1F0TA

Bovine trypsin complexed with rpr131247
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TRYPSIN
publication title Crystal structures of human factor Xa complexed with potent inhibitors.
pubmed doi rcsb
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f0tA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f0tA02
2BLQA 2FDAA 4BXSA 4A1XA 3B8JA 5L6NH 1HYLA 4CR9A 2Z7FE 5JBBS 2ULLA 1HXFH 1C1SA 1BMLA 4GLYA 3VB4A 3SU6A 1CBWB 3UREA 1GG6B 2VU8E 4D9RA 1RTLA 2BQ7B 4H6TA 3SW2B 1EZUC 1Z8IB 4J1YA 2OXSA 4DGJA 3ZZCA 1GBJA 3AASA 1QQ4A 3SGAE 3QZRA 3CENA 3GISB 2A1DB 1FAXA 2BVRH 4B71A 5AFZH 3SN8A 1OYQA 3TNTA 3R3GB 1LHEH 3GY5A 2V35A 1C5MD 4AZ2B 1G32B 1RTFB 2PGBB 4YOIA 5C67A 4ZUHA 4LK4A 5JB8S 1LHDH 1HJAB 1T8OA 1ELVA 8ESTE 1D9IA 1C1VH 2HLCA 1BMAA 1Y3YA 2QA9E 2AGGX 1TPSA 1HRTH 2CHAB 3FP6E 1DOJA 3VGCC 4HI3A 2YNAA 4D76A 3V12A 3RXHA 3LU9B 3RXDA 1LKBA 1O2ZA 1P03A 1O38A 1SQTA 2FOEA 1XUHA 3LGWA 1UK3A 2FS9A 2G51A 1YP9A 1KLJH 1SB1H 5TCAA 1Q2WA 2NU3E 3JZ2B 3VGCB 1TBZH 5A8ZA 1AKSA 1OXGA 1ETSH 2A4GA 3PO1C 1ETRH 1ELAA 1L1GA 3MFJA 1XUFA 4WMFA 1PPHE 2ZGXH 2ZFTA 4J2YB 1C2IA 2F9NA 2FMJA 3RXMA 4Y8XA 3KQEA 3P17H 5FBIA 1E34B 1V2RT 1N8OC 1T4VH 3SUFA 3PO1B 4MPWA 3V7TA 2F9BH 1GMDG 3T29A 2HOBA 1NROH 4GSOA 3M37A 3STIA 4ABGA 2HALA 1C1RA 4BAMB 1BJVA 2B7DH 2GTBA 5GJ4B 1O5FH 1AVGH 1C5PA 2K1QA 5FPTA 1XUGA 1N8OB 2PFEA 4Y6DA 1L0ZA 1P2OA 1DUAA 5T6DA 5TJXA 1F0SA 3RXLA 1DWDH 1MCTA 4AG1A 4YM9A 3JZ1B 4X6OA 3RXQA 4IGDA 3SU1A 1ZPCA 2HNTE 1AWHB 3RLYH 4Y0ZE 2SGAA 2XC5A 1CGIE 3MI4A 1QIXB 4JZDH 4AB8A 1JRSA 3E16B 1F5LA 3UQOA 1O35A 2VH0A 1AQ7A 2BXTH 1EJNA 3M35A 4AORA 4I8GA 1PPCE 2QXGA 3SI4H 3IWMA 3GY6A 2ZHFH 3ZVCA 4MNYA 2H9HA 4AGKA 4A5TS 1C5YB 3R0FA 1UCYE 1SMFE 1TAWA 1INCA 3SI3H 1Y5BT 5LH8A 2ZQ2A 2BDBA 4LZ4B 1V2WT 2FX6A 1VGCB 2QYIA 1V2VT 4FUEA 1ESBA 1W7XH 3VFEA 3LIWA 1O32A 3Q77A 3HK3B 3FZZA 1ZYOA 1EJMA 4CRAA 5DP7A 4NZLA 1ZOMA 1OWKA 2OINA 5EQRA 2G8TA 3SBKA 1QA7A 2FEQH 2B5TB 2GV6A 1IQHA 2ZTYA 4YLUA 5E2PA 2VB0A 2SNVA 3P70B 4E7RG 1SOZA 3PLPA 2ZECA 1O2QA 1MUEB 3RMLH 1C1NA 1DVAH 3ATMA 2HGTH 4LXBH 4GHQA 4X2VA 3BIUH 3HGPA 3PB1E 2FOHA 2WPIS 2Z3DA 3BG8A 3S0NA 2A32A 1GMDF 2SGFE 4FUCA 1O37A 1DLKB 3RXOA 4WWYA 2BX3A 3U1IB 1AI8H 1SGIB 1NFYA 1QL8A 5DP3A 1CSOE 3RM2H 1TGSZ 1CVWH 7GCHG 5EW1H 3FAOA 3QGNB 4KP0A 4U01A 4KGAA 1ZPZA 4D9QA 1F2SE 2A7JA 1O3OA 2OC8A 3ODDA 1BMMH 1RJXB 3ZZAA 1ANEA 1XXDA 3BEUA 3QGJA 3FZDA 2B9LA 3C27B 4X8UH 5B6OA 1CE5A 1LQEA 2ZCHP 2CN0H 1H8IH 1GHAF 4YLQH 3LGYA 3DFJA 2R2WU 4FUJA 2XXLA 1C5LH 2ZO3H 1BCUH 2CMYA 1W0YH 3ATKA 3M7UA 3TJVA 4TYDA 4UFGH 3GCHC 1C1OA 1DFPA 1IQNA 1GJCB 3STJA 1BHXF 1O31A 1HAXB 1SFQB 2FLRH 3GCNA 3HPTB 3UR6A 9LPRA 2AGIX 4AN7A 3OTJE 1F7ZA 1NFXA 4NA7A 4XBBA 1HXEH 1FJSA 4FU8A 1GHWH 1GHXH 3T25A 1THSH 1YCPH 1EX3A 1BMNH 2BDCA 3KEEA 3GCHB 2AIQA 2VIPA 3U1JB 1UK2A 1C5NH 3AAUA 3TJNA 2BOHB 2FOMB 3EA8A 4CRFA 2W7SA 3BTTE 4TY7A 1AUTC 2DE8A 2ZPQA 4AFSA 4FVDA 1C2GA 4AOQA 3TGIE 2IJOB 1BOQA 2H5DA 3MU1A 1VCWA 1UTQA 1LDTT 1F92A 4BAOB 1W10U 4ZKRU 2P59A 1O3AA 3RC5A 2BLVA 1GBKA 3A85A 3QTVH 1AVWA 1G3CA 1G37A 3S69A 1WV7H 4NCYA 4X1SU 1GJ5H 1MZAA 1GBBA 2ZFFH 2ZGHA 3E90B 4GVUA 4I32A 2XBYA 5BPEA 1K1LA 1NPMA 3SHCH 1TMUH 1KLTA 5SGAE 3RC6A 1B0EA 5A0AE 2ZNKH 4UDWH 3TPIZ 3UQVA 2AMDA 4INHA 5DP8A 1OP0A 1SOTA 3UWJH 5DPAA 1V2OT 4YO9A 1ZHPA 1NFWA 1IQJA 2BD7A 2ZPSA 1TA2A 7GCHF 3UFAA 3V3MA 1G30B 3GYLB 1FY1A 3M3VA 3QO6A 1JRTA 2BDAA 2SFAA 4I33A 4X8VH 1RGQA 2ZHDA 2Y6TA 2F83A 2OTVA 3U98H 2OLGA 1VJAU 3F9GA 5LPFA 4JCNA 3EA7A 4F49A 3SU4A 1WCZA 3A80A 5ESBA 3A7ZA 1LVYA 3BF6H 3LJOA 4BTUB 2RA0A 1N6XA 1LKAA 1SGCA 2F91A 2V3HH 3FP8E 2HPQH 3D49H 4BAHB 1CHOF 1AHTH 1P06A 2NU0E 3Q76A 5IYTA 2WUBA 2AIPA 4JZEH 3O8RA 1HAHH 1FN8A 1V2LT 4GAWA 1OWEA 4K8YA 1IQMA 1LHGH 4O9VA 5FPYA 3S7HB 3BG4C 1SQAA 4MNXA 5AHGH 4IMZA 1G3BA 5DP5A 2PV9B 4MPUA 2EI7A 4AYYB 1HUTH 3ESTA 1XM1A 2ODPA 1T8NA 3V0XA 2NU4E 1C4Y2 2Z94A 3TIUA 2HWLB 1T8MA 2ZHQH 1GBDA 2FOBA 2UUFB 3MH7A 1RD3B 3SV2H 1JWTA 3KN2A 5L30H 1ZMLA 5HXFA 1IOEA 2V0BA 1GJBB 4R8TB 3BG4B 2AH4X 3MHWU 1BIOA 2BHGA 3UOPA 3KQBA 2Q1JA 1EZQA 1F5KU 1OSSA 2G5VA 1V2NT 5TCCA 3L6PA 2TGAA 1A0LA 4A92A 1QBNA 3SGBE 1MTNC 3CP7A 1TWXB 1QRXA 2H6MA 3DFLA 2V6NA 3KNXA 4OS4A 1IAUA 1M9UA 2R3YA 1AU8A 4GPGA 2QXHA 1O2OA 2UWPA 3M5MA 3MU4A 2WINI 6LPRA 2O8MA 1K1IA 2C3SA 1P9UA 2A45B 4TWWA 2OCVB 1H4WA 1ZTJA 1TMBH 8GCHG 1TOCB 3M3TA 3NK8A 4ZXXH 3ZVEA 1WAYB 1PPFE 2BD5A 1C2EA 2HNTF 1VITH 3A88A 1ZLRA 1O5GH 1Z6EA 1Z8GA 4FU9A 3UR9A 3BTME 2FXRA 3E0PB 3ATLA 1EUFA 1K2I1 1C9PA 1O2YA 1Y8TA 3T5FH 3MYWA 4DT7B 2SNWA 4MG3A 1PJPA 2AMQA 2FOAA 1ZRKA 3QUMP 4ISHH 1FONA 3SNCA 1A0JA 1SGDE 2PUQH 2Y81A 1HV7A 1DSTA 2ANKH 5C1UA 1K1MA 2WPLS 3D23A 1Z8JB 3NUMA 1MBQA 1CA8B 1O3KA 2G4TA 2ZFPH 5FBEA 4AG2A 3DD2H 1A0HB 1P2KA 2BQWB 2FYQA 2C8XB 2CJIA 1GBIA 1GJ7B 3OX7U 2RG3A 5EQQA 5K7RA 6GCHF 1HBTH 4IN1A 1QFKH 4INKA 1EOJA 5EG4A 2BVSH 3B9FH 1UTMA 1WTHD 1FAKH 1JXPA 3SGQE 3L3TA 2VJ1A 5PTPA 1O3JA 1EXFA 4JZFH 2P95A 3BEFB 5EOKA 5IDKA 1WSSH 4A1TA 1KLIH 5JBTA 2B8OH 3AW1A 1QL9A 5CHAB 4K1SA 2ZQ1A 4ASHA 2TGDA 4JYVH 2A4QA 4BXWA 3GDUA 1IQIA 2OBOA 3SUGA 