MH0A 3CENA 1GI3A 1P2QA 7KMEH 1K1PA 2ZNKH 4ABFA 1C1WH 4M7GA 4NSVA 1EJNA 2HVXA 4INLA 1NFWA 1C2FA 2ANYA 1ELDE 3EAJA 1O30A 1KY9A 1XUFA 1GJDB 3RXMA 1C4U2 4K8YA 3A84A 2ZPQA 3OX7U 4I8HA 5T6GA 1O31A 3MOCA 1O5GH 2BYAX 1GGDB 1CGIE 5L30H 1TGTA 2ODPA 2W6JD 3A7YA 3NPSA 1HNEE 1F5RA 3RXKA 5C1UA 4YLUA 1EOJA 5A2MH 2ODQA 2VH6A 3FP6E 3W95A 2CF9H 3GY3A 2PKSB 2F43B 2K0QA 2OCVB 1DITH 1K1IA 4BTIB 2G4TA 5EJ1A 5TCAA 2GCHG 2Y5FA 1TLDA 4I32A 3K2UA 2XNDD 1GVZA 2W7UA 2RA0A 2SFAA 5GCHF 4O3TA 3SBKA 2XWAA 3BEIB 1GBBA 1W12U 2ULLA 4YLQH 1O3AA 1RFNA 3MU4A 3FFGA 3MYWA 1LVMA 3F3BA 5K7RA 1ZOMA 5DP8A 2C3SA 4TWYA 1FY4A 3G01A 3UB0A 3SNBA 1YKTA 3UY9A 3ZV8A 2WPKS 3ZZ8A 3SNEA 1TB6H 4YT7H 2ZHWH 3SYJA 2G4UA 3LJJA 4IN1A 1T8LA 3BTME 4GCHF 4Q7XA 3UOPA 2KAIB 1TGSZ 3SJ9A 2A7CA 1HGTH 5FCRA 1CA8B 1N8OC 1SL3A 3P8OA 1TA2A 3GYMA 3P17H 6GCHG 4PROA 1A4WH 1UTKA 2SGPE 3S9BA 1QB9A 4ABGA 5C5OA 3S9AA 2OBOA 2BB4A 3I78A 3ZVAA 8GCHG 1ZPCA 1OWKA 2G00A 1JBUH 4FU7A 2WHXA 4RKJB 4Y11E 5ABWA 1YYY1 1D3PB 1T31A 3T5FH 4A5TS 2SGDE 1T32A 3UFAA 1WTHD 4X8SH 3ATIA 5E0HA 3SW2B 1SHHB 2BY8X 1BTYA 2D8WA 2ZFPH 3E8LA 4NIVA 1O2LA 5ESBA 1GJ8B 1BRBE 4Q7YA 1RTLA 5FX6A 3TGJE 1QFKH 5J4SA 2J94A 1DT2A 1D3DB 1AWHB 1SLXB 1UCYE 2P59A 4NA8A 3T25A 5JBCS 1VGCB 5GDSH 1HJ8A 2CMYA 2VGCC 1HAVB 1YGCH 4AG1A 3F6UH 1C1VH 1Z1IA 4I7YH 1O38A 3MH5A 1TE0A 2FS8A 1HRTH 1TQ0B 2FXRA 4DURA 2A4RA 5DSFA 4JYTA 3TH3H 1CU1A 1Z8RA 2W26A 3GY8A 2WYGA 3RXUA 4MQAA 1F2SE 1CVWH 1GMHG 4A1XA 3RMOH 2PLXA 3BV9B 4RI0A 3P8GA 4WXIA 3T2NA 1MABB 2PGBB 2PUQH 5FBIA 1SI5H 1VJAU 4AG2A 4HG6A 1T4UH 2V3HH 3FP7E 1EP6A 5IYTA 3U9AH 1C5UA 1FQ3A 1MTUA 2QN5T 1EKBB 2H5CA 4BNRA 4E05H 4TPYA 4GHQA 1O3LA 1C2LA 2XXLA 4Z1MD 3VPKA 4A92A 1FXYA 1Y3YA 5LPFA 4Y71A 3ODDA 4AN7A 1O3EA 2C8YB 5HM9A 4YOIA 2VIPA 2A7HA 2F9UA 1BMNH 5DP4A 1FIZA 1EJAA 2CGAA 1O3IA 1WBGB 1TFXA 1QY6A 2ZCKP 2OBQA 2C90B 4MVNA 3TNTA 1BDAA 1XUKA 3FN8A 4AB9A 1P57B 1O5DH 4NCYA 