1F0TA

Bovine trypsin complexed with rpr131247
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Crystal structures of human factor Xa complexed with potent inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f0tA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f0tA02
1YKTA 5L2ZH 1GHXH 3DD2H 1GVZA 1JRSA 3AAVA 1C1UH 2A4GA 1GBCA 2Q6GA 4AGJA 1UVUH 1EATA 3UNRA 3EA8A 1MTNC 1QJ6B 4ABJA 3SU5A 1LVOA 1ZPZA 4J2YB 2XC0A 5A2MH 1ESBA 1SR5C 5JBCS 2JETC 1DLKB 1SC8U 2FYQA 1XXFA 1O2OA 3FZDA 1BJVA 1E38B 1EX3A 5BPEA 1XUIA 1L2EA 1C2IA 2QGRA 1C2GA 1UK2A 1H8IH 1QY6A 2F9PA 2F91A 4IMQA 3I78A 2CV3A 3RXHA 3ZVEA 4KTSA 1P3CA 1P9UA 3P17H 2OINA 1GMHF 1C5LH 2AYWA 2CJIA 3KGPA 5AHGH 1A5HA 1HBTH 4AOQA 3SU2A 1AIXH 2V6NA 1MKWK 1GBJA 3A7YA 3RXOA 3JZ1B 1ARCA 2OUAA 3LU9B 1EOLA 1W7GH 5HYOA 1TPOA 3SGQE 4AYVB 1HJAC 3RXTA 2FI4E 2ZHQH 5T6DA 2P93A 1YLDA 2G51A 1XM1A 3EDXB 5LH8A 3M5OA 4YT7H 3RXSA 1YCPH 2VIDA 2ZDVH 1DY8A 2AGIX 1N6YA 5E8EH 2CF8H 1SHHB 2BLWA 2FTLE 2OD3B 1OS8A 1O3GA 1C2KA 4OS4A 1VCPA 2ZFSA 1K1PA 3PWCA 1E37B 3ZVDA 3ZV9A 1N1LA 3LGYA 1T8NA 2V3HH 3ZZ8A 3ITIA 1MCVA 4SGAE 1GMCG 5AVDA 1V2RT 5BRRE 1GMDF 1C5UA 1NC6A 2FLRH 4XFQA 1QRXA 4NCYA 4UE7H 2ZHWH 1VGCC 2Q6DA 1BMLA 2R3YA 4ZKRU 3VGCC 3MH7A 1UK4A 4CHAC 1Y3XA 5FBIA 3LT3A 1JRTA 2GZ9A 3P92A 2EC9H 1CSOE 2BYAX 3SU6A 1M9UA 4YLQH 1G2LA 1FDPA 1XKAC 1CBWC 1DICA 1O32A 3SJOA 3GCHC 5E0GA 1GJ9B 2P3TB 2ZPSA 1XUJA 1A5IA 4NZLA 1KXDA 1S0QA 1LHFH 3UREA 4Y8XA 1DWCH 1QNJA 3M3SA 1FLEE 2ZCHP 2ALPA 5HM9A 1WQVH 2F9VA 2Z9KA 2VIPA 4H42U 3S7KB 1V2OT 3Q3XA 1AY6H 1HJ8A 1G9IE 4JCNA 1BJUA 3LJJA 5EXLA 1RRKA 1LVYA 2AMDA 5I46H 4XDEA 1UTLM 2F9BH 1UCYH 4A6LA 1Y5UT 2V3OH 3PTBA 4NG9H 3LGWA 4Y8ZA 5DP6A 4Y7AA 4LOYH 4DIHH 1Y3VA 2FOAA 1JOUB 3A7ZA 2PGBB 5T6FA 4GHQA 1C1SA 2PTNA 3RXGA 3DUXH 1UO6A 1GJ7B 1ANDA 2ZFRH 1YPHC 1GBIA 3KCGH 5DG6A 3V0XA 2WPKS 1C5XB 3A7TA 1LO6A 1JWTA 1DLEA 5GJ4B 1T4UH 1PQ7A 2CGAA 3RXMA 3MNBA 2XBWA 3DHKH 1ZMNA 4CRAA 2QC2A 4MNYA 8ESTE 1TBRH 2AIPA 4IBLH 5L2YH 1XUGA 1SGFA 4ISNA 4JK6A 2GMTB 3PTNA 2GCHF 4K8YA 3GCTF 5ESTE 4NSVA 2GDDA 2VGCC 2C3SA 2FWWA 4JZDH 3C27B 1RFNA 3SQEE 2Z9LA 1LHDH 2BY6X 4FUBA 3E3TA 1SG8B 1C1TA 1XUKA 1EP5A 2A45B 1TQ7B 3SJ8A 1U6QA 1TMUH 1NFYA 3S69A 2RA3A 3U8RH 4AGKA 1K1NA 4CH2B 1Y5BT 3NUMA 5EW1H 1BTYA 1LVMA 1O3EA 2A5AA 2B0FA 3LGIA 3SBKA 2A7CA 1YC0A 3UQVA 1EJNA 3GY7A 2G55A 3MNCA 4HZHA 1OYQA 2OC0A 3SV7A 1BTXA 1Y3YA 5JB9S 4Y6DA 2BVXH 1UMAH 1G36A 2B5TB 1H9HE 1O2TA 2OLGA 4CREA 1BRBE 5FPSA 1NO9H 1IHTH 5DGJA 3CP7A 4GCHF 4RKJB 2VH0A 4BAOB 1O2IA 1C9TA 3SORA 1LPZB 1N6XA 1S5SA 2J92A 2ZKSA 4OS6A 1CGHA 1V3XA 2XBVA 3I77A 4NFEA 1XVMA 5J4QA 2ZU5A 1UCYE 1VZQH 4INLA 1EZQA 2EI6A 1GBKA 3D23A 1AQ7A 2QA9E 3NPSA 3KN2A 1ELGA 2FPZA 4GSOA 3RM2H 1S82A 1TGBA 1EJMA 1FN8A 3SGBE 3UNSA 1GHYH 4GLYA 1C1VH 2PHBA 3URCA 2W3IA 1TX6A 3AW0A 4ASHA 2J94A 3SV9A 2C4FH 2XBXA 1F2SE 5DJ7A 2VWLA 1O39A 1GWAA 4UDWH 1O3JA 4XBDA 5EODA 4M7GA 1C1OA 1YLCA 3PO1B 3UOUA 3K9XB 2Y5GA 5J4SA 1ELFA 1C2EA 1AKSA 3QWCH 1C2MA 1ZRBA 2ZDMA 1WOFA 1XVOA 1BB0B 1GI8B 1HNEE 2H2ZA 1PPCE 1HAGE 5TJXA 3ZVGA 1O5BB 1GI9B 1C4V2 5DPAA 4I8HA 2AGEX 1GG6C 3V3MA 1O3MA 2R2WU 4XBBA 2VIQA 4ZXYH 2FXRA 2A7HA 2FMJA 2A1DB 2WPLS 2BY5X 1L1NA 4UONA 1V2QT 1Y8TA 3LOXA 2QXGA 2NU3E 3ATKA 3ZZDA 4X1QU 1CGJE 2FI5E 4X6MA 1C2DA 2Y80A 2ZDNA 2GTBA 1BBRH 4DOQA 1AFQB 1DFPA 1LVBA 1O2QA 3U1IB 3S9BA 1P0SH 3F68H 2OBQA 1PQAA 4XSKU 1KDQB 4AFUA 3L33A 2PKSB 3B23B 3QN7A 1CT0E 3KF2A 3ENSB 2GVFA 1KIGH 3A8CA 2ZQ1A 2ZTXA 4MLFB 4GUXA 1RIWB 3TGIE 2SGPE 3OYPA 5A8YA 2OC8A 1O2HA 3RLWH 4MPXA 1TA2A 1LQDB 4D8NA 1AMHA 1GPZA 4O03A 1YBWA 3U9AH 2Y7XA 3LH1A 3BTDE 5JYIA 2ZU4A 1Z6EA 3QUMP 1EB2A 3PV4A 1GI4A 1YYY1 3ZZBA 2WUCA 2VWMA 5DP7A 2ZF0H 4I8LA 2C93B 2VH6A 2ZIQH 7LPRA 1GDUA 2QF3A 4KTCA 1IQGA 3BTEE 3K6YA 1GI7B 1WV7H 5EGMA 1KLJH 2Z7FE 3SUGA 2FLBH 1DT2A 1OP8A 1BMNH 5CMXH 2BY8X 2FYRA 1TNKA 1SGIB 2A7JA 1A3EH 4WMDA 1C5VA 1HIAA 3QO6A 4X1SU 2IJOB 4WF8A 3A7XA 3AW1A 1X7AC 4ABFA 2HRVA 1DUEA 7GCHG 1W0ZU 1C4Y2 5DO4H 3KL6A 3HPTB 4Z6AH 1E0FD 2FX4A 2HNTE 2BDCA 1EZSC 2J38A 3M7UA 4WH6A 3TJNA 1ZGVA 3K6ZA 2O8MA 1P8VC 4DY7B 2ZDAH 1D6WA 2C8ZB 1TNGA 2QAAA 4Q7XA 5EPNA 4X2YA 1EPTA 1C2FA 2BX4A 2WPMS 4A1TA 2EI7A 1FY1A 4I8KA 3MO6A 2BTCE 4QT8C 1PPHE 1NRNH 2PW8H 3OY5U 1GBDA 4B73A 4ISHH 3KHVA 2ZTYA 5I25A 4A5TS 3QLPH 1FONA 4TY6A 3BG8A 2BD7A 4MDSA 3VB7A 2XNIA 2QF0A 2H9TH 1Z1JA 2IOTA 2ZCLP 3VXEH 2DUCA 3E1XB 1EB1H 2FEQH 4CRGA 3TGJE 2XW9A 1W11U 3SV6A 4XBCA 2A5KA 1A46H 1W8BH 3MI4A 3I29A 3BEFB 1T8LA 4B2BA 1C5ZB 2WINI 2A4OA 3MYWA 1FQ3A 4K5ZA 1OX1A 3OU0A 3UR9A 2GD4B 3ZZ5A 3SUFA 1TA6A 4CRDA 1ELAA 1XUFA 2HOBA 4AG1A 4AFSA 2HALA 1ZMLA 5DP8A 4ZXXH 5EQQA 3A80A 3NK8A 1GJ5H 2HGTH 2RA0A 1QRZA 1DUAA 2RG3A 3E91A 5EQRA 2XC5A 1O5AB 1NESE 3ZZAA 2UUYA 4I8GA 3IITA 4ABHA 1YP9A 1C1RA 4O9VA 1F0UA 1DITH 4BNRA 1K9OE 1NTPA 3MFJA 1FPCH 3MH6A 3A88A 6GCHF 1TALA 4AG2A 4FUFA 1SGFG 4CRFA 5SGAE 2KAIA 3RMMH 3EAJA 2ZGJA 3SU0A 1HCGA 1ZSJA 3AAUA 4J1YA 3K65B 1OP0A 1FJSA 2GV7A 2OXSA 4ZROA 4JK5A 1CHOG 4UFFH 1V2WT 4JYTA 1GBFA 2ZO3H 2HWLB 1O3HA 3BEUA 1G3BA 4FU7A 2GCTC 1AN1E 3EYDA 1IQJA 2ODQA 3RUOA 