1SFIA 3O8CA 1V3XA 4K69A 3MO3A 3ENSB 4OS2A 2ZDMA 1YLCA 4Y8YA 2WYGA 2PUXB 2QXJA 1YPKH 3MO9A 5C3NA 1QBOA 1O2PA 5E8EH 1QA0A 2OBQA 1KXFA 3GY4A 1YCPK 1AE8H 1ELBA 3EA9A 4X0WU 1P09A 1XX9A 1NM6A 4YOGA 2RDLA 1O5DH 1UO6A 2HRVA 1GHBG 2BLWA 2BY9X 1UHBA 3ZVBA 2HPPH 4BOHA 1E37B 1GBFA 1P0SH 3IITA 1RRKA 3LJJA 2PLXA 2EI8A 4YT7H 2A31A 1AZ8A 1ZGIA 1X7AC 1MAXA 1GBLA 1QL7A 8GCHF 4AFZA 3RLWH 2B0FA 1VCPA 2BDHA 3QZQA 3KQDA 3GOVB 3BSQA 1RS0A 1A7SA 3BTHE 4FUDA 1HDTH 3BEIB 4XE4A 3SNBA 4E05H 5FXLA 1MBMA 3S9AA 4NWLA 5F8XA 3LONA 4IS5A 1NC6A 2R0LA 1V2ST 3RU4D 3QDZB 1MKWK 3KL6A 1TNJA 2GMTC 1ANDA 1MD7A 3CS7A 1P3CA 3GCTF 1UHBB 2G55A 1BTUA 2ODQA 1O2LA 1Z6JH 2ZG0H 4DVAU 1YM0A 1ZMJA 4AFUA 2CF8H 5FX5A 4WH6A 1SHHB 2VGCC 3RXCA 1MH0A 5K0HA 5BRRE 3E1XB 1NFUA 3KGPA 2LPRA 3E6PH 3LC3A 1GPZA 2CGAA 5I25A 1N6YA 1IQKA 3K6YA 4DIHH 4F4OC 5DP9A 1QB9A 1TNGA 2JH0D 2SGPE 1Y3XA 1FI8A 1BBRE 2FO9A 4ZROA 2QGRA 3A7WA 1TABE 2WV5A 2ZU2A 5H4IB 4UONA 1QCPA 3QLPH 2P93A 1P02A 3OY5U 3A89A 3A7VA 4XFQA 4QT8C 4B1TA 1G2MA 1SC8U 2STAE 5T3HA 3A8AA 4ABBA 1MTWA 4NIWA 3KF2A 4ESTE 4KTUA 3UUZA 4XBCA 1TALA 4FUIA 2Q6DA 3FP7E 3EYDA 5HGGA 4H4FA 1AD8H 4TPYA 4X1PU 2FPZA 3IG6B 5F03A 1HB0B 3MH4A 4OS5A 4NG9H 2ZZUH 2ANMH 1S83A 3HK6B 4HGCA 1ETTH 4B73A 5JBAS 2J34A 1PPEE 5J4QA 6CHAC 4A7IB 3M7QA 1GHBF 2P3FH 3Q3KA 4Y11E 2FX4A 1NRRH 4CRCA 4MQAA 1C5OH 3ZYEA 1MTVA 1BUIA 1GJ6A 5A2MH 4ABIA 1GHVH 4MTBA 1GJDB 1HNEE 1EQ9A 1UVPA 3A8BA 1QB1A 1O3LA 1MMJN 1SGFG 1C5XB 5EW2H 1C1PA 1F0UA 1TYNA 4DG4A 3S9BA 3NCLA 1C5ZB 1XUKA 1H8DH 2YOLA 1SI5H 1A46H 1FZZA 4GCHF 4CBOA 1P2MA 1J8AA 4WXIA 1O3BA 2C8YB 2XBVA 2A7CA 2O8LA 1C5TA 5C1YA 1GCDA 2GT8A 3T28A 4IW4E 2WPKS 1IQFA 2ZU4A 2NU1E 1ZGVA 1QURH 2FOGA 1HAGE 1PYTC 1S6FA 4NA8A 3M7TA 3U8OH 1A2CH 2GVFA 2A5IA 3AW0A 1UTKA 1GHAG 4Q7YA 1O2JA 1EP5A 1MU8B 3LGTA 4WVPE 1P2IA 1TRMA 2VIQA 4CBNA 2HNTC 1BQYA 5F6MA 1QRZA 4ZKOU 1F5RA 4HFPB 3VXEH 4FXGH 1MCVA 3MO6A 2EA3A 3S7KB 8KME2 1FDPA 2F9VA 1UVOA 2XWAA 1YPLH 1OP2A 2FOCA 1YF4A 2Y5HA 4YTAA 2H5CA 4DCDA 2A5KA 4NIVA 4Q80A 2R0KA 1C1UH 2ILNA 1XUIA 3M5OA 1FV9A 5C5NA 3RMNH 1GBCA 1CA0C 1GGDC 1MD8A 1PFXC 3F6UH 1EB1H 1EAWA 2Z3EA 3TNSA 3UTUH 3SU5A 3BV9B 4BAQB 5GDSH 1TNKA 5C5OA 4LZ1H 1KTSB 4RSPA 2H9TH 1P8VC 3SUEA 1KYNA 1D6WA 2IN2A 1Y5AT 1MAYA 2XYAA 3KQCA 1FY5A 1O3MA 2ZEBA 4Y71A 4D7GA 1LPKB 4ISIH 1CA0B 2JETC 5EXLA 1TRYA 1AGJA 1AZZA 4X8SH 3DA9B 3AAVA 1KY9A 1TX6A 5E0HA 1MU6B 1QJ7B 2ALPA 1SGQE 1UK4A 3BTEE 5DKMA 4CHAC 1QR3E 1EPTA 1ZZZA 1S0RA 1GDNA 2Q6FA 5ABWA 3MNBA 2XC4A 1QTFA 1BTHH 2AERH 4DY7B 1CT0E 3BTWE 3SU2A 2PTNA 1G36A 1EASA 3E8LA 3RXUA 2R3UA 1SHYA 2XCNA 2VWMA 1EPTC 3ZZBA 4BTIB 2IOTA 2QXIA 4B2CA 5L2YH 1SBWA 4I8JA 1P04A 1BITA 2ZWLH 5ESTE 3MU8A 1EAUA 1K1OA 2FTMA 3UOUA 2XTTB 1FY3A 1P11E 1SQOA 1THPB 1CHOG 1KIGH 2ZFQH 2GP9B 4FVBA 5GCHF 1LCYA 2BOKA 4THNH 1EPTB 1AY6H 1GHYH 3Q3XA 3M5LA 1VCQA 2W26A 4U2WA 3TH4H 4K60A 5GWZA 5AVDA 2BMGB 2Z9GA 2BLOA 1ELFA 1DM4B 1P2JA 2NWNA 3SV7A 1GMHG 1V2JT 1GDQA 1NN6A 2BDIA 1A5IA 1UCYK 4ZH8A 4UFFH 3BTKE 1PQ8A 2ZFRH 1ACBE 4TY6A 1YPJH 3RXBA 2WPJS 3TK6A 3K6ZA 4I7YH 2BX4A 2OQ5A 3A7YA 4ZHLU 2QF0A 3TH3H 1DPOA 3RXPA 1ZHMA 1JIRA 4INLA 1D3TB 3M36A 1TQ0B 1BTZA 1GMCG 4X8TH 1GBAA 1P9SA 1K28D 1TPPA 1TNIA 4JK5A 4Y7BA 2FYRA 3RM0H 3E91A 1Z71A 1SSXA 2H1UA 2GZ9A 1C5RA 1CQQA 4ZKNU 2VIOA 1S85A 2GZ8A 3ZVFA 1SGPE 2VWOA 3ELAH 4BANB 4JK6A 2J9NA 2ESTE 1NT1A 2WUCA 1MKWH 3A86A 2ASUB 1C2MA 1UTNA 3NPSA 2O8WA 3OU0A 4OGXA 1XMNB 1QBVH 2GCHF 1MZDA 1G3EA 2GKVE 1BRUP 1NZQH 4NZQA 1K21H 2FIRH 3ZVAA 1VITF 5E0JA 1XXFA 1ORFA 3PWCA 3U69H 1O39A 1PQ7A 1QHRB 3AVZA 3URDA 3TK9A 1D3PB 1SG8B 2ZPRA 4O97A 5C1XA 2G4UA 4K1EA 2KAIA 3U8TH 1C5UA 1O5EH 1P3EA 1TB6H 1K1JA 1MKXH 1O3NA 2OC7A 1TONA 3MNXA 2UWOA 1DANH 2BB4A 1NTPA 2FI3E 1ELCA 1ABIH 1ELEE 1YPHE 1OPHB 1GI5A 1V2KT 4ABFA 1TNLA 6GCHG 1ZMNA 3UIRA 3VXFH 1YPEH 2AEIH 3GY7A 1C2JA 2BY6X 1ZHRA 1YYY1 2O9QA 1CHGA 4X6MA 5A0BA 1NO9H 2J4IA 2ZDLA 2D26C 3ZV9A 3VB6A 2TGTA 2Y82A 2PTCE 3TGKE 5T6GA 3SQHE 1GMHF 1GI0A 3PROA 3KCGH 1BRBE 1RFNA 1BB0B 5EPYA 2KAIB 1FUJA 3Q00A 1V2PT 3DHKH 1SLXB 1V2QT 1BTWA 1Z8RA 5DO4H 1GMCF 3F9HA 1KXEA 1W8BH 2ZGBH 3ATIA 4M7GA 2J92A 2OD3B 5FAHA 1IQGA 1O2VA 3EQ0H 1GI9B 4NSVA 5T6FA 1O0DH 1W12U 1D6RA 3MH5A 3A81A 4YZUA 1BTYA 1S81A 1LVMA 4X1RU 4YESB 2ZDVH 2AYWA 1BZXE 4K2YA 3PTNA 3T27A 1JOUB 1LVOA 4E7NA 1HGTH 3RC4A 1BTPA 4UFDH 3GY3A 1Z1JA 3ITIA 1NU9A 6ESTA 5JDUB 4JZ1A 2OC1A 1LPGB 4Y8ZA 1V2TT 2BD4A 1W2KH 3SNDA 1BTXA 1SGFA 1GVLA 3T62A 4E06H 5HYOA 1MQ5A 4CRDA 1OKXA 1O3GA 1E36B 3VEQB 3MWIU 1MTNB 5LPRA 2BXUH 2P8OC 3BTFE 4X6NA 1HAYB 3RU4T 1O2XA 2BY5X 1CU1A 1WYKA 3B23B 3TJOA 2P3UB 4FUGA 1J14A 1WUNH 3ZYDA 5JYIA 3MU5A 1KDQB 3HGNA 2XCFA 2A2QH 3RMMH 3ZZ7A 3TH2H 1Y3WA 4WXVA 2BQ6B 1ID5H 1SL3A 1J9CH 1T8LA 3GCTG 9ESTA 4ZMAH 1GBMA 1HIAB 1SVPA 1CT2E 1GJ4H 1UMAH 3H5CB 1E35B 1L4DA 1ZTLA 4X6PA 1QGFA 1LPZB 4JYUH 3FFGA 3N7OA 3P8GA 1GI6A 1TOMH 1Y59T 3SU3A 1C5SA 1EAXA 1GBTA 5F8TA 2M5TA 1C1QA 2G00A 3P8NA 1EB2A 4U30A 1TA6A 3MNSA 3RDZA 1S0QA 2VIVA 2H9EH 1DS2E 4K3JA 1EKBB 3ZV8A 1DWEH 5EQSA 5F8ZA 1T4UH 2AS9A 5L2ZH 1L4ZA 3T26A 3U8RH 1YKTA 3KHVA 2F9UA 4NIYA 1S84A 3RMOH 