1CGHA 3K6ZA 1OPHB 2HGTH 2I6QA 1DANH 1NO9H 3ZV9A 1SG8B 2A7JA 4HFPB 4AZ2B 3VFEA 3KGPA 2ZTXA 4YXWD 1MTWA 5GNDA 1WTGH 5DPAA 3UNRA 1MTSA 2OC8A 3NRLA 3RLWH 1IHSH 4AORA 4AFSA 5BRRE 1GJAB 2XWBI 3RMMH 1QR3E 3PWBA 1U6QA 3RMLH 1FAXA 3MNBA 1D6RA 4XOJA 1NFYA 3RM2H 1PJPA 1IQFA 4OS1A 1V2NT 1P9UA 3RP2A 2GDEH 2RDEA 2WPHS 3LU9B 1QTFA 5CDFE 3QWCH 5A0BA 3WWBA 2GVFA 1O2XA 1AUTC 2ALVA 3T62A 2VIQA 5EXNA 3CP7A 4J1YA 1T8NA 4B75A 2LP6A 1PYTD 1TPAE 2ZECA 3U1JB 3ZVCA 3VB4A 5DP6A 1X7AC 3VEQB 2FX6A 3MO6A 2FS9A 1ARCA 1TMBH 1SGRE 2FWWA 1HAVA 1Y59T 1W2KH 3A86A 1IQIA 1UTOA 3HPTB 1BUIA 1S6FA 1O34A 1QRZA 2TGTA 1MBQA 1TNLA 3QDZB 2Y5HA 1GI9B 2CXVA 4ABBA 1P8VC 4IC6A 1EB2A 1XUIA 3VG8A 2Q6FA 1CQQA 1QRWA 4FVDA 1LMWB 1Z6JH 1GG6B 1ZRKA 1LPGB 5B6OA 4BTUB 4OS4A 4Y76A 3A7WA 2JJ2D 1UVUH 2XCNA 1L2EA 5E0JA 1QB1A 3TU7H 1C1PA 1E79D 4ZMAH 3S7KB 2NU3E 2YOLA 1GMCG 1A0LA 1VCPA 2EY4C 1FMGA 2GMTB 1L0ZA 2OC1A 4KELA 1JXPA 1K22H 2B8OH 2A5KA 3FP8E 3SGAE 3L6PA 5EXLA 5HKKD 4A6LA 1V2TT 3PB1E 1AVXA 4TYDA 2FI4E 2GTBA 2XOKD 3EE0B 1DOJA 4TWWA 1KXDA 3BEUA 1P2IA 1FPHH 4OS2A 1EZXC 3LGUA 1GBTA 3PLBA 3PLKA 3RLYH 4O9VA 1C9TA 1O2QA 2BY7X 5CHAB 2UUKB 4Y0YE 1HLTH 3ZZ5A 1ETTH 2ZKSA 1Z8GA 4X8VH 4AGKA 3H7OA 1UVSH 3GCTF 3RC6A 3AW0A 1RTKA 4KP0A 4XDEA 2P93A 2R3YA 1TRNA 3MQKC 1LQDB 2HPQH 1K1OA 4NGAH 2M5TA 3E6PH 1A3BH 5HYOA 1P03A 1DSTA 2XYAA 1O5CB 2O8WA 3A7ZA 2FPZA 2Z3EA 3A85A 4FU9A 1MD7A 2ZFFH 2ZHQH 1UTQA 2GT7A 1PFXC 1SGTA 5FBEA 1MBMA 1FI8A 2G51A 3LGWA 3MMGA 2BLVA 1C5TA 3RM0H 3E3TA 4FUHA 1KIGH 1MCVA 5HM2A 2STAE 1OP8A 1W3CA 4RKOB 4CRBA 5EQRA 3RDZA 2BY5X 2WPDD 3MO3A 1GWAA 1GCTB 1E36B 2V6NA 3ZVEA 2EI8A 1DICA 1K1LA 3RXFA 3U69H 1O2HA 5A8XA 2QA9E 1SGYE 5JB8S 1AHTH 2FTLE 1UVOA 3D49H 5GXPA 5GWZA 4JZDH 3HK6B 3RXLA 9LPRA 1K1MA 4DT7B 2FMJA 5L2ZH 3SQEE 1XKBC 3ATLA 2XBWA 3SU6A 1TNIA 2NU2E 2A2QH 3L33A 2AIPA 3AAUA 2NU1E 5AFZH 1UJ1A 3U8RH 2F9NA 1DWCH 2ZU5A 4VGCB 2BX4A 1ETSH 1MAYA 3A8CA 