1C5NH 1HRTH 1DWBH 1MU6B 3A8BA 2GT8A 7ESTE 4IN2A 1DPOA 1JIMA 1N8OC 1QBNA 1T32A 1J16A 1C4U2 5FX5A 1G37A 1O31A 1QL7A 3FP8E 1ZR0A 3GDUA 4BAMB 5GPIB 3DFLA 4FUJA 1MQ5A 3HATH 3L6PA 1FAXA 2BLVA 1UTKA 1ETRH 1TPAE 2G00A 1Z1IA 1BRUP 3EQ0H 4YLUA 1VITG 4IC6A 4GVUA 1F0TA 1L1GA 2ANWA 1JXPA 2P8OC 1GI0A 4DW2U 2TPIZ 3QTOH 2G52A 2ZHDA 3RXKA 3A85A 1O3KA 4Y76A 2VWOA 3TJOA 2J9NA 2ODPA 4D9QA 1HLTH 1AU8A 3ZZ7A 1Y59T 2Y6TA 2AMQA 1RXPA 2ZTZA 4H4FA 2XCFA 2ZEBA 3B9FH 2STAE 3MH5A 8GCHG 1L0ZA 1SGYE 4X6NA 1P12E 3MU4A 1Z71A 3GISB 3CENA 2P3FH 1NM6A 3MMGA 3F9HA 5JB8S 2SGAA 2ZHFH 1F92A 2NWNA 1O5DH 2PGQB 1ZMJA 3URDA 7GCHF 2EI8A 1MKWH 2W7UA 2J34A 2XWAA 1TAWA 4YOJA 1MUEB 1KLTA 1XX9A 3GY8A 1D6RA 2C90B 2BY7X 3RU4T 1D3DB 1V2MT 3ZVAA 2BLQA 2R0KA 5F8TA 3HKIB 1EAIA 2EA3A 3F9GA 3Q00A 3KEEA 5CE1A 2A31A 3M7QA 1UTOA 3P6ZB 1C2HA 4JZIA 1C1NA 2G4UA 2O9QA 1G32B 1DDJA 3BG4C 4ABDA 1KXEA 5C67A 1GHVH 4I7YH 3E6PH 5FPTA 1CHGA 1G3CA 1OWIA 1VITH 1C5OH 1O5GH 1PPZA 3GCNA 3T28A 1AWHB 1FIZA 2F9OA 2O8WA 3S9CA 2ZA5A 3MO3A 2YNAA 1RTLA 3ESTA 3RXEA 1G3EA 5A09A 4NIXA 2ODYB 1GI5A 1GJ8B 1DSTA 1P2MA 4U32A 1A0HB 1O35A 4JMYA 1ORFA 3MHWU 1UHBA 3UOPA 2TGDA 1KXBA 1TLDA 3SN8A 3P8NA 2FO9A 3M3TA 5E0JA 1XUHA 3TH4H 1NY22 1WTGH 2SFAA 3RXVA 1BHXF 2V0BA 1AKSB 1V6DA 1EUFA 1ZRKA 3RXRA 4MQAA 2G8TA 3A7WA 3OTJE 1QL8A 4TWYA 2TGAA 1AWFH 1A7SA 3UFAA 3A82A 5C5OA 2VIWA 4B74A 3SNDA 3SJKA 1NU7B 1GBAA 3NCLA 1HJAB 3SW2B 2VINA 1HFDA 1V2LT 4AB8A 4ZKOU 4I32A 1QB9A 1K1LA 1CHOF 1LKBA 2GZ8A 4IN1A 4B76A 1NRPH 3TNTA 3MU8A 2FM2A 8LPRA 2GZ7A 2BX3A 1BOQA 1G30B 1DVAH 1O3CA 4JYUH 3A87A 3E8LA 1O3AA 2FOCA 4WWYA 1NRQH 4FVBA 4AZ2B 3PB1E 3EA7A 1NFWA 1HAOH 2BVRH 1FI8A 2P95A 3FANA 1LHCH 3TJUA 3KQEA 4K8BA 1UTQA 1ZZZA 2O8UA 2DE9A 1VGCB 1AZZA 1RJXB 3MOCA 3AASA 5GXPA 3VGCB 3W95A 1ESAA 3SGAE 4BXWA 3LJOA 3UPEA 2Z3EA 5K0HA 1CGIE 4NA9H 2BZ6H 1MKXK 3KIDU 3Q3KA 3PM3A 1AVWA 1CBWB 4ZHAA 1HAXB 5IYTA 2DE8A 2O8TA 2OP9A 2CMYA 1D4PB 1UVPA 4NA7A 1MTSA 3SHAH 8GCHF 2WPHS 1LKAA 2Z94A 1TMTH 1A61H 2ZECA 1LMWB 2ASUB 2OTVA 3VB3A 3ZV8A 2V35A 5ESBA 1WCZA 3CS0A 2JH0D 2AMPA 4OS5A 4ZHMU 2NU0E 5DP5A 1TPSA 3OX7U 1QRWA 2UUJB 2YOLA 2FESH 1J9CH 1HIAB 1PYTD 1MTUA 3UTUH 1WYKA 5FAHA 1UTNA 1TQ0B 4ISIH 1CO7E 2Q6FA 1P2KA 3V12A 4LK4A 2ZNKH 1S83A 4R0IA 4BXSA 1SHYA 4B75A 1FY3A 4YESB 1D3PB 3C1KA 1VR1H 5LGOA 2B9LA 2W7SA 3EA9A 1GHBG 3S0NA 4X8VH 4WXVA 2GMTC 3VB5A 1Y5AT 2OCVB 3N7OA 2FS9A 3PLKA 2Y7ZA 4BAKB 4Q80A 1PYTC 1EPTB 5GCHG 4BTUB 2CHAC 4ABAA 1EKBB 3EE0B 1C5RA 4D9RA 4Q7YA 1EZUC 1NT1A 1BITA 4INKA 2ZCKP 4LZ1H 4K69A 5F03A 2BHGA 1V2TT 4AN7A 1LPKB 4WH8A 4MPWA 3MU0A 2WPJS 1BT7A 1O2RA 2A0QB 1GJBB 1YPLH 1MCTA 2QN5T 2FOGA 1UVOA 4Y7BA 1SB1H 3RMOH 4K1TA 2W26A 4DURA 1GI6A 1AUTC 3UWIA 1C5MD 4JZEH 4KKDA 5A8XA 5DK1A 1D3QB 1DXPA 2BOKA 1EXFA 1K28D 1O2LA 5C2ZA 3HK6B 1ANCA 1QA0A 1JBUH 5B6OA 3BTTE 3LGTA 5A0AE 1S81A 3TJVA 3T5FH 2H9HA 1QR3E 4XOJA 1AVGH 1FUJA 1UVTH 4CR9A 5L30H 4HFPB 2JH6D 1LTOA 3TH3H 3ZVBA 3FP7E 1TNHA 2A2QH 1P2IA 2NU1E 3QDZB 1GMCF 4H6SB 4OGXA 5C3NA 2UUFB 4FUGA 1DOJA 2QIQA 1DXWA 1TNLA 2KAIB 1PJPA 1YPJH 2XXLA 3QZQA 4MVNA 3RM0H 1ZHRA 1O2SA 1OYTH 1C5PA 3LDXH 1K22H 2XWBI 4IGDA 4YO9A 1GHWH 1OKXA 4CR5A 1RTFB 2OBOA 1W2KH 2SGQE 4INHA 3P70B 1BMAA 2K1QA 5C1YA 3MNSA 5JPMH 3A89A 1LHEH 1Z8IB 1W10U 1SGQE 3BEIB 1QJ7B 2H5CA 3PO1C 2VVUA 1QIXB 2BVSH 3BF6H 2AIQA 4KTUA 1GCTB 1QL9A 1YPMH 2QXHA 2BZAA 3TGKE 4Y71A 2ZFPH 3F9EA 3A8DA 5AFZH 1MBMA 2R9PA 2UUKB 5LPFA 1FMGA 1TX8A 2PFEA 4A7IB 9ESTA 1MD7A 5JBAS 1EAWA 1CA0B 3U8TH 1S6FA 1G2MA 1VCWA 1HAIH 2CN0H 2UWPA 4TY7A 1P10A 3VFEA 1EP6A 1O2ZA 5TCAA 1ZHPA 4ZH8A 2BD2A 1YPHE 2HPQH 1ELEE 1BQYA 2BDHA 3QTVH 4YOIA 2R0LA 1FZZA 1IQHA 4I33A 2H5DA 1S84A 1QQ4A 2TGPZ 3PMJA 5JBBS 4KELA 1NS3A 1WBGB 1C2JA 1CT2E 1QA7A 3A84A 1MD8A 2BQ6B 1QQUA 2FOBA 2XRCA 3Q3YA 3P95A 4NIWA 3SV2H 3FZZA 2H6MA 1FNIA 3IWMA 2Y81A 1NN6A 4Y0ZE 1AFEH 1GI2A 1THSH 2XCNA 2UWLA 3SO3A 1P2QA 2W3KA 1Z6JH 1YCPM 1Y3WA 2QCYA 4O97A 3P8FA 1GI1A 1MQ6A 1O2YA 2BD9A 3VEQB 3RC4A 2M5TA 3O8DA 2Y82A 5FXLA 2OQUA 1O3IA 3GY2A 2Z6BD 3SNBA 4B2CA 3S9AA 1C9PA 4UEHH 1GGDC 1W0YH 2THFB 1FXYA 4U01A 4GPGA 1MTVA 3OY6U 1GHAG 5E2PA 3M5LA 3LGVA 1K1OA 2BMGB 3ATWA 3SNEA 2GKVE 1Z7KA 1UJ1A 1L4DA 4JZFH 1JMOH 1SQAA 1RTKA 1HAYB 2CXVA 2BDYA 4WXIA 2VVVA 3ODDA 1UHBB 2BXTH 2J95A 5EQSA 1EASA 3S7HB 1ETTH 3A81A 3VXFH 2UWOA 4MTBA 2AH4X 5K7RA 1IQNA 3RXAA 1O33A 1KYNA 3GICB 5EW2H 2GGVB 2VB0A 3GY3A 4RSPA 2LNCA 3UR6A 1JIRA 3BTME 1GDNA 1TGCA 4X6PA 3RXLA 3V13A 3LC3A 5EPYA 4ABEA 3BIUH 1C5SA 2PR3A 1PPBH 2SNWA 4F49A 1TGNA 1ZSKA 1MAXA 1AD8H 1O37A 2ZGXH 1ZSLA 2FOEA 2C8YB 2A32A 1THRH 2QXJA 2Z3DA 5E0HA 5HMAA 1C5TA 1ESTA 1TBQH 1AB9B 1GJCB 1T8MA 2H9EH 2A4RA 2BM2A 2O8LA 4MNWA 1YGCH 1QHRB 1J8AA 1SGDE 2W5EA 3R3GB 1Q3XA 1DSUA 2BOHB 2C8WB 2BD4A 3BIVH 1B0EA 1GMHG 2P3UB 1C1PA 1ZPBA 2BB4A 1MU8B 4GHTA 1YPKH 2AERH 1AZ8A 3BTWE 3GY5A 4CRBA 6CHAC 2ESTE 5T3HA 4TPYA 3U98H 4DVAU 3KQCA 5GIBA 1K1JA 4E06H 3NWUA 1FV9A 2FIRH 4DG4A 1DM4B 2B8OH 4X2XA 1O0DH 1HB0B 4X0WU 1AHTH 1O2KA 2PWXA 3AVZA 1GJAB 3QGJA 3DFJA 1LHGH 3SU4A 3ATIA 3RXQA 3BTFE 2BDGA 2Y5FA 4AFZA 1TMBH 1XMNB 3M3VA 1RS0A 2ZI2H 