2A7CA

On the routine use of soft x-rays in macromolecular crystallography, part iii- the optimal data collection wavelength
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title On the routine use of soft X-rays in macromolecular crystallography. Part III. The optimal data-collection wavelength.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Elastase 1
total genus 65
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2a7cA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2a7cA01
2BD2A 1AU8A 1B5GH 1BTUA 5CHAB 4GCHG 1QR3E 4OGXA 2HOBA 3BEIB 4YZUA 3CP7A 3KN2A 4OS5A 2GCTB 1C5SA 1MKXH 1IHSH 3MU0A 1FDPA 1NT1A 2GDEH 1AN1E 1EAWA 3SJ8A 2BYAX 4FUGA 1A5HA 1GBKA 4JK5A 3H7TA 1TMBH 3RXCA 4WMEA 1YC0A 1O3GA 3ZVAA 1V2JT 1O5FH 1AIXH 3PV4A 1CVWH 3BTHE 3EQ0H 1CBWB 1C5WB 5EW1H 4A5TS 2WYJA 1N6XA 1P2IA 3B23B 4WMDA 5I25A 5JB9S 2WV5A 3HK3B 3IITA 3ZYDA 5G4BA 2Y5GA 1UTJA 4MNVA 5T3HA 3LGTA 1SB1H 1AWHB 1DANH 5AFZH 1HV7A 2W3KA 4ZHAA 2CF9H 5LH8A 5TJXA 3F9FA 4IMZA 1YCPH 1DY8A 1D6WA 2WYGA 4TPYA 3L33A 5B6OA 3M5MA 1ZRBA 3FANA 3M3SA 3TIUA 2QC2A 1ZGIA 4IN1A 2XTTB 1SC8U 2OTVA 2VNTA 4Z6AH 2ODQA 2A4OA 3BEUA 2A5AA 1TABE 1QL9A 1THPB 1K2I1 3MO9A 2BZ6H 4D7GA 2V0BA 3UWIA 1UMAH 2XRCA 5EQQA 3RXDA 3SV6A 1W7GH 3TK6A 1LPKB 2FO9A 1ELEE 2J9NA 2HWLB 1EXFA 1RXPA 3O8RA 1NTPA 1D3TB 1VITH 2FOEA 1TALA 5A0AE 5F8ZA 2ZCLP 1ESAA 1T8MA 1WQVH 3SNAA 2Z94A 1O2NA 1H8DH 2BHGA 1EKBB 4Y8XA 3KQDA 5GJ4B 3MHWU 1P04A 1DT2A 1SGFA 3SGBE 2UUJB 1JXPA 3E0NB 5TCAA 2G55A 5JBTA 4Y11E 2J4IA 2ZFFH 1CHOG 1TRNA 3U69H 2F9VA 1O5BB 3KCGH 4U2WA 1A5IA 1OWHA 3STJA 7GCHF 4RKOB 1HNEE 3SHCH 3EYDA 3ELAH 3KIDU 2W7SA 3TVJB 2NU2E 3ZZAA 3RXFA 1GBCA 2D2DA 2CMYA 1WTGH 2QXGA 1C4V2 1MTWA 1BHXF 1TNJA 2VVUA 1SSXA 1C5ZB 5FCKA 2HVXA 4UFFH 3Q77A 1ZOMA 3RXUA 4FUFA 1GG6C 1EAIA 4NA7A 1YPMH 4X8VH 2ASUB 1J9CH 2VINA 1BRUP 1HDTH 2FTLE 2ULLA 4WXVA 5A8ZA 1K21H 1BA8B 4YLQH 1XKAC 4VGCB 1F0RA 4ZAEA 5K7RA 1IQIA 1T31A 2ILNA 1PQ7A 2FYRA 1ARCA 1O5DH 4INKA 4U32A 4CHAC 4JZFH 1MTSA 2IOTA 3T25A 2H2ZA 4NSYA 2P95A 5EXLA 1UTMA 2QXIA 3A7XA 2Y6TA 3ATKA 1NRRH 4MPUA 5F8TA 4CRCA 4AYVB 3HGNA 3RXOA 3SU3A 3RDZA 3KHVA 4HZHA 1ANCA 5JBBS 2GZ7A 4NIXA 3RXLA 1AB9B 2FX4A 2ESTE 1PQ8A 3A7ZA 3M5NA 2F9OA 4GHTA 1JWTA 2AEIH 3DHKH 3UQOA 1GMHF 4KTSA 1Y5AT 3SNCA 3RXEA 1T4VH 1L4DA 1ZTKA 2G4TA 3TLOA 4BAQB 1MTNC 2OC7A 1D3QB 1K9OE 3KQEA 3SOSA 3GCHC 4OS4A 1QTFA 1AVWA 3ZVFA 2FI5E 1V2NT 1EQ9A 3HPTB 1GPZA 2HALA 4FVDA 1TBQH 4MLFB 3OYPA 2V3HH 3S69A 2BD7A 3P17H 2HLCA 3ZZDA 1QY6A 3UR9A 1HYLA 1UVSH 3DFJA 1BJUA 3TGKE 1SHHB 5IDKA 4AB8A 1NO9H 1FIZA 5PTPA 3E90B 1W7XH 3VB6A 1GJBB 4AGJA 1NFXA 4X8UH 1JIRA 1GG6B 5EODA 4JMYA 2D8WA 3A8CA 3URDA 1G32B 2B5TB 5LPRA 5ESBA 3F9HA 4NGAH 2UUFB 1MQ6A 3QGNB 2EA3A 3FVFB 1O31A 2GD4B 2XC4A 2WUCA 3UWJH 1HAHH 5C2ZA 1ZYOA 1MZAA 1O3MA 2IPHA 3RXKA 4ASHA 1O2VA 1TGSZ 4GPGA 1S0RA 3V13A 5C5NA 2ZGJA 3M5OA 4D76A 1G3EA 2VVVA 5FPYA 1Z8RA 3PYHA 1O5EH 1BBRE 3TJUA 2FOBA 3PMHB 4GAWA 1HAYB 1A7SA 2ZDMA 3RLWH 3BV9B 1PJPA 5E0GA 1O2LA 3ZZ4A 2OP9A 1IQEA 4NCYA 3RC6A 4B1TA 1SVPA 2H1UA 1ANDA 1A5GH 1ELDE 1GHWH 1V2KT 1GI0A 3RXBA 1XXFA 4K2YA 1OKXA 1QL8A 3GDSA 2HNTF 3BG8A 1E38B 3VPKA 1SMFE 1HAGE 2ZNKH 1KXEA 2C93B 5GDSH 1EPTB 1IQJA 1WAYB 5JDUB 1VGCC 5DGJA 1ZPZA 3GY5A 2FESH 2P16A 1NU7B 1SPJA 6ESTA 1KSNA 1O2HA 1EB1H 2P59A 3GY3A 2O8LA 4FU9A 3M61U 1KIGH 3PTBA 1XVMA 3SUDA 1ACBE 4YLUA 1AE8H 4B76A 3A7WA 3U8TH 1ZHRA 3LIWA 2B0FA 1AGJA 1P3CA 1G3DA 3G01A 2BMGB 2VH0A 2BD9A 1WQSA 3MU5A 3VEQB 4CBNA 1GWAA 3ZV8A 5CE1A 3URCA 1C2GA 1OPHB 2C8WB 1UHBB 1GBTA 1O2QA 3HK6B 1LQEA 1EJMA 2XBWA 1DWCH 1F92A 1SGPE 2PFEA 2BX4A 2P94A 1WU1A 1Z1IA 3A82A 3AASA 1L1NA 2R3UA 2ZHEH 1YPGH 1XUFA 3A87A 1P0SH 3A80A 5A0BA 2JH0D 2JKHA 1F5KU 2ZGBH 4ZKSU 2VVCA 1KXBA 1EP6A 1OX1A 1C9TA 1VCWA 2EEKA 2Q6DA 3HATH 1PPEE 7GCHG 1EATA 4A6LA 1BB0B 1FJSA 3RUOA 3NK8A 2XBYA 4MQAA 1ABIH 5DP3A 2ZDLA 5GCHF 1LHEH 3SBKA 1NM6A 3DT0H 3AW0A 1SL3A 1TWXB 2PKSC 1PPBH 1BT7A 1KLJH 1Z71A 2VB0A 2TGPZ 1GBJA 4E06H 1VITF 1AKSA 4IW4E 2D1JA 1ELGA 2ZGXH 1ZHMA 3GCTG 4K3JA 3TH2H 3V12A 1S85A 1TAWA 2TBSA 3KQBA 4I32A 1IQGA 1RTLA 6CHAB 1O2XA 3OU0A 4AFUA 1YPJH 2B9LA 3A8AA 5EGMA 1C5UA 1V2VT 3ZZCA 2J38A 3LPRA 1GBIA 1D4PB 2W26A 3HKIB 3HGPA 3O8DA 1E0FD 2FDAA 3RU4D 1W13U 3R3GB 2Z9GA 2FZZA 1DM4B 1GHYH 1FPCH 1UCYH 4LXBH 3SU5A 1QIXB 3P8FA 1TX8A 4SGAE 3F9GA 1THSH 1C5MD 1TGCA 4CH8B 2BDCA 2F9BH 2ZFQH 4TPIZ 5CMXH 1K28D 4AN7A 4IC6A 3TJNA 4D9QA 5C1YA 1VJAU 1ZSLA 1FY8E 2GT8A 4ABBA 2NU3E 2QGRA 3PO1B 1LPZB 2PGBB 1UCYE 1YGCH 3H5CB 4X6NA 2FLRH 5DO4H 3JZ1B 3NPSA 1P2QA 1IQMA 1MQ5A 1UHBA 3ESTA 1NPMA 1IQHA 4TY7A 1BOQA 2GVFA 3QO6A 4WVPE 4BAKB 2GZ9A 1O5GH 1V3XA 4AG1A 4I8KA 1F0TA 3VXEH 1MBQA 1UK4A 3BTFE 3RC4A 1O39A 1K1NA 4HI3A 1BUIA 5FX6A 1MU8B 1TQ7B 1BTHH 2P93A 3T5FH 2D26C 3TNSA 2H5CA 3BN9A 4ABJA 2CHAC 1N8OC 2V6NA 5C5OA 1FN8A 6GCHG 1NRPH 1WCZA 3ODDA 2F83A 2NWNA 3V7TA 2QYIA 2TGTA 3MFJA 3D65E 1DPOA 2FS9A 4ISOA 1HJ9A 4NWLA 4K1TA 1HAZB 3GY8A 3GY2A 1V2UT 3BEFB 3I78A 4K5ZA 3FZDA 3AAUA 3ODFA 4IBLH 3M7QA 5T6FA 1NFYA 4MVNA 2JETC 4X8TH 2F9UA 3SU0A 2ODPA 1YCPM 4X6PA 1DX5M 4F49A 3GY4A 1L1GA 1Y3YA 3VB5A 4TY6A 