1F0TA

Bovine trypsin complexed with rpr131247
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Crystal structures of human factor Xa complexed with potent inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f0tA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f0tA02
1OXGA 4X1PU 2G00A 2NU2E 4E7RG 2LPRA 1C4V2 3SU2A 1P2MA 1ZMLA 3RXHA 4YESB 3ZVBA 1IHTH 2P3UB 1RTKA 4B2AA 2D1JA 4FXGH 3I29A 5EODA 1G32B 2FS9A 3AW1A 2D8WA 3FP6E 1SGEE 4K3JA 2RDLA 1IQNA 2VIOA 5FPSA 3MH7A 1Y5UT 2AEIH 1AB9B 1QURH 1WV7H 3RU4T 3RXBA 1HAVA 2JH6D 2YNBA 3MYWA 4X1RU 1SGFG 4NWKA 2FOFA 4B75A 4ZKSU 2O8TA 2BLWA 3B9FH 1W3CA 1MU8B 1P9SA 2ZI2H 1JIMA 2B5TB 2ZFTA 4X6NA 2ZTZA 1QFKH 2AYWA 1C1MA 1KXDA 1D3TB 4Y6DA 1C5ZB 5EXMA 3GOVB 1D6RA 2Y81A 1O32A 4KELA 4B76A 3SBKA 4DVAU 3NPSA 1CGHA 3M35A 3SGQE 3A84A 2H2ZA 2G5NA 3SV8A 4YO9A 3UNRA 1C1VH 4M7GA 1SGDE 1C5RA 1FNIA 1DS2E 2HALA 1UTMA 5DP3A 1P2KA 5E8EH 4FU9A 1CT0E 1LQEA 1GI9B 4DURA 4H42U 1KLJH 2QIQA 1A1RA 1NTPA 3A8BA 4OS6A 1WQSA 3MNCA 4AFQA 2WPJS 1V2KT 2RCEA 1DY8A 2G52A 3A8DA 1NO9H 1IQJA 1MZAA 1LPGB 3ZYDA 1GCDA 1LMWB 4YZUA 4D9RA 2SGFE 4BXWA 4X2WA 3A86A 1UMAH 3VB5A 1SGQE 1DWCH 1ELDE 1TABE 4HFPB 4IBLH 2BB4A 1SOZA 5HM2A 5DO4H 3ZZ9A 2CHAB 1BMAA 1O3FA 3GCHC 4ISLA 1EXFA 4Y8ZA 1FQ3A 2VVVA 4QT8C 1W11U 1D9IA 1WAYB 3DUXH 2R0LA 2V3HH 3KNXA 4CRBA 3RXVA 2H9EH 1S81A 5FXLA 1O2ZA 1IQHA 1O2PA 3S7HB 1AWHB 1EP5A 2F3CE 1BMNH 4F4OC 5DK1A 3FP7E 2G4TA 1C2MA 4WH8A 3U1JB 1S83A 2FIRH 1P9UA 1O2WA 5GJ4B 2ZTYA 1ELBA 1O36A 1MCTA 1B7XB 1V2PT 3U69H 4U32A 1HCGA 1OWJA 4HGCA 1ZHMA 3M7TA 3P92A 2ANWA 1GVZA 2JH5D 4NA7A 4O03A 1OS8A 4Q80A 1DUEA 1P11E 2ZDMA 1BMMH 1GHAG 1BRBE 1ZRKA 2BOKA 4D7FA 1C1TA 1OWEA 1QL7A 5HM9A 1DANH 8LPRA 1YLDA 2DUCA 2FS8A 4BAMB 4DCDA 4MPWA 1BIOA 3BTHE 1LDTT 2O8LA 3SI4H 1NESE 1KXEA 1UVTH 3TK6A 1S0RA 9LPRA 4UFDH 2Y5GA 4GAWA 2FDAA 1O3NA 4X8SH 1C2LA 1YGCH 3MU4A 1J17T 4FUHA 5GXPA 2ZWLH 4ABJA 1UTOA 1IAUA 2H1UA 4AB9A 4DJZB 2FM2A 1J15A 4WY3A 3KQCA 3BTDE 2ZG0H 1SQAA 1SI5H 3RXKA 4NGAH 5A0AE 1NROH 2H9TH 1SLXB 1QA7A 4FUEA 3P8NA 1BHXF 2NU1E 3FVFB 1GJ8B 1RRKA 1PQ7A 1BTPA 1D6WA 4Y7BA 3SJ8A 5C1YA 1IHSH 2PKAB 2Y6TA 2ZHFH 1C5UA 3TH2H 1YPHC 2ZC9H 4ZHMU 1BDAA 1EZQA 1V2OT 4RSPA 3PLPA 4UFEH 1P3CA 2CV3A 1XM1A 2PV9B 3ZVDA 3E0NB 5FCRA 2EI8A 1H8DH 2FZZA 1TMTH 1GJ4H 1HAHH 1O5AB 2FMJA 2ILNA 3RXSA 4U01A 1FY8E 1O3DA 2FYRA 4CH8B 1W14U 2WINI 2HPPH 2QGRA 1CHOG 3A7XA 4FUJA 2SGPE 4X6PA 2OQUA 1XUFA 3GYMA 3PB1E 1ELAA 3GISB 3HKIB 3RXOA 2QV1A 2FOCA 3DT0H 2OP9A 3FAOA 4FUFA 4YOGA 4AGJA 3QK1A 4MDSA 1GMDG 1SGIB 1UTNA 1KXAA 2FTMA 3LH3A 3LGVA 1MD8A 1AKSA 2AGGX 2BLVA 3LGTA 1HJAC 1UVUH 1WU1A 2FESH 4LXBH 2OBQA 4MPXA 3JZ2B 4X2VA 1O3BA 2A4GA 2BD7A 2EI6A 1GBKA 3SGAE 2K1QA 5A09A 2A4RA 2ZDAH 1ID5H 4B74A 1RS0A 3A7YA 3SU4A 5A8ZA 2ESTE 3QUMP 2V35A 1GPZA 3PTBA 3V0XA 1CGJE 3CS0A 1YCPH 3BV9B 4JK5A 4O97A 4H6SB 1FMGA 1FN8A 2BYAX 1GJ5H 3EA9A 4JYVH 4NA8A 1ESTA 2FWWA 3HGPA 3P8GA 3UOUA 2BDAA 1JOUB 2R3UA 5LPEA 3RC4A 1BTZA 2A7CA 2C8ZB 1GBDA 9ESTA 1MZDA 2HVXA 1TNKA 3KF2A 1OP0A 1GMCF 4ISOA 2G5VA 1HAYB 1NRQH 1VGCB 1SBWA 3BTKE 2BTCE 1G3BA 2WPLS 4ZKRU 1SSXA 3Q3KA 1L4DA 2NU3E 1HPGA 2HWLB 1MU6B 1O2GH 1AI8H 1O3EA 2PGQB 1GL1A 4JYTA 1SLUB 2EA3A 2WPIS 3MNBA 2PSXA 7ESTE 4DOQA 1ANDA 2F9OA 1GBAA 1O3HA 1D3QB 1YPEH 3KHVA 3TH3H 4BXSA 1GMHF 1S5SA 2SNVA 1DWBH 3ATIA 3T27A 2TGDA 1HV7A 2VU8E 1TOCB 3UOPA 5F03A 2A5IA 1H4WA 3BTME 1C2KA 1HUTH 1FY1A 2A2QH 4YTAA 2ODQA 3PTNA 2IJOB 4YT7H 1ABIH 2O9QA 8ESTE 4K8YA 1ZPBA 1A3BH 5DP4A 4I8GA 5HGGA 2H9HA 2BDHA 3MTYA 5EQQA 3RM2H 3T62A 1Q2WA 1K1JA 4CR5A 1QA0A 2OTVA 1Q3XA 4CRFA 3BTTE 1UK2A 1AFEH 1WUNH 1GI7B 1C2GA 1TNJA 2AFQB 1LHCH 1W13U 4ISIH 5EXLA 1QL9A 1O2HA 1GHBF 2R3YA 1NU9A 1BRCE 4NSVA 1GDQA 1GGDC 2Z9LA 1EB2A 1Z8GA 4UDWH 3A80A 1ORFA 2JETC 4CHAB 3LGUA 1P2QA 2Q6GA 2XNIA 1PQ8A 1F5RA 4MQAA 1O30A 1AFQC 3LJJA 4X2YA 5TJXA 1O2IA 3A83A 6LPRA 1X7AC 2C3SA 5FPTA 3SQHE 1AD8H 3SW2B 1KSNA 3B23B 1E38B 1O3PB 1ETSH 3SU3A 3RMNH 2XC0A 5JBCS 1GJAB 3KQDA 1CBWC 1FJSA 3QLPH 1Y59T 2PW8H 4YLQH 4THNH 1JXPA 1LVOA 1PPFE 1ZTKA 3SNCA 2ZF0H 2SGDE 2RA3A 2RA0A 2TRMA 2ZHQH 2XBVA 1NRNH 1EOJA 5FBIA 1MKWH 4ZROA 2G81E 1SHYA 1F5LA 3A8AA 4Q7XA 3V13A 1SLWB 3H7OA 3PMJA 1D4PB 4MNWA 1L2EA 3A7VA 3O8BA 3U9AH 2XRCA 1PJPA 1NRPH 1O39A 1WOFA 1IQFA 1G3DA 4Y71A 4AFZA 4AZ2B 3URCA 2PSYA 1L4ZA 2BD2A 1GHWH 3SQEE 4MPVA 3C27B 1FIWA 2J95A 4YT6H 1AUTC 1S0QA 2V6NA 3OY5U 1SOTA 3ZZ3A 1GHXH 1BUIA 3I77A 1DDJA 3TPIZ 2H5DA 2WYJA 5EQSA 4WMFA 2PWXA 1XUHA 5TCCA 1OX1A 3T26A 1NM6A 2Z9IA 1EQ9A 1J9CH 1DXWA 1VGCC 5JBBS 1MBMA 1GCTC 7GCHF 1C5QA 2TIOA 5H4IB 2HNTC 1FPHH 1MTWA 1UCYH 5AF9H 5AFYH 2SGQE 1TMUH 1ANEA 3LOXA 5I25A 1F0UA 3E91A 5C5OA 1QB6A 1VJ9U 3RXMA 1KDQA 3DA9B 4XOJA 1GI6A 2BZAA 1SPJA 2ZEBA 3PO1C 4NG9H 6ESTA 3FFGA 2ZDVH 3UWJH 1ZMNA 2VH0A 5EPNA 4IS5A 1VZQH 4AN7A 1NPMA 1HYLA 4TYDA 2VINA 1Y5AT 2SFAA 3E16B 4OS7A 3HKJB 1XUIA 1Y8TA 3I78A 1ETTH 3ATLA 3K6ZA 2ALVA 2BDCA 1MTNB 1ZR0A 6GCHF 5L6NH 3MMGA 5EU8A 2IPHA 1YLCA 2UWPA 1UTPA 2AIQA 1DXPA 3GDUA 1J16A 3RU4D 2UUKB 1G3CA 5DP6A 1RXPA 2ZU4A 3ZZBA 1C5NH 1GI1A 1UVSH 4AG1A 4B1TA 3UUZA 2I6QA 3U8TH 