2A7CA

On the routine use of soft x-rays in macromolecular crystallography, part iii- the optimal data collection wavelength
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elastase 1
publication title On the routine use of soft X-rays in macromolecular crystallography. Part III. The optimal data-collection wavelength.
pubmed doi rcsb
molecule tags Hydrolase
total genus 65
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2a7cA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2a7cA01
4X1NU 3E0NB 1G36A 1TQ0B 5FXLA 5GCHG 1TOCB 1L0ZA 1GMHF 1DWCH 2EA3A 3QK1A 1GBBA 1SC8U 1BOQA 4BTTB 1LPZB 3RMOH 4WMDA 2PSYA 3EQ0H 4AZ2B 4K1SA 1GCTB 1SVPA 3S7KB 1F92A 3OU0A 2XC5A 4A1XA 3SV9A 2TGAA 1DLEA 2SGFE 1C4V2 3T29A 1OXGA 1C2DA 2SGAA 2AERH 2EI7A 1NPMA 3A86A 1NRSH 1GBEA 3VB5A 3NCLA 7GCHF 1OYTH 5GWZA 4JZ1A 1HXFH 1P3EA 4I8LA 1ELVA 4AN7A 1YPGH 2JH5D 2P3TB 3QLPH 4IMZA 2ESTE 1IQEA 2BLVA 5A8XA 2R2MB 1ELEE 1BTPA 3P70B 1ZPZA 1EZSC 4THNH 1A7SA 1WCZA 1SGCA 4WVPE 1P2OA 1L1NA 3URDA 1C5QA 2TIOA 2ZHQH 3BSQA 3A89A 2NU0E 2BVSH 3SNBA 1ZJDA 1ZYOA 3A81A 4CHAB 1C2EA 3A7YA 1MAXA 5HM9A 1GHYH 1TE0A 3TU7H 4A92A 2ZPRA 1Q31A 3L3TA 3HGPA 1JXPA 2DE9A 3A83A 3M61U 2CJIA 2ZFFH 3F9FA 3P8OA 4FVDA 3LGWA 1K1IA 3IITA 1MTVA 4IGDA 4I8HA 2VB0A 3RMMH 1IQNA 3A7ZA 1AKSA 1RTKA 3RXQA 1J8AA 3SNDA 4E7NA 2B5TB 2Z7FE 2BXUH 3RXMA 3RXFA 3TGKE 3ZZ7A 1RS0A 4NG9H 4TPIZ 5BRRE 2R2WU 1KIGH 1TX7A 2XC4A 3PROA 1MQ6A 4BAHB 3FP7E 2BY8X 3SO3A 1IQGA 2P3UB 5DP7A 3MHWU 1WUNH 3TVJB 1ELBA 1AU8A 3CP7A 1TNHA 3E16B 2Z3DA 1CA0B 1AD8H 4BAQB 4YM9A 4HTCH 2ZTYA 2F83A 4IC5A 3KIDU 3M5OA 2C4FH 1D3DB 2R0KA 1Y3YA 4DVAU 3A7VA 1EP6A 1C1WH 1Z6EA 1MU8B 2K1QA 5BPEA 2BY6X 1GG6C 1SL3A 2BXTH 3SU2A 1BRBE 2XCNA 1ANDA 3AASA 3F9GA 2Z6BD 2Z9IA 2ZPSA 1DE7H 3U1JB 2ZG0H 1S5SA 1TBZH 1ZHMA 5GCHF 3MYWA 3RC4A 4CR9A 3M7QA 3ATWA 5DP6A 3EDXB 1ABIH 8ESTE 2A7CA 2Y7XA 4ABGA 2O8TA 1Q3XA 1ZR0A 1HRTH 1YCPK 3UTUH 1VJ9U 1HBTH 1GBLA 1LTOA 1C5PA 2J4IA 4GPGA 3EA8A 3SGAE 1J9CH 4WJG2 3TITA 4AB9A 2SGEE 1QCPA 2XXLA 4Y10E 1QB9A 3E8LA 2FLRH 3PWCA 4OS6A 3ATMA 1PYTD 2GVFA 1XXDA 1P06A 1S85A 4ZHAA 4ZXYH 1E35B 2OP9A 4Q80A 6CHAC 3MU5A 1ZMLA 5FAHA 1F0RA 1HAOH 3UQVA 1YPJH 3TJOA 2V35A 1PPHE 3RUOA 3SNCA 2Y80A 3TPIZ 1TPSA 1ZMNA 4WF8A 1YGCH 1XVOA 1EJNA 1GI7B 4VGCC 4BAKB 4A1TA 4BTUB 4AYYB 3NKKA 4O9VA 3UY9A 2PUXB 2P8OB 5FHTA 1QBOA 2F9OA 1OWKA 1T8MA 1L4ZA 3DFJA 1TNKA 3QDZB 1QBVH 2VJ1A 2VWLA 2XNIA 2F9BH 2BDCA 1SOTA 2SGPE 3HKJB 1TGNA 1FI8A 1HAGE 1C2GA 3K65B 1HGTH 3SN8A 5TCCA 1TNLA 3ITIA 1SBWA 3U98H 1O2MA 2ZU1A 1LPKB 1P0SH 1DSTA 1BMLA 3ZZAA 2FOGA 1Y5BT 3PWBA 1E38B 3VXEH 1SLUB 1TMBH 1P03A 1MKXK 4ZHLU 1QA7A 1V2ST 3BTEE 3P92A 1A0JA 1W8BH 2PV9B 4LZ1H 1IHSH 4B2BA 3SJOA 4I31A 2CF9H 1T4UH 1V2OT 5EODA 3LJJA 1A5HA 5LPFA 3LDXH 3UFAA 2WUBA 1JOUB 1GJDB 1O34A 3R3GB 2YNAA 1E37B 1CGJE 3VB6A 3K9XB 3BTQE 1P57B 1C5NH 3LGVA 4MTBA 1MMJN 1MD8A 3T26A 4WXVA 1NU9A 1JRTA 1BB0B 1OP2A 1HJAC 1CSOE 3P17H 1FIZA 2BZAA 2A4RA 3M36A 4B1TA 2ZDVH 4J1YA 4K60A 2FESH 1DUEA 2A2XH 3HKIB 1AWHB 2ZZUH 2BDGA 4B76A 1UJ1A 3V13A 4BAMB 1WYKA 1O30A 1ZGIA 2GP9B 1KLTA 2F3CE 4WWYA 3I29A 2QAAA 4NA8A 2H6MA 1JBUH 1C5UA 1GL1A 1BDAA 1V2LT 3A7TA 4ZKNU 3HGNA 1UK2A 1KLIH 1P2QA 1OYQA 1ZTKA 2A1DB 2FTLE 2FS9A 1GG6B 4R8TB 2UWOA 1LVOA 3PLPA 1SGEE 2ZWLH 3SU1A 1BRAA 4DJZB 3A8BA 2BD9A 2O8UA 3FP8E 2GT8A 3ZZ8A 4SGBE 1H9IE 1DFPA 3RXIA 1G32B 3T2NA 3GYMA 5HXFA 2QXGA 4TYDA 4X8TH 1CA8B 1P2KA 2FM2A 1FXYA 2LNCA 1NFUA 2DUCA 4FUFA 2VINA 3MOCA 2I6QA 4ISOA 1ARBA 3HK3B 1YPHE 1MAYA 1TGSZ 2AIPA 1AGJA 8KME2 1TQ7B 2AIQA 2F9PA 5EOKA 3ZVCA 1QY6A 4OS2A 3V7TA 1JMOH 1IQKA 2PSXA 6CHAB 1UK4A 2I6SA 1TPPA 3Q77A 4FUGA 4NGAH 1A3BH 1V2WT 3PM3A 1GBMA 3OTJE 1KYNA 1AFEH 1GPZA 2GCHG 2BDYA 4UDWH 1OWJA 2VWMA 3ZZDA 2F91A 2FEQH 4YT6H 1EJMA 1PPFE 3RXJA 5GIBA 2ZFPH 2NU3E 2BDIA 5IDKA 3ZVFA 2ZHEH 4ABJA 3RXTA 1WV7H 6GCHG 2R3YA 1WAYB 1UVPA 1O2IA 3RXGA 1EP5A 3HATH 1GBKA 1LQDB 4WMFA 5EXNA 1HJ9A 3P6ZB 1YLCA 3QN7A 1UK3A 4A7IB 1THPB 3GOVB 2WYGA 2W7UA 1WU1A 1GI6A 2ZCLP 2A2QH 1DM4B 4JMYA 1D9IA 2EEKA 1PPBH 2H5CA 3LC3A 1O3MA 1G3BA 1PFXC 3TIUA 1OWDA 1HV7A 1EAWA 3SU4A 4X6NA 1GJCB 1P8VC 1SGIB 1Y3WA 4WH8A 1YYY1 2ZC9H 4DIIH 1GCTC 3ENSB 1HUTH 2P16A 2A5KA 2GTBA 4HI3A 1TGBA 1JIMA 5FCKA 2G81E 2BOKA 3AAUA 2ANMH 2VIOA 1W14U 3KQBA 1NFWA 1DXWA 5E8EH 1SGNE 1O2GH 1S6FA 3A80A 1ELDE 2GV6A 3A85A 4Z0KA 4M7GA 4X8SH 5EPNA 1A0HB 1QJ7B 4GAWA 1YLDA 2XWBI 5DK1A 2Z9KA 2G5VA 1C2JA 1HJAB 2JETC 4D8NA 2CMYA 2FI4E 1V2QT 1JWTA 4H42U 1O2VA 4YT7H 2QIQA 4X2WA 4KELA 4BNRA 1OSSA 1Y3XA 1QBNA 3DT0H 2ZIQH 3D65E 1NFYA 1Y3VA 3QTOH 2GT7A 2UUFB 1J16A 2NU1E 2ZDLA 1O2YA 1AB9C 1DWEH 3QZQA 4XBDA 4CHAC 2B7DH 1TA2A 4KKDA 1EXFA 5AFYH 4MQAA 3MI4A 4FUIA 1NRNH 5FPTA 2ZGBH 4K5ZA 2PW8H 3PLKA 1K2I1 1D3PB 5A8ZA 3SI4H 4TY6A 1PQ8A 1TPAE 4Y0ZE 1Z1JA 6LPRA 1PQ5A 1PPZA 5GDSH 1F7ZA 4IW4E 1FONA 2WV4A 1MD7A 2BOHB 2OLGA 1P2JA 5T6FA 3ZZCA 1QR3E 7KMEH 1QNJA 3UWJH 1K1OA 2GX4A 5ESTE 1FDPA 1S6HA 4YOGA 1G3CA 3ATLA 4BAOB 1BBRE 2GCHF 2V3OH 5EG4A 1HCGA 1ANCA 4XFQA 1BZXE 2FMJA 1ZJKA 3FVFB 1GMCG 3F68H 1BHXB 2W3IA 1CA0C 6GCHF 1FPCH 2GZ9A 4GUXA 1GGDC 1GI4A 3BTME 1GDUA 4K1TA 