1EP5A 2ANMH 3SNDA 3UUZA 2BVRH 2ZU1A 1BDAA 5LGOA 1C1UH 3LKWA 2G51A 1QNJA 4CH2B 1GI2A 1QB9A 2A2XH 1J16A 2FOCA 1LVMA 1ESTA 1O2RA 1LHDH 1P3EA 1MAXA 1O2KA 1WTHD 3D23A 1ABJH 2QA9E 3GDUA 1AZZA 1HJAC 1V2ST 4ZKNU 3LU9B 1QQUA 1A3BH 1AVGH 5BRRE 2QCYA 3F9EA 1HB0B 2H5DA 3BIVH 1LKBA 1G3CA 3VFEA 2FYQA 4WXIA 4CRAA 2GGVB 3L6PA 1TPAE 3BTME 3LGWA 1JOUB 2RA3A 1LKAA 1N6YA 2BVXH 1DWEH 3UNQA 2ALPA 1HBTH 2TIOA 2QV1A 5JBAS 1YPKH 1YPEH 1C4Y2 1NY22 4D8NA 3MH5A 1KYNA 1P06A 1RS0A 4X2YA 4XBBA 4B2CA 1GGDC 2BXUH 2A0QB 2TPIZ 3PWBA 2WPIS 2P8OB 2AS9A 2ZFSA 4Q7YA 3NWUA 2AYWA 6CHAC 2GDDA 3TGJE 3P8GA 4I8JA 2Y5HA 1BBRH 1GHXH 1ZRKA 4Y0ZE 2BM2A 3WY8A 1SGRE 3ATMA 3LJJA 4NIVA 5C67A 1TONA 5ABWA 4AOQA 1OSSA 3T2NA 1SGIB 4B2AA 1H8IH 1AFQB 2PKSB 4MDSA 3MU1A 1CT0E 2GKVE 1C5QA 3VB7A 2ZDNA 3EDXB 1AHTH 1B0FA 4TYDA 4DT7B 1G37A 2ALVA 2OC8A 4UONA 2ZDAH 2P3FH 2FTMA 2Z7FE 1TNLA 1C2HA 3O8BA 4MNXA 1QRXA 1DDJA 2ZHFH 1AWFH 2J92A 2O8WA 4LOYH 3M7UA 4UE7H 2BZAA 4A1XA 2BDGA 4F4OC 2SGDE 3MI4A 3SUFA 2VIPA 5E8EH 4DY7B 4YOJA 1C1WH 2ZO3H 1E34B 1BMMH 1HLTH 4H42U 1EJAA 3QTVH 1KLIH 1CU1A 1P10A 1C2LA 5FBIA 4AG2A 3GCNA 3PM3A 4CHAB 1FY1A 2R0LA 1UVTH 2G5VA 1BMAA 1S6HA 1O3AA 4Q2KA 3P70B 1EZUC 2J34A 1QGFA 4NSVA 5IYTA 3SQHE 5DP4A 1P2JA 1SGNE 1O2WA 1TGNA 1WYKA 4KTCA 1JBUH 2M5TA 4YT6H 5HM2A 5AF9H 4DGJA 4NWKA 2XXLA 1P09A 2Y5FA 3MH7A 4UFEH 5DP6A 2ZPSA 5A09A 4AFQA 3MU8A 1MD8A 2QAAA 3SV7A 1XUKA 3RMNH 1FNIA 2H9EH 5H4IB 2C8XB 1T8NA 3M35A 1O35A 2TRMA 3S9BA 1Q2WA 1W2KH 4JYVH 4X1SU 5FAHA 2BVSH 1O33A 2Y81A 5EQRA 2PSYA 1V2PT 2Z3EA 1K1OA 3ZZ9A 1KDQA 3KEEA 1OWEA 1KY9A 2F9PA 2G8TA 3LH3A 1HXFH 4Q7XA 2G4UA 4FUEA 3GCTF 3LOXA 3BIUH 1YPHE 2SFAA 2ODYB 2PHBA 2B7DH 2FOHA 3ZVBA 1QRZA 2Z9IA 3AW1A 3S7HB 5DP8A 1O3PB 1CHGA 1C1QA 1BHXB 1SQAA 2XYAA 3RXRA 2BY7X 1VR1H 3MH6A 1CO7E 1W11U 2PTNA 1P11E 2C8ZB 3CS0A 4KTUA 2OUAA 2FODA 1BJVA 4ZMAH 1E35B 2R9PA 3S9AA 3SGAE 1ZGVA 1KXFA 3PTNA 3D62A 1S84A 1TLDA 4ZUHA 4NIWA 4DIIH 1H1BA 2K1QA 2C3SA 3SO3A 8ESTE 4NFFA 3RXGA 3SU1A 3BTDE 1F5LA 1OS8A 3CENA 1MMJN 3FP6E 4MTBA 3QK1A 1TMTH 2HRVA 2AMPA 2DE8A 1C5NH 2ZHDA 1W14U 3M37A 2QF3A 4FU7A 4UDWH 3K2UA 1CSOE 2H9TH 4DOQA 4NA9H 2A4GA 1H9IE 2VH6A 1MCVA 5FPTA 1RIWC 4ABEA 2A4QA 3AAVA 1O3CA 1MKWH 2BXTH 1DOJA 1BQYA 1K1IA 3I29A 1QJ6B 4HGCA 4MPWA 1H9HE 4BOHA 3GISB 2G5NA 2ZTYA 3MOCA 4QT8C 1TOCB 1O2TA 1DUEA 2A5IA 2BY5X 2VIWA 3LC3A 3MYWA 1IOEA 1GJ5H 3DA9B 1Z8JB 2ZWLH 2A4RA 1GI1A 1DXPA 1VCPA 1CE5A 3M5LA 1SGEE 1UTPA 1GHBF 2Q6GA 3E91A 1GL0E 1O3OA 2WPLS 1KTSB 1H9LB 2SGQE 1SLUB 1PPZA 2ZDVH 3TPIZ 1P2MA 1OWIA 2QY0B 1QHRB 1LQDB 3FZZA 1NESE 2Y80A 1AQ7A 5L30H 1SOTA 2P8OC 5EQSA 1KDQB 4DJZB 4Y10E 2FS8A 2JH6D 2OINA 1DLEA 1QCPA 4INLA 1GCTC 4UEHH 4XBCA 4ZXXH 1XMNB 4AFZA 2R2MB 3W94A 3ZZ7A 1OWDA 4FVBA 2NU4E 5GXPA 1AFQC 5C20A 1SQOA 4WY3A 4ABAA 1VZQH 1ELVA 2PKAB 3A86A 1ZMNA 3ENSB 2SGEE 4MPXA 1SGYE 3EA8A 2QXHA 1HUTH 1V2MT 2VWMA 3P8NA 3T29A 4D9RA 4O03A 4RN6A 3SI3H 1UJ1A 4FXGH 1ELCA 5C3NA 1LVYA 2A1DB 2CV3A 2YNBA 1AVXA 1HAOH 4FUCA 1V2QT 3GOVB 5DPAA 1Y59T 1IQFA 4ZROA 4IS5A 1YLCA 1TQ0B 1CA0C 3BTKE 3M36A 1QA0A 1GGDB 1V2WT 2F9NA 2PUXB 4SGBE 2I6SA 4UFGH 3PLKA 3QGJA 2ZGCA 2EI6A 2GP9B 3K6YA 3MWIU 1G3BA 2KAIB 1LMWB 3RC5A 1P9UA 2WPKS 5L2YH 1QJ1B 1GBAA 1TPOA 3ZZ3A 3QLPH 2ZQ1A 2AMQA 3RP2A 2AIPA 2VJ1A 1CQQA 1UK2A 1SR5C 5AVDA 1GVKB 1CA8B 3EA9A 1SOZA 1O5AB 2ZPQA 1YPLH 1Z6JH 4K60A 1F0UA 1N1LA 3A7YA 1H4WA 1C2FA 3RXTA 4E7NA 3TGIE 1GMCF 1RJXB 2ZU3A 5EPNA 4ABIA 2WV4A 5I46H 1FXYA 3GCOA 2AGGX 2SNVA 1UVUH 1LVOA 5JYIA 3PB1E 1A0LA 1RIWB 2VWNA 2THFB 1WSSH 1T8LA 1O3LA 3RXVA 1C5RA 1ELAA 1P2KA 3GICB 3A84A 1ZHPA 2F91A 1YKTA 3SU4A 4DIHH 3SNBA 2H6MA 4X1PU 4Y0YE 1QBVH 3E0PB 3MO6A 2AGIX 4HTCH 1AKSB 3MNBA 1KXDA 1CGIE 1O3EA 9ESTA 2QXJA 2OD3B 1HFDA 3QDZB 1K1LA 4TWYA 4M7GA 1S81A 1TRMA 3SJ9A 3T27A 5K0HA 4X1NU 1DICA 1OP0A 2UWPA 5LPFA 3HKJB 2BLVA 2BD5A 1Z8GA 1EB2A 1EAXA 1RFNA 4FUDA 1QB6A 1FZZA 4K8YA 1XM1A 1Z8IB 1FQ3A 1LHFH 1O3KA 4I7YH 4PROA 1MKWK 4B74A 1AI8H 2ZGHA 4Q7ZA 4UFDH 1OXGA 1IAUA 3Q3KA 2ZHWH 1GBFA 4YOIA 2FM2A 1G9IE 1TE0A 4INHA 3GY6A 4WH6A 2BY8X 1BRCE 3K9XB 1J15A 1HXEH 1W0YH 2VIDA 5A2MH 3A89A 5HM9A 4X0WU 3V3MA 1UTLM 2WINI 3T62A 4DCDA 2Z9JA 3U1IB 2G81E 1D3DB 3PO1C 1MH0A 4YESB 4Y8YA 1DWBH 1L1JA 1D3PB 1C2DA 1Z6EA 1LHGH 3SJKA 3SU2A 1O0DH 1SGFG 4Y6DA 1SGCA 1JRTA 1MD7A 1HAIH 1XXDA 3C1KA 1YLDA 1NFWA 3VB3A 4R0IA 1PYTC 4ISNA 4I8HA 4Q80A 4ISIH 4OS1A 4THNH 2RDLA 4VGCC 4AFSA 5E2OA 1ZSKA 1FN6A 4O97A 4H6SB 2BOKA 1A61H 4AZ2B 1Z1JA 2BDYA 4J2YB 4FU8A 1ZLRA 3LGUA 3ZZ5A 3UOUA 2Z3CA 5ETXA 1A0JA 3FAOA 4GSOA 1TYNA 3RXHA 4TWWA 1S6FA 2LPRA 4ISLA 5HGGA 4ABFA 2OC1A 3LH1A 3JZ2B 4DVAU 1UCYK 4YO9A 1PQ5A 2VIVA 5DG6A 5DP7A 1AFEH 4MG3A 1OWJA 2WPHS 3E16B 1X7AC 1FUJA 2FOFA 1ANBA 3PWCA 1C4U2 1ETSH 3RLYH 3ZVDA 4JCNA 4X8SH 2ZHQH 1FV9A 3R0FA 1ID5H 3PMJA 2UUKB 1QFKH 2BTCE 4OS7A 1HGTH 1DLKB 1RRKA 1GI3A 1MTUA 3DFLA 1C5PA 3VXFH 3U1JB 2PUQH 2J94A 1O2PA 3CS7A 1VJ9U 1GJAB 3RXIA 3RXMA 1O2ZA 5C1UA 2BDAA 1GJCB 1O32A 4ZKOU 1T8OA 3E8LA 2CJIA 2XNIA 2ZPRA 8KME2 4NA8A 1F7ZA 1ZPCA 1C1OA 1NRQH 3LGVA 3PMBB 1P9SA 1P03A 1GJ7B 2GV6A 4FUIA 1O30A 2ZC9H 1EAUA 4ZHMU 1C5OH 3ATIA 5E0JA 1Y5UT 