2IJOB

Crystal structure of the west nile virus ns2b-ns3 protease complexed with bovine pancreatic trypsin inhibitor
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
176
structure length
168
Chain Sequence
b'GGVLWKKGDTTTGVYRIMTRGLLGSYQAGAGVMVEGVFHTLWHTTKGAALMSGEGRLDPYWGSVKEDRLCYGGPWQLQHKWNGQDEVQMIVVEPGRNVKNVQTKPGVFKTPEGEIGAVTLDFPTGTSGSPIVDKNGDVIGLYGNGVIMPNGSYISAIVQGERMDEPIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyprotein
publication title Structural evidence for regulation and specificity of flaviviral proteases and evolution of the Flaviviridae fold.
pubmed doi rcsb
source organism West nile virus
molecule tags Hydrolase/hydrolase inhibitor
total genus 29
structure length 168
sequence length 176
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00949 Peptidase_S7 Peptidase S7, Flavivirus NS3 serine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ijoB02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2ijoB01
1ZTKA 3SNDA 2O8LA 1BMAA 2Y80A 2WPJS 2BQ6B 2NU3E 3GY6A 3RXFA 3ZVEA 3M36A 1GG6C 1UTLM 4NZLA 5PTPA 1ZHPA 1G32B 5JPMH 3E0NB 3IG6B 1SGEE 4H6SB 4A92A 1FV9A 2EA3A 1RRKA 4E7RG 1W2KH 3MU4A 3ZZ6A 1GI2A 1GI9B 3HKJB 4NWKA 3A88A 1L4ZA 4FUBA 4FUJA 1LPGB 2ALPA 3ATWA 3U8RH 3RDZA 4KKDA 1FN8A 1ANDA 2V0BA 1NRRH 4IMQA 1GJDB 1TE0A 4WF8A 1V2RT 2H1UA 2PSYA 3SHAH 2BLQA 1W11U 3EE0B 3EAJA 4CHAC 2FWWA 4MNVA 8GCHG 3E16B 5L6NH 1UO6A 1NESE 3RXIA 3A85A 3PLPA 1Q3XA 3UQOA 5DP9A 1ZMJA 5EXLA 1U6QA 3OY6U 2PKAA 1H9HE 5JBBS 1ZYOA 1SLWB 4NA8A 3LC3A 3GYMA 3PMJA 3MU5A 2ZTXA 3TH2H 1JXPA 3BTTE 2FS9A 2Z9LA 2O8MA 2ZCHP 3SGQE 2TGTA 1UK3A 2IJD1 4E06H 2B7DH 3S0NA 1TBZH 1TX6A 4CH8B 1UVUH 4MNWA 5JBCS 3RXPA 2G00A 3GISB 1Z1IA 4NG9H 4J2YB 2PSXA 3LGYA 2G5VA 4FUIA 3M5LA 1CT0E 3EGKH 2BDCA 1FDPA 4I8HA 5AFYH 5L2YH 1UCYE 1O3FA 1EPTA 4DY7B 1A3BH 4GVUA 1LQEA 4MG3A 3GCNA 1SSXA 1J16A 1RXPA 1W13U 2JETB 3DD2H 1RTFB 2VIDA 1FY8E 3HGNA 1ETTH 3QUMP 1HXEH 2BZ6H 4KGAA 2D8WA 1IQNA 4UD9H 4X6NA 2HWLB 1CHGA 1C5TA 3RXSA 3TNSA 4I8JA 1CGJE 1K1LA 2A5IA 1SGIB 1ID5H 1QRXA 3S7HB 2BOKA 2A7JA 3BTHE 4INKA 1GMDF 5ETXA 1N8OB 2R0KA 3U8TH 1XX9A 2VU8E 1EPTC 1WU1A 3LGUA 2BDIA 1X7AC 2IJOB 1EAIA 3SV9A 1V2LT 7GCHG 1CGIE 3QGJA 3UUZA 1E37B 3U8OH 4Y8XA 2HPQH 3KQCA 1FZZA 1K1NA 5GIBA 4XBDA 2GX4A 2OQUA 4UFDH 2STBE 1LKBA 3TK5A 1LHFH 1H8IH 5FPYA 1KXEA 3UOPA 1EAWA 4GHQA 2JH6D 1ZOMA 4ZKOU 2J9NA 3FAOA 2CMYA 2SGDE 2A4GA 1K22H 4I8KA 4JZEH 1BTHH 1P09A 2CGAA 3GY8A 2FM2A 3O8CA 3KNXA 2A2QH 1SG8B 1AUTC 2J94A 4AZ2B 1MQ5A 3GYLB 4ZKRU 1LCYA 4U30A 2R2MB 2O8TA 1HAGE 4Y7BA 5FXLA 2A5AA 4JYUH 1FY4A 3T2NA 1W7GH 2VWLA 3MO3A 2SGPE 5J4SA 1GCDA 1DSTA 3K6ZA 1DWDH 5EPYA 3GY3A 1GGDB 1BB0B 1AQ7A 5LPFA 1Y3XA 4AB9A 2HRVA 5DP6A 2CJIA 2CHAB 2AIQA 2F9OA 2GMTC 4XBBA 1ESBA 1P12E 4D9RA 3RXKA 1GJ6A 2FXRA 1HCGA 1GJ4H 2AH4X 3LU9B 3M37A 2PKAB 1MBMA 1C9PA 2FI4E 1MD8A 1DLKB 5DP8A 2FOFA 2XBVA 2PR3A 4CREA 1C5NH 4X6PA 1UTPA 1BTPA 