2BQ6B 1FXYA 1V2JT 4I8KA 1TPOA 4JCNA 1ACBE 3UQVA 2YOLA 1P57B 2TGTA 2XC5A 3M5NA 1SGNE 1TOMH 3NUMA 3KIDU 1LVMA 4JZ1A 3D49H 1TPAE 1T4UH 5EPYA 2ZQ1A 4ZH8A 3H5CB 2GP9B 3BF6H 1RIWC 1Y3XA 2CF9H 2Y7XA 4JZIA 4AYVB 1W0ZU 4GSOA 3NKKA 2GX4A 3ATMA 2PKAA 1T31A 4YM9A 4I33A 5C67A 2PTCE 4ABGA 5C5NA 2ZCHP 2VGCB 2ZGXH 1BTHH 2GZ9A 3AASA 1ELEE 1YKTA 5A2MH 2Y5FA 3AW0A 3GY5A 2XYAA 1F0RA 2OBOA 1IOEA 3S9AA 1ARBA 4NIVA 1THRH 2FO9A 5EQRA 2ZU2A 3UY9A 1EATA 5GCHG 2G51A 1BTWA 1AUJA 1JRSA 2D26C 1O2YA 1E36B 2PFEA 1UTQA 3D23A 1Z6JH 1HXFH 1VCWA 3SUEA 1BQYA 4OGYA 1O3GA 3T5FH 3LJOA 1UTJA 1GJBB 1C4Y2 2FYQA 1C9PA 5T6GA 3RUOA 1VCQA 2ANKH 1O2NA 2F9NA 2OC8A 4E7NA 3RXGA 1BBRH 4HI3A 2GZ8A 4CRAA 4NA9H 3S0NA 1O33A 1BB0B 1ZHRA 5F8TA 1HAIH 1GMCG 5FHTA 2P59A 4JZFH 1EX3A 4I31A 5SGAE 3RXTA 2VWOA 1O35A 3P8FA 1E0FD 2TBSA 4UD9H 3GCTF 2FLRH 1GG6C 3QN7A 2C4FH 1TQ0B 3LT3A 3TJOA 3EGKH 3IWMA 1RGQA 3AAVA 1E34B 1JIRA 1B0EA 2ZHWH 1GI3A 2G55A 2PR3A 3D62A 4MNXA 5J4QA 1GI5A 2C8WB 2XWAA 2ZIQH 3GY2A 1XX9A 1ZZZA 2PKSC 1DSUA 1S82A 4JK6A 1YC0A 5C20A 3M7QA 5ESTE 3ZZ8A 3K9XB 2A0QB 2FOHA 1O37A 3ZVFA 2WYGA 4MPUA 1YPHE 4ISNA 1C1QA 2P3TB 2WV5A 4KTSA 1K1LA 1O2OA 4A1TA 1DY9A 4AORA 4LZ1H 2ZTXA 1GJ6A 2BD9A 2J38A 2V3OH 1D3PB 2BXUH 3URDA 3QTVH 2VJ1A 2V0BA 3BIUH 1BCUH 3ZVAA 1MKXK 5K7RA 3NWUA 1P2NA 2ZKSA 4SGBE 4FVBA 2XBXA 5K0HA 3SU6A 3SHAH 5IDKA 1N8OC 2O8MA 4H4FA 4VGCB 1MTNC 1PPCE 1TNGA 1VR1H 1GHBG 1T8MA 2O8UA 1BT7A 5DKMA 1OP2A 1NRRH 5JBAS 1TONA 5CMXH 1OOKB 2VIVA 4E05H 3BEUA 2QF3A 3LC5A 1ETRH 5C1XA 2DE9A 1KDQB 2ASUB 3QO6A 1OYTH 2F91A 2SNWA 3ESTA 3DD2H 1G9IE 5HMAA 1A4WH 2BOHB 2D2DA 1CSOE 4DIIH 2C90B 1MUEB 1CA8B 3D65E 2BVRH 1SGYE 3M61U 1O2JA 3MU1A 2B0FA 5HYOA 1EASA 2P93A 1N6YA 5FX5A 1G2LA 4O9VA 3RXLA 4AOQA 4Y76A 1NS3A 2VIDA 1T7CA 2BM2A 2HNTF 3SV6A 3BG4B 3A7TA 4TY7A 2AH4X 2PUXB 1OPHB 1WBGB 3SI3H 1NZQH 1ABJH 3E8LA 4A6LA 4IGDA 1TMBH 2GCHF 4IC6A 3EAJA 4FVDA 4I8HA 3VB3A 3EA7A 3LGYA 1CVWH 3BTGE 1BTXA 2GV7A 3MO6A 3A85A 3SU0A 1ZTLA 1G3EA 2GDDA 4BTIB 4D9QA 3OX7U 1HJ9A 1AB9C 4WXIA 1CO7E 1AWFH 1G30B 1PYTD 1HNEE 3M3VA 3RXEA 2VWLA 1KTTB 2ZP0H 8GCHF 2EC9H 2FTLE 1KIGH 5PTPA 3NCLA 4A1VA 4TWWA 2A5AA 1BJUA 2FP7B 3GY4A 4CRDA 2BHGA 5DG6A 2A1DB 5EXNA 4IN2A 1J14A 1A0LA 1P04A 3BN9A 4KTCA 1FN6A 3C1KA 3E1XB 4ISHH 4O3TA 3PLKA 2F9UA 7GCHG 1AVGH 1G2MA 2ODPA 1YPLH 2PTNA 2Z7FE 4GCHF 4BANB 3MU8A 1F0TA 3NXPA 1F7ZA 1TRNA 4I7YH 4GHQA 1GBLA 2BVSH 3K2UA 3SJOA 2P8OB 2BLQA 3SNEA 1NT1A 1AQ7A 2GGVB 3ZV9A 4IW4E 3HK6B 1XXFA 3FANA 5L2ZH 1VITG 2WPKS 5F6MA 1G36A 2STBE 3QZQA 1ELGA 1TNHA 2VIQA 1DX5M 2J94A 2P16A 4KP0A 2XC4A 2GTBA 1KLIH 1MTUA 3RXRA 3TLOA 1ZLRA 3HGNA 3IG6B 1Z1JA 1TX8A 3VXFH 3LH1A 1T8NA 3T28A 1T32A 2Z9JA 1O3LA 3P17H 1OYQA 1QL8A 2OINA 3P8OA 1C2FA 1HBTH 3P70B 1BZXE 2CHAC 4GVUA 1ANCA 1BTYA 1FAKH 4A1XA 3TH4H 5CHAB 6GCHG 1A7SA 1YPMH 4NIYA 5EGMA 1ARCA 3M36A 2B7DH 3B8JA 3P95A 1GDUA 3G01A 2FOBA 1AGJA 3QGNB 2CF8H 4Y79A 1WTHD 3UWIA 1SLVB 4K69A 1LKAA 2VH6A 1WYKA 1E37B 2BX4A 5DGJA 1O3OA 1LHFH 1O2MA 4K60A 1O2KA 2TPIZ 5GDSH 3RXFA 1PPHE 3DFLA 3RXQA 1CA0B 2ZFPH 1P0SH 3QTOH 2F9PA 1O34A 2BD5A 5LPRA 1O3AA 5AHGH 1ZGVA 4X8UH 4A5TS 4XE4A 1KTSB 2Z9GA 2BZ6H 1XXDA 5T6FA 1DLEA 2GT7A 3R0FA 1MD7A 1Z1IA 3OSYA 3SUFA 3LKWA 5TCAA 1QTFA 2QY0B 2W26A 1QGFA 3CENA 3STIA 4JZDH 2CXVA 1W7GH 1FY3A 1PYTC 4NFEA 4YOIA 4OS1A 8KME2 7LPRA 5LGOA 3ENSB 1L0ZA 2OC7A 4Y11E 3O8RA 4X6MA 5JDUB 1GBEA 4K1TA 3LONA 3V3MA 1TA2A 1FPCH 4AFSA 2ZDKA 3M5MA 5GWZA 4K5ZA 4NFFA 2XCNA 4MNVA 5E2OA 1AU8A 4ZXYH 3RXDA 1GJDB 1LCYA 5EG4A 2A4OA 1A2CH 1FI8A 4F49A 3ODFA 1O0DH 4TPYA 2HNTE 4DIHH 1GJ9B 3FP8E 1YP9A 1KYNA 1Z71A 3TU7H 2Y80A 2HGTH 6CHAB 1AVWA 1LVBA 1P06A 3KL6A 1O2QA 2WUBA 3Q77A 3O8CA 4X8VH 3HPTB 3UNSA 3VGCB 1C1UH 1TYNA 2CMYA 1TX6A 4ASHA 1ESAA 3F1SB 3T29A 3W94A 3A8CA 1LPZB 3E6PH 1S84A 2GCTB 2ZCLP 3T2NA 3TJNA 2BY7X 2GMTB 5ESBA 1BHXB 1MMJN 1S6HA 2VIPA 1G37A 3SO3A 2A2XH 4BTTB 2GT8A 2ZPRA 5G4BA 5FCKA 1DOJA 3KQEA 2XWBI 1A46H 1SB1H 2EEKA 5DP9A 2GKVE 1C5YB 1TLDA 2VIWA 2ZPQA 2ZFRH 3UREA 1C5PA 1YF4A 1F5KU 3F9FA 1EKBB 1MTVA 1H9HE 3A7WA 3MNSA 1C9TA 4WF8A 3RMMH 2FEQH 4FUCA 3DHKH 3EE0B 2ZGHA 2TGPZ 1ELTA 1HB0B 4AGKA 1TRYA 1O5FH 4O3UA 3TGIE 3ATKA 1GJCB 3UTUH 1Z7KA 1RJXB 1Q31A 2HLCA 4HZHA 3NK8A 1E35B 1TFXA 5CHAC 2WPMS 3VB7A 3LU9B 4INKA 2FOAA 1AZ8A 1TGNA 1SGCA 1ZJKA 2A45B 4RKJB 3BTEE 3FZDA 1DWEH 4X1NU 4ESTE 1YM0A 1CT2E 2FOGA 2ZCKP 2QXJA 2Z3EA 1OKXA 1AVXA 1ZOMA 3M3TA 3VFEA 1TGBA 1EUFA 2BMGB 5JPMH 4X0WU 1K1IA 2A31A 1CGIE 1D3DB 4MVNA 3PROA 1A61H 1DITH 3ZV8A 1SHHB 3KEEA 1GHVH 3Q00A 1CA0C 2ZPSA 1QBNA 2OXSA 4Z6AH 3RLYH 1EJMA 3AVZA 3CP7A 3ZZ4A 2AGEX 3U1IB 1FUJA 4CH2B 2PLXA 1UK4A 1XMNB 3ZZCA 3SNDA 3S69A 1V2WT 2GDEH 2FX6A 4CRCA 4X6OA 3MOCA 4NIXA 1GBTA 1JRTA 1T8LA 1P09A 3Q3XA 1LO6A 5FAHA 5CE1A 3RDZA 4XFQA 4IMQA 2BQ7B 1DVAH 3V7TA 2FLBH 1C1SA 4ABFA 2WV4A 1W12U 3A88A 1T8OA 1GVKB 3PV4A 3A82A 1MAXA 3KGPA 2QF0A 3TNSA 2ZU3A 1L1GA 1QRWA 1W2KH 1SGRE 3QDZB 1O2TA 2F9VA 3GY8A 1MAYA 2AIPA 1XVOA 1IQMA 1FIZA 5GIBA 4K8BA 1SG8B 5J4SA 1GL0E 1FV9A 3SNBA 4TWYA 1O5BB 2OQ5A 1NY22 6CHAC 3QWCH 1P01A 2W3KA 4KTUA 1IQKA 3TIUA 3RMLH 1MBQA 1QR3E 