1Z8RA 4CH8B 2F83A 1FN6A 5DP4A 1OXGA 1SGEE 4NZQA 4YTAA 1O3FA 2JKHA 5ABWA 5TCCA 1FY8E 3KNXA 1O38A 1W14U 1RGQA 1P2NA 1NZQH 4UFDH 2WYJA 8KME2 1C1QA 3RXCA 1P01A 3R0FA 3DA9B 1HAVA 1NFUA 5EXNA 1GI3A 1F0RA 1GCDA 5CHAC 4YOGA 2ZG0H 3E90B 3E0PB 4ZAEA 2D2DA 3M36A 3V7TA 1FPHH 2ALVA 1N8OB 9LPRA 2H1UA 4Y79A 3RDZA 4FU8A 1TYNA 1ZHMA 1TOCB 1HXFH 1OWHA 1OWEA 1P04A 2RCEA 5IDKA 3GYLB 3M5NA 2QXIA 4X8UH 4VGCC 3RXFA 2P8OB 3PMAB 1O2PA 3UUZA 3UWJH 1BIOA 4YZUA 4A92A 2R2MB 1OWJA 3K2UA 3NZIA 3TLOA 1DE7H 3KQBA 2F9UA 3DT0H 5DP9A 3P8OA 3ZVFA 3BSQA 3SJ9A 7KMEH 2AEIH 1FY5A 4AORA 4B71A 3T26A 5FHTA 1TBZH 4K1SA 1BTUA 1ELDE 1HJ9A 2ILNA 4O3UA 4XE4A 2BD3A 1IOEA 2ZGBH 2GDEH 1P05A 3D65E 2QY0B 4CBNA 5JBTA 4NA8A 1OWDA 2WV4A 3H7TA 1CVWH 4THNH 3PYHA 1TRNA 5A0CA 1C5QA 1SQTA 2ZPQA 2BD5A 2A5IA 1E36B 2VNTA 3U8OH 1F7ZA 2WUBA 1O2WA 2SGFE 5GDSH 4BAHB 3TU7H 1ELTA 5DP3A 1MTNB 1SFIA 2PTCE 4DT7B 1EAUA 2JETB 1B0FA 3SJIA 2AS9A 4ZMAH 1T4VH 1T31A 4BAQB 1ZTJA 4DIIH 4IMZA 1VCQA 1MZDA 2ZU2A 3BG4B 1CE5A 3RMLH 2GCHG 1ANBA 1HGTH 3GCTG 3TK6A 3FFGA 3GY4A 4KP0A 1SFQB 1QJ1B 3BN9A 3T29A 1QCPA 1OSSA 3T25A 1BCUH 1ZJKA 1O2GH 1ARBA 1IQMA 1E34B 1SVPA 6ESTA 2BLOA 4CRCA 3UY9A 1ZTLA 1P02A 1WSSH 5FCRA 1O3PB 3SV8A 2ZZUH 5AF9H 3EGKH 1DX5M 4OS2A 3Q76A 2SNVA 1OP2A 1O2XA 3PWBA 3SU3A 4NWKA 2VU8E 2WYGA 4X2WA 1WQSA 1DWEH 1IQIA 1MKXH 2BQWB 1CA8B 1WUNH 1VJ9U 1K21H 3A83A 3PROA 5FBEA 3T2NA 4UFGH 2FX6A 3BV9B 3O8CA 3MH4A 1FY4A 1V2NT 1SGTA 1GL0E 3E16B 3ZYEA 1H9IE 1UVSH 4UFEH 2OC1A 3SI4H 2ZU3A 3ELAH 3GOVB 3ATMA 3ZZCA 1TWXB 1V2KT 4GCHG 2XC4A 3GY6A 4SGBE 2VVCA 3QZRA 4Q7ZA 1FIWA 2BXUH 5EXMA 3ZVCA 3JZ2B 1ZJDA 2PUQH 2FOMB 1BRAA 1DANH 1PPGE 1O3NA 1P09A 3D62A 1O3LA 1F5RA 2FZZA 3G01A 3M5MA 1P2JA 1W3CA 5LPRA 1VITF 2SGDE 2NU2E 4CHAB 1EJAA 2BDIA 3LC5A 1PPFE 1W12U 3MU5A 1E35B 1TB6H 5A0BA 1PQ8A 1BTWA 1WU1A 4ZKNU 4BOHA 2BDBA 3SNAA 4B2AA 2PKAA 1O3BA 3CS7A 1BZXE 2PSYA 3GCHB 2QV1A 2SGEE 2OQ5A 1YCPK 2ZFQH 1O5EH 4B1TA 3ZZ3A 3U69H 1SQOA 4HTCH 2WPIS 4JYVH 3MO9A 1SSXA 2Y5HA 3QX5H 3ZYDA 1CU1A 4BTIB 3GCOA 1QGFA 1ZYOA 1MH0A 1PFXC 1QB1A 3W94A 3T62A 2HVXA 1A4WH 3MTYA 1O30A 1DS2E 2ANMH 4GAWA 4BTTB 1GDQA 1BA8B 3STIA 2D26C 4K2YA 2A4QA 4E05H 1HAPH 1IQEA 2PUXB 1SMFE 2ZFFH 3M7TA 3RXDA 1C5WB 1Z8JB 4LXBH 2TBSA 1WAYB 3TK5A 4R8TB 3RP2A 4TPIZ 1INCA 2FODA 1NRSH 2I6SA 2STBE 2TGTA 4FUIA 4OS1A 3SZNA 3F6UH 1H4WA 1HUTH 2ZP0H 1P11E 4NGAH 2G5VA 1KTTB 1EPTC 2ZFTA 2ZGHA 2CF9H 4X1RU 1PPEE 1ZPCA 1TPPA 4ABIA 2PLXA 2ULLA 1QBVH 3QGNB 3F1SB 3H5CB 1KLIH 1GJ6A 1NRRH 4D7FA 4Y0YE 4FXGH 3UIRA 1SGPE 1ETSH 1SLUB 1UTJA 2JH5D 1Q2WA 4JZ1A 2Q1JA 4D7GA 2VGCB 1Q31A 2ZQ2A 4O3TA 1AO5A 1AVXA 1GBHA 1V2JT 2CHAB 1HAHH 1EZXC 1UCYK 3SNCA 1O36A 4X8SH 1QB6A 4YT6H 4LZ4B 1SL3A 4NWLA 2AGGX 4DCDA 5EOKA 5F8XA 4A1VA 1NPMA 3RC5A 1SLWB 1V2PT 1TNJA 2XBYA 3RXJA 5F6MA 1VJAU 2PSXA 1S85A 4X8TH 4Z0KA 4D76A 1GBEA 5FPYA 1F0SA 3FP6E 2R3UA 2ZU1A 1SGNE 1TONA 2GX4A 1RD3B 5JDUB 4X6OA 1K2I1 5EG4A 1UTMA 1O3DA 1YF4A 1A0JA 2Z9GA 2ZDKA 3LH3A 1BTPA 2B7DH 3RU4D 4FUEA 1L4ZA 4E7RG 4Q2KA 5HGGA 1C5YB 2P94A 1ID5H 6LPRA 2HNTC 2FS8A 3M61U 4FUDA 3O8BA 1ABIH 3FVFB 3RXUA 1GJDB 3GDSA 1P03A 2BDAA 1H1BA 2I6QA 3M35A 5ETXA 2P59A 1ZTKA 5PTPA 1IQKA 1D9IA 1GCTC 1EQ9A 1A2CH 1W7XH 2GT7A 1SI5H 1ANEA 4TWWA 1AGJA 1P2OA 4MNVA 1P06A 3VB4A 1YPGH 3H7OA 1A1RA 3T27A 4FUCA 1HAVB 5C20A 4I31A 1CA0C 5EU8A 3HGNA 1O34A 3P8GA 5T6GA 2TRMA 1H9LB 3WY8A 1A0LA 1J15A 2Z9JA 2QYIA 3A8AA 1BTHH 4YM9A 1UTPA 2FOFA 3BTKE 1AFQC 1GG6B 5GWZA 1OPHB 1IHSH 1K1IA 3RLYH 2PKSC 2XTTB 1C1WH 2NU4E 3F9FA 1MTWA 3B8JA 1YM0A 3FAOA 1O2UA 3Q77A 4IW4E 3SI3H 1GVLA 1GBTA 3HK3B 3OSYA 1BDAA 1KTSB 2ZGCA 1RIWC 6GCHG 2Z3CA 1SPJA 1XXDA 4Y11E 4I8JA 3RXPA 3TH2H 1WTHD 1SLVB 2ZDLA 2P16A 2VIOA 5F8ZA 1G3DA 5HM2A 1LQEA 1MAYA 3LONA 1GHBF 1O2VA 5FCKA 1O2NA 2G81E 4PROA 2VWNA 4A1XA 2GV6A 1MMJN 4NFFA 1TGTA 2VIVA 3ATLA 5GCHF 1L1JA 4BANB 1GJ4H 1SOZA 1TE0A 1LCYA 3TNSA 4CBOA 1V2VT 4NIYA 4MNXA 4ESTE 1NFXA 1SBWA 3D49H 1A3BH 4K3JA 1C2LA 3TIUA 1AE5A 1PQ5A 1QURH 1IQLA 1HPGA 2GP9B 1J14A 3TK9A 4AB9A 2AFQB 4H6TA 1TIOA 2XYAA 1B7XB 4OGYA 1GGDB 2HNTF 3M37A 3PLPA 1MZAA 4WVPE 1SOTA 1CQQA 1T7CA 5FX6A 1BBRK 1NU9A 3A86A 1ZOMA 1S0RA 2WV5A 2IPHA 2C8XB 1AI8H 1THPB 1TABE 2G4TA 5L6NH 1ELCA 3PLBA 1HXEH 1HAZB 1V2ST 2FTMA 5AFYH 4AYYB 1S6HA 1ELVA 3ZZ6A 3LKWA 1O5FH 1LDTT 4ISLA 5G4BA 1DWDH 5C1XA 4E7NA 3GYMA 3O8RA 2ZPRA 3E0NB 2FI3E 4FU9A 3VPKA 4WY3A 4ABBA 1TRMA 1XKBC 4FUHA 4UD9H 4X2VA 4U30A 3LGUA 1QTFA 1GL1A 3NXPA 4Y8YA 1O2MA 2FDAA 2EEKA 1H8DH 2ZHEH 1AB9C 3RU4E 1BRCE 1DY9A 1KXAA 5A8ZA 3KQDA 3STJA 1BTZA 1P9SA 4WMEA 4HI3A 1TGSZ 2F3CE 1BBRE 4RN6A 1OOKB 1ELBA 1O3OA 4DGJA 4ZUHA 1OWKA 1BMMH 3LIWA 1GBBA 3LPRA 1GHZA 3SQHE 1GBLA 3HGPA 2YNBA 1IAUA 1AE8H 2FOHA 3SU1A 1C1MA 2FP7B 4MPUA 3PMHB 4U2WA 1YPEH 3NKKA 1IQFA 3MU1A 1P3EA 4X1PU 1MBQA 4KGAA 4Y10E 3HKJB 1NROH 2A2XH 3TVJB 1KXCA 2OC7A 2PKAB 3A7VA 3TPIZ 4K60A 3QK1A 3BTHE 2RDLA 3ZZ9A 1SGCA 1O5CB 4OS7A 3ZZ4A 4WJG2 3RC6A 2VJ1A 3VB6A 3UQOA 1LPGB 1A5GH 4AX9H 5H4IB 4ZHLU 1HV7A 2ANYA 4NIVA 4NSYA 6CHAB 1D3TB 4TYDA 1GBMA 1B5GH 1CT4E 2LPRA 1TRYA 1SLXB 1V2UT 4MG3A 2HPPH 5C1UA 3TITA 2TIOA 2J2UA 3RMNH 1ZGIA 1EOJA 1ACBE 1TX7A 1GMDG 4FVDA 1J17T 3SHCH 2GCTB 2Z9IA 3GDVA 1BUIA 4DJZB 4ABGA 2BQ7B 5HXFA 1F5KU 2ZC9H 5C5NA 1SGRE 1KXFA 1Y3UA 1BHXB 3IG6B 3UNQA 1W13U 1F5LA 3MNXA 2J4IA 4ISOA 1AUJA 1TOMH 1ABJH 1UK3A 1GHAF 5CHAB 2G5NA 4AFQA 1HYLA 1QBOA 3BTQE 3SOSA 1GVKB 4HGCA 5E2OA 4ZKSU 1EAXA 1KY9A 1ZLRA 1KSNA 1O2JA 5LPEA 4RKOB 3MWIU 3BTGE 2F9NA 1T8OA 4X1NU 4IS5A 2BD8A 2D1JA 3SUDA 3ODFA 3L3TA 3SUEA 4F4OC 2BY9X 2PV9B 2ZWLH 4VGCB 4IC5A 3RXIA 1KDQA 1K1MA 4K1EA 1HDTH 1P57B 2ANKH 2D8WA 2HLCA 1FAKH 4WMFA 1QFKH 1Z8GA 2IN2A 3RXBA 3U1JB 4MPVA 3PMBB 1TFXA 1TNIA 5DKMA