2EI6A 3A7XA 1KXDA 1HAHH 2HNTC 1W11U 1AHTH 1B5GH 4DIHH 4ZAEA 1DITH 1TYNA 5TCAA 2GZ7A 1XKAC 1KXAA 1BBRH 5L30H 2Y82A 1UTNA 2VVVA 3Q3YA 1YPKH 4YLQH 4U32A 2RG3A 3UWIA 2D1JA 3LKWA 3U9AH 1MZDA 3VB3A 4MNWA 2R9PA 3A87A 4Q7ZA 4D7FA 1YBWA 2OCVB 2FO9A 5T3HA 3RXVA 1KLJH 1CVWH 2PFEA 3ZVAA 3K2UA 4TPYA 3RU4T 3SQHE 3P8NA 1DWDH 1PJPA 2GKVE 1CT4E 2ZECA 4Y0YE 1HAYB 1UTPA 1O2QA 2C8ZB 2A32A 4AG1A 3BEIB 2G8TA 1W12U 2ZGCA 2HNTF 2ZI2H 1U6QA 3QZRA 5EW1H 4U01A 3SUEA 1O3AA 2OINA 1K1NA 2BQWB 1GJ9B 3RLYH 4UFEH 2PGQB 3ODDA 5DPAA 3SJ9A 1V2VT 1HAIH 1LCYA 5EXLA 2P3FH 4ZUHA 3U69H 2OQ5A 3VFEA 1INCA 3L6PA 3ZZBA 2ZDNA 4QT8C 3HK6B 3KCGH 2P8OC 3TNSA 2KAIB 1J15A 1BA8B 4GHTA 5A09A 2D26C 1EZXC 1C5LH 1O3LA 2A4GA 2ZU4A 1O2NA 3SQEE 4X1SU 2VIDA 1O5CB 1QQUA 3WY8A 2H9TH 1CBWC 1X7AC 1HJ8A 1NTPA 1IAUA 1NZQH 3MTYA 5A2MH 3SV2H 5T6GA 1IQMA 3E6PH 3KNXA 1AUTC 3ZYDA 2ASUB 1LHDH 1GI0A 1RFNA 1T4VH 3UPEA 3U8OH 4X2VA 1O3HA 1C1UH 2OC1A 3O8DA 3VXFH 5LH8A 5ESBA 5L2ZH 1SQTA 2JETB 1CT0E 2PKSC 3KQCA 3QO6A 1TX6A 3E91A 1HDTH 4AG2A 5E2OA 3RP2A 4B74A 3UIRA 4DGJA 1P10A 2Q1JA 1C2KA 1SHYA 1CO7E 8GCHF 1O36A 1SGFG 1KXFA 1AB9B 3RXOA 4CBOA 1FPHH 1SLWB 3S69A 3Q3KA 3ESTA 1EASA 3TNTA 1C4Y2 1EPTB 2PUQH 3M7TA 1ORFA 4CBNA 3SU6A 3I77A 4Y7BA 4MVNA 3RC5A 1GMCF 1TRMA 2BD3A 3MH7A 4ASHA 2V3HH 2PKAA 2BD5A 2OUAA 3GDVA 2FWWA 3PV4A 4DURA 1QL7A 1TMUH 2JH0D 3TK9A 3KEEA 5C5NA 1V2NT 2BD8A 4JZIA 3S9BA 4ZH8A 1CQQA 2FODA 1EX3A 2XWAA 1XXFA 4WY3A 1EJAA 5C20A 5F8ZA 1GHXH 1TGTA 5EQSA 1A0LA 3SV8A 2XYAA 2OC8A 2ZFRH 5I46H 1HXEH 2XBYA 1ELTA 1O2XA 1O2ZA 2XC0A 1DX5M 1GDQA 1BTUA 2SNVA 3BTTE 4E7RG 1T8LA 2HRVA 1EATA 1HAZB 2W7SA 1D3QB 4UFDH 1JRSA 1DSUA 1DT2A 3ATIA 3A8DA 1GGDB 3P8GA 1Z6JH 1P04A 2G4TA 4I8KA 4NA9H 1MUEB 1K28D 1O5AB 1GHAG 1RD3B 1MTNB 1BITA 2STAE 1UCYK 2XRCA 1O3PB 2BMGB 3AAVA 3SV7A 4XDEA 2ODQA 4AX9H 3A8CA 1P05A 4X6MA 1PYTC 2BLOA 3RXPA 3ATKA 1TLDA 3E1XB 1TNGA 2W26A 1TGCA 2Q6FA 3LPRA 2PGBB 1YM0A 2QV1A 1BMAA 2FI3E 3QGJA 5JBBS 1OPHB 3M3TA 1MBQA 1QFKH 4JK5A 4PROA 5JYIA 5LPRA 3ODFA 2XTTB 2FI5E 4K1EA 2KAIA 4Q7XA 4TWWA 2ZQ2A 3DD2H 1RTFB 2VNTA 1P01A 4ZMAH 1YKTA 1UO6A 3H7OA 3RDZA 1BTZA 1ELFA 1O32A 1P2MA 1XUHA 4AFQA 1LQEA 1ZRKA 1C2HA 1MH0A 1Z1IA 1NRPH 1AUJA 4KTCA 5EQQA 1V2MT 3MNSA 1UTKA 1IQJA 2FZZA 3MO6A 1AY6H 1SB1H 5FBEA 3U1IB 5CHAC 1D6WA 8LPRA 1O5EH 4IN2A 3UQOA 5ETXA 1FUJA 2FOBA 2AEIH 1T8OA 3LIWA 1HFDA 2ZU5A 4K8BA 3RU4E 1O3KA 3GCOA 1CBWB 1XUGA 3SNEA 2VVUA 2G55A 1CT2E 1HIAB 3C1KA 1AE8H 4DW2U 1L2EA 1WTGH 2VIVA 4ZKSU 2XW9A 4D7GA 1C5RA 1S0QA 1NM6A 1O3NA 4ABHA 1G30B 1QTFA 2PKSB 1H9HE 3UNQA 1KY9A 1WQVH 2J94A 2J9NA 3M5MA 5PTPA 1XUFA 1ZTLA 2Q6DA 3V3MA 3BEUA 1E0FD 1EZQA 1CHGA 3TH2H 1EB2A 1XUKA 2FOFA 4Z6AH 3CENA 1O3GA 6ESTA 5AHGH 1NESE 2AMQA 4AOQA 3OSYA 4OS4A 1C5VA 2GD4B 1LPGB 2J2UA 4Y8XA 1PQ7A 1O5FH 1LMWB 3BTHE 1QRWA 1EOLA 3IWMA 1AWFH 1C5WB 1GBFA 1H9LB 1ZMJA 5EXMA 1WOFA 1DUAA 1ID5H 1W7XH 1NU7B 2A5AA 2WV5A 4KTSA 1Y3UA 1O2JA 1EB1H 3NK8A 4X2XA 3TK5A 9ESTA 1FZZA 4OGXA 2PHBA 1GVZA 4X1PU 1Y8TA 2QXHA 1GHAF 1P9SA 1AVXA 2Z9GA 2VGCC 5CE1A 2IPHA 1Q2WA 1ELGA 1BMMH 3EE0B 2GMTC 1RJXB 2P94A 2F9UA 2CHAC 1L4DA 2HALA 1S82A 1Z8IB 5ABWA 1DWBH 1A5GH 1QJ6B 3UUZA 2FOCA 3ZVGA 1C2MA 1O2PA 3MNBA 3M37A 1SLXB 5FCRA 3RXBA 1GJ5H 2AMPA 3STIA 1V2JT 3QX5H 3MO9A 2CN0H 3ZZ9A 1MBMA 1C5ZB 1S0RA 4MNXA 2O8WA 4O97A 2Y6TA 2A31A 4NIVA 1TABE 4B2AA 3T62A 3H7TA 2HOBA 4HFPB 2FDAA 4XSKU 5H4IB 4MPWA 1W2KH 5IYTA 3CS7A 5HGGA 3TJNA 3M3SA 1SGYE 3Q76A 5JDUB 4CRDA 2ILNA 5SGAE 1KSNA 1QQ4A 1GVKB 2ANKH 1O0DH 1Y5AT 2RCEA 1VITH 3SU0A 4DOQA 1C2LA 1FY5A 4YLUA 1AVGH 1WSSH 1BQYA 1VJAU 3QWCH 2VH6A 4KGAA 4FUHA 1UVOA 3MMGA 3GY5A 3UOUA 3BV9B 1HAVB 2G4UA 2RA3A 2XBWA 1AQ7A 1K9OE 2ZPQA 4YO9A 3CS0A 1E34B 3MH5A 3ZZ5A 1BJUA 3TLOA 1SR5C 4MPXA 2OQUA 5DP9A 4MNYA 2PLXA 5E2PA 2Z94A 4X1QU 3EYDA 2ZP0H 3SW2B 2ZTZA 1TIOA 2ZU2A 3RMNH 3HPTB 1TNJA 3PTNA 2H9EH 1DVAH 1TA6A 3RXDA 5CHAB 2FOAA 2GV7A 2OXSA 1VCQA 4TY7A 1SSXA 3GY3A 2B0FA 1MTWA 3V0XA 1UMAH 1V2TT 1C1VH 3PB1E 1TMTH 3UNSA 4DY7B 3AW1A 2SGDE 1TRYA 2QXIA 2TBSA 4HGCA 1HB0B 3W95A 1MKWK 3RXEA 3BIUH 1YPLH 3PMBB 4ESTE 1C1MA 5DJ7A 3SV6A 5C2ZA 1S83A 2BHGA 1QL8A 2AMDA 1SGPE 2J92A 3BF6H 3K6YA 3FAOA 2QF3A 4X8VH 1SQOA 3LU9B 2UUYA 3D23A 1GMDG 1SQAA 4XOJA 2IOTA 3A8AA 2OTVA 1XUIA 3QTVH 2J95A 3SHCH 4XE4A 1BTWA 3BN9A 4LOYH 1BRUP 1EZUC 2Y7ZA 1A61H 3F6UH 1C4U2 2VU8E 4DCDA 4SGAE 5E0JA 1Z8JB 2BD2A 1H4WA 3VPKA 3IG6B 1ZZZA 4B73A 5GXPA 2TRMA 3BTKE 1GBCA 1LVMA 4X0WU 2ZHDA 1ETRH 5FX5A 2WPKS 1QRZA 1OS8A 2BTCE 2YNBA 4NFFA 5J4SA 4CRBA 1TALA 1CGHA 4JZEH 3A7WA 1Z8RA 2VGCB 4ABDA 2ZCKP 4GHQA 2FXRA 1TX8A 2WINI 2GMTB 4Y71A 4FU8A 4I33A 2R0LA 2O8LA 5DGJA 2CHAB 3MU8A 2ZFSA 2D8WA 2SGQE 3O8BA 2V6NA 1OX1A 5EGMA 3SUDA 2ZGHA 3EGKH 3RXCA 3GICB 2PWXA 1XM1A 3TGIE 1IQFA 1EAXA 3RXRA 1LKAA 3D62A 2JH6D 1UVTH 2BLWA 1V3XA 1C5YB 1AMHA 4FUEA 4H6SB 1EPTC 2QXJA 2BDAA 1O2WA 2ZO3H 2R3UA 1SGFA 1THSH 2GCTC 1T7CA 2WPHS 1LDTT 1C9PA 1C5XB 3RXSA 1GBIA 2QF0A 5J4QA 4MLFB 3UR6A 3PMAB 5JBCS 1GDNA 4BANB 1VGCB 3RM2H 1AZ8A 1ABJH 5DKMA 4CREA 2NWNA 2A4QA 4FUBA 4UFGH 5A0BA 2QN5T 1RGQA 1FV9A 3BTFE 3LGYA 3Q00A 5E0GA 2BQ7B 2VVCA 1SLVB 4O03A 1DY8A 4Y76A 