1TB6H 2J4IA 1AMHA 1DT2A 1T4VH 1H1BA 1ZMJA 4X2XA 1Y5BT 3L6PA 2IOTA 1M9UA 1GVLA 1TBQH 4GCHG 3RM0H 3GCOA 2XTTB 3TGJE 1THSH 2ZU1A 5C3NA 1K22H 4Q2KA 2GCTC 4WWYA 5FX6A 2HOBA 2AGIX 4CHAC 5FPYA 3F9GA 2BXTH 5L2YH 3A87A 2FI3E 5DPAA 4INLA 4I8JA 4BAHB 4YLUA 3GY6A 4GUXA 2UUFB 1TGCA 1W0YH 2NWNA 3QZRA 2Z94A 4FUIA 1AN1E 1LTOA 2ZECA 2ZZUH 2EI7A 2Z3CA 2R0KA 1QQ4A 1ZPZA 3F68H 1MTSA 3ITIA 1OWIA 2WPHS 1QRZA 1THPB 3F9HA 4D8NA 1HFDA 3ZZDA 4ABHA 1YPJH 3RLWH 2ZDNA 1NFWA 2H6MA 3RXPA 1DICA 1P2JA 1C5VA 5EOKA 4ZHLU 1EB1H 3ZVCA 1O5CB 4J1YA 4UE7H 3H7TA 5DP8A 1UVPA 1TGSZ 4WXVA 3GDSA 1HAXB 5ABWA 1XVMA 3PMHB 2QN5T 3UPEA 1BRAA 1IQEA 1C2IA 3MO9A 1FZZA 2R2WU 2AERH 5AFZH 2Q1JA 5ETXA 2BX3A 2BY9X 2Z3DA 3SUDA 1LQDB 3N7OA 1GBMA 2B9LA 1GHYH 1CE5A 1V2MT 2FOEA 1O5DH 4UFGH 3UFAA 3SV7A 1BRUP 3SORA 1C5TA 1ZRBA 3RXJA 1JMOH 3SU5A 3EA8A 3RMOH 3SOSA 1O2XA 2ZFFH 1DWDH 2C8XB 2XCFA 3F6UH 3BTFE 4AYYB 3Q76A 1V2TT 3P6ZB 1UO6A 1P2IA 3UQOA 1GMHG 1Z6EA 4X1QU 2VWMA 3TK5A 1GBBA 1HDTH 2LNCA 2OC0A 1K28D 1EJAA 1O3KA 1ZHPA 2J2UA 4DGJA 3VB4A 3L33A 1SQOA 2PGBB 1TPSA 4XBDA 1NFUA 4A7IB 3ELAH 1C1OA 2XBYA 1MCVA 3AAUA 1EAWA 5A8YA 3ATWA 3PLBA 3SN8A 1SC8U 2QCYA 1LHDH 2ZHEH 2O8WA 2J92A 1P8VC 4XSKU 3BIVH 1EAUA 1IQLA 2J9NA 4OS2A 3RP2A 1EJNA 1UJ1A 2TGAA 2A7JA 1ZSJA 1QB1A 1INCA 1LVYA 2BQWB 1C5SA 1YBWA 4OGXA 4K2YA 4ZAEA 4FUDA 2B8OH 2ZNKH 1HJAB 2A5KA 3ZVEA 1K1NA 1RFNA 5FBEA 1FAXA 2JH0D 1YYY1 1YPGH 1TBZH 5LPFA 1C2EA 4B2BA 1V2NT 2STAE 3Q3YA 1GI8B 1V3XA 4FU8A 4MTBA 4U2WA 4ZUHA 2GVFA 2W5EA 2Y5HA 1C2HA 2PHBA 2Y7ZA 4BTUB 3VPKA 2W7SA 1MKXH 1TQ7B 3TK9A 1SFQB 4ZMAH 1O2LA 2ZO3H 1EZSC 1C1PA 1V2LT 2ZFSA 4BAKB 4X8TH 3A81A 3OY6U 5T3HA 3CS7A 3BEIB 1DPOA 2YNAA 1GI0A 3NZIA 2BLOA 5BPEA 1Z8RA 2QAAA 1HIAA 1B5GH 3LC3A 4NIWA 3VXEH 2Z6BD 4B2CA 3WY8A 2VGCC 1HJ8A 1O3MA 4CREA 1AHTH 2Z9KA 5B6OA 1LHEH 3ZZAA 1H9LB 1CT4E 1RTFB 1C1RA 3M5LA 1BITA 2ZA5A 2CGAA 1AIXH 2ULLA 1QIXB 4Y10E 1VJAU 3LIWA 2ANMH 1GBFA 4NZQA 1NRSH 1A0HB 1QJ1B 1KXCA 1S85A 1DLKB 1EPTA 2A7HA 1O2RA 4UONA 4BAOB 5A8XA 1BTUA 3ZZ5A 1V2RT 3TVJB 3MHWU 2NU0E 1B0FA 4Y0YE 1LPKB 1TNIA 4MLFB 5DJ7A 5GPIB 1WTGH 4WMEA 2XXLA 2VVUA 4HTCH 4FUBA 5E0HA 1U6QA 3A89A 3LGIA 2WUCA 1K1OA 1QJ6B 3ODDA 1L1JA 3PMBB 2BY5X 5T6DA 1VITH 2BY6X 1HAZB 3SV9A 1XKBC 1LHGH 3STJA 1C4U2 2UUJB 1ELVA 2ZGJA 5F8XA 1HGTH 1P02A 1TX7A 5I46H 1UHBA 2I6SA 2KAIA 2RG3A 2VWNA 1ESBA 3SNAA 1TRMA 1GGDB 2BDYA 1S6FA 5A0CA 1NFXA 2JETB 4WJG2 1MH0A 1A5HA 3GCNA 1AFQB 2BD4A 1HXEH 3LPRA 3S9CA 3LDXH 4ABDA 4AB8A 1K21H 1FDPA 1JBUH 2PUQH 1TGTA 3W95A 1HAOH 1XUGA 3QGJA 2HPQH 2FPZA 1TBRH 3BTWE 3TJVA 1K9OE 5DP7A 5A0BA 4D76A 1YCPK 1NU7B 2ZQ2A 2P95A 1HAVB 2OUAA 1CBWB 1H8IH 1TA6A 4GHTA 4VGCC 2FX4A 3O8DA 3LGWA 3SGBE 1SR5C 3F9EA 1BA8B 1A5IA 4IC5A 2BDBA 3HK3B 1C2JA 4ABEA 2BY8X 1GI2A 3HATH 3S9BA 3OU0A 4K1SA 3PWCA 1SGFA 5L30H 1K1MA 5JYIA 3MH4A 1N6XA 2QA9E 2JKHA 4AG2A 4ZXXH 3EQ0H 4DW2U 3M7UA 4KKDA 4WVPE 1P05A 4MG3A 1WQVH 1CU1A 1Y3VA 1V2ST 4LZ4B 1PQAA 2DE8A 4UEHH 1TWXB 1GDNA 1AY6H 4INHA 2C93B 1K2I1 1QRXA 1F0SA 4K1EA 1QBOA 2AMQA 5JBTA 5GCHF 1CQQA 4TPIZ 1ZTJA 2ALPA 3MU5A 1P2OA 3MU0A 1PPBH 1O2VA 3SJ9A 3QX5H 1QHRB 4UFFH 3VB6A 4CRGA 4AX9H 1OWDA 2R9PA 3M37A 2ODYB 1QB9A 4H6TA 4SGAE 2ZU5A 1EOLA 2OC1A 2GZ7A 2VNTA 5HXFA 1OSSA 3BG4C 1P12E 1QCPA 1UTLM 1ZSKA 3GY3A 4NSYA 2ZDLA 4WH6A 3SJKA 2ZFQH 4GPGA 4Y7AA 1ZGIA 3RXAA 3ZZ6A 2W3IA 1K1PA 2CJIA 1O2SA 3MH5A 2J34A 1GCTB 2ANYA 1BMLA 2UWOA 1FY4A 2OLGA 1O5GH 4XDEA 5DP5A 1C5LH 1C5WB 1C1NA 1DSTA 1PFXC 3MNXA 1GWAA 4IMZA 4A92A 1GBCA 4ABAA 3R3GB 4I32A 4CBOA 4Y8XA 3TGKE 5C2ZA 1O3CA 3RXUA 1A3EH 1C5MD 1SQTA 3GDVA 4CBNA 2GD4B 3EDXB 4JZEH 1O5EH 1V2UT 3PO1B 1FY5A 3SZNA 3KCGH 3GYLB 1MQ6A 1O3JA 3BG8A 1IQGA 1BJVA 1YCPM 1P3EA 1QQUA 4J2YB 2SGEE 3GCTG 1EZXC 1GI4A 4ABBA 1ZYOA 2CN0H 1F92A 1SMFE 3MFJA 1HIAB 4LK4A 1KXBA 4JYUH 1HAPH 2M5TA 2BVXH 3UR6A 2XBWA 5BRRE 4R0IA 1NFYA 3SV2H 1Z8JB 2FXRA 3TITA 2IN2A 2P8OC 2Y82A 1W7XH 3KQBA 3ZVGA 1UCYE 2OD3B 2Q6FA 2GV6A 1DE7H 3SUGA 1CHGA 4Y8YA 3M5OA 3RC6A 1H9IE 1KY9A 1MKWK 1ZSLA 2BD8A 4RN6A 3PMAB 1MQ5A 4LOYH 1EPTB 5JB8S 2UUYA 3UIRA 4XBCA 1GHZA 3GICB 4DY7B 3UR9A 3GY7A 1P10A 1C5XB 4NWLA 1TAWA 1AE5A 1GBHA 1SL3A 2OCVB 2R2MB 1RIWB 3DFJA 4RKOB 1XUKA 4Z0KA 1LKBA 4MNYA 4ZKNU 1XKAC 1QJ7B 2FI4E 3K6YA 2W7UA 3SJIA 5LH8A 2XW9A 1SFIA 1V6DA 2AMDA 5C1UA 2ZGBH 1Y3WA 1C5OH 1GHAF 4GLYA 1J8AA 4Q7YA 2A32A 3U8OH 1A0JA 2QXIA 1UHBB 2KAIB 1EP6A 2G8TA 1JWTA 3VEQB 5JB9S 4PROA 3RXCA 4OS4A 2THFB 5EW1H 1KXFA 2H5CA 5E0JA 3U98H 1IQIA 4R8TB 1HAGE 4WMDA 1GBJA 1UCYK 1TE0A 4DT7B 1KLTA 1UK3A 1WCZA 3OYPA 4ABIA 1ELCA 3FZZA 2QC2A 2F83A 4TY6A 2AMPA 5IYTA 2ZHDA 1C2DA 1RTLA 4JMYA 1BOQA 1OWHA 4NZLA 1ANBA 3SHCH 1AE8H 3E90B 2GCHG 1Z8IB 1Y3UA 3JZ1B 1DFPA 1EZUC 1O31A 3ZZ7A 2QXGA 3MH6A 4D7GA 1TPPA 1PPZA 1GBIA 1ZJDA 4ZKOU 1O38A 1AKSB 3S7KB 3E0PB 1GG6B 1NN6A 2A4QA 3MI4A 2QYIA 1N1LA 1V2VT 2NU4E 1W8BH 2FI5E 3BSQA 3MO3A 2C8YB 1FLEE 3IITA 3A7ZA 1EAIA 1PPGE 3PYHA 1O2UA 3MWIU 1F2SE 3BTQE 8GCHG 2PKSB 1O3IA 1ELFA 3OTJE 1DM4B 7KMEH 1V2QT 1VCPA 1CHOF 1VITF 1RD3B 1SGTA 1AO5A 1UTKA 1OP8A 3TJUA 4B71A 1BBRE 2P94A 4FU7A 1WSSH 3VGCC 1HRTH 4Y0ZE 3U8RH 1PQ5A 2QXHA 4AFUA 3PM3A 3EYDA 2BDGA 1AZZA 1L1NA 1HLTH 1QY6A 2FOMB 2VB0A 1GMDF 4OS5A 2SGAA 3GCHB 4E06H 2P3FH 4BAQB 3RU4E 1YPKH 1W10U 3V12A 2GMTC 2AS9A 1NC6A 1TALA 4BNRA 2F9BH 1N8OB 1QNJA 5F8ZA 3SU1A 1SGPE 2G4UA 3M3SA 4FUGA 3K65B 3L3TA 2VVCA 3RXIA 1C1WH 2BDIA 4Q7ZA 4NCYA 3E3TA 1ZPCA 4B73A 4KGAA 1EAXA 5E2PA 5AVDA 4BOHA 1XUJA 4ZHAA 2BD3A 2Q6DA 3KN2A 4XBBA 2ZGCA 3T25A 1UVOA 3TNTA 3RC5A 1EPTC 3BEFB 1Y3YA 4DG4A 4CR9A 1DUAA 1A5GH 1FONA 5E0GA 1TIOA 1TNLA 2FODA 3ZYEA 1P03A 3PWBA 1GJ7B 2HRVA 4I8LA 1PPEE 1SVPA 1QBVH 5EW2H 4X1SU 4U30A 1BBRK 3UNQA 4YOJA 2UWLA 4IN1A 1OWKA