chains in the Genus database with same CATH superfamily
1YKTA 5L2ZH 1COWD 1GHXH 3DD2H 1GVZA 1JRSA 3AAVA 1C1UH 2A4GA 1GBCA 3CNRA 3F2FA 2Q6GA 4AGJA 1UVUH 1EATA 3UNRA 3EA8A 1MTNC 1QJ6B 4ABJA 3SU5A 1LVOA 1ZPZA 4J2YB 2XC0A 1WXRA 5A2MH 1ESBA 1SR5C 5JBCS 2JETC 1DLKB 1SC8U 2FYQA 1XXFA 1O2OA 3FZDA 1BJVA 1E38B 1EX3A 5BPEA 1XUIA 1L2EA 1C2IA 2QGRA 1C2GA 1UK2A 1H8IH 1QY6A 2F9PA 2F91A 4IMQA 3I78A 2CV3A 4TT3D 3RXHA 4KTSA 3ZVEA 4M9FA 1P3CA 1P9UA 3WWBA 3P17H 2OINA 1GMHF 1C5LH 2AYWA 2CJIA 3KGPA 5AHGH 1A5HA 1HBTH 4AOQA 3SU2A 1AIXH 5EJZA 2V6NA 1MKWK 1GBJA 3A7YA 5EJ1A 3RXOA 3JZ1B 1ARCA 2OUAA 3LU9B 1EOLA 1W7GH 5KEDA 5HYOA 1TPOA 3SGQE 4AYVB 1HJAC 3RXTA 2FI4E 2ZHQH 5T6DA 2P93A 1YLDA 2G51A 1XM1A 3EDXB 2W6ID 5LH8A 3PV2A 3M5OA 1S6LA 5F53A 4YT7H 3RXSA 1YCPH 2VIDA 2ZDVH 1DY8A 2AGIX 1N6YA 5E8EH 2CF8H 1SHHB 2BLWA 2FTLE 2OD3B 1OS8A 1O3GA 1C2KA 2WV9A 1VCPA 1H8HD 4OS4A 2ZFSA 1K1PA 3PWCA 1E37B 3ZVDA 3ZV9A 2XNDD 1N1LA 3LGYA 1T8NA 2V3HH 3ZZ8A 3ITIA 1MCVA 4SGAE 1GMCG 5AVDA 1V2RT 5BRRE 1GMDF 1C5UA 1NC6A 2FLRH 4XFQA 1QRXA 4NCYA 4UE7H 2ZHWH 1VGCC 5KGOA 2Q6DA 1BMLA 2R3YA 4ZKRU 3VGCC 3MH7A 1UK4A 4CHAC 1Y3XA 5FBIA 3LT3A 1JRTA 2GZ9A 3P92A 2EC9H 1CSOE 2BYAX 3SU6A 3SZEA 1M9UA 4YLQH 1G2LA 1FDPA 1XKAC 1CBWC 1DICA 1O32A 3SJOA 3GCHC 5E0GA 2K0QA 1GJ9B 2P3TB 2ZPSA 1XUJA 1A5IA 4NZLA 1KXDA 1S0QA 1LHFH 3UREA 2J97A 4Y8XA 1DWCH 1QNJA 3DSPA 3M3SA 1FLEE 2ZCHP 2ALPA 5HM9A 1WQVH 2F9VA 2Z9KA 2VIPA 4H42U 3S7KB 1V2OT 3Q3XA 1AY6H 1HJ8A 1G9IE 4JCNA 1BJUA 3LJJA 5EXLA 1RRKA 1LVYA 2AMDA 5I46H 4XDEA 1UTLM 2F9BH 1UCYH 4A6LA 1Y5UT 2V3OH 3PTBA 4NG9H 3LGWA 4Y8ZA 5DP6A 4Y7AA 4LOYH 4DIHH 1Y3VA 2FOAA 1JOUB 3A7ZA 2PGBB 5T6FA 4GHQA 1C1SA 2PTNA 3RXGA 3DUXH 1UO6A 1GJ7B 1ANDA 2ZFRH 1YPHC 1GBIA 3KCGH 5DG6A 3V0XA 2WPKS 1C5XB 3W1EA 3A7TA 1LO6A 1JWTA 1DLEA 5GJ4B 1T4UH 1PQ7A 2CGAA 3RXMA 3MNBA 2XBWA 3DHKH 1ZMNA 4CRAA 2QC2A 4MNYA 8ESTE 1TBRH 2AIPA 4IBLH 5L2YH 1XUGA 1SGFA 4ISNA 4JK6A 2GMTB 3PTNA 2GCHF 4K8YA 3GCTF 5ESTE 4NSVA 2GDDA 2VGCC 2C3SA 2FWWA 4JZDH 3C27B 4P02A 1RFNA 3SQEE 2Z9LA 1LHDH 2BY6X 4FUBA 3E3TA 1SG8B 1C1TA 1XUKA 1EP5A 2A45B 1TQ7B 3SJ8A 1U6QA 5CHBA 1TMUH 1NFYA 3S69A 2RA3A 3U8RH 4AGKA 1K1NA 5HKKD 3PRDA 4CH2B 1Y5BT 3NUMA 5EW1H 1BTYA 1LVMA 1O3EA 2A5AA 2B0FA 3LGIA 3SBKA 2A7CA 1YC0A 3UQVA 1EJNA 3GY7A 2G55A 3MNCA 4HZHA 1OYQA 2OC0A 3SV7A 1BTXA 1Y3YA 5JB9S 4Y6DA 2BVXH 1UMAH 1G36A 2B5TB 1H9HE 1O2TA 2QF5A 2OLGA 4CREA 1BRBE 4FETA 5FPSA 1NO9H 1IHTH 5DGJA 3CP7A 4GCHF 4RKJB 2VH0A 4BAOB 1O2IA 1C9TA 3SORA 1LPZB 1N6XA 1S5SA 2J92A 2ZKSA 3EE7A 1CGHA 1V3XA 2XBVA 3I77A 4NFEA 4OS6A 1XVMA 5J4QA 2ZU5A 1UCYE 1VZQH 4INLA 1EZQA 2EI6A 1GBKA 3D23A 2F43B 1AQ7A 2QA9E 3NPSA 2JJ1D 3KN2A 1ELGA 2FPZA 4GSOA 3RM2H 1S82A 2VBCA 1TGBA 1EJMA 1FN8A 3SGBE 3UNSA 1GHYH 4GLYA 1C1VH 2PHBA 3URCA 2W3IA 1TX6A 3AW0A 4ASHA 2J94A 3SV9A 2C4FH 2YMSD 2XBXA 1F2SE 5DJ7A 2VWLA 1O39A 1GWAA 4UDWH 1NBMD 1O3JA 2HVYB 4XBDA 5EODA 4M7GA 1C1OA 3FKSD 1YLCA 3PO1B 3UOUA 3K9XB 2Y5GA 3OFND 5J4SA 1ELFA 1C2EA 2EY4C 1AKSA 3QWCH 2WSSD 1C2MA 1ZRBA 2ZDMA 1WOFA 1XVOA 1BB0B 1GI8B 1HNEE 2H2ZA 1PPCE 1HAGE 5TJXA 3ZVGA 5IK2D 1O5BB 1GI9B 1C4V2 5DPAA 4I8HA 2AGEX 1GG6C 3V3MA 1O3MA 2R2WU 4XBBA 2VIQA 4ZXYH 2FXRA 4P00A 2A7HA 2FMJA 2A1DB 2WPLS 2BY5X 1L1NA 4UONA 1V2QT 1Y8TA 3LOXA 2QXGA 2JJ2D 2NU3E 3ATKA 3ZZDA 4X1QU 1E1QD 1CGJE 2FI5E 4X6MA 1C2DA 2Y80A 2ZDNA 2GTBA 1BBRH 4DOQA 1AFQB 1DFPA 1LVBA 1O2QA 3U1IB 3S9BA 1P0SH 3F68H 2OBQA 1PQAA 4XSKU 1KDQB 4AFUA 3L33A 2PKSB 3B23B 3QN7A 2L74A 1CT0E 3KF2A 3ENSB 2GVFA 1KIGH 3A8CA 2ZQ1A 2ZTXA 4MLFB 4GUXA 1RIWB 3TGIE 2SGPE 3OYPA 5A8YA 2OC8A 1O2HA 3RLWH 4MPXA 1TA2A 1LQDB 4D8NA 1AMHA 1GPZA 4O03A 1YBWA 3U9AH 2Y7XA 3LH1A 3BTDE 5JYIA 2ZU4A 1Z6EA 5C94A 3QUMP 1EB2A 3PV4A 1GI4A 1YYY1 3ZZBA 2WUCA 2VWMA 5DP7A 2ZF0H 4I8LA 2C93B 2VH6A 2ZIQH 7LPRA 1GDUA 2QF3A 4KTCA 1EFRD 1IQGA 3BTEE 3K6YA 1GI7B 1WV7H 5EGMA 1KLJH 2Z7FE 3SUGA 2FLBH 1DT2A 1OP8A 1BMNH 5CMXH 2BY8X 2FYRA 1TNKA 1SGIB 2A7JA 1A3EH 4WMDA 1C5VA 1HIAA 3QO6A 4X1SU 2IJOB 4WF8A 3A7XA 3AW1A 1X7AC 4ABFA 2HRVA 1DUEA 7GCHG 1W0ZU 2W6JD 1C4Y2 5DO4H 3KL6A 3HPTB 4Z6AH 1E0FD 2FX4A 2HNTE 4B6FA 2BDCA 1EZSC 2J38A 3M7UA 4WH6A 3TJNA 1ZGVA 3K6ZA 2O8MA 1P8VC 4DY7B 2ZDAH 1D6WA 2C8ZB 1TNGA 4ASUD 2QAAA 4Q7XA 5EPNA 4X2YA 1EPTA 1C2FA 2BX4A 2WPMS 4A1TA 2EI7A 1FY1A 4I8KA 3MO6A 2BTCE 4QT8C 1PPHE 1NRNH 2PW8H 3OY5U 1GBDA 4Q63A 4B73A 4ISHH 3KHVA 2ZTYA 5I25A 4A5TS 3QLPH 1FONA 4TY6A 3BG8A 2BD7A 4MDSA 3VB7A 2XNIA 2QF0A 2H9TH 1Z1JA 2IOTA 2ZCLP 3VXEH 2DUCA 3E1XB 4RT0A 1EB1H 