5JB9S 1P05A 1L2EA 1P2NA 3TGJE 3A87A 2UWLA 1K1NA 3MH6A 4CRGA 1GDUA 3TLOA 2J2UA 4CREA 4ABDA 2P94A 2JH5D 3D62A 4X2YA 1S6HA 3D65E 4UFEH 1ZJDA 1C1WH 2G81E 2VVCA 4ISOA 4DOQA 1BHXB 1EP6A 2XWBI 1O3PB 1AWFH 2GT7A 2QN5T 5FX6A 4RN6A 2Q6GA 1KXCA 1Z7KA 5A0CA 2YNBA 3LGIA 2A2XH 1HAPH 4XBDA 4BNRA 1W3CA 3SHAH 3GY8A 1PPBH 2FODA 5JPMH 5DP6A 3W95A 3PTBA 3MU0A 1NU7B 2ALVA 2OP9A 4MVNA 4GCHG 1GCTC 1NESE 5E0GA 1H9LB 2DE9A 2GV7A 2XNIA 3H7TA 3ZZDA 2A4OA 1GG6C 1DUEA 4NGAH 3ZVDA 1GJ9B 3SJ9A 2FM2A 2W3KA 1WU1A 1AFEH 3SZNA 3ZZ3A 1D3DB 2G52A 1H9IE 1O3CA 1A61H 1ARBA 4Y7AA 3NKKA 3PLBA 4Y76A 1AE5A 1ELTA 3GICB 1GCTB 3ZVGA 1FXYA 2DUCA 3PMJA 3ATWA 3I29A 1C5QA 3W94A 1YCPM 2BDYA 3BTQE 2Y7XA 1DLEA 2GMTB 4R0IA 1FY4A 1HJAC 1SLWB 4NFFA 1UCYH 4OS1A 1T32A 3NXPA 4X2WA 2FWWA 2PGQB 3A8CA 1MKXK 1B5GH 2XBWA 2A7HA 3PV4A 2CHAC 4YOJA 1DXPA 4AFQA 8LPRA 2BZ6H 2VGCB 1V2UT 1J15A 2ZHWH 1O2GH 4K5ZA 1TMTH 2G5NA 1L1NA 1Z1IA 1UVSH 1C1MA 5EXNA 1P2QA 2ZP0H 3NWUA 1P12E 5DK1A 2ZU1A 1SPJA 4NSYA 1O2IA 4Q2KA 3TK5A 2ZCKP 4X1QU 2FI4E 2PR3A 1XKBC 3RXSA 3PWBA 1ZJKA 1UVTH 3M61U 1Q3XA 3RXVA 1C4U2 1GI4A 1Y5UT 1C2KA 1HAZB 5A09A 4DW2U 4ZXYH 1QJ1B 3SQEE 1KXAA 1XUJA 1EOLA 2FZZA 1SGRE 3OY6U 1ESTA 1ABJH 2C8ZB 4KELA 4VGCC 4HZHA 2ZTZA 6CHAB 1IQEA 4MPVA 1C1TA 4LOYH 4Q7XA 2PHBA 4HTCH 4B2BA 2PW8H 4D8NA 1O36A 1O2RA 1OWJA 1H9HE 4H6SB 1GJ8B 3I77A 2QF3A 2QV1A 1YLDA 1FMGA 2WV4A 1LMWB 1AMHA 2P16A 3EGKH 4VGCB 1ELDE 4UD9H 2ZA5A 4ISNA 4X1NU 2LNCA 1FN6A 4I8HA 4NWKA 3GY2A 3SV6A 1ZTKA 1UTJA 2WYJA 2QC2A 1A1RA 1HFDA 2GDEH 2RCEA 2J38A 1PPGE 2Z3CA 3A83A 3RUOA 2BD2A 2F9PA 1BA8B 1K9OE 2TIOA 3RXRA 4B76A 1AKSB 1UTOA 1YPMH 4KKDA 1O5AB 5GCHG 1LTOA 1W14U 2EC9H 2CV3A 3QWCH 1CGHA 2ZKSA 1O3HA 4ABHA 5LPEA 3SV9A 3L33A 1S5SA 3RXIA 2A5AA 2SGDE 3QK1A 4FUFA 5AFYH 3URCA 1VGCC 1D4PB 1BBRK 3VPKA 2QIQA 4FU7A 5GIBA 3G01A 1TGCA 4ABEA 1YPGH 3GYMA 3BTGE 2QCYA 4WMDA 1XKAC 4DIIH 2TPIZ 3ZZ4A 3H7OA 1OS8A 4KTCA 3PMHB 1GVZA 1WQSA 4DJZB 2QAAA 1MTSA 5GXPA 1HCGA 1GI1A 2D8WA 3SJ8A 1C2DA 1DWBH 2R2MB 4Q7ZA 1CT4E 2O8TA 7KMEH 4FUBA 2A4RA 3TJUA 3KIDU 1AFQC 2BY7X 1RIWC 1O2UA 1GGDB 1P01A 2OUAA 3MTYA 2IPHA 3F9EA 1FPHH 4Z6AH 1V2MT 2ZFSA 4X2XA 4CRBA 3TVJB 1HJ8A 1GL1A 1EZXC 4MLFB 3HKIB 1AUJA 2Y5GA 1VJ9U 1O2MA 4OS6A 3UY9A 2Z6BD 3A7XA 1AFQB 3PMBB 1RIWB 5A8XA 3HKJB 1O2NA 2JETB 3U9AH 2GCHG 3NZIA 2ANYA 1HLTH 2W5EA 1GL0E 3PYHA 3ZZ9A 1S82A 1AIXH 1DX5M 1VITG 4IC6A 2FLBH 1HJ9A 4ABJA 1WBGB 1QJ6B 1DT2A 4RKOB 3LC5A 1TBRH 1TGTA 1YBWA 5HM2A 3UPEA 4CHAB 2GCTC 4IC5A 1DWCH 1ZRBA 5J4SA 1ZSJA 1SGTA 1EZSC 1O2WA 4JYTA 1ELGA 4TWYA 4O3UA 2EEKA 3EE0B 3RXEA 4K1TA 1FNIA 1O2HA 2XRCA 1TIOA 1ANBA 3Q3YA 1K1PA 1EJAA 2Z9KA 3SJIA 2BD3A 2FOFA 1BJUA 2ZIQH 4RKJB 1IHSH 1ZSLA 3SJKA 4IBLH 1Q31A 1UJ1A 3VB7A 2GCTB 1GI7B 3TITA 2ZDKA 1QRWA 3ODFA 2GD4B 4NA9H 4DURA 3A84A 7LPRA 3MOCA 3SUDA 2TBSA 2FP7B 2GX4A 3RXJA 4BAKB 4ZAEA 1GI2A 2SGQE 2FESH 2ODYB 3RXAA 1V6DA 1TX8A 3E0NB 1O3FA 2GZ7A 1TLDA 1NRQH 3QX5H 1GJAB 2WPHS 2Z9IA 3P92A 1W11U 4SGBE 2ZGJA 5FCRA 5GPIB 3F9FA 1KTTB 5DJ7A 5CE1A 1GWAA 2W3IA 1E38B 2AGEX 2VIWA 2PWXA 4ZHMU 4OS7A 4I31A 1A5GH 5DGJA 1A3BH 3BTDE 1AB9C 1ZPBA 4KTSA 1UTPA 4WJG2 1OOKB 3RP2A 1C2LA 1O30A 3BN9A 1JIMA 3RXTA 1LVBA 3RU4E 2THFB 3PLKA 5DG6A 1FLEE 5FHTA 1G2LA 2ZC9H 1BT7A 3A7TA 2C93B 1H1BA 2GGVB 3M3SA 1P10A 3OYPA 1AB9B 3SNEA 1LO6A 1DXWA 1G3DA 1O34A 1C9TA 2BD9A 2Z9JA 1A5HA 2CF9H 4GUXA 5DP4A 2C90B 1JBUH 1BDAA 3RXFA 4B75A 2GDDA 2FTLE 4Y0YE 2ZCLP 3PMAB 4CH8B 3LH1A 3O8DA 5E2OA 1LHFH 1THRH 1SR5C 4MPXA 1CO7E 1DY8A 1XVOA 2ZDNA 2BVXH 2W7UA 3EDXB 4ZHAA 1TE0A 2I6SA 2UUYA 4CR5A 2BDGA 2VINA 1LQDB 2H2ZA 1AO5A 4MNVA 5LGOA 1FY8E 2TGPZ 2UUJB 5FCKA 1OWHA 3SJOA 4GHTA 4I8KA 2EI6A 3P8OA 2ANWA 3SU0A 1YGCH 3ZZ8A 1OWIA 4O03A 2QY0B 1YPHC 4A6LA 1SGEE 4O3TA 1DE7H 4UEHH 3VB5A 1OWDA 1O2SA 1DY9A 5EU8A 1O3DA 3UNQA 4XSKU 4Y79A 3TU7H 5FPSA 2F9OA 5I46H 3LGVA 1FIZA 1GI8B 4AB9A 1AN1E 1HAVA 3LT3A 1BRCE 1OP8A 2JKHA 1RTKA 1VZQH 3E3TA 1TPOA 2BYAX 4ZKSU 4JMYA 3SORA 1CGJE 1U6QA 1F0TA 3V13A 3P95A 4XOJA 1TFXA 1C4V2 1E0FD 1QB6A 3FVFB 4UE7H 2TRMA 1OYTH 4CH2B 1DITH 3UNRA 1C5VA 3T2NA 1C2HA 5A8YA 3S9CA 1IQLA 1PYTD 2BM2A 1KDQA 1ZSKA 2ZDAH 2O8UA 4XDEA 5HMAA 4WH8A 4AX9H 3QTOH 4MNWA 1GBHA 1FQ3A 2PKAA 2BY8X 2PSYA 3HATH 3LPRA 1J16A 3RXKA 2V3OH 1PQ5A 3SV8A 3LOXA 1HIAA 1T31A 1TGNA 3M5NA 1AVXA 4Y10E 1SGYE 2I6QA 2AMPA 2VVUA 5C2ZA 2BD8A 1ARCA 1P57B 2XBXA 5CMXH 2ZI2H 3ZZ5A 1HAVB 3SO3A 5AF9H 1D3QB 1SGNE 1XVMA 1W0ZU 2RA3A 3ZZ6A 1O2KA 3P6ZB 1HAIH 1ANCA 2F3CE 1T7CA 1QNJA 4Z0KA 1ESAA 2BZAA 2Y5FA 3K2UA 4NIXA 3RXGA 3GCOA 1HPGA 1OX1A 2ZGCA 3VB3A 1TQ7B 4OGYA 2HVXA 1GHZA 2OC0A 2ZHEH 1KXBA 1TRNA 3SNAA 3C1KA 3MMGA 1ZR0A 2PKAB 2ZTXA 2FS8A 1DSUA 2P3TB 1NRSH 3GDVA 3LGUA 5EGMA 3WY8A 3LH3A 2P8OB 4B2AA 1F0RA 2Y7ZA 3A8DA 1DDJA 1MQ6A 1TNHA 4ISLA 3MNCA 2UUKB 1GBEA 1O3EA 4H42U 1NY22 2XC0A 4WY3A 2FI5E 1BBRH 2PKSC 3CS0A 4B74A 3O8BA 2D2DA 1VR1H 1A3EH 2PSXA 3DUXH 4AGJA 5EPNA 1KSNA 2SGEE 1NRPH 2ZF0H 2C8WB 4I8LA 7ESTE 3UWIA 3P8FA 2VWNA 3BIVH 4D7FA 2JH6D 5ETXA 4K8BA 4A1VA 1WTGH 3A82A 1PQAA 4IMQA 1O3IA 1UVUH 1NRNH 4TPIZ 5CHAC 1TPAE 1HAOH 1Y3VA 2A0QB 4WMEA 2XW9A 5G4BA 2ZU3A 3F1SB 3LKWA 4NFEA 4ABAA 2PKSB 3DT0H 2VIDA 2Y80A 4MDSA 2D1JA 5C20A 3K9XB 1FPCH 1BRAA 1YC0A 1GI3A 3I78A 2C4FH 1RXPA 1C2FA 1LHCH 1O33A 1SLUB 1KXDA 1O5BB 1WQVH 2J94A 1EATA 1O5CB 2R9PA 1QQUA 3OSYA 1QY6A 3FANA 1MTUA 1C5WB 1N1LA 1L1JA 2Z9LA 1K22H 1G9IE 4BTTB 3K65B 2J95A 2CXVA 3QN7A 1A4WH 1UTLM 4JZIA 1B7XB 4PROA 4IN2A 3LDXH 4SGAE 2VNTA 5HM9A 2STBE 2NU2E 5EODA 2VVVA 1WOFA 2WPMS 3SOSA 1B0FA 1O2TA 1W13U 4U32A 1Y3UA 1GVKB 1W7GH 3EAJA 1TX7A 3F68H 1NS3A 2AFQB 4AYVB 1EAIA 5JBCS 1IHTH 2BTCE 5EXMA 4WF8A 2VWLA 1J17T 2VH6A 2OQUA 2ZU5A 3UNSA 3PM3A 1TBQH 3GDSA 1SLVB 1PPZA 1FIWA 1TGBA 4YT6H 1CBWC 1DICA 1JMOH 4FUHA