chains in the Genus database with same CATH superfamily
1OXGA 4X1PU 2G00A 2NU2E 4E7RG 2LPRA 1C4V2 3SU2A 1P2MA 1ZMLA 3RXHA 4YESB 3ZVBA 1IHTH 2P3UB 1RTKA 4B2AA 2D1JA 4FXGH 3I29A 5EODA 1G32B 2FS9A 3AW1A 2D8WA 3FP6E 1SGEE 4K3JA 2RDLA 1IQNA 1E79D 2VIOA 5FPSA 3MH7A 1QZ8A 1Y5UT 2AEIH 1AB9B 1QURH 1WV7H 3RU4T 3RXBA 1HAVA 4Q4LA 1YY3A 2JH6D 2YNBA 3MYWA 4X1RU 1SGFG 4NWKA 2FOFA 4B75A 4ZKSU 2O8TA 2BLWA 3B9FH 1W3CA 1MU8B 1P9SA 2ZI2H 5KGOA 1JIMA 2B5TB 2ZFTA 4X6NA 2ZTZA 1QFKH 2AYWA 1C1MA 1KXDA 1D3TB 4Y6DA 1C5ZB 1UW7A 5EXMA 3GOVB 1D6RA 2Y81A 1O32A 4KELA 4B76A 3SBKA 4DVAU 3NPSA 1CGHA 3M35A 3SGQE 3A84A 2H2ZA 2G5NA 3SV8A 4YO9A 3UNRA 1C1VH 4M7GA 1SGDE 1C5RA 1FNIA 2IPQX 1DS2E 2HALA 1UTMA 5DP3A 1P2KA 5E8EH 4FU9A 1CT0E 1LQEA 1GI9B 4DURA 4H42U 1KLJH 2QIQA 1A1RA 1NTPA 3A8BA 4OS6A 1WQSA 3MNCA 1K0HA 4AFQA 2WPJS 1V2KT 2WZQA 2RCEA 1DY8A 2G52A 3A8DA 1NO9H 3PV2A 1IQJA 1MZAA 1LPGB 3H09A 2HLDD 1GCDA 1LMWB 4YZUA 3ZYDA 4D9RA 2SGFE 1H8ED 4BXWA 4X2WA 3A86A 1UMAH 3VB5A 1SGQE 1DWCH 1ELDE 1TABE 4HFPB 4IBLH 2BB4A 1SOZA 5HM2A 5DO4H 3SYJA 2CHAB 3ZZ9A 1BMAA 1O3FA 3GCHC 4ISLA 1EXFA 1VKYA 4Y8ZA 1FQ3A 2VVVA 4QT8C 1W11U 1D9IA 1WAYB 3DUXH 2R0LA 2V3HH 3KNXA 4CRBA 3RXVA 2H9EH 1S81A 5FXLA 1O2ZA 1IQHA 1O2PA 3S7HB 1AWHB 1EP5A 2F3CE 1BMNH 4F4OC 5DK1A 3FP7E 3OEED 4TT3D 2G4TA 1C2MA 4WH8A 3U1JB 4P00A 1S83A 2FIRH 1P9UA 5EJ1A 1O2WA 5GJ4B 2ZTYA 1ELBA 1O36A 1MCTA 1B7XB 1V2PT 3U69H 4U32A 1HCGA 1OWJA 4HGCA 1ZHMA 3M7TA 3P92A 2ANWA 1GVZA 2JH5D 4NA7A 4O03A 1OS8A 4Q80A 1DUEA 1P11E 2ZDMA 1BMMH 1GHAG 1BRBE 1ZRKA 2BOKA 4D7FA 1C1TA 1OWEA 1QL7A 5HM9A 1DANH 8LPRA 1YLDA 2DUCA 2FS8A 4BAMB 4DCDA 4MPWA 1BIOA 3BTHE 1LDTT 2O8LA 3SI4H 1NESE 1KXEA 1UVTH 3TK6A 1S0RA 9LPRA 4UFDH 2Y5GA 4GAWA 2FDAA 1O3NA 4X8SH 1C2LA 1YGCH 3MU4A 1J17T 4FUHA 5GXPA 2ZWLH 4ABJA 1UTOA 1IAUA 2H1UA 4AB9A 4DJZB 2FM2A 1J15A 4WY3A 3KQCA 3BTDE 2ZG0H 1SQAA 1SI5H 3RXKA 4NGAH 5A0AE 1NROH 2H9TH 1SLXB 1QA7A 4FUEA 3P8NA 1BHXF 2NU1E 3FVFB 5C0TA 1GJ8B 2QE7D 1RRKA 1PQ7A 1BTPA 1D6WA 4Y7BA 3SJ8A 5C1YA 1IHSH 2PKAB 2Y6TA 2ZHFH 1C5UA 3TH2H 1YPHC 2ZC9H 4ZHMU 1BDAA 1EZQA 1V2OT 3F0OA 4RSPA 3PLPA 4UFEH 1P3CA 2CV3A 1XM1A 2PV9B 3ZVDA 3E0NB 5FCRA 3WWFA 2EI8A 1H8DH 2FZZA 1TMTH 1GJ4H 1HAHH 1O5AB 2FMJA 2ILNA 3RXSA 4U01A 1FY8E 1O3DA 2FYRA 4CH8B 1W14U 2WINI 2HPPH 2QGRA 1CHOG 3A7XA 4FUJA 2SGPE 4X6PA 2OQUA 1XUFA 3GYMA 3PB1E 1ELAA 3GISB 3HKIB 3RXOA 5CDFE 3OE7D 2QV1A 2FOCA 3DT0H 2OP9A 3FAOA 2J98A 4FUFA 4YOGA 3OAAD 4OM9A 4AGJA 3QK1A 4MDSA 1GMDG 1SGIB 1UTNA 1KXAA 2FTMA 3LH3A 3LGVA 1MD8A 1AKSA 2AGGX 2BLVA 3LGTA 1HJAC 1UVUH 1WU1A 2FESH 4LXBH 2OBQA 4MPXA 3JZ2B 4X2VA 1O3BA 2A4GA 2BD7A 2KFWA 2EI6A 1GBKA 3SGAE 2M2AA 2K1QA 2J5UA 5A09A 2A4RA 2ZDAH 1ID5H 4B74A 1RS0A 3A7YA 3SU4A 5A8ZA 2ESTE 3QUMP 3KYFA 2V35A 4RT1A 1GPZA 3SZEA 3PTBA 3V0XA 1CGJE 3CS0A 1YCPH 3BV9B 4JK5A 4O97A 4H6SB 1FMGA 1FN8A 2BYAX 1GJ5H 3EA9A 4JYVH 4NA8A 1ESTA 2FWWA 3HGPA 3P8GA 4HG6A 3UOUA 2BDAA 1JOUB 2R3UA 5LPEA 3RC4A 1BTZA 2A7CA 1W0KD 1GBDA 2C8ZB 9ESTA 1MZDA 2HVXA 5CHBA 1TNKA 3KF2A 1OP0A 1GMCF 4ISOA 2G5VA 1HAYB 1NRQH 1VGCB 1SBWA 3BTKE 2BTCE 1G3BA 2WPLS 4ZKRU 1SSXA 3Q3KA 1L4DA 2NU3E 4I86A 1HPGA 2HWLB 1MU6B 1O2GH 1AI8H 1O3EA 2PGQB 1GL1A 4JYTA 1SLUB 2EA3A 2WPIS 3MNBA 2PSXA 7ESTE 4DOQA 1ANDA 1S6LA 2F9OA 1GBAA 1O3HA 1D3QB 1YPEH 3KHVA 3TH3H 4BXSA 1GMHF 1S5SA 2SNVA 1DWBH 3ATIA 3T27A 2TGDA 1HV7A 2VU8E 1TOCB 3UOPA 5F03A 2A5IA 1H4WA 3BTME 1C2KA 1HUTH 1FY1A 2A2QH 4YTAA 2KZ4A 2ODQA 3PTNA 2IJOB 4YT7H 1H8HD 1ABIH 2O9QA 8ESTE 4K8YA 1ZPBA 1A3BH 5DP4A 4I8GA 5HGGA 2H9HA 2BDHA 3MTYA 5EQQA 3RM2H 3T62A 1Q2WA 1K1JA 4CR5A 1QA0A 2OTVA 1Q3XA 4CRFA 3BTTE 1UK2A 5IK2D 1AFEH 1WUNH 2KCAA 1GI7B 1C2GA 2W6ID 1TNJA 2AFQB 5KECA 3N99A 1LHCH 1W13U 4ISIH 5DSFA 5EXLA 1QL9A 1O2HA 1GHBF 2R3YA 1NU9A 1BRCE 4NSVA 1GDQA 1GGDC 2Z9LA 1EB2A 1Z8GA 4UDWH 3A80A 1ORFA 2JETC 4CHAB 3LGUA 1P2QA 2Q6GA 2XNIA 1PQ8A 1F5RA 4MQAA 1O30A 1AFQC 3LJJA 4X2YA 5TJXA 1O2IA 3A83A 6LPRA 1X7AC 2C3SA 5FPTA 3SQHE 1AD8H 3SW2B 1KSNA 3B23B 1E38B 1O3PB 1ETSH 3SU3A 3RMNH 2XC0A 5JBCS 1GJAB 3KQDA 1CBWC 1FJSA 3QLPH 1Y59T 5EJLA 2PW8H 4YLQH 4THNH 1JXPA 1LVOA 1PPFE 1ZTKA 3SNCA 2ZF0H 2SGDE 2RA3A 2RA0A 4AC9A 5DN6D 2TRMA 2ZHQH 2XBVA 3FOAA 1NRNH 1EOJA 5FBIA 1MKWH 4ZROA 2G81E 1SHYA 1F5LA 3A8AA 4Q7XA 3V13A 1SLWB 3H7OA 3PMJA 1D4PB 4MNWA 1L2EA 3A7VA 3O8BA 3U9AH 2XRCA 1PJPA 1NRPH 1O39A 1WOFA 1IQFA 1G3DA 4Y71A 4AFZA 4AZ2B 5FL7D 3URCA 2JIZD 2PSYA 1L4ZA 2BD2A 5C17A 1GHWH 3SQEE 4MPVA 3C27B 1FIWA 2J95A 4YT6H 1AUTC 1S0QA 2V6NA 3OY5U 