2FEQH 4CRGA 3TGJE 2XW9A 1W11U 3SV6A 4XBCA 2A5KA 1A46H 1W8BH 3MI4A 3I29A 3BEFB 1T8LA 4B2BA 1C5ZB 2WINI 2A4OA 3MYWA 1FQ3A 4K5ZA 1OX1A 3OU0A 3UR9A 1NBME 2GD4B 3ZZ5A 3SUFA 4HG6A 1TA6A 4CRDA 1ELAA 1XUFA 2HOBA 4AG1A 4AFSA 2HALA 1ZMLA 5DP8A 4ZXXH 4TSFD 5EQQA 3A80A 3NK8A 1GJ5H 2HGTH 2RA0A 1QRZA 1DUAA 2RG3A 3E91A 5EQRA 2XC5A 1O5AB 1NESE 2KX4A 3ZZAA 2UUYA 4I8GA 3IITA 4ABHA 1YP9A 1C1RA 4O9VA 1F0UA 1DITH 4BNRA 1K9OE 1NTPA 3MFJA 1FPCH 3MH6A 3A88A 6GCHF 1TALA 4AG2A 4FUFA 1SGFG 4CRFA 1SQRA 5SGAE 2KAIA 3RMMH 3EAJA 2ZGJA 3SU0A 1HCGA 1OHHD 1ZSJA 3AAUA 4J1YA 3K65B 1OP0A 1FJSA 2GV7A 2OXSA 4ZROA 4JK5A 1CHOG 4UFFH 1V2WT 4JYTA 1GBFA 2ZO3H 2HWLB 1O3HA 3BEUA 1G3BA 4FU7A 2GCTC 1AN1E 1MABB 1IQJA 3EYDA 2ODQA 3RUOA 1C5NH 1HRTH 1DWBH 1MU6B 3A8BA 2GT8A 7ESTE 5DSFA 4IN2A 1DPOA 1JIMA 1N8OC 1QBNA 1T32A 1J16A 2JDID 1C4U2 5FX5A 1G37A 1O31A 1QL7A 1YWUA 3FP8E 1ZR0A 3GDUA 4BAMB 5GPIB 3DFLA 4FUJA 1MQ5A 3HATH 3L6PA 1FAXA 2BLVA 1UTKA 1ETRH 1TPAE 2G00A 1Z1IA 1BRUP 3EQ0H 4YLUA 1VITG 4IC6A 4GVUA 2GJGA 1F0TA 1L1GA 2ANWA 1JXPA 2P8OC 5FL7D 1GI0A 4DW2U 2TPIZ 3QTOH 2G52A 2ZHDA 3U28C 3RXKA 3A85A 2WZQA 1O3KA 4Y76A 2VWOA 3TJOA 2J9NA 2ODPA 4D9QA 2HLDD 1HLTH 1AU8A 3ZZ7A 1Y59T 2Y6TA 2AMQA 1RXPA 2ZTZA 4H4FA 2XCFA 2ZEBA 1BMFD 2STAE 3B9FH 3MH5A 8GCHG 1L0ZA 1SGYE 4X6NA 1P12E 3MU4A 1Z71A 3GISB 3CENA 2P3FH 1NM6A 3MMGA 3F9HA 5JB8S 2SGAA 2ZHFH 1F92A 2NWNA 1O5DH 2PGQB 1ZMJA 3URDA 3PRBA 7GCHF 2EI8A 1MKWH 2W7UA 2J34A 2XWAA 1TAWA 4YOJA 1MUEB 1KLTA 1XX9A 4FOUC 3GY8A 4I86A 3OAAD 3SYJA 1D6RA 2C90B 2BY7X 3RU4T 1D3DB 1V2MT 3ZVAA 2BLQA 2R0KA 5F8TA 3HKIB 1EAIA 3F2GA 2EA3A 3F9GA 3Q00A 3KEEA 5CE1A 2A31A 3M7QA 1UTOA 3P6ZB 1C2HA 4JZIA 1C1NA 2G4UA 2O9QA 1G32B 1DDJA 3BG4C 4ABDA 1KXEA 5C67A 1GHVH 4I7YH 3E6PH 5FPTA 1CHGA 1G3CA 1OWIA 1VITH 1C5OH 1O5GH 2AHME 1PPZA 3GCNA 3T28A 1AWHB 1FIZA 2F9OA 2O8WA 3S9CA 2ZA5A 3MO3A 2YNAA 1RTLA 3ESTA 3RXEA 1G3EA 5A09A 4NIXA 2ODYB 1GI5A 1GJ8B 1DSTA 1P2MA 4U32A 1A0HB 1O35A 4JMYA 1ORFA 3MHWU 1UHBA 3UOPA 2TGDA 1KXBA 1TLDA 3SN8A 3P8NA 2FO9A 3M3TA 5E0JA 1XUHA 3TH4H 1NY22 1WTGH 2SFAA 3RXVA 3N99A 1BHXF 2V0BA 1AKSB 1V6DA 1EUFA 4OM9A 1ZRKA 3RXRA 4MQAA 2G8TA 3A7WA 1SKYE 3OTJE 1QL8A 4TWYA 2TGAA 1AWFH 1A7SA 3UFAA 1H8ED 3A82A 5C5OA 2VIWA 4B74A 3SNDA 3SJKA 1NU7B 1GBAA 3NCLA 1HJAB 3SW2B 2VINA 1HFDA 1V2LT 4AB8A 4ZKOU 4I32A 1QB9A 1K1LA 1CHOF 1LKBA 2GZ8A 5B6LA 4IN1A 4B76A 1NRPH 3TNTA 3MU8A 2FM2A 8LPRA 2GZ7A 2BX3A 1BOQA 1G30B 1DVAH 1O3CA 4JYUH 3A87A 3E8LA 1O3AA 2FOCA 4WWYA 1NRQH 4FVBA 4AZ2B 3PB1E 3OEHD 3EA7A 1NFWA 1HAOH 2BVRH 1FI8A 2P95A 3FANA 1LHCH 3TJUA 3KQEA 4K8BA 1UTQA 1ZZZA 2O8UA 3GS9A 2DE9A 1VGCB 1AZZA 1RJXB 3MOCA 3AASA 5GXPA 3VGCB 3W95A 1ESAA 3SGAE 4BXWA 3LJOA 3UPEA 2Z3EA 5K0HA 1CGIE 4NA9H 2BZ6H 1MKXK 3KIDU 3Q3KA 3PM3A 1AVWA 1CBWB 4ZHAA 1HAXB 5IYTA 2DE8A 2O8TA 2KCOA 2OP9A 2CMYA 1D4PB 1UVPA 4NA7A 1MTSA 3SHAH 8GCHF 2WPHS 1LKAA 2Z94A 1TMTH 1A61H 2ZECA 1LMWB 2ASUB 2OTVA 3VB3A 3ZV8A 2V35A 5ESBA 1WCZA 3CS0A 5HIYA 2JH0D 2AMPA 4OS5A 4ZHMU 2NU0E 5DP5A 1TPSA 3OX7U 2QE7D 1QRWA 2UUJB 2YOLA 2FESH 1J9CH 1HIAB 1PYTD 1W0JD 1MTUA 3UTUH 1WYKA 5FAHA 1UTNA 1TQ0B 4ISIH 1K0HA 1CO7E 2Q6FA 1P2KA 3V12A 3FOAA 4LK4A 2ZNKH 1S83A 4R0IA 4BXSA 1SHYA 4B75A 1FY3A 1YY3A 4YESB 1D3PB 3C1KA 1VR1H 5LGOA 2B9LA 2W7SA 3EA9A 1GHBG 3S0NA 4X8VH 4WXVA 2GMTC 3VB5A 1Y5AT 2OCVB 2JIZD 3N7OA 2FS9A 3PLKA 2Y7ZA 4BAKB 4Q80A 1PYTC 1EPTB 5GCHG 4RI0A 4BTUB 2CHAC 4ABAA 1EKBB 3EE0B 1C5RA 4D9RA 4Q7YA 1EZUC 1NT1A 1BITA 4INKA 2ZCKP 4LZ1H 4K69A 5F03A 2BHGA 1V2TT 4AN7A 1LPKB 4WH8A 4MPWA 3MU0A 2WPJS 1BT7A 1O2RA 2A0QB 1GJBB 1YPLH 1MCTA 2QN5T 2FOGA 1UVOA 4Y7BA 1SB1H 3RMOH 3KYFA 4K1TA 2W26A 4DURA 1GI6A 1AUTC 3UWIA 1C5MD 5C0TA 4JZEH 4KKDA 5A8XA 5DK1A 2LP6A 1E1RD 1D3QB 3H09A 1DXPA 2BOKA 1EXFA 1K28D 1O2LA 5C2ZA 3HK6B 1ANCA 1QA0A 1JBUH 5B6OA 3BTTE 3LGTA 5A0AE 1S81A 3TJVA 3T5FH 2H9HA 1QR3E 4XOJA 1AVGH 1FUJA 1UVTH 4CR9A 5L30H 4HFPB 2JH6D 1LTOA 3TH3H 3ZVBA 3FP7E 1TNHA 2A2QH 1P2IA 2NU1E 3QDZB 1GMCF 4H6SB 4OGXA 5C3NA 2UUFB 4FUGA 1DOJA 4ACBA 2QIQA 1DXWA 1TNLA 2KAIB 1PJPA 1YPJH 2XXLA 3QZQA 4MVNA 3RM0H 1ZHRA 1O2SA 1OYTH 1C5PA 3LDXH 1K22H 2XWBI 4IGDA 4YO9A 1GHWH 1OKXA 4CR5A 1RTFB 2OBOA 1W2KH 2SGQE 4INHA 3P70B 1BMAA 2K1QA 4RT1A 5C1YA 3MNSA 5JPMH 3A89A 1LHEH 1Z8IB 1W10U 1SGQE 3BEIB 1QJ7B 2H5CA 3PO1C 2VVUA 1QIXB 2BVSH 3BF6H 2AIQA 4KTUA 1GCTB 1QL9A 1YPMH 2QXHA 2BZAA 3TGKE 4Y71A 2ZFPH 3F9EA 3A8DA 5AFZH 1MBMA 2R9PA 2UUKB 5LPFA 1FMGA 1TX8A 2PFEA 4A7IB 9ESTA 1MD7A 5JBAS 1EAWA 1CA0B 3U8TH 1S6FA 1G2MA 1VCWA 1HAIH 2CN0H 2UWPA 4TY7A 1P10A 3VFEA 1EP6A 1O2ZA 5TCAA 1ZHPA 4ZH8A 2BD2A 1YPHE 2HPQH 1ELEE 4AC9A 5KECA 1BQYA 2BDHA 3QTVH 4YOIA 2YMSB 2R0LA 1FZZA 1IQHA 4I33A 2H5DA 1S84A 1QQ4A 2TGPZ 3F2HA 3PMJA 5JBBS 4KELA 1NS3A 1WBGB 1C2JA 1CT2E 1QA7A 3A84A 1MD8A 2BQ6B 4B6EA 1QQUA 2FOBA 2XRCA 3Q3YA 3P95A 4NIWA 3SV2H 4YXWD 3FZZA 2H6MA 1FNIA 3IWMA 2Y81A 1NN6A 4Y0ZE 1AFEH 1GI2A 1THSH 2XCNA 3VG8A 2UWLA 3SO3A 1P2QA 2W3KA 1Z6JH 1YCPM 1Y3WA 2QCYA 3WWFA 4O97A 3P8FA 1GI1A 1MQ6A 1O2YA 2BD9A 3VEQB 3RC4A 2M5TA 3O8DA 2Y82A 5FXLA 2OQUA 1O3IA 3GY2A 2Z6BD 3SNBA 4B2CA 2OK5A 3MQKC 3S9AA 