4K69A 5AVDA 3RLWH 2F9VA 1C1SA 1XKBC 3C27B 2VWNA 4E05H 3B8JA 3ZV8A 1W13U 2BD4A 2ANWA 5C3NA 1N8OC 2UWLA 1GHVH 3VEQB 1LHFH 3SI3H 1N6YA 4NCYA 2EI8A 1SFQB 1PPGE 1A5IA 3KL6A 2ZDMA 4CH2B 4ABEA 2ZKSA 3UOPA 1AZZA 1SHHB 3TH3H 5JB9S 4NIYA 1MTNC 2P95A 1UTQA 1GI3A 1YP9A 1GMDF 2RA0A 4XBCA 1G37A 4UFFH 3AW0A 1ZTJA 4I7YH 4ZKOU 1ESTA 2VIQA 2Z9LA 3VGCC 1OWHA 3DHKH 1H8IH 2Z3EA 1LHCH 4OGYA 2OBOA 2WPLS 3OX7U 2ZHWH 5DG6A 2Y81A 1CE5A 4MPVA 4X2YA 1F5RA 1QRXA 4UE7H 2Y5FA 4INLA 2ZU3A 1FIWA 3TGJE 5TJXA 2HGTH 2A0QB 3SU3A 1KXEA 2ZDAH 4DG4A 5GPIB 5C67A 2ANYA 4FVBA 1KTTB 1E36B 1O2OA 4AGJA 3GISB 2FP7B 3RXUA 3SUFA 3LGIA 1CGIE 1SGTA 3SZNA 4AGKA 4RKOB 1C2FA 1O35A 3PYHA 3FP6E 4ABAA 3GCNA 3SJIA 2H5DA 4IS5A 3GDSA 5F8TA 1O2SA 4Y7AA 5HMAA 1F5LA 5FPYA 1GJ6A 3T27A 1BMNH 3FANA 3F9EA 1GI1A 3MFJA 1P09A 1SFIA 5DP4A 1HNEE 1GI2A 4INKA 4NSYA 1C9TA 1UVSH 1VCPA 2PR3A 5FPSA 1AIXH 4R0IA 5I25A 1BTYA 2B8OH 3AVZA 4BXWA 3PMHB 1ZPCA 3KHVA 3NUMA 1RRKA 1K22H 1MQ5A 2XBXA 1S84A 2UUKB 1AFQC 1Z71A 1HAPH 1O39A 1AVWA 1GJAB 5L6NH 4K8YA 1K1LA 4MPUA 3URCA 1SG8B 3LT3A 1O3DA 1T31A 3RXKA 4ABIA 1ZRBA 1C1QA 3GY8A 1TFXA 2BY7X 2EC9H 4RN6A 1BUIA 4YESB 2Z9JA 4I8GA 2SNWA 3LH1A 1ZHPA 2DE8A 2VH0A 5F8XA 1G2LA 1FJSA 1O5GH 1Y59T 4ZKRU 3VB4A 3PTBA 4FUCA 3NXPA 3LJOA 1RIWB 5A8YA 2GCTB 1ETSH 1F0SA 1SGQE 4DT7B 2ULLA 4NIXA 4NWLA 1OWIA 4A6LA 4ISHH 1O2KA 1MZAA 2A45B 3RXLA 2A7HA 4CR5A 3M3VA 1CU1A 3A84A 1GBTA 4INHA 1C1NA 1UCYE 2LPRA 1G9IE 1ZHRA 4F49A 3EA9A 2OBQA 3MU0A 5FBIA 2HPQH 3SGBE 1N8OB 4NFEA 3UREA 4NWKA 2AGGX 4LXBH 2BB4A 2WUCA 1GI8B 2H2ZA 2VIPA 3BIVH 1W0ZU 4IBLH 3RMLH 1AO5A 4MG3A 2NU2E 1EAIA 4A1VA 1A4WH 1BCUH 2C8XB 1Z7KA 1F5KU 1B7XB 4ISLA 1FAKH 2G00A 3GY4A 1FLEE 4Y11E 1V2RT 3A88A 4JYUH 3O8RA 1UCYH 2ALVA 1QGFA 3DA9B 1FY8E 1VCWA 3MO3A 2ZF0H 2BD7A 3VGCB 4CRCA 3SBKA 3S7HB 4KP0A 1ARCA 1P11E 2OC7A 1FAXA 1FN8A 2H9HA 1NRQH 4NSVA 3P95A 1LVBA 4AFSA 1G3EA 1V2PT 1ZSLA 1GJBB 1LVYA 4I32A 2GDDA 2THFB 3PMJA 1D3TB 4K2YA 3OY5U 3SOSA 3MU4A 1YCPH 3BG4B 1ACBE 4J2YB 3B23B 1FN6A 1SOZA 1ANEA 1OKXA 4Q2KA 1V2UT 3ZYEA 1QJ1B 3L33A 4ISNA 1K1JA 1GWAA 4LK4A 1A3EH 3W94A 1Y5UT 4K3JA 5F03A 3ZZ6A 1OP0A 1G2MA 3PLBA 5LGOA 1O5BB 3ZZ4A 1DPOA 2FPZA 5FX6A 1VITG 2UWPA 4YZUA 5K7RA 2BDBA 4CRFA 3LGUA 3S9AA 1O3JA 3GDUA 4AORA 3M5LA 3TJUA 1UTJA 1FY3A 1H1BA 3DUXH 3LGTA 3ZVDA 3V12A 4X1RU 3SNAA 2BZ6H 3ELAH 3N7OA 3GY7A 4D76A 1N1LA 3RU4D 2WPMS 1TAWA 3JZ1B 4OS5A 5A0CA 4B2CA 2FOHA 5LPEA 1A46H 1AFQB 4RKJB 1EPTA 2BQ6B 3OY6U 1B0EA 1TRNA 1TWXB 1GJ7B 1GBAA 3E0PB 3SGQE 3SJ8A 1C5TA 1DY9A 1BTXA 3DFLA 1TBRH 1O31A 1O3CA 1MU6B 2ZA5A 1ETTH 3GY2A 2FYQA 4WH6A 1T32A 1QB1A 1O3BA 2C93B 1P12E 1GJ8B 4IC6A 1NROH 3ZVEA 3LH3A 2J34A 3K6ZA 1MKXH 1SMFE 5EU8A 2HVXA 1O37A 2PTCE 1M9UA 2W5EA 2FX6A 1UTOA 4Q7YA 4X6OA 1V6DA 2OC0A 2G51A 1RTLA 1P2NA 2BY9X 1O33A 1HYLA 3T25A 2BY5X 3O8CA 2M5TA 1ZSKA 2XCFA 2J38A 2FOMB 1W7GH 1NC6A 1O3OA 1B0FA 1C2IA 3LC5A 1O2RA 1G3DA 1O2LA 1PQAA 5B6OA 1IQHA 1W3CA 4JK6A 3PO1C 3LOXA 3UNRA 1P02A 4AFUA 3FZDA 2BVXH 3GCTG 4FUDA 3H5CB 1WTHD 2ZEBA 2C90B 4NZLA 5C1YA 2BX3A 1J14A 2BLQA 1KTSB 1DS2E 1DXPA 5C5OA 1BTHH 3RC6A 2AS9A 1BT7A 3T5FH 1UTMA 2PTNA 3S9CA 4ZXXH 4H6TA 2ODPA 4F4OC 1HAXB 1LO6A 2P93A 2AFQB 2FOEA 1VGCC 1VR1H 4KTUA 1SPJA 4IN1A 4AYVB 2AGEX 1YPHC 4BTIB 4LZ4B 1VITF 4GVUA 4Y8YA 1AE5A 1QHRB 4X8UH 2TGPZ 5HM2A 1IQIA 3EAJA 2H1UA 1W10U 7ESTE 2D2DA 1XVMA 3GY6A 3M7UA 2HWLB 3D49H 1IOEA 2UUJB 1TPOA 1DLKB 5JB8S 2Z3CA 3SHAH 2QC2A 4Y6DA 1Z8GA 2QCYA 4JYVH 4CH8B 1PPEE 2C3SA 4ZROA 2AGIX 5JPMH 4MDSA 1ESAA 2XBVA 3BTGE 1HIAA 3SJKA 1ELAA 1THRH 1GJ4H 1ESBA 3MNXA 2F9NA 1O38A 1CHOG 2TGTA 1W0YH 1DDJA 1ZOMA 2ALPA 3TK6A 3FFGA 1KDQB 2C8YB 4YOIA 5A0AE 4NIWA 5JBAS 1DICA 1QURH 3RM0H 4AFZA 3GCHC 2ZCHP 4XBBA 4YOJA 3T28A 1F0UA 2ZGJA 1MTUA 1K1PA 3QGNB 4A5TS 1A2CH 3MWIU 2ZFTA 1S81A 4Y79A 2QYIA 1BRCE 4OS7A 2W3KA 2QA9E 2ZDKA 4VGCB 1WQSA 2GZ8A 1MKWH 1MCVA 5DP5A 1TBQH 1SGRE 4OS1A 3P8FA 3MU1A 4O3UA 2YOLA 1ANBA 4UONA 1RXPA 2ZTXA 1YCPM 2V0BA 1C1PA 4GSOA 1EUFA 3ZV9A 1O3FA 1TB6H 2TGDA 1GBHA 4JZDH 5EQRA 1HLTH 1YC0A 5G4BA 3E3TA 5T6DA 1BHXF 3NZIA 3BTWE 1SGDE 4D9QA 2FYRA 3A82A 4JYTA 5K0HA 3MH4A 4GCHG 1NY22 4CRGA 2O8MA 2STBE 1V2KT 3G01A 3BTDE 1UHBB 5DP3A 2ZFQH 4ZHMU 3ZVBA 1JIRA 1EAUA 1XX9A 3B9FH 1GHBG 3GCTF 4WXIA 4ABFA 2CXVA 1TNIA 1VZQH 2HLCA 4RSPA 1L1GA 5CMXH 1HPGA 1C1RA 3Q3XA 4ABBA 4E06H 2Q6GA 1EQ9A 1FY4A 1GHWH 5L2YH 4NZQA 4H4FA 1YF4A 1QIXB 1NT1A 5F6MA 3SORA 1QA0A 4BOHA 4I8JA 1MTSA 2FS8A 1GL0E 1DANH 1KXBA 2WPIS 3RXHA 2G5NA 3PO1B 3GYLB 3NPSA 1QL9A 4TWYA 2IJOB 5AF9H 1PPCE 1K21H 3BG8A 3STJA 2BM2A 1C1OA 1XUJA 1GMHG 4JZFH 4Y8ZA 3KN2A 3UR9A 1ZSJA 2Y5GA 2HPPH 2GGVB 2A7JA 3SU5A 1GVLA 1UTLM 2Y5HA 3TJVA 5C1UA 1LHGH 1J17T 7LPRA 3R0FA 1AN1E 1D6RA 1RIWC 1K1MA 1NS3A 3MH6A 4FUJA 4UD9H 1ZGVA 1F2SE 1SI5H 1C1TA 1HAVA 4B71A 4U2WA 1O3EA 1H8DH 5DP8A 1C5MD 3KQEA 7GCHG 3BEFB 5C1XA 1MCTA 1L1JA 1NN6A 2BYAX 3I78A 5E0HA 1ELCA 3U8TH 4CRAA 3M5NA 3ZZ3A 2QY0B 4U30A 1CHOF 3E90B 1OWEA 1XMNB 1TOMH 5GJ4B 1D4PB 1ZPBA 1GBDA 1GBJA 1KDQA 1P2IA 2G52A 3KF2A 2JKHA 1P3CA 4D9RA 1F0TA 1O2HA 2WPJS 3KGPA 4AB8A 1OOKB 2ZNKH 2RDLA 1FNIA 2OD3B 5DO4H 1GHZA 1O2TA 2ZQ1A 2A4OA 9LPRA 1O3IA 1OP8A 3S0NA 1NO9H 2VWOA 3JZ2B 1NRRH 4FU7A 1EKBB 3F1SB 8GCHG 1P9UA 1DOJA 4GLYA 2WYJA 3U8RH 4JCNA 1UVUH 1O2UA 4B75A 1IQLA 5EPYA 2A5IA 4WMEA 4UEHH 2FIRH 2AH4X 4HZHA 2TPIZ 3NWUA 2P59A 4YTAA 5EW2H 3GCHB 3VB7A 2ZGXH 2IN2A 2VIWA 2PKAB 1FY1A 1T8NA 1TONA 3LONA 1O5DH 3F9HA 1AKSB 1GCDA 1LKBA 2O9QA 1BBRK 4NA7A 1WBGB 1KXCA 2NU4E 2C8WB 2FTMA 1LHEH 1FMGA 1BJVA 1YPMH 4GCHF 4FU9A 1GI9B 4ISIH 2GDEH 2CGAA 1A1RA 1GI5A 2BDHA 3BG4C 5JBTA 3M35A 1UHBA 4X6PA 1NFXA 2AYWA 4FXGH 3EA7A 3SUGA 1GHBF 2HNTE 2CV3A 1YPEH 4O3TA 4IMQA 1FQ3A 3KQDA 3RXAA 2FX4A 5AFZH 3FZZA 2CF8H 3TH4H 4MNVA 2BX4A 1AI8H 2SFAA 1N6XA 2FLBH 1IHTH 2QGRA 2ODYB 3OYPA 2ZHFH 1ZLRA 2BVRH 5HYOA 1BIOA 4BXSA 1C5OH 3MNCA 3QUMP 2B9LA 1C5SA 1QB6A 1EOJA
