1F0TA

Bovine trypsin complexed with rpr131247
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of human factor Xa complexed with potent inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords TRYPSIN
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f0tA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f0tA02
2FODA 3H7TA 1QBNA 1G3EA 1GBTA 2FMJA 4X1PU 3M7TA 1BJUA 2BLOA 3LGTA 1QY6A 1A1RA 4BAMB 3A82A 1EOLA 4UFGH 1ABIH 3F68H 2HVXA 4I8JA 2WPLS 1AZZA 1O39A 1SGPE 5A0BA 1DY9A 1GHAF 1P06A 1GBHA 1TRNA 2DUCA 3FANA 5HXFA 2AS9A 2WPHS 1KLJH 1GBJA 1TQ0B 1Z7KA 1C1NA 2Q6FA 1C4V2 3KGPA 6GCHG 2SGPE 4E05H 1IQNA 1DLEA 1FY1A 1T8NA 1UHBB 2BD9A 1T8OA 4A1TA 1A0JA 1VGCB 1DT2A 3TNTA 3ATKA 1C5NH 1OPHB 2ZA5A 1MTUA 3F9HA 2O9QA 4AZ2B 2XRCA 2FLRH 5ETXA 4KP0A 2R2WU 2GDEH 1AD8H 2G00A 4FUEA 3OU0A 1C5XB 1WU1A 3BEIB 3BEUA 3RU4E 4JZ1A 1C4U2 3EYDA 5ESBA 1LDTT 3GY3A 1XVOA 1C2FA 4X2WA 1SQAA 1QTFA 1ESAA 2YNBA 2R0LA 1VITF 4H6SB 4UFEH 1XUGA 3RXCA 1YPEH 3M37A 1OWHA 2FS9A 1NFXA 4JZIA 1CVWH 4NWKA 1RTFB 1W10U 4ABGA 1TNHA 1UVUH 1YGCH 1H8IH 1P3CA 3BTEE 3RXPA 4AX9H 2SGQE 2FOMB 2P3TB 3A84A 3TITA 4JK5A 3PLBA 1SPJA 1UMAH 3ZZ3A 3P8NA 2CF9H 1DOJA 3K65B 1O0DH 4AGJA 3KN2A 1SLUB 1G30B 1QFKH 2P3UB 4U2WA 2ODYB 1ZHMA 1GMCG 1OWKA 2VIVA 1NT1A 5HM2A 3TU7H 5C67A 3MI4A 7LPRA 1O3MA 1O3DA 2A5IA 5T3HA 4X1QU 1GHZA 3GCHC 2C93B 1D4PB 1O5FH 3W95A 2BXTH 1NRQH 5JBBS 1ZTLA 5T6FA 1HAXB 1TBQH 1THSH 1UTKA 2WYGA 1W0ZU 3RXJA 1SGEE 3DFLA 1HAYB 3ZVFA 1L0ZA 2A32A 2VNTA 1TOCB 2HNTF 2VH0A 3M7UA 3D65E 1FNIA 1P57B 1IQKA 2WV5A 4YO9A 4R0IA 1CBWC 1DY8A 1O2OA 3LGIA 4D9RA 1MH0A 1J15A 4X8UH 2GP9B 5H4IB 1OYQA 1AE5A 2BXUH 1Z8IB 1UTQA 2G5NA 3A89A 1K1PA 1JRSA 4FVBA 1A0LA 1C9PA 4YM9A 3A8AA 2FYQA 3P8GA 4MQAA 2NU4E 2B5TB 4IN2A 3RMMH 2VIQA 5FPSA 3NXPA 3QN7A 1O2MA 2FI5E 2F9PA 1OP8A 1WV7H 2UWLA 3ZVGA 1W12U 2FM2A 4AORA 2ZKSA 1TONA 2B0FA 1T31A 2ZG0H 5DPAA 3RC4A 1PPEE 3A83A 3U8RH 2A7CA 5JB9S 3LJJA 2HPPH 3EGKH 5I25A 2PKAB 1FDPA 1DDJA 2Y7XA 4AYVB 2ZU3A 1O3KA 3DT0H 3FFGA 1GMHF 2Z9LA 1TX7A 2Y80A 1O2NA 1QRZA 1SGTA 4GCHF 1GBLA 1DWBH 1O2VA 4WXIA 3T29A 1YLCA 1QL9A 1TNIA 2VU8E 4LOYH 1GJBB 3FZZA 5LGOA 3M36A 1HJAC 1QR3E 2Z6BD 4IC6A 2ZFFH 1MKXH 1YP9A 2Y5GA 1WAYB 3D62A 1W14U 1Y5BT 3MU0A 4NWLA 2P3FH 2GMTB 3LJOA 1K1NA 3SU2A 1IQIA 1D6WA 3KL6A 2VVVA 1RTLA 3T2NA 2ZDNA 1EAXA 2ZTXA 3QGJA 3E91A 1NESE 4FU7A 4SGBE 3SJKA 3SQEE 1GMCF 1O3OA 4ABHA 2F9NA 4YT6H 1S6HA 2ZU4A 1MCTA 2G55A 3I29A 3VXEH 2A2QH 3QX5H 3RMLH 4WH6A 1K9OE 4ZKSU 2F9VA 3GCNA 1HAZB 5GWZA 3V13A 5L2YH 1RJXB 2H9TH 3SU6A 3PMJA 5DGJA 2ZDAH 2BY5X 3F6UH 3VEQB 4NA7A 4ABBA 4A6LA 4WF8A 2HNTE 1CHGA 1EP5A 4CH8B 1E36B 1TALA 2XBWA 4D76A 4B76A 2BVSH 4ABJA 4DIHH 1P04A 1GHXH 3GY5A 1C5QA 1GBIA 4RKOB 2PUQH 1BMNH 1EKBB 3M35A 1UVPA 4FUBA 1ID5H 3RXFA 1FONA 4LZ4B 4HFPB 1B5GH 1ETSH 1FV9A 1KLTA 1Y8TA 2GTBA 1MAYA 2A4OA 2ZGHA 3SO3A 3LGVA 1C5ZB 1YPLH 3LH1A 3U1IB 1FN8A 2CHAB 3UUZA 1TGTA 1FXYA 1AVWA 1V2TT 5FAHA 2OBOA 3U8OH 2QY0B 3UPEA 1L1GA 1P9SA 1C1WH 4AFSA 2OC8A 4X8SH 1FY3A 3HATH 1TABE 1P2IA 4BOHA 2HPQH 1K28D 2EC9H 2D1JA 1QNJA 3FP8E 4A92A 2SFAA 3GCHB 4ZKOU 3SNCA 4RSPA 4ZKRU 2WPMS 3GDUA 1A3EH 2ZHFH 1V2NT 2XYAA 1NU9A 1IQGA 1SGCA 3ENSB 4R8TB 1SLWB 1S85A 3H7OA 1GI2A 5A0AE 1NRSH 2BMGB 2R9PA 4WJG2 1BQYA 1YPGH 1AO5A 1T4VH 3QTVH 1DANH 3ZYDA 1Z6EA 1F5LA 3SU5A 4O97A 1UK2A 1LCYA 1TLDA 3ODFA 1O3JA 3MOCA 4JZFH 4BXWA 3ZZ4A 2VIPA 1C1RA 4X1SU 2AERH 3ATMA 2QF3A 1MZDA 1LHGH 3NKKA 1MQ5A 2BY6X 1IQHA 4H6TA 2XC5A 4K1SA 1AHTH 2AMQA 4BNRA 2XWAA 1GHVH 1L1JA 1GCTB 2SGEE 1P0SH 1QBVH 1SFIA 3KF2A 2G8TA 3GISB 3LGYA 2A45B 1GL1A 1EOJA 3O8CA 4CRCA 1JIRA 2H6MA 2V3OH 3RXSA 4O3UA 1MAXA 1BBRH 2JH5D 3S69A 1HRTH 4NIXA 3A7WA 1KDQA 1VITG 2TGDA 3MNSA 1M9UA 1C2GA 1CQQA 2CF8H 2JH0D 1BOQA 1MTNB 4CR9A 1TMBH 3RM2H 1OKXA 3SBKA 3A87A 1DE7H 1HXEH 2FOGA 4Y79A 3RC6A 2A5KA 3ELAH 2H9HA 3PM3A 4ABEA 5F8ZA 5EPNA 2GCHG 1C2MA 1D6RA 3S9BA 1BMAA 1ESTA 5L2ZH 1C5SA 4IBLH 1GI5A 3KEEA 3IITA 1KXCA 1ZMLA 1O32A 1NY22 1GVKB 3Q3YA 3SJ9A 2F9OA 1O3BA 3UNSA 2XXLA 2AH4X 3QZRA 1TBZH 2J95A 1RXPA 2Y7ZA 2ZPSA 2O8WA 4IMZA 3NUMA 4Q2KA 2ZQ1A 3RXAA 2FDAA 4YTAA 3M5MA 4TY6A 2HOBA 3M3SA 1GI1A 3UIRA 1HNEE 1S84A 2P8OB 3NK8A 1QRXA 5K7RA 2BOHB 2DE9A 4JK6A 1ELGA 4DVAU 1L2EA 1V2QT 2PGQB 1ZHRA 3VB5A 4CRAA 1KXDA 3UWIA 2BHGA 1MBMA 3GICB 4ISHH 4DT7B 3KQEA 2Y5FA 1O5AB 1O3HA 4WMFA 2A4RA 2ZU1A 4ISNA 2ZO3H 4YLUA 3MU8A 2FOEA 5EOKA 1VCPA 3HGPA 1O2HA 2ANWA 1BRBE 4IW4E 1GJAB 4B1TA 1GBDA 2JETB 1SGQE 1SFQB 1GMHG 2BD7A 2PWXA 1MKWH 1XUJA 4ASHA 1XX9A 4XOJA 1Y5UT 1Z8RA 1QBOA 3M5LA 1P9UA 4H4FA 1LTOA 4HI3A 1WBGB 4ZAEA 1Y3YA 1K1IA 1TPPA 2K1QA 4K1TA 4ISIH 1BMMH 1XUIA 1BRCE 3RM0H 3SORA 1GGDB 2Z9KA 2XBVA 4O3TA 2GCHF 4B2AA 3PMHB 2LPRA 4UDWH 1FN6A 2QN5T 4Y7BA 4GUXA 4YLQH 2PHBA 1BRUP 3U98H 3ZV9A 1JWTA 4OS1A 1DS2E 4Q7XA 3PMBB 2VB0A 2FX4A 3RXGA 2GCTC 5K0HA 3D23A 2ZTZA 1P2OA 3ZYEA 1WOFA 1UVSH 2JETC 4TPIZ 1YM0A 4WXVA 1BTHH 3ZZDA 1DX5M 1O2IA 1H9HE 3LKWA 4X6PA 5LH8A 1EZXC 3A80A 1QURH 1ZSKA 1K1OA 3RXBA 3E8LA 4XE4A 1QL7A 1Z8GA 2ZGCA 1DICA 3M3VA 5G4BA 4MPXA 4MNYA 2ZF0H 1MZAA 1WUNH 1LQDB 1TRMA 3B8JA 4NIYA 1A5IA 