3D62A 1B5GH 1TQ7B 3TNTA 5FCRA 1HLTH 1F0RA 2VJ1A 4CRBA 2ESTE 4YTAA 2FEQH 3MU0A 4B74A 1LPZB 2A2XH 5C67A 5DO4H 2GDEH 2ODPA 3QZRA 1WV7H 1XM1A 1GI0A 1FLEE 1MU6B 2CV3A 1GHAG 2QIQA 2XCFA 4M7GA 1AVWA 1VZQH 1G30B 1BTZA 3SOSA 1ZRKA 5DJ7A 1O32A 5C2ZA 1EP5A 3RM0H 4YT6H 3ZVDA 4MNXA 2V35A 3ATMA 2G55A 4B2AA 1QL7A 3SJ9A 4ABHA 2J95A 3B9FH 1FXYA 3SQEE 2XBXA 4YOIA 3VPKA 2ZDLA 1S5SA 3T5FH 2BHGA 1ESTA 5DKMA 1QBOA 2Y5GA 3ZV9A 1K1IA 1XXFA 1AHTH 2ZCLP 2OLGA 1DVAH 3F9GA 1PQ8A 2WHXA 3BTME 1TGNA 1F7ZA 1RS0A 1C2MA 1NRNH 1P05A 4WY3A 5DP5A 2AMQA 2A4QA 4NWLA 1YC0A 3Q77A 4TPYA 3PV4A 3ATIA 4ABBA 1FIWA 3GCTF 3KQBA 1FN6A 1LHGH 1RTKA 1DOJA 2I6QA 1JOUB 2F91A 3PLKA 1K2I1 2AMDA 2ZU3A 4Y0YE 4BAOB 3LIWA 2YNBA 2C90B 1DSUA 3T29A 2C8YB 2XWBI 1V6DA 2FZZA 1GBJA 2JKHA 1GJ9B 4FUDA 5FBEA 3T28A 4MPXA 2ZP0H 4WJG2 1O3OA 1Y3WA 4LOYH 1O3DA 1XUFA 3O8BA 1AWHB 2R0LA 1IOEA 1KXAA 2TBSA 4J1YA 3MOCA 4AB8A 5HYOA 3AAUA 1QJ1B 1O3KA 3LKWA 4CRAA 1TABE 2GTBA 1OWIA 1IQEA 2EI7A 1AFEH 3FP7E 3SGBE 3SV6A 1O3GA 1FPCH 2FYQA 4UFEH 3PO1C 3TJNA 1FNIA 1B7XB 2ZHDA 2FTMA 2FOEA 3TJUA 1YPJH 4U01A 1QY6A 4AGKA 1SR5C 1SMFE 1CHOG 2PGBB 1Y5UT 3FANA 4ZKSU 1AMHA 4BTTB 1TRMA 1F2SE 4FUHA 2WPHS 6GCHF 1J8AA 3OX7U 1DS2E 3Q3XA 2GZ9A 3MI4A 1EKBB 3GDUA 1TALA 3QLPH 4ZH8A 2BDGA 3MFJA 4CRDA 2VH6A 1W14U 1F0SA 2OP9A 1OKXA 4A1TA 1MTVA 1O5AB 1VITF 2FMJA 5A8XA 3KN2A 2FLBH 1K1MA 2B8OH 2BLVA 2WV4A 1A7SA 3ZZ9A 1C1PA 3LOXA 3W95A 4AOQA 1TPPA 1BRCE 2BX3A 2P93A 1C2FA 2IN2A 1SGFG 1AFQC 3MH7A 2FOBA 2UUYA 3F1SB 1HDTH 1FY1A 1Q31A 1O2SA 2VIPA 2ZCKP 2PKSB 2BOHB 5A09A 2W5EA 2G81E 3RLYH 1MD7A 1SHHB 1EZQA 1JBUH 3F9HA 1O2YA 1GMDG 3BEIB 2HNTF 2GT7A 4NSYA 2BDBA 2UWLA 2F9VA 4Q2KA 1VCQA 2V3OH 1A2CH 1AIXH 1C2DA 2GCHG 4IN2A 3UNSA 3CENA 2TGAA 1UTKA 3UNQA 2OTVA 2TGPZ 4OGYA 2ZDMA 1S0RA 4B76A 3VB7A 5L30H 1GHVH 8LPRA 5DG6A 3A83A 4WMDA 2AFQB 1RD3B 1ELBA 1VGCC 2OINA 5GJ4B 3SUFA 4ISNA 2BYAX 5AHGH 1L2EA 1QB9A 3KEEA 1UHBA 3RP2A 2V3HH 1E38B 2QF0A 3MWIU 3BTEE 5TJXA 1K9OE 1LQDB 4XDEA 1BBRK 1MBQA 1S0QA 4JZFH 1EZUC 3RU4E 1K1PA 1GBMA 5EGMA 1SVPA 2SGFE 2ZHQH 1RGQA 4GAWA 1TGSZ 1LVYA 1V2KT 4ISHH 4LZ1H 2BD9A 1DDJA 1QBNA 1KTSB 5DK1A 3SJOA 3ZVGA 3ZVCA 3GY5A 3R3GB 1S6HA 1O2XA 5EW1H 1PPZA 3MMGA 1WTHD 4Z0KA 1QIXB 2F9PA 3KL6A 3MO6A 4IC5A 2HGTH 2GP9B 2Y82A 3RXUA 3TU7H 3RXTA 2ZZUH 1ANCA 2Z3DA 1OYTH 1QA0A 1C1SA 1O2ZA 3LT3A 3ZVFA 3FP8E 1P2IA 4ABFA 1YBWA 3P92A 4IBLH 1MKXK 3NKKA 2YOLA 4JMYA 1O3JA 5BPEA 1WXRA 4KTSA 1NRSH 1AUJA 2QXJA 7ESTE 1QL8A 4H4FA 1O35A 1LHCH 1MH0A 3U98H 2ZG0H 3ATKA 1O3EA 5LPRA 2NU2E 3DT0H 1C1MA 4OS6A 2AIPA 3A8DA 3PM3A 1XVMA 4Y8YA 2UWOA 1OWEA 1YF4A 2RA0A 1T8NA 2UUKB 3VB6A 1JIRA 1WQVH 5GCHF 5LPEA 1XUGA 1XUJA 3GCOA 1THRH 2Q6DA 2BD7A 2QN5T 5FX5A 3P17H 5AF9H 1TNGA 3SU4A 1PPCE 3SI3H 3BG8A 1W7XH 1XXDA 4DCDA 3M5NA 3GOVB 4O3TA 1TNHA 2GCTB 3QK1A 4BAMB 4QT8C 3NWUA 1V2NT 3U1IB 2BDHA 3KCGH 4K1SA 4Y10E 2UWPA 2ZFFH 5CHAB 1NU7B 1GJCB 1P9SA 1GHYH 1TOCB 2CF9H 3A82A 1Y5BT 