chains in the Genus database with same CATH superfamily
4X1NU 3E0NB 1G36A 1TQ0B 5FXLA 5GCHG 1TOCB 1L0ZA 1GMHF 1DWCH 2EA3A 3QK1A 5C94A 4XD7D 1GBBA 1SC8U 1BOQA 5EJLA 4BTTB 1LPZB 3RMOH 4WMDA 2PSYA 3EQ0H 4AZ2B 4K1SA 1GCTB 1SVPA 3S7KB 1F92A 3OU0A 2XC5A 4A1XA 3SV9A 2TGAA 1DLEA 2SGFE 1C4V2 3T29A 1OXGA 1C2DA 2SGAA 2AERH 2EI7A 1NPMA 3A86A 1H8ED 1NRSH 1GBEA 3VB5A 3NCLA 7GCHF 1OYTH 5GWZA 4JZ1A 3GS9A 1HXFH 1P3EA 4I8LA 1ELVA 4AN7A 1YPGH 2JH5D 2P3TB 3QLPH 4IMZA 2IPQX 2ESTE 1IQEA 2BLVA 5A8XA 2R2MB 1ELEE 1BTPA 3OEED 3P70B 1ZPZA 1EZSC 4THNH 1A7SA 1WCZA 1SGCA 4WVPE 1P2OA 1L1NA 2WZQA 3URDA 1C5QA 2TIOA 2ZHQH 3BSQA 3A89A 2NU0E 2BVSH 3SNBA 1ZJDA 1ZYOA 3A81A 4CHAB 1C2EA 3A7YA 1MAXA 5HM9A 1GHYH 1TE0A 3TU7H 4A92A 3PV2A 1S6LA 2ZPRA 1Q31A 3L3TA 3HGPA 1JXPA 2DE9A 2LP6A 3A83A 3M61U 2CJIA 2ZFFH 3F9FA 3P8OA 4FVDA 3LGWA 1K1IA 3IITA 1MTVA 4IGDA 4I8HA 2VB0A 3RMMH 1IQNA 3A7ZA 1AKSA 1RTKA 3RXQA 1J8AA 3SNDA 4E7NA 2B5TB 2Z7FE 2BXUH 3RXMA 3RXFA 3TGKE 3ZZ7A 1RS0A 4NG9H 4TPIZ 5BRRE 2R2WU 1KIGH 1TX7A 2XC4A 3PROA 1MQ6A 4BAHB 3FP7E 2BY8X 3SO3A 1IQGA 2P3UB 5DP7A 3MHWU 1WUNH 3TVJB 1ELBA 1AU8A 3CP7A 1TNHA 3E16B 2Z3DA 1CA0B 1AD8H 4OM9A 4BAQB 4YM9A 4HTCH 2ZTYA 2F83A 4IC5A 3KIDU 3M5OA 2C4FH 1D3DB 2EY4C 2R0KA 1Y3YA 4DVAU 3A7VA 1EP6A 1C1WH 1Z6EA 1MU8B 2K1QA 5BPEA 2BY6X 1GG6C 1SL3A 2BXTH 3SU2A 1BRBE 2XCNA 1ANDA 3AASA 3F9GA 2Z6BD 2Z9IA 2L74A 2ZPSA 1DE7H 3U1JB 2ZG0H 1S5SA 1TBZH 1ZHMA 5GCHF 3MYWA 3RC4A 4CR9A 3M7QA 3ATWA 5DP6A 3EDXB 1ABIH 8ESTE 4YXWD 2A7CA 2Y7XA 4ABGA 2O8TA 1Q3XA 1ZR0A 1HRTH 1YCPK 3UTUH 1VJ9U 1HBTH 1GBLA 1LTOA 1C5PA 2J4IA 4GPGA 3EA8A 3SGAE 1J9CH 4WJG2 3TITA 4AB9A 2SGEE 1QCPA 1YY3A 2XXLA 4Y10E 1QB9A 3E8LA 2FLRH 3PWCA 4OS6A 5CDFE 3ATMA 1PYTD 2GVFA 1XXDA 1P06A 1S85A 4ZHAA 4ZXYH 1E35B 2OP9A 4Q80A 6CHAC 3MU5A 1ZMLA 5FAHA 1F0RA 1HAOH 3UQVA 1YPJH 3TJOA 2V35A 1PPHE 3RUOA 3SNCA 2Y80A 3TPIZ 1TPSA 1ZMNA 4WF8A 1YGCH 1XVOA 1EJNA 1GI7B 4VGCC 4BAKB 4A1TA 4BTUB 4AYYB 3NKKA 4O9VA 3UY9A 2PUXB 2P8OB 5FHTA 1QBOA 2F9OA 1OWKA 1T8MA 1L4ZA 3DFJA 1TNKA 3QDZB 1QBVH 2VJ1A 2VWLA 2XNIA 2F9BH 2BDCA 1SOTA 2SGPE 3HKJB 4FETA 1TGNA 1FI8A 1E79D 1HAGE 1C2GA 4ACAA 3K65B 1HGTH 2HLDD 3SN8A 5TCCA 1TNLA 3ITIA 1SBWA 3U98H 1O2MA 2ZU1A 1LPKB 1P0SH 1DSTA 1BMLA 3ZZAA 2FOGA 1Y5BT 3PWBA 1E38B 3VXEH 1SLUB 1TMBH 1P03A 1MKXK 4ZHLU 1QA7A 1V2ST 3BTEE 3P92A 1A0JA 1W8BH 2PV9B 4LZ1H 1IHSH 4B2BA 3SJOA 4I31A 2CF9H 1T4UH 1V2OT 5EODA 3LJJA 1A5HA 5LPFA 3LDXH 3UFAA 2V7QD 2WUBA 1JOUB 1GJDB 1O34A 3R3GB 2YNAA 1E37B 1CGJE 3VB6A 3K9XB 4RT0A 3BTQE 1P57B 1C5NH 3LGVA 4MTBA 1MMJN 1MD8A 3T26A 4WXVA 1NU9A 1JRTA 1BB0B 1OP2A 1HJAC 1CSOE 3P17H 1FIZA 2BZAA 2A4RA 3M36A 4B1TA 2ZDVH 4J1YA 4K60A 2FESH 1DUEA 2A2XH 3HKIB 1AWHB 1MABB 2ZZUH 2BDGA 4B76A 1UJ1A 3F0OA 3V13A 4BAMB 1WYKA 1O30A 1ZGIA 2GP9B 1KLTA 3ZIAD 2F3CE 4WWYA 3I29A 2QAAA 4NA8A 2H6MA 1JBUH 1C5UA 1GL1A 1BDAA 1V2LT 3A7TA 4ZKNU 3HGNA 1UK2A 1KLIH 1P2QA 1OYQA 1ZTKA 2A1DB 2FTLE 2FS9A 1GG6B 4R8TB 2UWOA 1LVOA 3PLPA 1SGEE 2ZWLH 3SU1A 1BRAA 4DJZB 3A8BA 2BD9A 2O8UA 3FP8E 2GT8A 3ZZ8A 4SGBE 2AHME 1H9IE 1DFPA 3RXIA 1G32B 3T2NA 3GYMA 5HXFA 2QXGA 4TYDA 4X8TH 1CA8B 1P2KA 2FM2A 1FXYA 2LNCA 1NFUA 2DUCA 4FUFA 2K0QA 2VINA 3MOCA 2I6QA 4ISOA 1ARBA 3HK3B 1YPHE 1MAYA 3N7DA 2K8IA 1TGSZ 2AIPA 1AGJA 8KME2 1TQ7B 2AIQA 2F9PA 5EOKA 3ZVCA 1QY6A 5F53A 4OS2A 3V7TA 1JMOH 3OTPA 1IQKA 2PSXA 6CHAB 1WXRA 1UK4A 2I6SA 1TPPA 3Q77A 4FUGA 4NGAH 1A3BH 1V2WT 3PM3A 1GBMA 3OTJE 1KYNA 1AFEH 1GPZA 2GCHG 2BDYA 4UDWH 1OWJA 2VWMA 3ZZDA 2F91A 2FEQH 4YT6H 1EJMA 1PPFE 3RXJA 5GIBA 2ZFPH 1EFRD 2NU3E 2BDIA 5IDKA 3ZVFA 2ZHEH 1NBMD 4ABJA 3RXTA 5KECA 1WV7H 6GCHG 2R3YA 1WAYB 1UVPA 1O2IA 3RXGA 1EP5A 3HATH 1GBKA 1LQDB 4WMFA 5EXNA 1HJ9A 3P6ZB 1YLCA 3QN7A 1UK3A 4A7IB 1THPB 3GOVB 2WYGA 2W7UA 1WU1A 1GI6A 2ZCLP 3F0PA 2A2QH 1DM4B 4JMYA 1D9IA 2EEKA 1PPBH 2H5CA 3LC3A 1O3MA 1G3BA 1PFXC 3TIUA 5KEDA 1OWDA 1HV7A 1EAWA 3SU4A 4F48B 4X6NA 1GJCB 1P8VC 1SGIB 1Y3WA 4WH8A 1YYY1 2ZC9H 4DIIH 1GCTC 3ENSB 1HUTH 2P16A 2A5KA 2GTBA 4HI3A 1TGBA 1JIMA 5FCKA 2G81E 2BOKA 3AAUA 2ANMH 2VIOA 2WSSD 1W14U 3KQBA 1NFWA 1DXWA 5E8EH 1SGNE 1O2GH 1S6FA 3A80A 1ELDE 2GV6A 3A85A 2JIZD 4Z0KA 4M7GA 4X8SH 4ACBA 5EPNA 1A0HB 3DSGA 1QJ7B 4GAWA 1YLDA 2XWBI 5DK1A 2Z9KA 2G5VA 1C2JA 1HJAB 4ZCNA 2JETC 4D8NA 2CMYA 2FI4E 1V2QT 1JWTA 4H42U 1O2VA 4YT7H 2QIQA 4X2WA 4KELA 4BNRA 1OSSA 1Y3XA 1QBNA 3DT0H 2ZIQH 3D65E 2M2AA 