1C9PA 4UEHH 1GGDC 1WDIA 1W0YH 2THFB 1FXYA 4U01A 4GPGA 1MTVA 3OY6U 1GHAG 5E2PA 3M5LA 3LGVA 1K1OA 2BMGB 3ATWA 3SNEA 2GKVE 1Z7KA 1UJ1A 1L4DA 4JZFH 1JMOH 1SQAA 1RTKA 3UB0A 1HAYB 2CXVA 2BDYA 4WXIA 2VVVA 3ODDA 1UHBB 2BXTH 2J95A 5EQSA 1EASA 3S7HB 1ETTH 3A81A 3VXFH 2UWOA 4MTBA 2AH4X 5K7RA 1IQNA 3RXAA 1O33A 1KYNA 2KM0A 3GICB 5EW2H 2GGVB 2VB0A 3GY3A 4RSPA 2LNCA 3UR6A 1JIRA 3BTME 1GDNA 1TGCA 4X6PA 3RXLA 3V13A 3LC3A 5EPYA 4ABEA 3BIUH 1C5SA 2PR3A 1PPBH 3F0OA 2SNWA 4F49A 1TGNA 1ZSKA 1MAXA 1AD8H 1O37A 2ZGXH 1ZSLA 2FOEA 2C8YB 2A32A 1THRH 2QXJA 2Z3DA 5E0HA 5HMAA 1C5TA 1ESTA 2K8IA 1TBQH 1AB9B 1GJCB 1T8MA 2H9EH 2A4RA 2BM2A 2O8LA 4MNWA 1YGCH 1QHRB 1J8AA 1SGDE 2W5EA 3R3GB 1Q3XA 1DSUA 2BOHB 2C8WB 2BD4A 3BIVH 1B0EA 1GMHG 2P3UB 5C17A 1C1PA 1ZPBA 2KCAA 2BB4A 1MU8B 4GHTA 1YPKH 2AERH 1AZ8A 3BTWE 3GY5A 4CRBA 6CHAC 2ESTE 5T3HA 4TPYA 3U98H 4DVAU 3KQCA 5GIBA 1K1JA 4E06H 3NWUA 1FV9A 2FIRH 4DG4A 1DM4B 2B8OH 2PP6A 4X2XA 1O0DH 1HB0B 4X0WU 1AHTH 1O2KA 2PWXA 5EIYA 3AVZA 5GNDA 1GJAB 3QGJA 4Z1MD 3DFJA 1LHGH 3SU4A 3ATIA 3RXQA 3BTFE 2BDGA 2Y5FA 4AFZA 1TMBH 1XMNB 3M3VA 1RS0A 2ZI2H 1Z8RA 4CH8B 2F83A 1FN6A 5DP4A 1OXGA 1SGEE 4NZQA 4YTAA 1O3FA 2F4LA 2JKHA 5ABWA 5TCCA 1FY8E 3KNXA 1O38A 1W14U 2L6OA 1RGQA 1P2NA 1NZQH 4UFDH 2WYJA 8KME2 1C1QA 3RXCA 1P01A 3R0FA 3DA9B 1HAVA 1NFUA 3FN8A 5EXNA 1GI3A 1F0RA 1GCDA 5CHAC 4YOGA 2ZG0H 3E90B 3E0PB 5C0UA 4ZAEA 2D2DA 3M36A 3V7TA 1FPHH 2ALVA 1N8OB 9LPRA 2H1UA 1YLNA 4Y79A 3RDZA 4FU8A 1TYNA 1ZHMA 1TOCB 1HXFH 1OWHA 1OWEA 1P04A 2RCEA 5IDKA 3GYLB 3M5NA 2QXIA 2KCYA 4X8UH 4VGCC 3RXFA 2P8OB 3PMAB 1O2PA 3UUZA 3UWJH 1BIOA 4YZUA 4A92A 2R2MB 1OWJA 3K2UA 3NZIA 3TLOA 1DE7H 3KQBA 2F9UA 3DT0H 5DP9A 3P8OA 3ZVFA 3BSQA 3SJ9A 7KMEH 2AEIH 1FY5A 4AORA 4B71A 3T26A 5FHTA 1TBZH 4K1SA 1BTUA 1ELDE 1HJ9A 2ILNA 4O3UA 4XE4A 2BD3A 1IOEA 2ZGBH 2GDEH 1P05A 3D65E 2QY0B 4CBNA 5JBTA 4NA8A 1OWDA 2WV4A 3H7TA 1CVWH 4THNH 3PYHA 1TRNA 5A0CA 1C5QA 1SQTA 2ZPQA 2BD5A 4ACAA 2A5IA 1E36B 2VNTA 3U8OH 2WPDD 1F7ZA 2WUBA 1O2WA 2SGFE 5GDSH 4BAHB 3TU7H 1ELTA 5DP3A 1MTNB 1SFIA 2PTCE 4DT7B 1EAUA 2JETB 1B0FA 3SJIA 2AS9A 4ZMAH 1T4VH 1T31A 4BAQB 1ZTJA 1QZ8A 4DIIH 4IMZA 1VCQA 1MZDA 2ZU2A 3BG4B 1CE5A 3RMLH 2GCHG 1ANBA 1HGTH 3GCTG 3TK6A 3FFGA 3GY4A 4KP0A 1SFQB 1QJ1B 3BN9A 3T29A 1QCPA 1OSSA 3T25A 1BCUH 1ZJKA 1O2GH 1ARBA 1IQMA 1E34B 1SVPA 6ESTA 2BLOA 4CRCA 3UY9A 1ZTLA 1P02A 1WSSH 5FCRA 1O3PB 3SV8A 2ZZUH 3DCLA 5AF9H 3EGKH 1DX5M 4OS2A 3Q76A 2SNVA 1OP2A 1O2XA 3PWBA 3SU3A 4NWKA 2VU8E 2WYGA 4X2WA 1WQSA 1DWEH 1IQIA 1MKXH 2BQWB 1CA8B 1WUNH 1VJ9U 1K21H 3A83A 3PROA 3KYGA 5FBEA 3T2NA 4UFGH 2FX6A 3BV9B 3O8CA 3MH4A 1FY4A 1V2NT 1SGTA 1GL0E 3E16B 3ZYEA 3AK5A 1H9IE 1UVSH 4UFEH 2OC1A 3SI4H 2ZU3A 3ELAH 3GOVB 3ATMA 3ZZCA 1TWXB 1V2KT 4GCHG 2XC4A 3GY6A 5CDFE 4SGBE 2VVCA 3QZRA 4Q7ZA 1FIWA 2BXUH 5EXMA 3ZVCA 3JZ2B 1ZJDA 2PUQH 2FOMB 1BRAA 1DANH 1PPGE 1O3NA 1P09A 3D62A 1O3LA 3N7DA 1F5RA 2FZZA 3G01A 3M5MA 1P2JA 1W3CA 5LPRA 2RDEA 1VITF 2SGDE 2NU2E 4CHAB 1EJAA 4F55A 2BDIA 3LC5A 1PPFE 1W12U 3MU5A 4F48B 1E35B 1TB6H 5A0BA 1PQ8A 1BTWA 1WU1A 4ZKNU 4BOHA 2BDBA 3SNAA 4B2AA 2PKAA 1O3BA 3CS7A 1BZXE 2PSYA 3GCHB 2QV1A 2SGEE 2OQ5A 1YCPK 2ZFQH 1O5EH 4B1TA 3ZZ3A 3U69H 1SQOA 4HTCH 2WPIS 4JYVH 3MO9A 1SSXA 4OS1A 2Y5HA 3QX5H 3ZYDA 1CU1A 4BTIB 3GCOA 1QGFA 1ZYOA 1MH0A 1PFXC 1QB1A 3W94A 3T62A 2HVXA 1A4WH 3MTYA 1O30A 1DS2E 2ANMH 4GAWA 2V7QD 4BTTB 1GDQA 1BA8B 3STIA 2D26C 4K2YA 2A4QA 4ZCNA 4E05H 1HAPH 1IQEA 2PUXB 1SMFE 2ZFFH 3M7TA 3RXDA 1C5WB 1Z8JB 4LXBH 2TBSA 1WAYB 3TK5A 4R8TB 3RP2A 3F3BA 4TPIZ 1INCA 2FODA 1NRSH 2I6SA 2STBE 2TGTA 2CK3D 3DSOA 4FUIA 3F6UH 1H4WA 3SZNA 1HUTH 2ZP0H 1P11E 4NGAH 2G5VA 1KTTB 1EPTC 2ZFTA 2ZGHA 2CF9H 4X1RU 1PPEE 1ZPCA 2KFWA 1TPPA 4ABIA 2PLXA 2ULLA 1QBVH 3QGNB 3F1SB 3H5CB 1KLIH 1GJ6A 1NRRH 4D7FA 4Q4LA 4Y0YE 4FXGH 3UIRA 1SGPE 1ETSH 1SLUB 1UTJA 2JH5D 1Q2WA 4JZ1A 2Q1JA 4D7GA 2VGCB 1Q31A 2ZQ2A 4O3TA 1AO5A 1AVXA 1GBHA 1V2JT 2CHAB 2J98A 1HAHH 1EZXC 1UCYK 3SNCA 3OEED 3PV5A 1O36A 4X8SH 1QB6A 4YT6H 4LZ4B 1SL3A 4NWLA 2AGGX 4DCDA 5EOKA 5F8XA 4A1VA 1NPMA 3RC5A 1SLWB 1V2PT 1TNJA 2XBYA 3RXJA 5F6MA 1VJAU 2PSXA 1S85A 2V3MA 4X8TH 4Z0KA 4D76A 1GBEA 5FPYA 1F0SA 3FP6E 2R3UA 2LELA 2ZU1A 1SGNE 1TONA 2GX4A 1RD3B 5HIZA 5JDUB 4X6OA 1K2I1 5EG4A 1UTMA 1O3DA 1YF4A 1A0JA 2Z9GA 2ZDKA 3LH3A 1BTPA 2B7DH 3RU4D 4FUEA 1L4ZA 4E7RG 2J5UA 4Q2KA 5HGGA 1C5YB 2IPQX 2P94A 1ID5H 6LPRA 2HNTC 3NRLA 2FS8A 3M61U 4FUDA 3O8BA 3KQ5A 1ABIH 3FVFB 3RXUA 1GJDB 3GDSA 1P03A 2BDAA 1H1BA 2I6QA 3M35A 5ETXA 2P59A 1ZTKA 5PTPA 1IQKA 1D9IA 1GCTC 1EQ9A 1A2CH 1W7XH 3N7EA 2GT7A 1SI5H 1ANEA 4TWWA 1AGJA 1P2OA 4MNVA 1P06A 1E79D 3VB4A 1YPGH 3H7OA 1A1RA 3T27A 4FUCA 1HAVB 5C20A 4I31A 1CA0C 5EU8A 3HGNA 1O34A 3P8GA 1VKYA 5T6GA 2TRMA 2EQNA 1H9LB 3WY8A 1A0LA 1J15A 2Z9JA 2QYIA 3A8AA 3WW7A 1BTHH 4YM9A 1UTPA 2FOFA 3BTKE 2YMSC 3FO8D 1AFQC 1GG6B 5GWZA 1OPHB 1IHSH 1K1IA 3RLYH 2PKSC 2XTTB 1C1WH 2NU4E 3F9FA 1MTWA 3B8JA 1YM0A 3FAOA 1O2UA 3Q77A 4IW4E 3SI3H 1GVLA 1GBTA 3HK3B 1UW7A 3OSYA 1BDAA 1KTSB 2ZGCA 1RIWC 6GCHG 4DT4A 2Z3CA 1SPJA 1XXDA 4Y11E 4I8JA 3RXPA 3TH2H 1WTHD 1SLVB 2ZDLA 2P16A 2VIOA 