1MTSA 4K1TA 2VBCA 3SU3A 1AKSA 4VGCB 2QV1A 1MU8B 6LPRA 2ASUB 1QB6A 4D7FA 4JZDH 1PPGE 1AZ8A 2ULLA 1TRNA 2G8TA 1MZDA 1O39A 1HJAB 4LXBH 1UTQA 1G36A 1V2OT 1GHBG 1UCYK 1BT7A 5EU8A 1G3EA 1CA0C 3ODDA 1ZGIA 4Q7YA 2P3TB 2ZDNA 2BY9X 2FS8A 2OC8A 1OS8A 1HXFH 1GBKA 2ANKH 2ODYB 1H9IE 3KHVA 1DLEA 1O38A 2FLRH 1SQAA 1BA8B 2ZGBH 2ZU5A 3H5CB 3RXOA 1W12U 1MTNB 2ZWLH 5HM9A 1P03A 3TK6A 1Y8TA 1P3CA 4INLA 1F0TA 1WCZA 1O2MA 2D1JA 2WPKS 2OXSA 1P2QA 2FIRH 2G4TA 1ARBA 1FPHH 1DM4B 1NRQH 1SGTA 1AVGH 1UHBB 1Y3UA 2K1QA 3H09A 3UPEA 1AU8A 1O2GH 1OP8A 5JYIA 1YM0A 1GMCG 2ZHEH 2RA3A 3Q3YA 4Y79A 2A45B 1GL0E 1OOKB 5EPNA 4AFZA 2Z3EA 4CRGA 2F9UA 1AVXA 1P9UA 3VGCC 3RXLA 1OWDA 1SGCA 5EW2H 4JK5A 1AO5A 1UCYH 1JRSA 3I29A 1LTOA 1OP2A 3A7VA 1PQ7A 1K1OA 4ZROA 1P02A 2SNVA 1EB2A 1NC6A 1ELTA 1H9LB 1DE7H 2R3UA 1GMHF 2SNWA 3HKIB 1AE5A 1FAXA 3VXFH 1C1WH 4KELA 3KIDU 8KME2 1AB9B 1QRZA 1WSSH 1ZJKA 1VITG 2FOGA 2NWNA 1IQLA 4TYDA 3HPTB 2C3SA 1DWBH 2F9BH 2VIQA 2BQWB 2FDAA 3SU1A 4MPUA 3H7TA 4ZKNU 3DHKH 4MLFB 1E34B 3A89A 1SC8U 1TPSA 1IQKA 2H5CA 2WPLS 1ELAA 2HVXA 1ZZZA 2J4IA 1A0LA 4DIHH 3URDA 2FI5E 1C5YB 1VCWA 3C1KA 4RKOB 4XOJA 3TJOA 4X1RU 1V2TT 1V3XA 3T25A 1O2JA 3SORA 4B75A 1XUIA 1OSSA 2VIVA 3TITA 3NXPA 1Z71A 3E90B 1JIMA 3RC5A 1EOLA 2BVXH 1TMUH 3E0PB 4AFQA 1OYQA 2VWNA 1G9IE 1GG6B 2Q1JA 2BX4A 5EODA 1AWFH 5DP4A 2BQ7B 5C5NA 4B6EA 1AKSB 2VVCA 4YM9A 1UTJA 1XUHA 2AGIX 1BOQA 3LH3A 1YGCH 3UTUH 3EA7A 2H6MA 1HFDA 2ZQ2A 5FCKA 3C27B 1C5VA 1ZPCA 2Z9IA 1H8DH 5H4IB 1A3EH 1GJ7B 2A7CA 1O2VA 1LHDH 1PYTD 3VB3A 3Q00A 2BDAA 2PUXB 1O3BA 2VVVA 4CHAB 1WOFA 2HNTE 3N7OA 1O5GH 1MKWK 3ZVAA 2UUFB 1C9TA 4K5ZA 3ZYDA 3SV8A 1FIZA 3GCHC 3QTOH 1SI5H 2VGCC 3BG4C 1SFQB 2QXGA 2QAAA 1EP6A 5A8YA 4MPVA 1O3NA 1TGCA 5AFZH 2ILNA 4MTBA 1IQGA 3KGPA 3F6UH 4Q7ZA 1O3IA 2GGVB 2GV7A 2WYJA 3O8DA 3RU4T 1SLXB 3V13A 1SOTA 1SBWA 5E0JA 2HPPH 1HAHH 5JBAS 1V2PT 1A5GH 1MCVA 1S81A 3ITIA 1GL1A 1HB0B 3B8JA 1P2JA 3EQ0H 4BOHA 1ZR0A 1AE8H 3A84A 5I25A 1YPHE 3KQDA 2UUJB 4ABIA 2AEIH 3ZZ3A 1SGQE 2XRCA 3P8NA 1F5LA 1QR3E 2XXLA 5J4QA 4OS2A 1ABIH 1AN1E 1WBGB 2QCYA 4X1SU 5LGOA 1ZPZA 1V2UT 1ORFA 3SBKA 1DWEH 1TNLA 2ZGHA 4YO9A 2GD4B 5IYTA 2PW8H 3OTJE 1WUNH 1A5HA 1YCPK 3SNCA 1KY9A 1MKWH 2A0QB 3STJA 2C93B 1AGJA 5IDKA 2WZQA 2P16A 1T8OA 3M5OA 3MU8A 4A5TS 4D9QA 1NZQH 3SO3A 4AORA 1VJ9U 1GI6A 2TRMA 1PPEE 2DUCA 1PJPA 2QF3A 4K8BA 3K6YA 6CHAC 1CVWH 4BTIB 1EPTB 4X1NU 2A31A 2Z9JA 2ZU1A 3A7ZA 3SV7A 2CF8H 1KIGH 3LC5A 4WXVA 1YPKH 3TPIZ 1GI5A 1CT4E 3SZNA 1NT1A 1H1BA 1BHXB 1TX8A 5EXMA 2BTCE 4K60A 2BY6X 4NA7A 2SGAA 4Y7AA 2HALA 1SL3A 2W26A 1MTWA 2ZPSA 2A4RA 1K1JA 3BIVH 4FUCA 3TH3H 3A7WA 1TX7A 3M3SA 4ABDA 4JCNA 3QN7A 2G52A 4X8SH 3LJJA 2EC9H 1FAKH 2ZDAH 3BTKE 4XE4A 3VFEA 4CH2B 1ABJH 4GCHF 1ETSH 1NROH 1XVOA 1EJMA 4BTUB 1ELVA 4K8YA 1O3CA 2WV9A 1Z6EA 4HZHA 3RXQA 4DJZB 3Q3KA 1YCPH 1O3HA 1W10U 2B5TB 2R3YA 1P57B 4OS7A 1ZSJA 4YESB 4NIWA 1SGDE 5T6DA 3UFAA 4ISIH 1O5CB 4O3UA 3MH4A 3TIUA 