3OFND 1NFYA 1Y3VA 3QTOH 2GT7A 2QF4A 2UUFB 1J16A 2NU1E 2ZDLA 1O2YA 1AB9C 1DWEH 3QZQA 4XBDA 4CHAC 2B7DH 1TA2A 4KKDA 1EXFA 5AFYH 4MQAA 3MI4A 4FUIA 1OHHD 1NRNH 5FPTA 3NRLA 2ZGBH 4K5ZA 2PW8H 3PLKA 1K2I1 1D3PB 5A8ZA 3SI4H 4TY6A 1PQ8A 1TPAE 4Y0ZE 1Z1JA 6LPRA 1PQ5A 3OEHD 1PPZA 5GDSH 1F7ZA 4IW4E 1FONA 2WV4A 1MD7A 2BOHB 2OLGA 1P2JA 5T6FA 3ZZCA 1QR3E 7KMEH 1QNJA 3UWJH 1K1OA 2GX4A 5DSFA 5ESTE 1FDPA 1S6HA 4YOGA 1G3CA 3ATLA 4BAOB 1BBRE 2GCHF 2V3OH 5EG4A 1HCGA 1ANCA 4XFQA 1BZXE 2FMJA 1ZJKA 3FVFB 1GMCG 3F68H 1BHXB 2W3IA 2KM0A 1CA0C 6GCHF 1FPCH 2GZ9A 4GUXA 1GGDC 1GI4A 3BTME 1GDUA 4K1TA 2EI6A 3A7XA 1KXDA 1HAHH 2HNTC 1W11U 1AHTH 1B5GH 4DIHH 4ZAEA 1DITH 1TYNA 5TCAA 2GZ7A 1XKAC 1KXAA 1BBRH 2W6ID 5L30H 2Y82A 1UTNA 2VVVA 3Q3YA 1YPKH 4YLQH 4U32A 2RG3A 3UWIA 2D1JA 3LKWA 3U9AH 1MZDA 3VB3A 4MNWA 2R9PA 3A87A 4Q7ZA 4D7FA 1YBWA 2OCVB 2FO9A 5T3HA 3RXVA 1KLJH 1CVWH 2OK5A 2PFEA 3ZVAA 3K2UA 4TPYA 3RU4T 3SQHE 3P8NA 1DWDH 4AC9A 1PJPA 2GKVE 1CT4E 2ZECA 4Y0YE 1HAYB 1UTPA 1O2QA 1E1QD 2C8ZB 2A32A 4AG1A 3BEIB 2G8TA 1W12U 2ZGCA 2HNTF 2ZI2H 1U6QA 3QZRA 5EW1H 4U01A 3SUEA 1O3AA 2KX4A 2OINA 1K1NA 2BQWB 1GJ9B 3RLYH 4UFEH 2PGQB 3ODDA 5DPAA 3SJ9A 1V2VT 1HAIH 1LCYA 5EXLA 2P3FH 4ZUHA 3U69H 2OQ5A 3VFEA 1INCA 3L6PA 3ZZBA 2ZDNA 4QT8C 3HK6B 3KCGH 2P8OC 3TNSA 2KAIB 1J15A 1BA8B 4GHTA 5A09A 2D26C 1EZXC 1C5LH 1O3LA 2A4GA 2ZU4A 1O2NA 3SQEE 4X1SU 2VIDA 1O5CB 1QQUA 3WY8A 2H9TH 1CBWC 1X7AC 1HJ8A 1NTPA 1IAUA 1NZQH 3MTYA 5A2MH 3SV2H 5T6GA 1IQMA 3E6PH 3KNXA 1AUTC 3ZYDA 2ASUB 1LHDH 1GI0A 1RFNA 1T4VH 3UPEA 3U8OH 1BMFD 4X2VA 1O3HA 1C1UH 3F2FA 5EJZA 2OC1A 3O8DA 3VXFH 5LH8A 5ESBA 5L2ZH 1SQTA 2JETB 1CT0E 2PKSC 3KQCA 3QO6A 1TX6A 3E91A 1HDTH 4AG2A 5B6LA 5E2OA 3PRBA 3RP2A 4B74A 3UIRA 4DGJA 1P10A 2Q1JA 1C2KA 1SHYA 1CO7E 2HVYB 8GCHF 1O36A 1SGFG 1KXFA 1AB9B 3RXOA 2KFWA 4CBOA 1FPHH 1SLWB 3S69A 3Q3KA 3ESTA 1EASA 3TNTA 1C4Y2 1EPTB 2PUQH 2JJ2D 5C0UA 3M7TA 2KZ4A 1ORFA 2KCYA 4CBNA 3SU6A 3I77A 4Y7BA 4MVNA 3RC5A 1GMCF 1TRMA 2BD3A 3MH7A 4ASHA 2V3HH 2PKAA 2BD5A 2OUAA 2RFKC 3GDVA 2FWWA 3PV4A 4DURA 1QL7A 1TMUH 2JH0D 3TK9A 3KEEA 5C5NA 1V2NT 2BD8A 4JZIA 3S9BA 4ZH8A 1CQQA 2FODA 1EX3A 2XWAA 1XXFA 4WY3A 1EJAA 5C20A 5F8ZA 1GHXH 1TGTA 5EQSA 1A0LA 3SV8A 3WWBA 2XYAA 2OC8A 2ZFRH 5I46H 1HXEH 2XBYA 1ELTA 1O2XA 1O2ZA 2XC0A 1DX5M 3CNRA 1GDQA 1BTUA 2JDID 2SNVA 3BTTE 4E7RG 1T8LA 2HRVA 1EATA 1HAZB 2W7SA 1D3QB 4UFDH 1JRSA 1DSUA 1DT2A 3DSPA 3ATIA 3A8DA 1GGDB 2PP6A 1Z6JH 1P04A 2G4TA 3P8GA 4I8KA 4NA9H 5EIYA 1MUEB 1K28D 1O5AB 1GHAG 1RD3B 1MTNB 1BITA 2STAE 1UCYK 2XRCA 1O3PB 2BMGB 3AAVA 3SV7A 4XDEA 2ODQA 4AX9H 3A8CA 1P05A 4X6MA 1PYTC 2BLOA 3RXPA 3ATKA 1TLDA 3E1XB 1TNGA 2W26A 1TGCA 2Q6FA 3LPRA 2PGBB 1YM0A 2QV1A 1BMAA 2FI3E 3QGJA 5JBBS 1OPHB 3M3TA 1MBQA 1QFKH 4JK5A 4PROA 5JYIA 5LPRA 3ODFA 2XTTB 2FI5E 4K1EA 2KAIA 4Q7XA 4TWWA 2ZQ2A 3DD2H 1RTFB 2VNTA 1P01A 4ZMAH 1YKTA 1UO6A 3H7OA 3RDZA 1BTZA 1ELFA 1O32A 1P2MA 1XUHA 4AFQA 1LQEA 1ZRKA 1C2HA 1MH0A 1Z1IA 1NRPH 1AUJA 4KTCA 5EQQA 5FL7D 1V2MT 3MNSA 4TT3D 1UTKA 1IQJA 2FZZA 3MO6A 1AY6H 1SB1H 5FBEA 3U1IB 5CHAC 1D6WA 8LPRA 1O5EH 4IN2A 3UQOA 5ETXA 1FUJA 2FOBA 2AEIH 2YMSD 1T8OA 3LIWA 1HFDA 2ZU5A 4K8BA 3RU4E 1O3KA 3GCOA 1CBWB 1XUGA 3SNEA 2VVUA 3UAIC 2G55A 1CT2E 1HIAB 3C1KA 1AE8H 4DW2U 1L2EA 1WTGH 2VIVA 4ZKSU 2XW9A 4D7GA 1C5RA 1S0QA 1NM6A 1O3NA 4ABHA 1G30B 1QTFA 4F55A 2PKSB 1H9HE 3UNQA 1UW7A 1KY9A 1WQVH 2J94A 2J9NA 3M5MA 5PTPA 1XUFA 1ZTLA 2Q6DA 3V3MA 3BEUA 1E0FD 1EZQA 1CHGA 3TH2H 1EB2A 1XUKA 2FOFA 4Z6AH 3CENA 1O3GA 6ESTA 5AHGH 1NESE 2AMQA 4AOQA 4TSFD 3OSYA 4OS4A 1C5VA 2GD4B 1LPGB 2J2UA 4Y8XA 1PQ7A 1O5FH 1LMWB 3BTHE 1QRWA 1EOLA 3IWMA 1AWFH 1C5WB 1GBFA 1H9LB 1ZMJA 5EXMA 1WOFA 1DUAA 1ID5H 1W7XH 1NU7B 2A5AA 2WV5A 2RDEA 4KTSA 1Y3UA 1O2JA 1EB1H 3NK8A 4X2XA 3SZEA 3TK5A 9ESTA 1FZZA 4OGXA 2PHBA 1GVZA 4X1PU 1Y8TA 2QXHA 1GHAF 1P9SA 1AVXA 2Z9GA 2VGCC 5CE1A 2IPHA 1Q2WA 1ELGA 1BMMH 3EE0B 2GMTC 1RJXB 2P94A 2F43B 2F9UA 2CHAC 1L4DA 2HALA 1S82A 1Z8IB 5ABWA 1DWBH 1A5GH 1QJ6B 2L6OA 2FOCA 3UUZA 3ZVGA 1C2MA 1O2PA 3MNBA 3KYFA 3M37A 5GNDA 1SLXB 2KCAA 5FCRA 3RXBA 1GJ5H 2AMPA 1QZ8A 3STIA 1V2JT 3QX5H 3MO9A 2CN0H 3ZZ9A 1MBMA 1C5ZB 1S0RA 4MNXA 2O8WA 4O97A 2Y6TA 2A31A 4NIVA 1TABE 4B2AA 3T62A 3H7TA 3MQKC 2HOBA 4HFPB 2FDAA 4XSKU 5H4IB 4MPWA 1W2KH 5IYTA 3CS7A 5HGGA 3TJNA 3M3SA 1SGYE 3Q76A 5JDUB 4CRDA 2ILNA 5SGAE 2CK3D 1KSNA 1QQ4A 1GVKB 2ANKH 1O0DH 1Y5AT 2RCEA 1VITH 3SU0A 4DOQA 1C2LA 1FY5A 4YLUA 1AVGH 1WSSH 1BQYA 1VJAU 3QWCH 2VH6A 4KGAA 4FUHA 1UVOA 3MMGA 3GY5A 3UOUA 3BV9B 1HAVB 2G4UA 2RA3A 2XBWA 1AQ7A 1K9OE 2ZPQA 4YO9A 3CS0A 1E34B 3MH5A 3ZZ5A 1BJUA 4P02A 3TLOA 1SR5C 4MPXA 2OQUA 5DP9A 4MNYA 2PLXA 5E2PA 2Z94A 4X1QU 3EYDA 2ZP0H 3SW2B 2ZTZA 1TIOA 2ZU2A 3RMNH 3HPTB 1TNJA 3PTNA 2H9EH 3KYGA 1DVAH 1TA6A 3RXDA 5CHAB 3DSOA 2FOAA 2GV7A 2OXSA 1VCQA 4TY7A 1SSXA 3GY3A 2B0FA 1MTWA 3V0XA 1UMAH 1V2TT 1C1VH 3PB1E 1TMTH 3UNSA 4DY7B 3AW1A 2SGDE 1TRYA 2QXIA 2TBSA 4HGCA 1HB0B 3W95A 1MKWK 3RXEA 3BIUH 1YPLH 3PMBB 4ESTE 1C1MA 5DJ7A 3SV6A 5C2ZA 1S83A 2BHGA 5C17A 1QL8A 2AMDA 1SGPE 2J92A 3BF6H 3K6YA 3FAOA 2QF3A 4X8VH 1SQOA 3LU9B 1YWUA 2UUYA 3D23A 1GMDG 3FO8D 1SQAA 4XOJA 2IOTA 