2AIPA 1UK4A 3B9FH 4B2BA 1SGRE 2GZ9A 5CHAC 1K21H 5EW2H 1SGDE 3UNQA 1TQ7B 4JZEH 1FY4A 4MNXA 4B74A 3A7TA 4AB9A 1B0EA 4CRGA 3OX7U 1KXEA 4Q7ZA 1GBKA 1ZJDA 4FU8A 5ABWA 5BPEA 2BLWA 1SBWA 3LOXA 5LPEA 1PQ8A 1ZPBA 2OQ5A 3VXFH 2F3CE 2TRMA 3ZZCA 1PQ5A 3HKIB 1BDAA 4A1VA 1O2QA 4D9QA 3H5CB 3URDA 2TGTA 1YCPK 4ZHLU 1SB1H 2UUYA 1MD7A 2VJ1A 3TH2H 4Y11E 4BTIB 4WWYA 3RP2A 1LKBA 3BTQE 1G2MA 3V12A 1VZQH 1AFQB 5CHAB 2G4UA 5JDUB 1F5RA 1S83A 1SI5H 1NN6A 1PPFE 4OS7A 1LMWB 2JKHA 1G3BA 1J17T 1B0FA 1YC0A 1QQUA 1W11U 4IMQA 3A88A 4D7FA 1TX8A 4TPYA 1Y5AT 4LZ1H 5DK1A 3T28A 5F6MA 4YOGA 5C1XA 2VWLA 1UVTH 2EI6A 2PKSB 5EODA 1F0UA 1O3PB 1E35B 1IHTH 3SUEA 2R3YA 2FOCA 1HIAA 3SHCH 3EDXB 1F0RA 3TVJB 3ZVCA 1N6XA 2A2XH 1UJ1A 3SNBA 2B9LA 1UTNA 1GWAA 1L4ZA 3MNXA 2FESH 1NU7B 4I8LA 4ZHAA 1LHEH 4U32A 1INCA 5AFYH 4X8TH 4AN7A 3RUOA 1EZQA 4B73A 3TGIE 4FXGH 3IWMA 1G36A 1W3CA 3STIA 1D3TB 1F5KU 6CHAB 2ZFRH 3BTWE 3ZVBA 3MO6A 2VH6A 3SQHE 4NA9H 1UCYK 1MD8A 2O8TA 1GI3A 1G9IE 1F7ZA 2G4TA 1GL0E 2PKSC 1G3DA 2ZCHP 7GCHG 1OWIA 1TGNA 1O5CB 1W13U 1P2KA 4MG3A 1IQLA 4BXSA 1BBRE 2ANKH 3ITIA 1T32A 2WPIS 3A7YA 4CHAB 3TJOA 4AYYB 5AFZH 1A3BH 1HCGA 3PO1C 3P92A 3EA7A 4CBNA 3QGNB 1PPHE 2GMTC 3CP7A 4NG9H 2Z3DA 1EJAA 3AAUA 1O2ZA 4YZUA 3FVFB 1SG8B 2A5AA 2GKVE 4OS6A 4I7YH 3F9FA 3V3MA 1SVPA 2FWWA 1TNLA 3TK6A 5FHTA 1TA6A 1ANEA 1ANDA 1YKTA 2HALA 2OUAA 4XBBA 3LGWA 5JBAS 2WUCA 1O2XA 3KQDA 1A5HA 3P95A 3GYLB 1TBRH 1SHHB 1IOEA 1YYY1 1SOZA 4NZLA 1EZUC 3ODDA 5FXLA 1MTNC 3SV8A 5GJ4B 4WMDA 3BIUH 2OXSA 2SNWA 2VWMA 4Z0KA 3KHVA 3PO1B 3GCTG 3PWCA 4BAOB 3I78A 4INKA 8KME2 1O2PA 1CHOF 1CU1A 1O31A 5F8XA 1P2QA 1XVMA 1FUJA 3TLOA 3D49H 1C2DA 2ANYA 1F2SE 1NM6A 1JMOH 1HDTH 1O2SA 1UCYH 4SGAE 1JIMA 4NA8A 1V3XA 2GDDA 3ZZ6A 1OOKB 1GDQA 1H9LB 4NCYA 3QK1A 1K1LA 2FZZA 5DO4H 2BX4A 2VIOA 5DP8A 3SU4A 1DWEH 2HNTC 4YESB 1AU8A 3MYWA 2FI4E 4XBDA 2GZ7A 1SMFE 1PPZA 1EAIA 1O5BB 2UWOA 2QA9E 1YCPM 1ZRKA 2RDLA 4I8HA 3TPIZ 2ZPQA 1BTYA 3BEFB 2GX4A 4ISLA 2Z9IA 5A09A 2QXGA 1HLTH 2OP9A 2BDHA 3PB1E 1CGJE 4I8GA 3MH5A 3MU4A 2AGEX 1C5WB 3PMAB 4GSOA 4JYTA 1MBQA 3RLYH 3SJOA 1JRTA 2A0QB 1DXPA 1V2JT 1WTGH 2ZHQH 2HRVA 1FAKH 2XCNA 3MU5A 3ESTA 2ZECA 3MFJA 1W7GH 4UEHH 3T5FH 3WY8A 5TCAA 3E16B 1U6QA 2ZHDA 1YPHE 1WSSH 1OP2A 2QXIA 2BQWB 1LQEA 1NRPH 2RCEA 1HFDA 2OC1A 3UQOA 3T26A 1NFWA 1SSXA 1ACBE 1DM4B 1QB6A 4ZMAH 1MKWK 4FUJA 1DWDH 1P10A 1DUAA 1SGIB 5BRRE 1BBRK 7ESTE 1KYNA 1G32B 5T6DA 2I6QA 1LVYA 2Y81A 1PPCE 1GPZA 2P93A 1G3CA 2XBYA 4AG1A 1G37A 1ZLRA 2ASUB 3Q3XA 1TNKA 3OY6U 1HV7A 1QB1A 1PPGE 2Y82A 4K5ZA 4BANB 3I77A 2BZ6H 4M7GA 1XUFA 3UR9A 2VIWA 4H42U 5F8TA 1S6FA 1ELAA 5FX5A 4X2XA 1H9IE 2J4IA 3RMOH 2ZTYA 4FUHA 2AFQB 1SLVB 1FIWA 2PV9B 1NTPA 2ZCKP 2P16A 3LPRA 3PV4A 2PTNA 1GJ5H 1ZHPA 1K1MA 1A4WH 2Z3CA 2P94A 4Q7YA 3Q00A 1PQAA 1T8MA 5E2PA 2Y5HA 3GY7A 3RLWH 1DPOA 1FJSA 1GBFA 1CHOG 3BN9A 2W3IA 2BQ7B 2IPHA 1KXAA 1MU6B 1BHXF 1OP0A 1L4DA 4DY7B 2AMDA 3HPTB 3U9AH 2ZHWH 1GMDG 1PYTC 4WMEA 2BDBA 5C2ZA 3RXHA 5L30H 1YPHC 1YF4A 1QIXB 3E0NB 4Y8YA 1TYNA 2A31A 1EAWA 4K8YA 1CT4E 2VINA 1BUIA 2Z9JA 2GCTB 3TJNA 3EQ0H 1FPHH 2BD5A 3MH6A 3PLKA 4Y6DA 3MTYA 4DW2U 1P01A 3SU3A 1NFUA 1YPKH 3MU1A 1E34B 5HGGA 1AFEH 1TB6H 1AB9C 1GHBG 2BTCE 3RMNH 2QC2A 3VB3A 3SGBE 1O2KA 1C1OA 3UNRA 1XUHA 1C2KA 2TPIZ 4K60A 1O2LA 1T4UH 1JBUH 3BIVH 3EE0B 1AUTC 3LC3A 2AEIH 1EPTB 1RRKA 3S0NA 1CGHA 2R2MB 1TPOA 1X7AC 1S82A 1NRRH 2NU0E 3B23B 1O34A 1AQ7A 1HAPH 4AG2A 1IQFA 4K1EA 2J34A 2V0BA 1W8BH 2BB4A 3AW0A 3KIDU 2YNAA 5DP5A 2A7HA 2XWBI 2J94A 2J9NA 3DHKH 1GJ7B 3TJVA 3FAOA 4VGCC 1AUJA 4WH8A 4D8NA 2GV6A 3VB4A 1H1BA 1BRAA 3E90B 3URCA 2P8OC 3K2UA 2XCFA 4B75A 3JZ1B 3TGJE 1AI8H 2FI3E 1C5LH 2Z9GA 3ZVEA 2QXHA 1T8LA 1LPKB 1P8VC 2YOLA 2Q6DA 2SNVA 1GHAG 2ESTE 3BTDE 1AY6H 4A7IB 1TPAE 2O8MA 1BCUH 1HUTH 4OS5A 3GDSA 4I31A 2QIQA 3A7ZA 4DGJA 1FI8A 1H8DH 4F4OC 2KAIA 1D3DB 1IQEA 1ABJH 4AFQA 1O3NA 3UWJH 4TWWA 5AF9H 3AW1A 1ARBA 1ZYOA 1HAOH 2FPZA 3Q77A 2UUFB 1P3EA 1ZJKA 4TYDA 1CT0E 3SV2H 3O8RA 1UTLM 4AFZA 4X6OA 4ESTE 2CMYA 3AAVA 1N8OB 1O5EH 2UUKB 1KTSB 4ABIA 2THFB 2NWNA 2OLGA 1EAUA 5GIBA 3T25A 4X1RU 2ANMH 3BV9B 2XNIA 2PKAA 1P2JA 3STJA 2G5VA 1F92A 5C5NA 1EB1H 2TBSA 2SGDE 1ZSJA 1GJCB 4AOQA 2OINA 1TOMH 1SGFA 1ETTH 3A81A 1KTTB 3SNEA 1BZXE 4K8BA 2FTMA 2IOTA 3PWBA 4LK4A 1V2VT 4E06H 4FU9A 2XC4A 8LPRA 3CS0A 2TIOA 1UTJA 1O30A 1Z1IA 2PSXA 3SN8A 1ZSLA 1AKSA 3W94A 1S0QA 3EA9A 1GDUA 5PTPA 4XFQA 3SZNA 3N7OA 1ELEE 1NRNH 1C2IA 1CE5A 3SW2B 2PUXB 4RKJB 4E7NA 1ZPZA 4Y76A 3S9AA 4BTTB 1V2MT 1TRYA 2FTLE 3S7KB 4OGYA 1WCZA 1C1SA 5TJXA 4HGCA 4CRBA 4QT8C 3HGNA 3KNXA 3RXRA 1BB0B 1LPZB 3K9XB 2SGAA 1V6DA 4BAKB 1O5GH 4AFUA 2OCVB 5JB8S 1K22H 1FZZA 4CREA 1UTMA 2PW8H 1QA0A 2WINI 2ZHEH 2BM2A 1GJ4H 3DD2H 1QB9A 1LVBA 4B2CA 2H9EH 1TA2A 1O3FA 4Y10E 3A8BA 1V2KT 2ZFSA 1A7SA 2CN0H 2ALVA 1N1LA 1N6YA 3O8BA 3UQVA 1C9TA 1C1MA 1O2RA 4FUCA 3E6PH 3UOUA 1C5PA 3MWIU 2QCYA 3GCOA 1ZOMA 3KQCA 3SGQE 1ELVA 1ORFA 3AASA 1HAVA 2VGCB 4UONA 3P8FA 1Y59T 1MKXK 1BTUA 3L3TA 3RXMA 2XTTB 1OX1A 1ZMNA 1GI0A 1KDQB 4CHAC 1O33A 1Z8JB 1MTVA 1VCWA 2OC0A 4J2YB 5EXNA 3ZVAA 1RTKA 4Z6AH 1UTOA 3M5NA 3OY5U 4DCDA 4LXBH 