2BLWA 2P3UB 1MTUA 1ZSKA 3RC4A 1L4DA 3BF6H 3IITA 4ZUHA 5F03A 2XTTB 3PYHA 1O3LA 2ZQ1A 5JB8S 1TA6A 1T7CA 1VR1H 1P2NA 3NPSA 2A4OA 1RIWC 2Q6FA 2XNIA 2VIWA 3SW2B 1MAXA 2FODA 3F68H 1V2MT 5CMXH 2ZA5A 4UE7H 3WY8A 4FUFA 4D7GA 1JWTA 2HNTC 2GMTB 2BY7X 5F8TA 1CA8B 1TBRH 3NZIA 1YP9A 1ELEE 5F6MA 1GBDA 3SU6A 3V12A 1TOMH 4XSKU 4OGXA 3R0FA 2W7UA 2FP7B 1DUEA 1GBAA 4YZUA 1S85A 1UMAH 2D26C 8GCHF 9LPRA 4SGAE 1QNJA 4XFQA 2G5NA 2FESH 1ZMNA 2QC2A 3PMAB 1ANEA 1HAYB 1ZGVA 4PROA 5EXNA 4F49A 1P0SH 4X6OA 2BLOA 1Z8JB 5FBIA 3M7TA 2TIOA 1O2OA 5T6FA 1CE5A 3U1JB 4MQAA 1EB1H 2OD3B 3RXGA 1D3PB 4BNRA 3RXAA 4D8NA 2ALVA 1QJ7B 3NUMA 1DITH 1GMHG 1O2TA 1QFKH 1YPHC 5JDUB 4X2WA 1ETRH 4ZHLU 5A2MH 3OYPA 1O3PB 2Z3CA 4OM9A 1YLDA 4WMFA 2VH0A 3D49H 1FY3A 2AERH 1EQ9A 2QGRA 1C5XB 4FU9A 3BEUA 1LKAA 1W8BH 1D3DB 2WUCA 3E3TA 5A0AE 1NPMA 1F5RA 2ANWA 3TVJB 4Y71A 1WAYB 1ELFA 2P94A 4FU8A 2CXVA 1EASA 1CT2E 1XUKA 4CR5A 1TFXA 1QTFA 1ZMLA 2G4UA 2XWAA 1GHZA 1L1JA 3BTDE 4K69A 3BSQA 1PQ5A 3LPRA 7LPRA 1NFUA 2GT8A 3H7OA 3BN9A 2NU1E 4H42U 4X8VH 3ZZ7A 3AASA 1EAUA 2P8OC 3A8BA 4AN7A 2XW9A 4A1VA 1J9CH 1W3CA 5T3HA 2A1DB 3QX5H 5E0GA 3QTVH 1UK2A 2Z9GA 5C20A 3BTWE 1NRPH 2QXHA 4FXGH 1EUFA 4X2YA 1EOJA 1O30A 3OY5U 1O2KA 1O33A 4NIVA 2C8WB 2WYGA 3PLBA 1QB1A 2VVUA 3S69A 3ZZAA 2EI8A 1C2GA 1LDTT 1B0EA 3PB1E 3E91A 1Z1JA 4RSPA 3MNBA 1A61H 5FX6A 1HAZB 3PMBB 1THPB 1P11E 5SGAE 1YPGH 1SGYE 3P70B 3TH4H 7GCHF 5K0HA 4BANB 2JH5D 5FPSA 1C2IA 4NCYA 3M3VA 1E0FD 1S83A 2Y6TA 4YLUA 1C5PA 1GCTC 5T6GA 4I8GA 4MVNA 4AFSA 3MNCA 2THFB 1CBWC 1BQYA 1DWCH 3SYJA 1W0ZU 3SU2A 2A7HA 1F0UA 3PO1B 1ANBA 2ZO3H 1UVSH 3OTPA 1O2LA 1NFWA 5G4BA 2LNCA 2BZAA 1BIOA 4JYTA 2BMGB 4AGJA 2BD2A 3DFJA 1MQ6A 2FPZA 3GDVA 3QGNB 4KTCA 1LO6A 1Z8IB 1VJAU 3UNRA 3V7TA 3V3MA 3BTQE 4ZHMU 1FJSA 4M9FA 4Q80A 1O0DH 1A1RA 1YYY1 1S84A 5A0BA 3I77A 1GVKB 1RFNA 5K7RA 2VNTA 3TLOA 1A46H 4X1PU 1SB1H 3PWCA 4A1XA 1HJ9A 1O2PA 3S9CA 1Y59T 1UK4A 1XMNB 1LVBA 3FVFB 1ZSLA 4K2YA 1G2MA 1Z8RA 4D76A 1QURH 2ZF0H 1YLCA 1O5EH 3SNBA 1ZHRA 1NU9A 1S82A 3FZDA 2ZEBA 1ACBE 2PHBA 1HBTH 1FY5A 4X0WU 1TQ0B 1NFYA 2PFEA 4LZ4B 1AFQB 2F3CE 2O8UA 1C2KA 1CSOE 4FUGA 5DP7A 5FHTA 4ASHA 4CR9A 1J17T 3LONA 1TNJA 2ZHWH 2SGEE 1L0ZA 3RXJA 3OSYA 4RN6A 4HI3A 3ZVBA 1HIAA 3ZZ5A 1AY6H 1SQOA 2WUBA 3EDXB 4Q7XA 1BDAA 4MNYA 1D3QB 3ZZCA 3MU1A 4FVDA 4E7NA 2HOBA 1RTLA 2J38A 1MMJN 2OK5A 1C1NA 2DE8A 2W7SA 1IAUA 3S9BA 2I6SA 4ZHAA 3BIUH 1GHAF 3SJKA 5FPTA 3RLWH 1SGFA 3M61U 4UEHH 2BVSH 2RCEA 1HJ8A 1NFXA 4NIXA 2C4FH 2BXUH 2JETC 1VGCB 4INHA 4BAHB 1BCUH 4TWWA 1A4WH 3A86A 1EATA 3F9EA 1P2MA 4OS1A 3MNXA 3FP6E 2O8WA 4ABAA 5GWZA 3QDZB 3A8AA 3ATLA 4WH6A 2B9LA 1SHYA 1DY9A 1GBCA 1T31A 3GCTG 1KXFA 3QZQA 1GI1A 2FTLE 2VINA 2FI3E 3TGIE 1KXBA 2Y5FA 1MCTA 2VWMA 2ZFRH 1TB6H 1KDQA 3ZV8A 1GDUA 1T8LA 1N8OC 3VXEH 1T4VH 1KLTA 1SQTA 5DGJA 1ESAA 3ODFA 3ZZBA 3SUGA 2PTNA 2PTCE 5DP3A 2Y81A 2AGEX 3TJVA 2XYAA 2F9NA 4WWYA 5HMAA 2H9HA 1Y3YA 4GHTA 2WPMS 1O31A 