3SYJA 3A8AA 2OTVA 1XUIA 3QTVH 2J95A 3SHCH 4XE4A 1BTWA 3BN9A 4LOYH 1BRUP 1EZUC 2Y7ZA 1A61H 3F6UH 1C4U2 5KGOA 2VU8E 4DCDA 4SGAE 5E0JA 1Z8JB 2BD2A 1H4WA 3VPKA 3IG6B 1ZZZA 4B73A 5GXPA 2TRMA 3BTKE 1GBCA 1LVMA 4X0WU 2ZHDA 1ETRH 5FX5A 2WPKS 1QRZA 1OS8A 2BTCE 2YNBA 4NFFA 5J4SA 4CRBA 1TALA 2IJD1 1CGHA 4JZEH 3A7WA 1Z8RA 2VGCB 4ABDA 5HIYA 5CHBA 2ZCKP 3PV5A 4GHQA 2FXRA 1TX8A 2WINI 2GMTB 3OE7D 4Y71A 4FU8A 4I33A 2R0LA 2O8LA 5DGJA 2CHAB 3MU8A 2ZFSA 2D8WA 2SGQE 3O8BA 2V6NA 1OX1A 5EGMA 3SUDA 2ZGHA 3EGKH 3RXCA 3GICB 2PWXA 1XM1A 3TGIE 1IQFA 1EAXA 3RXRA 1LKAA 3D62A 2JH6D 1UVTH 2BLWA 1V3XA 1C5YB 1AMHA 4FUEA 4H6SB 1EPTC 2QXJA 2BDAA 1O2WA 2ZO3H 2R3UA 1SGFA 1THSH 2GCTC 1T7CA 2WPHS 1LDTT 1C9PA 1C5XB 3RXSA 1GBIA 2QF0A 5J4QA 4MLFB 3UR6A 3PMAB 5JBCS 1GDNA 4BANB 1VGCB 2WPDD 3RM2H 1AZ8A 1ABJH 5DKMA 4CREA 2NWNA 2A4QA 4FUBA 4UFGH 5A0BA 2QN5T 1RGQA 1FV9A 3BTFE 3LGYA 3Q00A 5E0GA 2BQ7B 2VVCA 1SLVB 4O03A 1DY8A 2WV9A 4Y76A 4K69A 5AVDA 3RLWH 2F9VA 1C1SA 1XKBC 3C27B 2VWNA 4E05H 3B8JA 3ZV8A 1W13U 2BD4A 2ANWA 5C3NA 1N8OC 2UWLA 1GHVH 3VEQB 1LHFH 3SI3H 1N6YA 4NCYA 4M9FA 2EI8A 4Q63A 1SFQB 1PPGE 1A5IA 3KL6A 2ZDMA 4CH2B 4ABEA 2ZKSA 3UOPA 1AZZA 1SHHB 3TH3H 5HKKD 4NIYA 5JB9S 1MTNC 2P95A 1UTQA 1GI3A 1YP9A 1GMDF 1VKYA 2RA0A 4XBCA 1G37A 4UFFH 3AW0A 1ZTJA 4I7YH 4ZKOU 1ESTA 2VIQA 2Z9LA 3VGCC 1OWHA 3DHKH 1H8IH 2Z3EA 2KCPA 1LHCH 2J98B 4OGYA 2OBOA 2WPLS 3OX7U 2ZHWH 5DG6A 2Y81A 1CE5A 4MPVA 4X2YA 4XRNA 1F5RA 1QRXA 4UE7H 4RT1A 2Y5FA 4INLA 2ZU3A 1FIWA 3TGJE 5TJXA 2HGTH 2A0QB 3SU3A 1KXEA 2ZDAH 4DG4A 5GPIB 5C67A 2ANYA 4FVBA 2J5UA 1KTTB 1E36B 1O2OA 4AGJA 3GISB 2FP7B 3RXUA 3SUFA 3LGIA 1CGIE 1SGTA 3H09A 3SZNA 4RKOB 4AGKA 1C2FA 1O35A 3PYHA 3FP6E 1YLNA 4ABAA 3GCNA 3SJIA 2H5DA 4IS5A 3GDSA 4DT4A 5F8TA 1O2SA 4Y7AA 5HMAA 1F5LA 5FPYA 1GJ6A 3T27A 1BMNH 3FANA 1WDIA 3F9EA 3U28C 1GI1A 3MFJA 1P09A 1SFIA 5DP4A 1HNEE 1GI2A 2XOKD 4INKA 4NSYA 1C9TA 1UVSH 1VCPA 2PR3A 5FPSA 1AIXH 1E1RD 4R0IA 5I25A 1BTYA 2B8OH 3AVZA 4BXWA 3PMHB 1ZPCA 3KHVA 2KR7A 3NUMA 1RRKA 1K22H 1MQ5A 2XBXA 1S84A 2UUKB 1AFQC 1Z71A 1HAPH 1O39A 1AVWA 1GJAB 5L6NH 4K8YA 1K1LA 4MPUA 3URCA 1SG8B 3LT3A 1O3DA 4B6FA 1T31A 3RXKA 4ABIA 1ZRBA 1C1QA 3GY8A 2QF5A 1TFXA 2BY7X 2EC9H 4RN6A 1BUIA 4YESB 2Z9JA 4I8GA 2SNWA 3LH1A 1ZHPA 2DE8A 2VH0A 5F8XA 1G2LA 1FJSA 1O5GH 1Y59T 4ZKRU 3VB4A 3PTBA 4FUCA 3NXPA 3LJOA 1RIWB 5A8YA 2GCTB 1ETSH 1F0SA 1SGQE 4DT7B 2ULLA 4NIXA 4NWLA 1OWIA 4A6LA 4ISHH 3FKSD 1O2KA 1MZAA 2A45B 3RXLA 2A7HA 4CR5A 3M3VA 1CU1A 3UB0A 2QE7D 3A84A 1GBTA 4INHA 1C1NA 1UCYE 2LPRA 1G9IE 1ZHRA 4F49A 3EA9A 2OBQA 3MU0A 5FBIA 2HPQH 3SGBE 1N8OB 3OAAD 4NFEA 3UREA 2J98A 4NWKA 2AGGX 2JJ1D 4LXBH 2BB4A 2EQNA 2WUCA 1GI8B 2H2ZA 2VIPA 3BIVH 1W0ZU 4IBLH 3RMLH 3EE7A 1AO5A 4MG3A 2NU2E 1EAIA 4A1VA 1A4WH 1BCUH 4P00A 2C8XB 1Z7KA 1F5KU 1B7XB 4Z1MD 3W1EA 4ISLA 1FAKH 2G00A 3GY4A 1FLEE 4Y11E 1V2RT 3A88A 4JYUH 3O8RA 1UCYH 2ALVA 1QGFA 3DA9B 1FY8E 1VCWA 3MO3A 1KMHB 2XNDD 2ZF0H 2BD7A 3VGCB 4CRCA 3SBKA 3S7HB 4KP0A 1ARCA 1P11E 2OC7A 1FAXA 1FN8A 2H9HA 1NRQH 4NSVA 3P95A 1LVBA 4AFSA 1G3EA 1V2PT 1ZSLA 1GJBB 1LVYA 4HG6A 2VBCA 4I32A 2GDDA 3WW7A 2THFB 3PMJA 1D3TB 4K2YA 3OY5U 3SOSA 3MU4A 1YCPH 3BG4B 1ACBE 4J2YB 3B23B 1FN6A 1SOZA 1ANEA 1OKXA 4Q2KA 1V2UT 3ZYEA 1QJ1B 3L33A 4ISNA 1K1JA 1GWAA 2YMSC 4LK4A 1A3EH 3W94A 1Y5UT 4K3JA 5F03A 3ZZ6A 1OP0A 1G2MA 3PLBA 5LGOA 1O5BB 3ZZ4A 1DPOA 2FPZA 3F2HA 5FX6A 1VITG 2UWPA 4YZUA 5K7RA 1SQRA 2BDBA 4CRFA 3LGUA 3S9AA 1O3JA 3GDUA 4AORA 3M5LA 3TJUA 1UTJA 1FY3A 1H1BA 3DUXH 3LGTA 3ZVDA 3V12A 2GJGA 4X1RU 3SNAA 2BZ6H 3ELAH 3N7OA 3GY7A 4D76A 1N1LA 3RU4D 2WPMS 3F2GA 1K0HA 1TAWA 3JZ1B 4OS5A 5A0CA 4B2CA 2FOHA 5LPEA 1A46H 1AFQB 2WHXA 4RKJB 1EPTA 2BQ6B 3OY6U 1B0EA 1TRNA 1TWXB 1GJ7B 1GBAA 3E0PB 3SGQE 3SJ8A 1C5TA 1DY9A 1BTXA 3DFLA 1TBRH 1O31A 3FN8A 1O3CA 1MU6B 2ZA5A 1ETTH 3GY2A 2FYQA 4WH6A 1T32A 1QB1A 1O3BA 2C93B 1P12E 1GJ8B 4IC6A 1NROH 3ZVEA 3LH3A 2J34A 3K6ZA 1MKXH 1SMFE 5EU8A 2HVXA 1O37A 2PTCE 1M9UA 2W5EA 2FX6A 5IK2D 1UTOA 4Q7YA 3N7EA 4X6OA 1V6DA 2OC0A 2G51A 1RTLA 1P2NA 2BY9X 1O33A 1HYLA 3T25A 2BY5X 3O8CA 2M5TA 1ZSKA 2J97A 2XCFA 2J38A 2FOMB 1W7GH 1NC6A 1O3OA 1B0FA 1C2IA 3LC5A 1O2RA 3FOAA 1G3DA 1O2LA 1PQAA 5B6OA 1IQHA 1W3CA 4JK6A 3PO1C 3LOXA 3UNRA 1P02A 4AFUA 3FZDA 2BVXH 3GCTG 4FUDA 3H5CB 1WTHD 2ZEBA 2C90B 4NZLA 5C1YA 2BX3A 1J14A 2F4LA 1W0JD 2BLQA 1KTSB 1DS2E 1DXPA 5C5OA 1BTHH 3RC6A 2AS9A 1BT7A 3T5FH 1UTMA 2PTNA 3S9CA 4ZXXH 4H6TA 2ODPA 4F4OC 1HAXB 1LO6A 2P93A 2AFQB 2FOEA 1VGCC 1VR1H 4KTUA 1SPJA 4IN1A 4AYVB 2AGEX 1YPHC 4BTIB 4LZ4B 1VITF 4GVUA 4Y8YA 1AE5A 1QHRB 4X8UH 5HIZA 2TGPZ 5HM2A 1IQIA 3EAJA 2H1UA 1W10U 7ESTE 2D2DA 1XVMA 3GY6A 3M7UA 2HWLB 3D49H 2V3MA 1IOEA 2UUJB 1TPOA 1DLKB 5JB8S 2Z3CA 3SHAH 2QC2A 4Y6DA 1Z8GA 2QCYA 4JYVH 4CH8B 1PPEE 2C3SA 4ZROA 2AGIX 5JPMH 2YMSB 4MDSA 1ESAA 2XBVA 3F3BA 3BTGE 3N99A 1HIAA 3SJKA 1ELAA 1THRH 1GJ4H 1ESBA 3MNXA 2F9NA 1O38A 1CHOG 2TGTA 4ASUD 1W0YH 1DDJA 1ZOMA 2ALPA 3TK6A 5C0TA 3FFGA 1KDQB 2C8YB 4YOIA 5A0AE 4NIWA 5JBAS 4I86A 1DICA 1QURH 3RM0H 4AFZA 3GCHC 2ZCHP 4XBBA 4YOJA 3T28A 1F0UA 2ZGJA 1MTUA 1K1PA 3QGNB 4A5TS 1A2CH 2LELA 3MWIU 2KCOA 2ZFTA 1S81A 