1FY8E 1SHYA 4X2YA 1GCDA 2FEQH 2VVUA 3HKJB 4Y0YE 1BJVA 4FUDA 6GCHF 1EATA 1D3QB 2XBXA 3SUGA 5HM9A 4TWYA 2P59A 3LT3A 1GBCA 5A8ZA 5C20A 1ZR0A 4GHQA 3QZQA 5HMAA 2J2UA 1A2CH 1P09A 3A8CA 2V3HH 1SGNE 3V7TA 5AHGH 5EQRA 5FX6A 1QJ6B 2BD4A 1GBAA 2Y6TA 2PTCE 1E0FD 3VFEA 1D9IA 2GT7A 2F9UA 3BG4B 1C1PA 1BHXB 1P11E 4CR5A 3GDVA 1DVAH 2F91A 4KTCA 1UTPA 3MH4A 4WY3A 1EUFA 1YPMH 1O2WA 2D8WA 2CGAA 1GJDB 2BD2A 2IN2A 1A0HB 3VB7A 3U8TH 1Q31A 3MO3A 1J9CH 4INLA 1MU8B 4CRDA 1UVOA 4PROA 1W7XH 1GVLA 2C90B 4XDEA 2ZI2H 1O2JA 1GGDC 4KELA 1RS0A 2AYWA 2RG3A 2BDYA 1TWXB 4X6MA 4CH2B 3K6ZA 5C1YA 3VB6A 2QAAA 1QCPA 2ZFTA 4GLYA 2BOKA 1CO7E 1NO9H 1IAUA 2BX3A 3SUFA 1FLEE 1SGYE 1AWFH 5DG6A 5LPRA 1OWDA 1DXWA 4ISOA 1EPTA 5GPIB 3F1SB 5EPYA 5HYOA 1IHSH 1QGFA 1VJ9U 4JCNA 1DWCH 3ZZ7A 3RXVA 3HK6B 3RDZA 1BTPA 2Q6GA 4O9VA 3KCGH 1O3IA 3ATWA 1XUKA 2TGAA 2UUJB 1Y3WA 5ESTE 1GJ6A 2VIDA 3FP6E 3NZIA 1HJ9A 1XKBC 1TE0A 1BTZA 2G51A 1Y3VA 2RA3A 5CE1A 1GI8B 5T6GA 1BTWA 1ESBA 2J38A 2W7SA 1MQ6A 3TH4H 2OQUA 5IYTA 4GVUA 3A7XA 1OSSA 1RFNA 4NFEA 4JYVH 1GI6A 4MPWA 1C2JA 3RXUA 1LHFH 3VGCC 2ULLA 1CBWB 2OD3B 2BD3A 2C8YB 1O2GH 1OWJA 3C27B 2NU2E 6LPRA 4AB8A 9ESTA 5GXPA 2ZDKA 4OGXA 3RXKA 3BTHE 1O2UA 4A5TS 4BAHB 4Y8XA 4BTUB 3AVZA 3F9EA 5E0JA 1AVXA 4I32A 1AWHB 4X6NA 2H5CA 5A2MH 3R3GB 2A4GA 5SGAE 3ZZAA 1A46H 5FPTA 5LPFA 3ATIA 3CENA 3R0FA 3MNBA 3ATLA 1H4WA 1GCTC 1FQ3A 5L6NH 3Q76A 3SUDA 1SLXB 3DA9B 3TK9A 2EEKA 1TNGA 2LNCA 3SU0A 1C5TA 3M61U 1UK3A 1HAIH 2A7JA 2XC0A 3MNCA 2QV1A 1J14A 1O2TA 1RIWC 2FYRA 1EJNA 1EPTC 1TGBA 8GCHF 4O03A 3SNDA 4OS4A 1V2LT 1AB9B 2AMPA 2TGPZ 3PLPA 5J4QA 1ZGVA 3Q3KA 1GBMA 1A5GH 1AN1E 1ELFA 1RIWB 3TK5A 1RGQA 3M3TA 2G81E 1AIXH 3UTUH 1KY9A 1EP6A 1HPGA 4HTCH 4ZROA 1OWEA 1UHBA 2BDIA 4U01A 3RXOA 4GAWA 4YOJA 3RU4T 1PFXC 4MPUA 2F9BH 2WV4A 1CSOE 3QO6A 1VGCC 1HJAB 3EA8A 2ZFPH 1GDNA 1C1VH 1Z6JH 4JMYA 5DP3A 2STBE 5FBIA 1AZ8A 2D26C 1GG6C 1CA0B 4B71A 3ZVDA 2P95A 2VGCC 8ESTE 1XXFA 2BDGA 4I33A 1XXDA 1ANCA 5EXMA 3ZZ8A 1JXPA 3F9GA 1UCYE 4MNVA 4Q80A 3VPKA 1C5VA 3SV7A 2W26A 4GPGA 1O3GA 4IN1A 2EA3A 2ZU5A 1O36A 2BYAX 4ZXYH 1QRWA 1O38A 2QF0A 5E0GA 2RA0A 5DP6A 1BA8B 4X2VA 3RXIA 5I46H 1GHBF 1J8AA 1NC6A 5DJ7A 1P12E 5F03A 1ELDE 1SQOA 5JBCS 1BT7A 1HGTH 1NZQH 3A7VA 1QL8A 3RXEA 1VITH 3QWCH 1HAGE 1O3AA 1WYKA 2XW9A 4GCHG 4Y71A 4ZKNU 1FPCH 4ZHMU 1J16A 2OC7A 5C5OA 3SU1A 3QUMP 1EASA 1TX6A 1GG6B 3RC5A 1LHDH 4NFFA 5EQSA 1TGSZ 1AGJA 2FOFA 2C8XB 3OYPA 1KLIH 3OSYA 1O35A 1TNJA 1DFPA 3LDXH 3ZZBA 2CXVA 3GYMA 3BTME 2BZAA 2FS8A 1LO6A 4JYUH 4MPVA 2PLXA 3GY6A 3SI4H 1TMUH 1LKAA 1D3PB 2WUBA 2H1UA 4AGKA 1C1TA 1MTWA 4VGCB 1O3EA 4HZHA 5FPYA 2ZZUH 1YLDA 1THRH 5GCHF 9LPRA 4MDSA 3ZZ9A 1TFXA 4FVDA 1P02A 2CJIA 3UREA 2AGGX 2HWLB 2PR3A 4NIVA 3BG4C 1ZTKA 1C4Y2 3LGUA 2Q1JA 4OS2A 3KQBA 3CS7A 4DOQA 4IGDA 1GHYH 1C5RA 1Y3UA 3ZZ5A 2Z94A 2W7UA 3PYHA 1QJ1B 1THPB 1QQ4A 1S5SA 4MTBA 1O5DH 1GJ9B 1V2ST 1SC8U 2FXRA 2ZDVH 1HJ8A 2HLCA 5C3NA 5JYIA 4U30A 1MTSA 1QA7A 3RU4D 2G52A 3SJ8A 2GD4B 3A85A 2NU3E 1WQVH 3GOVB 3RXLA 3SHAH 3SJIA 1IQJA 1V2UT 2SGFE 1ETRH 4TY7A 1P05A 3L33A 2STAE 1YPJH 4E7RG 3M5OA 3BG8A 3QDZB 2CHAC 1YBWA 4DJZB 2AIQA 3RXTA 1FAXA 2ILNA 2FLBH 2EI8A 2BY9X 3P8OA 4DIIH 4KTSA 4X0WU 2BVRH 5FCRA 1JOUB 1GMDF 2ZPRA 2PSYA 2OBQA 3K6YA 4J1YA 3IG6B 1SL3A 3A8DA 4D7GA 1SQTA 2DE8A 3T27A 1F0TA 4MLFB 4UFFH 1GI7B 1OXGA 3UOPA 1YCPH 4KTUA 1AE8H 1XM1A 5EU8A 1HAHH 1AMHA 2ZDMA 3RXDA 2Z7FE 3SV9A 3GCTF 1C5UA 5E2OA 2BDCA 3BTKE 3M7QA 2GGVB 2JH6D 2B8OH 2A4QA 3LIWA 5JPMH 2VVCA 4MNWA 1C2HA 3O8DA 3LH3A 1C2LA 3L6PA 1CT2E 1AKSB 2R3UA 3MH7A 7KMEH 2A1DB 5C1UA 4YOIA 3PROA 2QGRA 1CA0C 1E38B 1EJMA 8GCHG 2BY8X 1T7CA 2BLVA 2ZFQH 5B6OA 3MHWU 4I8KA 2FX6A 4K3JA 3U69H 2CV3A 3JZ2B 1B7XB 4IC5A 1CGIE 4NSYA 1MUEB 3BSQA 1IQMA 1LVOA 1BITA 2FP7B 1ARCA 3FZDA 1EXFA 1ZTJA 1FY5A 2J92A 1DSUA 2O8LA 2C8ZB 1P2NA 4Y7AA 6ESTA 4YT7H 4WVPE 1TPSA 4X8VH 1NS3A 4ZUHA 4CRFA 2WPJS 2ZCLP 1O37A 1EQ9A 1V2RT 4FUFA 2W5EA 3NWUA 1L1NA 1HXFH 2ZGBH 3UR6A 3G01A 1SOTA 1OS8A 5DP9A 1EZSC 1NFYA 1C5YB 5CMXH 1HB0B 1RD3B 1BIOA 1Q3XA 2WPKS 4ABAA 1TIOA 1W0YH 3DFJA 1E37B 1MMJN 4MVNA 5TCCA 3QLPH 1Z1JA 5JBTA 1TAWA 5E0HA 1WQSA 1OYTH 2HGTH 7GCHF 1UO6A 4FUIA 2ZNKH 1A61H 1K2I1 3TNSA 4ZH8A 3PTBA 2B7DH 3V0XA 4UFDH 1HYLA 4Y8ZA 1XMNB 1EB2A 1MCVA 1N8OC 1TGCA 2BQ6B 2V6NA 1GVZA 5FCKA 1KXBA 4ABDA 3BF6H 2BLQA 1C2EA 1CA8B 3LU9B 1ZMJA 2R0KA 1DUEA 1AFQC 3UFAA 1HIAB 1ELBA 1AVGH 3TJUA 4A1XA 2VWOA 4DG4A 3E3TA 5IDKA 1F0SA 5DP4A 1Y3XA 1PPBH 2IJOB 2VWNA 3BTGE 3MO9A 3C1KA 2ZP0H 3SV6A 3VGCB 3BTTE 1O3LA 5AVDA 3S9CA 1GI4A 1QJ7B 1LVMA 1V2PT 2ZC9H 1DSTA 1WTHD 3P70B 3HK3B 5EW1H 3S7HB 1KSNA 3E1XB 4BAQB 2ZGJA 1ZZZA 2GV7A 4CBOA 5GCHG 1V2OT 4KGAA 2WYJA 1ANBA 3TIUA 3GY8A 2QYIA 5GDSH 2GZ8A 2C8WB 2OTVA 4X1NU 2KAIB 3TGKE 2PFEA 1FIZA 5J4SA 2D2DA 2ZEBA 3FP7E 1GBEA 3MMGA 2C3SA 2C4FH 1TMTH 4THNH 1GJ8B 2F83A 1SGFG 1C5MD 4FUGA 1C1UH 1Z71A 2FIRH 1VCQA 1DLKB 1GHWH 2ODPA 4JZDH 3LC5A 4UE7H 2ZQ2A 4F49A 1ZRBA 2ZDLA 4XBCA 2M5TA 3NPSA 5DP7A 4UD9H 2ODQA 3A86A 2FOHA 2ZU2A 1FMGA 1GBBA 1C1QA 1K1JA 3NCLA 5EQQA 2ALPA 4KKDA 2BDAA 2ZIQH 4NSVA 4NZQA 1W2KH 1HAVB 1LPGB 3OTJE 3TH3H 2I6SA 3LONA 5FBEA 1NPMA 1O3CA 4IS5A 5EXLA 1SR5C 1VR1H 3EAJA 1P03A 2BY7X 3U1JB 5A8YA 2FOAA 2FOBA 1HBTH 3PTNA 2BD8A 3P17H 3E0PB 1ZGIA 1S0RA 1DITH 5DKMA 2FO9A 3T62A 3SOSA 2QXJA 5A0CA 1G2LA 1PQ7A 4ZXXH 4NIWA 1XKAC 2NU1E 6CHAC 1QHRB 1GI9B 2V35A 1BMLA 2H2ZA 2UWPA 2AGIX 2GVFA 2ZGXH 2GT8A 1O2YA 3GY2A 2BVXH 1Q2WA 1ZPCA 1EX3A 2EI7A 1BTXA 4XSKU 4GHTA 1ELCA 4Y0ZE 1ELTA 1KIGH 1LHCH 3RXQA 1P2MA 3DUXH 1PJPA 5E8EH 4DURA 2O8UA 2H5DA 2PGBB 5A8XA 3ZV8A 3SNAA 5EG4A 5EGMA 3BTFE 1NROH 1V2WT 1VJAU 3P6ZB 4K2YA 4RN6A 2Z3EA 3SGAE 2ZWLH 4K69A 4ABFA 4INHA 3QTOH 3GY4A 3UY9A 1C5OH 1KXFA 1PYTD 4NGAH 2W3KA 1S81A 3SI3H