3P8OA 2V6NA 2GZ7A 1NY22 2ZFPH 2ZPQA 3RXCA 1GVLA 1O36A 3EA8A 1HAVA 1UVPA 3AVZA 4ISLA 1YKTA 2SFAA 3RMLH 4JZ1A 2ZC9H 1TAWA 1GWAA 2TPIZ 1YCPM 1BITA 4MDSA 3LGVA 1NN6A 3JZ2B 4O03A 3S9AA 1RJXB 4UFGH 4ABEA 4GLYA 1BMMH 3GY7A 4TY7A 2BD5A 3MO9A 1UVOA 4OS4A 1GDNA 1HV7A 1O3MA 3GDSA 4FU7A 6GCHG 1CHOF 3DA9B 1FONA 1IHSH 1WYKA 5L2ZH 1OWJA 1JRTA 3P6ZB 2A32A 1P3EA 1L1GA 1J14A 3SU0A 1V2QT 5E2PA 5ESBA 2TGDA 1GGDC 1BJVA 1GJ8B 1Q2WA 1WTGH 1KTTB 3L3TA 1KYNA 2EI6A 1P01A 2CHAC 3D23A 3L6PA 1EXFA 3UQVA 3SUEA 1A5IA 1S6FA 2Y7XA 3V0XA 1XKAC 4THNH 3TGJE 1HAPH 2GZ8A 1ELGA 1VITH 1CGHA 5A0CA 3NK8A 1QA7A 4I33A 1HPGA 5DPAA 2ZHFH 3M7UA 4DURA 2F83A 5C1UA 5EQQA 2P59A 1W0YH 1G3BA 5AVDA 1M9UA 1O2UA 3OU0A 3Q76A 1MZAA 1HIAB 4YLQH 2ZFQH 1CA0B 1GHWH 2BM2A 2OC1A 3UR9A 1Z8GA 1FQ3A 1GI4A 1UTMA 1GJAB 1P8VC 1E35B 2OBQA 1C5SA 3VB4A 1BJUA 5F8XA 1D6WA 3NCLA 3A87A 3UWIA 2WPIS 1IQJA 2R2WU 3QO6A 1PPHE 4NA9H 4B1TA 1EZSC 5C3NA 1BTUA 2GCHF 4ZAEA 4DG4A 1VCPA 1A0HB 1PFXC 1QRWA 1T32A 1UTOA 4R8TB 4YT7H 4KTUA 1CO7E 2BD8A 3I78A 4X2VA 1KLJH 2AS9A 4YOGA 1G37A 3KQEA 2B0FA 3M3TA 5E2OA 4HTCH 4I32A 1QJ6B 3RXVA 3T62A 1ELCA 4X1QU 3T27A 3IWMA 1GBLA 4JK6A 3ESTA 4Y11E 1HAOH 3LH1A 1GI7B 1C5ZB 2ZECA 5LH8A 3SN8A 1KDQB 1TNIA 4E05H 3VGCB 2FOMB 3A7YA 1KLIH 5HXFA 3CP7A 2ZKSA 4X2XA 5EOKA 1HYLA 3PMHB 1DFPA 1KXDA 1DXWA 1C4V2 1O2NA 3RXDA 3BEFB 1GBIA 1GBTA 1Z6JH 6ESTA 2Z94A 2OBOA 2Z9KA 2XBWA 1EZXC 1UJ1A 1HAVB 1YPLH 2HLCA 4X8TH 1DX5M 1TA2A 1GJ5H 2NU4E 1O5BB 1PQAA 2C8XB 2ZPRA 3SJ8A 5EQSA 1INCA 1TMTH 2GVFA 2P3FH 1TIOA 3SV2H 1TBQH 1HAIH 4CRCA 3PV2A 2IPHA 1C5WB 4IC6A 1TWXB 1C4Y2 3SNAA 2F4LA 3JZ1B 3AW1A 2FYRA 2J2UA 3SU5A 3DUXH 5GCHG 4ZMAH 1PPFE 4HGCA 3UY9A 3RXRA 3URCA 1N1LA 4WH8A 1O2HA 1SLUB 1BHXF 4H6TA 8ESTE 2YNAA 2H5DA 5GXPA 1FUJA 3BV9B 1SLVB 4B73A 2KAIA 4BXSA 1SPJA 1P06A 1K21H 2C8ZB 4ZXYH 3HATH 1NTPA 1O34A 2BY5X 1C2LA 1ZTJA 1SFIA 2SGQE 4JZIA 2XBYA 2BD4A 1SGNE 1GBEA 4HFPB 2ANMH 1TGBA 3A80A 4A6LA 1P04A 5E0HA 1O5FH 3A7TA 1DXPA 4MPWA 1OWKA 1QCPA 1OX1A 2ZFTA 3BTGE 1THSH 4AG1A 2OCVB 3K2UA 4IGDA 5GDSH 3RC6A 3PWBA 2FO9A 1T4UH 4F4OC 4I7YH 3AAVA 1OXGA 4SGBE 1IQFA 2XC4A 3RMMH 3MH6A 1LVMA 1TRYA 1DUAA 5TCCA 1QL9A 2PKSC 4U32A 4Y0ZE 1DANH 3U69H 1O37A 2FOHA 4X8UH 5HGGA 1K28D 1TONA 1GHBF 3RUOA 2OC7A 3ZZ8A 1ZHMA 5BRRE 3GCHB 4RKJB 2ZNKH 2Q6GA 3DFLA 3HK6B 2VGCB 3BG4B 4Y8ZA 5C1YA 3KF2A 2AYWA 1TGTA 3PTNA 2PWXA 2FOCA 4IW4E 1QBVH 2ZTYA 4KP0A 3FFGA 3SHCH 1GBHA 4CBOA 2W3IA 4NGAH 4DT7B 4AYVB 1GVZA 4Z6AH 1MUEB 1EX3A 3EYDA 4RI0A 1TYNA 2XC5A 2ODQA 3LGIA 1V2VT 5I46H 3BTFE 2ZDVH 1O5DH 2VB0A 3VEQB 2OQ5A 5A8ZA 1H4WA 3MYWA 1GDQA 5C1XA 3RXHA 2J34A 1BTXA 1SGRE 1O2WA 2BVRH 1V2JT 1ZTLA 3A7XA 2ZDKA 4NFFA 1HNEE 1ZPBA 2PV9B 2JH0D 4U2WA 2VWOA 3MHWU 3SNEA 2Z7FE 1G3DA 1OP0A 4DVAU 1HGTH 2M5TA 4FUEA 1GMCF 4TY6A 7KMEH 1BRBE 3O8RA 4NZQA 2ZFSA 2PLXA 1C4U2 1EJNA 2ANYA 1D3TB 1BRAA 1QQ4A 1GJBB 3FZZA 2GKVE 4R0IA 5B6LA 3RXBA 2XCNA 1NM6A 1C1TA 4ABGA 1KSNA 1FMGA 