2A7CA

On the routine use of soft x-rays in macromolecular crystallography, part iii- the optimal data collection wavelength
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title On the routine use of soft X-rays in macromolecular crystallography. Part III. The optimal data-collection wavelength.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Elastase 1
total genus 65
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2a7cA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2a7cA01
3TK5A 2AS9A 5DP5A 2D26C 2VWNA 2SGQE 3QN7A 1UCYE 3PMJA 3KQDA 2IJOB 2VIDA 3PV4A 1TNKA 3RXUA 1ARBA 3VGCB 1ZSKA 4DOQA 1MU8B 1UJ1A 2OCVB 3E16B 4IC5A 1HAOH 2A2XH 5A8XA 1G3CA 1K2I1 1S0QA 1ABJH 1LKBA 2QGRA 1GBCA 3GICB 3QO6A 1VITF 2QF3A 1BMAA 3VB7A 2CJIA 1MCTA 4HZHA 2Y82A 1GJCB 4CREA 2FI4E 1CT4E 3DT0H 2O8WA 2ZDLA 3V0XA 1CGHA 2C93B 1C1QA 1WSSH 3TJUA 5A8ZA 2C8YB 1ZHRA 4BAMB 5DP4A 1MKXH 1D3DB 5A2MH 1MTUA 2NU0E 2BD2A 1FN8A 2ZGBH 3FP7E 1HPGA 2I6QA 3QX5H 3BTKE 1YGCH 6ESTA 4CRAA 4UONA 4BANB 1O2QA 1T8OA 3SNAA 3CP7A 4ISNA 4JZ1A 1UTLM 1AI8H 1NRNH 4MNXA 1SLWB 3TIUA 2FS9A 2W5EA 3RXVA 2P3TB 4XE4A 4FXGH 2EI7A 5EXLA 5FBEA 2XYAA 5F03A 3E8LA 2VU8E 3IITA 2UUYA 1HAPH 1GBAA 2VH6A 5L6NH 5B6OA 4ABAA 3QK1A 5C1YA 2OBOA 1GHYH 3TITA 3LC3A 1EPTC 3RU4T 6CHAB 4CRFA 1HRTH 2FOGA 1WTGH 1XXFA 2A2QH 1AKSA 2ZFQH 1GVKB 1MH0A 1GJ7B 5DP8A 1TBZH 3G01A 1TIOA 1HB0B 1DLEA 4SGAE 1DWCH 1ZRBA 3TPIZ 3VXEH 1O3CA 4DT7B 3MNCA 2Y6TA 3BG8A 4HGCA 3UOUA 4FU9A 4M7GA 2VIOA 4CHAC 4K1TA 2PKSB 1O2YA 3BSQA 5IYTA 1O3DA 1BTYA 1HJ8A 1SFIA 2B0FA 2Z9KA 2GV6A 1B0EA 4HTCH 2FOHA 2OQ5A 4D9RA 4BAKB 4AFSA 3P6ZB 1KLJH 2BLQA 1SGTA 3N7OA 4Y6DA 1ETSH 1UK3A 3RMMH 3O8DA 1ZPZA 5H4IB 1FY3A 2ZFTA 1E36B 4X1RU 1BBRE 3MOCA 3SNDA 2A7JA 2XC4A 3MO6A 1ELEE 4J1YA 1RIWB 1J16A 1TPPA 1HUTH 2ZCKP 1TYNA 3SI4H 1JIRA 4H6SB 1HXEH 4LK4A 1O5FH 4KTUA 1AVGH 1GWAA 4TWWA 4YTAA 5FXLA 7ESTE 2XXLA 1EZSC 2ZNKH 3RUOA 2ILNA 2PGBB 1AVXA 2C4FH 1DOJA 1K1MA 1PJPA 1CA0C 1YF4A 1YPEH 3KNXA 4MPXA 3LONA 1F5RA 2P16A 2H9TH 4X8VH 1FMGA 1ANCA 1YCPM 1EJNA 1O3EA 1C1UH 5T6GA 3A7WA 2PR3A 2HALA 2VWMA 4MPWA 3RXMA 1P3EA 1BHXB 1HJAB 2BY8X 2F9PA 2VVCA 4OS2A 4I32A 1BTWA 4YOIA 1CHGA 1UVSH 1FY5A 1HLTH 3VFEA 1C5ZB 1RGQA 1BTUA 1D3PB 2ZZUH 2QY0B 2BMGB 3P95A 1V2RT 1ZGIA 1XM1A 1PYTC 1NM6A 1GI7B 1ZSJA 3I29A 1C1OA 4AG1A 1OPHB 2BDAA 1TOCB 4RN6A 1SLVB 2GMTC 3D65E 4K1EA 1BTZA 1A5HA 4A1TA 3SV9A 2G5NA 1HAHH 1Y59T 2EEKA 2XC5A 4VGCC 1A3BH 1MBQA 1XX9A 1DSTA 1A1RA 1AIXH 1KTSB 4RSPA 1V2PT 4X6PA 4MPVA 1W2KH 1FLEE 1OWKA 1C2GA 3OY6U 4GVUA 3UNRA 3TH4H 2V0BA 4K69A 1WV7H 1ELTA 1EZUC 4CRBA 3V12A 2BLWA 5DJ7A 1GBKA 1FNIA 1GJ4H 3FVFB 1WOFA 1E35B 6LPRA 1C2FA 3RU4D 4X6OA 1O34A 2G81E 3M7QA 2WPMS 3E91A 2F91A 1TPAE 1QB6A 3Q3XA 1EUFA 1LQDB 2JETB 2A32A 3SUDA 1O36A 1BTPA 4XBBA 5LPRA 3ODDA 1Z8JB 3FP6E 1O32A 1A2CH 2AMPA 2FZZA 3RXDA 3LGYA 1DY8A 2OUAA 3VXFH 1Z6EA 4CRDA 1BRCE 1FDPA 4FUFA 1UK2A 2R2MB 4ZHAA 1SGNE 1HNEE 1P57B 2NU2E 2NU1E 1Y8TA 3ZVFA 1A0HB 1O31A 2QXIA 5K7RA 1TPOA 1TQ0B 9LPRA 1CU1A 4ABBA 1ETTH 1QBNA 1ELAA 4A5TS 5J4SA 1AWHB 2BLVA 1TAWA 3SGBE 1OS8A 3BTQE 2ZGCA 1O2HA 1GJBB 3B8JA 2J4IA 3GCNA 2GP9B 2GDEH 4K1SA 4Q7ZA 1K1OA 4MQAA 5EW2H 3DFLA 2F9UA 2OC8A 4X6NA 4JYVH 1C2JA 1TX8A 1YPGH 3MU4A 1H8IH 2F83A 3STJA 1O2VA 3RU4E 2GKVE 2FO9A 1GVZA 1WQVH 3L6PA 3SNCA 2VIVA 1RTKA 1EXFA 3RXKA 1H4WA 1MUEB 1T8NA 3A89A 4BXSA 3W95A 1TALA 3FP8E 3DHKH 2Y5FA 4B2CA 1Z1JA 4IS5A 2G5VA 1Y3UA 2G8TA 1C5QA 1B5GH 1F0RA 1TRNA 4CBOA 1P04A 1L1GA 2ZU5A 1LDTT 2ZIQH 4WMFA 1C2HA 2KAIA 3SGQE 1O2ZA 5EOKA 1OP2A 2LPRA 1KXEA 2Z94A 2RA0A 5JBAS 4ISOA 1LVOA 1Y3WA 2J38A 3TJOA 4Q7YA 3PLKA 2BDGA 1SR5C 1E38B 3ZZ6A 1AU8A 4YO9A 5E0JA 1O5BB 1HV7A 3KGPA 1JOUB 2O8LA 3RXAA 4NFEA 4ZKNU 5HXFA 1DVAH 2AYWA 2ZGJA 4GHTA 1GJ6A 3B23B 1GBDA 1PQ5A 3HATH 1EAWA 1VJ9U 1SOZA 3TH3H 3SU6A 5A09A 1UVPA 2ZU3A 3TGJE 4ZHMU 2H9EH 2AFQB 1KDQA 2BQ6B 3T25A 5FAHA 1F0TA 2FEQH 2FOBA 4XBCA 1NRSH 2C8WB 1JXPA 3T27A 1DY9A 3EA8A 3MNBA 1OP0A 4OS1A 4X8UH 3A7VA 5FCKA 2FOCA 4XBDA 4GPGA 1GBMA 3K65B 4DURA 1XKAC 1XUIA 2WV5A 4YOJA 1O5EH 1MBMA 3DFJA 3O8BA 1GHBG 3TGKE 2V3HH 2ANWA 1QBVH 3GDSA 1P03A 1CVWH 4FVDA 2OBQA 3P17H 1SGQE 2QN5T 1O2MA 1OSSA 2P8OC 1TNHA 1FPCH 1J14A 1GGDB 1A0JA 4ABEA 3RDZA 4ISLA 4NSVA 1C5SA 2GMTB 1KXAA 4I8JA 5AFZH 2QXHA 1MD7A 3SW2B 4JZIA 3PMBB 5GPIB 2W3KA 2R0KA 2ANYA 5JYIA 1G30B 5C5OA 1F2SE 2SFAA 3A82A 5FPYA 4YZUA 4ASHA 2NWNA 1IQHA 3ELAH 2FXRA 2GT8A 4J2YB 2A7HA 1H1BA 1SOTA 2OP9A 1GJAB 1C1PA 4AFZA 1TA6A 1WTHD 3TNSA 2BOKA 4NA9H 1EQ9A 2ODQA 2ZU2A 2FOEA 2GZ7A 3A81A 4GSOA 4IC6A 3RXSA 2VNTA 4U32A 4NWKA 3A83A 4KP0A 3U8RH 1SC8U 1O3GA 5L2ZH 3E0PB 3STIA 5LPFA 5LPEA 1P06A 2PKAB 2GVFA 1G2LA 1JRTA 4OS7A 1AE5A 2VB0A 3Q3YA 4KTSA 2PTNA 1BRUP 1CBWB 3BG4B 2GCTB 2HVXA 5JPMH 1LPGB 5HM9A 1GMDG 3TNTA 4AYVB 1DFPA 1OWHA 1DM4B 1JIMA 2GZ8A 4Y7BA 2XC0A 3MNXA 4NA8A 1LHFH 3NXPA 1FIZA 1P9SA 1MQ6A 4Q2KA 4I8KA 3MNSA 2F3CE 3L33A 2ZP0H 3SU3A 2Y5HA 1XXDA 1EP5A 4O3TA 8KME2 1SB1H 3NZIA 1ZGVA 3A8BA 3A7YA 4K5ZA 1W11U 2RG3A 1QL7A 1DE7H 4Y0ZE 2FTMA 2TGPZ 4GCHG 3W94A 2H6MA 1CHOG 1OP8A 1W0ZU 1LHDH 2G52A 1QQUA 4LZ4B 2D2DA 2ZA5A 3V7TA 