chains in the Genus database with same CATH superfamily
2BLQA 2KX4A 2FDAA 4BXSA 4A1XA 3B8JA 5L6NH 1HYLA 4CR9A 3FOAA 3VG8A 2Z7FE 5JBBS 2ULLA 5DN6D 1HXFH 1C1SA 1BMLA 4GLYA 3VB4A 3SU6A 1CBWB 2JJ2D 3UREA 1GG6B 2VU8E 4D9RA 1RTLA 2BQ7B 4H6TA 3SW2B 1EZUC 1Z8IB 4J1YA 2OXSA 4DGJA 3ZZCA 1GBJA 3AASA 1QQ4A 3SGAE 3QZRA 3CENA 3GISB 2A1DB 1FAXA 2BVRH 4B71A 5AFZH 3SN8A 1OYQA 3TNTA 3R3GB 1LHEH 3GY5A 2V35A 1C5MD 4AZ2B 1G32B 1RTFB 2PGBB 3CNRA 2HLDD 4YOIA 4ZUHA 4LK4A 5C67A 5JB8S 1LHDH 1HJAB 1T8OA 1QZ8A 4F55A 1ELVA 3PV2A 8ESTE 1D9IA 1C1VH 2HLCA 1BMAA 1Y3YA 2QA9E 2AGGX 1TPSA 2WPDD 1HRTH 2WHXA 2CHAB 3FP6E 1DOJA 3VGCC 4HI3A 2YNAA 2J5UA 4D76A 3V12A 3RXHA 3LU9B 3RXDA 1LKBA 1O2ZA 1P03A 1O38A 1SQTA 2FOEA 1XUHA 3LGWA 5CHBA 1UK3A 2FS9A 2G51A 1YP9A 1KLJH 1SB1H 5TCAA 1Q2WA 2NU3E 3JZ2B 3VGCB 1TBZH 5A8ZA 1AKSA 1OXGA 1ETSH 2A4GA 3PO1C 1ETRH 1ELAA 1L1GA 3MFJA 1XUFA 2LP6A 4WMFA 1PPHE 2ZGXH 2ZFTA 4J2YB 1C2IA 2F9NA 2FMJA 3RXMA 4Y8XA 3KQEA 3P17H 3WW7A 5FBIA 1E34B 1V2RT 1N8OC 1COWD 1T4VH 3SUFA 3PO1B 4MPWA 3V7TA 2F9BH 1GMDG 3T29A 2HOBA 1NROH 4GSOA 3M37A 3STIA 4ABGA 2HALA 1C1RA 4BAMB 1VKYA 1BJVA 2B7DH 2GTBA 5GJ4B 1O5FH 1AVGH 1C5PA 2K1QA 5FPTA 1XUGA 1N8OB 2PFEA 4Y6DA 3MQKC 1L0ZA 1P2OA 1DUAA 5T6DA 5TJXA 1F0SA 3RXLA 1DWDH 1MCTA 4AG1A 4YM9A 3JZ1B 4X6OA 3RXQA 4IGDA 3SU1A 1ZPCA 2HNTE 1AWHB 3RLYH 4Y0ZE 2SGAA 2XC5A 1CGIE 3MI4A 1QIXB 4JZDH 4AB8A 1JRSA 3E16B 1F5LA 3UQOA 1O35A 2VH0A 1AQ7A 2BXTH 1EJNA 3M35A 4AORA 4I8GA 1PPCE 2QXGA 3SI4H 3IWMA 3GY6A 2ZHFH 3ZVCA 4MNYA 2H9HA 4AGKA 4A5TS 1C5YB 3R0FA 1UCYE 1SMFE 1TAWA 1INCA 3SI3H 1Y5BT 5LH8A 2ZQ2A 2BDBA 4LZ4B 1V2WT 2FX6A 1VGCB 2QYIA 1V2VT 4FUEA 1ESBA 1W7XH 3VFEA 3LIWA 1O32A 3Q77A 3HK3B 3FZZA 1ZYOA 1EJMA 4CRAA 5DP7A 4NZLA 1ZOMA 1OWKA 2OINA 5EQRA 2G8TA 3SBKA 1QA7A 2FEQH 2B5TB 2GV6A 1IQHA 2ZTYA 4YLUA 5GNDA 5E2PA 2VB0A 2SNVA 3P70B 4E7RG 1SOZA 3PLPA 2ZECA 1O2QA 1MUEB 3RMLH 1C1NA 1DVAH 3ATMA 2HGTH 4LXBH 1W0KD 4GHQA 4X2VA 3BIUH 3HGPA 3PB1E 2FOHA 3OEED 2WPIS 2Z3DA 3BG8A 4M9FA 3S0NA 2A32A 1GMDF 2SGFE 4FUCA 1O37A 1DLKB 3RXOA 4WWYA 2BX3A 3U1IB 1AI8H 1SGIB 1NFYA 1QL8A 5DP3A 1CSOE 3RM2H 1TGSZ 1CVWH 7GCHG 5EW1H 3FAOA 3QGNB 4KP0A 4U01A 4KGAA 1ZPZA 4D9QA 1F2SE 4OM9A 2A7JA 1O3OA 2OC8A 3ODDA 1BMMH 1RJXB 3ZZAA 1ANEA 1XXDA 3BEUA 3QGJA 3FZDA 2B9LA 3C27B 4X8UH 5B6OA 1CE5A 1LQEA 2ZCHP 2CN0H 1H8IH 1GHAF 4YLQH 3LGYA 3DFJA 2R2WU 4FUJA 2XXLA 1C5LH 2ZO3H 1BCUH 2CMYA 1W0YH 3ATKA 3M7UA 4ACAA 3TJVA 4TYDA 4UFGH 3GCHC 1C1OA 1DFPA 1IQNA 1GJCB 3STJA 1BHXF 1O31A 1HAXB 1SFQB 2FLRH 3GCNA 3HPTB 3UR6A 5KGOA 2AGIX 9LPRA 4AN7A 3OTJE 1F7ZA 1NFXA 4NA7A 4XBBA 1HXEH 1FJSA 4FU8A 1GHWH 1GHXH 3T25A 1THSH 1YCPH 1EX3A 1OHHD 1BMNH 2BDCA 3KEEA 3GCHB 2AIQA 2VIPA 3U1JB 1UK2A 1C5NH 3AAUA 3TJNA 2BOHB 2FOMB 3EA8A 4CRFA 2W7SA 3BTTE 4TY7A 1AUTC 2DE8A 2ZPQA 4AFSA 4FVDA 1C2GA 4AOQA 3TGIE 2IJOB 1BOQA 2H5DA 3MU1A 1VCWA 1UTQA 2K8IA 1LDTT 1F92A 4BAOB 1W10U 4ZKRU 2P59A 3FN8A 1O3AA 3RC5A 2BLVA 1GBKA 3A85A 3QTVH 1AVWA 1G3CA 1G37A 3S69A 1WV7H 4NCYA 4X1SU 1GJ5H 1MZAA 1GBBA 2ZFFH 2ZGHA 3E90B 4GVUA 4Q63A 4I32A 2XBYA 5BPEA 1K1LA 1NPMA 3SHCH 1TMUH 1KLTA 5SGAE 2QF5A 3RC6A 1B0EA 5A0AE 2ZNKH 4UDWH 3TPIZ 3UQVA 2AMDA 4INHA 5DP8A 1OP0A 1SOTA 3UWJH 5DPAA 1V2OT 4YO9A 1ZHPA 1NFWA 1IQJA 2BD7A 2ZPSA 1TA2A 7GCHF 3UFAA 3V3MA 1G30B 3GYLB 1FY1A 3M3VA 3QO6A 1JRTA 2BDAA 2SFAA 4I33A 4X8VH 1RGQA 2ZHDA 2Y6TA 2F83A 2OTVA 3U98H 2OLGA 1VJAU 3F9GA 5LPFA 4JCNA 3EA7A 4F49A 3SU4A 1WCZA 3A80A 5ESBA 3A7ZA 1LVYA 3BF6H 3LJOA 4BTUB 3N7EA 2RA0A 1N6XA 1LKAA 1SGCA 2F91A 2V3HH 3FP8E 2HPQH 3D49H 4BAHB 1CHOF 4ACBA 1AHTH 1P06A 2NU0E 2WSSD 3FO8D 3Q76A 5IYTA 2WUBA 2AIPA 1S6LA 4JZEH 2AHME 3O8RA 1HAHH 1FN8A 1V2LT 4GAWA 1OWEA 4K8YA 1IQMA 1LHGH 4O9VA 5FPYA 3S7HB 3BG4C 1SQAA 4MNXA 5AHGH 4IMZA 1G3BA 5DP5A 2PV9B 4MPUA 2EI7A 4AYYB 1HUTH 3ESTA 1XM1A 2ODPA 1T8NA 3V0XA 2NU4E 1C4Y2 2Z94A 3TIUA 2HWLB 1T8MA 2ZHQH 4ZCNA 1E1RD 1GBDA 2FOBA 2UUFB 3MH7A 1RD3B 3SV2H 1JWTA 3KN2A 5L30H 1W0JD 1ZMLA 5HXFA 1IOEA 2V0BA 1GJBB 4R8TB 3BG4B 2AH4X 3MHWU 1BIOA 2BHGA 3UOPA 3KQBA 2Q1JA 1EZQA 1F5KU 1OSSA 2G5VA 1V2NT 5TCCA 3L6PA 2TGAA 1A0LA 4A92A 1QBNA 3SGBE 1MTNC 3CP7A 1TWXB 1QRXA 4AC9A 2H6MA 3DFLA 2V6NA 3KNXA 4OS4A 1IAUA 1M9UA 2R3YA 1AU8A 4GPGA 2QXHA 1O2OA 2UWPA 3M5MA 3MU4A 3PV5A 2WINI 6LPRA 2O8MA 1K1IA 2C3SA 1P9UA 2A45B 4TWWA 1YWUA 2OCVB 2LELA 1H4WA 4TT3D 1ZTJA 1TMBH 8GCHG 1TOCB 3M3TA 3NK8A 4ZXXH 3ZVEA 1WAYB 1PPFE 2BD5A 1C2EA 2HNTF 1VITH 3A88A 1ZLRA 1O5GH 1Z6EA 1Z8GA 4FU9A 4HG6A 