1A0JA 4ZXXH 4DIIH 3LGTA 1ZJDA 6CHAB 4FVBA 1DY8A 1D9IA 3L33A 1PYTC 5EG4A 5ESTE 3UIRA 2PGQB 4GPGA 2R9PA 2Y5HA 1NO9H 1DT2A 2VIOA 3SGAE 1T8MA 3HGPA 2DE9A 2LPRA 4GSOA 5EQRA 1C2JA 1JMOH 2FX6A 1C1OA 1LHEH 2NU0E 3AW0A 3P8FA 1HAXB 2FOAA 5TCAA 3K65B 4UONA 1BRUP 1HRTH 2ZIQH 4X6MA 4AYYB 5B6OA 5FAHA 1TPAE 1WQSA 2ZGJA 1C1UH 4AFUA 1D6RA 5JB9S 2KAIB 5GPIB 1BZXE 4OS5A 2H2ZA 1NS3A 3F9FA 1CU1A 1Y5AT 2STAE 4AG2A 3RU4D 3GY2A 2AMPA 4I8LA 4BAKB 1Z7KA 2OUAA 1O2RA 2GCTC 2ZGXH 2ZTZA 3A8CA 3LGWA 4BXWA 3T26A 3D65E 4I31A 2WINI 1P2OA 4JYVH 1ZRBA 1CQQA 5CHAC 3PV5A 1SOZA 1GBFA 1IQIA 3RMOH 2GDDA 2QY0B 1D4PB 1GHXH 3G01A 1N6YA 4VGCC 3ELAH 5CE1A 5JBTA 2QYIA 1ZLRA 1BMNH 4K1EA 1RIWB 1C5QA 5F8ZA 2P95A 4B71A 3ENSB 1HUTH 1E36B 4DGJA 4WXIA 4WMEA 3UR6A 4LK4A 4IMZA 3RM2H 4O97A 1BUIA 1HJAC 3E6PH 5T1VA 2FX4A 1Y3VA 1LMWB 2D2DA 2BY8X 1GBBA 1OPHB 3UWJH 1C5LH 2Z6BD 1KXCA 3ZYEA 1C5RA 4DW2U 4IS5A 4ISOA 2ZU2A 3TK9A 1C5UA 2H9EH 3B23B 1AI8H 2OC0A 2Y7ZA 3UREA 1MTNC 4TPIZ 3ZZ4A 3GY4A 3RXEA 1MAYA 3P8GA 4A7IB 3CS7A 2ZI2H 9ESTA 4XBCA 4NIYA 4UDWH 1G2LA 2BD3A 3UOUA 3SUDA 3E8LA 2QXIA 2W3KA 1TLDA 1O2QA 1ELDE 2PUQH 3LDXH 1LVOA 4YOJA 3U9AH 5C5OA 4AX9H 4ABJA 4ESTE 3AK5A 2CN0H 1BTYA 1UVTH 4IN1A 1EAXA 1EJAA 3M35A 4CRFA 1UTNA 3RXMA 3A81A 1P10A 1L1NA 1QHRB 4NSVA 3VB5A 3RMNH 1F5KU 1YPMH 4O9VA 3PROA 1BMLA 4K3JA 2GV6A 2ZGCA 4B6FA 3SI4H 1C5OH 3P95A 3ZZDA 1TPOA 1C1RA 5ABWA 2BDYA 5E8EH 3E1XB 1YPEH 1DPOA 1DICA 2EEKA 4UFFH 1TMBH 1BBRH 2P8OB 5GNDA 1LPKB 2RG3A 4DOQA 1TNKA 1V2ST 3K9XB 3PTBA 1OWHA 2WV5A 2RDLA 3MNSA 1IQHA 4GUXA 2QA9E 1PPBH 2BXTH 3SJIA 1QQUA 3W94A 1N6XA 1G3CA 1XKBC 4TWYA 3LJOA 5HM2A 1B0FA 1AD8H 1AB9C 1GPZA 3QWCH 2ZU4A 3SQHE 3TGKE 1F92A 1BBRE 4NFEA 1SGPE 1QGFA 2J92A 2O9QA 2IOTA 2A5KA 3STIA 1AZZA 1C1VH 3M5MA 1ARCA 3EA9A 1O2IA 2H9TH 2XC0A 4BAQB 3MH5A 3GICB 1GI3A 4Y76A 4CBNA 1MKXH 3CS0A 1C1QA 1GCTB 3HK3B 1C2HA 1GI8B 3MTYA 4GCHG 3S7KB 4B2CA 1C5MD 4Y6DA 1P2KA 1V2WT 2AGGX 1FI8A 1CBWB 2G51A 1IQMA 1J15A 1C2EA 1IHTH 1O3AA 2BB4A 3SZEA 1BTWA 4WVPE 3M7QA 4B2BA
chains in the Genus database with same CATH superfamily
1ZTKA 3SNDA 2WPDD 2O8LA 1BMAA 2Y80A 2WPJS 1YWUA 2K8IA 2BQ6B 2NU3E 3GY6A 3RXFA 3ZVEA 3M36A 3W1EA 1GG6C 1UTLM 4NZLA 5PTPA 1ZHPA 1G32B 5JPMH 3E0NB 3IG6B 1SGEE 4H6SB 4A92A 1FV9A 1NBME 2EA3A 1RRKA 4E7RG 1W2KH 3MU4A 3ZZ6A 1GI2A 1SQRA 1GI9B 3HKJB 4NWKA 3A88A 1L4ZA 4FUBA 4FUJA 1LPGB 2ALPA 3ATWA 3U8RH 3RDZA 4KKDA 1FN8A 1ANDA 2V0BA 2W6ID 1NRRH 4IMQA 1GJDB 1TE0A 4WF8A 1V2RT 2H1UA 2PSYA 3SHAH 2BLQA 1W11U 3EE0B 3EAJA 4CHAC 2FWWA 4MNVA 8GCHG 3E16B 5L6NH 1UO6A 1NESE 3RXIA 3A85A 3PLPA 1Q3XA 3UQOA 5DP9A 1ZMJA 5EXLA 1U6QA 3OY6U 2PKAA 1H9HE 5JBBS 1ZYOA 1SLWB 4NA8A 3LC3A 3GYMA 3PMJA 3MU5A 1VKYA 3WWBA 2ZTXA 3TH2H 1JXPA 3BTTE 2FS9A 2Z9LA 2O8MA 2ZCHP 3SGQE 2TGTA 1UK3A 2IJD1 4E06H 2B7DH 3S0NA 1TBZH 1TX6A 4CH8B 1UVUH 4MNWA 5JBCS 3RXPA 2G00A 3GISB 1Z1IA 4NG9H 4J2YB 2PSXA 3LGYA 2G5VA 4FUIA 3M5LA 1CT0E 3EGKH 2BDCA 