3MH7A 1Z71A 3A7TA 3I77A 1SGIB 1AZ8A 2KCPA 1O2IA 1G3BA 2TGPZ 5C1YA 1UO6A 3M3VA 1DVAH 1O2JA 1ZPZA 3RXGA 4F48B 1QJ6B 4O97A 1BTZA 4Q4LA 1ANBA 1HJAB 4YO9A 1OOKB 3LKWA 1LHEH 2G81E 2Y7ZA 2J34A 3A87A 3NKKA 4X1RU 1O3NA 1V2JT 4H4FA 2BD2A 5T6FA 1F0SA 1C2IA 1LPKB 3RUOA 1HUTH 2AGIX 1AB9B 1JRTA 2A2XH 3OAAD 1GI6A 2ZO3H 2ZPRA 4MPUA 3A80A 4DG4A 1KXEA 3BTDE 4IS5A 3RU4E 3NUMA 1T8MA 4NA7A 4H42U 2EI7A 1A61H 3MH4A 1P2OA 1J15A 4LK4A 3SNCA 2HOBA 1O5BB 1FLEE 1V2KT 1YPGH 1LQEA 1ZJDA 2FM2A 2V3MA 3M37A 3SJIA 3M61U 3SU4A 1KDQB 2BD5A 5A8YA 4UDWH 3TJUA 4NSYA 1B0EA 2O9QA 2RCEA 4JYVH 1J14A 1GMHF 2WPMS 3DSGA 4BAQB 1DUEA 2BDCA 1K2I1 1MKWH 4NWLA 1Z8JB 2SNVA 2ZTZA 2F9OA 5DK1A 3ZZ3A 2A1DB 2GP9B 1A3EH 5EGMA 3MU1A 3F9EA 3GY7A 1Z8IB 1J8AA 3VB6A 1Y3VA 5DP5A 1W7GH 1ZSKA 1MQ5A 1MMJN 2QV1A 4K69A 2FLBH 2ZU2A 4I86A 2OLGA 3DT0H 1RRKA 3FVFB 2QY0B 7GCHG 5FL7D 5T1VA 3U98H 3GICB 4MPXA 3RXOA 1UTPA 3ODFA 4OM9A 2BD4A 3BG4B 2C4FH 2FOCA 1O2RA 4J2YB 4O3UA 3OTJE 5ETXA 2ZHEH 3O8RA 3EA7A 1MKWK 4DVAU 3P8NA 1BCUH 1TNKA 2V35A 3GY5A 3K9XB 1C5PA 4ZH8A 5F8TA 1BZXE 3QK1A 1W8BH 7ESTE 4SGBE 4OGYA 1Z1JA 1GBAA 1PPHE 1V2OT 1AU8A 1EAWA 1C1UH 1WUNH 1ZTLA 1FY5A 1AI8H 4X2XA 1NRQH 1QZ8A 1F5KU 2RDLA 3F2HA 3TJNA 1HBTH 1RD3B 2A31A 4FETA 4X2WA 3GY6A 6LPRA 2BX3A 2D26C 3AW1A 3SJ8A 2IOTA 2AYWA 4TSFD 1VITF 2W5EA 1V2ST 4NG9H 1TPPA 4INKA 4BXSA 2H6MA 1MAXA 1UHBA 2WINI 4U2WA 4XSKU 1GHYH 1EUFA 1C1OA 3FO8D 1T8OA 4WMDA 1GHXH 1ZPBA 5C94A 3LIWA 3MNSA 1BJUA 4BAOB 4ZKOU 1O32A 1CHGA 4MNWA 1AN1E 4ACAA 1K1JA 3BIVH 4XE4A 4FUGA 1GI1A 1QJ1B 1GBKA 5IK2D 1XMNB 4KTUA 3N7EA 2BTCE 3UREA 2BQ7B 3SO3A 1LCYA 4B74A 1IOEA 1GHBG 1O3OA 1B0FA 1HAXB 1W0ZU 1FUJA 5F8ZA 1BRAA 2BY9X 2QXJA 1EPTB 1W0YH 4THNH 1MZDA 1CA0B 1GPZA 3UR9A 1NRPH 3LONA 4K2YA 2LNCA 4JK6A 1IQJA 3M7QA 1C2EA 3EE7A 1KXAA 1EOLA 3D65E 3F9FA 1AWFH 1V2PT 1C2DA 2AFQB 2A4OA 2C8ZB 1P0SH 3GDVA 4ASUD 2XCFA 2HNTF 1SGPE 1TMUH 4FUJA 1DXPA 3ZZ4A 