1EOLA 4D9QA 2OC1A 3T2NA 1GI5A 3EYDA 1AFEH 3IG6B 3LU9B 1CA8B 1O3MA 4A7IB 1EP6A 2VWOA 2WUCA 4AZ2B 2Y7XA 2BDYA 4I31A 2PWXA 2P3UB 3ZZBA 3R3GB 3PLBA 2CV3A 1DLKB 1QA7A 2ZDAH 4B1TA 1C2IA 1SGRE 3BIVH 1QL9A 2BDCA 4D76A 1QRZA 3SI3H 4K3JA 1ANEA 1C5NH 1ABIH 2ZDMA 3U69H 2VGCB 3MYWA 2ANKH 4Y76A 4BTTB 3MU1A 3RXPA 2O8UA 1EAXA 3KQCA 3RLYH 1IHSH 1GL0E 1PPFE 4JZFH 4PROA 1DXWA 1AUTC 2Y81A 2CF9H 3SBKA 3ZZ4A 1G3EA 1N6XA 4DCDA 1JMOH 1O2KA 5FHTA 4UFGH 2FODA 3ZZAA 1YYY1 3RMNH 2BDBA 3ZVBA 3GOVB 3IWMA 1GJ8B 1LHEH 4GHQA 2VIWA 3M5LA 2CHAC 2SGFE 3S7HB 2BZAA 3S7KB 1O35A 1P10A 3K9XB 5JBCS 1LVMA 2Q6DA 1EB1H 5GWZA 2RCEA 4INLA 5GDSH 1UTQA 2OC7A 3TVJB 1UTOA 4Y71A 2G4TA 1C2KA 3RXTA 1L4ZA 5I46H 2GT7A 1D6RA 3O8RA 1O5GH 3ZZ5A 1DT2A 3LGTA 2Q6FA 4FUBA 5DP6A 1RS0A 4Y8ZA 1Z7KA 3BEFB 2PLXA 1O5AB 4BTIB 1G2MA 1YPJH 3TJNA 2JH0D 3A7XA 2Z6BD 5F6MA 1C5WB 5C67A 1O2UA 1ZSLA 5EU8A 2QC2A 3TK9A 1THSH 1HJ9A 1VZQH 2BD7A 5HM2A 2H5CA 5E2PA 3PLPA 4KGAA 2SGEE 1BBRK 4K60A 1P2KA 3ZVEA 2FM2A 1SGEE 1GHAG 3PTBA 1M9UA 1MTNC 1Z1IA 1TFXA 3LJJA 1ZMJA 3FZZA 1V2MT 1C2EA 1AQ7A 5DK1A 2Z7FE 3PYHA 3OY5U 1S81A 3MFJA 4BAHB 4INKA 2OLGA 3AW1A 4F4OC 4NIYA 3HKIB 1OYQA 1QRXA 2UWOA 2IPHA 3RP2A 2PV9B 1MAXA 2J34A 1LCYA 1SI5H 3SOSA 4X8TH 5FCRA 4FUGA 4U30A 1D3TB 1SSXA 2XTTB 1BJVA 5F8XA 4FU8A 3P8OA 3SV8A 2H5DA 1C5PA 1NRPH 1Y3YA 1LVYA 1IAUA 2BQ7B 3F6UH 1AY6H 1EKBB 2CN0H 3SV6A 3ZZ7A 1UTNA 1RTLA 1V2LT 4TY7A 4D7GA 3E90B 1DWDH 5JBBS 1ZPCA 2BX3A 1BOQA 2BD4A 1QRWA 1QBOA 2SGAA 4JZEH 2NU4E 4LOYH 4BXWA 1YM0A 2VINA 1OYTH 4WH6A 2FYRA 3S9CA 1N6YA 3SJKA 1FY8E 4X2VA 3ZV8A 1ZR0A 1C9TA 1GBIA 1TNGA 1OOKB 4WJG2 1ESBA 1XVOA 1NRQH 1TPSA 3F9EA 1P2JA 4DVAU 1XUKA 1VJAU 2PSXA 1N8OC 4MTBA 1GI9B 1YPLH 4ABIA 1XUGA 1V2NT 3HGNA 4MPUA 2ZTXA 1C1SA 2C90B 4JK5A 1C2MA 1KSNA 2W26A 2ZWLH 4Y0YE 3GY2A 1O2JA 2UWLA 5GCHF 3QGNB 4HI3A 2ZCLP 3LPRA 1KLTA 2A5AA 3LC5A 1VCQA 1TNIA 5TJXA 1JWTA 5C20A 2P8OB 3AAUA 3UUZA 1RXPA 1KXDA 1ELDE 4AFQA 1AZ8A 1TGNA 2A4GA 3PWCA 1ELVA 1UTMA 1O3HA 5CMXH 2HNTE 2FOFA 2F9BH 2YNAA 3RC4A 1GBLA 1NPMA 5A8YA 5E0GA 2FLBH 2VVVA 3PTNA 2HOBA 1EOJA 2EC9H 1FY1A 4JYTA 1W10U 2ZGXH 4A92A 1E37B 1YP9A 4E05H 2FI5E 1NC6A 4OS6A 4AORA 1BMLA 1TGCA 3UWJH 3LH3A 4O03A 1C5OH 1P2MA 4FUIA 1F92A 4B75A 1GI0A 3BTTE 1A5IA 1OKXA 4RKOB 1EATA 3GCTG 1LPKB 1HXFH 1NFUA 4YOGA 1GBBA 1GCDA 1Z8RA 3RXOA 4ABFA 2HGTH 1S6HA 4ISHH 3LOXA 3EQ0H 4OS4A 1S6FA 1EAUA 4THNH 1TX6A 4MLFB 4B2BA 1K1IA 3LGUA 1GMHG 2AEIH 3OYPA 2O8TA 1IQFA 2AERH 1YCPK 1L4DA 1O3FA 3E1XB 4E06H 2H1UA 1IOEA 1TBRH 3A85A 1W7XH 3P8FA 1QTFA 1CGJE 2RDLA 4IGDA 3VB3A 4R0IA 4OGXA 1SGDE 3LT3A 1OWEA 1P2IA 3D62A 1UVOA 3UPEA 2SNWA 5ESTE 3EE0B 1TONA 3K6ZA 1NZQH 3A8AA 1O2NA 1TB6H 3M7UA 5GXPA 1AFQB 1T8MA 2TBSA 3SUEA 1C1TA 2CF8H 3ZZ8A 8ESTE 3UIRA 1GMHF 5HMAA 1KXCA 1SMFE 1W0YH 7KMEH 2XBVA 1ZPBA 1AVWA 2O8MA 4TPIZ 4IMQA 1V2ST 1QJ7B 1V2KT 1MZDA 1HAVA 1UCYH 3VPKA 2ZDKA 3SV2H 2TIOA 1L0ZA 4K2YA 1YCPH 4WF8A 4IN2A 1O2TA 4X1NU 2GGVB 2JH5D 1ELBA 4CRCA 1Z8GA 1EZXC 5AFYH 2YNBA 1GBJA 1J17T 3NUMA 3QTOH 1O3PB 4U2WA 2BXTH 1MKXK 3KN2A 2Y80A 4SGBE 1AB9B 3VB5A 2ODYB 1KLIH 2BD3A 3LGIA 4Y8YA 1T32A 1AWFH 2FI3E 5GCHG 1BITA 1TQ7B 1EZQA 3A8DA 3M35A 3V3MA 4ABHA 2ZI2H 1OXGA 1K9OE 3ATIA 1HAZB 1NROH 1PQ8A 1WBGB 1EAIA 1C2LA 2C8ZB 3URDA 1YC0A 1AN1E 1UCYK 3UQVA 1BT7A 1F5LA 4ZKOU 1V2JT 5DP7A 2UWPA 1GBEA 1P2QA 1A61H 3H5CB 1WAYB 3UWIA 3BF6H 3SJ8A 2M5TA 3RXCA 3JZ2B 3RXBA 2BXUH 2XWAA 1P05A 4E7NA 1GMDF 2A5KA 4KKDA 1AKSB 4NZLA 2BD9A 2DE9A 3Q76A 3F68H 1TMTH 3PMAB 1EX3A 5TCAA 4ZMAH 1GCTC 3A84A 4Y79A 2BX4A 2A7CA 1Y5UT 2FESH 2WPLS 6GCHG 7GCHF 1C1RA 2ZEBA 6CHAC 3KIDU 1JBUH 1QCPA 4VGCB 3P92A 1ESAA 2IN2A 1QHRB 3LDXH 2A45B 3UREA 1BMMH 5AF9H 4B74A 1PPBH 1PYTD 3S69A 9ESTA 2BVRH 2ZFPH 1A0LA 2FTLE 3RXHA 1AUJA 1SG8B 3EA9A 4RKJB 4KELA 5K0HA 1CT0E 4AN7A 5AHGH 2BZ6H 3VEQB 4X1QU 3U8TH 1SVPA 1FV9A 2XBXA 3VB4A 1C2DA 2FPZA 1CBWC 1W13U 5DO4H 2J94A 4NZQA 4A1VA 4Y8XA 1P11E 2FIRH 1WCZA 1GCTB 5L2YH 3EA7A 1LHCH 2FMJA 4AGJA 2P3FH 3BEUA 3UOPA 3NPSA 2PW8H 3I78A 4ABJA 1UTJA 1GBHA 5EQSA 2R3UA 1S82A 4IMZA 2XCFA 2AMDA 3U1IB 1O2LA 2J2UA 1ZJDA 1LTOA 2FYQA 3I77A 1K22H 5HYOA 2DUCA 1HIAB 3SU4A 1ETRH 4FUJA 5BPEA 3M3SA 1VCWA 4MDSA 1O0DH 2Z3DA 1BTXA 1GVLA 3PMHB 3ATKA 1ZHMA 2SGDE 2F9OA 1FJSA 4IN1A 3OX7U 1VCPA 1Q31A 3CS0A 1SBWA 3RC6A 2VIPA 4YT6H 1TABE 2FX4A 1C5LH 4FU7A 2VJ1A 4UEHH 1ZJKA 4JZDH 1MTVA 2SGPE 2BVXH 3F9GA 2QA9E 1F7ZA 3NCLA 6GCHF 7GCHG 1OWJA 1AB9C 1O5DH 4AGKA 4O97A 3SU5A 4WXIA 2YOLA 1YLDA 2GCHG 4X1SU 5ETXA 2ZDVH 3P70B 3U9AH 4XFQA 1V6DA 2WPKS 3SUFA 5ABWA 1GDNA 3M3VA 2BLOA 3FZDA 1B0FA 1MD8A 1RJXB 2ZPRA 1XUHA 2G00A 3P8NA 5DP3A 1GMCF 1PQ7A 2I6SA 1FAXA 5IDKA 5EQQA 3RXLA 1ELCA 1NU9A 1YPKH 1WU1A 4KTCA 1GHXH 4WVPE 3RXIA 3ZZ3A 4DG4A 4E7RG 2ZF0H 1G3DA 3ZYEA 1HAYB 1P9UA 1O3IA 2B9LA 2J9NA 3QLPH 3AAVA 5C1XA 3Q77A 2OXSA 3F1SB 4WMEA 1TRYA 2W7SA 3ZVGA 2HLCA 4O3UA 2P93A 2D8WA 1O3LA 1QA0A 2DE8A 2AGEX 4TWYA 2ZGHA 1SGYE 1SLXB 3UNSA 5LGOA 3T26A 5EW1H 2C8XB 2D1JA 2A4OA 3UQOA 2ZQ2A 2J95A 1C9PA 4AB9A 1J8AA 1DX5M 5AVDA 1C4Y2 1GBTA 3HKJB 4NGAH 2BDIA 2STBE 4GUXA 4MNVA 3M5MA 1MTWA 1O3BA 1AFQC 2O9QA 3ESTA 4X0WU 1H9IE 1QFKH 2B8OH 