chains in the Genus database with same CATH superfamily
2FODA 3H7TA 1QBNA 1G3EA 1GBTA 2FMJA 4X1PU 3M7TA 1BJUA 1H8HD 2BLOA 3LGTA 1QY6A 1A1RA 4BAMB 3A82A 1EOLA 4UFGH 2CK3D 1ABIH 3F68H 2HVXA 4I8JA 2WPLS 1AZZA 1O39A 1SGPE 5A0BA 1DY9A 1GHAF 1P06A 1GBHA 1QZ8A 1TRNA 2DUCA 3FANA 5HXFA 2AS9A 2WPHS 4RT0A 1KLJH 1GBJA 1TQ0B 1Z7KA 1C1NA 2Q6FA 1C4V2 3KGPA 6GCHG 2SGPE 4E05H 1IQNA 1DLEA 1FY1A 1T8NA 1UHBB 2BD9A 1T8OA 4A1TA 1A0JA 1VGCB 1DT2A 3TNTA 3ATKA 1C5NH 1OPHB 2ZA5A 1MTUA 3F9HA 2O9QA 4AZ2B 2XRCA 2FLRH 5ETXA 4KP0A 2R2WU 2GDEH 1AD8H 2G00A 4FUEA 3OU0A 1C5XB 1WU1A 3BEIB 3BEUA 3RU4E 4JZ1A 1C4U2 3EYDA 5ESBA 1LDTT 3GY3A 1XVOA 2V3MA 1C2FA 4X2WA 2K8IA 1SQAA 1QTFA 1ESAA 2YNBA 2R0LA 3F2GA 2OK5A 1VITF 4H6SB 4UFEH 1XUGA 3RXCA 1YPEH 1S6LA 3M37A 1OWHA 2FS9A 4YXWD 1NFXA 4JZIA 1CVWH 4NWKA 1RTFB 1W10U 4ABGA 1TNHA 1UVUH 1YGCH 1H8IH 1P3CA 3BTEE 3RXPA 4AX9H 2SGQE 2FOMB 2P3TB 3A84A 3TITA 4JK5A 3PLBA 1SPJA 1UMAH 3ZZ3A 3P8NA 2CF9H 1DOJA 3K65B 1O0DH 4AGJA 3KN2A 1SLUB 1G30B 1QFKH 2P3UB 4U2WA 2ODYB 1ZHMA 1GMCG 1OWKA 2VIVA 1NT1A 5HM2A 3TU7H 5C67A 3MI4A 7LPRA 1O3MA 1O3DA 2A5IA 5T3HA 4X1QU 1GHZA 3GCHC 2C93B 1D4PB 1O5FH 3W95A 2BXTH 1NRQH 5JBBS 1ZTLA 5T6FA 1HAXB 1TBQH 5KECA 1THSH 1UTKA 2WYGA 1W0ZU 3RXJA 1SGEE 3DFLA 1HAYB 3ZVFA 1L0ZA 2A32A 2VNTA 1TOCB 2HNTF 2VH0A 3M7UA 3D65E 1FNIA 2LP6A 1P57B 1IQKA 2WV5A 4YO9A 4R0IA 1CBWC 1DY8A 1O2OA 3LGIA 4D9RA 1MH0A 1J15A 4X8UH 3WWBA 2GP9B 5H4IB 1OYQA 1AE5A 2BXUH 1Z8IB 1UTQA 2G5NA 3A89A 1K1PA 1JRSA 4FVBA 1A0LA 1C9PA 4YM9A 3A8AA 2FYQA 3P8GA 4MQAA 2NU4E 2B5TB 4IN2A 3RMMH 2VIQA 5FPSA 3NXPA 3QN7A 1O2MA 2FI5E 1OP8A 1WV7H 2UWLA 3ZVGA 1W12U 2FM2A 4AORA 2ZKSA 1TONA 2B0FA 1T31A 2ZG0H 5DPAA 1OHHD 1PPEE 3A83A 3RC4A 3U8RH 2A7CA 5JB9S 3LJJA 3F0OA 2HPPH 3EGKH 5I25A 2PKAB 1FDPA 1DDJA 2Y7XA 4AYVB 2ZU3A 3F0PA 1O3KA 3DT0H 3FFGA 1GMHF 2Z9LA 1TX7A 2Y80A 1O2NA 1QRZA 1SGTA 4GCHF 1GBLA 1DWBH 1O2VA 4WXIA 3T29A 1YLCA 1QL9A 1TNIA 2VU8E 4LOYH 1GJBB 3FZZA 5LGOA 3M36A 1HJAC 1QR3E 2Z6BD 4IC6A 2ZFFH 1MKXH 1YP9A 2Y5GA 5T1VA 1WAYB 3D62A 1W14U 1Y5BT 3MU0A 4NWLA 2P3FH 2GMTB 3LJOA 1K1NA 3SU2A 1IQIA 1D6WA 3KL6A 2VVVA 1RTLA 3T2NA 2ZDNA 3W1EA 1EAXA 2ZTXA 3QGJA 3E91A 1NESE 4FU7A 4SGBE 3SJKA 3SQEE 1GMCF 1O3OA 4ABHA 2F9NA 4YT6H 1S6HA 2ZU4A 1MCTA 2G55A 3I29A 3VXEH 2A2QH 3QX5H 3RMLH 4WH6A 1K9OE 4ZKSU 5EJ1A 2F9VA 3GCNA 1HAZB 5GWZA 3V13A 5L2YH 1RJXB 2H9TH 3SU6A 3PMJA 5DGJA 2ZDAH 1MABB 2BY5X 3F6UH 3VEQB 4NA7A 4ABBA 4A6LA 4WF8A 2HNTE 1CHGA 1EP5A 4CH8B 1E36B 1TALA 2XBWA 4D76A 4B76A 2BVSH 4ABJA 4DIHH 1P04A 1GHXH 3GY5A 1C5QA 1GBIA 4RKOB 3U28C 2PUQH 1BMNH 1EKBB 3M35A 1UVPA 4FUBA 1ID5H 3RXFA 1FONA 4LZ4B 4HFPB 1B5GH 1ETSH 4TSFD 1FV9A 4RI0A 1KLTA 1Y8TA 2GTBA 1MAYA 2A4OA 2ZGHA 1VKYA 3SO3A 1NBME 3LGVA 1C5ZB 2IJD1 1EFRD 1YPLH 3LH1A 3U1IB 3VG8A 1FN8A 2CHAB 2LELA 3UUZA 1TGTA 1FXYA 1AVWA 1V2TT 4AC9A 5FAHA 2OBOA 3U8OH 2QY0B 3UPEA 1L1GA 1P9SA 1C1WH 4AFSA 2OC8A 4X8SH 1FY3A 3PRDA 3HATH 2XNDD 1TABE 1P2IA 4BOHA 2HPQH 1K28D 2EC9H 2D1JA 1QNJA 3FP8E 4A92A 2SFAA 3GCHB 4ZKOU 3SNCA 4RSPA 4ZKRU 2WPMS 3GDUA 1A3EH 2ZHFH 1V2NT 2XYAA 1NU9A 1IQGA 1SGCA 3ENSB 4R8TB 1SLWB 1S85A 3H7OA 1GI2A 5A0AE 5C17A 1NRSH 2BMGB 2R9PA 4WJG2 1BQYA 1YPGH 1AO5A 1T4VH 3QTVH 1DANH 3ZYDA 1Z6EA 1F5LA 3SU5A 4O97A 1UK2A 1H8ED 2JDID 2KCYA 1LCYA 2WPDD 1TLDA 3ODFA 1O3JA 3MOCA 4JZFH 4BXWA 3ZZ4A 2VIPA 1C1RA 4X1SU 2AERH 3ATMA 2QF3A 1MZDA 1LHGH 3NKKA 1MQ5A 2BY6X 1IQHA 4H6TA 2XC5A 4K1SA 1AHTH 2AMQA 4BNRA 2XWAA 1GHVH 1L1JA 1GCTB 2SGEE 1P0SH 1QBVH 1SFIA 3KF2A 2G8TA 3GISB 3LGYA 2A45B 1GL1A 1EOJA 3O8CA 4CRCA 1JIRA 2H6MA 2V3OH 3RXSA 4O3UA 1MAXA 1BBRH 2JH5D 3S69A 1HRTH 4NIXA 3A7WA 1KDQA 1VITG 2TGDA 3MNSA 1M9UA 1C2GA 1CQQA 2CF8H 2JH0D 1BOQA 1MTNB 4CR9A 4TT3D 1TMBH 3RM2H 1OKXA 3SBKA 3A87A 1DE7H 1HXEH 2FOGA 4Y79A 3WW7A 3RC6A 2A5KA 3ELAH 2H9HA 3PM3A 4ABEA 4P02A 5F8ZA 5EPNA 2GCHG 1C2MA 1D6RA 3S9BA 1BMAA 1ESTA 5L2ZH 1C5SA 4IBLH 1GI5A 3KEEA 3IITA 1KXCA 2WV9A 1ZMLA 1O32A 1NY22 1GVKB 3Q3YA 3SJ9A 2F9OA 1O3BA 3UNSA 2XXLA 2AH4X 3QZRA 1TBZH 2J95A 1RXPA 2Y7ZA 2ZPSA 2O8WA 4IMZA 1KMHB 3NUMA 4Q2KA 2ZQ1A 3RXAA 2FDAA 2W3KA 4YTAA 3M5MA 4TY6A 5KEDA 2HOBA 3AK5A 3M3SA 1GI1A 3UIRA 1HNEE 1S84A 2P8OB 3NK8A 1QRXA 3FOAA 5K7RA 2BOHB 2DE9A 4JK6A 1ELGA 4DVAU 1L2EA 2F43B 1V2QT 2PGQB 1ZHRA 3VB5A 4CRAA 1KXDA 5C94A 3UWIA 2BHGA 1MBMA 3GICB 4ISHH 4DT7B 1WXRA 3KQEA 2Y5FA 1O5AB 1O3HA 4WMFA 2A4RA 2ZU1A 4ISNA 2ZO3H 4YLUA 3MU8A 2FOEA 5EOKA 1VCPA 3HGPA 1O2HA 2ANWA 1BRBE 4IW4E 1GJAB 4B1TA 1GBDA 