1SOTA 4XRNA 3ZZ3A 1GHXH 1BUIA 3I77A 1DDJA 3TPIZ 2H5DA 2WYJA 5EQSA 4WMFA 2PWXA 1XUHA 4FETA 5TCCA 1OX1A 3T26A 1NM6A 2Z9IA 1EQ9A 1J9CH 1DXWA 1VGCC 5JBBS 1MBMA 5HKKD 1GCTC 7GCHF 3KYGA 1C5QA 2TIOA 5H4IB 2HNTC 1FPHH 1MTWA 1UCYH 5AF9H 5AFYH 2SGQE 1TMUH 1ANEA 2IJD1 3LOXA 5I25A 1F0UA 3E91A 5C5OA 1QB6A 1VJ9U 2RDEA 1KDQA 3RXMA 3DA9B 4XOJA 1GI6A 2BZAA 1COWD 1SPJA 2ZEBA 1NBME 3PO1C 4NG9H 6ESTA 3FFGA 2ZDVH 3UWJH 2EY4C 1ZMNA 2VH0A 5EPNA 4IS5A 1VZQH 4AN7A 1NPMA 1HYLA 4TYDA 2VINA 1Y5AT 2SFAA 3E16B 4OS7A 3HKJB 1XUIA 1Y8TA 3I78A 1ETTH 3ATLA 3K6ZA 2ALVA 3DCLA 2BDCA 1MTNB 1ZR0A 6GCHF 3F2HA 5L6NH 3MMGA 5EU8A 2IPHA 1YLCA 2UWPA 1UTPA 2AIQA 1DXPA 3GDUA 1J16A 3RU4D 2UUKB 1G3CA 5DP6A 1RXPA 2ZU4A 3ZZBA 1C5NH 1GI1A 1UVSH 4AG1A 4B1TA 3UUZA 2I6QA 3U8TH 3MQKC 2BQ6B 1FXYA 1V2JT 4I8KA 1TPOA 4JCNA 1ACBE 3UQVA 2YOLA 1P57B 2TGTA 2XC5A 3M5NA 1SGNE 1TOMH 3NUMA 3KIDU 1LVMA 4JZ1A 3D49H 1TPAE 1T4UH 5EPYA 2ZQ1A 4ZH8A 3H5CB 2GP9B 3BF6H 1RIWC 1Y3XA 2CF9H 2Y7XA 4JZIA 4AYVB 1W0ZU 4GSOA 3NKKA 2GX4A 3ATMA 2PKAA 1T31A 4YM9A 4I33A 5C67A 2PTCE 4ABGA 5C5NA 2ZCHP 2VGCB 2ZGXH 1BTHH 2GZ9A 3AASA 1ELEE 1YKTA 5A2MH 2Y5FA 3AW0A 3GY5A 2XYAA 1F0RA 2OBOA 1IOEA 3S9AA 1ARBA 4NIVA 1THRH 2FO9A 5EQRA 2ZU2A 3UY9A 1EATA 5GCHG 2G51A 1BTWA 1AUJA 1JRSA 2D26C 1O2YA 1E36B 2PFEA 5C0UA 1UTQA 2J97A 1Z6JH 3D23A 1HXFH 1VCWA 3SUEA 1BQYA 4OGYA 2KCPA 1O3GA 3T5FH 3LJOA 1UTJA 1GJBB 1C4Y2 2FYQA 1C9PA 5T6GA 3RUOA 1VCQA 2ANKH 1O2NA 2F9NA 2OC8A 4E7NA 3RXGA 1BBRH 4HI3A 2GZ8A 4CRAA 4NA9H 3S0NA 1O33A 1BB0B 1ZHRA 5F8TA 1HAIH 1GMCG 5FHTA 2P59A 4JZFH 1EX3A 4I31A 5SGAE 3RXTA 2W6JD 2VWOA 1O35A 3P8FA 1E0FD 2TBSA 4UD9H 3GCTF 2FLRH 1GG6C 3QN7A 2C4FH 3OFND 1TQ0B 3LT3A 3TJOA 3EGKH 3IWMA 1RGQA 3AAVA 1E34B 1JIRA 1B0EA 2ZHWH 1GI3A 2G55A 2PR3A 3D62A 4MNXA 5J4QA 1GI5A 2C8WB 2XWAA 2ZIQH 3GY2A 1XX9A 1ZZZA 2PKSC 1DSUA 1S82A 4JK6A 1YC0A 5C20A 3M7QA 5ESTE 3ZZ8A 3K9XB 2A0QB 2FOHA 1O37A 3ZVFA 2WYGA 3ZIAD 4MPUA 1YPHE 4TSFD 4ISNA 1C1QA 2P3TB 2WV5A 4KTSA 1K1LA 1O2OA 3DSOA 1DY9A 4A1TA 4AORA 4LZ1H 2ZTXA 1GJ6A 2BD9A 2J38A 2V3OH 1D3PB 2BXUH 3URDA 3QTVH 2VJ1A 2V0BA 3BIUH 1BCUH 3ZVAA 1MKXK 5K7RA 3NWUA 1P2NA 2ZKSA 4SGBE 4FVBA 2XBXA 5K0HA 3SU6A 3SHAH 5IDKA 1N8OC 2O8MA 4H4FA 4VGCB 1MTNC 1PPCE 1TNGA 1VR1H 1GHBG 1T8MA 2O8UA 1BT7A 5DKMA 1OP2A 1NRRH 5JBAS 1TONA 2KCYA 5CMXH 1OOKB 2VIVA 4E05H 3BEUA 2QF3A 3LC5A 1ETRH 5C1XA 2DE9A 2QF4A 1KDQB 2ASUB 3QO6A 1OYTH 2L74A 2F91A 2SNWA 3ESTA 3DD2H 1G9IE 5HMAA 4B6FA 1A4WH 2BOHB 2D2DA 1CSOE 4DIIH 4XD7D 2C90B 1MUEB 1CA8B 3D65E 2BVRH 1SGYE 3M61U 1O2JA 3MU1A 2B0FA 5HYOA 1EASA 2P93A 2KCOA 1N6YA 5FX5A 1G2LA 4O9VA 3RXLA 4AOQA 4Y76A 1NS3A 2VIDA 1T7CA 2BM2A 2HNTF 3SV6A 3BG4B 3A7TA 4TY7A 2AH4X 2PUXB 1OPHB 1WBGB 3SI3H 1NZQH 1ABJH 3E8LA 4A6LA 4IGDA 1TMBH 2GCHF 4IC6A 3EAJA 4FVDA 4I8HA 3VB3A 3EA7A 3LGYA 1CVWH 3BTGE 1BTXA 2GV7A 3MO6A 3A85A 3SU0A 1ZTLA 2AHME 1G3EA 2GDDA 3F2GA 4BTIB 4D9QA 3OX7U 1HJ9A 1AB9C 4WXIA 1CO7E 1AWFH 1G30B 1PYTD 1HNEE 3M3VA 3RXEA 2VWLA 1KTTB 2ZP0H 8GCHF 2EC9H 2FTLE 1KIGH 5PTPA 5KEDA 3NCLA 4A1VA 4TWWA 2A5AA 1BJUA 2FP7B 3GY4A 4CRDA 2BHGA 5DG6A 2A1DB 5EXNA 4IN2A 1J14A 1A0LA 1P04A 3BN9A 4KTCA 1FN6A 3C1KA 3E1XB 4ISHH 4O3TA 3PLKA 2F9UA 7GCHG 1AVGH 1G2MA 2ODPA 1YPLH 2PTNA 2Z7FE 4GCHF 4BANB 3MU8A 1F0TA 3NXPA 1F7ZA 1TRNA 4I7YH 4GHQA 1GBLA 2BVSH 3K2UA 3SJOA 2P8OB 2BLQA 3SNEA 1NT1A 1AQ7A 2GGVB 3ZV9A 4IW4E 3HK6B 1XXFA 3FANA 5L2ZH 1VITG 1SQRA 2WPKS 5F6MA 1G36A 2STBE 3QZQA 1ELGA 1TNHA 2VIQA 1DX5M 2J94A 2P16A 4KP0A 2XC4A 2GTBA 1KLIH 1MTUA 3RXRA 3TLOA 1ZLRA 3HGNA 3IG6B 1Z1JA 1TX8A 3VXFH 3LH1A 1T8NA 3T28A 1T32A 2Z9JA 1O3LA 4F55A 3P17H 1OYQA 1QL8A 2OINA 3P8OA 1C2FA 1HBTH 3P70B 1BZXE 2CHAC 4GVUA 1ANCA 1BTYA 1FAKH 4A1XA 3TH4H 5CHAB 6GCHG 1A7SA 3N7EA 1YPMH 4NIYA 5EGMA 1ARCA 3M36A 2B7DH 3B8JA 3P95A 1GDUA 3G01A 2FOBA 1AGJA 3QGNB 2CF8H 4Y79A 1WTHD 3UWIA 1SLVB 4K69A 1LKAA 3AK5A 2VH6A 1WYKA 1E37B 4P02A 2BX4A 5DGJA 3CNRA 1O3OA 1LHFH 1O2MA 4K60A 1O2KA 2TPIZ 5GDSH 3RXFA 1PPHE 3DFLA 3FN8A 3RXQA 1CA0B 2ZFPH 1P0SH 3QTOH 3PRBA 2F9PA 1O34A 2BD5A 5LPRA 1O3AA 5AHGH 1ZGVA 4X8UH 4A5TS 4XE4A 1KTSB 2Z9GA 2BZ6H 1XXDA 5T6FA 1DLEA 2GT7A 3R0FA 1MD7A 1Z1IA 3OSYA 3SUFA 3LKWA 5TCAA 1QTFA 2QY0B 2W26A 1QGFA 3CENA 3STIA 4JZDH 2CXVA 1W7GH 1FY3A 1PYTC 4NFEA 4YOIA 4OS1A 8KME2 7LPRA 5T1VA 5LGOA 2L6OA 3ENSB 1L0ZA 2OC7A 4Y11E 3O8RA 4X6MA 5JDUB 1GBEA 4K1TA 3LONA 3V3MA 1TA2A 1FPCH 4AFSA 2ZDKA 3M5MA 5GWZA 4K5ZA 4NFFA 2XCNA 4MNVA 5E2OA 1AU8A 4ZXYH 2CK3D 3RXDA 1GJDB 1LCYA 5EG4A 2A4OA 1A2CH 1FI8A 4F49A 3ODFA 1O0DH 4TPYA 2HNTE 4DIHH 1GJ9B 3FP8E 3FKSD 1YP9A 1KYNA 1Z71A 3TU7H 2Y80A 2HGTH 6CHAB 1AVWA 1LVBA 1P06A 3KL6A 1O2QA 2VBCA 2WUBA 3Q77A 3O8CA 4ACAA 4X8VH 3HPTB 3UNSA 3VGCB 1C1UH 1TYNA 2CMYA 1TX6A 4ASHA 1ESAA 3F1SB 1OHHD 3T29A 3W94A 3A8CA 1LPZB 3E6PH 1S84A 2GCTB 2ZCLP 3T2NA 3TJNA 2BY7X 2GMTB 5ESBA 1BHXB 1MMJN 1S6HA 2VIPA 1G37A 3SO3A 2A2XH 4BTTB 2GT8A 2ZPRA 5G4BA 5FCKA 2QF5A 1DOJA 3KQEA 2XWBI 1A46H 1SB1H 2EEKA 5DP9A 2GKVE 1C5YB 1TLDA 2VIWA 2ZPQA 2ZFRH 3UREA 1C5PA 1YF4A 1F5KU 3F9FA 1EKBB 1MTVA 1H9HE 3A7WA 3MNSA 1C9TA 4WF8A 3RMMH 2FEQH 4FUCA 3DHKH 3EE0B 