3UR9A 3BTME 2FXRA 3E0PB 3ATLA 2GJGA 1EUFA 1K2I1 1C9PA 1NBMD 1O2YA 1Y8TA 3T5FH 1H8HD 3MYWA 4DT7B 2SNWA 4MG3A 1PJPA 2AMQA 2FOAA 1ZRKA 3QUMP 4ISHH 1FONA 3SNCA 1A0JA 1SGDE 2PUQH 2Y81A 1HV7A 1BMFD 1DSTA 2ANKH 5C1UA 3DSPA 1K1MA 2WPLS 3D23A 1Z8JB 3NUMA 1MBQA 1CA8B 1O3KA 2G4TA 2ZFPH 5FBEA 4AG2A 3DD2H 1A0HB 1P2KA 2BQWB 2FYQA 2C8XB 2CJIA 1GBIA 1GJ7B 3OX7U 2RG3A 5EQQA 5K7RA 6GCHF 1HBTH 4IN1A 1QFKH 4INKA 1EOJA 5EG4A 2BVSH 3B9FH 1UTMA 1WTHD 1FAKH 1JXPA 3SGQE 3L3TA 2VJ1A 5EIYA 5PTPA 1O3JA 1EXFA 4JZFH 2P95A 2J98A 3BEFB 5EOKA 5IDKA 5C0TA 1WSSH 4A1TA 1KLIH 5JBTA 2B8OH 3AW1A 1QL9A 5CHAB 4K1SA 2ZQ1A 4ASHA 2TGDA 4JYVH 2A4QA 2OK5A 4BXWA 3GDUA 1IQIA 2OBOA 3SUGA 1SFIA 3O8CA 1V3XA 4K69A 3MO3A 3ENSB 4OS2A 1FX0B 2ZDMA 1YLCA 2JJ1D 2WYGA 2XNDD 2PUXB 2QXJA 4Y8YA 1YPKH 3MO9A 2IPQX 1E1QD 5C3NA 1QBOA 1O2PA 5E8EH 1QA0A 2OBQA 1KXFA 3GY4A 1YCPK 1AE8H 3N99A 1ELBA 3EA9A 4X0WU 1P09A 1XX9A 1NM6A 4YOGA 2RDLA 1O5DH 1UO6A 2HRVA 1GHBG 2BLWA 2BY9X 1UHBA 3ZVBA 2HPPH 4BOHA 1E37B 1GBFA 1P0SH 3IITA 1RRKA 3LJJA 2J98B 2PLXA 2EI8A 4YT7H 2A31A 1AZ8A 1ZGIA 5KEDA 1X7AC 1MAXA 1GBLA 1QL7A 8GCHF 4AFZA 3RLWH 2B0FA 1VCPA 2BDHA 3QZQA 3KQDA 3GOVB 3BSQA 1RS0A 1A7SA 3BTHE 4FUDA 1HDTH 3BEIB 4XE4A 3SNBA 4E05H 2PP6A 5FXLA 1MBMA 4TSFD 5FL7D 3S9AA 4NWLA 5F8XA 3LONA 4IS5A 1NC6A 2IJD1 2R0LA 1V2ST 3RU4D 3QDZB 1MKWK 3KL6A 1TNJA 2GMTC 1ANDA 1MD7A 3CS7A 4FETA 1P3CA 3GCTF 1UHBB 2G55A 1BTUA 2ODQA 1O2LA 1Z6JH 2ZG0H 4DVAU 1YM0A 1ZMJA 4AFUA 2CF8H 5FX5A 4WH6A 1SHHB 2VGCC 3RXCA 1MH0A 5K0HA 5BRRE 5EJZA 3E1XB 1NFUA 3KGPA 2LPRA 3E6PH 3LC3A 1GPZA 2CGAA 5I25A 1N6YA 1IQKA 3K6YA 4DIHH 4F4OC 5DP9A 1QB9A 1TNGA 2JH0D 2SGPE 1Y3XA 1FI8A 1BBRE 2FO9A 4ZROA 2QGRA 3A7WA 1TABE 2WV5A 2ZU2A 5H4IB 4UONA 1QCPA 3QLPH 2P93A 1P02A 3OY5U 3A89A 2KCPA 3A7VA 4XFQA 4QT8C 4B1TA 1G2MA 1SC8U 2STAE 3OAAD 3A8AA 5T3HA 4ABBA 1MTWA 3H09A 4NIWA 1WXRA 3KF2A 4ESTE 4KTUA 3UUZA 4XBCA 1TALA 4FUIA 2Q6DA 4P00A 3FP7E 3EYDA 5HGGA 4H4FA 1AD8H 4TPYA 4X1PU 2FPZA 3IG6B 5F03A 1HB0B 3MH4A 4OS5A 4NG9H 2ZZUH 2ANMH 1S83A 3HK6B 4HGCA 1ETTH 4B73A 5JBAS 2J34A 1PPEE 4FOUC 5J4QA 6CHAC 4A7IB 3M7QA 1GHBF 2P3FH 3Q3KA 4Y11E 2FX4A 1NRRH 4CRCA 4MQAA 1C5OH 3ZYEA 1MTVA 1BUIA 1GJ6A 5A2MH 4ABIA 1SKYE 1GHVH 4MTBA 1GJDB 1HNEE 1EQ9A 1UVPA 3A8BA 1QB1A 1O3LA 1MMJN 1SGFG 1C5XB 5EW2H 1C1PA 1F0UA 1TYNA 4DG4A 3S9BA 3NCLA 1C5ZB 1XUKA 4DT4A 1H8DH 2YOLA 1SI5H 1A46H 1FZZA 4GCHF 4CBOA 1P2MA 1J8AA 4WXIA 4B6FA 1O3BA 2C8YB 2XBVA 2A7CA 2O8LA 1C5TA 5C1YA 1GCDA 2GT8A 3T28A 4IW4E 2WPKS 1IQFA 2ZU4A 5B6LA 2NU1E 1ZGVA 1QURH 2FOGA 1HAGE 1PYTC 1S6FA 4NA8A 3M7TA 3U8OH 1A2CH 2GVFA 2A5IA 3AW0A 1UTKA 1GHAG 4Q7YA 1O2JA 1EP5A 1MU8B 3LGTA 4WVPE 1P2IA 1TRMA 2VIQA 4CBNA 2HNTC 1BQYA 5F6MA 1QRZA 4ZKOU 1F5RA 4HFPB 3VXEH 4FXGH 1MCVA 3MO6A 2EA3A 3S7KB 8KME2 1FDPA 2F9VA 1UVOA 2XWAA 1YPLH 1OP2A 2FOCA 1YF4A 2Y5HA 4YTAA 2H5CA 4DCDA 2A5KA 4NIVA 4Q80A 2R0KA 1C1UH 2ILNA 1XUIA 3M5OA 1FV9A 5C5NA 3RMNH 1GBCA 1CA0C 1GGDC 1MD8A 1PFXC 3F6UH 1EB1H 1EAWA 1SQRA 2Z3EA 3TNSA 3UTUH 3SU5A 3BV9B 4BAQB 2YMSD 5GDSH 1TNKA 5C5OA 4LZ1H 1KTSB 4RSPA 2H9TH 1P8VC 3SUEA 1KYNA 1D6WA 2IN2A 1Y5AT 1MAYA 2XYAA 3KQCA 1FY5A 1O3MA 2ZEBA 4Y71A 4D7GA 1LPKB 4ISIH 1CA0B 2L74A 1NBME 2JETC 5EXLA 1TRYA 1AGJA 1AZZA 4X8SH 3DA9B 3AAVA 2KR7A 1KY9A 2KCOA 1TX6A 5E0HA 1MU6B 1QJ7B 2ALPA 1SGQE 1UK4A 3BTEE 5DKMA 4CHAC 5F53A 1QR3E 1EPTA 1ZZZA 1S0RA 1GDNA 2Q6FA 2V3MA 5ABWA 3MNBA 2XC4A 1QTFA 1BTHH 2AERH 4DY7B 1CT0E 3BTWE 3SU2A 2PTNA 2EQNA 1G36A 1EASA 3E8LA 3RXUA 2R3UA 1SHYA 2XCNA 2VWMA 1EPTC 3ZZBA 4BTIB 2EY4C 2IOTA 2QXIA 4B2CA 5L2YH 1SBWA 4I8JA 1P04A 1BITA 2ZWLH 5ESTE 3MU8A 1EAUA 1K1OA 2FTMA 3UOUA 2XTTB 1FY3A 1P11E 1SQOA 1THPB 1CHOG 1KIGH 2ZFQH 2GP9B 4FVBA 5GCHF 1LCYA 4RT1A 2BOKA 4THNH 1EPTB 1AY6H 1GHYH 3Q3XA 3M5LA 1VCQA 2W26A 4U2WA 3TH4H 4K60A 5GWZA 5AVDA 2BMGB 2Z9GA 2BLOA 1ELFA 1DM4B 5HKKD 1P2JA 2NWNA 2CK3D 3UAIC 3SV7A 1GMHG 1V2JT 1GDQA 1NN6A 2BDIA 1A5IA 1UCYK 4ZH8A 4UFFH 3BTKE 1PQ8A 2ZFRH 1ACBE 4TY6A 1YPJH 3RXBA 2WPJS 3TK6A 3K6ZA 4I7YH 2BX4A 2OQ5A 3A7YA 4ZHLU 2QF0A 3TH3H 1DPOA 3RXPA 1ZHMA 1JIRA 4INLA 4RI0A 1D3TB 3M36A 1TQ0B 1BTZA 1GMCG 4X8TH 1GBAA 1P9SA 1K28D 1TPPA 1TNIA 4JK5A 4Y7BA 2FYRA 3RM0H 3E91A 1Z71A 1SSXA 5EJLA 2H1UA 2GZ9A 1C5RA 1E79D 1CQQA 4ZKNU 2VIOA 1S85A 2GZ8A 3ZVFA 1SGPE 2VWOA 3ELAH 4BANB 4JK6A 2J9NA 2ESTE 1NT1A 2WUCA 3OE7D 1MKWH 3A86A 2ASUB 1C2MA 1UTNA 3NPSA 2O8WA 3OU0A 4OGXA 1XMNB 1QBVH 2GCHF 1MZDA 1G3EA 2GKVE 1BRUP 1NZQH 4NZQA 2VBCA 1K21H 2FIRH 3ZVAA 1VITF 5E0JA 1XXFA 1ORFA 3PWCA 3U69H 1O39A 1PQ7A 1QHRB 3AVZA 3URDA 3TK9A 1D3PB 1SG8B 5C17A 2ZPRA 4O97A 5C1XA 2G4UA 4K1EA 2KAIA 3U8TH 1C5UA 1O5EH 1P3EA 1TB6H 1K1JA 1MKXH 1O3NA 2OC7A 1TONA 3MNXA 2UWOA 1DANH 2BB4A 1NTPA 2FI3E 3W1EA 1ELCA 1WDIA 1ABIH 1ELEE 1YPHE 1OPHB 1GI5A 1V2KT 4ABFA 1TNLA 6GCHG 1ZMNA 3UIRA 3VXFH 1YPEH 2AEIH 3GY7A 1C2JA 2BY6X 1ZHRA 1YYY1 2O9QA 1CHGA 4X6MA 5A0BA 1NO9H 2J4IA 2ZDLA 2D26C 3ZV9A 3VB6A 2TGTA 3ZIAD 2Y82A 2PTCE 3WWBA 3TGKE 5T6GA 3SQHE 1GMHF 1GI0A 3PROA 1UW7A 3KCGH 1BRBE 1RFNA 1BB0B 5EPYA 2KAIB 1FUJA 3Q00A 1V2PT 3DHKH 1SLXB 1V2QT 1BTWA 1Z8RA 5DO4H 1GMCF 3F9HA 1KXEA 