1FDPA 4I8HA 5AFYH 5L2YH 1UCYE 1O3FA 1EPTA 4DY7B 1A3BH 4GVUA 1LQEA 4MG3A 3GCNA 1SSXA 1J16A 1RXPA 1W13U 4Z1MD 2JETB 3DD2H 1RTFB 2VIDA 1FY8E 3HGNA 1ETTH 3QUMP 1HXEH 2BZ6H 4KGAA 2D8WA 1IQNA 4UD9H 4X6NA 2HWLB 1CHGA 1C5TA 3RXSA 3TNSA 4I8JA 1CGJE 1K1LA 2A5IA 1SGIB 1ID5H 1QRXA 3S7HB 2BOKA 2A7JA 3BTHE 4INKA 1GMDF 5ETXA 1N8OB 2R0KA 3U8TH 1XX9A 2VU8E 1EPTC 1WU1A 3LGUA 2BDIA 1X7AC 2IJOB 1EAIA 3SV9A 1V2LT 7GCHG 1CGIE 3QGJA 3UUZA 1E37B 3U8OH 3OAAD 4Y8XA 4P00A 2HPQH 3KQCA 1FZZA 1K1NA 5GIBA 4XBDA 2GX4A 2OQUA 4UFDH 2STBE 1LKBA 3TK5A 1LHFH 1H8IH 5FPYA 1KXEA 3UOPA 1EAWA 4GHQA 2JH6D 1ZOMA 4ZKOU 2J9NA 2J98B 3FAOA 2CMYA 2SGDE 2A4GA 1K22H 4I8KA 4JZEH 1BTHH 1P09A 2CGAA 3GY8A 2FM2A 3O8CA 3KNXA 2A2QH 1SG8B 1AUTC 2J94A 4AZ2B 1MQ5A 3GYLB 4ZKRU 1LCYA 4U30A 2R2MB 2O8TA 1HAGE 4Y7BA 5FXLA 2A5AA 4JYUH 1FY4A 3T2NA 1W7GH 2VWLA 3F3BA 3MO3A 2SGPE 5J4SA 1GCDA 1DSTA 3K6ZA 1DWDH 5EPYA 3GY3A 1GGDB 1BB0B 1AQ7A 5LPFA 1Y3XA 4AB9A 2HRVA 5DP6A 2CJIA 2CHAB 2AIQA 2F9OA 2L6OA 2GMTC 4XBBA 1ESBA 1P12E 4D9RA 3RXKA 1GJ6A 2WSSD 2FXRA 1HCGA 1GJ4H 2AH4X 3LU9B 3M37A 2PKAB 1MBMA 1C9PA 2FI4E 1MD8A 1DLKB 5DP8A 2FOFA 2XBVA 2PR3A 4CREA 1C5NH 4X6PA 5KEDA 1UTPA 1BTPA 3D62A 1B5GH 1TQ7B 3TNTA 5FCRA 1HLTH 1F0RA 2VJ1A 4CRBA 2ESTE 4YTAA 2FEQH 3MU0A 4B74A 1LPZB 2A2XH 3UAIC 5C67A 5DO4H 2GDEH 2ODPA 3QZRA 1WV7H 1XM1A 1GI0A 1FLEE 1MU6B 2CV3A 1GHAG 2QIQA 4RT1A 2XCFA 4M7GA 1AVWA 1VZQH 1G30B 1BTZA 3SOSA 1ZRKA 5DJ7A 1O32A 5C2ZA 5HKKD 1EP5A 3RM0H 4YT6H 3ZVDA 4MNXA 2V35A 3ATMA 2G55A 4B2AA 1QL7A 3SJ9A 4ABHA 2J95A 3B9FH 1FXYA 3SQEE 2XBXA 4YOIA 3VPKA 2ZDLA 1S5SA 3T5FH 2BHGA 1ESTA 5DKMA 1QBOA 2Y5GA 3ZV9A 1K1IA 1XXFA 1AHTH 2ZCLP 2OLGA 1DVAH 3F9GA 1PQ8A 2WHXA 3ZIAD 3BTME 1TGNA 1F7ZA 1RS0A 5C17A 1C2MA 1NRNH 1P05A 4WY3A 5DP5A 2AMQA 2A4QA 4NWLA 1YC0A 3Q77A 4TPYA 3PV4A 3ATIA 4ABBA 1FIWA 3GCTF 3KQBA 1FN6A 1LHGH 3DSPA 1RTKA 1DOJA 2I6QA 1JOUB 2F91A 3PLKA 1K2I1 2AMDA 2F43B 2ZU3A 4Y0YE 4BAOB 3LIWA 2YNBA 2C90B 4XD7D 1DSUA 3T29A 2C8YB 2XWBI 1V6DA 2FZZA 1GBJA 2JKHA 3KYFA 1GJ9B 4FUDA 5FBEA 3T28A 2K0QA 4MPXA 2ZP0H 4WJG2 1O3OA 1Y3WA 4LOYH 1O3DA 1XUFA 3O8BA 1AWHB 2R0LA 1IOEA 1KXAA 2TBSA 4J1YA 3MOCA 4AB8A 5HYOA 3AAUA 1QJ1B 1O3KA 3LKWA 4CRAA 1TABE 2GTBA 1OWIA 2EI7A 1IQEA 1AFEH 3FP7E 3SGBE 3SZEA 1O3GA 1FPCH 2FYQA 4UFEH 3PO1C 3TJNA 1FNIA 1B7XB 2ZHDA 2FTMA 2FOEA 3TJUA 1YPJH 4U01A 1QY6A 4AGKA 1SR5C 1SMFE 1CHOG 2PGBB 1Y5UT 3FANA 4ZKSU 1AMHA 4BTTB 1TRMA 1F2SE 4FUHA 2WPHS 6GCHF 1J8AA 3OX7U 1DS2E 3Q3XA 2GZ9A 3MI4A 1EKBB 3GDUA 1TALA 3QLPH 4ZH8A 2BDGA 3MFJA 4CRDA 2VH6A 1W14U 1F0SA 2OP9A 1OKXA 4A1TA 1MTVA 1O5AB 1VITF 2FMJA 5A8XA 3KN2A 2FLBH 1K1MA 2B8OH 2BLVA 2WV4A 1A7SA 3ZZ9A 1C1PA 2KCOA 3LOXA 3W95A 4AOQA 1TPPA 1BRCE 2BX3A 2P93A 1C2FA 2IN2A 1SGFG 1AFQC 3MH7A 2FOBA 2UUYA 3F1SB 1HDTH 1FY1A 1Q31A 1O2SA 2VIPA 2ZCKP 2PKSB 2BOHB 5A09A 2RFKC 2W5EA 2G81E 3RLYH 1MD7A 1SHHB 1WDIA 1EZQA 1JBUH 3F9HA 1O2YA 1GMDG 2KCAA 3BEIB 2HNTF 2GT7A 4NSYA 