4RN6A 1V2QT 2R2MB 3M7TA 1BTHH 1EB1H 2GCTC 1OWDA 3ATWA 3Q3KA 3VGCB 3ZZ9A 3QLPH 1O37A 3Q00A 3EA8A 1GI7B 3GS9A 5EW2H 1O3DA 3M5NA 4RT0A 5JDUB 4K8BA 1GHVH 1LDTT 1FX0B 2ZF0H 1KDQA 1EJMA 1L4DA 4K1EA 1FY8E 2J97A 2BHGA 1ESBA 3MU0A 1H8IH 1WXRA 1P3CA 2V0BA 2L74A 5ESTE 2G52A 1F7ZA 1ELGA 1KXCA 4MPVA 1LVYA 1HXFH 1NRRH 2V7QD 1O5EH 2P95A 2BLQA 3ZZ6A 2ZI2H 1G3DA 1SLUB 2QXIA 2XRCA 2FOEA 4BANB 6CHAB 1XXFA 4BTTB 4MLFB 2VIOA 5EPNA 2LELA 4IBLH 2FESH 1UW7A 1C2JA 3F68H 4IGDA 3Q3XA 1OXGA 1SHYA 1C1SA 1O3JA 2ANKH 3BTFE 2WYJA 1ID5H 1RGQA 3BG8A 1QL7A 4NFFA 1SGFA 1D9IA 4B76A 2OP9A 3UQVA 1ZSLA 5CHAC 5B6LA 1O2WA 3AAVA 1AKSB 2RA3A 3KQCA 2Q1JA 3PMAB 1YBWA 2P94A 2QAAA 2OQUA 2ZDNA 3LH3A 3M5MA 3STJA 1TNHA 1AE8H 3PO1B 2GGVB 4ABEA 2J95A 4FOUC 4UE7H 3KL6A 1VZQH 1P3EA 5E8EH 1E35B 1SOTA 2OUAA 1ZGVA 2TPIZ 1M9UA 1UTMA 2BQWB 3SORA 3FKSD 1EZUC 5EJLA 2BQ6B 5FXLA 2VNTA 1C5MD 4FUBA 1NM6A 5A09A 2W3IA 2Z3CA 4CH2B 1A5IA 2QXHA 3HK3B 2G8TA 3C1KA 3IITA 4HI3A 1CHOF 2GX4A 2JH0D 1O2UA 2TGDA 1O2TA 2BD3A 2QGRA 4H6TA 1ZMJA 1QIXB 2B5TB 1BBRH 5C20A 1EPTA 1O0DH 2CF8H 2H1UA 1NU9A 1IQMA 1OWJA 8ESTE 2EC9H 1VCWA 4FUEA 1TGBA 1KXFA 1C2GA 4JCNA 2Y82A 1VCQA 4XRNA 1NS3A 5AFYH 5G4BA 1OSSA 2HNTC 4Z0KA 1GJ9B 2QIQA 4Q7ZA 3SQHE 3WW7A 2ZZUH 4X6OA 1SC8U 4ZAEA 1CT2E 1GBDA 2ZCLP 4JZEH 1BMLA 2HLDD 2YMSD 3ITIA 5EU8A 5HGGA 1F92A 3SJKA 2RG3A 1BBRK 2G5VA 2DE8A 2Z9JA 3JZ1B 1L4ZA 2K1QA 1YCPH 4LXBH 3RXTA 4VGCC 3MH6A 3SV7A 4D7FA 1HB0B 5F53A 2VWNA 4D76A 2Y7XA 4X0WU 4K60A 4MNYA 1GI8B 3MHWU 1XM1A 4UFFH 1MZAA 4I8GA 3TJOA 1CE5A 3LT3A 3BTTE 3RXQA 3KQEA 1T7CA 1HJAC 4OS5A 1CSOE 1GMDG 3P8FA
chains in the Genus database with same CATH topology