2ZGHA 2TGPZ 1ELTA 1HB0B 4AGKA 1TRYA 3OEHD 1O5FH 4O3UA 3TGIE 3ATKA 1GJCB 3UTUH 1Z7KA 1RJXB 1Q31A 2HLCA 4HZHA 3NK8A 1E35B 1TFXA 5CHAC 2WPMS 3VB7A 3LU9B 4INKA 2FOAA 1AZ8A 4RT0A 2V7QD 1TGNA 1SGCA 1ZJKA 2A45B 4RKJB 3BTEE 3FZDA 1DWEH 4X1NU 4ESTE 1YM0A 1CT2E 2FOGA 2ZCKP 2WSSD 2QXJA 2Z3EA 1OKXA 1AVXA 1ZOMA 3M3TA 3VFEA 1TGBA 1EUFA 2BMGB 3W1EA 5JPMH 4X0WU 1K1IA 2A31A 1CGIE 1D3DB 4MVNA 3PROA 1A61H 1DITH 1E1RD 3ZV8A 1SHHB 3KEEA 1GHVH 3Q00A 1CA0C 2K0QA 2ZPSA 1QBNA 2OXSA 4Z6AH 3RLYH 1EJMA 3AVZA 3CP7A 3ZZ4A 2AGEX 3U1IB 1FUJA 4CH2B 2PLXA 5EIYA 1UK4A 1XMNB 3ZZCA 3SNDA 3S69A 1V2WT 2GDEH 2FX6A 4CRCA 4X6OA 3MOCA 4NIXA 1GBTA 1JRTA 1T8LA 1P09A 3Q3XA 1LO6A 5FAHA 4YXWD 5CE1A 3RDZA 4XFQA 4IMQA 2BQ7B 2LELA 3F2FA 3UB0A 1DVAH 3V7TA 2FLBH 1C1SA 4ABFA 1YWUA 2WV4A 1W12U 3A88A 1T8OA 1GVKB 3N7DA 3PV4A 3A82A 1MAXA 3KGPA 3EE7A 2QF0A 3TNSA 2ZU3A 1L1GA 1QRWA 1W2KH 1SGRE 3QDZB 1O2TA 2F9VA 3GY8A 1MAYA 2AIPA 1XVOA 1IQMA 1FIZA 5GIBA 4K8BA 1SG8B 5J4SA 1NBMD 1GL0E 1FV9A 3SNBA 4TWYA 5GNDA 1O5BB 2OQ5A 1NY22 6CHAC 3QWCH 1P01A 2W3KA 2XNDD 4KTUA 1IQKA 3TIUA 3RMLH 1MBQA 1QR3E 1TB6H 2J4IA 1AMHA 1DT2A 1T4VH 1H1BA 1ZMJA 4X2XA 1Y5BT 3L6PA 2IOTA 1M9UA 1GVLA 1TBQH 4GCHG 3RM0H 3GCOA 2XTTB 3TGJE 1THSH 2ZU1A 5C3NA 1K22H 4Q2KA 2GCTC 2PP6A 3KQ5A 4WWYA 5FX6A 2HOBA 2AGIX 4CHAC 5FPYA 3F9GA 2BXTH 5L2YH 3A87A 2FI3E 5DPAA 4INLA 4I8JA 4BAHB 4YLUA 3GY6A 4GUXA 2UUFB 1TGCA 1W0YH 2NWNA 3QZRA 2Z94A 4FUIA 1AN1E 1LTOA 2ZECA 2ZZUH 2EI7A 2Z3CA 2R0KA 1QQ4A 1ZPZA 3F68H 1MTSA 2HVYB 3ITIA 1OWIA 2WPHS 1QRZA 1THPB 3FO8D 3F9HA 4D8NA 2XOKD 1HFDA 3ZZDA 4ABHA 1YPJH 3RLWH 2ZDNA 1NFWA 2H6MA 3RXPA 1DICA 1P2JA 1C5VA 5EOKA 4ZHLU 1EB1H 3ZVCA 1O5CB 4J1YA 4UE7H 3H7TA 5DP8A 1UVPA 1TGSZ 5HIYA 4WXVA 3GDSA 1HAXB 5ABWA 1XVMA 3PMHB 2QN5T 3UPEA 1BRAA 5EJZA 1IQEA 1C2IA 3MO9A 1FZZA 2R2WU 2AERH 5AFZH 2Q1JA 4DT4A 5ETXA 2BX3A 2BY9X 2Z3DA 3SUDA 1LQDB 3N7OA 1GBMA 2B9LA 1GHYH 1CE5A 1V2MT 2FOEA 1O5DH 4UFGH 3UFAA 3SV7A 4B6EA 1BRUP 3SORA 1C5TA 1ZRBA 3RXJA 1JMOH 3SU5A 3EA8A 3RMOH 3SOSA 1O2XA 2ZFFH 1DWDH 2C8XB 2XCFA 3F6UH 3BTFE 4AYYB 3Q76A 1V2TT 3P6ZB 1UO6A 1P2IA 3UQOA 1GMHG 1Z6EA 4X1QU 2VWMA 3TK5A 1GBBA 1HDTH 1K28D 1O3KA 1EJAA 2LNCA 2J2UA 1ZHPA 2OC0A 4DGJA 3VB4A 3L33A 1SQOA 2PGBB 1TPSA 4XBDA 4ASUD 1NFUA 4A7IB 3ELAH 3GS9A 1C1OA 2XBYA 1MCVA 3AAUA 1EAWA 5A8YA 3ATWA 3PLBA 3SN8A 1SC8U 2QCYA 1LHDH 2ZHEH 3UAIC 2O8WA 2J92A 1P8VC 4XSKU 3BIVH 1EAUA 4M9FA 1IQLA 2J9NA 4OS2A 3RP2A 1EJNA 4Z1MD 1UJ1A 2TGAA 2A7JA 1ZSJA 1E1QD 1INCA 1QB1A 1LVYA 2BQWB 1C5SA 1YBWA 4OGXA 4K2YA 4ZAEA 4FUDA 2B8OH 2WV9A 2ZNKH 1HJAB 2A5KA 3ZVEA 1K1NA 2YMSB 1RFNA 5FBEA 1FAXA 2JH0D 1YYY1 1YPGH 1TBZH 5LPFA 1C2EA 4B2BA 1V2NT 2STAE 3Q3YA 1GI8B 1V3XA 4FU8A 4MTBA 4U2WA 4ZUHA 2GVFA 2W5EA 2Y5HA 1C2HA 2PHBA 2Y7ZA 4BTUB 3VPKA 1SKYE 2W7SA 1MKXH 1TQ7B 3TK9A 1SFQB 4ZMAH 1O2LA 3WWBA 2ZO3H 1EZSC 2YMSD 1C1PA 1V2LT 2KR7A 3F0PA 2ZFSA 4BAKB 4X8TH 2KM0A 3A81A 3OY6U 5T3HA 3CS7A 3BEIB 1DPOA 2YNAA 1GI0A 2F4LA 3NZIA 3VG8A 2BLOA 5BPEA 1Z8RA 2QAAA 2JJ1D 1HIAA 1B5GH 3LC3A 4NIWA 3VXEH 2Z6BD 4B2CA 3WY8A 2VGCC 1HJ8A 1O3MA 4CREA 4Q63A 1AHTH 2Z9KA 5B6OA 1LHEH 3ZZAA 1H9LB 1CT4E 1RTFB 1C1RA 3M5LA 1BITA 3U28C 2ZA5A 2CGAA 1AIXH 2ULLA 1QIXB 4Y10E 1VJAU 3LIWA 4ACBA 2ANMH 1GBFA 4NZQA 1NRSH 5C94A 1A0HB 1QJ1B 1KXCA 1EFRD 1S85A 1DLKB 1EPTA 2A7HA 1O2RA 4UONA 4BAOB 5A8XA 1BTUA 3ZZ5A 1V2RT 3TVJB 3MHWU 2NU0E 1B0FA 4Y0YE 1LPKB 1TNIA 4MLFB 5DJ7A 5F53A 5GPIB 1WTGH 4WMEA 2XXLA 2VVUA 4HTCH 4FUBA 5E0HA 1U6QA 3A89A 3LGIA 2WUCA 1K1OA 1QJ6B 3ODDA 1L1JA 3PMBB 2BY5X 5T6DA 1VITH 2BY6X 5B6LA 1HAZB 3SV9A 1XKBC 1LHGH 3STJA 1C4U2 2UUJB 1ELVA 2ZGJA 5F8XA 1HGTH 1P02A 1TX7A 5I46H 1UHBA 2I6SA 2KAIA 2RG3A 2VWNA 1ESBA 3SNAA 1TRMA 1GGDB 2BDYA 1S6FA 5A0CA 1NFXA 2JETB 4WJG2 1MH0A 1A5HA 3GCNA 1AFQB 2BD4A 2RFKC 1HXEH 3LPRA 3S9CA 3LDXH 4ABDA 4AB8A 1K21H 1FDPA 1JBUH 2PUQH 1TGTA 3W95A 1HAOH 1XUGA 3QGJA 2HPQH 2KX4A 2FPZA 1TBRH 3BTWE 3TJVA 1K9OE 5DP7A 5A0BA 4D76A 1YCPK 1NU7B 2ZQ2A 2P95A 1HAVB 2OUAA 1CBWB 1H8IH 1TA6A 2V3MA 4GHTA 4VGCC 2FX4A 3O8DA 3LGWA 3SGBE 1SR5C 2F43B 3F9EA 1BA8B 1A5IA 2JJ2D 4IC5A 2BDBA 3HK3B 1C2JA 4ABEA 2BY8X 2YMSC 1GI2A 5HIZA 3HATH 3S9BA 3OU0A 4K1SA 3PWCA 1SGFA 5L30H 1K1MA 5JYIA 3MH4A 1N6XA 2QA9E 2JKHA 1MABB 3DSPA 4ZXXH 4AG2A 3EQ0H 4DW2U 3M7UA 4KKDA 4WVPE 1P05A 4MG3A 1WQVH 1CU1A 1Y3VA 1V2ST 4LZ4B 1PQAA 2DE8A 4UEHH 1TWXB 1GDNA 3PRDA 1AY6H 4INHA 2C93B 1K2I1 1QRXA 1F0SA 4K1EA 1QBOA 2AMQA 5JBTA 5GCHF 1CQQA 4TPIZ 1ZTJA 2ALPA 3MU5A 1P2OA 3MU0A 1PPBH 1O2VA 3SJ9A 3QX5H 1QHRB 4UFFH 3VB6A 4CRGA 4AX9H 1OWDA 2R9PA 3M37A 2ODYB 1QB9A 2OK5A 4H6TA 4SGAE 2ZU5A 1BMFD 1EOLA 2OC1A 2GZ7A 2VNTA 5HXFA 1OSSA 3BG4C 1P12E 1QCPA 1UTLM 1ZSKA 3GY3A 4NSYA 2ZDLA 4WH6A 3SJKA 2ZFQH 4GPGA 4Y7AA 2LP6A 1ZGIA 3RXAA 3ZZ6A 2W3IA 1K1PA 2CJIA 1O2SA 3MH5A 2J34A 1GCTB 2ANYA 1BMLA 3OTPA 2UWOA 1FY4A 2OLGA 1O5GH 4XDEA 5DP5A 1C5LH 1C5WB 4FOUC 1C1NA 1DSTA 1PFXC 3MNXA 1GWAA 1KMHB 4IMZA 4A92A 1GBCA 4ABAA 3R3GB 4I32A 4CBOA 4Y8XA 3TGKE 5C2ZA 1O3CA 3RXUA 1A3EH 1C5MD 1SQTA 3GDVA 4CBNA 2GD4B 3EDXB 4JZEH 1O5EH 1V2UT 3PO1B 4F48B 1FY5A 3SZNA 3WW7A 3KCGH 3GYLB 1MQ6A 