2JETB 1SGQE 1SFQB 1GMHG 2BD7A 2PWXA 1MKWH 1XUJA 4ASHA 2RFKC 1XX9A 4XOJA 1Y5UT 1Z8RA 1QBOA 3M5LA 4FOUC 1P9UA 4H4FA 1LTOA 4HI3A 1WBGB 4ZAEA 1Y3YA 1K1IA 1TPPA 2K1QA 2JJ1D 4K1TA 4ISIH 1BMMH 1XUIA 1BRCE 3RM0H 3SORA 1GGDB 2Z9KA 2XBVA 4O3TA 3PV2A 2GCHF 4B2AA 3PMHB 2LPRA 3F3BA 4UDWH 1FN6A 2QN5T 4Y7BA 4GUXA 4YLQH 2PHBA 1BRUP 3U98H 3ZV9A 1JWTA 4OS1A 1DS2E 4Q7XA 3PMBB 2VB0A 2FX4A 1YWUA 2GCTC 3RXGA 5K0HA 3D23A 2ZTZA 1P2OA 3ZYEA 1WOFA 1UVSH 2JETC 4TPIZ 1YM0A 4WXVA 1BTHH 3ZZDA 1DX5M 1O2IA 1H9HE 3LKWA 4X6PA 5LH8A 1EZXC 3A80A 1QURH 1ZSKA 1K1OA 3RXBA 3E8LA 4XE4A 1QL7A 1Z8GA 2ZGCA 1DICA 2EQNA 3M3VA 5G4BA 4MPXA 4MNYA 2ZF0H 1MZAA 1WUNH 1LQDB 1TRMA 3B8JA 4NIYA 1A5IA 2AIPA 1UK4A 3B9FH 4B2BA 1SGRE 2GZ9A 5CHAC 1K21H 5EW2H 1SGDE 3UNQA 1TQ7B 1COWD 4JZEH 3UAIC 1FY4A 4MNXA 4B74A 3A7TA 4AB9A 1B0EA 4CRGA 3OX7U 1KXEA 2KCAA 2QF4A 4Q7ZA 1GBKA 1BMFD 1ZJDA 4FU8A 2WSSD 5ABWA 5BPEA 2BLWA 1SBWA 3LOXA 5LPEA 1PQ8A 1ZPBA 2OQ5A 3VXFH 5C0TA 2F3CE 2KM0A 2TRMA 3ZZCA 1PQ5A 3HKIB 1BDAA 3ZIAD 4A1VA 1O2QA 4D9QA 3H5CB 3URDA 2TGTA 1YCPK 4ZHLU 1SB1H 2UUYA 5CHBA 1MD7A 2VJ1A 3TH2H 4Y11E 4BTIB 4WWYA 3RP2A 1LKBA 3BTQE 1G2MA 3V12A 1VZQH 1AFQB 5CHAB 2G4UA 5JDUB 2HLDD 1F5RA 1S83A 1E1QD 1SI5H 1NN6A 1PPFE 4OS7A 1LMWB 2JKHA 1G3BA 1J17T 1B0FA 1YC0A 1QQUA 1W11U 5KGOA 4IMQA 3A88A 4D7FA 1TX8A 4TPYA 1Y5AT 4LZ1H 5DK1A 3T28A 5F6MA 1W0JD 4YOGA 5C1XA 2VWLA 1UVTH 2EI6A 2PKSB 5EODA 1F0UA 1O3PB 1E35B 1IHTH 3SUEA 2R3YA 2FOCA 1HIAA 3SHCH 3EDXB 1F0RA 3TVJB 3ZVCA 1N6XA 2A2XH 1UJ1A 3SNBA 2B9LA 5DN6D 1UTNA 1GWAA 1L4ZA 3MNXA 2FESH 1NU7B 4I8LA 4ZHAA 1LHEH 4U32A 1INCA 5AFYH 4X8TH 4AN7A 3RUOA 1EZQA 4B73A 3TGIE 4FXGH 3IWMA 1G36A 1W3CA 3STIA 1D3TB 1F5KU 6CHAB 2ZFRH 3BTWE 3ZVBA 3MO6A 2VH6A 2QE7D 3SQHE 4NA9H 1UCYK 1MD8A 2O8TA 1GI3A 1G9IE 1F7ZA 2G4TA 1GL0E 2PKSC 1G3DA 2ZCHP 7GCHG 1OWIA 1TGNA 1O5CB 1W13U 1P2KA 4MG3A 1IQLA 4BXSA 1BBRE 2ANKH 3ITIA 1T32A 2WPIS 3A7YA 4CHAB 3TJOA 4AYYB 5AFZH 1A3BH 1HCGA 3PO1C 3P92A 3EA7A 4CBNA 3QGNB 1PPHE 2GMTC 3CP7A 4NG9H 2Z3DA 1EJAA 3AAUA 1O2ZA 4YZUA 3FVFB 1SG8B 2A5AA 2GKVE 4OS6A 4I7YH 3F9FA 3V3MA 2YMSB 4B6EA 1SVPA 2FWWA 1TNLA 3TK6A 5FHTA 1TA6A 1ANEA 1ANDA 3FN8A 1YKTA 2HALA 2OUAA 4XBBA 3LGWA 5JBAS 2WUCA 1O2XA 3KQDA 1A5HA 3P95A 3GYLB 1TBRH 1SHHB 1IOEA 1YYY1 1SOZA 4NZLA 1EZUC 3ODDA 3DCLA 5FXLA 1MTNC 3SV8A 4RT1A 5GJ4B 4WMDA 3BIUH 2OXSA 2SNWA 2VWMA 4Z0KA 3KHVA 3PO1B 3GCTG 3PWCA 4BAOB 3I78A 4INKA 8KME2 1O2PA 1CHOF 1CU1A 1O31A 5F8XA 3PRBA 1P2QA 1XVMA 1FUJA 3TLOA 3D49H 1C2DA 2ANYA 1F2SE 3UB0A 1NM6A 1JMOH 1HDTH 1O2SA 3DSPA 1UCYH 4SGAE 1JIMA 4NA8A 1V3XA 2GDDA 3ZZ6A 1OOKB 1GDQA 1H9LB 4NCYA 3QK1A 1K1LA 2FZZA 5DO4H 2BX4A 2VIOA 5DP8A 3SU4A 2YMSC 1DWEH 2HNTC 4YESB 1AU8A 3MYWA 2FI4E 4XBDA 2GZ7A 1SMFE 1PPZA 1EAIA 1O5BB 2UWOA 2QA9E 1YCPM 1ZRKA 2RDLA 4I8HA 3TPIZ 2ZPQA 1BTYA 3BEFB 2GX4A 4ISLA 2Z9IA 5A09A 2QXGA 1HLTH 2OP9A 2BDHA 3PB1E 1CGJE 4I8GA 3MH5A 3MU4A 2AGEX 1C5WB 3PMAB 4GSOA 4JYTA 1MBQA 2VBCA 3RLYH 3SJOA 1JRTA 2A0QB 2KX4A 1DXPA 1V2JT 5C0UA 1WTGH 2ZHQH 4ZCNA 2HRVA 1FAKH 2XCNA 3MU5A 3ESTA 2ZECA 3MFJA 5IK2D 1W7GH 4UEHH 3T5FH 3WY8A 5TCAA 3E16B 1U6QA 2ZHDA 5B6LA 1YPHE 1WSSH 1OP2A 2QXIA 2BQWB 1LQEA 1NRPH 2RCEA 1HFDA 2OC1A 3UQOA 3T26A 1NFWA 1SSXA 1ACBE 1DM4B 1QB6A 4ZMAH 1MKWK 3KYGA 3GS9A 4FUJA 1DWDH 1NBMD 1P10A 4XRNA 1DUAA 1SGIB 5BRRE 1BBRK 7ESTE 1KYNA 1G32B 5T6DA 2I6QA 1LVYA 2Y81A 1PPCE 1GPZA 2P93A 1G3CA 2XBYA 4AG1A 1G37A 1ZLRA 2ASUB 3Q3XA 1TNKA 3OY6U 1HV7A 1QB1A 1PPGE 1YY3A 2Y82A 4K5ZA 4BANB 3I77A 2BZ6H 4M7GA 1XUFA 3UR9A 2VIWA 4H42U 5F8TA 1S6FA 1ELAA 2PP6A 5FX5A 4X2XA 1H9IE 2J4IA 3RMOH 2J98A 2ZTYA 4FUHA 2AFQB 1SLVB 1FIWA 2PV9B 1NTPA 2ZCKP 2P16A 3LPRA 3PV4A 2PTNA 1GJ5H 1ZHPA 1K1MA 1A4WH 2Z3CA 2P94A 4Q7YA 3Q00A 1PQAA 1T8MA 5E2PA 2Y5HA 3GY7A 3RLWH 3KQ5A 1DPOA 1FJSA 1GBFA 1CHOG 3BN9A 2W3IA 2BQ7B 2IPHA 1KXAA 1MU6B 1BHXF 1OP0A 1L4DA 4DY7B 2AMDA 3HPTB 3U9AH 2ZHWH 1GMDG 1PYTC 4WMEA 2BDBA 5C2ZA 3RXHA 2RDEA 5L30H 1YPHC 1YF4A 1QIXB 3E0NB 4Y8YA 1TYNA 2A31A 1EAWA 4K8YA 1CT4E 2VINA 1BUIA 2Z9JA 2GCTB 3TJNA 3EQ0H 1FPHH 2BD5A 3MH6A 3PLKA 4Y6DA 3MTYA 4DW2U 1P01A 3SU3A 1NFUA 1YPKH 3MU1A 1E34B 5HGGA 1AFEH 1TB6H 1AB9C 1GHBG 2BTCE 3RMNH 2QC2A 3VB3A 4F48B 3SGBE 1O2KA 1C1OA 3UNRA 1XUHA 1C2KA 2TPIZ 4K60A 1O2LA 1T4UH 1JBUH 3BIVH 3EE0B 1AUTC 3LC3A 2AEIH 1EPTB 1RRKA 3S0NA 1CGHA 2R2MB 1TPOA 1X7AC 2W6JD 1S82A 1NRRH 2NU0E 3B23B 2JJ2D 1O34A 1AQ7A 1HAPH 4AG2A 1IQFA 4K1EA 2J34A 2V0BA 1W8BH 2BB4A 3AW0A 3KIDU 2YNAA 5DP5A 2A7HA 2XWBI 2J94A 5HIZA 2J9NA 3DHKH 1GJ7B 3SZEA 3TJVA 3FAOA 4VGCC 1AUJA 4WH8A 4D8NA 2GV6A 3VB4A 1H1BA 1BRAA 3E90B 3URCA 3DSOA 2P8OC 3K2UA 2XCFA 4B75A 3JZ1B 3TGJE 1AI8H 2FI3E 1C5LH 2Z9GA 3ZVEA 2QXHA 1T8LA 1LPKB 1P8VC 2YOLA 2Q6DA 2SNVA 1GHAG 2ESTE 3BTDE 1AY6H 4A7IB 1TPAE 2O8MA 1BCUH 1HUTH 4OS5A 3GDSA 4I31A 2J5UA 2QIQA 3A7ZA 4DGJA 1FI8A 1H8DH 4F4OC 2KAIA 1D3DB 1IQEA 1ABJH 2IPQX 4AFQA 5EJLA 1O3NA 3UWJH 4TWWA 5AF9H 5EJZA 3AW1A 1ARBA 1ZYOA 1HAOH 2FPZA 2GJGA 3Q77A 2UUFB 4HG6A 1P3EA 1ZJKA 4TYDA 1CT0E 3SV2H 3O8RA 1UTLM 4AFZA 4X6OA 4ESTE 2CMYA 3AAVA 1N8OB 1O5EH 2UUKB 1KTSB 4ABIA 2THFB 2NWNA 2OLGA 1EAUA 5GIBA 3T25A 