2VIQA 3Q3YA 2FOAA 3OY5U 6GCHF 1F0SA 5HXFA 1QA7A 2Y82A 3A7VA 8GCHG 1SBWA 1L4ZA 4A1TA 2HNTC 2VU8E 2BD3A 3ZVGA 3TU7H 1T4UH 4GUXA 4B73A 5FHTA 3NZIA 1O2SA 2OBOA 3Q00A 4CR5A 1GHAF 3TH3H 1FY3A 1O3DA 5AHGH 4OS2A 1GI9B 3C27B 1EPTA 3EGKH 5EG4A 1BRAA 9LPRA 2CGAA 1FIWA 2GZ8A 3T26A 1CGJE 1TRYA 3LGYA 3W95A 4GCHF 2BDBA 2FLBH 1DSUA 2C90B 4I31A 3QN7A 1NN6A 3F68H 1P2NA 5HMAA 1GHAG 1IQKA 4AYYB 3OY6U 3QZRA 1FONA 4RSPA 4WWYA 1D9IA 4AB9A 1TA2A 1K1MA 7ESTE 8GCHF 3SUGA 3A81A 2SGPE 4I33A 4X2WA 2UWLA 3UFAA 1SFQB 4ABGA 4BANB 1TPSA 2FMJA 4Z0KA 5HYOA 3U8OH 1O3FA 3PMAB 4B71A 2ZG0H 1FI8A 2XWAA 3U8RH 3TH4H 3LT3A 1ZPBA 2PSXA 1W0ZU 2P3UB 1BCUH 1NRNH 4IC5A 5FCRA 1GBLA 2V35A 5BPEA 3SQEE 1Y3XA 2QF0A 1XUIA 2ZFPH 1AZ8A 1A1RA 1EJNA 2GCTC 2A5KA 2WPJS 3ATLA 1W10U 4MPVA 1YP9A 1VCQA 1GL1A 1AD8H 3K65B 3PLBA 1ELBA 3IG6B 5CHAC 2AGEX 1Z7KA 1YM0A 3BTEE 2A45B 3RM0H 1VITG 5J4SA 5GWZA 1BMNH 1CT2E 1O3HA 1SGDE 1NU9A 4NZLA 1S83A 2A7JA 2STBE 2W3IA 3M7TA 3UIRA 1DXWA 5F03A 4ZKRU 1HRTH 1GJ9B 1TX6A 1LDTT 1WOFA 1PQAA 1S5SA 5FXLA 2OLGA 1YYY1 3TK9A 1GMDF 3MTYA 3FP7E 3QWCH 4BTIB 1PPHE 3KGPA 2BD4A 1QRWA 2BY6X 3I77A 1DS2E 3VGCB 5EPYA 2PGQB 2XWBI 1HIAA 2RA0A 3ATWA 1CHOF 1GBBA 1XUGA 1LPGB 2A2QH 1C1SA 4MNYA 1DE7H 1C5YB 1GDUA 1P8VC 5SGAE 1GBDA 2WPMS 1RTFB 4CR9A 1QBNA 4KKDA 4D7FA 2EI8A 5C1XA 2CN0H 1V2LT 5A8YA 3RXQA 3MNCA 2Q6FA 1O3IA 4JZIA 3NXPA 2ANKH 4ABDA 1DY9A 4NIYA 5EXNA 1T7CA 1RD3B 1THRH 4CRFA 1ZMJA 5F8XA 2FPZA 2GTBA 1HAPH 4BXWA 2FOMB 1V2RT 1T32A 2Q1JA 1MUEB 2AFQB 2J95A 3UREA 1CA0B 1TFXA 2PTCE 2OCVB 3VB4A 2ZDKA 4BTUB 3S0NA 1Y3WA 5F6MA 3KL6A 4HFPB 1FMGA 3NUMA 1SHYA 1UTOA 2XC5A 3P6ZB 4WF8A 1Q31A 1IQLA 2Z9LA 4ZH8A 1NC6A 1BTWA 3A8DA 3GY7A 4O9VA 3ZZ8A 3TITA 3TK5A 1D6RA 2UWOA 3F6UH 4Y71A 3GYMA 4WH8A 3UNRA 2C8YB 4I8GA 3OSYA 4WMFA 5A8XA 3Q3XA 2IN2A 1C1VH 4JZ1A 3A88A 1F2SE 3RXPA 2A32A 2AH4X 3Q76A 1GBHA 1GCDA 2Y7XA 3KNXA 5L2ZH 1TBZH 2GV7A 2OQUA 3EA7A 3STIA 1O2GH 1DWDH 4FUBA 1SI5H 1TB6H 2FI3E 1O38A 1SGTA 1Y3VA 3IWMA 1ZZZA 2DUCA 1CGHA 1O34A 1AUJA 2ZECA 4MNWA 3M3VA 1FY4A 1OYTH 1DSTA 1UVPA 2NU1E 4B75A 1WBGB 1MTVA 5AFYH 2ZEBA 2DE9A 1KXAA 4JYUH 3SJIA 1J8AA 1MBMA 3DUXH 5GIBA 3KF2A 1BTXA 1C2IA 3UOPA 1LCYA 1K22H 2CHAB 5JPMH 1O2OA 1TGBA 3SUEA 1BTZA 1C2MA 3E1XB 1GBMA 1G30B 3P8OA 3S7KB 1AO5A 1EASA 1ZJKA 5GCHG 1GVLA 4IMQA 4FUHA 3H7OA 3RMLH 4ISHH 3UTUH 1TGTA 3EE0B 2VGCB 1O3JA 1P05A 1OYQA 4Y8ZA 1DFPA 5ESTE 1LTOA 1V2OT 1SQTA 2STAE 1O3NA 2FWWA 1TOMH 2VWOA 3UNSA 4CRGA 4XOJA 1C2JA 2ZA5A 1EZXC 3MMGA 5E2PA 2P3TB 1HIAB 3UQVA 4AX9H 1NZQH 2BLOA 1SLVB 4BXSA 1XUJA 1EPTC 4A1VA 1SGQE 1A4WH 2CXVA 3QUMP 2ZFRH 3BTGE 2BQ6B 2ZCHP 1JRSA 3LC5A 1AUTC 1LHCH 2O8MA 3SHAH 3RMMH 1B0EA 2FEQH 1FLEE 1PPGE 1Q3XA 1A2CH 1EZSC 1TNKA 4OGYA 5TCCA 1ZR0A 2G52A 1O2JA 3RXAA 4ESTE 2ZKSA 1O37A 3RM2H 3ZVCA 4ZHLU 1GHZA 1ANEA 4IN2A 4U01A 3P95A 1CBWC 3M3TA 4JK6A 1O36A 1QJ7B 3PROA 2W5EA 3A83A 4YOGA 1C5LH 4H6TA 1C1RA 2BOHB 2BY9X 2ZTZA 3AVZA 2Z3DA 4BAMB 4CREA 1P12E 1NS3A 4XSKU 3SI4H 1UTQA 3LJOA 2F3CE 1C1PA 2XCFA 4GHQA 1BZXE 1DUAA 1EOLA 2Y7ZA 2ZI2H 4O3UA 3RMOH 3SZNA 3BG4C 3ZZBA 1TMUH 2GCHF 5EW2H 2PKAA 2C4FH 1MCTA 1TA6A 1HCGA 3KQCA 3BTTE 1EZQA 4KP0A 4KELA 1Y5BT 4DG4A 1W3CA 2OC0A 2FOGA 1FAXA 1L0ZA 4K1EA 3OX7U 1ARBA 3ZVEA 1C1NA 5EOKA 4K69A 1SG8B 3SV2H 1NROH 3E3TA 1A0HB 1XUHA 4LK4A 3B8JA 1RTKA 2FI4E 2QIQA 2XW9A 1AB9C 4X2VA 1GI5A 1XKBC 1QL7A 2UUYA 4B2BA 4CRDA 2XCNA 3LDXH 1ZSJA 1CT4E 2GMTB 2ZF0H 1GMDG 2A7HA 1QURH 1OOKB 3MNSA 2AMDA 3EAJA 1UO6A 4YT7H 3U9AH 2RCEA 2VGCC 2ZU4A 1KLTA 2ZZUH 1EX3A 5DP9A 1E36B 4A7IB 1PPCE 3FFGA 2Z9KA 1ESBA 1Y8TA 4GLYA 2PWXA 4E7RG 4XFQA 4BNRA 4X6OA 1QQ4A 1SLXB 4JYTA 2ZU5A 4NZQA 2HNTE 3SU6A 1UTKA 5A0CA 1GMCG 5EXMA 3TNTA 3P92A 5E0HA 1P01A 2I6QA 1C5TA 3K6ZA 2FIRH 4X1QU 2VIOA 4Y79A 1TBRH 3SW2B 4XBDA 4AGKA 2BB4A 1KXCA 1UTNA 2ZFTA 3V0XA 1XVOA 2H9HA 5FBEA 2ZIQH 4U30A 1HAVA 2HPPH 1V2TT 1QBOA 3T28A 3SV9A 1GI4A 1BBRK 1AY6H 1GDQA 3GCHB 1MTNB 1GCTB 2J2UA 1O2IA 1ETRH 1C2EA 1O2UA 3ZYEA 1GMHG 1P57B 1DVAH 3RU4T 3QX5H 5T6DA 3VGCC 1NRSH 2ANYA 2BQ7B 1G2MA 2OQ5A 4Y76A 1HPGA 1MZDA 1TNIA 2BDHA 1GI6A 2PLXA 5L6NH 1INCA 1ZTLA 3MU4A 5FX5A 5JBCS 1HAXB 2PR3A 1A46H 4K1SA 1P2OA 3SJOA 4Y7AA 1TNHA 1YF4A 5DP5A 1AMHA 1MKXK 2HGTH 4O3TA 1LVBA 1JIMA 1C5VA 4R8TB 3SN8A 2VWLA 2IJOB 1TNGA 5DKMA 1FY5A 1K1PA 1EOJA 2FX6A 1GI7B 2XC0A 1PPFE 1S0QA 1BMLA 2PW8H 2BDIA 3BG4B 1C2KA 2AIQA 4UD9H 7LPRA 3ZZ6A 1BIOA 4J1YA 4JZEH 4JZDH 1ELTA 2BLQA 2ZCKP 2Z6BD 1QB1A 6LPRA 1O3BA 2LNCA 2ZQ2A 4H4FA 1TIOA 3PLPA 1KTTB 1G36A 4X6MA 1V6DA 4XE4A 2A31A 2EC9H 2ZU2A 1ORFA 1ZTJA 2BD8A 3D49H 4I8LA 2BQWB 2NU0E 4YM9A 1C1TA 2HPQH 2YNAA 1K1JA 1M9UA 2OXSA 2ZP0H 3NKKA 3TJVA 1YCPK 2TGDA 2PV9B 3FP8E 1PFXC 4DURA 1U6QA 4NG9H 1XX9A 4K8BA 1TX7A 1GJ6A 1OP8A 1L2EA 4LZ4B 2R2WU 3ITIA 3E6PH 3L3TA 2JH5D 3BF6H 2GT7A 4FUJA 2SGFE 3F1SB 1SLWB 2SGAA 2ZTXA 4ZXYH 1ZMLA 2BLWA 5GPIB 2G00A 4YTAA 4BTTB 1BTYA 2O8TA 1HJAB 5J4QA 1ETTH 2JETB 1FAKH 1F5RA 3S9CA 3BSQA 1W12U 4WJG2 4AORA 4E05H 2V3OH 1GHBG 1GI8B 3LGIA 3DD2H 3BTQE 2A7CA 1BRBE 1TPPA 4A92A 2GCHG 4OS6A 1G2LA 3A7TA 2AERH 4GVUA 3B9FH 1WV7H 2KAIA 4Y7BA 1C1MA 3UPEA 3MO3A 2TGAA 1NFUA 2BX3A 2O8UA 3RXSA 4ABHA 4XDEA 1HJ8A 1UK3A 1GVZA 3A85A 3TJOA 5JB8S 1GBEA 4DW2U 2XBXA 1J14A 1PYTD 2FP7B 1C9PA 1GHVH 1JMOH 1O5CB 2O9QA 3U98H 2YOLA 1EUFA 1ELFA 7KMEH 1MAYA 1WUNH 2XBVA 4CBOA 2QN5T 3SGQE 1C5XB 1W8BH 4X2XA 3A8BA 1FPHH 1HAVB 3GYLB 3OTJE 8LPRA 1LO6A 3N7OA 4KGAA 2GMTC 3SNEA 1VGCB 3LONA 3O8CA 4BAHB 1O2YA 1IQNA 1J17T 2RG3A 1B7XB 1DITH 4CRBA 4LZ1H 5DK1A 1E37B 1BTPA 1UVOA 4RKJB 2GX4A 1N8OB 2W7UA 2SNWA 1GJ8B 1OWKA 4BAOB 3ZV9A 2WUBA 4X1RU 4NFEA 5EU8A 5DJ7A 3UR6A 2EI7A 1SFIA 1A3EH 1OP2A 1P02A 2R0KA 3GDVA 5FPSA 1S82A 3SORA 4IGDA 2R3YA 1GJDB 1ZJDA 1Y3UA 1RGQA 3UY9A 1GDNA 1YPHC 3BTWE 5T6GA 3MH4A 1YBWA 3QZQA 1IHTH 3MNXA 3NCLA 1GJ4H 2FXRA 1BITA 1MU6B 2OBQA 2B8OH 3SV8A 1O2MA 2ANWA 1AE5A 3RXJA 3RU4E 5LPEA 3QTOH 2CF8H