1GI6A 1Y5BT 1NN6A 4Q7XA 1LO6A 5HGGA 4ZKSU 1LMWB 1IQKA 2A4RA 3SHAH 3BTDE 4B73A 2ZCHP 4CHAB 2PUXB 2ZTZA 1GJ5H 1GI2A 2A4QA 3ZZDA 3HK6B 3SV7A 1ZHPA 3L3TA 1ZMLA 1C5UA 1ZTKA 1HFDA 3AW0A 1K21H 1K28D 1O2GH 2W7UA 3SQHE 4R8TB 3ZZCA 4NIVA 1BB0B 4NWLA 4LZ1H 1ORFA 2Q1JA 4F49A 2FDAA 1GI4A 4BAQB 1H9LB 2F9VA 4XOJA 4CRGA 1DWBH 2HPQH 1IQJA 4UFEH 5C5NA 1MTSA 1DUEA 5JB8S 3ZZ9A 2PSYA 3KL6A 2G51A 1P2OA 1RIWC 2UUKB 1ZTJA 2OC0A 1O30A 2QAAA 3QZRA 1BUIA 2GD4B 1KXFA 3HK3B 1RTFB 1DPOA 4NFFA 5FBIA 3LIWA 4TPYA 3RXGA 4BNRA 1QIXB 1GL1A 1WUNH 3QDZB 1DICA 1O5CB 4AB8A 1DDJA 2Z9GA 2PUQH 1YPHE 1UTKA 5EODA 3OTJE 4CH8B 3U1JB 2XWBI 3MH5A 3ITIA 2HNTC 3RM2H 2ZFFH 3DA9B 1N1LA 1GHVH 2PKSC 1NFXA 1RRKA 1TMUH 2WPHS 4INHA 4D7FA 1K1LA 3GDUA 3T5FH 4YT7H 1SHYA 2WPIS 2A5IA 1GDQA 3RC5A 3E0NB 4LXBH 4AYYB 2BY9X 2CXVA 4Z0KA 4FUHA 2HRVA 1A3EH 3KHVA 3RXFA 1O2IA 1A46H 1T4VH 2UUJB 2C3SA 3UTUH 1ELGA 2ZHFH 1OWIA 2VGCC 1V2TT 1O37A 3MU5A 3EAJA 3RXJA 2BYAX 1NY22 1HGTH 3GYMA 1NRRH 2FX6A 1GJDB 5GIBA 1ZLRA 2VIQA 2R9PA 3QTVH 1AMHA 3URCA 1NESE 1O3JA 4TY6A 2UUFB 2TRMA 2GV7A 4ESTE 3SQEE 1HJAC 1MAYA 5L30H 3SJ9A 4UE7H 3WY8A 3KQBA 3GY8A 3M7TA 5ESBA 2KAIB 1UHBB 3MH6A 3LGWA 1GI8B 2ZFRH 1EJMA 2JKHA 3A80A 4NG9H 4B71A 4IBLH 4JMYA 1YLCA 1EPTB 1VITG 1ZZZA 1FAKH 1LVBA 1P12E 5FPTA 1MCVA 1ZOMA 1Z71A 2QIQA 1TA2A 1C1NA 3A88A 4WXVA 3FAOA 4I33A 2PHBA 1WYKA 5C2ZA 3LKWA 3PM3A 4UDWH 1W12U 2BD5A 4CR9A 1KIGH 1N8OB 1LPZB 3GY4A 3F9FA 1GHAF 1QURH 5EQRA 5G4BA 2J92A 4MG3A 5E8EH 3KEEA 2ZPQA 3JZ1B 1UTPA 2B5TB 1VITH 3BN9A 3UY9A 2A0QB 5E0HA 4ZKRU 5DP9A 1CHOF 2OINA 3GY3A 5FX6A 3TH2H 2QCYA 2EI8A 1CT2E 1B7XB 1ZTLA 2TGAA 1GDUA 1O2OA 1PPCE 3KF2A 3SU2A 1O3AA 1H9HE 2PGQB 2ZFSA 3K6YA 3SGAE 4AX9H 1QJ1B 3SU1A 3SZNA 1XVMA 1V2WT 2ASUB 4XSKU 2W3IA 1F0SA 1FUJA 3LGVA 4YESB 5DKMA 1ARCA 1KY9A 3BIUH 2QF0A 3AVZA 2V3OH 1HAIH 2A31A 1XKBC 5BRRE 1BTHH 1YPHC 8GCHF 4K8YA 1HCGA 1D9IA 3HPTB 1V3XA 2Q6GA 1AD8H 4HFPB 2ZU1A 2Z9IA 1C5MD 3EGKH 1KYNA 1MQ5A 4WH8A 1DS2E 1TWXB 1MZAA 3FANA 3MTYA 2OTVA 1NO9H 1ZYOA 1O3NA 1GGDC 2BVSH 1V2OT 5LH8A 2FS8A 1T8LA 2FWWA 1ANBA 1CQQA 4H42U 2PKAA 3FFGA 2XCNA 1IQLA 1GG6B 5T3HA 1MU6B 5DG6A 3SJIA 3R0FA 1SQTA 4K8BA 2TGTA 1GG6C 3P8GA 1BIOA 3GYLB 5F8ZA 1SPJA 2BQWB 1VGCC 3OU0A 3UNQA 1E0FD 1XUFA 1ACBE 2R0LA 3M3TA 4Y7AA 3ZV9A 2EA3A 2SNVA 4I8HA 2CMYA 1TOMH 3BTWE 2XBYA 4B76A 1P8VC 4Y10E 4NSYA 4I8GA 4X2XA 2GX4A 3LH1A 1BHXF 4BOHA 1G9IE 3PO1B 1D4PB 3MU8A 1C5YB 1EB2A 2EI6A 4BAOB 1DWEH 2ZQ1A 2XRCA 1L2EA 1C5XB 1QB9A 1EJAA 3B9FH 1UMAH 1THRH 4AOQA 2ODPA 1P2NA 3ZVCA 1IQIA 3Q3KA 2ZHDA 3D23A 1SGPE 1Y3VA 5C3NA 1TE0A 2HWLB 3TLOA 1BRAA 3BG4C 2BY7X 4GAWA 2VVUA 3E6PH 1IQGA 2OQUA 1O2PA 2FLRH 2ZECA 4DIHH 1XMNB 2CHAB 2P94A 1IQMA 3QWCH 3M5NA 1NS3A 3C1KA 2V6NA 4DIIH 3RXEA 2A1DB 1UK4A 3KQEA 1FN6A 1BBRH 1G37A 1TMBH 5PTPA 3A86A 3E3TA 1E34B 4WWYA 1TNJA 2QXGA 4H4FA 3NWUA 1O3KA 1D6WA 1ZMNA 2K1QA 2Z3EA 3F9HA 1P02A 2BOHB 1GPZA 5CE1A 2OD3B 2Y7ZA 1GMCG 2G4UA 1UO6A 4YLUA 3UFAA 3D49H 2BY6X 1T4UH 2PTCE 4ZAEA 3ATMA 3PWBA 3MU0A 3ZVAA 2H9HA 1TLDA 1NFWA 2WUBA 3RXQA 5I25A 3BTHE 1BDAA 4Q80A 3S0NA 4X1PU 2ZHWH 1ESTA 3A8CA 5J4QA 1GI3A 4D8NA 3VGCC 1IQEA 3SORA 1RFNA 4QT8C 1HAVB 4H6TA 2GCHF 1IHTH 3CS7A 1TGTA 1Q3XA 2AMQA 4X8SH 5C1UA 3SNBA 3BTME 1SGFA 3DUXH 5EGMA 3T28A 3M36A 1JRSA 1AO5A 3SN8A 1XUJA 1TNLA 1O2RA 1H8DH 1VGCB 2V35A 1O2SA 2TPIZ 4YM9A 1C1MA 3H7TA 4FVBA 1HAGE 3RMLH 1ZRKA 5JB9S 1KXBA 2P59A 3ZYDA 1AHTH 1NTPA 4XDEA 4WMDA 1SGIB 3SO3A 1PPGE 2WPJS 5A0BA 4I8LA 3GY5A 1A5GH 4X6MA 5A0CA 1P0SH 2WV4A 3MMGA 1TBQH 2Z3CA 1KTTB 1T31A 2ZO3H 2VWLA 1UHBA 2PFEA 3SJOA 3MO9A 1DUAA 2P95A 5CHAC 3EDXB 1G36A 2ZHEH 1Y3XA 1A4WH 1ANDA 2FP7B 2Z9LA 2R3YA 1FI8A 1O39A 1TGSZ 1C5VA 3PB1E 4ZXXH 4ZXYH 4U01A 2GCTC 1C5TA 1OX1A 5SGAE 3S9AA 1PQAA 1QL8A 2ESTE 1PPHE 4GLYA 1AE8H 1PPZA 1WQSA 2XW9A 2QV1A 1QJ6B 1BJUA 1X7AC 4ZUHA 1SQOA 1TRMA 2AGGX 4X2WA 1QNJA 1FY4A 3GCHB 3ATWA 4UFDH 1CSOE 3LJOA 4I7YH 2ULLA 1RD3B 3A7TA 4FUEA 5DPAA 1UVTH 1UVUH 4Y11E 2ALVA 1CO7E 1Y5AT 5GJ4B 2AIPA 2FOAA 1BQYA 1LHGH 1BRBE 1S5SA 2NU3E 4JYUH 4X2YA 1W8BH 2XBWA 3T62A 1P3CA 2TGDA 1SGCA 1D3QB 4ABGA 3MHWU 1BMNH 1C1WH 1QR3E 4CBNA 1GHZA 2ZC9H 1HIAA 1SLUB 2BM2A 2JH6D 2ZU4A 3ATLA 2GZ9A 4MNWA 5EPNA 4FUDA 2HNTF 3BV9B 3RM0H 4DGJA 3MH4A 1YKTA 4ZH8A 1ELFA 3AASA 4BTUB 4JK6A 1Q2WA 4Z6AH 1O38A 3GCOA 4NIWA 1GI1A 1EASA 2GDDA 3A7ZA 2B7DH 4MNYA 1V2VT 2ZDNA 1TGBA 1FXYA 1TX7A 2ZTYA 1QB1A 3H7OA 5T6FA 3TU7H 1P09A 3QUMP 4JCNA 1OWDA 2ZHQH 1CA0B 1FONA 4NA7A 3U8OH 3BTGE 3GCTF 5FX5A 1NFYA 2BY5X 3KCGH 1NT1A 1V2QT 1Z6JH 1L1JA 3BEIB 2VH0A 2ZG0H 3SUGA 3UR6A 3Q00A 2F9NA 4UFFH 2QXJA 1MKWH 3GDVA 2WYJA 4DJZB 2ANMH 1EPTA 3NK8A 3S9BA 2AH4X 1G32B 1W14U 3PO1C 3RMOH 5TCCA 2JETC 1AGJA 4MVNA 1ID5H 2QYIA 3A87A 3HGPA 2H2ZA 3MWIU 3GY7A 1HAXB 2Z9JA 8LPRA 3TJVA 4O9VA 2ZPSA 3T29A 1FPHH 1MTNB 3DD2H 7LPRA 1SFQB 3M5OA 4OS5A 1SL3A 1SGFG 2RA3A 4ZROA 2BDHA 5E2OA 2Y5GA 3M37A 3GY6A 5EG4A 1S84A 1J9CH 1U6QA 4CR5A 4OGYA 3SHCH 3MH7A 3UR9A 5EXMA 3RXRA 2FOMB 4DW2U 2AIQA 4YLQH 1HDTH 1MKWK 3ZVDA 3BTEE 1YBWA 1S0RA 2BHGA 1BZXE 1KDQB 1W3CA 1SHHB 2WINI 1VR1H 3RLWH 1W7GH 4ISIH 1DXPA 2IOTA 1BCUH 1DANH 4AG2A 1O2XA 3TK6A 1FZZA 1F5KU 3V13A 4AFUA 1PPEE 3GISB 5CHAB 1S83A 5FPSA 1K1PA 1F0UA 1THPB 2WYGA 3CENA 5F8TA 1S85A 3BTFE 4TYDA 5A0AE 2CGAA 4CH2B 1INCA 1C4V2 1YPMH 1O33A 1L1NA 1V2UT 3ODFA 4FUCA 1GJ9B 5JBTA 1HYLA 5EXNA 5JDUB 1HBTH 1QGFA 2GTBA 4ZHLU 1NU7B 1LKAA 2BB4A 3C27B 1BA8B 1AZZA 3K2UA 3MI4A 4NIXA 3QZQA 3PROA 3U98H 5T6DA 1DSUA 4DY7B 1LQEA 4ABDA 1O3OA 4A6LA 4A1XA 1GHWH 1DITH 1GHBF 2AGIX 4GCHF 1P01A 2ALPA 4B2AA 4IW4E 4WY3A 3O8CA 3M61U 2THFB 3TGIE 1CGIE 2HPPH 3QGJA 1IQNA 1T7CA 2LNCA 2G55A 1G3BA 2ZKSA 5DGJA 3VB6A 1QY6A 5EPYA 4NCYA 3ENSB 2XNIA 1Z8IB 1C4U2 1J15A 1C5RA 2BTCE 1FIWA 1GBFA 1K1JA 3OSYA 1MMJN 1QQ4A 3GCHC 1PFXC 1A7SA 1K1NA 2BD8A 8GCHG 1O2WA 1CE5A 3SNEA 3MO3A 4UD9H 2STAE 3SU0A 1SQAA 2R2WU 1FQ3A 1C1VH 3NKKA