1W8BH 2ZGBH 3ATIA 4M7GA 2J92A 2OD3B 5FAHA 1IQGA 1O2VA 3EQ0H 1GI9B 3F2GA 4NSVA 5T6FA 1O0DH 1W12U 1D6RA 3MH5A 3A81A 4YZUA 1BTYA 1S81A 1LVMA 4X1RU 4YESB 2ZDVH 2AYWA 1BZXE 4K2YA 3PTNA 3T27A 1JOUB 1LVOA 4E7NA 1HGTH 3RC4A 1BTPA 4UFDH 3GY3A 1Z1JA 3ITIA 1NU9A 6ESTA 5JDUB 4JZ1A 2OC1A 1LPGB 4Y8ZA 1V2TT 2BD4A 1W2KH 3SNDA 1BTXA 1SGFA 1GVLA 3T62A 4E06H 5HYOA 1MQ5A 4CRDA 1OKXA 1O3GA 1E36B 3VEQB 3MWIU 1MTNB 5LPRA 2BXUH 2P8OC 3BTFE 4X6NA 1HAYB 3RU4T 1O2XA 2BY5X 1CU1A 1WYKA 3B23B 3TJOA 2P3UB 4FUGA 1J14A 1WUNH 3ZYDA 5JYIA 3MU5A 1KDQB 3HGNA 2XCFA 2A2QH 3RMMH 3ZZ7A 3TH2H 1Y3WA 4WXVA 2BQ6B 1ID5H 1SL3A 1J9CH 1T8LA 3GCTG 9ESTA 4ZMAH 1GBMA 1HIAB 1SVPA 1CT2E 1GJ4H 1UMAH 3H5CB 1E35B 1L4DA 1ZTLA 4X6PA 1QGFA 1LPZB 4JYUH 3DSGA 3FFGA 3N7OA 3P8GA 1GI6A 1TOMH 1Y59T 3SU3A 1C5SA 4FUHA 1EAXA 1GBTA 5F8TA 2M5TA 1C1QA 2G00A 3P8NA 1EB2A 4U30A 1TA6A 3MNSA 3F2HA 3RDZA 1S0QA 2VIVA 2H9EH 1DS2E 4K3JA 1K0HA 1EKBB 3ZV8A 1DWEH 5EQSA 2V7QD 3KYFA 5F8ZA 1T4UH 2AS9A 5L2ZH 1L4ZA 3T26A 3U8RH 1YKTA 3KHVA 2F9UA 4NIYA 1S84A 3RMOH 5JB9S 1P05A 1L2EA 1P2NA 3TGJE 3OTPA 3A87A 2UWLA 2KCYA 1K1NA 3MH6A 4CRGA 1GDUA 3TLOA 5IK2D 2J2UA 4CREA 4ABDA 2P94A 2JH5D 3D62A 4X2YA 1S6HA 2KM0A 3D65E 4UFEH 1ZJDA 1C1WH 2G81E 2VVCA 4ISOA 4DOQA 1BHXB 1EP6A 2XWBI 1O3PB 1AWFH 2GT7A 2QN5T 5FX6A 4RN6A 2Q6GA 1KXCA 1Z7KA 5A0CA 2YNBA 3LGIA 2A2XH 1HAPH 4XBDA 4BNRA 1W3CA 3SHAH 3GY8A 5CDFE 1PPBH 2FODA 2RDEA 5JPMH 5DP6A 3F0OA 3W95A 3PTBA 3MU0A 1NU7B 2ALVA 2OP9A 4MVNA 4GCHG 1GCTC 1NESE 5E0GA 1H9LB 2DE9A 2GV7A 2XNIA 3H7TA 3ZZDA 2A4OA 1GG6C 1DUEA 4NGAH 3ZVDA 1GJ9B 4I86A 3SJ9A 2FM2A 2W3KA 1WU1A 1AFEH 3SZNA 3ZZ3A 1D3DB 2G52A 1H9IE 1O3CA 1A61H 1ARBA 4Y7AA 3NKKA 1YLNA 3PLBA 4Y76A 1AE5A 1ELTA 3GICB 1GCTB 3ZVGA 1FXYA 2DUCA 3PMJA 3ATWA 3I29A 3SZEA 1C5QA 3W94A 1YCPM 2BDYA 3BTQE 2Y7XA 1DLEA 2GMTB 4R0IA 1FY4A 1HJAC 1SLWB 4NFFA 1UCYH 4OS1A 1T32A 3NXPA 4X2WA 2FWWA 2PGQB 3A8CA 1MKXK 1B5GH 2XBWA 2A7HA 3PV4A 2CHAC 4YOJA 1DXPA 4AFQA 8LPRA 2BZ6H 2VGCB 3PRBA 1H8ED 2KCAA 1V2UT 1J15A 2ZHWH 1O2GH 4K5ZA 1TMTH 2G5NA 1L1NA 1Z1IA 1UVSH 3EE7A 1C1MA 5EXNA 3UB0A 1P2QA 2ZP0H 3NWUA 3GS9A 1P12E 5DK1A 3FKSD 2JIZD 2ZU1A 1SPJA 4NSYA 1O2IA 4Q2KA 3TK5A 2ZCKP 4X1QU 2FI4E 5T1VA 2PR3A 1XKBC 1KMHB 3RXSA 3PWBA 2WV9A 1ZJKA 1UVTH 3M61U 1Q3XA 3RXVA 1C4U2 1GI4A 1Y5UT 1C2KA 1HAZB 5A09A 4DW2U 4ZXYH 1QJ1B 3SQEE 1KXAA 1XUJA 1EOLA 2FZZA 1SGRE 3OY6U 1ESTA 1ABJH 2C8ZB 4KELA 4VGCC 4HZHA 2ZTZA 6CHAB 1IQEA 4MPVA 1C1TA 2KZ4A 4LOYH 4Q7XA 2PHBA 4HTCH 4B2BA 2PW8H 4D8NA 1O36A 1O2RA 1OWJA 1H9HE 4H6SB 1GJ8B 3I77A 2QF3A 2QV1A 1YLDA 4XD7D 3F2FA 1FMGA 2WV4A 1LMWB 1AMHA 2P16A 3EGKH 4VGCB 1ELDE 4UD9H 2ZA5A 4ISNA 4X1NU 2LNCA 1FN6A 4I8HA 4NWKA 3GY2A 3SV6A 1ZTKA 1UTJA 2WYJA 2QC2A 1A1RA 1HFDA 2GDEH 2RCEA 2J38A 1PPGE 2Z3CA 3A83A 3RUOA 5HIZA 2BD2A 2F9PA 1BA8B 1K9OE 2TIOA 3RXRA 4B76A 1AKSB 1UTOA 1YPMH 5KECA 4KKDA 1O5AB 5GCHG 1LTOA 1W14U 2EC9H 2CV3A 3QWCH 1CGHA 2ZKSA 1O3HA 4ABHA 5LPEA 3SV9A 3L33A 1S5SA 3RXIA 2A5AA 2SGDE 3QK1A 4FUFA 5AFYH 3URCA 1VGCC 1D4PB 1BBRK 3VPKA 2QIQA 4FU7A 5EJ1A 5GIBA 3G01A 1TGCA 4ABEA 1YPGH 3GYMA 3BTGE 2QCYA 4WMDA 1XKAC 4DIIH 2TPIZ 3ZZ4A 3H7OA 1OS8A 4KTCA 3PMHB 1GVZA 1WQSA 3KYGA 4DJZB 2QAAA 1MTSA 5GXPA 1HCGA 1GI1A 2D8WA 3SJ8A 1C2DA 1DWBH 2R2MB 4Q7ZA 1CT4E 2O8TA 7KMEH 4FUBA 2A4RA 3TJUA 3SYJA 2F4LA 3KIDU 1AFQC 2BY7X 1RIWC 1O2UA 1GGDB 1P01A 2OUAA 3MTYA 2IPHA 3F9EA 1FPHH 4Z6AH 1V2MT 2ZFSA 4X2XA 4CRBA 3TVJB 1HJ8A 1GL1A 1EZXC 4MLFB 3HKIB 1AUJA 2Y5GA 1VJ9U 1O2MA 4OS6A 3UY9A 2Z6BD 3A7XA 1AFQB 3PMBB 1RIWB 5A8XA 3HKJB 1O2NA 2JETB 3U9AH 2GCHG 4ASUD 3NZIA 2ANYA 1HLTH 2W5EA 1GL0E 3PYHA 3ZZ9A 1S82A 3OFND 1AIXH 1DX5M 1VITG 4IC6A 2FLBH 1HJ9A 4ABJA 1WBGB 1QJ6B 1DT2A 3AK5A 4RKOB 3LC5A 1TBRH 1TGTA 1YBWA 5HM2A 3UPEA 4CHAB 2GCTC 4IC5A 1DWCH 1ZRBA 5J4SA 1ZSJA 1SGTA 1EZSC 1O2WA 4JYTA 1ELGA 4TWYA 4O3UA 2EEKA 3EE0B 3RXEA 4K1TA 1FNIA 1O2HA 2XRCA 1TIOA 1ANBA 3DCLA 3Q3YA 1K1PA 1EJAA 2Z9KA 3F0PA 3SJIA 2BD3A 2FOFA 1BJUA 1MABB 2M2AA 2ZIQH 1IHSH 1ZSLA 4RKJB 3SJKA 4IBLH 1Q31A 1UJ1A 3VB7A 2GCTB 1GI7B 3TITA 2ZDKA 1QRWA 3ODFA 2GD4B 4NA9H 4Z1MD 4DURA 3WWFA 3A84A 7LPRA 3MOCA 3U28C 3SUDA 2TBSA 2FP7B 5HIYA 2GX4A 3RXJA 4BAKB 4ZAEA 2RFKC 1GI2A 2SGQE 3F3BA 2FESH 2ODYB 3RXAA 1V6DA 1TX8A 3E0NB 1O3FA 2GZ7A 1TLDA 1NRQH 3QX5H 1GJAB 2QF4A 2WPHS 2Z9IA 3P92A 1W11U 4SGBE 2ZGJA 5FCRA 5GPIB 3F9FA 1KTTB 5DJ7A 5CE1A 1GWAA 2W3IA 1E38B 2AGEX 2VIWA 2PWXA 4ZHMU 4OS7A 4I31A 1A5GH 5DGJA 1A3BH 3BTDE 1AB9C 1ZPBA 4KTSA 1UTPA 4WJG2 1OOKB 3RP2A 1C2LA 1O30A 3BN9A 1JIMA 3RXTA 1LVBA 3RU4E 2THFB 3PLKA 5DG6A 1FLEE 5FHTA 1G2LA 2K0QA 2ZC9H 1BT7A 3A7TA 2C93B 3OEHD 1H1BA 2GGVB 3M3SA 1P10A 3OYPA 1AB9B 3SNEA 1LO6A 1DXWA 1G3DA 1O34A 1C9TA 2BD9A 2Z9JA 1A5HA 2CF9H 4GUXA 5DP4A 2C90B 1JBUH 1BDAA 3RXFA 4B75A 2GDDA 2FTLE 4Y0YE 2ZCLP 3PMAB 4CH8B 3LH1A 3O8DA 5E2OA 1LHFH 1THRH 1SR5C 4MPXA 1CO7E 1DY8A 1XVOA 2ZDNA 2BVXH 2W7UA 3EDXB 4Q4LA 1TE0A 4ZHAA 2I6SA 2UUYA 4CR5A 2BDGA 2VINA 2F43B 1LQDB 2H2ZA 1AO5A 4MNVA 5LGOA 1FY8E 2TGPZ 2UUJB 5FCKA 1OWHA 3SJOA 4XRNA 4GHTA 4I8KA 2EI6A 3P8OA 2ANWA 3SU0A 1YGCH 3ZZ8A 1OWIA 4O03A 2QY0B 1YPHC 4A6LA 1SGEE 4O3TA 