1O3JA 3BG8A 1IQGA 1BJVA 1YCPM 1P3EA 1QQUA 4J2YB 2SGEE 3GCTG 1EZXC 1GI4A 4ABBA 1ZYOA 2CN0H 1F92A 2EQNA 1SMFE 3PV5A 3MFJA 1HIAB 4LK4A 1KXBA 4JYUH 1HAPH 2M5TA 2BVXH 3UR6A 2XBWA 5BRRE 2K8IA 4R0IA 1NFYA 3SV2H 1Z8JB 2FXRA 3TITA 2IN2A 2P8OC 2Y82A 1W7XH 3KQBA 3ZVGA 1UCYE 2OD3B 2Q6FA 2GV6A 1DE7H 3SUGA 1CHGA 4Y8YA 3M5OA 3RC6A 1H9IE 1KY9A 1MKWK 1ZSLA 2BD8A 4RN6A 3PMAB 1MQ5A 4LOYH 1EPTB 5JB8S 2UUYA 3UIRA 4XBCA 1GHZA 3GICB 4DY7B 3UR9A 3GY7A 1P10A 1C5XB 4NWLA 1TAWA 1AE5A 1GBHA 1SL3A 2OCVB 2R2MB 1RIWB 3DFJA 4RKOB 1XUKA 4Z0KA 1LKBA 4MNYA 4ZKNU 1XKAC 1QJ7B 2FI4E 3K6YA 2W7UA 3SJIA 5LH8A 2XW9A 1SFIA 1V6DA 2AMDA 5C1UA 4RI0A 2ZGBH 1Y3WA 1C5OH 1GHAF 4GLYA 1J8AA 4Q7YA 2A32A 3U8OH 1A0JA 2QXIA 1UHBB 2KAIB 1EP6A 2G8TA 1JWTA 3VEQB 5JB9S 4PROA 3RXCA 4OS4A 2THFB 5EW1H 1KXFA 2H5CA 5E0JA 3U98H 1IQIA 4R8TB 1HAGE 4WMDA 1GBJA 1UCYK 1TE0A 4DT7B 1KLTA 1UK3A 1WCZA 3OYPA 4ABIA 2GJGA 1ELCA 3FZZA 2QC2A 2F83A 4TY6A 2AMPA 5IYTA 1WXRA 2ZHDA 1C2DA 1RTLA 4JMYA 1BOQA 1OWHA 4NZLA 1ANBA 3SHCH 1AE8H 1W0JD 3E90B 2JDID 2GCHG 2J98B 1Z8IB 1Y3UA 3JZ1B 1DFPA 1EZUC 1O31A 3ZZ7A 2QXGA 3MH6A 4D7GA 1TPPA 1YLNA 1PPZA 1GBIA 1ZJDA 4ZKOU 1O38A 1AKSB 3S7KB 3E0PB 1GG6B 1NN6A 2A4QA 3MI4A 2QYIA 1N1LA 1V2VT 2NU4E 2WHXA 1W8BH 2FI5E 3BSQA 3MO3A 2C8YB 3NRLA 1WDIA 1FLEE 3IITA 3A7ZA 1EAIA 1PPGE 3PYHA 1O2UA 3MWIU 1F2SE 3BTQE 8GCHG 2PKSB 1O3IA 1ELFA 3OTJE 1DM4B 7KMEH 1V2QT 1VCPA 1CHOF 1VITF 1RD3B 1SGTA 1AO5A 1UTKA 1OP8A 3TJUA 3F3BA 4B71A 1BBRE 2P94A 4FU7A 1WSSH 3VGCC 1HRTH 4Y0ZE 3U8RH 1PQ5A 2QXHA 4AFUA 3PM3A 3EYDA 2BDGA 1AZZA 1L1NA 1HLTH 1QY6A 2FOMB 2VB0A 1GMDF 4OS5A 2SGAA 3GCHB 4E06H 2P3FH 4BAQB 3RU4E 1YPKH 1W10U 3V12A 2GMTC 2AS9A 1NC6A 1TALA 4BNRA 2F9BH 1N8OB 1QNJA 5F8ZA 3SU1A 1SGPE 2G4UA 3M3SA 4FUGA 3K65B 3L3TA 2VVCA 3RXIA 1C1WH 2BDIA 4Q7ZA 4NCYA 3E3TA 1ZPCA 4B73A 4KGAA 1EAXA 5E2PA 5AVDA 4BOHA 1XUJA 4ZHAA 2BD3A 2Q6DA 3KN2A 4XBBA 2ZGCA 3T25A 1UVOA 3TNTA 3RC5A 1EPTC 3BEFB 1Y3YA 4DG4A 4CR9A 1DUAA 1A5GH 1FONA 5E0GA 4ZCNA 1TIOA 1TNLA 2FODA 3ZYEA 1P03A 3PWBA 1GJ7B 2HRVA 4I8LA 1PPEE 1SVPA 2WPDD 1QBVH 5EW2H 4X1SU 1FX0B 1BBRK 4U30A 3UNQA 2UWLA 4YOJA 3DSGA 4IN1A 1OWKA
chains in the Genus database with same CATH topology
1OXGA 4X1PU 2G00A 2NU2E 4E7RG 2LPRA 1C4V2 3SU2A 1P2MA 1ZMLA 3RXHA 4YESB 3ZVBA 1IHTH 2P3UB 1RTKA 4B2AA 2D1JA 4FXGH 3I29A 5EODA 1G32B 2FS9A 3AW1A 2D8WA 3FP6E 1SGEE 4K3JA 2RDLA 1IQNA 2VIOA 5FPSA 3MH7A 1Y5UT 2AEIH 1AB9B 1QURH 1WV7H 3RU4T 3RXBA 1HAVA 2JH6D 2YNBA 3MYWA 4X1RU 1SGFG 4NWKA 2FOFA 4B75A 4ZKSU 2O8TA 2BLWA 3B9FH 1W3CA 1MU8B 1P9SA 2ZI2H 1JIMA 2B5TB 2ZFTA 4X6NA 2ZTZA 1QFKH 2AYWA 1C1MA 1KXDA 1D3TB 4Y6DA 1C5ZB 5EXMA 3GOVB 1D6RA 2Y81A 1O32A 4KELA 4B76A 3SBKA 4DVAU 3NPSA 1CGHA 3M35A 3SGQE 3A84A 2H2ZA 2G5NA 3SV8A 4YO9A 3UNRA 1C1VH 4M7GA 1SGDE 1C5RA 1FNIA 1DS2E 2HALA 1UTMA 5DP3A 1P2KA 5E8EH 4FU9A 1CT0E 1LQEA 1GI9B 4DURA 4H42U 1KLJH 2QIQA 1A1RA 1NTPA 3A8BA 4OS6A 1WQSA 3MNCA 4AFQA 2WPJS 1V2KT 2RCEA 1DY8A 2G52A 3A8DA 1NO9H 1IQJA 1MZAA 1LPGB 3ZYDA 1GCDA 1LMWB 4YZUA 4D9RA 2SGFE 4BXWA 4X2WA 3A86A 1UMAH 3VB5A 1SGQE 1DWCH 1ELDE 1TABE 4HFPB 4IBLH 2BB4A 1SOZA 5HM2A 5DO4H 3ZZ9A 2CHAB 1BMAA 1O3FA 3GCHC 4ISLA 1EXFA 4Y8ZA 1FQ3A 2VVVA 4QT8C 1W11U 1D9IA 1WAYB 3DUXH 2R0LA 2V3HH 3KNXA 4CRBA 3RXVA 2H9EH 1S81A 5FXLA 1O2ZA 1IQHA 1O2PA 3S7HB 1AWHB 1EP5A 2F3CE 1BMNH 4F4OC 5DK1A 3FP7E 2G4TA 1C2MA 4WH8A 3U1JB 1S83A 2FIRH 1P9UA 1O2WA 5GJ4B 2ZTYA 1ELBA 1O36A 1MCTA 1B7XB 1V2PT 3U69H 4U32A 1HCGA 1OWJA 4HGCA 1ZHMA 3M7TA 3P92A 2ANWA 1GVZA 2JH5D 4NA7A 4O03A 1OS8A 4Q80A 1DUEA 1P11E 2ZDMA 1BMMH 1GHAG 1BRBE 1ZRKA 2BOKA 4D7FA 1C1TA 1OWEA 1QL7A 5HM9A 1DANH 8LPRA 1YLDA 2DUCA 2FS8A 4BAMB 4DCDA 4MPWA 1BIOA 3BTHE 1LDTT 2O8LA 3SI4H 1NESE 1KXEA 1UVTH 3TK6A 1S0RA 9LPRA 4UFDH 2Y5GA 4GAWA 2FDAA 1O3NA 4X8SH 1C2LA 1YGCH 3MU4A 1J17T 4FUHA 5GXPA 2ZWLH 4ABJA 1UTOA 1IAUA 2H1UA 4AB9A 4DJZB 2FM2A 1J15A 4WY3A 3KQCA 3BTDE 2ZG0H 1SQAA 1SI5H 3RXKA 4NGAH 5A0AE 1NROH 2H9TH 1SLXB 1QA7A 4FUEA 3P8NA 1BHXF 2NU1E 3FVFB 1GJ8B 1RRKA 1PQ7A 1BTPA 1D6WA 4Y7BA 3SJ8A 5C1YA 1IHSH 2PKAB 2Y6TA 2ZHFH 1C5UA 3TH2H 1YPHC 2ZC9H 4ZHMU 1BDAA 1EZQA 1V2OT 4RSPA 3PLPA 4UFEH 1P3CA 2CV3A 1XM1A 2PV9B 3ZVDA 3E0NB 5FCRA 2EI8A 1H8DH 2FZZA 1TMTH 1GJ4H 1HAHH 1O5AB 2FMJA 2ILNA 3RXSA 4U01A 1FY8E 1O3DA 2FYRA 4CH8B 1W14U 2WINI 2HPPH 2QGRA 1CHOG 3A7XA 4FUJA 2SGPE 4X6PA 2OQUA 1XUFA 3GYMA 3PB1E 1ELAA 3GISB 3HKIB 3RXOA 2QV1A 2FOCA 3DT0H 2OP9A 3FAOA 4FUFA 4YOGA 4AGJA 3QK1A 4MDSA 1GMDG 1SGIB 1UTNA 1KXAA 2FTMA 3LH3A 3LGVA 1MD8A 1AKSA 2AGGX 2BLVA 3LGTA 1HJAC 1UVUH 1WU1A 2FESH 4LXBH 2OBQA 4MPXA 3JZ2B 4X2VA 1O3BA 2A4GA 2BD7A 2EI6A 1GBKA 3SGAE 2K1QA 5A09A 2A4RA 2ZDAH 1ID5H 4B74A 1RS0A 3A7YA 3SU4A 5A8ZA 2ESTE 3QUMP 2V35A 1GPZA 3PTBA 3V0XA 1CGJE 3CS0A 1YCPH 3BV9B 4JK5A 4O97A 4H6SB 1FMGA 1FN8A 2BYAX 1GJ5H 3EA9A 4JYVH 4NA8A 1ESTA 2FWWA 3HGPA 3P8GA 3UOUA 2BDAA 1JOUB 2R3UA 5LPEA 3RC4A 1BTZA 2A7CA 2C8ZB 1GBDA 9ESTA 1MZDA 2HVXA 1TNKA 3KF2A 1OP0A 1GMCF 4ISOA 2G5VA 1HAYB 1NRQH 1VGCB 1SBWA 3BTKE 2BTCE 1G3BA 2WPLS 4ZKRU 1SSXA 3Q3KA 1L4DA 2NU3E 1HPGA 2HWLB 1MU6B 1O2GH 1AI8H 1O3EA 2PGQB 1GL1A 