chains in the Genus database with same CATH superfamily
3TK5A 2AS9A 5DP5A 2D26C 2VWNA 2SGQE 3QN7A 1UCYE 3PMJA 3KQDA 2IJOB 2VIDA 3PV4A 1TNKA 3RXUA 1ARBA 3VGCB 1ZSKA 4DOQA 1MU8B 1UJ1A 2OCVB 3E16B 4IC5A 1HAOH 2A2XH 5A8XA 1G3CA 1K2I1 1S0QA 1ABJH 1LKBA 2QGRA 1GBCA 3GICB 3QO6A 1VITF 2QF3A 1BMAA 3VB7A 2CJIA 1MCTA 4HZHA 2Y82A 1GJCB 4CREA 2FI4E 1CT4E 2F43B 3DT0H 2O8WA 2ZDLA 3V0XA 1CGHA 3DSPA 2C93B 1C1QA 4ZCNA 1WSSH 3TJUA 5A8ZA 2C8YB 1ZHRA 4BAMB 1E1RD 1MKXH 1D3DB 5DP4A 1MTUA 5A2MH 2NU0E 2BD2A 1FN8A 2ZGBH 3FP7E 1HPGA 2I6QA 3QX5H 3BTKE 4M9FA 1YGCH 6ESTA 4CRAA 4UONA 4BANB 1O2QA 3FN8A 1T8OA 3SNAA 3CP7A 4ISNA 4JZ1A 1UTLM 1AI8H 1NRNH 4MNXA 1SLWB 3TIUA 2FS9A 2W5EA 3RXVA 2EQNA 2P3TB 4XE4A 4FXGH 2EI7A 5EXLA 5FBEA 2XYAA 5F03A 3E8LA 2VU8E 2W6JD 3IITA 2UUYA 1HAPH 1GBAA 2VH6A 5L6NH 5B6OA 4ABAA 3QK1A 5C1YA 2OBOA 1GHYH 3TITA 3LC3A 1EPTC 3RU4T 6CHAB 4CRFA 1HRTH 2FOGA 1WTGH 1XXFA 2A2QH 1AKSA 2ZFQH 1GVKB 1MH0A 1GJ7B 5DP8A 1TBZH 3G01A 4Z1MD 1TIOA 1HB0B 1YY3A 1DLEA 2WHXA 4SGAE 1DWCH 1ZRBA 3TPIZ 3VXEH 1O3CA 4DT7B 3MNCA 2Y6TA 3BG8A 4HGCA 3UOUA 4FU9A 4M7GA 2VIOA 4CHAC 4K1TA 2PKSB 1O2YA 3BSQA 5IYTA 1O3DA 1BTYA 1HJ8A 1SFIA 2B0FA 2Z9KA 2GV6A 1B0EA 4HTCH 2FOHA 2OQ5A 4D9RA 4BAKB 4AFSA 3P6ZB 1KLJH 2BLQA 1SGTA 3N7OA 4Y6DA 1ETSH 3ZIAD 2V7QD 1UK3A 3RMMH 3O8DA 5CHBA 1ZPZA 5H4IB 1FY3A 2ZFTA 1E36B 4X1RU 1BBRE 3MOCA 3SNDA 2A7JA 2XC4A 3MO6A 1ELEE 4J1YA 4ACBA 1RIWB 1J16A 1TPPA 1HUTH 2ZCKP 1TYNA 3SI4H 1JIRA 4H6SB 1HXEH 4LK4A 1O5FH 2LP6A 4KTUA 1AVGH 1GWAA 4TWWA 4YTAA 5FXLA 7ESTE 2XXLA 1EZSC 2ZNKH 3RUOA 2ILNA 2PGBB 1AVXA 2C4FH 1DOJA 1K1MA 1PJPA 1CA0C 1YF4A 1YPEH 3KNXA 4MPXA 3LONA 1F5RA 2P16A 2H9TH 4X8VH 1FMGA 1ANCA 1UW7A 1EJNA 1YCPM 1O3EA 1C1UH 5T6GA 3A7WA 2PR3A 3FOAA 2HALA 2VWMA 4MPWA 3RXMA 1P3EA 1BHXB 1HJAB 2BY8X 2F9PA 2VVCA 4OS2A 4I32A 1BTWA 4YOIA 1CHGA 1UVSH 1FY5A 1HLTH 3VFEA 1C5ZB 1RGQA 1BTUA 1D3PB 2ZZUH 3W1EA 2QY0B 2BMGB 3CNRA 3P95A 1V2RT 1ZGIA 1XM1A 1PYTC 4Q63A 1NM6A 1GI7B 1ZSJA 3I29A 1C1OA 4AG1A 1OPHB 2BDAA 1TOCB 3DSGA 4RN6A 1SLVB 2GMTC 3D65E 4K1EA 1BTZA 1A5HA 4A1TA 3SV9A 2G5NA 1HAHH 1Y59T 2EEKA 2XC5A 4VGCC 1A3BH 1MBQA 1XX9A 1DSTA 1A1RA 1AIXH 1KTSB 4RSPA 1V2PT 4X6PA 4MPVA 1W2KH 1FLEE 1OWKA 1C2GA 3OY6U 4GVUA 1NBME 3UNRA 3TH4H 2V0BA 4K69A 1WV7H 1ELTA 1EZUC 4CRBA 3V12A 2BLWA 5DJ7A 1GBKA 1FNIA 1GJ4H 3FVFB 1WOFA 1E35B 6LPRA 1C2FA 3RU4D 4X6OA 1O34A 2G81E 3M7QA 2WPMS 3E91A 2F91A 1TPAE 1QB6A 3Q3XA 1EUFA 1LQDB 2JETB 2A32A 3SUDA 1O36A 1BTPA 4XBBA 5LPRA 3ODDA 1Z8JB 3FP6E 1O32A 1A2CH 3F2HA 2AMPA 2FZZA 3RXDA 3LGYA 1DY8A 2OUAA 3VXFH 1Z6EA 2KX4A 4CRDA 1BRCE 3UB0A 1FDPA 4FUFA 1UK2A 2R2MB 4ZHAA 1SGNE 1HNEE 1P57B 2NU2E 2NU1E 1Y8TA 3ZVFA 1A0HB 1O31A 2QXIA 5K7RA 1TPOA 1TQ0B 9LPRA 1CU1A 4ABBA 1ETTH 1QBNA 1ELAA 4A5TS 5J4SA 1AWHB 2BLVA 1TAWA 3SGBE 1OS8A 3BTQE 2ZGCA 1O2HA 1GJBB 3B8JA 2J4IA 3GCNA 2GP9B 2GDEH 4K1SA 4RT1A 4Q7ZA 1K1OA 4MQAA 5EW2H 3DFLA 2F9UA 2OC8A 4X6NA 4JYVH 1C2JA 1TX8A 1YPGH 3MU4A 1H8IH 2F83A 3STJA 1O2VA 3RU4E 2GKVE 2FO9A 1GVZA 1WQVH 3L6PA 3SNCA 2VIVA 1RTKA 1EXFA 2KCYA 3RXKA 1H4WA 1MUEB 1T8NA 3A89A 4BXSA 3W95A 1TALA 3FP8E 3DHKH 2Y5FA 4B2CA 1Z1JA 4IS5A 2G5VA 1Y3UA 2G8TA 1C5QA 1B5GH 1F0RA 1TRNA 4CBOA 1P04A 1L1GA 2ZU5A 1LDTT 2ZIQH 5DSFA 4WMFA 1C2HA 2KAIA 3SGQE 1O2ZA 5EOKA 1OP2A 2LPRA 1KXEA 2Z94A 2RA0A 5JBAS 4ISOA 1LVOA 1Y3WA 2J38A 3TJOA 4Q7YA 3PLKA 2BDGA 1SR5C 1E38B 3ZZ6A 1AU8A 4YO9A 5E0JA 1O5BB 1HV7A 3KGPA 1JOUB 2O8LA 3RXAA 4NFEA 4ZKNU 5HXFA 1DVAH 2AYWA 2ZGJA 4GHTA 1GJ6A 3B23B 1GBDA 4AC9A 1PQ5A 3HATH 1EAWA 1VJ9U 3PV5A 1SOZA 3TH3H 3SU6A 5A09A 1UVPA 2ZU3A 3TGJE 4ZHMU 2H9EH 2AFQB 1KDQA 2BQ6B 3T25A 5FAHA 1F0TA 3F0PA 2XNDD 2FEQH 2FOBA 4XBCA 1NRSH 2C8WB 3OEHD 1JXPA 3T27A 1DY9A 3EA8A 3MNBA 1OP0A 4OS1A 4X8UH 3A7VA 5FCKA 1E79D 2FOCA 4XBDA 4GPGA 1GBMA 2J5UA 3K65B 4DURA 1XKAC 1XUIA 2WV5A 4YOJA 1O5EH 1MBMA 3DFJA 3O8BA 1GHBG 3TGKE 2V3HH 2ANWA 1QBVH 3GDSA 1P03A 1CVWH 4FVDA 2OBQA 3P17H 1MABB 1SGQE 2QN5T 1O2MA 1OSSA 2P8OC 1TNHA 1FPCH 1J14A 1GGDB 3N7DA 2KFWA 1A0JA 4ABEA 3RDZA 4ISLA 4NSVA 1C5SA 2GMTB 1KXAA 4I8JA 5AFZH 2QXHA 1MD7A 3SW2B 4YXWD 2KZ4A 3PMBB 4JZIA 5GPIB 2W3KA 2R0KA 2ANYA 5JYIA 3NRLA 1G30B 5C5OA 1F2SE 2SFAA 3A82A 5FPYA 3OAAD 4YZUA 4ASHA 2NWNA 1IQHA 3ELAH 2FXRA 2GT8A 1WXRA 4J2YB 2A7HA 1H1BA 1SOTA 2OP9A 1GJAB 1C1PA 4AFZA 1TA6A 1WTHD 3TNSA 2BOKA 4NA9H 1EQ9A 2ODQA 2ZU2A 2FOEA 2GZ7A 3A81A 4GSOA 4IC6A 