2FOBA 3SUEA 1ZTJA 2GKVE 5F03A 2VJ1A 1ACBE 2EEKA 2FX4A 4JYUH 1N6YA 1SQAA 3BSQA 4AYYB 1S81A 1YLDA 1AB9C 1FN6A 1YCPK 1D3TB 3JZ2B 4B71A 3M5LA 1TBZH 2WV4A 1O2MA 3SHAH 1LVBA 2HLCA 1GI2A 3URDA 1DSUA 4K5ZA 3T28A 2XC5A 3PV4A 1Y5AT 1G2LA 1EASA 2KAIA 3LC5A 3RXIA 3GCHB 1ABJH 3TH2H 1O3FA 1XUHA 3M35A 4F49A 3PM3A 3RXVA 1MCTA 1KLJH 4GSOA 1NRSH 4DIIH 4JZFH 3UIRA 5JB9S 4CREA 3BTKE 5LPRA 3NWUA 4CHAB 1GHAF 2BDGA 1TOCB 4UFGH 2CHAB 2BD8A 1FIWA 2VWOA 3LGTA 1YF4A 1YPMH 1CBWB 1OP2A 1BITA 1PPBH 4X1PU 2FOMB 5T3HA 3TIUA 1J16A 5A8ZA 1S6HA 7GCHF 4CBOA 5AVDA 1ELTA 5DG6A 1S82A 3E91A 3ENSB 1J17T 2TIOA 1JRSA 3ZVGA 1FZZA 1Q2WA 4ISIH 1GI0A 1CT0E 2A5IA 3T26A 3A88A 2H9EH 3EDXB 1UMAH 1A1RA 4ISNA 3SU5A 5C1XA 5JBAS 2QF3A 1DUAA 2SGFE 1YPHE 2F9PA 2O8TA 3RXRA 4LOYH 1ESAA 2JETB 3OU0A 3E1XB 3MO9A 2GV6A 1C1MA 1HFDA 4AGJA 1ORFA 1YPLH 3EQ0H 4E06H 2NU0E 2PSXA 2IJOB 5A0AE 2O8MA 2ZFQH 2AGEX 2VH0A 3SNDA 5GJ4B 1RIWB 1WU1A 1Y3UA 2ZFTA 5DP3A 5EQQA 2DUCA 1RJXB 2FOGA 4ASHA 1OKXA 1NC6A 3H5CB 1G30B 1V3XA 4YZUA 2AIQA 2BDYA 5L6NH 5GCHG 1ETRH 5EG4A 1XUGA 1C5SA 1SMFE 3VXEH 1C1TA 4AFQA 1YCPM 1GJBB 4UONA 1EAXA 1GVLA 3QTOH 3K6YA 1NU7B 2A5AA 1GHBF 1YP9A 3RU4D 1EPTC 1TABE 5CMXH 4MTBA 1RS0A 1ZHPA 4B2CA 5EW1H 1IAUA 3GY2A 1AO5A 2HWLB 2JH6D 5GIBA 3MU5A 1DLKB 1DY9A 2Z9IA 1VITH 2BOKA 1J9CH 3KF2A 3U8OH 2LPRA 2F9VA 2UWLA 1JWTA 1YPHC 4YT6H 1GGDC 2Z9GA 1HAYB 3E90B 1BMAA 3IG6B 3QX5H 1BA8B 4UD9H 1C1RA 1B5GH 3BIUH 2PKSC 1QNJA 4BOHA 1GBHA 1C2MA 5JBBS 4JZ1A 1C5LH 4I8LA 2J4IA 2UUFB 2YNBA 2GCHF 3TH4H 3H7TA 4HZHA 2A0QB 4D9RA 4I8KA 1P12E 1K21H 1TNJA 1DWDH 1A46H 1GJ7B 1K1NA 2VIWA 2ZDLA 3LGVA 4ABHA 2IPHA 1GI4A 3KHVA 1N6XA 2IN2A 3TJVA 5C3NA 1QHRB 1LKBA 2H9HA 1YM0A 2VGCB 1FPCH 1HDTH 4ZXXH 1AFQB 1WQVH 2FTMA 4CRCA 1AD8H 1ZZZA 1P04A 2UUJB 1A5HA 5HMAA 1Q3XA 1E0FD 1TX7A 2BD9A 4D9QA 2UUYA 1OS8A 2AGGX 3M3TA 3PWCA 3PMBB 1JMOH 1BBRE 6GCHF 1KYNA 2SGQE 3W94A 1HPGA 4CRDA 1LHGH 8GCHF 1BHXF 1SOZA 2B9LA 2P16A 1O3MA 3E0PB 5A0CA 4MDSA 1S0QA 1GHWH 2AERH 5TCCA 1ZR0A 1YPKH 3SU0A 1CGJE 4I31A 2P8OB 2Q6DA 1DS2E 1IQNA 1Y3WA 1BRUP 4B2AA 3PO1C 1YPEH 3MTYA 1UCYH 2TBSA 4D8NA 3E16B 2GZ9A 4CBNA 4JK5A 3RXEA 1PPEE 3A7XA 1XX9A 1GJ4H 1E34B 1EAIA 