4X1RU 2ANMH 3BV9B 2XNIA 2PKAA 1P2JA 5CDFE 3STJA 2G5VA 1F92A 5C5NA 1EB1H 2TBSA 2SGDE 1ZSJA 1GJCB 4AOQA 2OINA 1TOMH 1SGFA 1ETTH 3A81A 1KTTB 3SNEA 1BZXE 4K8BA 2FTMA 2IOTA 3PWBA 2YMSD 4LK4A 1V2VT 4E06H 4FU9A 2XC4A 8LPRA 3CS0A 2TIOA 1UTJA 1O30A 1Z1IA 2KFWA 2PSXA 3SN8A 1ZSLA 1AKSA 3W94A 1S0QA 3NRLA 3EA9A 1GDUA 5PTPA 4XFQA 3SZNA 3N7OA 1ELEE 1NRNH 1C2IA 1CE5A 3SW2B 2PUXB 4RKJB 2HVYB 4E7NA 1ZPZA 4Y76A 3S9AA 4BTTB 1V2MT 1TRYA 2FTLE 3S7KB 4OGYA 1WCZA 1C1SA 5TJXA 4HGCA 4CRBA 4QT8C 3HGNA 3KNXA 3RXRA 1SQRA 1BB0B 1LPZB 2JIZD 3K9XB 2SGAA 1V6DA 4BAKB 1O5GH 4AFUA 2OCVB 5JB8S 1K22H 1FZZA 4CREA 1UTMA 2PW8H 1QA0A 2WINI 2ZHEH 2BM2A 1GJ4H 3DD2H 1QB9A 3OEHD 3H09A 1LVBA 4B2CA 2H9EH 1TA2A 1O3FA 4Y10E 3A8BA 1V2KT 2ZFSA 1A7SA 2CN0H 2ALVA 1N1LA 1N6YA 3O8BA 3UQVA 1C9TA 1C1MA 1O2RA 4FUCA 3E6PH 3UOUA 1C5PA 3MWIU 2QCYA 3GCOA 1ZOMA 1W0KD 3KQCA 3SGQE 1ELVA 1ORFA 3AASA 1HAVA 2VGCB 4UONA 3P8FA 3OTPA 2J97A 1Y59T 1MKXK 1BTUA 3L3TA 3RXMA 2XTTB 1OX1A 1ZMNA 1GI0A 1KDQB 4CHAC 1O33A 1Z8JB 1MTVA 1VCWA 2OC0A 4J2YB 5EXNA 3ZVAA 1RTKA 4Z6AH 1UTOA 2KR7A 3M5NA 3OY5U 4DCDA 4LXBH 1FY8E 1SHYA 4X2YA 1GCDA 2FEQH 2VVUA 3HKJB 2AHME 4Y0YE 1BJVA 4FUDA 6GCHF 1EATA 1D3QB 2XBXA 3SUGA 5HM9A 4TWYA 2P59A 3LT3A 1GBCA 5A8ZA 5C20A 1E79D 1ZR0A 4GHQA 3QZQA 5HMAA 2J2UA 1A2CH 1P09A 3A8CA 2WHXA 2V3HH 1SGNE 3V7TA 5AHGH 5EQRA 5FX6A 1QJ6B 2BD4A 1WDIA 1GBAA 2Y6TA 2PTCE 1E0FD 3VFEA 1D9IA 2GT7A 2F9UA 3BG4B 1C1PA 1BHXB 1P11E 4CR5A 3GDVA 1DVAH 2F91A 4KTCA 4XD7D 1UTPA 3MH4A 4WY3A 1EUFA 1YPMH 1O2WA 2D8WA 2CGAA 1GJDB 2BD2A 2IN2A 1A0HB 3VB7A 2W6ID 3EE7A 3U8TH 1Q31A 4Q4LA 3MO3A 1J9CH 4INLA 1MU8B 4CRDA 1UVOA 4PROA 1W7XH 1GVLA 2C90B 3KYFA 4XDEA 2ZI2H 1O2JA 1GGDC 4KELA 3N7EA 1RS0A 2AYWA 4DT4A 2RG3A 2BDYA 1TWXB 4X6MA 4CH2B 3K6ZA 2KCPA 5C1YA 3VB6A 2QAAA 1QCPA 2ZFTA 4GLYA 2BOKA 1CO7E 1NO9H 5GNDA 1IAUA 2BX3A 3SUFA 1FLEE 1SGYE 1AWFH 5DG6A 5DSFA 1OWDA 5LPRA 1DXWA 4ISOA 1EPTA 1YLNA 5GPIB 3F1SB 5EPYA 5HYOA 1IHSH 1QGFA 1VJ9U 4JCNA 1DWCH 3ZZ7A 3RXVA 4M9FA 3HK6B 3RDZA 1BTPA 2Q6GA 4O9VA 3KCGH 1O3IA 3ATWA 1XUKA 2TGAA 2UUJB 1Y3WA 5ESTE 1GJ6A 2VIDA 3FP6E 3NZIA 3MQKC 1HJ9A 1XKBC 1TE0A 1BTZA 2G51A 1Y3VA 2V7QD 2RA3A 5CE1A 1GI8B 5T6GA 1BTWA 1ESBA 2J38A 2W7SA 1MQ6A 3TH4H 2OQUA 5IYTA 4GVUA 3A7XA 1OSSA 1RFNA 4NFEA 4JYVH 1GI6A 4MPWA 1C2JA 3RXUA 1LHFH 3VGCC 2ULLA 1CBWB 2OD3B 5EIYA 2BD3A 2C8YB 1O2GH 1OWJA 3C27B 2NU2E 6LPRA 4AB8A 9ESTA 5GXPA 2ZDKA 4OGXA 3RXKA 3BTHE 1O2UA 4A5TS 4BAHB 4Y8XA 4BTUB 3AVZA 3F9EA 5E0JA 1AVXA 4I32A 1AWHB 4X6NA 2H5CA 5A2MH 3R3GB 2A4GA 5SGAE 3ZZAA 1A46H 5FPTA 5LPFA 3ATIA 3CENA 3R0FA 3MNBA 3ATLA 1H4WA 1GCTC 1FQ3A 5L6NH 3Q76A 3FO8D 3SUDA 4Q63A 1SLXB 3DA9B 3TK9A 2EEKA 1TNGA 2LNCA 3DSGA 3CNRA 3SU0A 1C5TA 3M61U 1UK3A 1HAIH 2A7JA 2XC0A 3MNCA 2QV1A 1J14A 1O2TA 1RIWC 2FYRA 1EJNA 1EPTC 1TGBA 8GCHF 4O03A 3SNDA 4OS4A 1V2LT 1AB9B 2AMPA 5HIYA 2TGPZ 3PLPA 5J4QA 1ZGVA 3Q3KA 1GBMA 1E1RD 1A5GH 1AN1E 1ELFA 1RIWB 3TK5A 1RGQA 3M3TA 2G81E 1AIXH 3UTUH 1KY9A 1EP6A 1HPGA 4HTCH 4ZROA 1OWEA 1UHBA 2BDIA 4U01A 3RXOA 4GAWA 4YOJA 3RU4T 1PFXC 4MPUA 2F9BH 2WV4A 1CSOE 3QO6A 1VGCC 1HJAB 3EA8A 2ZFPH 1GDNA 1C1VH 1Z6JH 4JMYA 5DP3A 2STBE 5FBIA 1AZ8A 2D26C 1GG6C 1CA0B 4B71A 4I86A 2P95A 3ZVDA 2VGCC 8ESTE 1XXFA 2BDGA 4I33A 1XXDA 5FL7D 1ANCA 5EXMA 3ZZ8A 1JXPA 3F9GA 1UCYE 4MNVA 4Q80A 3VPKA 1C5VA 3SV7A 2W26A 4GPGA 1O3GA 3F2FA 4IN1A 2EA3A 2ZU5A 1O36A 2BYAX 4ZXYH 1QRWA 1O38A 2QF0A 5E0GA 2RA0A 5DP6A 1BA8B 4X2VA 3RXIA 5I46H 1GHBF 1J8AA 1NC6A 5DJ7A 1P12E 5F03A 1ELDE 1SQOA 5JBCS 1BT7A 1HGTH 1NZQH 3A7VA 1QL8A 3RXEA 1VITH 3QWCH 1HAGE 4ASUD 1O3AA 1WYKA 2XW9A 4GCHG 4Y71A 4ZKNU 1FPCH 4ZHMU 1J16A 2OC7A 5C5OA 3SU1A 3QUMP 1EASA 1TX6A 1GG6B 3RC5A 1LHDH 4NFFA 5EQSA 1TGSZ 1AGJA 2FOFA 2C8XB 3OYPA 1KLIH 3OSYA 1O35A 1TNJA 1DFPA 2KCOA 3LDXH 3ZZBA 2CXVA 3GYMA 3BTME 2BZAA 2FS8A 1LO6A 4JYUH 4MPVA 2PLXA 3GY6A 3SI4H 3WWFA 1TMUH 1LKAA 1D3PB 2WUBA 2H1UA 4AGKA 1C1TA 1MTWA 4VGCB 1O3EA 4HZHA 5FPYA 2ZZUH 1YLDA 1THRH 5GCHF 9LPRA 4MDSA 3ZZ9A 1TFXA 4FVDA 1P02A 2CJIA 3UREA 2AGGX 2HWLB 2PR3A 4NIVA 3BG4C 1ZTKA 1C4Y2 3LGUA 2Q1JA 4OS2A 3KQBA 3CS7A 4DOQA 4IGDA 3F2HA 1GHYH 1C5RA 1Y3UA 3ZZ5A 2Z94A 2W7UA 3PYHA 1QJ1B 1THPB 1QQ4A 1S5SA 4MTBA 1O5DH 1GJ9B 1V2ST 1SC8U 2FXRA 2QF5A 2ZDVH 1HJ8A 2HLCA 5C3NA 5JYIA 4U30A 3OAAD 1MTSA 1QA7A 3RU4D 2G52A 3SJ8A 2GD4B 3A85A 2NU3E 1WQVH 3GOVB 3RXLA 3SHAH 3SJIA 1IQJA 1V2UT 2SGFE 1ETRH 4TY7A 1P05A 3L33A 2STAE 1YPJH 4E7RG 3M5OA 3BG8A 3QDZB 2CHAC 1YBWA 4DJZB 2AIQA 3RXTA 1FAXA 2ILNA 2FLBH 2EI8A 2BY9X 3P8OA 4DIIH 4KTSA 4X0WU 2BVRH 5FCRA 1JOUB 1GMDF 2ZPRA 2PSYA 2OBQA 3K6YA 4J1YA 3IG6B 1SL3A 3A8DA 4D7GA 1SQTA 2DE8A 3T27A 2K0QA 1F0TA 4MLFB 4UFFH 1GI7B 2M2AA 1OXGA 3UOPA 1YCPH 4KTUA 2WZQA 1AE8H 1XM1A 5EU8A 1HAHH 1AMHA 2ZDMA 3RXDA 2Z7FE 3SV9A 3GCTF 1C5UA 5E2OA 2BDCA 3BTKE 3M7QA 2GGVB 2JH6D 2B8OH 2A4QA 3LIWA 5JPMH 2VVCA 4MNWA 1C2HA 3O8DA 3LH3A 1C2LA 3L6PA 1CT2E 1AKSB 2R3UA 3MH7A 7KMEH 2A1DB 5C1UA 3N99A 4YOIA 2XOKD 4ACAA 3PROA 2QGRA 1CA0C 1E38B 1EJMA 3FKSD 8GCHG 2BY8X 1T7CA 2BLVA 2ZFQH 5B6OA 3MHWU 1SKYE 4I8KA 2FX6A 4K3JA 3U69H 2CV3A 3JZ2B 1B7XB 4IC5A 1CGIE 4NSYA 1MUEB 