3RXSA 2VNTA 4U32A 4NWKA 3A83A 4KP0A 3U8RH 1SC8U 1O3GA 5L2ZH 3E0PB 3STIA 5LPFA 5LPEA 1P06A 2PKAB 2GVFA 1G2LA 1JRTA 4OS7A 4F55A 1AE5A 2VB0A 3Q3YA 4KTSA 2PTNA 1BRUP 1CBWB 3BG4B 2GCTB 2HVXA 5JPMH 1LPGB 2CK3D 5HM9A 1GMDG 2KR7A 5EJZA 3TNTA 4AYVB 1DFPA 1OWHA 1DM4B 1W0KD 1JIMA 2GZ8A 4Y7BA 2XC0A 3MNXA 4NA8A 1LHFH 3NXPA 1FIZA 1P9SA 1MQ6A 4Q2KA 5KEDA 4I8KA 3MNSA 1SQRA 2F3CE 3L33A 2ZP0H 3SU3A 2Y5HA 1XXDA 1EP5A 4O3TA 8KME2 1SB1H 3NZIA 1ZGVA 2HLDD 3A8BA 3A7YA 4K5ZA 1W11U 2RG3A 1QL7A 1DE7H 5FL7D 4Y0ZE 2FTMA 2TGPZ 4GCHG 3W94A 2H6MA 1CHOG 1OP8A 1W0ZU 1LHDH 2G52A 1QQUA 4LZ4B 2D2DA 2ZA5A 3V7TA 1EOLA 4D9QA 2OC1A 3T2NA 1GI5A 3EYDA 1AFEH 3IG6B 3LU9B 3OE7D 1CA8B 1O3MA 4A7IB 1EP6A 2VWOA 2WUCA 4AZ2B 2Y7XA 2BDYA 4I31A 2PWXA 2P3UB 3ZZBA 3R3GB 3PLBA 3F3BA 2CV3A 1DLKB 1QA7A 2ZDAH 4B1TA 1C2IA 1SGRE 2WV9A 3BIVH 1QL9A 2BDCA 2YMSD 1QRZA 4D76A 3SI3H 4K3JA 1ANEA 1C5NH 1ABIH 2ZDMA 3U69H 2VGCB 3MYWA 2ANKH 4Y76A 4BTTB 3MU1A 3RXPA 2O8UA 1EAXA 3KQCA 3RLYH 1IHSH 1GL0E 1PPFE 4JZFH 4PROA 1DXWA 1AUTC 2Y81A 2CF9H 3SBKA 3ZZ4A 1G3EA 1N6XA 2IJD1 4DCDA 1JMOH 1O2KA 5FHTA 4UFGH 2FODA 3ZZAA 1YYY1 3RMNH 2BDBA 3ZVBA 3GOVB 3IWMA 1GJ8B 1LHEH 4GHQA 2VIWA 5EIYA 3DSOA 3M5LA 2CHAC 2SGFE 3S7HB 2BZAA 3S7KB 1O35A 1P10A 3K9XB 5JBCS 1LVMA 2Q6DA 1EB1H 5GWZA 2RCEA 4INLA 5GDSH 1UTQA 2OC7A 3TVJB 1UTOA 4Y71A 2G4TA 1C2KA 3RXTA 1L4ZA 4Q4LA 5I46H 2GT7A 1D6RA 3O8RA 1O5GH 3ZZ5A 1DT2A 3LGTA 2Q6FA 4FUBA 5DP6A 1RS0A 4Y8ZA 1Z7KA 3BEFB 2PLXA 1O5AB 4BTIB 1G2MA 1YPJH 3TJNA 2JH0D 3A7XA 2Z6BD 5F6MA 1C5WB 5C67A 1O2UA 1ZSLA 5EU8A 2QC2A 3TK9A 1K0HA 1THSH 1HJ9A 5C94A 2GJGA 1VZQH 2BD7A 5HM2A 3WWBA 2H5CA 5E2PA 3PLPA 4KGAA 2SGEE 1BBRK 4K60A 3OTPA 1P2KA 3ZVEA 2FM2A 1SGEE 1GHAG 3PTBA 1M9UA 1MTNC 1Z1IA 3MQKC 1TFXA 3LJJA 1ZMJA 3FZZA 1V2MT 1C2EA 1AQ7A 3GS9A 5DK1A 2Z7FE 3PYHA 3OY5U 1S81A 3MFJA 4BAHB 4INKA 2OLGA 3AW1A 4F4OC 4NIYA 3HKIB 1OYQA 4OM9A 1QRXA 2UWOA 2IPHA 3RP2A 2PV9B 1MAXA 2J34A 1LCYA 1SI5H 3SOSA 4X8TH 5FCRA 4FUGA 4U30A 1KMHB 1D3TB 1SSXA 1BJVA 2XTTB 5F8XA 4FU8A 3P8OA 3SV8A 2H5DA 1C5PA 1NRPH 1Y3YA 1LVYA 1IAUA 2BQ7B 3F6UH 1AY6H 1EKBB 2CN0H 3SV6A 3ZZ7A 1UTNA 1RTLA 1V2LT 4TY7A 4D7GA 3E90B 1DWDH 5JBBS 1ZPCA 2BX3A 1BOQA 2BD4A 1QRWA 1QBOA 2SGAA 4JZEH 2NU4E 4LOYH 4BXWA 1YM0A 2VINA 1OYTH 3OEED 4WH6A 2FYRA 3S9CA 1N6YA 3SJKA 1FY8E 4X2VA 3ZV8A 1ZR0A 1C9TA 1GBIA 1TNGA 1OOKB 4WJG2 1ESBA 1XVOA 1NRQH 1TPSA 3F9EA 1P2JA 4DVAU 1XUKA 1VJAU 2PSXA 1N8OC 4MTBA 1GI9B 1YPLH 4ABIA 1XUGA 1V2NT 3HGNA 4MPUA 2ZTXA 1C1SA 2C90B 4JK5A 1C2MA 1KSNA 2W26A 2ZWLH 4Y0YE 5B6LA 3GY2A 1O2JA 2UWLA 5GCHF 3QGNB 4HI3A 2ZCLP 3LPRA 1KLTA 2A5AA 3LC5A 1VCQA 1TNIA 5TJXA 2V3MA 5HIYA 1JWTA 5C20A 2P8OB 3AAUA 3UUZA 1RXPA 1KXDA 1ELDE 4AFQA 3KYGA 1AZ8A 1TGNA 2A4GA 3PWCA 1ELVA 1UTMA 1O3HA 5CMXH 2HNTE 2FOFA 2F9BH 2YNAA 3RC4A 2K8IA 1GBLA 1NPMA 5A8YA 5E0GA 2FLBH 2VVVA 2PP6A 3PTNA 2HOBA 1EOJA 2L6OA 1NBMD 2EC9H 1FY1A 4JYTA 1W10U 2ZGXH 4A92A 1E37B 1YP9A 4E05H 2FI5E 1NC6A 4OS6A 4AORA 1BMLA 1TGCA 3UWJH 3LH3A 4O03A 1C5OH 1P2MA 4FUIA 1F92A 4B75A 1GI0A 3BTTE 1A5IA 1OKXA 4RKOB 1EATA 3GCTG 4P00A 1LPKB 1HXFH 1NFUA 4YOGA 1GBBA 1GCDA 1Z8RA 3RXOA 4ABFA 2HGTH 1S6HA 4ISHH 3LOXA 3EQ0H 4OS4A 1S6FA 1EAUA 4THNH 1TX6A 4MLFB 2JJ1D 4B2BA 1K1IA 3LGUA 1GMHG 2AEIH 3OYPA 2O8TA 1IQFA 2AERH 1YCPK 3VG8A 1L4DA 1O3FA 2M2AA 3E1XB 4E06H 2H1UA 1IOEA 1TBRH 3A85A 1W7XH 1EFRD 1BMFD 3P8FA 1QTFA 1CGJE 2RDLA 4IGDA 3VB3A 4R0IA 4OGXA 1SGDE 3LT3A 1OWEA 1P2IA 1S6LA 3D62A 1UVOA 3UPEA 2SNWA 5ESTE 3EE0B 1TONA 3K6ZA 1NZQH 3A8AA 1O2NA 1TB6H 3M7UA 5GXPA 1AFQB 1T8MA 2TBSA 3SUEA 1C1TA 2CF8H 3ZZ8A 8ESTE 3UIRA 1GMHF 5HMAA 1KXCA 1SMFE 1W0YH 7KMEH 2XBVA 1ZPBA 1AVWA 2O8MA 5GNDA 4TPIZ 4IMQA 1V2ST 1QJ7B 1V2KT 1MZDA 1HAVA 1UCYH 3VPKA 2ZDKA 3SV2H 2L74A 2TIOA 1L0ZA 4K2YA 1YCPH 4WF8A 4IN2A 1O2TA 4X1NU 2GGVB 2JH5D 4RI0A 1ELBA 4CRCA 1Z8GA 1EZXC 5AFYH 2YNBA 1GBJA 1J17T 3NUMA 3QTOH 1O3PB 4U2WA 2BXTH 1MKXK 3KN2A 2Y80A 4SGBE 1AB9B 3VB5A 1H8HD 2ODYB 1KLIH 4F48B 2BD3A 3LGIA 4Y8YA 1T32A 1AWFH 2FI3E 5GCHG 1BITA 1TQ7B 1EZQA 3A8DA 3M35A 3V3MA 4ABHA 2ZI2H 1OXGA 4FETA 1K9OE 3ATIA 1HAZB 1NROH 1PQ8A 1WBGB 1EAIA 3KYFA 1C2LA 2C8ZB 3URDA 1YC0A 1AN1E 1UCYK 3UQVA 1BT7A 1F5LA 4ZKOU 1V2JT 5DP7A 2UWPA 1GBEA 1P2QA 1A61H 3H5CB 1WAYB 3UWIA 3BF6H 3SJ8A 2M5TA 3RXCA 3JZ2B 3RXBA 2BXUH 4ACAA 2XWAA 1P05A 4E7NA 1GMDF 2A5KA 4KKDA 1AKSB 4NZLA 2BD9A 2DE9A 3Q76A 3F68H 1TMTH 3PMAB 1EX3A 5TCAA 4ZMAH 1GCTC 3A84A 4Y79A 2BX4A 2A7CA 1Y5UT 5CDFE 2FESH 2WPLS 6GCHG 7GCHF 1C1RA 2ZEBA 5C0TA 6CHAC 3KIDU 1JBUH 1QCPA 4VGCB 3P92A 1ESAA 2IN2A 1QHRB 3LDXH 2A45B 3UREA 1BMMH 4XD7D 5AF9H 4B74A 1PPBH 1PYTD 3S69A 9ESTA 2BVRH 2ZFPH 1A0LA 2FTLE 3RXHA 1AUJA 1SG8B 3EA9A 4RKJB 4KELA 5K0HA 1CT0E 4AN7A 5AHGH 2BZ6H 3VEQB 4X1QU 3U8TH 1SVPA 1FV9A 2XBXA 3VB4A 1C2DA 2FPZA 1CBWC 1W13U 5DO4H 2J94A 4NZQA 4A1VA 4Y8XA 1P11E 2FIRH 1WCZA 1GCTB 4TSFD 3OFND 5L2YH 3EA7A 1LHCH 2FMJA 4AGJA 2P3FH 3BEUA 3UOPA 3NPSA 2PW8H 3I78A 4ABJA 1UTJA 1GBHA 5EQSA 2R3UA 1S82A 4IMZA 2XCFA 2AMDA 3U1IB 1O2LA 2J2UA 1ZJDA 1LTOA 2FYQA 3I77A 1K22H 5HYOA 2DUCA 1HIAB 3SU4A 1ETRH 4FUJA 5BPEA 3M3SA 1VCWA 4MDSA 1O0DH 2Z3DA 1BTXA 1GVLA 3PMHB 3ATKA 1ZHMA 