2NWNA 1SSXA 1HJ9A 1VGCC 4XBCA 5CE1A 2FP7B 1TYNA 1C2HA 2PUXB 3O8CA 2ZIQH 2R0LA 3GCOA 4A1TA 4Y8XA 3R3GB 2A32A 3SZNA 1GDUA 1GJCB 2PKAB 2Z9LA 3S0NA 2ZFRH 1C4Y2 4KTCA 1UCYK 4X8TH 3UR6A 5E0GA 1PYTC 2H9TH 1K9OE 3AASA 1C4V2 1UVPA 4BAMB 1AY6H 2WUBA 3FZZA 3TNSA 2WPJS 2FO9A 2TGAA 8LPRA 5EODA 4GHTA 2V3OH 2ZPSA 8KME2 3ZVBA 1VJ9U 1S5SA 2NU4E 4DCDA 1V2MT 5DP9A 1AMHA 2ZGCA 1MQ6A 4WMEA 4GPGA 1O5AB 2ZQ2A 3DUXH 1HIAB 3SGQE 3VXFH 2XW9A 1OWHA 1C5RA 1PPFE 2OD3B 1LHFH 2J38A 2VB0A 5AHGH 5FHTA 1Y3XA 3SI3H 3TGKE 3F9HA 1F0UA 4UFEH 1ZTKA 4E7RG 1O33A 1GDNA 2BZ6H 2P3UB 1BRCE 2BVSH 1W10U 2ANMH 1QQ4A 3SV9A 1UTNA 1BTXA 1ZHRA 3A8BA 1WQSA 2PW8H 3MNCA 4Y8YA 1GL1A 2CN0H 1O3HA 2OC7A 2VIVA 1O39A 4K3JA 3M5OA 3RXPA 1TRYA 2QXGA 1DXWA 2FOHA 2JH5D 2BDBA 2UWOA 2GD4B 4QT8C 4E7NA 2F3CE 5I46H 3E0NB 3SV6A 3A81A 3DFJA 2ZDAH 4XBDA 1ABIH 1IHTH 1O2NA 1GBLA 1A0HB 4NWKA 1V6DA 1KLIH 1QL8A 2WUCA 4KGAA 3GCHC 1GJ6A 5LPEA 1Z7KA 2G5NA 2STBE 2XBYA 1WAYB 5JPMH 3OYPA 4AX9H 1O3CA 1P11E 3HGPA 1IQLA 3Q76A 4CHAC 3QZQA 3OY5U 1CSOE 2CHAC 3SHCH 2PWXA 3T29A 1P10A 1XXDA 5JYIA 1A7SA 1CBWC 2J2UA 2VU8E 4RSPA 2PTCE 3UQOA 2ZEBA 1TPOA 2ZQ1A 3DA9B 1UK2A 3UWJH 4I8JA 4MNXA 1TALA 1EATA 1W7XH 2OXSA 2VVCA 2G55A 2PGQB 3SV8A 3V12A 2FDAA 2BVXH 2ZGBH 2GT8A 1P02A 2FZZA 1GBFA 1QA7A 1N1LA 2AMPA 3UNSA 1SQTA 4CH8B 1SFIA 3ZZAA 2PKAA 1V2WT 3FAOA 4H6SB 4WWYA 3GCTG 1FAKH 1THSH 2HPPH 4XBBA 3U1IB 2JETC 3URCA 5JBTA 1ESTA 4TPIZ 3KN2A 5HXFA 1DE7H 1LO6A 4AYVB 3KCGH 1Y8TA 2ZWLH 4DY7B 1BTWA 3LPRA 1GG6C 3PTBA 2GZ8A 2W3KA 4ZHMU 2Y5GA 1RIWC 2FYRA 1LTOA 3V7TA 3SOSA 1MU8B 1EZSC 1TONA 3PYHA 1ELCA 4DOQA 1H1BA 1EP5A 2BLWA 1GMCF 1A0JA 4FUCA 3ATKA 1HAOH 1Y5UT 3RXCA 1HIAA 1W11U 1W13U 1ZGIA 2GMTC 5EPYA 2VINA 1HAIH 2FIRH 1GCDA 3B8JA 3WY8A 1GBCA 4X8UH 3UTUH 4IW4E 2QC2A 1ANCA 1ELAA 2ALPA 4ZUHA 3SV2H 1AUJA 2HNTE 3DHKH 5F6MA 4NIWA 1UK4A 4ZKSU 1HAPH 2H2ZA 4Y8ZA 1RTFB 4JMYA 3TITA 3M3SA 3UOUA 4A1VA 1OYQA 