5F8ZA 1G3DA 5HM2A 1LQEA 1MAYA 3LONA 1GHBF 1O2VA 5FCKA 1O2NA 2G81E 4PROA 2VWNA 4A1XA 3F0PA 2GV6A 1MMJN 4NFFA 1TGTA 2VIVA 1W0KD 3ATLA 5GCHF 1L1JA 4BANB 1GJ4H 1SOZA 1TE0A 1LCYA 3TNSA 4CBOA 1V2VT 4NIYA 4MNXA 4ESTE 1KMHB 1NFXA 1SBWA 3D49H 1A3BH 4K3JA 1C2LA 3TIUA 1AE5A 1PQ5A 1QURH 4XRNA 1IQLA 1HPGA 2GP9B 1J14A 2QF4A 3TK9A 4AB9A 2AFQB 5DN6D 4H6TA 1TIOA 2XYAA 1B7XB 4OGYA 1GGDB 2HNTF 3M37A 3PLPA 1MZAA 4WVPE 1SOTA 1CQQA 1T7CA 5FX6A 1BBRK 1NU9A 3A86A 1ZOMA 1S0RA 2WV5A 2IPHA 2C8XB 3ZIAD 1AI8H 1THPB 2WHXA 1TABE 2G4TA 5L6NH 1ELCA 3PLBA 1HXEH 1HAZB 1V2ST 5T1VA 2FTMA 5AFYH 4AYYB 1S6HA 1ELVA 3ZZ6A 3LKWA 1O5FH 2RFKC 1LDTT 4ISLA 1FX0B 1DWDH 5G4BA 5C1XA 4E7NA 3GYMA 3O8RA 2ZPRA 3E0NB 2FI3E 5EJLA 2IJD1 4FU9A 3VPKA 4WY3A 4ABBA 1TRMA 1XKBC 4FUHA 4UD9H 4X2VA 4U30A 3LGUA 1QTFA 1GL1A 3NXPA 4Y8YA 1O2MA 2FDAA 2EEKA 2KCPA 1H8DH 2ZHEH 1AB9C 3RU4E 1BRCE 1DY9A 1KXAA 5A8ZA 3KQDA 3STJA 1BTZA 1P9SA 4WMEA 4HI3A 1TGSZ 2F3CE 1BBRE 4RN6A 1OOKB 1ELBA 1O3OA 4DGJA 4ZUHA 1OWKA 1BMMH 2XOKD 3LIWA 1GBBA 3LPRA 1GHZA 3SQHE 3OE7D 1GBLA 3HGPA 2YNBA 1IAUA 1AE8H 2FOHA 3SU1A 1C1MA 2FP7B 3OTPA 4MPUA 3PMHB 4U2WA 1YPEH 3NKKA 1IQFA 3MU1A 1P3EA 4X1PU 1MBQA 4KGAA 4Y10E 3HKJB 1NROH 2A2XH 3TVJB 1KXCA 2OC7A 2PKAB 3A7VA 3TPIZ 4K60A 3QK1A 3BTHE 2RDLA 3ZZ9A 1SGCA 1O5CB 4OS7A 3ZZ4A 4WJG2 3RC6A 2VJ1A 3VB6A 3UAIC 3UQOA 1LPGB 1A5GH 4AX9H 5H4IB 3DSGA 4ZHLU 1HV7A 2ANYA 4NIVA 4NSYA 6CHAB 1D3TB 4TYDA 1GBMA 1B5GH 1CT4E 2LPRA 1TRYA 1SLXB 1V2UT 4MG3A 2HPPH 5C1UA 3TITA 2TIOA 2J2UA 3RMNH 1ZGIA 1EOJA 1ACBE 1TX7A 1GMDG 4FVDA 1J17T 3SHCH 2GCTB 2Z9IA 3GDVA 1BUIA 2KZ4A 4DJZB 4ABGA 2BQ7B 5HXFA 4XD7D 1F5KU 2ZC9H 5C5NA 1SGRE 1KXFA 2M2AA 1Y3UA 1BHXB 3IG6B 3UNQA 1W13U 1F5LA 3MNXA 2J4IA 2KR7A 4ISOA 1AUJA 1TOMH 1ABJH 1UK3A 1GHAF 5CHAB 2G5NA 4AFQA 1HYLA 1QBOA 3BTQE 3SOSA 1GVKB 4HGCA 5E2OA 4ZKSU 1EAXA 1KY9A 1ZLRA 1KSNA 1O2JA 5LPEA 4RKOB 3MWIU 3BTGE 2F9NA 2J98B 1T8OA 4X1NU 4IS5A 2BD8A 2D1JA 3SUDA 3ODFA 3L3TA 3SUEA 4F4OC 2BY9X 2PV9B 2ZWLH 4VGCB 4IC5A 3RXIA 1KDQA 1K1MA 4K1EA 1HDTH 1P57B 2ANKH 2D8WA 2HLCA 1FAKH 4WMFA 1QFKH 1Z8GA 2IN2A 3RXBA 3U1JB 4MPVA 3PMBB 1TFXA 1TNIA 5DKMA
chains in the Genus database with same CATH topology
1YKTA 5L2ZH 1GHXH 3DD2H 1GVZA 1JRSA 3AAVA 1C1UH 2A4GA 1GBCA 2Q6GA 4AGJA 1UVUH 1EATA 3UNRA 3EA8A 1MTNC 1QJ6B 4ABJA 3SU5A 1LVOA 1ZPZA 4J2YB 2XC0A 5A2MH 1ESBA 1SR5C 5JBCS 2JETC 1DLKB 1SC8U 2FYQA 1XXFA 1O2OA 3FZDA 1BJVA 1E38B 1EX3A 5BPEA 1XUIA 1L2EA 1C2IA 2QGRA 1C2GA 1UK2A 1H8IH 1QY6A 2F9PA 2F91A 4IMQA 3I78A 2CV3A 3RXHA 3ZVEA 4KTSA 1P3CA 1P9UA 3P17H 2OINA 1GMHF 1C5LH 2AYWA 2CJIA 3KGPA 5AHGH 1A5HA 1HBTH 4AOQA 3SU2A 1AIXH 2V6NA 1MKWK 1GBJA 3A7YA 3RXOA 3JZ1B 1ARCA 2OUAA 3LU9B 1EOLA 1W7GH 5HYOA 1TPOA 3SGQE 4AYVB 1HJAC 3RXTA 2FI4E 2ZHQH 5T6DA 2P93A 1YLDA 2G51A 1XM1A 3EDXB 5LH8A 3M5OA 4YT7H 3RXSA 1YCPH 2VIDA 2ZDVH 1DY8A 2AGIX 1N6YA 5E8EH 2CF8H 1SHHB 2BLWA 2FTLE 2OD3B 1OS8A 1O3GA 1C2KA 4OS4A 1VCPA 2ZFSA 1K1PA 3PWCA 1E37B 3ZVDA 3ZV9A 1N1LA 3LGYA 1T8NA 2V3HH 3ZZ8A 3ITIA 1MCVA 4SGAE 1GMCG 5AVDA 1V2RT 5BRRE 1GMDF 1C5UA 1NC6A 2FLRH 4XFQA 1QRXA 4NCYA 4UE7H 2ZHWH 1VGCC 2Q6DA 1BMLA 2R3YA 4ZKRU 3VGCC 3MH7A 1UK4A 4CHAC 1Y3XA 5FBIA 3LT3A 1JRTA 2GZ9A 3P92A 2EC9H 1CSOE 2BYAX 3SU6A 1M9UA 4YLQH 1G2LA 1FDPA 1XKAC 1CBWC 1DICA 1O32A 3SJOA 3GCHC 5E0GA 1GJ9B 2P3TB 2ZPSA 1XUJA 1A5IA 4NZLA 1KXDA 1S0QA 1LHFH 3UREA 4Y8XA 1DWCH 1QNJA 3M3SA 1FLEE 2ZCHP 2ALPA 5HM9A 1WQVH 2F9VA 2Z9KA 2VIPA 4H42U 3S7KB 1V2OT 3Q3XA 1AY6H 1HJ8A 1G9IE 4JCNA 1BJUA 3LJJA 5EXLA 1RRKA 1LVYA 2AMDA 5I46H 4XDEA 1UTLM 2F9BH 1UCYH 4A6LA 1Y5UT 2V3OH 3PTBA 4NG9H 3LGWA 4Y8ZA 5DP6A 4Y7AA 4LOYH 4DIHH 1Y3VA 2FOAA 1JOUB 3A7ZA 2PGBB 5T6FA 4GHQA 1C1SA 2PTNA 3RXGA 3DUXH 1UO6A 1GJ7B 1ANDA 2ZFRH 1YPHC 1GBIA 3KCGH 5DG6A 3V0XA 2WPKS 1C5XB 3A7TA 1LO6A 1JWTA 1DLEA 5GJ4B 1T4UH 1PQ7A 2CGAA 3RXMA 3MNBA 2XBWA 3DHKH 1ZMNA 4CRAA 2QC2A 4MNYA 8ESTE 1TBRH 2AIPA 4IBLH 5L2YH 1XUGA 1SGFA 4ISNA 4JK6A 2GMTB 3PTNA 2GCHF 4K8YA 3GCTF 5ESTE 4NSVA 2GDDA 2VGCC 2C3SA 2FWWA 4JZDH 3C27B 1RFNA 3SQEE 2Z9LA 1LHDH 2BY6X 4FUBA 3E3TA 1SG8B 1C1TA 1XUKA 1EP5A 2A45B 1TQ7B 3SJ8A 1U6QA 1TMUH 1NFYA 3S69A 2RA3A 3U8RH 4AGKA 1K1NA 4CH2B 1Y5BT 3NUMA 5EW1H 1BTYA 1LVMA 1O3EA 2A5AA 2B0FA 3LGIA 3SBKA 2A7CA 1YC0A 3UQVA 1EJNA 3GY7A 2G55A 3MNCA 4HZHA 1OYQA 2OC0A 3SV7A 1BTXA 1Y3YA 5JB9S 4Y6DA 2BVXH 1UMAH 1G36A 2B5TB 1H9HE 1O2TA 2OLGA 4CREA 1BRBE 5FPSA 1NO9H 1IHTH 5DGJA 3CP7A 4GCHF 4RKJB 2VH0A 4BAOB 1O2IA 1C9TA 3SORA 1LPZB 1N6XA 1S5SA 2J92A 2ZKSA 4OS6A 1CGHA 1V3XA 2XBVA 3I77A 4NFEA 1XVMA 5J4QA 2ZU5A 1UCYE 1VZQH 4INLA 1EZQA 2EI6A 1GBKA 3D23A 1AQ7A 2QA9E 3NPSA 3KN2A 1ELGA 2FPZA 4GSOA 3RM2H 1S82A 1TGBA 1EJMA 1FN8A 3SGBE 3UNSA 1GHYH 4GLYA 1C1VH 2PHBA 3URCA 2W3IA 1TX6A 3AW0A 4ASHA 2J94A 3SV9A 2C4FH 2XBXA 1F2SE 5DJ7A 2VWLA 1O39A 1GWAA 4UDWH 1O3JA 4XBDA 5EODA 4M7GA 1C1OA 1YLCA 3PO1B 3UOUA 3K9XB 2Y5GA 5J4SA 1ELFA 1C2EA 1AKSA 3QWCH 1C2MA 1ZRBA 2ZDMA 1WOFA 1XVOA 1BB0B 1GI8B 1HNEE 2H2ZA 1PPCE 1HAGE 5TJXA 3ZVGA 1O5BB 1GI9B 1C4V2 5DPAA 4I8HA 2AGEX 1GG6C 3V3MA 1O3MA 2R2WU 4XBBA 2VIQA 4ZXYH 2FXRA 2A7HA 2FMJA 2A1DB 