5DN6D 4Y79A 2QYIA 1BRCE 3WWFA 4OS7A 2W3KA 2QA9E 2ZDKA 4VGCB 1WQSA 2GZ8A 1MKWH 1MCVA 5DP5A 1TBQH 1SGRE 4OS1A 3P8FA 3MU1A 4O3UA 2YOLA 1ANBA 1NBME 4UONA 1RXPA 2ZTXA 1YCPM 2V0BA 1H8HD 1C1PA 4GSOA 3AK5A 1EUFA 3ZV9A 1O3FA 1TB6H 2TGDA 1GBHA 4JZDH 5EQRA 1HLTH 1YC0A 5G4BA 3E3TA 5T6DA 1BHXF 3NZIA 3BTWE 1SGDE 4D9QA 2FYRA 3A82A 4JYTA 5K0HA 3MH4A 4GCHG 1NY22 4CRGA 2O8MA 2STBE 1V2KT 3G01A 3BTDE 1UHBB 5DP3A 2ZFQH 4ZHMU 3ZVBA 1JIRA 1EAUA 1XX9A 3B9FH 3DCLA 1GHBG 3GCTF 4WXIA 4ABFA 2CXVA 1TNIA 4RI0A 1VZQH 2HLCA 5T1VA 4RSPA 1L1GA 5CMXH 1HPGA 1C1RA 3Q3XA 4ABBA 4E06H 2Q6GA 1EQ9A 1FY4A 1W0KD 1GHWH 5L2YH 4B6EA 4NZQA 4H4FA 1YF4A 1QIXB 1NT1A 5F6MA 3SORA 1QA0A 4BOHA 4I8JA 1MTSA 2FS8A 1GL0E 1DANH 1KXBA 2WPIS 3RXHA 2G5NA 3PO1B 3GYLB 3NPSA 1QL9A 4TWYA 2IJOB 5AF9H 1PPCE 1K21H 3BG8A 3STJA 2BM2A 1C1OA 1XUJA 1GMHG 4JZFH 4Y8ZA 3KN2A 3UR9A 3KQ5A 1ZSJA 3VG8A 2Y5GA 2HPPH 2GGVB 2A7JA 3SU5A 1GVLA 1UTLM 2Y5HA 3TJVA 5C1UA 1LHGH 1J17T 7LPRA 3R0FA 1AN1E 1D6RA 1RIWC 1K1MA 1NS3A 3MH6A 4FUJA 4UD9H 1ZGVA 1F2SE 1SI5H 1C1TA 1HAVA 4B71A 4U2WA 1O3EA 1H8DH 5DP8A 1C5MD 3KQEA 7GCHG 3BEFB 5C1XA 1MCTA 1L1JA 1NN6A 2BYAX 3I78A 5E0HA 1ELCA 3U8TH 4CRAA 3M5NA 3ZZ3A 2QY0B 4U30A 1CHOF 3E90B 1OWEA 1XMNB 1TOMH 5GJ4B 1D4PB 1ZPBA 1GBDA 1GBJA 1KDQA 1P2IA 2G52A 3KF2A 2JKHA 1P3CA 4D9RA 1F0TA 1O2HA 2WPJS 3KGPA 4AB8A 1OOKB 2ZNKH 2RDLA 1FNIA 2OD3B 5DO4H 1GHZA 1O2TA 2ZQ1A 2A4OA 9LPRA 1O3IA 1OP8A 3S0NA 1NO9H 2VWOA 3JZ2B 1NRRH 4FU7A 1EKBB 3F1SB 8GCHG 1P9UA 3PRDA 1DOJA 4GLYA 2WYJA 5EJ1A 3U8RH 4JCNA 1UVUH 1O2UA 4B75A 1IQLA 5EPYA 2A5IA 4WMEA 4UEHH 2FIRH 1SKYE 2AH4X 4HZHA 2TPIZ 3NWUA 2P59A 4YTAA 5EW2H 3GCHB 3VB7A 2ZGXH 2IN2A 2VIWA 2PKAB 1FY1A 1T8NA 1TONA 3LONA 1O5DH 3F9HA 1AKSB 1GCDA 1LKBA 2O9QA 1BBRK 4NA7A 1WBGB 1KXCA 2NU4E 2C8WB 2FTMA 1LHEH 1FMGA 1BJVA 1YPMH 4GCHF 2W6JD 4FU9A 1GI9B 4ISIH 2GDEH 2CGAA 1A1RA 1GI5A 2BDHA 3BG4C 4FOUC 5JBTA 3M35A 1UHBA 4X6PA 1NFXA 2AYWA 4FXGH 3EA7A 3SUGA 4Q4LA 1GHBF 2HNTE 2CV3A 1YPEH 1FX0B 4O3TA 4IMQA 1FQ3A 3KQDA 3RXAA 2FX4A 5AFZH 3FZZA 2CF8H 3TH4H 4MNVA 2BX4A 1AI8H 2SFAA 1N6XA 2FLBH 1IHTH 2QGRA 2ODYB 3OYPA 2ZHFH 1ZLRA 2BVRH 1COWD 5HYOA 1BIOA 4BXSA 1C5OH 3MNCA 3QUMP 2B9LA 1C5SA 1QB6A 1EOJA
chains in the Genus database with same CATH topology
4X1NU 3E0NB 1G36A 1TQ0B 5FXLA 5GCHG 1TOCB 1L0ZA 1GMHF 1DWCH 2EA3A 3QK1A 1GBBA 1SC8U 1BOQA 4BTTB 1LPZB 3RMOH 4WMDA 2PSYA 3EQ0H 4AZ2B 4K1SA 1GCTB 1SVPA 3S7KB 1F92A 3OU0A 2XC5A 4A1XA 3SV9A 2TGAA 1DLEA 2SGFE 1C4V2 3T29A 1OXGA 1C2DA 2SGAA 2AERH 2EI7A 1NPMA 3A86A 1NRSH 1GBEA 3VB5A 3NCLA 7GCHF 1OYTH 5GWZA 4JZ1A 1HXFH 1P3EA 4I8LA 1ELVA 4AN7A 1YPGH 2JH5D 2P3TB 3QLPH 4IMZA 2ESTE 1IQEA 2BLVA 5A8XA 2R2MB 1ELEE 1BTPA 3P70B 1ZPZA 1EZSC 4THNH 1A7SA 1WCZA 1SGCA 4WVPE 1P2OA 1L1NA 3URDA 1C5QA 2TIOA 2ZHQH 3BSQA 3A89A 2NU0E 2BVSH 3SNBA 1ZJDA 1ZYOA 3A81A 4CHAB 1C2EA 3A7YA 1MAXA 5HM9A 1GHYH 1TE0A 3TU7H 4A92A 2ZPRA 1Q31A 3L3TA 3HGPA 1JXPA 2DE9A 3A83A 3M61U 2CJIA 2ZFFH 3F9FA 3P8OA 4FVDA 3LGWA 1K1IA 3IITA 1MTVA 4IGDA 4I8HA 2VB0A 3RMMH 1IQNA 3A7ZA 1AKSA 1RTKA 3RXQA 1J8AA 3SNDA 4E7NA 2B5TB 2Z7FE 2BXUH 3RXMA 3RXFA 3TGKE 3ZZ7A 1RS0A 4NG9H 4TPIZ 5BRRE 2R2WU 1KIGH 1TX7A 2XC4A 3PROA 1MQ6A 4BAHB 3FP7E 2BY8X 3SO3A 1IQGA 2P3UB 5DP7A 3MHWU 1WUNH 3TVJB 1ELBA 1AU8A 3CP7A 1TNHA 3E16B 2Z3DA 1CA0B 1AD8H 4BAQB 4YM9A 4HTCH 2ZTYA 2F83A 4IC5A 3KIDU 3M5OA 2C4FH 1D3DB 2R0KA 1Y3YA 4DVAU 3A7VA 1EP6A 1C1WH 1Z6EA 1MU8B 2K1QA 5BPEA 2BY6X 1GG6C 1SL3A 2BXTH 3SU2A 1BRBE 2XCNA 1ANDA 3AASA 3F9GA 2Z6BD 2Z9IA 2ZPSA 1DE7H 3U1JB 2ZG0H 1S5SA 1TBZH 1ZHMA 5GCHF 3MYWA 3RC4A 4CR9A 3M7QA 3ATWA 5DP6A 3EDXB 1ABIH 8ESTE 2A7CA 2Y7XA 4ABGA 2O8TA 1Q3XA 1ZR0A 1HRTH 1YCPK 3UTUH 1VJ9U 1HBTH 1GBLA 1LTOA 1C5PA 2J4IA 4GPGA 3EA8A 3SGAE 1J9CH 4WJG2 3TITA 4AB9A 2SGEE 1QCPA 2XXLA 4Y10E 1QB9A 3E8LA 2FLRH 3PWCA 4OS6A 3ATMA 1PYTD 2GVFA 1XXDA 1P06A 1S85A 4ZHAA 4ZXYH 1E35B 2OP9A 4Q80A 6CHAC 3MU5A 1ZMLA 5FAHA 1F0RA 1HAOH 3UQVA 1YPJH 3TJOA 2V35A 1PPHE 3RUOA 3SNCA 2Y80A 3TPIZ 1TPSA 1ZMNA 4WF8A 1YGCH 1XVOA 1EJNA 1GI7B 4VGCC 4BAKB 4A1TA 4BTUB 4AYYB 3NKKA 4O9VA 3UY9A 2PUXB 2P8OB 5FHTA 1QBOA 2F9OA 1OWKA 1T8MA 1L4ZA 3DFJA 1TNKA 3QDZB 1QBVH 2VJ1A 2VWLA 2XNIA 2F9BH 2BDCA 1SOTA 2SGPE 3HKJB 1TGNA 1FI8A 1HAGE 1C2GA 3K65B 1HGTH 3SN8A 5TCCA 1TNLA 3ITIA 1SBWA 3U98H 1O2MA 2ZU1A 1LPKB 1P0SH 1DSTA 1BMLA 3ZZAA 2FOGA 1Y5BT 3PWBA 1E38B 3VXEH 1SLUB 1TMBH 1P03A 1MKXK 4ZHLU 1QA7A 1V2ST 3BTEE 3P92A 1A0JA 1W8BH 2PV9B 4LZ1H 1IHSH 4B2BA 3SJOA 4I31A 2CF9H 1T4UH 1V2OT 5EODA 3LJJA 1A5HA 5LPFA 3LDXH 3UFAA 2WUBA 1JOUB 1GJDB 1O34A 3R3GB 2YNAA 1E37B 1CGJE 3VB6A 3K9XB 3BTQE 1P57B 1C5NH 3LGVA 4MTBA 1MMJN 1MD8A 3T26A 4WXVA 1NU9A 1JRTA 1BB0B 1OP2A 1HJAC 1CSOE 3P17H 1FIZA 2BZAA 2A4RA 3M36A 4B1TA 2ZDVH 4J1YA 4K60A 2FESH 1DUEA 2A2XH 3HKIB 1AWHB 2ZZUH 2BDGA 4B76A 1UJ1A 3V13A 4BAMB 1WYKA 1O30A 1ZGIA 2GP9B 1KLTA 2F3CE 4WWYA 3I29A 2QAAA 4NA8A 2H6MA 1JBUH 1C5UA 1GL1A 1BDAA 1V2LT 3A7TA 4ZKNU 3HGNA 1UK2A 1KLIH 1P2QA 1OYQA 1ZTKA 2A1DB 2FTLE 2FS9A 1GG6B 4R8TB 2UWOA 1LVOA 3PLPA 1SGEE 2ZWLH 3SU1A 1BRAA 4DJZB 3A8BA 2BD9A 2O8UA 3FP8E 2GT8A 3ZZ8A 4SGBE 1H9IE 1DFPA 3RXIA 1G32B 3T2NA 