chains in the Genus database with same CATH superfamily
2BD2A 1AU8A 1B5GH 1BTUA 5CHAB 4GCHG 2WZQA 1QR3E 4OGXA 2HOBA 3BEIB 3WW7A 2YMSC 4YZUA 3CP7A 3KN2A 4OS5A 2GCTB 1C5SA 1MKXH 1IHSH 3MU0A 1FDPA 1NT1A 2GDEH 1AN1E 1EAWA 3SJ8A 1H8ED 2BYAX 4FUGA 1A5HA 1GBKA 4JK5A 3H7TA 1TMBH 3RXCA 4WMEA 1YC0A 1O3GA 3ZVAA 1V2JT 1O5FH 1AIXH 5F53A 3PV4A 1CVWH 3BTHE 3EQ0H 2L6OA 1CBWB 1C5WB 3FKSD 5EW1H 4A5TS 2WYJA 1N6XA 1P2IA 3B23B 4WMDA 5I25A 5JB9S 2WV5A 3HK3B 3IITA 3ZYDA 5G4BA 2Y5GA 1UTJA 4MNVA 5T3HA 3LGTA 5T1VA 1SB1H 1AWHB 1DANH 5AFZH 1HV7A 2W3KA 4ZHAA 2CF9H 5LH8A 5TJXA 3F9FA 4IMZA 2JIZD 1YCPH 1E79D 3H09A 2IPQX 1DY8A 1D6WA 2WYGA 4TPYA 3L33A 5B6OA 3M5MA 1ZRBA 3FANA 3M3SA 3TIUA 2QC2A 1ZGIA 4IN1A 2XTTB 1SC8U 2OTVA 2VNTA 4Z6AH 2ODQA 2A4OA 3BEUA 4RT0A 2A5AA 1TABE 1QL9A 1THPB 1K2I1 3MO9A 2BZ6H 4D7GA 2V0BA 3UWIA 1UMAH 2XRCA 5EQQA 3RXDA 3SV6A 1W7GH 3TK6A 1LPKB 2FO9A 1ELEE 2J9NA 2HWLB 1EXFA 1RXPA 3O8RA 1NTPA 1D3TB 1VITH 3DSOA 2FOEA 1TALA 5A0AE 5F8ZA 2ZCLP 1ESAA 3N7DA 1T8MA 1WQVH 3SNAA 2Z94A 2PP6A 1O2NA 1H8DH 2BHGA 1EKBB 4Y8XA 3KQDA 5GJ4B 3MHWU 1P04A 1DT2A 1SGFA 3SGBE 2UUJB 1JXPA 3E0NB 5TCAA 3N99A 2G55A 5JBTA 4Y11E 2J4IA 2ZFFH 1CHOG 1TRNA 3U69H 2F9VA 1O5BB 3KCGH 4P02A 4U2WA 1A5IA 1OWHA 3STJA 7GCHF 4RKOB 1HNEE 3SHCH 3EYDA 3ELAH 3KIDU 2W7SA 3TVJB 2NU2E 3ZZAA 3RXFA 1GBCA 2D2DA 2CMYA 3SZEA 1WTGH 2QXGA 1C4V2 1MTWA 1BHXF 1TNJA 2YMSB 2VVUA 2EY4C 1SSXA 1C5ZB 5FCKA 2HVXA 4UFFH 3Q77A 1ZOMA 3RXUA 4FUFA 1GG6C 1EAIA 4NA7A 1YPMH 4X8VH 2ASUB 1J9CH 2VINA 1BRUP 1HDTH 2FTLE 2ULLA 4WXVA 5A8ZA 1K21H 1BA8B 4YLQH 1XKAC 4VGCB 1F0RA 4ZAEA 5K7RA 1IQIA 1T31A 2ILNA 1PQ7A 2FYRA 1ARCA 1O5DH 4INKA 4U32A 2YMSD 4CHAC 4JZFH 1MTSA 2IOTA 3T25A 2H2ZA 4NSYA 2P95A 5EXLA 1UTMA 2QXIA 3A7XA 2Y6TA 3ATKA 1NRRH 4MPUA 5F8TA 4CRCA 4AYVB 3HGNA 3RXOA 3SU3A 3RDZA 3KHVA 3PV5A 4HZHA 1ANCA 5JBBS 2GZ7A 4NIXA 2XNDD 3RXLA 1AB9B 2FX4A 2ESTE 1PQ8A 3A7ZA 3M5NA 2F9OA 4GHTA 1JWTA 2AEIH 3DHKH 1MABB 3UQOA 1GMHF 4KTSA 1Y5AT 3SNCA 3RXEA 1T4VH 2W6ID 1L4DA 1ZTKA 2G4TA 3TLOA 4BAQB 1MTNC 2OC7A 1D3QB 1K9OE 3KQEA 3SOSA 3GCHC 4OS4A 1QTFA 1AVWA 3ZVFA 2FI5E 1V2NT 1EQ9A 3HPTB 1GPZA 2HALA 3W1EA 4FVDA 1TBQH 4MLFB 3OYPA 2V3HH 3S69A 2BD7A 3P17H 2HLCA 3ZZDA 1QY6A 3UR9A 1HYLA 1UVSH 3DFJA 1BJUA 4Q63A 3TGKE 1SHHB 5IDKA 4AB8A 1NO9H 1FIZA 5PTPA 3E90B 1W7XH 3VB6A 1GJBB 4AGJA 1NFXA 4X8UH 1JIRA 1GG6B 5EODA 4JMYA 2D8WA 3A8CA 3URDA 1G32B 2B5TB 5LPRA 5ESBA 3F9HA 4NGAH 2UUFB 1MQ6A 3QGNB 2EA3A 3FVFB 1O31A 2GD4B 2XC4A 2WUCA 3UWJH 1HAHH 3NRLA 5C2ZA 1ZYOA 1MZAA 1O3MA 2IPHA 3RXKA 4ASHA 1O2VA 1TGSZ 4GPGA 1S0RA 3FN8A 3V13A 5C5NA 2ZGJA 3M5OA 4D76A 1G3EA 2VVVA 5FPYA 1Z8RA 3PYHA 1O5EH 1BBRE 3TJUA 2FOBA 3PMHB 4GAWA 1HAYB 1A7SA 2ZDMA 3RLWH 3BV9B 1PJPA 5E0GA 1O2LA 3ZZ4A 2OP9A 1IQEA 4NCYA 3RC6A 4XRNA 3F0OA 4B1TA 1SVPA 2H1UA 1ANDA 1A5GH 1ELDE 1GHWH 1V2KT 1GI0A 3RXBA 1XXFA 4K2YA 1OKXA 1QL8A 3GDSA 2KCAA 2HNTF 3BG8A 2HLDD 1E38B 3VPKA 1SMFE 1HAGE 2ZNKH 1KXEA 2C93B 5GDSH 1EPTB 1IQJA 1W0KD 1WAYB 2RFKC 5JDUB 1VGCC 5DGJA 1ZPZA 3GY5A 2FESH 2P16A 1NU7B 1SPJA 6ESTA 1KSNA 2KM0A 1O2HA 1EB1H 2P59A 3GY3A 2O8LA 4FU9A 3M61U 1KIGH 3PTBA 1XVMA 3SUDA 1ACBE 4YLUA 1AE8H 5KGOA 4B76A 3A7WA 3U8TH 1ZHRA 3LIWA 2B0FA 1AGJA 1P3CA 1G3DA 3G01A 2BMGB 2VH0A 2BD9A 1WQSA 3MU5A 3VEQB 4CBNA 1GWAA 3ZV8A 5CE1A 3URCA 1C2GA 1H8HD 1OPHB 2C8WB 1UHBB 1GBTA 1O2QA 3HK6B 1LQEA 1EJMA 2XBWA 1DWCH 1F92A 1SGPE 2PFEA 2BX4A 2P94A 1WU1A 1Z1IA 3A82A 3AASA 1L1NA 2R3UA 2ZHEH 1YPGH 1XUFA 3A87A 1P0SH 3A80A 5A0BA 2JH0D 2JKHA 1F5KU 2ZGBH 4ZKSU 2VVCA 1KXBA 1EP6A 1OX1A 1C9TA 1VCWA 2EEKA 2Q6DA 3HATH 1PPEE 7GCHG 1EATA 4A6LA 1BB0B 1FJSA 3RUOA 3NK8A 2XBYA 4MQAA 1ABIH 5DP3A 2ZDLA 5GCHF 1LHEH 3SBKA 1NM6A 3DT0H 3AW0A 1SL3A 1TWXB 2PKSC 1PPBH 1BT7A 1KLJH 1Z71A 2VB0A 2TGPZ 1GBJA 4E06H 1VITF 1AKSA 4IW4E 2D1JA 1ELGA 2ZGXH 1ZHMA 3GCTG 4K3JA 3TH2H 3V12A 1S85A 1TAWA 5EJ1A 2TBSA 3KQBA 4I32A 1IQGA 1RTLA 6CHAB 1O2XA 3OU0A 4AFUA 1YPJH 2B9LA 3A8AA 5EGMA 1C5UA 1V2VT 3ZZCA 2J38A 3LPRA 1GBIA 1D4PB 2W26A 3HKIB 3HGPA 3O8DA 1E0FD 2FDAA 3RU4D 1W13U 3OTPA 3R3GB 2Z9GA 2FZZA 1DM4B 1GHYH 1FPCH 1UCYH 2HVYB 4LXBH 3SU5A 1QIXB 3P8FA 1TX8A 4SGAE 3F9GA 1THSH 1C5MD 1TGCA 4CH8B 2BDCA 2F9BH 2ZFQH 4TPIZ 5CMXH 1K28D 4RI0A 4AN7A 4IC6A 3TJNA 4D9QA 5C1YA 1VJAU 1ZSLA 1FY8E 2GT8A 4ABBA 2NU3E 2QGRA 3PO1B 1LPZB 2PGBB 1UCYE 1YGCH 3H5CB 4X6NA 2FLRH 5DO4H 3JZ1B 3NPSA 1P2QA 1IQMA 1MQ5A 