3BSQA 1IQMA 1LVOA 1BITA 2FP7B 1ARCA 3FZDA 4F55A 1EXFA 1ZTJA 1FY5A 2J92A 4B6FA 1DSUA 2O8LA 2C8ZB 1P2NA 4Y7AA 6ESTA 4YT7H 4WVPE 1TPSA 4X8VH 1NS3A 4ZUHA 4CRFA 2WPJS 2ZCLP 1O37A 1EQ9A 1V2RT 4FUFA 2W5EA 3NWUA 1L1NA 1HXFH 2ZGBH 3UR6A 4OM9A 3G01A 1SOTA 1OS8A 5DP9A 1EZSC 1NFYA 1C5YB 2F4LA 1HB0B 1RD3B 5CMXH 1BIOA 1Q3XA 2WPKS 4ABAA 1TIOA 1W0YH 3DFJA 1E37B 1MMJN 4MVNA 5TCCA 3QLPH 1Z1JA 5JBTA 1TAWA 5E0HA 1WQSA 1OYTH 2HGTH 7GCHF 1UO6A 4FUIA 2ZNKH 1A61H 1K2I1 3TNSA 2L6OA 3PTBA 4ZH8A 2B7DH 3V0XA 4UFDH 1HYLA 4Y8ZA 1XMNB 1EB2A 1MCVA 1N8OC 1TGCA 2BQ6B 2V6NA 1GVZA 5FCKA 1KXBA 4ABDA 3BF6H 2BLQA 1C2EA 1CA8B 3LU9B 1ZMJA 2R0KA 1DUEA 1AFQC 3UFAA 1HIAB 1ELBA 1AVGH 3TJUA 4A1XA 2VWOA 4DG4A 3E3TA 5IDKA 1F0SA 5DP4A 1Y3XA 1PPBH 3PV5A 2IJOB 5HKKD 2VWNA 3BTGE 3MO9A 3C1KA 2ZP0H 3SV6A 3VGCB 3BTTE 1O3LA 2KZ4A 5AVDA 3S9CA 1GI4A 1QJ7B 1LVMA 1V2PT 2ZC9H 1DSTA 1WTHD 3P70B 3HK3B 5EW1H 3S7HB 1KSNA 3E1XB 3OE7D 4BAQB 2ZGJA 1ZZZA 2GV7A 4CBOA 5GCHG 1V2OT 4KGAA 2WYJA 1ANBA 3TIUA 3GY8A 4P00A 3SYJA 2QYIA 5GDSH 2GZ8A 1K0HA 2C8WB 2OTVA 4X1NU 5F53A 2KAIB 3TGKE 2PFEA 1FIZA 5J4SA 2D2DA 2ZEBA 3FP7E 1GBEA 3MMGA 1FX0B 2C3SA 2C4FH 1TMTH 4THNH 1GJ8B 2F83A 1SGFG 1C5MD 4FUGA 1C1UH 1Z71A 2FIRH 1VCQA 1DLKB 1GHWH 2ODPA 2EY4C 4JZDH 3LC5A 4UE7H 2J98B 2ZQ2A 4F49A 1ZRBA 2ZDLA 4XBCA 2M5TA 3NPSA 5DP7A 4UD9H 2ODQA 3A86A 2FOHA 2ZU2A 1FMGA 1GBBA 1C1QA 1K1JA 3NCLA 4FETA 5EQQA 2ALPA 4KKDA 2BDAA 2ZIQH 4NSVA 4NZQA 1W2KH 1HAVB 1LPGB 3OTJE 3TH3H 2I6SA 3LONA 5FBEA 1NPMA 1O3CA 4IS5A 5EXLA 1SR5C 1VR1H 3EAJA 1P03A 2BY7X 3U1JB 2L74A 5A8YA 2FOAA 2FOBA 1HBTH 3PTNA 2BD8A 3P17H 3E0PB 1ZGIA 1S0RA 1DITH 5DKMA 2FO9A 3N7DA 3T62A 3SOSA 2QXJA 5A0CA 1G2LA 1PQ7A 4ZXXH 4NIWA 1XKAC 2NU1E 6CHAC 1QHRB 1GI9B 2V35A 1BMLA 2H2ZA 4ACBA 2UWPA 2AGIX 2GVFA 2ZGXH 2GT8A 1O2YA 3GY2A 1UW7A 2BVXH 1Q2WA 1ZPCA 1EX3A 2EI7A 1BTXA 4XSKU 4GHTA 1ELCA 4Y0ZE 1ELTA 1KIGH 1LHCH 3RXQA 1P2MA 3DUXH 1PJPA 5E8EH 4DURA 3OFND 2O8UA 2H5DA 2PGBB 5A8XA 3ZV8A 3SNAA 5EG4A 5EGMA 3BTFE 1NROH 1V2WT 1VJAU 3P6ZB 4K2YA 4RN6A 2Z3EA 3SGAE 2ZWLH 4K69A 4Z1MD 4ABFA 4INHA 3QTOH 3GY4A 3OEED 3UY9A 1C5OH 1KXFA 1PYTD 4NGAH 2F9PA 1S81A 3SI3H
chains in the Genus database with same CATH topology
2FODA 3H7TA 1QBNA 1G3EA 1GBTA 2FMJA 4X1PU 3M7TA 1BJUA 2BLOA 3LGTA 1QY6A 1A1RA 4BAMB 3A82A 1EOLA 4UFGH 1ABIH 3F68H 2HVXA 4I8JA 2WPLS 1AZZA 1O39A 1SGPE 5A0BA 1DY9A 1GHAF 1P06A 1GBHA 1TRNA 2DUCA 3FANA 5HXFA 2AS9A 2WPHS 1KLJH 1GBJA 1TQ0B 1Z7KA 1C1NA 2Q6FA 1C4V2 3KGPA 6GCHG 2SGPE 4E05H 1IQNA 1DLEA 1FY1A 1T8NA 1UHBB 2BD9A 1T8OA 4A1TA 1A0JA 1VGCB 1DT2A 3TNTA 3ATKA 1C5NH 1OPHB 2ZA5A 1MTUA 3F9HA 2O9QA 4AZ2B 2XRCA 2FLRH 5ETXA 4KP0A 2R2WU 2GDEH 1AD8H 2G00A 4FUEA 3OU0A 1C5XB 1WU1A 3BEIB 3BEUA 3RU4E 4JZ1A 1C4U2 3EYDA 5ESBA 1LDTT 3GY3A 1XVOA 1C2FA 4X2WA 1SQAA 1QTFA 1ESAA 2YNBA 2R0LA 1VITF 4H6SB 4UFEH 1XUGA 3RXCA 1YPEH 3M37A 1OWHA 2FS9A 1NFXA 4JZIA 1CVWH 4NWKA 1RTFB 1W10U 4ABGA 1TNHA 1UVUH 1YGCH 1H8IH 1P3CA 3BTEE 3RXPA 4AX9H 2SGQE 2FOMB 2P3TB 3A84A 3TITA 4JK5A 3PLBA 1SPJA 1UMAH 3ZZ3A 3P8NA 2CF9H 1DOJA 3K65B 1O0DH 4AGJA 3KN2A 1SLUB 1G30B 1QFKH 2P3UB 4U2WA 2ODYB 1ZHMA 1GMCG 1OWKA 2VIVA 1NT1A 5HM2A 3TU7H 5C67A 3MI4A 7LPRA 1O3MA 1O3DA 2A5IA 5T3HA 4X1QU 1GHZA 3GCHC 2C93B 1D4PB 1O5FH 3W95A 2BXTH 1NRQH 5JBBS 1ZTLA 5T6FA 1HAXB 1TBQH 1THSH 1UTKA 2WYGA 1W0ZU 3RXJA 1SGEE 3DFLA 1HAYB 3ZVFA 1L0ZA 2A32A 2VNTA 1TOCB 2HNTF 2VH0A 3M7UA 3D65E 1FNIA 1P57B 1IQKA 2WV5A 4YO9A 4R0IA 1CBWC 1DY8A 1O2OA 3LGIA 4D9RA 1MH0A 1J15A 4X8UH 2GP9B 5H4IB 1OYQA 1AE5A 2BXUH 1Z8IB 1UTQA 2G5NA 3A89A 1K1PA 1JRSA 4FVBA 1A0LA 1C9PA 4YM9A 3A8AA 2FYQA 3P8GA 4MQAA 2NU4E 2B5TB 4IN2A 3RMMH 2VIQA 5FPSA 3NXPA 3QN7A 1O2MA 2FI5E 2F9PA 1OP8A 1WV7H 2UWLA 3ZVGA 1W12U 2FM2A 4AORA 2ZKSA 1TONA 2B0FA 1T31A 2ZG0H 5DPAA 3RC4A 1PPEE 3A83A 3U8RH 2A7CA 5JB9S 3LJJA 2HPPH 3EGKH 5I25A 2PKAB 1FDPA 1DDJA 2Y7XA 4AYVB 2ZU3A 1O3KA 3DT0H 3FFGA 1GMHF 2Z9LA 1TX7A 2Y80A 1O2NA 1QRZA 1SGTA 4GCHF 1GBLA 1DWBH 1O2VA 4WXIA 3T29A 1YLCA 1QL9A 1TNIA 2VU8E 4LOYH 1GJBB 3FZZA 5LGOA 3M36A 1HJAC 1QR3E 2Z6BD 4IC6A 2ZFFH 1MKXH 1YP9A 2Y5GA 1WAYB 3D62A 1W14U 1Y5BT 3MU0A 4NWLA 2P3FH 2GMTB 3LJOA 1K1NA 3SU2A 1IQIA 1D6WA 3KL6A 2VVVA 1RTLA 3T2NA 2ZDNA 1EAXA 2ZTXA 3QGJA 3E91A 1NESE 4FU7A 4SGBE 3SJKA 3SQEE 1GMCF 1O3OA 4ABHA 2F9NA 4YT6H 1S6HA 2ZU4A 1MCTA 2G55A 3I29A 3VXEH 2A2QH 3QX5H 3RMLH 4WH6A 1K9OE 4ZKSU 2F9VA 3GCNA 1HAZB 5GWZA 3V13A 5L2YH 1RJXB 2H9TH 3SU6A 3PMJA 5DGJA 2ZDAH 2BY5X 3F6UH 3VEQB 4NA7A 4ABBA 4A6LA 4WF8A 2HNTE 1CHGA 1EP5A 4CH8B 1E36B 1TALA 2XBWA 4D76A 4B76A 2BVSH 4ABJA 4DIHH 1P04A 1GHXH 3GY5A 1C5QA 1GBIA 4RKOB 2PUQH 1BMNH 1EKBB 3M35A 1UVPA 4FUBA 1ID5H 3RXFA 1FONA 4LZ4B 4HFPB 1B5GH 1ETSH 1FV9A 1KLTA 1Y8TA 2GTBA 1MAYA 2A4OA 2ZGHA 3SO3A 3LGVA 1C5ZB 1YPLH 3LH1A 3U1IB 1FN8A 2CHAB 3UUZA 1TGTA 1FXYA 1AVWA 1V2TT 5FAHA 2OBOA 3U8OH 2QY0B 3UPEA 1L1GA 1P9SA 1C1WH 4AFSA 2OC8A 4X8SH 1FY3A 3HATH 1TABE 1P2IA 4BOHA 2HPQH 1K28D 2EC9H 2D1JA 1QNJA 3FP8E 4A92A 2SFAA 3GCHB 4ZKOU 3SNCA 4RSPA 4ZKRU 2WPMS 3GDUA 1A3EH 2ZHFH 1V2NT 2XYAA 1NU9A 1IQGA 1SGCA 3ENSB 4R8TB 1SLWB 1S85A 3H7OA 1GI2A 