1DE7H 4UEHH 3VB5A 2HVYB 1OWDA 1O2SA 1DY9A 5EU8A 1O3DA 3UNQA 4XSKU 2QE7D 4Y79A 3TU7H 5FPSA 2F9OA 5I46H 3LGVA 1FIZA 1GI8B 4AB9A 1AN1E 2J97A 1HAVA 3LT3A 1BRCE 1OP8A 2JKHA 3N7DA 1RTKA 1VZQH 3E3TA 1TPOA 2BYAX 4ZKSU 4JMYA 3SORA 1CGJE 1U6QA 1F0TA 3V13A 3P95A 4XOJA 1TFXA 1C4V2 1E0FD 1QB6A 3FVFB 4UE7H 2TRMA 1OYTH 4CH2B 1DITH 3UNRA 1C5VA 3T2NA 1C2HA 5A8YA 3S9CA 2WZQA 1IQLA 1PYTD 2BM2A 1KDQA 1ZSKA 2ZDAH 2O8UA 4XDEA 5HMAA 4WH8A 4AX9H 3QTOH 4MNWA 1GBHA 1FQ3A 2PKAA 2BY8X 2PSYA 3HATH 3LPRA 1J16A 3RXKA 2V3OH 1PQ5A 3SV8A 4P02A 3LOXA 1HIAA 1T31A 1TGNA 3M5NA 1AVXA 4Y10E 1SGYE 2I6QA 2AMPA 2VVUA 5C2ZA 2BD8A 4RT0A 1ARCA 1P57B 2XBXA 2JDID 5CMXH 2ZI2H 3ZZ5A 1HAVB 3SO3A 5AF9H 3NRLA 1D3QB 1SGNE 1XVMA 1W0ZU 2RA3A 3ZZ6A 1O2KA 3P6ZB 1HAIH 1ANCA 2F3CE 3PRDA 1T7CA 1QNJA 4Z0KA 1ESAA 2BZAA 2Y5FA 3K2UA 5C0UA 4NIXA 3RXGA 3GCOA 1HPGA 1OX1A 2ZGCA 3VB3A 1TQ7B 4OGYA 2HVXA 1GHZA 2OC0A 2ZHEH 1KXBA 1TRNA 2KFWA 3SNAA 3C1KA 3MMGA 1ZR0A 2PKAB 5C94A 2ZTXA 2FS8A 1DSUA 2P3TB 1NRSH 3GDVA 3LGUA 5EGMA 3WY8A 4YXWD 3LH3A 2P8OB 4B2AA 1F0RA 2Y7ZA 3A8DA 1DDJA 1MQ6A 1TNHA 4ISLA 3MNCA 2UUKB 1GBEA 4F48B 1O3EA 4H42U 1NY22 2XC0A 4WY3A 1EFRD 2FI5E 1BBRH 2PKSC 3CS0A 4B74A 3O8BA 2D2DA 1VR1H 1A3EH 2PSXA 3DUXH 4AGJA 5EPNA 1KSNA 2W6ID 2SGEE 1NRPH 2YMSC 2ZF0H 2C8WB 4I8LA 7ESTE 3UWIA 3P8FA 4B6EA 2VWNA 3BIVH 4D7FA 2JH6D 5ETXA 3KQ5A 4K8BA 4A1VA 1WTGH 3A82A 1PQAA 4IMQA 1O3IA 1UVUH 1NRNH 4TPIZ 5CHAC 1TPAE 1HAOH 1Y3VA 2A0QB 4WMEA 2XW9A 5G4BA 2ZU3A 3F1SB 3DSOA 3LKWA 4NFEA 2PKSB 4ABAA 3DT0H 2VIDA 2Y80A 4MDSA 2D1JA 5C20A 3K9XB 1FPCH 1BRAA 1YC0A 1GI3A 2YMSB 3I78A 2C4FH 1RXPA 1C2FA 1LHCH 1O33A 1SLUB 1KXDA 1O5BB 1WQVH 2J94A 1EATA 1O5CB 2R9PA 1QQUA 3OSYA 1QY6A 3FANA 1MTUA 1C5WB 1N1LA 1L1JA 2Z9LA 1K22H 1G9IE 4BTTB 3K65B 2L6OA 2J95A 2CXVA 2W6JD 3QN7A 1A4WH 1UTLM 4JZIA 1B7XB 4PROA 4IN2A 3LDXH 4SGAE 2VNTA 5HM9A 2STBE 2NU2E 5EODA 2VVVA 1WOFA 2WPMS 3SOSA 1B0FA 1O2TA 1W13U 4U32A 1Y3UA 1GVKB 1W7GH 3EAJA 1TX7A 3F68H 1NS3A 2AFQB 4AYVB 1EAIA 5JBCS 1IHTH 2BTCE 5EXMA 2XOKD 4WF8A 2VWLA 1J17T 2VH6A 2OQUA 2ZU5A 5DSFA 3PM3A 3UNSA 1TBQH 3GDSA 1SLVB 1PPZA 1FIWA 1TGBA 4YT6H 1CBWC 1DICA 1JMOH 1YY3A
chains in the Genus database with same CATH topology
2BLQA 2FDAA 4BXSA 4A1XA 3B8JA 5L6NH 1HYLA 4CR9A 2Z7FE 5JBBS 2ULLA 1HXFH 1C1SA 1BMLA 4GLYA 3VB4A 3SU6A 1CBWB 3UREA 1GG6B 2VU8E 4D9RA 1RTLA 2BQ7B 4H6TA 3SW2B 1EZUC 1Z8IB 4J1YA 2OXSA 4DGJA 3ZZCA 1GBJA 3AASA 1QQ4A 3SGAE 3QZRA 3CENA 3GISB 2A1DB 1FAXA 2BVRH 4B71A 5AFZH 3SN8A 1OYQA 3TNTA 3R3GB 1LHEH 3GY5A 2V35A 1C5MD 4AZ2B 1G32B 1RTFB 2PGBB 4YOIA 5C67A 4ZUHA 4LK4A 5JB8S 1LHDH 1HJAB 1T8OA 1ELVA 8ESTE 1D9IA 1C1VH 2HLCA 1BMAA 1Y3YA 2QA9E 2AGGX 1TPSA 1HRTH 2CHAB 3FP6E 1DOJA 3VGCC 4HI3A 2YNAA 4D76A 3V12A 3RXHA 3LU9B 3RXDA 1LKBA 1O2ZA 1P03A 1O38A 1SQTA 2FOEA 1XUHA 3LGWA 1UK3A 2FS9A 2G51A 1YP9A 1KLJH 1SB1H 5TCAA 1Q2WA 2NU3E 3JZ2B 3VGCB 1TBZH 5A8ZA 1AKSA 1OXGA 1ETSH 2A4GA 3PO1C 1ETRH 1ELAA 1L1GA 3MFJA 1XUFA 4WMFA 1PPHE 2ZGXH 2ZFTA 4J2YB 1C2IA 2F9NA 2FMJA 3RXMA 4Y8XA 3KQEA 3P17H 5FBIA 1E34B 1V2RT 1N8OC 1T4VH 3SUFA 3PO1B 4MPWA 3V7TA 2F9BH 1GMDG 3T29A 2HOBA 1NROH 4GSOA 3M37A 3STIA 4ABGA 2HALA 1C1RA 4BAMB 1BJVA 2B7DH 2GTBA 5GJ4B 1O5FH 1AVGH 1C5PA 2K1QA 5FPTA 1XUGA 1N8OB 2PFEA 4Y6DA 1L0ZA 1P2OA 1DUAA 5T6DA 5TJXA 1F0SA 3RXLA 1DWDH 1MCTA 4AG1A 4YM9A 3JZ1B 4X6OA 3RXQA 4IGDA 3SU1A 1ZPCA 2HNTE 1AWHB 3RLYH 4Y0ZE 2SGAA 2XC5A 1CGIE 3MI4A 1QIXB 4JZDH 4AB8A 1JRSA 3E16B 1F5LA 3UQOA 1O35A 2VH0A 1AQ7A 2BXTH 1EJNA 3M35A 4AORA 4I8GA 1PPCE 2QXGA 3SI4H 3IWMA 3GY6A 2ZHFH 3ZVCA 4MNYA 2H9HA 4AGKA 4A5TS 1C5YB 3R0FA 1UCYE 1SMFE 1TAWA 1INCA 3SI3H 1Y5BT 5LH8A 2ZQ2A 2BDBA 4LZ4B 1V2WT 2FX6A 1VGCB 2QYIA 1V2VT 4FUEA 1ESBA 1W7XH 3VFEA 3LIWA 1O32A 3Q77A 3HK3B 3FZZA 1ZYOA 1EJMA 4CRAA 5DP7A 4NZLA 1ZOMA 1OWKA 2OINA 5EQRA 2G8TA 3SBKA 1QA7A 2FEQH 2B5TB 2GV6A 1IQHA 2ZTYA 4YLUA 5E2PA 2VB0A 2SNVA 3P70B 4E7RG 1SOZA 3PLPA 2ZECA 1O2QA 1MUEB 3RMLH 1C1NA 1DVAH 3ATMA 2HGTH 4LXBH 4GHQA 4X2VA 3BIUH 3HGPA 3PB1E 2FOHA 2WPIS 2Z3DA 3BG8A 3S0NA 2A32A 1GMDF 2SGFE 4FUCA 1O37A 1DLKB 3RXOA 4WWYA 2BX3A 3U1IB 1AI8H 1SGIB 1NFYA 1QL8A 5DP3A 1CSOE 3RM2H 1TGSZ 1CVWH 7GCHG 5EW1H 3FAOA 3QGNB 4KP0A 4U01A 4KGAA 1ZPZA 4D9QA 1F2SE 2A7JA 1O3OA 2OC8A 3ODDA 1BMMH 1RJXB 3ZZAA 1ANEA 1XXDA 3BEUA 3QGJA 3FZDA 2B9LA 3C27B 4X8UH 5B6OA 1CE5A 1LQEA 2ZCHP 2CN0H 1H8IH 1GHAF 4YLQH 3LGYA 3DFJA 2R2WU 4FUJA 2XXLA 1C5LH 2ZO3H 1BCUH 2CMYA 1W0YH 3ATKA 3M7UA 3TJVA 4TYDA 4UFGH 3GCHC 1C1OA 1DFPA 1IQNA 1GJCB 3STJA 1BHXF 1O31A 1HAXB 1SFQB 2FLRH 3GCNA 3HPTB 3UR6A 9LPRA 2AGIX 4AN7A 3OTJE 1F7ZA 1NFXA 4NA7A 4XBBA 1HXEH 1FJSA 4FU8A 1GHWH 1GHXH 3T25A 1THSH 1YCPH 1EX3A 1BMNH 2BDCA 3KEEA 3GCHB 2AIQA 2VIPA 3U1JB 1UK2A 1C5NH 3AAUA 3TJNA 2BOHB 2FOMB 3EA8A 4CRFA 2W7SA 3BTTE 4TY7A 1AUTC 2DE8A 2ZPQA 4AFSA 4FVDA 1C2GA 4AOQA 3TGIE 2IJOB 1BOQA 2H5DA 3MU1A 1VCWA 1UTQA 1LDTT 1F92A 4BAOB 1W10U 4ZKRU 2P59A 1O3AA 3RC5A 2BLVA 1GBKA 3A85A 3QTVH 1AVWA 1G3CA 1G37A 3S69A 1WV7H 4NCYA 4X1SU 1GJ5H 1MZAA 1GBBA 2ZFFH 2ZGHA 3E90B 4GVUA 4I32A 2XBYA 5BPEA 1K1LA 1NPMA 3SHCH 1TMUH 1KLTA 5SGAE 3RC6A 1B0EA 