1UHBA 3ESTA 1NPMA 1IQHA 4TY7A 1BOQA 2GVFA 3QO6A 4WVPE 4BAKB 2GZ9A 1O5GH 1V3XA 4AG1A 4I8KA 1F0TA 3VXEH 1MBQA 1UK4A 3BTFE 3RC4A 1O39A 1K1NA 4HI3A 1BUIA 5FX6A 1MU8B 1TQ7B 1BTHH 2P93A 3T5FH 2D26C 3TNSA 2H5CA 3BN9A 4ABJA 2CHAC 1N8OC 2V6NA 5C5OA 1FN8A 6GCHG 1NRPH 1WCZA 3ODDA 2F83A 2NWNA 3V7TA 2QYIA 2TGTA 3MFJA 4FETA 3D65E 1DPOA 2FS9A 4ISOA 1HJ9A 4NWLA 4K1TA 1HAZB 3GY8A 3GY2A 1V2UT 3BEFB 3I78A 4K5ZA 3FZDA 3AAUA 3ODFA 4IBLH 1UW7A 3M7QA 5T6FA 1NFYA 4MVNA 2JETC 4X8TH 1WDIA 2F9UA 3SU0A 2ODPA 1YCPM 4X6PA 1DX5M 4F49A 3GY4A 1L1GA 1Y3YA 3VB5A 4TY6A 1EP5A 2ANMH 3SNDA 4B6FA 3UUZA 2BVRH 2ZU1A 1BDAA 5LGOA 1C1UH 3KYGA 3LKWA 2G51A 1QNJA 4CH2B 1GI2A 1QB9A 2A2XH 1J16A 2FOCA 1LVMA 2J5UA 1ESTA 1O2RA 1LHDH 1P3EA 1MAXA 1O2KA 1WTHD 3D23A 1OHHD 1ABJH 2QA9E 2KX4A 3GDUA 1AZZA 1HJAC 1V2ST 4ZKNU 3LU9B 1QQUA 1A3BH 1AVGH 5BRRE 2QCYA 3F9EA 1HB0B 2H5DA 3BIVH 1LKBA 1G3CA 3VFEA 2FYQA 4WXIA 4CRAA 2GGVB 3L6PA 1TPAE 3BTME 3LGWA 1JOUB 2RA3A 1LKAA 1N6YA 2BVXH 1DWEH 3UNQA 2ALPA 1HBTH 2TIOA 2F43B 2QV1A 5JBAS 1YPKH 1YPEH 1C4Y2 1NY22 4D8NA 3MH5A 1KYNA 1P06A 1RS0A 4X2YA 4XBBA 4B2CA 1GGDC 2BXUH 2A0QB 2TPIZ 3PWBA 2WPIS 2P8OB 2AS9A 2ZFSA 4Q7YA 3NWUA 2AYWA 6CHAC 2GDDA 2QF5A 3TGJE 3P8GA 4I8JA 2Y5HA 1BBRH 1GHXH 1ZRKA 4Y0ZE 2BM2A 1K0HA 3WY8A 1SGRE 3ATMA 3LJJA 4NIVA 5C67A 1TONA 5ABWA 4AOQA 1OSSA 3T2NA 1KMHB 1SGIB 4B2AA 1H8IH 1AFQB 2PKSB 4MDSA 3MU1A 1CT0E 2GKVE 1C5QA 3VB7A 2ZDNA 3EDXB 1AHTH 1B0FA 4TYDA 4DT7B 1G37A 2ALVA 2OC8A 4UONA 2ZDAH 2P3FH 2FTMA 2Z7FE 1TNLA 1C2HA 3O8BA 4MNXA 1QRXA 1DDJA 2ZHFH 1AWFH 2J92A 2O8WA 4HG6A 2LP6A 3M7UA 4LOYH 4UE7H 2BZAA 4A1XA 2BDGA 4F4OC 2SGDE 4DT4A 3MI4A 3SUFA 2VIPA 5E8EH 4DY7B 4YOJA 1C1WH 2ZO3H 1E34B 1BMMH 1HLTH 4H42U 1EJAA 3QTVH 1KLIH 1CU1A 1P10A 1C2LA 5FBIA 4AG2A 3GCNA 3PM3A 4CHAB 1FY1A 2R0LA 1UVTH 2G5VA 1BMAA 1S6HA 3F2GA 1O3AA 4Q2KA 3P70B 1EZUC 2J34A 1QGFA 4NSVA 5IYTA 3SQHE 5DP4A 1P2JA 1SGNE 1O2WA 1EFRD 1TGNA 1WYKA 1JBUH 2M5TA 4KTCA 4YT6H 5HM2A 5AF9H 4DGJA 4NWKA 2XXLA 1P09A 2Y5FA 3MH7A 4UFEH 5DP6A 2ZPSA 5A09A 5CHBA 3MU8A 4AFQA 1MD8A 2QAAA 3SV7A 1XUKA 3RMNH 1FNIA 2H9EH 5H4IB 2C8XB 1T8NA 3M35A 1O35A 2TRMA 3S9BA 1Q2WA 1W2KH 4JYVH 4X1SU 5FAHA 3PRDA 2BVSH 1O33A 2Y81A 5EQRA 2PSYA 1V2PT 2Z3EA 1K1OA 3ZZ9A 1KDQA 3KEEA 1OWEA 1KY9A 2F9PA 2G8TA 3LH3A 1HXFH 4Q7XA 2G4UA 4FUEA 3GCTF 3LOXA 3BIUH 1YPHE 2SFAA 2ODYB 2PHBA 2B7DH 2FOHA 3ZVBA 1YWUA 1QRZA 2Z9IA 3AW1A 3S7HB 5DP8A 1O3PB 1CHGA 1C1QA 1BHXB 1SQAA 2XYAA 3RXRA 2BY7X 1VR1H 3MH6A 1CO7E 1W11U 2PTNA 1P11E 2C8ZB 3CS0A 4KTUA 2OUAA 2FODA 1BJVA 4ZMAH 1E35B 2R9PA 3S9AA 3SGAE 1ZGVA 1KXFA 3PTNA 3D62A 1S84A 1TLDA 4ZUHA 4NIWA 4DIIH 1H1BA 2K1QA 2KCPA 2C3SA 3SO3A 8ESTE 4NFFA 3RXGA 3SU1A 3BTDE 1F5LA 1OS8A 3CENA 1MMJN 3FP6E 4MTBA 3QK1A 1TMTH 2HRVA 2AMPA 2DE8A 1C5NH 2ZHDA 1W14U 3M37A 5KEDA 2QF3A 4FU7A 4UDWH 3K2UA 1CSOE 2H9TH 4DOQA 4NA9H 2KCOA 2A4GA 4YXWD 1H9IE 2VH6A 1MCVA 5FPTA 1RIWC 4ABEA 2A4QA 3AAVA 1O3CA 1MKWH 2BXTH 5EJLA 1DOJA 1BQYA 1K1IA 3I29A 1QJ6B 4HGCA 4MPWA 3SYJA 1H9HE 4BOHA 3GISB 2G5NA 2ZTYA 3MOCA 4QT8C 1TOCB 1O2TA 1DUEA 2A5IA 2BY5X 2VIWA 3LC3A 3MYWA 1IOEA 1GJ5H 3DA9B 1Z8JB 2ZWLH 2A4RA 1GI1A 1DXPA 1VCPA 2W6JD 1CE5A 3M5LA 1SGEE 1UTPA 1GHBF 2Q6GA 2M2AA 3E91A 1GL0E 1O3OA 2WPLS 1KTSB 1H9LB 2SGQE 1SLUB 1PPZA 2ZDVH 3TPIZ 1P2MA 1OWIA 2QY0B 1QHRB 1LQDB 3FZZA 1NESE 2Y80A 3CNRA 1AQ7A 5L30H 1SOTA 2P8OC 5EQSA 1KDQB 4DJZB 4Y10E 2FS8A 2JH6D 2OINA 1DLEA 1QCPA 4INLA 1GCTC 4UEHH 4XBCA 4ZXXH 1XMNB 4AFZA 2R2MB 3W94A 3ZZ7A 1OWDA 2RDEA 4FVBA 2NU4E 5GXPA 1AFQC 5C20A 1SQOA 4WY3A 4ABAA 1VZQH 1ELVA 2PKAB 5GNDA 3A86A 1ZMNA 3ENSB 2SGEE 4MPXA 1SGYE 3EA8A 2WV9A 2QXHA 1HUTH 1V2MT 2VWMA 3P8NA 3T29A 4D9RA 4O03A 4RN6A 3SI3H 1UJ1A 4FXGH 1ELCA 5C3NA 1LVYA 2A1DB 2CV3A 2YNBA 1AVXA 1HAOH 4FUCA 1V2QT 3GOVB 5DPAA 1Y59T 1IQFA 4ASUD 4ZROA 4IS5A 1YLCA 1TQ0B 1CA0C 3BTKE 3M36A 4B6EA 1QA0A 1GGDB 1V2WT 2F9NA 2PUXB 4SGBE 2I6SA 4UFGH 3PLKA 3QGJA 3DCLA 1NBME 2ZGCA 2EI6A 2GP9B 3K6YA 3MWIU 1G3BA 2KAIB 1LMWB 3RC5A 1P9UA 2WPKS 5L2YH 1QJ1B 1GBAA 1TPOA 3ZZ3A 3QLPH 2ZQ1A 2AMQA 3RP2A 2AIPA 2VJ1A 1CQQA 1UK2A 1SR5C 5AVDA 1GVKB 2J98B 1CA8B 3EA9A 1SOZA 1O5AB 2ZPQA 1YPLH 1Z6JH 4K60A 1F0UA 1N1LA 3A7YA 1H4WA 1C2FA 3RXTA 4E7NA 3TGIE 1GMCF 1RJXB 2ZU3A 5EPNA 4ABIA 2WV4A 5I46H 1FXYA 3GCOA 2AGGX 2SNVA 4Z1MD 3GS9A 1UVUH 1LVOA 5JYIA 3PB1E 1A0LA 1RIWB 3KYFA 2VWNA 2KR7A 2THFB 1WSSH 2QE7D 1T8LA 1O3LA 3RXVA 1C5RA 1ELAA 1P2KA 3GICB 3A84A 1ZHPA 2F91A 1YKTA 3SU4A 4DIHH 3SNBA 2H6MA 4X1PU 4Y0YE 1QBVH 3E0PB 3MO6A 2AGIX 4HTCH 1AKSB 3MNBA 1KXDA 1CGIE 1O3EA 9ESTA 2QXJA 2OD3B 1HFDA 3QDZB 2WSSD 1K1LA 4TWYA 4M7GA 1S81A 1TRMA 3SJ9A 3T27A 5K0HA 4X1NU 1DICA 1OP0A 2UWPA 5LPFA 3HKJB 2BLVA 2BD5A 1Z8GA 1EB2A 1EAXA 1RFNA 4FUDA 1QB6A 1FZZA 4K8YA 1XM1A 1Z8IB 1FQ3A 1LHFH 1O3KA 4I7YH 4PROA 1MKWK 4B74A 1AI8H 2ZGHA 4Q7ZA 4TSFD 1OXGA 4UFDH 1IAUA 1QZ8A 3Q3KA 2ZHWH 1GBFA 4YOIA 2FM2A 1G9IE 1TE0A 4INHA 3GY6A 4WH6A 2BY8X 1BRCE 3MQKC 3K9XB 1J15A 1HXEH 1E1RD 1W0YH 2VIDA 5A2MH 3A89A 5HM9A 4X0WU 3KQ5A 3V3MA 1UTLM 2WINI 3T62A 4DCDA 2Z9JA 3U1IB 2G81E 1D3DB 3PO1C 1MH0A 4YESB 4Y8YA 1DWBH 1L1JA 1D3PB 1C2DA 1Z6EA 1LHGH 3SJKA 3SU2A 1O0DH 3F2HA 