2SGDE 2F9OA 1YWUA 1FJSA 4IN1A 3OX7U 1VCPA 1Q31A 3CS0A 1SBWA 3RC6A 2VIPA 4YT6H 1TABE 2FX4A 1C5LH 4FU7A 2VJ1A 4UEHH 5EJ1A 1ZJKA 1WDIA 4JZDH 1MTVA 2SGPE 4B6EA 2BVXH 3F9GA 2QA9E 1F7ZA 3NCLA 6GCHF 7GCHG 1OWJA 1AB9C 1O5DH 4AGKA 4O97A 3SU5A 4WXIA 2YOLA 1YLDA 2GCHG 4X1SU 5ETXA 2ZDVH 3P70B 3U9AH 4XFQA 1V6DA 2WPKS 3SUFA 5ABWA 1GDNA 3M3VA 2BLOA 3FZDA 1B0FA 1MD8A 1RJXB 2ZPRA 1XUHA 2IPQX 2G00A 3P8NA 5DP3A 1GMCF 1PQ7A 2I6SA 1FAXA 5IDKA 5EQQA 3RXLA 1ELCA 1NU9A 1YPKH 1WU1A 4KTCA 1GHXH 4WVPE 3RXIA 3ZZ3A 4DG4A 4E7RG 2ZF0H 1G3DA 3ZYEA 1HAYB 1P9UA 1O3IA 2B9LA 2J9NA 3QLPH 3AAVA 5C1XA 3Q77A 2OXSA 3F1SB 4WMEA 1TRYA 4ASUD 2W7SA 3ZVGA 2HLCA 4O3UA 2P93A 2D8WA 1O3LA 1QA0A 3H09A 2DE8A 2AGEX 4TWYA 2ZGHA 1SGYE 1SLXB 3UNSA 5LGOA 3T26A 5EW1H 2C8XB 2D1JA 2A4OA 3UQOA 2ZQ2A 5EJLA 1FX0B 2J95A 1C9PA 4AB9A 1J8AA 1DX5M 5AVDA 1C4Y2 1GBTA 3HKJB 4NGAH 2BDIA 2STBE 4GUXA 4MNVA 3M5MA 1MTWA 1O3BA 1AFQC 4HG6A 2O9QA 3ESTA 4X0WU 1H9IE 3N7EA 1QFKH 2B8OH 1GI6A 1Y5BT 1NN6A 4Q7XA 1LO6A 5HGGA 4ZKSU 1LMWB 1IQKA 2A4RA 3SHAH 3BTDE 4B73A 2ZCHP 4CHAB 2PUXB 2ZTZA 1GJ5H 1GI2A 1OHHD 2A4QA 3ZZDA 3HK6B 3SV7A 1ZHPA 3L3TA 1ZMLA 2JDID 1C5UA 1ZTKA 1HFDA 3AW0A 1K21H 1K28D 1O2GH 2W7UA 3SQHE 4R8TB 3ZZCA 4NIVA 5C17A 1BB0B 4NWLA 4LZ1H 1ORFA 2Q1JA 4F49A 2FDAA 1GI4A 4BAQB 1H9LB 5F53A 2F9VA 4XOJA 3DCLA 2F4LA 4CRGA 1DWBH 2HPQH 1IQJA 4UFEH 5C5NA 1MTSA 1DUEA 2KCAA 2K0QA 5JB8S 3ZZ9A 2PSYA 3KL6A 3KQ5A 2G51A 1P2OA 1RIWC 2UUKB 1ZTJA 2OC0A 1O30A 2QAAA 3QZRA 1BUIA 2GD4B 1KXFA 3HK3B 1RTFB 1DPOA 5HKKD 4NFFA 5FBIA 3LIWA 4TPYA 3RXGA 4BNRA 1QIXB 1GL1A 1WUNH 3QDZB 1DICA 1O5CB 4AB8A 1DDJA 2Z9GA 2PUQH 1YPHE 1UTKA 5EODA 3OTJE 4CH8B 3U1JB 2XWBI 3MH5A 3ITIA 2HNTC 3RM2H 2ZFFH 3DA9B 3EE7A 1N1LA 1GHVH 2PKSC 1NFXA 5KGOA 1RRKA 1TMUH 2WPHS 4INHA 4D7FA 1K1LA 3GDUA 3T5FH 4YT7H 1SHYA 2WPIS 2A5IA 3SYJA 1GDQA 3N99A 3RC5A 3E0NB 4LXBH 4AYYB 2BY9X 2CXVA 4Z0KA 4FUHA 2HRVA 1A3EH 3KHVA 3RXFA 1O2IA 1A46H 1T4VH 2UUJB 2C3SA 3UTUH 1ELGA 2ZHFH 1OWIA 2VGCC 1V2TT 1O37A 3MU5A 3EAJA 3RXJA 2BYAX 2W6ID 1NY22 1HGTH 3GYMA 1NRRH 2FX6A 1GJDB 5GIBA 4B6FA 1ZLRA 2VIQA 2R9PA 3QTVH 1AMHA 3URCA 1NESE 1O3JA 4TY6A 2UUFB 2TRMA 2GV7A 4ESTE 3SQEE 1HJAC 1MAYA 5L30H 3SJ9A 4UE7H 3WY8A 3KQBA 3GY8A 3M7TA 5ESBA 2KAIB 1UHBB 3MH6A 3LGWA 1GI8B 2ZFRH 1EJMA 2JKHA 3A80A 4NG9H 3U28C 4B71A 4IBLH 4JMYA 1YLCA 1EPTB 1VITG 1ZZZA 1FAKH 1LVBA 1P12E 5FPTA 1MCVA 1ZOMA 1Z71A 2QIQA 2VBCA 1TA2A 1C1NA 3A88A 4WXVA 5C0UA 3FAOA 4I33A 2PHBA 1WYKA 5C2ZA 3LKWA 3PM3A 4UDWH 1W12U 2BD5A 4CR9A 1KIGH 1N8OB 1LPZB 3GY4A 3F9FA 1GHAF 1QURH 5EQRA 5G4BA 2J92A 4MG3A 5E8EH 3KEEA 2LELA 2ZPQA 3JZ1B 2RFKC 1UTPA 2B5TB 1VITH 3BN9A 3UY9A 2A0QB 5E0HA 4ZKRU 5DP9A 1CHOF 2OINA 4DT4A 3GY3A 5FX6A 3TH2H 2QCYA 3F2GA 2EI8A 1CT2E 3F0OA 2RDEA 1B7XB 1ZTLA 2TGAA 1GDUA 1O2OA 1PPCE 2YMSC 3KF2A 1O3AA 3SU2A 2HVYB 2J98B 1H9HE 2PGQB 2ZFSA 3K6YA 3SGAE 4AX9H 1QJ1B 3SU1A 3SZNA 1XVMA 1V2WT 2ASUB 4XSKU 2W3IA 1F0SA 1FUJA 3LGVA 4YESB 5DKMA 1ARCA 1KY9A 3BIUH 4XRNA 2QF0A 3AVZA 2V3OH 1HAIH 2A31A 1XKBC 5BRRE 1BTHH 1YPHC 2QE7D 4K8YA 8GCHF 1HCGA 1D9IA 3HPTB 1V3XA 2Q6GA 1AD8H 4HFPB 2ZU1A 2Z9IA 1C5MD 1COWD 3EGKH 1KYNA 1MQ5A 4WH8A 1DS2E 1TWXB 3PRDA 1MZAA 3FANA 3MTYA 2OTVA 1NO9H 1ZYOA 1O3NA 1GGDC 2BVSH 1V2OT 2WZQA 5LH8A 2FS8A 1T8LA 2FWWA 1ANBA 1CQQA 4H42U 2PKAA 3FFGA 2XCNA 1SKYE 1IQLA 1QZ8A 1GG6B 5T3HA 1MU6B 5DG6A 3SJIA 3R0FA 1SQTA 2JIZD 2TGTA 1GG6C 3P8GA 1BIOA 4K8BA 3GYLB 5F8ZA 1SPJA 2BQWB 2OK5A 1VGCC 3OU0A 2YMSB 3UNQA 1E0FD 1XUFA 1ACBE 2R0LA 3M3TA 4Y7AA 3WW7A 3ZV9A 2EA3A 2SNVA 4I8HA 2CMYA 1TOMH 3BTWE 2XBYA 4B76A 1P8VC 4Y10E 4FOUC 4NSYA 4I8GA 4X2XA 2XOKD 2GX4A 3LH1A 1BHXF 4BOHA 1G9IE 3PO1B 1D4PB 3MU8A 1C5YB 1EB2A 2EI6A 4BAOB 1DWEH 2ZQ1A 2XRCA 1L2EA 1C5XB 1QB9A 1EJAA 3B9FH 1UMAH 1THRH 4AOQA 2ODPA 1P2NA 3ZVCA 1IQIA 3Q3KA 2ZHDA 3D23A 1SGPE 1Y3VA 5C3NA 1TE0A 2HWLB 3TLOA 1BRAA 3BG4C 2BY7X 4GAWA 2VVUA 3E6PH 1IQGA 2OQUA 1O2PA 1YLNA 2FLRH 2ZECA 4DIHH 1XMNB 2CHAB 2P94A 1IQMA 3QWCH 3M5NA 1NS3A 3C1KA 2V6NA 4DIIH 3RXEA 2A1DB 1UK4A 3KQEA 1FN6A 1BBRH 1G37A 1TMBH 5PTPA 3A86A 3E3TA 1E34B 4WWYA 1TNJA 2QXGA 4H4FA 3NWUA 1O3KA 1D6WA 1ZMNA 2K1QA 2Z3EA 3F9HA 1P02A 2BOHB 1GPZA 5CE1A 2OD3B 2Y7ZA 1GMCG 2KCOA 2G4UA 5KECA 1UO6A 4YLUA 3UFAA 3D49H 2BY6X 1T4UH 2PTCE 4ZAEA 3ATMA 3PWBA 3MU0A 3ZVAA 2H9HA 1TLDA 2J98A 1NFWA 2WUBA 3RXQA 5I25A 3BTHE 1BDAA 4Q80A 3S0NA 4X1PU 2ZHWH 1ESTA 3A8CA 5J4QA 1GI3A 4D8NA 3VGCC 1IQEA 3SORA 1RFNA 4QT8C 1HAVB 4H6TA 2GCHF 1IHTH 3CS7A 1TGTA 1Q3XA 2AMQA 4X8SH 5C1UA 3SNBA 3BTME 1SGFA 3DUXH 5EGMA 3T28A 3M36A 2QF4A 1JRSA 1AO5A 3SN8A 1XUJA 1TNLA 1O2RA 2EY4C 1E1QD 1H8DH 1VGCB 3FO8D 2V35A 1O2SA 2TPIZ 4YM9A 1C1MA 3H7TA 4FVBA 1HAGE 3RMLH 3SZEA 5HIZA 1ZRKA 5DN6D 1KXBA 5JB9S 4I86A 2P59A 3ZYDA 1AHTH 1NTPA 4XDEA 4WMDA 1SGIB 3SO3A 2AHME 1PPGE 3WWFA 2WPJS 5A0BA 4I8LA 3GY5A 1A5GH 4X6MA 5A0CA 1P0SH 2WV4A 3MMGA 1TBQH 2Z3CA 1KTTB 1T31A 2ZO3H 2VWLA 1UHBA 2PFEA 3SJOA 3FKSD 3MO9A 1DUAA 2P95A 5CHAC 3EDXB 1G36A 2ZHEH 1Y3XA 1A4WH 1ANDA 2FP7B 2Z9LA 2R3YA 1FI8A 1O39A 1TGSZ 1C5VA 3PB1E 4ZXXH 4ZXYH 4U01A 2GCTC 1C5TA 1OX1A 5SGAE 3S9AA 1PQAA 1QL8A 2ESTE 1PPHE 4GLYA 1AE8H 1PPZA 1WQSA 