5A0AE 2ZNKH 4UDWH 3TPIZ 3UQVA 2AMDA 4INHA 5DP8A 1OP0A 1SOTA 3UWJH 5DPAA 1V2OT 4YO9A 1ZHPA 1NFWA 1IQJA 2BD7A 2ZPSA 1TA2A 7GCHF 3UFAA 3V3MA 1G30B 3GYLB 1FY1A 3M3VA 3QO6A 1JRTA 2BDAA 2SFAA 4I33A 4X8VH 1RGQA 2ZHDA 2Y6TA 2F83A 2OTVA 3U98H 2OLGA 1VJAU 3F9GA 5LPFA 4JCNA 3EA7A 4F49A 3SU4A 1WCZA 3A80A 5ESBA 3A7ZA 1LVYA 3BF6H 3LJOA 4BTUB 2RA0A 1N6XA 1LKAA 1SGCA 2F91A 2V3HH 3FP8E 2HPQH 3D49H 4BAHB 1CHOF 1AHTH 1P06A 2NU0E 3Q76A 5IYTA 2WUBA 2AIPA 4JZEH 3O8RA 1HAHH 1FN8A 1V2LT 4GAWA 1OWEA 4K8YA 1IQMA 1LHGH 4O9VA 5FPYA 3S7HB 3BG4C 1SQAA 4MNXA 5AHGH 4IMZA 1G3BA 5DP5A 2PV9B 4MPUA 2EI7A 4AYYB 1HUTH 3ESTA 1XM1A 2ODPA 1T8NA 3V0XA 2NU4E 1C4Y2 2Z94A 3TIUA 2HWLB 1T8MA 2ZHQH 1GBDA 2FOBA 2UUFB 3MH7A 1RD3B 3SV2H 1JWTA 3KN2A 5L30H 1ZMLA 5HXFA 1IOEA 2V0BA 1GJBB 4R8TB 3BG4B 2AH4X 3MHWU 1BIOA 2BHGA 3UOPA 3KQBA 2Q1JA 1EZQA 1F5KU 1OSSA 2G5VA 1V2NT 5TCCA 3L6PA 2TGAA 1A0LA 4A92A 1QBNA 3SGBE 1MTNC 3CP7A 1TWXB 1QRXA 2H6MA 3DFLA 2V6NA 3KNXA 4OS4A 1IAUA 1M9UA 2R3YA 1AU8A 4GPGA 2QXHA 1O2OA 2UWPA 3M5MA 3MU4A 2WINI 6LPRA 2O8MA 1K1IA 2C3SA 1P9UA 2A45B 4TWWA 2OCVB 1H4WA 1ZTJA 1TMBH 8GCHG 1TOCB 3M3TA 3NK8A 4ZXXH 3ZVEA 1WAYB 1PPFE 2BD5A 1C2EA 2HNTF 1VITH 3A88A 1ZLRA 1O5GH 1Z6EA 1Z8GA 4FU9A 3UR9A 3BTME 2FXRA 3E0PB 3ATLA 1EUFA 1K2I1 1C9PA 1O2YA 1Y8TA 3T5FH 3MYWA 4DT7B 2SNWA 4MG3A 1PJPA 2AMQA 2FOAA 1ZRKA 3QUMP 4ISHH 1FONA 3SNCA 1A0JA 1SGDE 2PUQH 2Y81A 1HV7A 1DSTA 2ANKH 5C1UA 1K1MA 2WPLS 3D23A 1Z8JB 3NUMA 1MBQA 1CA8B 1O3KA 2G4TA 2ZFPH 5FBEA 4AG2A 3DD2H 1A0HB 1P2KA 2BQWB 2FYQA 2C8XB 2CJIA 1GBIA 1GJ7B 3OX7U 2RG3A 5EQQA 5K7RA 6GCHF 1HBTH 4IN1A 1QFKH 4INKA 1EOJA 5EG4A 2BVSH 3B9FH 1UTMA 1WTHD 1FAKH 1JXPA 3SGQE 3L3TA 2VJ1A 5PTPA 1O3JA 1EXFA 4JZFH 2P95A 3BEFB 5EOKA 5IDKA 1WSSH 4A1TA 1KLIH 5JBTA 2B8OH 3AW1A 1QL9A 5CHAB 4K1SA 2ZQ1A 4ASHA 2TGDA 4JYVH 2A4QA 4BXWA 3GDUA 1IQIA 2OBOA 3SUGA 1SFIA 3O8CA 1V3XA 4K69A 3MO3A 3ENSB 4OS2A 2ZDMA 1YLCA 4Y8YA 2WYGA 2PUXB 2QXJA 1YPKH 3MO9A 5C3NA 1QBOA 1O2PA 5E8EH 1QA0A 2OBQA 1KXFA 3GY4A 1YCPK 1AE8H 1ELBA 3EA9A 4X0WU 1P09A 1XX9A 1NM6A 4YOGA 2RDLA 1O5DH 1UO6A 2HRVA 1GHBG 2BLWA 2BY9X 1UHBA 3ZVBA 2HPPH 4BOHA 1E37B 1GBFA 1P0SH 3IITA 1RRKA 3LJJA 2PLXA 2EI8A 4YT7H 2A31A 1AZ8A 1ZGIA 1X7AC 1MAXA 1GBLA 1QL7A 8GCHF 4AFZA 3RLWH 2B0FA 1VCPA 2BDHA 3QZQA 3KQDA 3GOVB 3BSQA 1RS0A 1A7SA 3BTHE 4FUDA 1HDTH 3BEIB 4XE4A 3SNBA 4E05H 5FXLA 1MBMA 3S9AA 4NWLA 5F8XA 3LONA 4IS5A 1NC6A 2R0LA 1V2ST 3RU4D 3QDZB 1MKWK 3KL6A 1TNJA 2GMTC 1ANDA 1MD7A 3CS7A 1P3CA 3GCTF 1UHBB 2G55A 1BTUA 2ODQA 1O2LA 1Z6JH 2ZG0H 4DVAU 1YM0A 1ZMJA 4AFUA 2CF8H 5FX5A 4WH6A 1SHHB 2VGCC 3RXCA 1MH0A 5K0HA 5BRRE 3E1XB 1NFUA 3KGPA 2LPRA 3E6PH 3LC3A 1GPZA 2CGAA 5I25A 1N6YA 1IQKA 3K6YA 4DIHH 4F4OC 5DP9A 1QB9A 1TNGA 2JH0D 2SGPE 1Y3XA 1FI8A 1BBRE 2FO9A 4ZROA 2QGRA 3A7WA 1TABE 2WV5A 2ZU2A 5H4IB 4UONA 1QCPA 3QLPH 2P93A 1P02A 3OY5U 3A89A 3A7VA 4XFQA 4QT8C 4B1TA 1G2MA 1SC8U 2STAE 5T3HA 3A8AA 4ABBA 1MTWA 4NIWA 3KF2A 4ESTE 4KTUA 3UUZA 4XBCA 1TALA 4FUIA 2Q6DA 3FP7E 3EYDA 5HGGA 4H4FA 1AD8H 4TPYA 4X1PU 2FPZA 3IG6B 5F03A 1HB0B 3MH4A 4OS5A 4NG9H 2ZZUH 2ANMH 1S83A 3HK6B 4HGCA 1ETTH 4B73A 5JBAS 2J34A 1PPEE 5J4QA 6CHAC 4A7IB 3M7QA 1GHBF 2P3FH 3Q3KA 4Y11E 2FX4A 1NRRH 4CRCA 4MQAA 1C5OH 3ZYEA 1MTVA 1BUIA 1GJ6A 5A2MH 4ABIA 1GHVH 4MTBA 1GJDB 1HNEE 1EQ9A 1UVPA 3A8BA 1QB1A 1O3LA 1MMJN 1SGFG 1C5XB 5EW2H 1C1PA 1F0UA 1TYNA 4DG4A 3S9BA 3NCLA 1C5ZB 1XUKA 1H8DH 2YOLA 1SI5H 1A46H 1FZZA 4GCHF 4CBOA 1P2MA 1J8AA 4WXIA 1O3BA 2C8YB 2XBVA 2A7CA 2O8LA 1C5TA 5C1YA 1GCDA 2GT8A 3T28A 4IW4E 2WPKS 1IQFA 2ZU4A 2NU1E 1ZGVA 1QURH 2FOGA 1HAGE 1PYTC 1S6FA 4NA8A 3M7TA 3U8OH 1A2CH 2GVFA 2A5IA 3AW0A 1UTKA 1GHAG 4Q7YA 1O2JA 1EP5A 1MU8B 3LGTA 4WVPE 1P2IA 1TRMA 2VIQA 4CBNA 2HNTC 1BQYA 5F6MA 1QRZA 4ZKOU 1F5RA 4HFPB 3VXEH 4FXGH 1MCVA 3MO6A 2EA3A 3S7KB 8KME2 1FDPA 2F9VA 1UVOA 2XWAA 1YPLH 1OP2A 2FOCA 1YF4A 2Y5HA 4YTAA 2H5CA 4DCDA 2A5KA 4NIVA 4Q80A 2R0KA 1C1UH 2ILNA 1XUIA 3M5OA 1FV9A 5C5NA 3RMNH 1GBCA 1CA0C 1GGDC 1MD8A 1PFXC 3F6UH 1EB1H 1EAWA 2Z3EA 3TNSA 3UTUH 3SU5A 3BV9B 4BAQB 5GDSH 1TNKA 5C5OA 4LZ1H 1KTSB 4RSPA 2H9TH 1P8VC 3SUEA 1KYNA 1D6WA 2IN2A 1Y5AT 1MAYA 2XYAA 3KQCA 1FY5A 1O3MA 2ZEBA 4Y71A 4D7GA 1LPKB 4ISIH 1CA0B 2JETC 5EXLA 1TRYA 1AGJA 1AZZA 4X8SH 3DA9B 3AAVA 1KY9A 1TX6A 5E0HA 1MU6B 1QJ7B 2ALPA 1SGQE 1UK4A 3BTEE 5DKMA 4CHAC 1QR3E 1EPTA 1ZZZA 1S0RA 1GDNA 2Q6FA 5ABWA 3MNBA 2XC4A 1QTFA 1BTHH 2AERH 4DY7B 1CT0E 3BTWE 3SU2A 2PTNA 1G36A 1EASA 3E8LA 3RXUA 2R3UA 1SHYA 2XCNA 2VWMA 1EPTC 3ZZBA 4BTIB 2IOTA 2QXIA 4B2CA 5L2YH 1SBWA 4I8JA 1P04A 1BITA 2ZWLH 5ESTE 3MU8A 1EAUA 1K1OA 2FTMA 3UOUA 2XTTB 1FY3A 1P11E 1SQOA 1THPB 1CHOG 1KIGH 2ZFQH 2GP9B 4FVBA 5GCHF 1LCYA 2BOKA 4THNH 1EPTB 1AY6H 1GHYH 3Q3XA 3M5LA 1VCQA 2W26A 4U2WA 3TH4H 4K60A 5GWZA 5AVDA 2BMGB 2Z9GA 2BLOA 1ELFA 1DM4B 1P2JA 2NWNA 3SV7A 1GMHG 1V2JT 1GDQA 1NN6A 2BDIA 1A5IA 1UCYK 4ZH8A 4UFFH 3BTKE 1PQ8A 2ZFRH 1ACBE 4TY6A 1YPJH 3RXBA 2WPJS 3TK6A 3K6ZA 4I7YH 2BX4A 2OQ5A 3A7YA 4ZHLU 2QF0A 3TH3H 1DPOA 3RXPA 1ZHMA 1JIRA 4INLA 1D3TB 3M36A 1TQ0B 1BTZA 1GMCG 4X8TH 1GBAA 1P9SA 1K28D 1TPPA 1TNIA 4JK5A 4Y7BA 2FYRA 3RM0H