1SGFG 4Y6DA 1SGCA 1JRTA 1VKYA 1MD7A 2F4LA 1HAIH 1XXDA 5C0UA 3C1KA 1YLDA 1NFWA 3VB3A 4R0IA 1PYTC 4ISNA 4I8HA 4Q80A 4ISIH 4OS1A 4THNH 2RDLA 4VGCC 4AFSA 5E2OA 5HKKD 1ZSKA 1FN6A 4O97A 4H6SB 2BOKA 1A61H 4AZ2B 1Z1JA 2BDYA 4J2YB 4FU8A 1ZLRA 3AK5A 3LGUA 3ZZ5A 3UOUA 2Z3CA 5ETXA 1A0JA 1SKYE 3FAOA 4GSOA 1TYNA 3RXHA 4TWWA 1S6FA 2LPRA 4ISLA 5HGGA 4ABFA 2OC1A 3LH1A 3JZ2B 4DVAU 1UCYK 4YO9A 1PQ5A 2VIVA 5DG6A 5DP7A 1AFEH 4MG3A 1OWJA 2WPHS 2QF4A 1NBMD 3E16B 1X7AC 1FUJA 2FOFA 1ANBA 3PWCA 1C4U2 1ETSH 3RLYH 3ZVDA 4JCNA 4X8SH 2ZHQH 1FV9A 3R0FA 1ID5H 5IK2D 3PMJA 2UUKB 1QFKH 2BTCE 4OS7A 1HGTH 1DLKB 1RRKA 1GI3A 1MTUA 3DFLA 1C5PA 3VXFH 3U1JB 2PUQH 2J94A 3ZIAD 1O2PA 3CS7A 1VJ9U 1GJAB 3RXIA 3RXMA 1O2ZA 5C1UA 2BDAA 1GJCB 1O32A 2WPDD 4ZKOU 1T8OA 3E8LA 2CJIA 2JJ1D 2XNIA 2ZPRA 8KME2 4NA8A 1F7ZA 1ZPCA 1C1OA 1NRQH 3DSPA 3LGVA 3PMBB 1P9SA 1P03A 2VBCA 4TT3D 1BMFD 1GJ7B 2GV6A 4FUIA 1O30A 2ZC9H 1EAUA 4ZHMU 1C5OH 3ATIA 5E0JA 1Y5UT 2VIQA 3Q3YA 2FOAA 2KZ4A 3OY5U 6GCHF 3U28C 1F0SA 5HXFA 1QA7A 2Y82A 3A7VA 8GCHG 1SBWA 1L4ZA 4A1TA 5CDFE 2HNTC 2VU8E 2BD3A 3ZVGA 3TU7H 1T4UH 2WHXA 4GUXA 4B73A 5FHTA 3NZIA 1O2SA 2OBOA 3Q00A 4CR5A 1GHAF 3TH3H 1FY3A 1O3DA 5AHGH 4OS2A 1GI9B 3C27B 1EPTA 3EGKH 5EG4A 1BRAA 9LPRA 2CGAA 1FIWA 2GZ8A 3T26A 1CGJE 1TRYA 3LGYA 3W95A 4GCHF 4RT1A 2BDBA 2FLBH 1DSUA 2C90B 4I31A 3QN7A 1NN6A 3F68H 1P2NA 5HMAA 1GHAG 1IQKA 4AYYB 3OY6U 3QZRA 1FONA 4RSPA 4WWYA 1D9IA 4AB9A 1TA2A 1K1MA 7ESTE 8GCHF 3SUGA 3A81A 2SGPE 4I33A 4X2WA 2UWLA 3UFAA 1SFQB 4ABGA 4BANB 2LELA 1TPSA 2FMJA 4Z0KA 5HYOA 3U8OH 1O3FA 3PMAB 4B71A 2ZG0H 1FI8A 2XWAA 3U8RH 3FOAA 3TH4H 3LT3A 1ZPBA 2PSXA 1W0ZU 2P3UB 1BCUH 1NRNH 4IC5A 5FCRA 1GBLA 2V35A 5BPEA 3SQEE 1Y3XA 2QF0A 1XUIA 2ZFPH 1AZ8A 1A1RA 1EJNA 2GCTC 2A5KA 2WPJS 3ATLA 1W10U 4MPVA 1YP9A 1VCQA 1GL1A 1AD8H 3K65B 3PLBA 4XD7D 1ELBA 3IG6B 5CHAC 2AGEX 1Z7KA 1YM0A 3BTEE 3F2FA 2A45B 3RM0H 1VITG 5J4SA 5GWZA 1YY3A 1BMNH 1CT2E 1O3HA 1SGDE 1NU9A 4NZLA 1S83A 2A7JA 2STBE 2W3IA 3M7TA 3UIRA 1DXWA 5F03A 4ZKRU 1HRTH 1GJ9B 1TX6A 1LDTT 1WOFA 1PQAA 1S5SA 5FXLA 2OLGA 1YYY1 5DSFA 1GMDF 3TK9A 3MTYA 3FP7E 3QWCH 4BTIB 1PPHE 3KGPA 2BD4A 1QRWA 2BY6X 3I77A 1DS2E 3VGCB 5EPYA 2PGQB 2XWBI 1HIAA 2RA0A 3ATWA 1CHOF 1GBBA 1XUGA 1LPGB 2A2QH 1C1SA 4MNYA 1DE7H 1C5YB 1GDUA 1P8VC 5SGAE 1GBDA 2WPMS 1RTFB 4CR9A 1QBNA 4KKDA 3OAAD 4D7FA 2EI8A 5C1XA 2CN0H 1V2LT 5A8YA 3RXQA 3MNCA 2Q6FA 2K0QA 1O3IA 4JZIA 2CK3D 3NXPA 2ANKH 4ABDA 1DY9A 4NIYA 5EXNA 1T7CA 1RD3B 1THRH 4CRFA 1ZMJA 5F8XA 2FPZA 2GTBA 3VG8A 1HAPH 4BXWA 2FOMB 1V2RT 1T32A 2Q1JA 1MUEB 2AFQB 2J95A 3UREA 1CA0B 1TFXA 4F55A 2PTCE 2OCVB 3VB4A 2ZDKA 4BTUB 3S0NA 1Y3WA 5F6MA 3KL6A 4HFPB 1FMGA 3NUMA 1SHYA 1UTOA 2XC5A 3P6ZB 4WF8A 3OEED 1Q31A 1IQLA 2Z9LA 4ZH8A 1NC6A 1BTWA 3A8DA 3GY7A 4O9VA 3ZZ8A 3TITA 3TK5A 1D6RA 2UWOA 3F6UH 3OEHD 4Y71A 3GYMA 4WH8A 3UNRA 2C8YB 4I8GA 3OSYA 4WMFA 5A8XA 5B6LA 5DN6D 3Q3XA 2IN2A 1C1VH 4JZ1A 3A88A 1F2SE 3UB0A 3RXPA 2A32A 2AH4X 3Q76A 1GBHA 1GCDA 2Y7XA 3KNXA 1FX0B 5L2ZH 1TBZH 2GV7A 2OQUA 3EA7A 3STIA 1O2GH 1DWDH 4FUBA 1SI5H 1TB6H 2FI3E 1O38A 1SGTA 1Y3VA 3IWMA 1ZZZA 2DUCA 1CGHA 4AC9A 1O34A 1AUJA 2ZECA 4MNWA 3M3VA 1FY4A 1OYTH 1DSTA 1UVPA 2NU1E 4B75A 1WBGB 1MTVA 5AFYH 2ZEBA 5KECA 2DE9A 1KXAA 4JYUH 3SJIA 1J8AA 3UAIC 1MBMA 3DUXH 5GIBA 3FO8D 3KF2A 1BTXA 1C2IA 3DSGA 3UOPA 1LCYA 4OM9A 1K22H 2CHAB 5JPMH 1O2OA 1TGBA 2XOKD 3SUEA 1BTZA 1C2MA 1S6LA 3E1XB 1GBMA 1G30B 3P8OA 3S7KB 1AO5A 2IJD1 1EASA 1ZJKA 5GCHG 1GVLA 4IMQA 4FUHA 3H7OA 3RMLH 4ISHH 3UTUH 1TGTA 3EE0B 2VGCB 1O3JA 1P05A 1OYQA 4Y8ZA 1DFPA 5ESTE 1LTOA 1V2OT 1SQTA 2STAE 1O3NA 4I86A 2FWWA 1TOMH 1W0JD 2VWOA 3PV2A 3UNSA 4CRGA 4XOJA 1C2JA 2ZA5A 1EZXC 3MMGA 5E2PA 2P3TB 1HIAB 3UQVA 4AX9H 1NZQH 2BLOA 1SLVB 4BXSA 1XUJA 1EPTC 4A1VA 1SGQE 1A4WH 2CXVA 2V3MA 2ZFRH 3BTGE 3QUMP 2BQ6B 2OK5A 4F48B 2ZCHP 1JRSA 3F0PA 3LC5A 1AUTC 1LHCH 2O8MA 3SHAH 3RMMH 1B0EA 2FEQH 1FLEE 1PPGE 1Q3XA 1A2CH 1EZSC 1TNKA 4OGYA 5TCCA 1ZR0A 2G52A 1O2JA 3RXAA 4ESTE 2ZKSA 1O37A 3RM2H 3ZVCA 4ZHLU 1GHZA 1COWD 1ANEA 4IN2A 4U01A 3P95A 1CBWC 3M3TA 4JK6A 1O36A 1QJ7B 3PROA 2W5EA 3A83A 4YOGA 4ZCNA 1C5LH 4H6TA 1C1RA 5FL7D 2BOHB 2BY9X 2ZTZA 3AVZA 2Z3DA 4BAMB 4CREA 1P12E 1E1QD 1NS3A 4XSKU 4FOUC 3SI4H 1UTQA 3LJOA 2F3CE 1C1PA 2XCFA 4GHQA 3OE7D 1BZXE 1DUAA 1EOLA 2Y7ZA 2ZI2H 4O3UA 3RMOH 3SZNA 1SQRA 3BG4C 3ZZBA 1TMUH 2GCHF 5EW2H 2GJGA 2PKAA 5C17A 2C4FH 1MCTA 1TA6A 1HCGA 3KQCA 3BTTE 1EZQA 4KP0A 4KELA 1Y5BT 4DG4A 1W3CA 2OC0A 2FOGA 1FAXA 5HIYA 1L0ZA 4K1EA 3OX7U 1ARBA 3ZVEA 1C1NA 5EOKA 4K69A 1SG8B 3N7EA 3SV2H 1NROH 3E3TA 1A0HB 1XUHA 4ACAA 4LK4A 3B8JA 1RTKA 3EE7A 2FI4E 2QIQA 2KCYA 1AB9C 2XW9A 4X2VA 1GI5A 1XKBC 1QL7A 2UUYA 4B2BA 4CRDA 2XCNA 3LDXH 3OFND 1ZSJA 1CT4E 2GMTB 2ZF0H 1GMDG 2A7HA 1QURH 1OOKB 3MNSA 2AMDA 3EAJA 1UO6A 4YT7H 3U9AH 2RCEA 2VGCC 2ZU4A 1KLTA 2ZZUH 1EX3A 5DP9A 1E36B 4A7IB 1PPCE 3FFGA 2Z9KA 1ESBA 1Y8TA 4GLYA 2PWXA 4E7RG 4XFQA 4BNRA 4X6OA 1QQ4A 1SLXB 4JYTA 2ZU5A 4NZQA 2HNTE 3SU6A 1UTKA 5A0CA 1GMCG 5EXMA 3TNTA 3P92A 3PRBA 5E0HA 1P01A 2I6QA 1C5TA 3K6ZA 2FIRH 4X1QU 2VIOA 4Y79A 1TBRH 3SW2B 4XBDA 4AGKA 2BB4A 1KXCA 1UTNA 2ZFTA 3V0XA 1XVOA 2H9HA 