2Y80A 1V2RT 4TY6A 3I29A 3QGJA 2Z3DA 1F0TA 2HRVA 3QUMP 1MTNB 4IN2A 3RC5A 4X6PA 1BOQA 1HV7A 4IC5A 2FYQA 3MNXA 3ZVFA 1KXBA 2BDAA 1QBNA 4ZROA 1BJVA 3NZIA 1B7XB 1ELEE 1O3PB 1NFXA 1QRXA 1FJSA 4LZ1H 3C27B 1D3QB 1LPZB 2CJIA 2Y81A 1OYTH 3P6ZB 3LGIA 2ZTYA 2GV7A 4MG3A 3TPIZ 1HAGE 1BB0B 3QN7A 7LPRA 1HXEH 1GBMA 2XNIA 4XFQA 5FPYA 3KNXA 1O2OA 5K0HA 4OS6A 1D4PB 1GCTC 4CR5A 4X1SU 2QYIA 2ZDVH 1XVOA 3ZZ7A 4IMQA 5TJXA 1SB1H 1IQEA 1O3GA 3CS0A 1AFQC 5I25A 4GVUA 3F9GA 2PR3A 4TY7A 3O8BA 4ISOA 2PTNA 3V3MA 3ZZBA 1FY1A 1NESE 2FOAA 9ESTA 1H8DH 3RXAA 1DWBH 2ZHDA 3M7UA 1GHZA 4HTCH 1C5VA 3P95A 2FLRH 2PHBA 3MU8A 1SQOA 2Z6BD 3DFLA 4NZQA 1O2KA 5C5NA 4X2VA 3VB3A 1P2MA 1AQ7A 1P9SA 5PTPA 4BAKB 2A4QA 4DW2U 2FODA 4R8TB 1HAZB 4WXVA 2P8OC 1QB6A 4CRFA 3B23B 1AE5A 3LJOA 1RXPA 1G36A 1C1QA 3AVZA 4NA9H 3SI4H 1GBIA 1H9HE 2XBXA 2BM2A 1GBEA 3Q3YA 2AEIH 1YPJH 1KTSB 4WJG2 4R0IA 2BMGB 3SUFA 2ODYB 5FPSA 2FEQH 3DD2H 1FN8A 4B2BA 3MFJA 4U32A 1LHCH 4YOGA 2TRMA 1PQ5A 4B1TA 1GJ5H 2ZG0H 1OWEA 1EAUA 3RC4A 1TRMA 3OSYA 1Q31A 5BPEA 1S84A 1JOUB 1OX1A 3GISB 1PPGE 5FX5A 1C5NH 1H9LB 2OINA 3F1SB 3ZYEA 1TGNA 3UWIA 2B7DH 4DGJA 4WY3A 1SVPA 4X2YA 1G3CA 4B73A 2R3UA 1QBOA 1VITG 2XC4A 4U01A 3ZZDA 3S7HB 2HALA 1EZQA 4WVPE 1BHXB 3KQBA 2YNAA 3QO6A 2XBVA 1AKSA 1TX6A 1ZMLA 1ZRBA 1L1NA 1SGQE 3R0FA 5DJ7A 4LZ4B 4UEHH 1C5YB 2GDDA 1FY3A 1TBRH 2ZDKA 3LGYA 2BVRH 1O2PA 2ZP0H 2O8UA 1FV9A 1HAHH 1O2ZA 2SGAA 1NZQH 2FI3E 3BG4C 3RMNH 3UNQA 2A45B 3NXPA 4ZKRU 3FZDA 1GI5A 1UTLM 1EX3A 1JIRA 1WOFA 1O3KA 2WV5A 2OC0A 1O5FH 2QCYA 3PMJA 2AMDA 4Q2KA 3V13A 4I33A 1NT1A 4ZKNU 1E37B 1PPCE 3SU3A 2BLOA 1CO7E 4ABAA 1KLTA 1ELFA 1ZYOA 4Y6DA 1P01A 1TGCA 1GDQA 1C2KA 1QCPA 2BOHB 3S9CA 1NY22 1IQKA 3KQDA 3GYLB 3D62A 4UFDH 1DDJA 1W14U 3HKIB 1YC0A 4YOJA 2GCTB 1EQ9A 1UK3A 1GVKB 1THPB 2ZU3A 2H5DA 5AF9H 2I6SA 3A82A 1OWIA 3RXSA 4ZHAA 2Z7FE 3LC3A 2ZA5A 1C5QA 3RU4T 1PQAA 1DM4B 1YLCA 1ZSJA 3EA9A 3BTGE 1JIMA 4Y10E 