4JYTA 1SLUB 2EA3A 2WPIS 3MNBA 2PSXA 7ESTE 4DOQA 1ANDA 2F9OA 1GBAA 1O3HA 1D3QB 1YPEH 3KHVA 3TH3H 4BXSA 1GMHF 1S5SA 2SNVA 1DWBH 3ATIA 3T27A 2TGDA 1HV7A 2VU8E 1TOCB 3UOPA 5F03A 2A5IA 1H4WA 3BTME 1C2KA 1HUTH 1FY1A 2A2QH 4YTAA 2ODQA 3PTNA 2IJOB 4YT7H 1ABIH 2O9QA 8ESTE 4K8YA 1ZPBA 1A3BH 5DP4A 4I8GA 5HGGA 2H9HA 2BDHA 3MTYA 5EQQA 3RM2H 3T62A 1Q2WA 1K1JA 4CR5A 1QA0A 2OTVA 1Q3XA 4CRFA 3BTTE 1UK2A 1AFEH 1WUNH 1GI7B 1C2GA 1TNJA 2AFQB 1LHCH 1W13U 4ISIH 5EXLA 1QL9A 1O2HA 1GHBF 2R3YA 1NU9A 1BRCE 4NSVA 1GDQA 1GGDC 2Z9LA 1EB2A 1Z8GA 4UDWH 3A80A 1ORFA 2JETC 4CHAB 3LGUA 1P2QA 2Q6GA 2XNIA 1PQ8A 1F5RA 4MQAA 1O30A 1AFQC 3LJJA 4X2YA 5TJXA 1O2IA 3A83A 6LPRA 1X7AC 2C3SA 5FPTA 3SQHE 1AD8H 3SW2B 1KSNA 3B23B 1E38B 1O3PB 1ETSH 3SU3A 3RMNH 2XC0A 5JBCS 1GJAB 3KQDA 1CBWC 1FJSA 3QLPH 1Y59T 2PW8H 4YLQH 4THNH 1JXPA 1LVOA 1PPFE 1ZTKA 3SNCA 2ZF0H 2SGDE 2RA3A 2RA0A 2TRMA 2ZHQH 2XBVA 1NRNH 1EOJA 5FBIA 1MKWH 4ZROA 2G81E 1SHYA 1F5LA 3A8AA 4Q7XA 3V13A 1SLWB 3H7OA 3PMJA 1D4PB 4MNWA 1L2EA 3A7VA 3O8BA 3U9AH 2XRCA 1PJPA 1NRPH 1O39A 1WOFA 1IQFA 1G3DA 4Y71A 4AFZA 4AZ2B 3URCA 2PSYA 1L4ZA 2BD2A 1GHWH 3SQEE 4MPVA 3C27B 1FIWA 2J95A 4YT6H 1AUTC 1S0QA 2V6NA 3OY5U 1SOTA 3ZZ3A 1GHXH 1BUIA 3I77A 1DDJA 3TPIZ 2H5DA 2WYJA 5EQSA 4WMFA 2PWXA 1XUHA 5TCCA 1OX1A 3T26A 1NM6A 2Z9IA 1EQ9A 1J9CH 1DXWA 1VGCC 5JBBS 1MBMA 1GCTC 7GCHF 1C5QA 2TIOA 5H4IB 2HNTC 1FPHH 1MTWA 1UCYH 5AF9H 5AFYH 2SGQE 1TMUH 1ANEA 3LOXA 5I25A 1F0UA 3E91A 5C5OA 1QB6A 1VJ9U 3RXMA 1KDQA 3DA9B 4XOJA 1GI6A 2BZAA 1SPJA 2ZEBA 3PO1C 4NG9H 6ESTA 3FFGA 2ZDVH 3UWJH 1ZMNA 2VH0A 5EPNA 4IS5A 1VZQH 4AN7A 1NPMA 1HYLA 4TYDA 2VINA 1Y5AT 2SFAA 3E16B 4OS7A 3HKJB 1XUIA 1Y8TA 3I78A 1ETTH 3ATLA 3K6ZA 2ALVA 2BDCA 1MTNB 1ZR0A 6GCHF 5L6NH 3MMGA 5EU8A 2IPHA 1YLCA 2UWPA 1UTPA 2AIQA 1DXPA 3GDUA 1J16A 3RU4D 2UUKB 1G3CA 5DP6A 1RXPA 2ZU4A 3ZZBA 1C5NH 1GI1A 1UVSH 4AG1A 4B1TA 3UUZA 2I6QA 3U8TH 2BQ6B 1FXYA 1V2JT 4I8KA 1TPOA 4JCNA 1ACBE 3UQVA 2YOLA 1P57B 2TGTA 2XC5A 3M5NA 1SGNE 1TOMH 3NUMA 3KIDU 1LVMA 4JZ1A 3D49H 1TPAE 1T4UH 5EPYA 2ZQ1A 4ZH8A 3H5CB 2GP9B 3BF6H 1RIWC 1Y3XA 2CF9H 2Y7XA 4JZIA 4AYVB 1W0ZU 4GSOA 3NKKA 2GX4A 3ATMA 2PKAA 1T31A 4YM9A 4I33A 5C67A 2PTCE 4ABGA 5C5NA 2ZCHP 2VGCB 2ZGXH 1BTHH 2GZ9A 3AASA 1ELEE 1YKTA 5A2MH 2Y5FA 3AW0A 3GY5A 2XYAA 1F0RA 2OBOA 1IOEA 3S9AA 1ARBA 4NIVA 1THRH 2FO9A 5EQRA 2ZU2A 3UY9A 1EATA 5GCHG 2G51A 1BTWA 1AUJA 1JRSA 2D26C 1O2YA 1E36B 2PFEA 1UTQA 3D23A 1Z6JH 1HXFH 1VCWA 3SUEA 1BQYA 4OGYA 1O3GA 3T5FH 3LJOA 1UTJA 1GJBB 1C4Y2 2FYQA 1C9PA 5T6GA 3RUOA 1VCQA 2ANKH 1O2NA 2F9NA 2OC8A 4E7NA 3RXGA 1BBRH 4HI3A 2GZ8A 4CRAA 4NA9H 3S0NA 1O33A 1BB0B 1ZHRA 5F8TA 1HAIH 1GMCG 5FHTA 2P59A 4JZFH 1EX3A 4I31A 5SGAE 3RXTA 2VWOA 1O35A 3P8FA 1E0FD 2TBSA 4UD9H 3GCTF 2FLRH 1GG6C 3QN7A 2C4FH 1TQ0B 3LT3A 3TJOA 3EGKH 3IWMA 1RGQA 3AAVA 1E34B 1JIRA 1B0EA 2ZHWH 1GI3A 2G55A 2PR3A 3D62A 4MNXA 5J4QA 1GI5A 2C8WB 2XWAA 2ZIQH 3GY2A 1XX9A 1ZZZA 2PKSC 1DSUA 1S82A 4JK6A 1YC0A 5C20A 3M7QA 5ESTE 3ZZ8A 3K9XB 2A0QB 2FOHA 1O37A 3ZVFA 2WYGA 4MPUA 1YPHE 4ISNA 1C1QA 2P3TB 2WV5A 4KTSA 1K1LA 1O2OA 4A1TA 1DY9A 4AORA 4LZ1H 2ZTXA 1GJ6A 2BD9A 2J38A 2V3OH 1D3PB 2BXUH 3URDA 3QTVH 2VJ1A 2V0BA 3BIUH 1BCUH 3ZVAA 1MKXK 5K7RA 3NWUA 1P2NA 2ZKSA 4SGBE 4FVBA 2XBXA 5K0HA 3SU6A 3SHAH 5IDKA 1N8OC 2O8MA 4H4FA 4VGCB 1MTNC 1PPCE 1TNGA 1VR1H 1GHBG 1T8MA 2O8UA 1BT7A 5DKMA 1OP2A 1NRRH 5JBAS 1TONA 5CMXH 1OOKB 2VIVA 4E05H 3BEUA 2QF3A 3LC5A 1ETRH 5C1XA 2DE9A 1KDQB 2ASUB 3QO6A 1OYTH 2F91A 2SNWA 3ESTA 3DD2H 1G9IE 5HMAA 1A4WH 2BOHB 2D2DA 1CSOE 4DIIH 2C90B 1MUEB 1CA8B 3D65E 2BVRH 1SGYE 3M61U 1O2JA 3MU1A 2B0FA 5HYOA 1EASA 2P93A 1N6YA 5FX5A 1G2LA 4O9VA 3RXLA 4AOQA 4Y76A 1NS3A 2VIDA 1T7CA 2BM2A 2HNTF 3SV6A 3BG4B 3A7TA 4TY7A 2AH4X 2PUXB 1OPHB 1WBGB 3SI3H 1NZQH 1ABJH 3E8LA 4A6LA 4IGDA 1TMBH 2GCHF 4IC6A 3EAJA 4FVDA 4I8HA 3VB3A 3EA7A 3LGYA 1CVWH 3BTGE 1BTXA 2GV7A 3MO6A 3A85A 3SU0A 1ZTLA 1G3EA 2GDDA 4BTIB 4D9QA 3OX7U 1HJ9A 1AB9C 4WXIA 1CO7E 1AWFH 1G30B 1PYTD 1HNEE 3M3VA 3RXEA 2VWLA 1KTTB 2ZP0H 8GCHF 2EC9H 2FTLE 1KIGH 5PTPA 3NCLA 4A1VA 4TWWA 2A5AA 1BJUA 2FP7B 3GY4A 4CRDA 2BHGA 5DG6A 2A1DB 5EXNA 4IN2A 1J14A 1A0LA 1P04A 3BN9A 4KTCA 1FN6A 3C1KA 3E1XB 4ISHH 4O3TA 3PLKA 2F9UA 7GCHG 1AVGH 1G2MA 2ODPA 1YPLH 2PTNA 2Z7FE 4GCHF 4BANB 3MU8A 1F0TA 3NXPA 1F7ZA 1TRNA 4I7YH 4GHQA 1GBLA 2BVSH 3K2UA 3SJOA 2P8OB 2BLQA 3SNEA 1NT1A 1AQ7A 2GGVB 3ZV9A 4IW4E 3HK6B 1XXFA 3FANA 5L2ZH 1VITG 2WPKS 5F6MA 1G36A 2STBE 3QZQA 1ELGA 1TNHA 2VIQA 1DX5M 2J94A 2P16A 4KP0A 2XC4A 2GTBA 1KLIH 1MTUA 3RXRA 3TLOA 1ZLRA 3HGNA 3IG6B 1Z1JA 1TX8A 3VXFH 3LH1A 1T8NA 3T28A 1T32A 2Z9JA 1O3LA 3P17H 1OYQA 1QL8A 2OINA 3P8OA 1C2FA 1HBTH 3P70B 1BZXE 2CHAC 4GVUA 1ANCA 1BTYA 1FAKH 4A1XA 3TH4H 5CHAB 6GCHG 1A7SA 1YPMH 4NIYA 5EGMA 1ARCA 3M36A 2B7DH 3B8JA 3P95A 1GDUA 3G01A 2FOBA 1AGJA 3QGNB 2CF8H 4Y79A 1WTHD 3UWIA 1SLVB 4K69A 1LKAA 2VH6A 1WYKA 1E37B 2BX4A 5DGJA 1O3OA 1LHFH 1O2MA 4K60A 1O2KA 2TPIZ 5GDSH 3RXFA 1PPHE 3DFLA 3RXQA 1CA0B 2ZFPH 1P0SH 3QTOH 2F9PA 1O34A 2BD5A 5LPRA 1O3AA 5AHGH 1ZGVA 4X8UH 4A5TS 4XE4A 1KTSB 2Z9GA 2BZ6H 1XXDA 5T6FA 1DLEA 2GT7A 3R0F