2XW9A 2QV1A 1QJ6B 1BJUA 1VKYA 1X7AC 4ZUHA 1SQOA 1TRMA 2AGGX 4X2WA 1QNJA 1FY4A 3GCHB 3ATWA 4UFDH 1CSOE 3LJOA 4I7YH 2ULLA 1RD3B 3A7TA 4FUEA 5DPAA 1UVTH 1UVUH 4Y11E 2ALVA 1CO7E 1Y5AT 5GJ4B 2AIPA 2FOAA 1BQYA 1LHGH 1BRBE 1S5SA 2NU3E 4JYUH 4X2YA 1W8BH 2XBWA 3T62A 1P3CA 2TGDA 1SGCA 1D3QB 4ABGA 3MHWU 1BMNH 1C1WH 1QR3E 4CBNA 4TT3D 1GHZA 2ZC9H 1HIAA 1SLUB 2BM2A 2JH6D 2ZU4A 3ATLA 2GZ9A 4MNWA 5EPNA 4FUDA 2HNTF 3BV9B 3RM0H 4DGJA 3MH4A 1YKTA 4ZH8A 1ELFA 3AASA 4BTUB 4JK6A 1Q2WA 4Z6AH 1O38A 3GCOA 4NIWA 1GI1A 1EASA 2GDDA 3A7ZA 2B7DH 4MNYA 2QF5A 1V2VT 2ZDNA 1TGBA 1FXYA 1TX7A 2ZTYA 1QB1A 3H7OA 2WPDD 5T6FA 3TU7H 1P09A 3QUMP 4JCNA 1OWDA 2ZHQH 1CA0B 2J97A 1FONA 4RT0A 4NA7A 3U8OH 3BTGE 3GCTF 5FX5A 1NFYA 2KM0A 2BY5X 3KCGH 1NT1A 1V2QT 1Z6JH 1L1JA 3BEIB 2VH0A 2ZG0H 3SUGA 3UR6A 3Q00A 2F9NA 1W0JD 4UFFH 2QXJA 1MKWH 3GDVA 2WYJA 4DJZB 2ANMH 1EPTA 3NK8A 3S9BA 2AH4X 1G32B 1W14U 3PO1C 3RMOH 5TCCA 2JETC 1AGJA 4MVNA 1ID5H 2QYIA 3A87A 3HGPA 2H2ZA 3MWIU 3GY7A 1HAXB 2Z9JA 8LPRA 3TJVA 4O9VA 2ZPSA 3T29A 1FPHH 1MTNB 3DD2H 3PRBA 7LPRA 1SFQB 3M5OA 4OS5A 1SL3A 1SGFG 2RA3A 4ZROA 2BDHA 5E2OA 2Y5GA 3M37A 3GY6A 5EG4A 1S84A 1J9CH 1U6QA 4CR5A 4OGYA 3SHCH 3MH7A 3UR9A 5EXMA 3RXRA 2FOMB 4DW2U 2AIQA 4YLQH 1HDTH 1MKWK 3ZVDA 3BTEE 1YBWA 1S0RA 2BHGA 1BZXE 1KDQB 1W3CA 1SHHB 1VR1H 2WINI 3RLWH 1W7GH 4ISIH 1DXPA 2IOTA 1BCUH 1DANH 4AG2A 1O2XA 3TK6A 1FZZA 1F5KU 3V13A 4AFUA 1PPEE 3GISB 5CHAB 1S83A 5FPSA 1K1PA 1F0UA 1THPB 2WYGA 3CENA 5F8TA 1S85A 3BTFE 4TYDA 5A0AE 2CGAA 4CH2B 1INCA 1C4V2 1YPMH 1H8ED 1O33A 1L1NA 1V2UT 3ODFA 3PV2A 4FUCA 1GJ9B 5JBTA 1HYLA 5EXNA 5JDUB 1HBTH 4P02A 1QGFA 2GTBA 4ZHLU 1NU7B 1LKAA 2BB4A 2KCPA 3C27B 1BA8B 1AZZA 3K2UA 3MI4A 4NIXA 3QZQA 5T1VA 3PROA 3U98H 3UAIC 5T6DA 1DSUA 4DY7B 2JJ2D 1LQEA 4ABDA 1O3OA 4A6LA 4A1XA 1GHWH 1DITH 1GHBF 2AGIX 4GCHF 1P01A 2ALPA 3F2FA 4B2AA 4IW4E 4WY3A 3O8CA 3M61U 2THFB 3TGIE 1CGIE 2HPPH 3QGJA 1IQNA 2WSSD 1T7CA 3AK5A 2LNCA 2G55A 1G3BA 2ZKSA 5DGJA 3VB6A 1QY6A 5EPYA 4NCYA 3ENSB 2XNIA 1Z8IB 1C4U2 1J15A 1C5RA 2BTCE 1FIWA 1GBFA 1K1JA 3OSYA 1MMJN 1QQ4A 3GCHC 1PFXC 5IK2D 1A7SA 1K1NA 2BD8A 8GCHG 1O2WA 1CE5A 3SNEA 3MO3A 4UD9H 2STAE 3SU0A 1SQAA 2R2WU 1FQ3A 1C1VH 3NKKA
chains in the Genus database with same CATH topology
3TK5A 2AS9A 5DP5A 2D26C 2VWNA 2SGQE 3QN7A 1UCYE 3PMJA 3KQDA 2IJOB 2VIDA 3PV4A 1TNKA 3RXUA 1ARBA 3VGCB 1ZSKA 4DOQA 1MU8B 1UJ1A 2OCVB 3E16B 4IC5A 1HAOH 2A2XH 5A8XA 1G3CA 1K2I1 1S0QA 1ABJH 1LKBA 2QGRA 1GBCA 3GICB 3QO6A 1VITF 2QF3A 1BMAA 3VB7A 2CJIA 1MCTA 4HZHA 2Y82A 1GJCB 4CREA 2FI4E 1CT4E 3DT0H 2O8WA 2ZDLA 3V0XA 1CGHA 2C93B 1C1QA 1WSSH 3TJUA 5A8ZA 2C8YB 1ZHRA 4BAMB 5DP4A 1MKXH 1D3DB 5A2MH 1MTUA 2NU0E 2BD2A 1FN8A 2ZGBH 3FP7E 1HPGA 2I6QA 3QX5H 3BTKE 1YGCH 6ESTA 4CRAA 4UONA 4BANB 1O2QA 1T8OA 3SNAA 3CP7A 4ISNA 4JZ1A 1UTLM 1AI8H 1NRNH 4MNXA 1SLWB 3TIUA 2FS9A 2W5EA 3RXVA 2P3TB 4XE4A 4FXGH 2EI7A 5EXLA 5FBEA 2XYAA 5F03A 3E8LA 2VU8E 3IITA 2UUYA 1HAPH 1GBAA 2VH6A 5L6NH 5B6OA 4ABAA 3QK1A 5C1YA 2OBOA 1GHYH 3TITA 3LC3A 1EPTC 3RU4T 6CHAB 4CRFA 1HRTH 2FOGA 1WTGH 1XXFA 2A2QH 1AKSA 2ZFQH 1GVKB 1MH0A 1GJ7B 5DP8A 1TBZH 3G01A 1TIOA 1HB0B 1DLEA 4SGAE 1DWCH 1ZRBA 3TPIZ 3VXEH 1O3CA 4DT7B 3MNCA 2Y6TA 3BG8A 4HGCA 3UOUA 4FU9A 4M7GA 2VIOA 4CHAC 4K1TA 2PKSB 1O2YA 3BSQA 5IYTA 1O3DA 1BTYA 1HJ8A 1SFIA 2B0FA 2Z9KA 2GV6A 1B0EA 4HTCH 2FOHA 2OQ5A 4D9RA 4BAKB 4AFSA 3P6ZB 1KLJH 2BLQA 1SGTA 3N7OA 4Y6DA 1ETSH 1UK3A 3RMMH 3O8DA 1ZPZA 5H4IB 1FY3A 2ZFTA 1E36B 4X1RU 1BBRE 3MOCA 3SNDA 2A7JA 2XC4A 3MO6A 1ELEE 4J1YA 1RIWB 1J16A 1TPPA 1HUTH 2ZCKP 1TYNA 3SI4H 1JIRA 4H6SB 1HXEH 4LK4A 1O5FH 4KTUA 1AVGH 1GWAA 4TWWA 4YTAA 5FXLA 7ESTE 2XXLA 1EZSC 2ZNKH 3RUOA 2ILNA 2PGBB 1AVXA 2C4FH 1DOJA 1K1MA 1PJPA 1CA0C 1YF4A 1YPEH 3KNXA 4MPXA 3LONA 1F5RA 2P16A 2H9TH 4X8VH 1FMGA 1ANCA 1YCPM 1EJNA 1O3EA 1C1UH 5T6GA 3A7WA 2PR3A 2HALA 2VWMA 4MPWA 3RXMA 1P3EA 1BHXB 1HJAB 2BY8X 2F9PA 2VVCA 4OS2A 4I32A 1BTWA 4YOIA 1CHGA 1UVSH 1FY5A 1HLTH 3VFEA 1C5ZB 1RGQA 1BTUA 1D3PB 2ZZUH 2QY0B 2BMGB 3P95A 1V2RT 1ZGIA 1XM1A 1PYTC 1NM6A 1GI7B 1ZSJA 3I29A 1C1OA 4AG1A 1OPHB 2BDAA 1TOCB 4RN6A 1SLVB 2GMTC 3D65E 4K1EA 1BTZA 1A5HA 4A1TA 3SV9A 2G5NA 1HAHH 1Y59T 2EEKA 2XC5A 4VGCC 1A3BH 1MBQA 1XX9A 1DSTA 1A1RA 1AIXH 1KTSB 4RSPA 1V2PT 4X6PA 4MPVA 1W2KH 1FLEE 1OWKA 1C2GA 3OY6U 4GVUA 3UNRA 3TH4H 2V0BA 4K69A 1WV7H 1ELTA 1EZUC 4CRBA 3V12A 2BLWA 5DJ7A 1GBKA 1FNIA 1GJ4H 3FVFB 1WOFA 1E35B 6LPRA 1C2FA 3RU4D 4X6OA 1O34A 2G81E 3M7QA 2WPMS 3E91A 2F91A 1TPAE 1QB6A 3Q3XA 1EUFA 1LQDB 2JETB 2A32A 3SUDA 1O36A 1BTPA 4XBBA 5LPRA 3ODDA 1Z8JB 3FP6E 1O32A 1A2CH 2AMPA 2FZZA 3RXDA 3LGYA 1DY8A 2OUAA 3VXFH 1Z6EA 4CRDA 1BRCE 1FDPA 4FUFA 1UK2A 2R2MB 4ZHAA 1SGNE 1HNEE 1P57B 2NU2E 2NU1E 1Y8TA 3ZVFA 1A0HB 1O31A 2QXIA 5K7RA 1TPOA 1TQ0B 9LPRA 1CU1A 4ABBA 1ETTH 1QBNA 1ELAA 4A5TS 5J4SA 1AWHB 2BLVA 1TAWA 3SGBE 1OS8A 3BTQE 2ZGCA 1O2HA 1GJBB 3B8JA 2J4IA 3GCNA 2GP9B 2GDEH 4K1SA 4Q7ZA 1K1OA 4MQAA 5EW2H 3DFLA 2F9UA 2OC8A 4X6NA 4JYVH 1C2JA 1TX8A 1YPGH 3MU4A 1H8IH 2F83A 3STJA 1O2VA 3RU4E 2GKVE 2FO9A 1GVZA 1WQVH 3L6PA 3SNCA 2VIVA 1RTKA 1EXFA 3RXKA 1H4WA 1MUEB 1T8NA 3A89A 4BXSA 3W95A 