3GYMA 5HXFA 2QXGA 4TYDA 4X8TH 1CA8B 1P2KA 2FM2A 1FXYA 2LNCA 1NFUA 2DUCA 4FUFA 2VINA 3MOCA 2I6QA 4ISOA 1ARBA 3HK3B 1YPHE 1MAYA 1TGSZ 2AIPA 1AGJA 8KME2 1TQ7B 2AIQA 2F9PA 5EOKA 3ZVCA 1QY6A 4OS2A 3V7TA 1JMOH 1IQKA 2PSXA 6CHAB 1UK4A 2I6SA 1TPPA 3Q77A 4FUGA 4NGAH 1A3BH 1V2WT 3PM3A 1GBMA 3OTJE 1KYNA 1AFEH 1GPZA 2GCHG 2BDYA 4UDWH 1OWJA 2VWMA 3ZZDA 2F91A 2FEQH 4YT6H 1EJMA 1PPFE 3RXJA 5GIBA 2ZFPH 2NU3E 2BDIA 5IDKA 3ZVFA 2ZHEH 4ABJA 3RXTA 1WV7H 6GCHG 2R3YA 1WAYB 1UVPA 1O2IA 3RXGA 1EP5A 3HATH 1GBKA 1LQDB 4WMFA 5EXNA 1HJ9A 3P6ZB 1YLCA 3QN7A 1UK3A 4A7IB 1THPB 3GOVB 2WYGA 2W7UA 1WU1A 1GI6A 2ZCLP 2A2QH 1DM4B 4JMYA 1D9IA 2EEKA 1PPBH 2H5CA 3LC3A 1O3MA 1G3BA 1PFXC 3TIUA 1OWDA 1HV7A 1EAWA 3SU4A 4X6NA 1GJCB 1P8VC 1SGIB 1Y3WA 4WH8A 1YYY1 2ZC9H 4DIIH 1GCTC 3ENSB 1HUTH 2P16A 2A5KA 2GTBA 4HI3A 1TGBA 1JIMA 5FCKA 2G81E 2BOKA 3AAUA 2ANMH 2VIOA 1W14U 3KQBA 1NFWA 1DXWA 5E8EH 1SGNE 1O2GH 1S6FA 3A80A 1ELDE 2GV6A 3A85A 4Z0KA 4M7GA 4X8SH 5EPNA 1A0HB 1QJ7B 4GAWA 1YLDA 2XWBI 5DK1A 2Z9KA 2G5VA 1C2JA 1HJAB 2JETC 4D8NA 2CMYA 2FI4E 1V2QT 1JWTA 4H42U 1O2VA 4YT7H 2QIQA 4X2WA 4KELA 4BNRA 1OSSA 1Y3XA 1QBNA 3DT0H 2ZIQH 3D65E 1NFYA 1Y3VA 3QTOH 2GT7A 2UUFB 1J16A 2NU1E 2ZDLA 1O2YA 1AB9C 1DWEH 3QZQA 4XBDA 4CHAC 2B7DH 1TA2A 4KKDA 1EXFA 5AFYH 4MQAA 3MI4A 4FUIA 1NRNH 5FPTA 2ZGBH 4K5ZA 2PW8H 3PLKA 1K2I1 1D3PB 5A8ZA 3SI4H 4TY6A 1PQ8A 1TPAE 4Y0ZE 1Z1JA 6LPRA 1PQ5A 1PPZA 5GDSH 1F7ZA 4IW4E 1FONA 2WV4A 1MD7A 2BOHB 2OLGA 1P2JA 5T6FA 3ZZCA 1QR3E 7KMEH 1QNJA 3UWJH 1K1OA 2GX4A 5ESTE 1FDPA 1S6HA 4YOGA 1G3CA 3ATLA 4BAOB 1BBRE 2GCHF 2V3OH 5EG4A 1HCGA 1ANCA 4XFQA 1BZXE 2FMJA 1ZJKA 3FVFB 1GMCG 3F68H 1BHXB 2W3IA 1CA0C 6GCHF 1FPCH 2GZ9A 4GUXA 1GGDC 1GI4A 3BTME 1GDUA 4K1TA 2EI6A 3A7XA 1KXDA 1HAHH 2HNTC 1W11U 1AHTH 1B5GH 4DIHH 4ZAEA 1DITH 1TYNA 5TCAA 2GZ7A 1XKAC 1KXAA 1BBRH 5L30H 2Y82A 1UTNA 2VVVA 3Q3YA 1YPKH 4YLQH 4U32A 2RG3A 3UWIA 2D1JA 3LKWA 3U9AH 1MZDA 3VB3A 4MNWA 2R9PA 3A87A 4Q7ZA 4D7FA 1YBWA 2OCVB 2FO9A 5T3HA 3RXVA 1KLJH 1CVWH 2PFEA 3ZVAA 3K2UA 4TPYA 3RU4T 3SQHE 3P8NA 1DWDH 1PJPA 2GKVE 1CT4E 2ZECA 4Y0YE 1HAYB 1UTPA 1O2QA 2C8ZB 2A32A 4AG1A 3BEIB 2G8TA 1W12U 2ZGCA 2HNTF 2ZI2H 1U6QA 3QZRA 5EW1H 4U01A 3SUEA 1O3AA 2OINA 1K1NA 2BQWB 1GJ9B 3RLYH 4UFEH 2PGQB 3ODDA 5DPAA 3SJ9A 1V2VT 1HAIH 1LCYA 5EXLA 2P3FH 4ZUHA 3U69H 2OQ5A 3VFEA 1INCA 3L6PA 3ZZBA 2ZDNA 4QT8C 3HK6B 3KCGH 2P8OC 3TNSA 2KAIB 1J15A 1BA8B 4GHTA 5A09A 2D26C 1EZXC 1C5LH 1O3LA 2A4GA 2ZU4A 1O2NA 3SQEE 4X1SU 2VIDA 1O5CB 1QQUA 3WY8A 2H9TH 1CBWC 1X7AC 1HJ8A 1NTPA 1IAUA 1NZQH 3MTYA 5A2MH 3SV2H 5T6GA 1IQMA 3E6PH 3KNXA 1AUTC 3ZYDA 2ASUB 1LHDH 1GI0A 1RFNA 1T4VH 3UPEA 3U8OH 4X2VA 1O3HA 1C1UH 2OC1A 3O8DA 3VXFH 5LH8A 5ESBA 5L2ZH 1SQTA 2JETB 1CT0E 2PKSC 3KQCA 3QO6A 1TX6A 3E91A 1HDTH 4AG2A 5E2OA 3RP2A 4B74A 3UIRA 4DGJA 1P10A 2Q1JA 1C2KA 1SHYA 1CO7E 8GCHF 1O36A 1SGFG 1KXFA 1AB9B 3RXOA 4CBOA 1FPHH 1SLWB 3S69A 3Q3KA 3ESTA 1EASA 3TNTA 1C4Y2 1EPTB 2PUQH 3M7TA 1ORFA 4CBNA 3SU6A 3I77A 4Y7BA 4MVNA 3RC5A 1GMCF 1TRMA 2BD3A 3MH7A 4ASHA 2V3HH 2PKAA 2BD5A 2OUAA 3GDVA 2FWWA 3PV4A 4DURA 1QL7A 1TMUH 2JH0D 3TK9A 3KEEA 5C5NA 1V2NT 2BD8A 4JZIA 3S9BA 4ZH8A 1CQQA 2FODA 1EX3A 2XWAA 1XXFA 4WY3A 1EJAA 5C20A 5F8ZA 1GHXH 1TGTA 5EQSA 1A0LA 3SV8A 2XYAA 2OC8A 2ZFRH 5I46H 1HXEH 2XBYA 1ELTA 1O2XA 1O2ZA 2XC0A 1DX5M 1GDQA 1BTUA 2SNVA 3BTTE 4E7RG 1T8LA 2HRVA 1EATA 1HAZB 2W7SA 1D3QB 4UFDH 1JRSA 1DSUA 1DT2A 3ATIA 3A8DA 1GGDB 3P8GA 1Z6JH 1P04A 2G4TA 4I8KA 4NA9H 1MUEB 1K28D 1O5AB 1GHAG 1RD3B 1MTNB 1BITA 2STAE 1UCYK 2XRCA 1O3PB 2BMGB 3AAVA 3SV7A 4XDEA 2ODQA 4AX9H 3A8CA 1P05A 4X6MA 1PYTC 2BLOA 3RXPA 3ATKA 1TLDA 3E1XB 1TNGA 2W26A 1TGCA 2Q6FA 3LPRA 2PGBB 1YM0A 2QV1A 1BMAA 2FI3E 3QGJA 5JBBS 1OPHB 3M3TA 1MBQA 1QFKH 4JK5A 4PROA 5JYIA 5LPRA 3ODFA 2XTTB 2FI5E 4K1EA 2KAIA 4Q7XA 4TWWA 2ZQ2A 3DD2H 1RTFB 2VNTA 1P01A 4ZMAH 1YKTA 1UO6A 3H7OA 3RDZA 1BTZA 1ELFA 1O32A 1P2MA 1XUHA 4AFQA 1LQEA 1ZRKA 1C2HA 1MH0A 1Z1IA 1NRPH 1AUJA 4KTCA 5EQQA 1V2MT 3MNSA 1UTKA 1IQJA 2FZZA 3MO6A 1AY6H 1SB1H 5FBEA 3U1IB 5CHAC 1D6WA 8LPRA 1O5EH 4IN2A 3UQOA 5ETXA 1FUJA 2FOBA 2AEIH 1T8OA 3LIWA 1HFDA 2ZU5A 4K8BA 3RU4E 1O3KA 3GCOA 1CBWB 1XUGA 3SNEA 2VVUA 2G55A 1CT2E 1HIAB 3C1KA 1AE8H 4DW2U 1L2EA 1WTGH 2VIVA 4ZKSU 2XW9A 4D7GA 1C5RA 1S0QA 1NM6A 1O3NA 4ABHA 1G30B 1QTFA 2PKSB 1H9HE 3UNQA 1KY9A 1WQVH 2J94A 2J9NA 3M5MA 5PTPA 1XUFA 1ZTLA 2Q6DA 3V3MA 3BEUA 1E0FD 1EZQA 1CHGA 3TH2H 1EB2A 1XUKA 2FOFA 4Z6AH 3CENA 1O3GA 6ESTA 5AHGH 1NESE 2AMQA 4AOQA 3OSYA 4OS4A 1C5VA 2GD4B 1LPGB 2J2UA 4Y8XA 1PQ7A 1O5FH 1LMWB 3BTHE 1QRWA 1EOLA 3IWMA 1AWFH 1C5WB 1GBFA 1H9LB 1ZMJA 5EXMA 1WOFA 1DUAA 1ID5H 1W7XH 1NU7B 2A5AA 2WV5A 4KTSA 1Y3UA 1O2JA 1EB1H 3NK8A 4X2XA 3TK5A 9ESTA 1FZZA 4OGXA 2PHBA 1GVZA 4X1PU 1Y8TA 2QXHA 1GHAF 1P9SA 1AVXA 2Z9GA 2VGCC 5CE1A 2IPHA 1Q2WA 1ELGA 1BMMH 3EE0B 2GMTC 1RJXB 2P94A 2F9UA 2CHAC 1L4DA 2HALA 1S82A 1Z8IB 5ABWA 1DWBH 1A5GH 1QJ6B 3UUZA 2FOCA 3ZVGA 1C2MA 1O2PA 3MNBA 3M37A 1SLXB 5FCRA 3RXBA 1GJ5H 2AMPA 3STIA 1V2JT 3QX5H 3MO9A 2CN0H 3ZZ9A 1MBMA 1C5ZB 1S0RA 4MNXA 2O8WA 4O97A 2Y6TA 2A31A 4NIVA 1TABE 4B2AA 3T62A 3H7TA 2HOBA 4HFPB 2FDAA 4XSKU 5H4IB