5FBEA 2ZIQH 4U30A 1HAVA 2HPPH 1V2TT 2L74A 1QBOA 3T28A 3SV9A 1GI4A 1BBRK 1AY6H 1GDQA 3GCHB 1MTNB 1GCTB 2J2UA 1O2IA 1ETRH 3WWFA 1C2EA 1O2UA 3ZYEA 3WWBA 1GMHG 1P57B 1DVAH 3RU4T 3QX5H 4P00A 5T6DA 3VGCC 1NRSH 2ANYA 2BQ7B 1G2MA 2OQ5A 4Y76A 1HPGA 1MZDA 1TNIA 2BDHA 1GI6A 2PLXA 5L6NH 1INCA 1ZTLA 3MU4A 5FX5A 5JBCS 1HAXB 2PR3A 1A46H 4K1SA 1P2OA 3SJOA 4Y7AA 1TNHA 1YF4A 5DP5A 1AMHA 1MKXK 2HGTH 4O3TA 1LVBA 1JIMA 1C5VA 4R8TB 3SN8A 2VWLA 2IJOB 1TNGA 5DKMA 1FY5A 1K1PA 1EOJA 2FX6A 1GI7B 2XC0A 1PPFE 1S0QA 1BMLA 2PW8H 2BDIA 4M9FA 3BG4B 1C2KA 2AIQA 4UD9H 7LPRA 3ZZ6A 1BIOA 4J1YA 2KFWA 4JZEH 5EIYA 4JZDH 1ELTA 2BLQA 2ZCKP 2Z6BD 1QB1A 5C0TA 6LPRA 1O3BA 2LNCA 2ZQ2A 4H4FA 1TIOA 3PLPA 1KTTB 1G36A 4X6MA 1V6DA 4XE4A 2A31A 2EC9H 2ZU2A 1ORFA 1ZTJA 2BD8A 3D49H 4I8LA 2BQWB 2NU0E 4YM9A 1C1TA 2HPQH 2YNAA 1K1JA 5C94A 1M9UA 2OXSA 2EQNA 2JJ2D 2ZP0H 3NKKA 3TJVA 1YCPK 2TGDA 2PV9B 3FP8E 1PFXC 4DURA 1U6QA 4NG9H 1XX9A 4K8BA 1TX7A 1GJ6A 1OP8A 1L2EA 4LZ4B 2R2WU 3ITIA 3E6PH 3L3TA 2JH5D 3BF6H 2GT7A 4FUJA 2SGFE 3F1SB 1SLWB 2SGAA 2ZTXA 4ZXYH 1ZMLA 2BLWA 5GPIB 2G00A 4YTAA 4BTTB 1BTYA 2O8TA 1HJAB 5J4QA 1ETTH 2J98A 2JETB 1FAKH 1F5RA 3S9CA 3BSQA 1W12U 4WJG2 4AORA 4E05H 1YLNA 2V3OH 1GHBG 1GI8B 3LGIA 3DD2H 3BTQE 2A7CA 1BRBE 5HIZA 1TPPA 4A92A 2GCHG 4OS6A 1G2LA 3A7TA 2AERH 4GVUA 3B9FH 1WV7H 2KAIA 4Y7BA 1C1MA 3UPEA 3MO3A 2TGAA 1NFUA 2BX3A 4Q4LA 2AHME 2O8UA 3RXSA 4ABHA 2K8IA 4XDEA 1HJ8A 3F3BA 1UK3A 1GVZA 3A85A 3TJOA 5JB8S 1GBEA 4DW2U 2XBXA 1J14A 1PYTD 2FP7B 1C9PA 1GHVH 1JMOH 1O5CB 2O9QA 2J97A 3U98H 2YOLA 1EUFA 1ELFA 7KMEH 1MAYA 1WUNH 2XBVA 4CBOA 2QN5T 3SGQE 1C5XB 1W8BH 4X2XA 3A8BA 1FPHH 1HAVB 3GYLB 3OTJE 8LPRA 1LO6A 4ACBA 3N7OA 4KGAA 2V7QD 2GMTC 3SNEA 1VGCB 3LONA 3O8CA 4BAHB 1O2YA 1IQNA 1J17T 2RG3A 1B7XB 1DITH 4CRBA 4LZ1H 5DK1A 1E37B 1BTPA 1UVOA 4RKJB 2GX4A 1N8OB 2W7UA 1WXRA 5EJZA 2SNWA 1GJ8B 1OWKA 4BAOB 3ZV9A 2WUBA 4X1RU 4NFEA 5EU8A 5DJ7A 3UR6A 2EI7A 1SFIA 1A3EH 1OP2A 1P02A 2R0KA 3GDVA 5FPSA 1S82A 2JDID 3SORA 4IGDA 2R3YA 1GJDB 1ZJDA 1Y3UA 1RGQA 3UY9A 1GDNA 1YPHC 3BTWE 5T6GA 3MH4A 1YBWA 3QZQA 1IHTH 3MNXA 3NCLA 1GJ4H 2FXRA 1BITA 1MU6B 2OBQA 2B8OH 3SV8A 1O2MA 2ANWA 1AE5A 3RXJA 3RU4E 5LPEA 3QTOH 2CF8H
chains in the Genus database with same CATH topology
2BD2A 1AU8A 1B5GH 1BTUA 5CHAB 4GCHG 1QR3E 4OGXA 2HOBA 3BEIB 4YZUA 3CP7A 3KN2A 4OS5A 2GCTB 1C5SA 1MKXH 1IHSH 3MU0A 1FDPA 1NT1A 2GDEH 1AN1E 1EAWA 3SJ8A 2BYAX 4FUGA 1A5HA 1GBKA 4JK5A 3H7TA 1TMBH 3RXCA 4WMEA 1YC0A 1O3GA 3ZVAA 1V2JT 1O5FH 1AIXH 3PV4A 1CVWH 3BTHE 3EQ0H 1CBWB 1C5WB 5EW1H 4A5TS 2WYJA 1N6XA 1P2IA 3B23B 4WMDA 5I25A 5JB9S 2WV5A 3HK3B 3IITA 3ZYDA 5G4BA 2Y5GA 1UTJA 4MNVA 5T3HA 3LGTA 1SB1H 1AWHB 1DANH 5AFZH 1HV7A 2W3KA 4ZHAA 2CF9H 5LH8A 5TJXA 3F9FA 4IMZA 1YCPH 1DY8A 1D6WA 2WYGA 4TPYA 3L33A 5B6OA 3M5MA 1ZRBA 3FANA 3M3SA 3TIUA 2QC2A 1ZGIA 4IN1A 2XTTB 1SC8U 2OTVA 2VNTA 4Z6AH 2ODQA 2A4OA 3BEUA 2A5AA 1TABE 1QL9A 1THPB 1K2I1 3MO9A 2BZ6H 4D7GA 2V0BA 3UWIA 1UMAH 2XRCA 5EQQA 3RXDA 3SV6A 1W7GH 3TK6A 1LPKB 2FO9A 1ELEE 2J9NA 2HWLB 1EXFA 1RXPA 3O8RA 1NTPA 1D3TB 1VITH 2FOEA 1TALA 5A0AE 5F8ZA 2ZCLP 1ESAA 1T8MA 1WQVH 3SNAA 2Z94A 1O2NA 1H8DH 2BHGA 1EKBB 4Y8XA 3KQDA 5GJ4B 3MHWU 1P04A 1DT2A 1SGFA 3SGBE 2UUJB 1JXPA 3E0NB 5TCAA 2G55A 5JBTA 4Y11E 2J4IA 2ZFFH 1CHOG 1TRNA 3U69H 2F9VA 1O5BB 3KCGH 4U2WA 1A5IA 1OWHA 3STJA 7GCHF 4RKOB 1HNEE 3SHCH 3EYDA 3ELAH 3KIDU 2W7SA 3TVJB 2NU2E 3ZZAA 3RXFA 1GBCA 2D2DA 2CMYA 1WTGH 2QXGA 1C4V2 1MTWA 1BHXF 1TNJA 2VVUA 1SSXA 1C5ZB 5FCKA 2HVXA 4UFFH 3Q77A 1ZOMA 3RXUA 4FUFA 1GG6C 1EAIA 4NA7A 1YPMH 4X8VH 2ASUB 1J9CH 2VINA 1BRUP 1HDTH 2FTLE 2ULLA 4WXVA 5A8ZA 1K21H 1BA8B 4YLQH 1XKAC 4VGCB 1F0RA 4ZAEA 5K7RA 1IQIA 1T31A 2ILNA 1PQ7A 2FYRA 1ARCA 1O5DH 4INKA 4U32A 4CHAC 4JZFH 1MTSA 2IOTA 3T25A 2H2ZA 4NSYA 2P95A 5EXLA 1UTMA 2QXIA 3A7XA 2Y6TA 3ATKA 1NRRH 4MPUA 5F8TA 4CRCA 4AYVB 3HGNA 3RXOA 3SU3A 3RDZA 3KHVA 4HZHA 1ANCA 5JBBS 2GZ7A 4NIXA 3RXLA 1AB9B 2FX4A 2ESTE 1PQ8A 3A7ZA 3M5NA 2F9OA 4GHTA 1JWTA 2AEIH 3DHKH 3UQOA 1GMHF 4KTSA 1Y5AT 3SNCA 3RXEA 1T4VH 1L4DA 1ZTKA 2G4TA 3TLOA 4BAQB 1MTNC 2OC7A 1D3QB 1K9OE 3KQEA 3SOSA 3GCHC 4OS4A 1QTFA 1AVWA 3ZVFA 2FI5E 1V2NT 1EQ9A 3HPTB 1GPZA 2HALA 4FVDA 1TBQH 4MLFB 3OYPA 2V3HH 3S69A 2BD7A 3P17H 2HLCA 3ZZDA 1QY6A 3UR9A 1HYLA 1UVSH 3DFJA 1BJUA 3TGKE 1SHHB 5IDKA 4AB8A 1NO9H 1FIZA 5PTPA 3E90B 1W7XH 3VB6A 1GJBB 4AGJA 1NFXA 4X8UH 1JIRA 1GG6B 5EODA 4JMYA 2D8WA 3A8CA 3URDA 1G32B 2B5TB 5LPRA 5ESBA 3F9HA 4NGAH 2UUFB 1MQ6A 3QGNB 2EA3A 3FVFB 1O31A 2GD4B 2XC4A 2WUCA 3UWJH 1HAHH 5C2ZA 1ZYOA 1MZAA 1O3MA 2IPHA 3RXKA 4ASHA 1O2VA 1TGSZ 4GPGA 1S0RA 3V13A 5C5NA 2ZGJA 3M5OA 4D76A 1G3EA 2VVVA 5FPYA 1Z8RA 3PYHA 1O5EH 1BBRE 3TJUA 2FOBA 3PMHB 4GAWA 1HAYB 1A7SA 2ZDMA 3RLWH 3BV9B 1PJPA 5E0GA 1O2LA 3ZZ4A 2OP9A 1IQEA 4NCYA 3RC6A 4B1TA 1SVPA 2H1UA 1ANDA 1A5GH 1ELDE 1GHWH 1V2KT 1GI0A 3RXBA 1XXFA 4K2YA 1OKXA 1QL8A 3GDSA 2HNTF 3BG8A 1E38B 3VPKA 1SMFE 1HAGE 2ZNKH 1KXEA 2C93B 5GDSH 1EPTB 1IQJA 1WAYB 5JDUB 1VGCC 5DGJA 1ZPZA 3GY5A 2FESH 2P16A 1NU7B 1SPJA 6ESTA 1KSNA 1O2HA 1EB1H 2P59A 3GY3A 2O8LA 4FU9A 3M61U 1KIGH 3PTBA 1XVMA 3SUDA 1ACBE 4YLUA 1AE8H 