5A0AE 1NRSH 2BMGB 2R9PA 4WJG2 1BQYA 1YPGH 1AO5A 1T4VH 3QTVH 1DANH 3ZYDA 1Z6EA 1F5LA 3SU5A 4O97A 1UK2A 1LCYA 1TLDA 3ODFA 1O3JA 3MOCA 4JZFH 4BXWA 3ZZ4A 2VIPA 1C1RA 4X1SU 2AERH 3ATMA 2QF3A 1MZDA 1LHGH 3NKKA 1MQ5A 2BY6X 1IQHA 4H6TA 2XC5A 4K1SA 1AHTH 2AMQA 4BNRA 2XWAA 1GHVH 1L1JA 1GCTB 2SGEE 1P0SH 1QBVH 1SFIA 3KF2A 2G8TA 3GISB 3LGYA 2A45B 1GL1A 1EOJA 3O8CA 4CRCA 1JIRA 2H6MA 2V3OH 3RXSA 4O3UA 1MAXA 1BBRH 2JH5D 3S69A 1HRTH 4NIXA 3A7WA 1KDQA 1VITG 2TGDA 3MNSA 1M9UA 1C2GA 1CQQA 2CF8H 2JH0D 1BOQA 1MTNB 4CR9A 1TMBH 3RM2H 1OKXA 3SBKA 3A87A 1DE7H 1HXEH 2FOGA 4Y79A 3RC6A 2A5KA 3ELAH 2H9HA 3PM3A 4ABEA 5F8ZA 5EPNA 2GCHG 1C2MA 1D6RA 3S9BA 1BMAA 1ESTA 5L2ZH 1C5SA 4IBLH 1GI5A 3KEEA 3IITA 1KXCA 1ZMLA 1O32A 1NY22 1GVKB 3Q3YA 3SJ9A 2F9OA 1O3BA 3UNSA 2XXLA 2AH4X 3QZRA 1TBZH 2J95A 1RXPA 2Y7ZA 2ZPSA 2O8WA 4IMZA 3NUMA 4Q2KA 2ZQ1A 3RXAA 2FDAA 4YTAA 3M5MA 4TY6A 2HOBA 3M3SA 1GI1A 3UIRA 1HNEE 1S84A 2P8OB 3NK8A 1QRXA 5K7RA 2BOHB 2DE9A 4JK6A 1ELGA 4DVAU 1L2EA 1V2QT 2PGQB 1ZHRA 3VB5A 4CRAA 1KXDA 3UWIA 2BHGA 1MBMA 3GICB 4ISHH 4DT7B 3KQEA 2Y5FA 1O5AB 1O3HA 4WMFA 2A4RA 2ZU1A 4ISNA 2ZO3H 4YLUA 3MU8A 2FOEA 5EOKA 1VCPA 3HGPA 1O2HA 2ANWA 1BRBE 4IW4E 1GJAB 4B1TA 1GBDA 2JETB 1SGQE 1SFQB 1GMHG 2BD7A 2PWXA 1MKWH 1XUJA 4ASHA 1XX9A 4XOJA 1Y5UT 1Z8RA 1QBOA 3M5LA 1P9UA 4H4FA 1LTOA 4HI3A 1WBGB 4ZAEA 1Y3YA 1K1IA 1TPPA 2K1QA 4K1TA 4ISIH 1BMMH 1XUIA 1BRCE 3RM0H 3SORA 1GGDB 2Z9KA 2XBVA 4O3TA 2GCHF 4B2AA 3PMHB 2LPRA 4UDWH 1FN6A 2QN5T 4Y7BA 4GUXA 4YLQH 2PHBA 1BRUP 3U98H 3ZV9A 1JWTA 4OS1A 1DS2E 4Q7XA 3PMBB 2VB0A 2FX4A 3RXGA 2GCTC 5K0HA 3D23A 2ZTZA 1P2OA 3ZYEA 1WOFA 1UVSH 2JETC 4TPIZ 1YM0A 4WXVA 1BTHH 3ZZDA 1DX5M 1O2IA 1H9HE 3LKWA 4X6PA 5LH8A 1EZXC 3A80A 1QURH 1ZSKA 1K1OA 3RXBA 3E8LA 4XE4A 1QL7A 1Z8GA 2ZGCA 1DICA 3M3VA 5G4BA 4MPXA 4MNYA 2ZF0H 1MZAA 1WUNH 1LQDB 1TRMA 3B8JA 4NIYA 1A5IA 2AIPA 1UK4A 3B9FH 4B2BA 1SGRE 2GZ9A 5CHAC 1K21H 5EW2H 1SGDE 3UNQA 1TQ7B 4JZEH 1FY4A 4MNXA 4B74A 3A7TA 4AB9A 1B0EA 4CRGA 3OX7U 1KXEA 4Q7ZA 1GBKA 1ZJDA 4FU8A 5ABWA 5BPEA 2BLWA 1SBWA 3LOXA 5LPEA 1PQ8A 1ZPBA 2OQ5A 3VXFH 2F3CE 2TRMA 3ZZCA 1PQ5A 3HKIB 1BDAA 4A1VA 1O2QA 4D9QA 3H5CB 3URDA 2TGTA 1YCPK 4ZHLU 1SB1H 2UUYA 1MD7A 2VJ1A 3TH2H 4Y11E 4BTIB 4WWYA 3RP2A 1LKBA 3BTQE 1G2MA 3V12A 1VZQH 1AFQB 5CHAB 2G4UA 5JDUB 1F5RA 1S83A 1SI5H 1NN6A 1PPFE 4OS7A 1LMWB 2JKHA 1G3BA 1J17T 1B0FA 1YC0A 1QQUA 1W11U 4IMQA 3A88A 4D7FA 1TX8A 4TPYA 1Y5AT 4LZ1H 5DK1A 3T28A 5F6MA 4YOGA 5C1XA 2VWLA 1UVTH 2EI6A 2PKSB 5EODA 1F0UA 1O3PB 1E35B 1IHTH 3SUEA 2R3YA 2FOCA 1HIAA 3SHCH 3EDXB 1F0RA 3TVJB 3ZVCA 1N6XA 2A2XH 1UJ1A 3SNBA 2B9LA 1UTNA 1GWAA 1L4ZA 3MNXA 2FESH 1NU7B 4I8LA 4ZHAA 1LHEH 4U32A 1INCA 5AFYH 4X8TH 4AN7A 3RUOA 1EZQA 4B73A 3TGIE 4FXGH 3IWMA 1G36A 1W3CA 3STIA 1D3TB 1F5KU 6CHAB 2ZFRH 3BTWE 3ZVBA 3MO6A 2VH6A 3SQHE 4NA9H 1UCYK 1MD8A 2O8TA 1GI3A 1G9IE 1F7ZA 2G4TA 1GL0E 2PKSC 1G3DA 2ZCHP 7GCHG 1OWIA 1TGNA 1O5CB 1W13U 1P2KA 4MG3A 1IQLA 4BXSA 1BBRE 2ANKH 3ITIA 1T32A 2WPIS 3A7YA 4CHAB 3TJOA 4AYYB 5AFZH 1A3BH 1HCGA 3PO1C 3P92A 3EA7A 4CBNA 3QGNB 1PPHE 2GMTC 3CP7A 4NG9H 2Z3DA 1EJAA 3AAUA 1O2ZA 4YZUA 3FVFB 1SG8B 2A5AA 2GKVE 4OS6A 4I7YH 3F9FA 3V3MA 1SVPA 2FWWA 1TNLA 3TK6A 5FHTA 1TA6A 1ANEA 1ANDA 1YKTA 2HALA 2OUAA 4XBBA 3LGWA 5JBAS 2WUCA 1O2XA 3KQDA 1A5HA 3P95A 3GYLB 1TBRH 1SHHB 1IOEA 1YYY1 1SOZA 4NZLA 1EZUC 3ODDA 5FXLA 1MTNC 3SV8A 5GJ4B 4WMDA 3BIUH 2OXSA 2SNWA 2VWMA 4Z0KA 3KHVA 3PO1B 3GCTG 3PWCA 4BAOB 3I78A 4INKA 8KME2 1O2PA 1CHOF 1CU1A 1O31A 5F8XA 1P2QA 1XVMA 1FUJA 3TLOA 3D49H 1C2DA 2ANYA 1F2SE 1NM6A 1JMOH 1HDTH 1O2SA 1UCYH 4SGAE 1JIMA 4NA8A 1V3XA 2GDDA 3ZZ6A 1OOKB 1GDQA 1H9LB 4NCYA 3QK1A 1K1LA 2FZZA 5DO4H 2BX4A 2VIOA 5DP8A 3SU4A 1DWEH 2HNTC 4YESB 1AU8A 3MYWA 2FI4E 4XBDA 2GZ7A 1SMFE 1PPZA 1EAIA 1O5BB 2UWOA 2QA9E 1YCPM 1ZRKA 2RDLA 4I8HA 3TPIZ 2ZPQA 1BTYA 3BEFB 2GX4A 4ISLA 2Z9IA 5A09A 2QXGA 1HLTH 2OP9A 2BDHA 3PB1E 1CGJE 4I8GA 3MH5A 3MU4A 2AGEX 1C5WB 3PMAB 4GSOA 4JYTA 1MBQA 3RLYH 3SJOA 1JRTA 2A0QB 1DXPA 1V2JT 1WTGH 2ZHQH 2HRVA 1FAKH 2XCNA 3MU5A 3ESTA 2ZECA 3MFJA 1W7GH 4UEHH 3T5FH 3WY8A 5TCAA 3E16B 1U6QA 2ZHDA 1YPHE 1WSSH 1OP2A 2QXIA 2BQWB 1LQEA 1NRPH 2RCEA 1HFDA 2OC1A 3UQOA 3T26A 1NFWA 1SSXA 1ACBE 1DM4B 1QB6A 4ZMAH 1MKWK 4FUJA 1DWDH 1P10A 1DUAA 1SGIB 5BRRE 1BBRK 7ESTE 1KYNA 1G32B 5T6DA 2I6QA 1LVYA 2Y81A 1PPCE 1GPZA 2P93A 1G3CA 2XBYA 4AG1A 1G37A 1ZLRA 2ASUB 3Q3XA 1TNKA 3OY6U 1HV7A 1QB1A 1PPGE 2Y82A 4K5ZA 4BANB 3I77A 2BZ6H 4M7GA 1XUFA 3UR9A 2VIWA 4H42U 5F8TA 1S6FA 1ELAA 5FX5A 4X2XA 1H9IE 2J4IA 3RMOH 2ZTYA 4FUHA 2AFQB 1SLVB 1FIWA 2PV9B 1NTPA 2ZCKP 2P16A 3LPRA 3PV4A 2PTNA 1GJ5H 1ZHPA 1K1MA 1A4WH 2Z3CA 2P94A 4Q7YA 3Q00A 1PQAA 1T8MA 5E2PA 2Y5HA 3GY7A 3RLWH 1DPOA 1FJSA 1GBFA 1CHOG 3BN9A 2W3IA 2BQ7B 2IPHA 1KXAA 1MU6B 1BHXF 1OP0A 1L4DA 4DY7B 2AMDA 3HPTB 3U9AH 2ZHWH 1GMDG 1PYTC 4WMEA 2BDBA 5C2ZA 3RXHA 5L30H 1YPHC 1YF4A 1QIXB 3E0NB 4Y8YA 1TYNA 2A31A 1EAWA 4K8YA 1CT4E 2VINA 1BUIA 2Z9JA 2GCTB 3TJNA 3EQ0H 1FPHH 2BD5A 3MH6A 3PLKA 4Y6DA 3MTYA 4DW2U 1P01A 3SU3A 1NFUA 1YPKH 3MU1A 1E34B 5HGGA 1AFEH 1TB6H 1AB9C 1GHBG 2BTCE 3RMNH 2QC2A 3VB3A 3SGBE 1O2KA