1TALA 3FP8E 3DHKH 2Y5FA 4B2CA 1Z1JA 4IS5A 2G5VA 1Y3UA 2G8TA 1C5QA 1B5GH 1F0RA 1TRNA 4CBOA 1P04A 1L1GA 2ZU5A 1LDTT 2ZIQH 4WMFA 1C2HA 2KAIA 3SGQE 1O2ZA 5EOKA 1OP2A 2LPRA 1KXEA 2Z94A 2RA0A 5JBAS 4ISOA 1LVOA 1Y3WA 2J38A 3TJOA 4Q7YA 3PLKA 2BDGA 1SR5C 1E38B 3ZZ6A 1AU8A 4YO9A 5E0JA 1O5BB 1HV7A 3KGPA 1JOUB 2O8LA 3RXAA 4NFEA 4ZKNU 5HXFA 1DVAH 2AYWA 2ZGJA 4GHTA 1GJ6A 3B23B 1GBDA 1PQ5A 3HATH 1EAWA 1VJ9U 1SOZA 3TH3H 3SU6A 5A09A 1UVPA 2ZU3A 3TGJE 4ZHMU 2H9EH 2AFQB 1KDQA 2BQ6B 3T25A 5FAHA 1F0TA 2FEQH 2FOBA 4XBCA 1NRSH 2C8WB 1JXPA 3T27A 1DY9A 3EA8A 3MNBA 1OP0A 4OS1A 4X8UH 3A7VA 5FCKA 2FOCA 4XBDA 4GPGA 1GBMA 3K65B 4DURA 1XKAC 1XUIA 2WV5A 4YOJA 1O5EH 1MBMA 3DFJA 3O8BA 1GHBG 3TGKE 2V3HH 2ANWA 1QBVH 3GDSA 1P03A 1CVWH 4FVDA 2OBQA 3P17H 1SGQE 2QN5T 1O2MA 1OSSA 2P8OC 1TNHA 1FPCH 1J14A 1GGDB 1A0JA 4ABEA 3RDZA 4ISLA 4NSVA 1C5SA 2GMTB 1KXAA 4I8JA 5AFZH 2QXHA 1MD7A 3SW2B 4JZIA 3PMBB 5GPIB 2W3KA 2R0KA 2ANYA 5JYIA 1G30B 5C5OA 1F2SE 2SFAA 3A82A 5FPYA 4YZUA 4ASHA 2NWNA 1IQHA 3ELAH 2FXRA 2GT8A 4J2YB 2A7HA 1H1BA 1SOTA 2OP9A 1GJAB 1C1PA 4AFZA 1TA6A 1WTHD 3TNSA 2BOKA 4NA9H 1EQ9A 2ODQA 2ZU2A 2FOEA 2GZ7A 3A81A 4GSOA 4IC6A 3RXSA 2VNTA 4U32A 4NWKA 3A83A 4KP0A 3U8RH 1SC8U 1O3GA 5L2ZH 3E0PB 3STIA 5LPFA 5LPEA 1P06A 2PKAB 2GVFA 1G2LA 1JRTA 4OS7A 1AE5A 2VB0A 3Q3YA 4KTSA 2PTNA 1BRUP 1CBWB 3BG4B 2GCTB 2HVXA 5JPMH 1LPGB 5HM9A 1GMDG 3TNTA 4AYVB 1DFPA 1OWHA 1DM4B 1JIMA 2GZ8A 4Y7BA 2XC0A 3MNXA 4NA8A 1LHFH 3NXPA 1FIZA 1P9SA 1MQ6A 4Q2KA 4I8KA 3MNSA 2F3CE 3L33A 2ZP0H 3SU3A 2Y5HA 1XXDA 1EP5A 4O3TA 8KME2 1SB1H 3NZIA 1ZGVA 3A8BA 3A7YA 4K5ZA 1W11U 2RG3A 1QL7A 1DE7H 4Y0ZE 2FTMA 2TGPZ 4GCHG 3W94A 2H6MA 1CHOG 1OP8A 1W0ZU 1LHDH 2G52A 1QQUA 4LZ4B 2D2DA 2ZA5A 3V7TA 1EOLA 4D9QA 2OC1A 3T2NA 1GI5A 3EYDA 1AFEH 3IG6B 3LU9B 1CA8B 1O3MA 4A7IB 1EP6A 2VWOA 2WUCA 4AZ2B 2Y7XA 2BDYA 4I31A 2PWXA 2P3UB 3ZZBA 3R3GB 3PLBA 2CV3A 1DLKB 1QA7A 2ZDAH 4B1TA 1C2IA 1SGRE 3BIVH 1QL9A 2BDCA 4D76A 1QRZA 3SI3H 4K3JA 1ANEA 1C5NH 1ABIH 2ZDMA 3U69H 2VGCB 3MYWA 2ANKH 4Y76A 4BTTB 3MU1A 3RXPA 2O8UA 1EAXA 3KQCA 3RLYH 1IHSH 1GL0E 1PPFE 4JZFH 4PROA 1DXWA 1AUTC 2Y81A 2CF9H 3SBKA 3ZZ4A 1G3EA 1N6XA 4DCDA 1JMOH 1O2KA 5FHTA 4UFGH 2FODA 3ZZAA 1YYY1 3RMNH 2BDBA 3ZVBA 3GOVB 3IWMA 1GJ8B 1LHEH 4GHQA 2VIWA 3M5LA 2CHAC 2SGFE 3S7HB 2BZAA 3S7KB 1O35A 1P10A 3K9XB 5JBCS 1LVMA 2Q6DA 1EB1H 5GWZA 2RCEA 4INLA 5GDSH 1UTQA 2OC7A 3TVJB 1UTOA 4Y71A 2G4TA 1C2KA 3RXTA 1L4ZA 5I46H 2GT7A 1D6RA 3O8RA 1O5GH 3ZZ5A 1DT2A 3LGTA 2Q6FA 4FUBA 5DP6A 1RS0A 4Y8ZA 1Z7KA 3BEFB 2PLXA 1O5AB 4BTIB 1G2MA 1YPJH 3TJNA 2JH0D 3A7XA 2Z6BD 5F6MA 1C5WB 5C67A 1O2UA 1ZSLA 5EU8A 2QC2A 3TK9A 1THSH 1HJ9A 1VZQH 2BD7A 5HM2A 2H5CA 5E2PA 3PLPA 4KGAA 2SGEE 1BBRK 4K60A 1P2KA 3ZVEA 2FM2A 1SGEE 1GHAG 3PTBA 1M9UA 1MTNC 1Z1IA 1TFXA 3LJJA 1ZMJA 3FZZA 1V2MT 1C2EA 1AQ7A 5DK1A 2Z7FE 3PYHA 3OY5U 1S81A 3MFJA 4BAHB 4INKA 2OLGA 3AW1A 4F4OC 4NIYA 3HKIB 1OYQA 1QRXA 2UWOA 2IPHA 3RP2A 2PV9B 1MAXA 2J34A 1LCYA 1SI5H 3SOSA 4X8TH 5FCRA 4FUGA 4U30A 1D3TB 1SSXA 2XTTB 1BJVA 5F8XA 4FU8A 3P8OA 3SV8A 2H5DA 1C5PA 1NRPH 1Y3YA 1LVYA 1IAUA 2BQ7B 3F6UH 1AY6H 1EKBB 2CN0H 3SV6A 3ZZ7A 1UTNA 1RTLA 1V2LT 4TY7A 4D7GA 3E90B 1DWDH 5JBBS 1ZPCA 2BX3A 1BOQA 2BD4A 1QRWA 1QBOA 2SGAA 4JZEH 2NU4E 4LOYH 4BXWA 1YM0A 2VINA 1OYTH 4WH6A 2FYRA 3S9CA 1N6YA 3SJKA 1FY8E 4X2VA 3ZV8A 1ZR0A 1C9TA 1GBIA 1TNGA 1OOKB 4WJG2 1ESBA 1XVOA 1NRQH 1TPSA 3F9EA 1P2JA 4DVAU 1XUKA 1VJAU 2PSXA 1N8OC 4MTBA 1GI9B 1YPLH 4ABIA 1XUGA 1V2NT 3HGNA 4MPUA 2ZTXA 1C1SA 2C90B 4JK5A 1C2MA 1KSNA 2W26A 2ZWLH 4Y0YE 3GY2A 1O2JA 2UWLA 5GCHF 3QGNB 4HI3A 2ZCLP 3LPRA 1KLTA 2A5AA 3LC5A 1VCQA 1TNIA 5TJXA 1JWTA 5C20A 2P8OB 3AAUA 3UUZA 1RXPA 1KXDA 1ELDE 4AFQA 1AZ8A 1TGNA 2A4GA 3PWCA 1ELVA 1UTMA 1O3HA 5CMXH 2HNTE 2FOFA 2F9BH 2YNAA 3RC4A 1GBLA 1NPMA 5A8YA 5E0GA 2FLBH 2VVVA 3PTNA 2HOBA 1EOJA 2EC9H 1FY1A 4JYTA 1W10U 2ZGXH 4A92A 1E37B 1YP9A 4E05H 2FI5E 1NC6A 4OS6A 4AORA 1BMLA 1TGCA 3UWJH 3LH3A 4O03A 1C5OH 1P2MA 4FUIA 1F92A 4B75A 1GI0A 3BTTE 1A5IA 1OKXA 4RKOB 1EATA 3GCTG 1LPKB 1HXFH 1NFUA 4YOGA 1GBBA 1GCDA 1Z8RA 3RXOA 4ABFA 2HGTH 1S6HA 4ISHH 3LOXA 3EQ0H 4OS4A 1S6FA 1EAUA 4THNH 1TX6A 4MLFB 4B2BA 1K1IA 3LGUA 1GMHG 2AEIH 3OYPA 2O8TA 1IQFA 2AERH 1YCPK 1L4DA 1O3FA 3E1XB 4E06H 2H1UA 1IOEA 1TBRH 3A85A 1W7XH 3P8FA 1QTFA 1CGJE 2RDLA 4IGDA 3VB3A 4R0IA 4OGXA 1SGDE 3LT3A 1OWEA 1P2IA 3D62A 1UVOA 3UPEA 2SNWA 5ESTE 3EE0B 1TONA 3K6ZA 1NZQH 3A8AA 1O2NA 1TB6H 3M7UA 5GXPA 1AFQB 1T8MA 2TBSA 3SUEA 1C1TA 2CF8H 3ZZ8A 8ESTE 3UIRA 1GMHF 5HMAA 1KXCA 1SMFE 1W0YH 7KMEH 2XBVA 1ZPBA 1AVWA 2O8MA 4TPIZ 4IMQA 1V2ST 1QJ7B 1V2KT 1MZDA 1HAVA 1UCYH 3VPKA 2ZDKA 3SV2H 2TIOA 1L0ZA 4K2YA 1YCPH 4WF8A 4IN2A 1O2TA 4X1NU 2GGVB 2JH5D 1ELBA 4CRCA 1Z8GA 1EZXC 5AFYH 2YNBA 1GBJA 1J17T 3NUMA 3QTOH 1O3PB 4U2WA 2BXTH 1MKXK 3KN2A 2Y80A 4SGBE 1AB9B 3VB5A 2ODYB 1KLIH 2BD3A 3LGIA 4Y8YA 1T32A 1AWFH 2FI3E 5GCHG 1BITA 1TQ7B 1EZQA 3A8DA 3M35A 3V3MA 4ABHA 2ZI2H 1OXGA 1K9OE 3ATIA 1HAZB 1NROH 1PQ8A 1WBGB 1EAIA 1C2LA 2C8ZB 3URDA 1YC0A 1AN1E 1UCYK 3UQVA 1BT7A 1F5LA 4ZKOU 1V2JT 5DP7A 2UWPA 1GBEA 1P2QA 1A61H 3H5CB 1WAYB 3UWIA 3BF6H 3SJ8A 2M5TA 3RXCA 3JZ2B