2WPLS 2BY5X 1L1NA 4UONA 1V2QT 1Y8TA 3LOXA 2QXGA 2NU3E 3ATKA 3ZZDA 4X1QU 1CGJE 2FI5E 4X6MA 1C2DA 2Y80A 2ZDNA 2GTBA 1BBRH 4DOQA 1AFQB 1DFPA 1LVBA 1O2QA 3U1IB 3S9BA 1P0SH 3F68H 2OBQA 1PQAA 4XSKU 1KDQB 4AFUA 3L33A 2PKSB 3B23B 3QN7A 1CT0E 3KF2A 3ENSB 2GVFA 1KIGH 3A8CA 2ZQ1A 2ZTXA 4MLFB 4GUXA 1RIWB 3TGIE 2SGPE 3OYPA 5A8YA 2OC8A 1O2HA 3RLWH 4MPXA 1TA2A 1LQDB 4D8NA 1AMHA 1GPZA 4O03A 1YBWA 3U9AH 2Y7XA 3LH1A 3BTDE 5JYIA 2ZU4A 1Z6EA 3QUMP 1EB2A 3PV4A 1GI4A 1YYY1 3ZZBA 2WUCA 2VWMA 5DP7A 2ZF0H 4I8LA 2C93B 2VH6A 2ZIQH 7LPRA 1GDUA 2QF3A 4KTCA 1IQGA 3BTEE 3K6YA 1GI7B 1WV7H 5EGMA 1KLJH 2Z7FE 3SUGA 2FLBH 1DT2A 1OP8A 1BMNH 5CMXH 2BY8X 2FYRA 1TNKA 1SGIB 2A7JA 1A3EH 4WMDA 1C5VA 1HIAA 3QO6A 4X1SU 2IJOB 4WF8A 3A7XA 3AW1A 1X7AC 4ABFA 2HRVA 1DUEA 7GCHG 1W0ZU 1C4Y2 5DO4H 3KL6A 3HPTB 4Z6AH 1E0FD 2FX4A 2HNTE 2BDCA 1EZSC 2J38A 3M7UA 4WH6A 3TJNA 1ZGVA 3K6ZA 2O8MA 1P8VC 4DY7B 2ZDAH 1D6WA 2C8ZB 1TNGA 2QAAA 4Q7XA 5EPNA 4X2YA 1EPTA 1C2FA 2BX4A 2WPMS 4A1TA 2EI7A 1FY1A 4I8KA 3MO6A 2BTCE 4QT8C 1PPHE 1NRNH 2PW8H 3OY5U 1GBDA 4B73A 4ISHH 3KHVA 2ZTYA 5I25A 4A5TS 3QLPH 1FONA 4TY6A 3BG8A 2BD7A 4MDSA 3VB7A 2XNIA 2QF0A 2H9TH 1Z1JA 2IOTA 2ZCLP 3VXEH 2DUCA 3E1XB 1EB1H 2FEQH 4CRGA 3TGJE 2XW9A 1W11U 3SV6A 4XBCA 2A5KA 1A46H 1W8BH 3MI4A 3I29A 3BEFB 1T8LA 4B2BA 1C5ZB 2WINI 2A4OA 3MYWA 1FQ3A 4K5ZA 1OX1A 3OU0A 3UR9A 2GD4B 3ZZ5A 3SUFA 1TA6A 4CRDA 1ELAA 1XUFA 2HOBA 4AG1A 4AFSA 2HALA 1ZMLA 5DP8A 4ZXXH 5EQQA 3A80A 3NK8A 1GJ5H 2HGTH 2RA0A 1QRZA 1DUAA 2RG3A 3E91A 5EQRA 2XC5A 1O5AB 1NESE 3ZZAA 2UUYA 4I8GA 3IITA 4ABHA 1YP9A 1C1RA 4O9VA 1F0UA 1DITH 4BNRA 1K9OE 1NTPA 3MFJA 1FPCH 3MH6A 3A88A 6GCHF 1TALA 4AG2A 4FUFA 1SGFG 4CRFA 5SGAE 2KAIA 3RMMH 3EAJA 2ZGJA 3SU0A 1HCGA 1ZSJA 3AAUA 4J1YA 3K65B 1OP0A 1FJSA 2GV7A 2OXSA 4ZROA 4JK5A 1CHOG 4UFFH 1V2WT 4JYTA 1GBFA 2ZO3H 2HWLB 1O3HA 3BEUA 1G3BA 4FU7A 2GCTC 1AN1E 3EYDA 1IQJA 2ODQA 3RUOA 1C5NH 1HRTH 1DWBH 1MU6B 3A8BA 2GT8A 7ESTE 4IN2A 1DPOA 1JIMA 1N8OC 1QBNA 1T32A 1J16A 1C4U2 5FX5A 1G37A 1O31A 1QL7A 3FP8E 1ZR0A 3GDUA 4BAMB 5GPIB 3DFLA 4FUJA 1MQ5A 3HATH 3L6PA 1FAXA 2BLVA 1UTKA 1ETRH 1TPAE 2G00A 1Z1IA 1BRUP 3EQ0H 4YLUA 1VITG 4IC6A 4GVUA 1F0TA 1L1GA 2ANWA 1JXPA 2P8OC 1GI0A 4DW2U 2TPIZ 3QTOH 2G52A 2ZHDA 3RXKA 3A85A 1O3KA 4Y76A 2VWOA 3TJOA 2J9NA 2ODPA 4D9QA 1HLTH 1AU8A 3ZZ7A 1Y59T 2Y6TA 2AMQA 1RXPA 2ZTZA 4H4FA 2XCFA 2ZEBA 3B9FH 2STAE 3MH5A 8GCHG 1L0ZA 1SGYE 4X6NA 1P12E 3MU4A 1Z71A 3GISB 3CENA 2P3FH 1NM6A 3MMGA 3F9HA 5JB8S 2SGAA 2ZHFH 1F92A 2NWNA 1O5DH 2PGQB 1ZMJA 3URDA 7GCHF 2EI8A 1MKWH 2W7UA 2J34A 2XWAA 1TAWA 4YOJA 1MUEB 1KLTA 1XX9A 3GY8A 1D6RA 2C90B 2BY7X 3RU4T 1D3DB 1V2MT 3ZVAA 2BLQA 2R0KA 5F8TA 3HKIB 1EAIA 2EA3A 3F9GA 3Q00A 3KEEA 5CE1A 2A31A 3M7QA 1UTOA 3P6ZB 1C2HA 4JZIA 1C1NA 2G4UA 2O9QA 1G32B 1DDJA 3BG4C 4ABDA 1KXEA 5C67A 1GHVH 4I7YH 3E6PH 5FPTA 1CHGA 1G3CA 1OWIA 1VITH 1C5OH 1O5GH 1PPZA 3GCNA 3T28A 1AWHB 1FIZA 2F9OA 2O8WA 3S9CA 2ZA5A 3MO3A 2YNAA 1RTLA 3ESTA 3RXEA 1G3EA 5A09A 4NIXA 2ODYB 1GI5A 1GJ8B 1DSTA 1P2MA 4U32A 1A0HB 1O35A 4JMYA 1ORFA 3MHWU 1UHBA 3UOPA 2TGDA 1KXBA 1TLDA 3SN8A 3P8NA 2FO9A 3M3TA 5E0JA 1XUHA 3TH4H 1NY22 1WTGH 2SFAA 3RXVA 1BHXF 2V0BA 1AKSB 1V6DA 1EUFA 1ZRKA 3RXRA 4MQAA 2G8TA 3A7WA 3OTJE 1QL8A 4TWYA 2TGAA 1AWFH 1A7SA 3UFAA 3A82A 5C5OA 2VIWA 4B74A 3SNDA 3SJKA 1NU7B 1GBAA 3NCLA 1HJAB 3SW2B 2VINA 1HFDA 1V2LT 4AB8A 4ZKOU 4I32A 1QB9A 1K1LA 1CHOF 1LKBA 2GZ8A 4IN1A 4B76A 1NRPH 3TNTA 3MU8A 2FM2A 8LPRA 2GZ7A 2BX3A 1BOQA 1G30B 1DVAH 1O3CA 4JYUH 3A87A 3E8LA 1O3AA 2FOCA 4WWYA 1NRQH 4FVBA 4AZ2B 3PB1E 3EA7A 1NFWA 1HAOH 2BVRH 1FI8A 2P95A 3FANA 1LHCH 3TJUA 3KQEA 4K8BA 1UTQA 1ZZZA 2O8UA 2DE9A 1VGCB 1AZZA 1RJXB 3MOCA 3AASA 5GXPA 3VGCB 3W95A 1ESAA 3SGAE 4BXWA 3LJOA 3UPEA 2Z3EA 5K0HA 1CGIE 4NA9H 2BZ6H 1MKXK 3KIDU 3Q3KA 3PM3A 1AVWA 1CBWB 4ZHAA 1HAXB 5IYTA 2DE8A 2O8TA 2OP9A 2CMYA 1D4PB 1UVPA 4NA7A 1MTSA 3SHAH 8GCHF 2WPHS 1LKAA 2Z94A 1TMTH 1A61H 2ZECA 1LMWB 2ASUB 2OTVA 3VB3A 3ZV8A 2V35A 5ESBA 1WCZA 3CS0A 2JH0D 2AMPA 4OS5A 4ZHMU 2NU0E 5DP5A 1TPSA 3OX7U 1QRWA 2UUJB 2YOLA 2FESH 1J9CH 1HIAB 1PYTD 1MTUA 3UTUH 1WYKA 5FAHA 1UTNA 1TQ0B 4ISIH 1CO7E 2Q6FA 1P2KA 3V12A 4LK4A 2ZNKH 1S83A 4R0IA 4BXSA 1SHYA 4B75A 1FY3A 4YESB 1D3PB 3C1KA 1VR1H 5LGOA 2B9LA 2W7SA 3EA9A 1GHBG 3S0NA 4X8VH 4WXVA 2GMTC 3VB5A 1Y5AT 2OCVB 3N7OA 2FS9A 3PLKA 2Y7ZA 4BAKB 4Q80A 1PYTC 1EPTB 5GCHG 4BTUB 2CHAC 4ABAA 1EKBB 3EE0B 1C5RA 4D9RA 4Q7YA 1EZUC 1NT1A 1BITA 4INKA 2ZCKP 4LZ1H 4K69A 5F03A 2BHGA 1V2TT 4AN7A 1LPKB 4WH8A 4MPWA 3MU0A 2WPJS 1BT7A 1O2RA 2A0QB 1GJBB 1YPLH 1MCTA 2QN5T 2FOGA 1UVOA 4Y7BA 1SB1H 3RMOH 4K1TA 2W26A 4DURA 1GI6A 1AUTC 3UWIA 1C5MD 4JZEH 4KKDA 5A8XA 5DK1A 1D3QB 1DXPA 2BOKA 1EXFA 1K28D 1O2LA 5C2ZA 3HK6B 1ANCA 1QA0A 1JBUH 5B6OA 3BTTE 3LGTA 5A0AE 1S81A 3TJVA 3T5FH 2H9HA 1QR3E 4XOJA 1AVGH 1FUJA 1UVTH 4CR9A 5L30H 4HFPB 2JH6D 1LTOA 3TH3H 3ZVBA 3FP7E 1TNHA 2A2QH 1P2IA 2NU1E 3QDZB 1GMCF 4H6SB 4OGXA 5C3NA 2UUFB 4FUGA 1DOJA 2QIQA 1DXWA 1TNLA 2KAIB 1PJPA 1YPJH 2XXLA 3QZQA 4MVNA 3RM0H 1ZHRA 1O2SA 1OYTH 1C5PA 3LDXH 1K22H 2XWBI 4IGDA 4YO9A 1GHWH 1OKXA 4CR5A 1RTFB 2OBOA 1W2KH