2ASUB 3Q77A 3TLOA 4DJZB 3HATH 4ISHH 3BF6H 2WPIS 1E38B 5F8XA 4FXGH 4INHA 1C5WB 2ZDMA 4CRAA 2AS9A 4Y79A 2ZFSA 4K1SA 3ZVDA 3VB7A 3KIDU 3PMHB 2PSYA 1O36A 3UPEA 1CA0C 1S85A 3ZZCA 2C93B 2W7SA 1V2LT 2C8XB 5C67A 1V2UT 4ZHLU 2WPLS 2DE9A 1QURH 2F91A 4MNVA 4CRGA 3P92A 4GCHG 2VIDA 1H9IE 4FU8A 1NFUA 2EA3A 4GAWA 3IWMA 3A89A 1PPZA 3BN9A 1QA0A 1SGCA 2VVUA 4JZIA 3STIA 2R9PA 3FANA 3A8DA 1BTPA 1A5GH 1N8OB 1O2SA 3GDUA 2BY6X 4GLYA 1ELVA 1O3BA 2PFEA 3A8AA 2EI6A 1G32B 3VGCC 2ZU4A 1D6WA 1AGJA 4U30A 4OGXA 1AVGH 3SNAA 2FI5E 1SPJA 2PV9B 3NK8A 1O35A 1NN6A 3TVJB 1SR5C 1TWXB 1VR1H 1AFEH 3M36A 1HYLA 3BEFB 4GUXA 2BD7A 4BXWA 2THFB 2AMQA 2P3TB 3SUGA 3ESTA 1ANEA 1LKAA 1P2NA 5EQSA 4ESTE 1MD8A 3MWIU 1O2GH 2B0FA 1TQ7B 1C5XB 1THRH 1XKAC 1TMTH 1QGFA 4Y7AA 1XVMA 2AH4X 2VWLA 1LVOA 3BTWE 6CHAC 3ZYDA 4ZXYH 1QQUA 2O8LA 3EYDA 3BTHE 1SGFG 2BDHA 5LH8A 3GCNA 3QTVH 2D1JA 1CHOG 2ZGHA 4AFUA 3ELAH 1WYKA 1BQYA 1DFPA 3B9FH 2F83A 5IDKA 4CR9A 4YESB 3CS7A 1A2CH 4X1NU 1TBQH 4X6NA 5L2YH 1SGNE 1QBVH 2D2DA 3SU1A 3N7OA 3T27A 1UTJA 1T4VH 3HKJB 1CT4E 4HGCA 2GZ7A 1V2VT 4FUIA 5FCKA 1NROH 4K1TA 6ESTA 3RXHA 1UHBB 1GL0E 1ARBA 1UVTH 1LHDH 1TX8A 5DP7A 1FDPA 3V0XA 4ABIA 1TNGA 1SLVB 1BTUA 3A83A 3TK6A 1MTNC 2ZU1A 4WF8A 5E2OA 2Z94A 5FAHA 1PQ7A 5DGJA 1C1NA 4Q80A 3S69A 4ABDA 2QF0A 1IQHA 4YM9A 1ZHMA 2J9NA 3O8DA 5J4QA 5EOKA 1DX5M 2ZCHP 3LDXH 3TGIE 4FVBA 1NPMA 1DWEH 1QJ7B 2Z9KA 2J92A 4WH6A 1G2MA 1TPSA 1DLEA 2OQ5A 4AFZA 1XUJA 1AZZA 1ELBA 1TOMH 4SGAE 2ILNA 1TA6A 1DPOA 3P70B 3SU2A 3UUZA 1SGDE 5T6DA 3PLPA 2JKHA 1O2YA 3ATMA 2BZAA 2ZC9H 1MTVA 1C5ZB 1Z6EA 1PQ8A 1INCA 3QZRA 4AOQA 5EXMA 3GDSA 2VVVA 3L3TA 3VB5A 1H4WA 5LGOA 2XC0A 4X1QU 1G37A 3EGKH 2SGEE 2CV3A 2F9BH 4WH8A 1ZMNA 3KEEA 1F5LA 3QGNB 5DO4H 4FUFA 5H4IB 4Y7BA 1L1JA 4WMFA 2Q6GA 3SGBE 3A7VA 1ZJKA 4NIXA 1GBJA 1HCGA 4YTAA 1TIOA 2ZGXH 3TK9A 3BTEE 3HGNA 1MUEB 1GHAG 3SJOA 2ZHFH 4KTSA 1MKXH 4ISLA 1NRNH 4ABJA 1L1GA 1G3EA