4B76A 3A7WA 3U8TH 1ZHRA 3LIWA 2B0FA 1AGJA 1P3CA 1G3DA 3G01A 2BMGB 2VH0A 2BD9A 1WQSA 3MU5A 3VEQB 4CBNA 1GWAA 3ZV8A 5CE1A 3URCA 1C2GA 1OPHB 2C8WB 1UHBB 1GBTA 1O2QA 3HK6B 1LQEA 1EJMA 2XBWA 1DWCH 1F92A 1SGPE 2PFEA 2BX4A 2P94A 1WU1A 1Z1IA 3A82A 3AASA 1L1NA 2R3UA 2ZHEH 1YPGH 1XUFA 3A87A 1P0SH 3A80A 5A0BA 2JH0D 2JKHA 1F5KU 2ZGBH 4ZKSU 2VVCA 1KXBA 1EP6A 1OX1A 1C9TA 1VCWA 2EEKA 2Q6DA 3HATH 1PPEE 7GCHG 1EATA 4A6LA 1BB0B 1FJSA 3RUOA 3NK8A 2XBYA 4MQAA 1ABIH 5DP3A 2ZDLA 5GCHF 1LHEH 3SBKA 1NM6A 3DT0H 3AW0A 1SL3A 1TWXB 2PKSC 1PPBH 1BT7A 1KLJH 1Z71A 2VB0A 2TGPZ 1GBJA 4E06H 1VITF 1AKSA 4IW4E 2D1JA 1ELGA 2ZGXH 1ZHMA 3GCTG 4K3JA 3TH2H 3V12A 1S85A 1TAWA 2TBSA 3KQBA 4I32A 1IQGA 1RTLA 6CHAB 1O2XA 3OU0A 4AFUA 1YPJH 2B9LA 3A8AA 5EGMA 1C5UA 1V2VT 3ZZCA 2J38A 3LPRA 1GBIA 1D4PB 2W26A 3HKIB 3HGPA 3O8DA 1E0FD 2FDAA 3RU4D 1W13U 3R3GB 2Z9GA 2FZZA 1DM4B 1GHYH 1FPCH 1UCYH 4LXBH 3SU5A 1QIXB 3P8FA 1TX8A 4SGAE 3F9GA 1THSH 1C5MD 1TGCA 4CH8B 2BDCA 2F9BH 2ZFQH 4TPIZ 5CMXH 1K28D 4AN7A 4IC6A 3TJNA 4D9QA 5C1YA 1VJAU 1ZSLA 1FY8E 2GT8A 4ABBA 2NU3E 2QGRA 3PO1B 1LPZB 2PGBB 1UCYE 1YGCH 3H5CB 4X6NA 2FLRH 5DO4H 3JZ1B 3NPSA 1P2QA 1IQMA 1MQ5A 1UHBA 3ESTA 1NPMA 1IQHA 4TY7A 1BOQA 2GVFA 3QO6A 4WVPE 4BAKB 2GZ9A 1O5GH 1V3XA 4AG1A 4I8KA 1F0TA 3VXEH 1MBQA 1UK4A 3BTFE 3RC4A 1O39A 1K1NA 4HI3A 1BUIA 5FX6A 1MU8B 1TQ7B 1BTHH 2P93A 3T5FH 2D26C 3TNSA 2H5CA 3BN9A 4ABJA 2CHAC 1N8OC 2V6NA 5C5OA 1FN8A 6GCHG 1NRPH 1WCZA 3ODDA 2F83A 2NWNA 3V7TA 2QYIA 2TGTA 3MFJA 3D65E 1DPOA 2FS9A 4ISOA 1HJ9A 4NWLA 4K1TA 1HAZB 3GY8A 3GY2A 1V2UT 3BEFB 3I78A 4K5ZA 3FZDA 3AAUA 3ODFA 4IBLH 3M7QA 5T6FA 1NFYA 4MVNA 2JETC 4X8TH 2F9UA 3SU0A 2ODPA 1YCPM 4X6PA 1DX5M 4F49A 3GY4A 1L1GA 1Y3YA 3VB5A 4TY6A 1EP5A 2ANMH 3SNDA 3UUZA 2BVRH 2ZU1A 1BDAA 5LGOA 1C1UH 3LKWA 2G51A 1QNJA 4CH2B 1GI2A 1QB9A 2A2XH 1J16A 2FOCA 1LVMA 1ESTA 1O2RA 1LHDH 1P3EA 1MAXA 1O2KA 1WTHD 3D23A 1ABJH 2QA9E 3GDUA 1AZZA 1HJAC 1V2ST 4ZKNU 3LU9B 1QQUA 1A3BH 1AVGH 5BRRE 2QCYA 3F9EA 1HB0B 2H5DA 3BIVH 1LKBA 1G3CA 3VFEA 2FYQA 4WXIA 4CRAA 2GGVB 3L6PA 1TPAE 3BTME 3LGWA 1JOUB 2RA3A 1LKAA 1N6YA 2BVXH 1DWEH 3UNQA 2ALPA 1HBTH 2TIOA 2QV1A 5JBAS 1YPKH 1YPEH 1C4Y2 1NY22 4D8NA 3MH5A 1KYNA 1P06A 1RS0A 4X2YA 4XBBA 4B2CA 1GGDC 2BXUH 2A0QB 2TPIZ 3PWBA 2WPIS 2P8OB 2AS9A 2ZFSA 4Q7YA 3NWUA 2AYWA 6CHAC 2GDDA 3TGJE 3P8GA 4I8JA 2Y5HA 1BBRH 1GHXH 1ZRKA 4Y0ZE 2BM2A 3WY8A 1SGRE 3ATMA 3LJJA 4NIVA 5C67A 1TONA 5ABWA 4AOQA 1OSSA 3T2NA 1SGIB 4B2AA 1H8IH 1AFQB 2PKSB 4MDSA 3MU1A 1CT0E 2GKVE 1C5QA 3VB7A 2ZDNA 3EDXB 1AHTH 1B0FA 4TYDA 4DT7B 1G37A 2ALVA 2OC8A 4UONA 2ZDAH 2P3FH 2FTMA 2Z7FE 1TNLA 1C2HA 3O8BA 4MNXA 1QRXA 1DDJA 2ZHFH 1AWFH 2J92A 2O8WA 4LOYH 3M7UA 4UE7H 2BZAA 4A1XA 2BDGA 4F4OC 2SGDE 3MI4A 3SUFA 2VIPA 5E8EH 4DY7B 4YOJA 1C1WH 2ZO3H 1E34B 1BMMH 1HLTH 4H42U 1EJAA 3QTVH 1KLIH 1CU1A 1P10A 1C2LA 5FBIA 4AG2A 3GCNA 3PM3A 4CHAB 1FY1A 2R0LA 1UVTH 2G5VA 1BMAA 1S6HA 1O3AA 4Q2KA 3P70B 1EZUC 2J34A 1QGFA 4NSVA 5IYTA 3SQHE 5DP4A 1P2JA 1SGNE 1O2WA 1TGNA 1WYKA 4KTCA 1JBUH 2M5TA 4YT6H 5HM2A 5AF9H 4DGJA 4NWKA 2XXLA 1P09A 2Y5FA 3MH7A 4UFEH 5DP6A 2ZPSA 5A09A 4AFQA 3MU8A 1MD8A 2QAAA 3SV7A 1XUKA 3RMNH 1FNIA 2H9EH 5H4IB 2C8XB 1T8NA 3M35A 1O35A 2TRMA 3S9BA 1Q2WA 1W2KH 4JYVH 4X1SU 5FAHA 2BVSH 1O33A 2Y81A 5EQRA 2PSYA 1V2PT 2Z3EA 1K1OA 3ZZ9A 1KDQA 3KEEA 1OWEA 1KY9A 2F9PA 2G8TA 3LH3A 1HXFH 4Q7XA 2G4UA 4FUEA 3GCTF 3LOXA 3BIUH 1YPHE 2SFAA 2ODYB 2PHBA 2B7DH 2FOHA 3ZVBA 1QRZA 2Z9IA 3AW1A 3S7HB 5DP8A 1O3PB 1CHGA 1C1QA 1BHXB 1SQAA 2XYAA 3RXRA 2BY7X 1VR1H 3MH6A 1CO7E 1W11U 2PTNA 1P11E 2C8ZB 3CS0A 4KTUA 2OUAA 2FODA 1BJVA 4ZMAH 1E35B 2R9PA 3S9AA 3SGAE 1ZGVA 1KXFA 3PTNA 3D62A 1S84A 1TLDA 4ZUHA 4NIWA 4DIIH 1H1BA 2K1QA 2C3SA 3SO3A 8ESTE 4NFFA 3RXGA 3SU1A 3BTDE 1F5LA 1OS8A 3CENA 1MMJN 3FP6E 4MTBA 3QK1A 1TMTH 2HRVA 2AMPA 2DE8A 1C5NH 2ZHDA 1W14U 3M37A 2QF3A 4FU7A 4UDWH 3K2UA 1CSOE 2H9TH 4DOQA 4NA9H 2A4GA 1H9IE 2VH6A 1MCVA 5FPTA 1RIWC 4ABEA 2A4QA 3AAVA 1O3CA 1MKWH 2BXTH 1DOJA 1BQYA 1K1IA 3I29A 1QJ6B 4HGCA 4MPWA 1H9HE 4BOHA 3GISB 2G5NA 2ZTYA 3MOCA 4QT8C 1TOCB 1O2TA 1DUEA 2A5IA 2BY5X 2VIWA 3LC3A 3MYWA 1IOEA 1GJ5H 3DA9B 1Z8JB 2ZWLH 2A4RA 1GI1A 1DXPA 1VCPA 1CE5A 3M5LA 1SGEE 1UTPA 1GHBF 2Q6GA 3E91A 1GL0E 1O3OA 2WPLS 1KTSB 1H9LB 2SGQE 1SLUB 1PPZA 2ZDVH 3TPIZ 1P2MA 1OWIA 2QY0B 1QHRB 1LQDB 3FZZA 1NESE 2Y80A 1AQ7A 5L30H 1SOTA 2P8OC 5EQSA 1KDQB 4DJZB 4Y10E 2FS8A 2JH6D 2OINA 1DLEA 1QCPA 4INLA 1GCTC 4UEHH 4XBCA 4ZXXH 1XMNB 4AFZA 2R2MB 3W94A 3ZZ7A 1OWDA 4FVBA 2NU4E 5GXPA 1AFQC 5C20A 1SQOA 4WY3A 4ABAA 1VZQH 1ELVA 2PKAB 3A86A 1ZMNA 3ENSB 2SGEE 4MPXA 1SGYE 3EA8A 2QXHA 1HUTH 1V2MT 2VWMA 3P8NA 3T29A 4D9RA 4O03A 4RN6A 3SI3H 1UJ1A 4FXGH 1ELCA 5C3NA 1LVYA 2A1DB 2CV3A 2YNBA 1AVXA 1HAOH 4FUCA 1V2QT 3GOVB 5DPAA 1Y59T 1IQFA 4ZROA 4IS5A 1YLCA 1TQ0B 1CA0C 3BTKE 3M36A 1QA0A 1GGDB 1V2WT 2F9NA 2PUXB 4SGBE 2I6SA 4UFGH 3PLKA 3QGJA 2ZGCA 2EI6A 2GP9B 3K6YA 3MWIU 1G3BA 2KAIB 1LMWB 3RC5A 1P9UA 2WPKS 5L2YH 1QJ1B 1GBAA 1TPOA 3ZZ3A 3QLPH 2ZQ1A 2AMQA 3RP2A 2AIPA 2VJ1A 1CQQA 1UK2A 1SR5C 5AVDA 1GVKB 1CA8B 3EA9A 1SOZA 1O5AB 2ZPQA 1YPLH 1Z6JH 4K60A 1F0UA 1N1LA 3A7YA 1H4WA 1C2FA