2BDBA 2UWLA 2F9VA 4Q2KA 1VCQA 2V3OH 1A2CH 1AIXH 1C2DA 2GCHG 4IN2A 3UNSA 2YMSC 3CENA 2TGAA 1UTKA 3UNQA 2OTVA 2TGPZ 4OGYA 2ZDMA 1S0RA 4B76A 3VB7A 3DSOA 5L30H 1GHVH 8LPRA 5DG6A 3A83A 4WMDA 2AFQB 1RD3B 1ELBA 1VGCC 2OINA 5GJ4B 3SUFA 4ISNA 2BYAX 5AHGH 3UB0A 1L2EA 1QB9A 3F2HA 3KEEA 1UHBA 3RP2A 2V3HH 1E38B 2QF0A 3MWIU 3BTEE 5TJXA 1K9OE 1LQDB 4XDEA 1BBRK 1MBQA 1S0QA 4JZFH 1EZUC 3RU4E 1K1PA 1GBMA 5EGMA 1SVPA 4ASUD 2SGFE 2ZHQH 1RGQA 4GAWA 1TGSZ 1LVYA 1V2KT 4ISHH 4LZ1H 2BD9A 1DDJA 1QBNA 1KTSB 5DK1A 3SJOA 3ZVGA 3ZVCA 3GY5A 3R3GB 1S6HA 1O2XA 5EW1H 1PPZA 3MMGA 1WTHD 2CK3D 4Z0KA 1QIXB 2F9PA 3KL6A 3MO6A 4IC5A 2HGTH 2GP9B 2Y82A 3RXUA 3TU7H 5FL7D 5HIZA 3RXTA 2ZZUH 1ANCA 2Z3DA 1OYTH 1QA0A 1C1SA 1O2ZA 3LT3A 3ZVFA 3FP8E 1P2IA 4ABFA 1YBWA 3P92A 4IBLH 1MKXK 3NKKA 2YOLA 4JMYA 1O3JA 5BPEA 1WXRA 4KTSA 1NRSH 1AUJA 2QXJA 5EIYA 7ESTE 1QL8A 4H4FA 1O35A 1LHCH 1MH0A 3U98H 2W6JD 2ZG0H 3ATKA 1O3EA 5LPRA 2NU2E 3DT0H 1C1MA 4OS6A 2AIPA 3A8DA 3PM3A 1XVMA 4Y8YA 1H8HD 2UWOA 1OWEA 1YF4A 2RA0A 1T8NA 2UUKB 3VB6A 1JIRA 1WQVH 2KCPA 5GCHF 5LPEA 1XUGA 1XUJA 3GCOA 1THRH 2Q6DA 2BD7A 2QN5T 5FX5A 3P17H 5AF9H 1TNGA 3SU4A 1PPCE 3GS9A 3SI3H 3BG8A 1W7XH 1XXDA 4DCDA 2KZ4A 3M5NA 3GOVB 3N7EA 4O3TA 1TNHA 2GCTB 3QK1A 4BAMB 4QT8C 1MABB 3NWUA 1V2NT 3U1IB 2BDHA 3KCGH 4K1SA 4Y10E 2UWPA 2ZFFH 5CHAB 1NU7B 1GJCB 1P9SA 1GHYH 1TOCB 2CF9H 3A82A 1Y5BT 1MTSA 4K1TA 2VBCA 3SU3A 1AKSA 4VGCB 2QV1A 1MU8B 6LPRA 2ASUB 1QB6A 2J97A 4D7FA 4JZDH 1PPGE 1AZ8A 2ULLA 1TRNA 2G8TA 3OEED 1MZDA 1O39A 1HJAB 4LXBH 1UTQA 1G36A 1V2OT 1GHBG 1UCYK 1BT7A 5EU8A 1G3EA 1CA0C 3ODDA 1ZGIA 4Q7YA 4DT4A 2P3TB 2ZDNA 2BY9X 2FS8A 2OC8A 1OS8A 1HXFH 1GBKA 2ANKH 2ODYB 1H9IE 3KHVA 4HG6A 1DLEA 1O38A 2FLRH 1SQAA 5DSFA 1BA8B 2ZGBH 2ZU5A 3H5CB 3RXOA 1W12U 1MTNB 2ZWLH 5HM9A 1P03A 3TK6A 1Y8TA 1P3CA 4INLA 1F0TA 1WCZA 1O2MA 2D1JA 2WPKS 2OXSA 1P2QA 2FIRH 2G4TA 1ARBA 1FPHH 1DM4B 1NRQH 1SGTA 1AVGH 1UHBB 1Y3UA 2K1QA 3H09A 3UPEA 1AU8A 1O2GH 1OP8A 4F55A 5JYIA 1YM0A 2V3MA 4P02A 1GMCG 2ZHEH 2RA3A 3Q3YA 4Y79A 2A45B 1GL0E 1OOKB 5EPNA 4AFZA 2Z3EA 4CRGA 2F9UA 1AVXA 1P9UA 3VGCC 3RXLA 1BMFD 1OWDA 1SGCA 5EW2H 4JK5A 1AO5A 1UCYH 1JRSA 3I29A 1LTOA 1OP2A 3A7VA 1PQ7A 1K1OA 4ZROA 1P02A 2SNVA 1EB2A 1NC6A 5IK2D 1ELTA 1H9LB 1DE7H 2R3UA 1GMHF 2SNWA 3HKIB 1AE5A 1FAXA 3VXFH 1C1WH 4KELA 3KIDU 8KME2 1OHHD 5KECA 1AB9B 1QRZA 1WSSH 1ZJKA 1VITG 2FOGA 2NWNA 1IQLA 4TYDA 3HPTB 2C3SA 1DWBH 2F9BH 2VIQA 2BQWB 2FDAA 1QZ8A 3SU1A 4MPUA 3H7TA 4ZKNU 3DHKH 4MLFB 1E34B 2AHME 3A89A 3KYGA 1SC8U 1TPSA 1IQKA 2H5CA 2WPLS 1ELAA 2HVXA 1ZZZA 2J4IA 1A0LA 4DIHH 3URDA 2FI5E 1C5YB 1VCWA 3C1KA 4RKOB 4XOJA 3TJOA 4X1RU 1V2TT 1V3XA 3T25A 1O2JA 3SORA 4B75A 3F2GA 1XUIA 1OSSA 2VIVA 3TITA 3NXPA 1Z71A 1UW7A 3E90B 1JIMA 3RC5A 1EOLA 2BVXH 1TMUH 4Q63A 3E0PB 1YY3A 4AFQA 1OYQA 2VWNA 1G9IE 1GG6B 2Q1JA 2BX4A 5EODA 1AWFH 2KX4A 2XNDD 5DP4A 2BQ7B 5C5NA 2LP6A 4B6EA 1AKSB 2VVCA 4YM9A 1UTJA 1XUHA 2AGIX 1BOQA 3LH3A 1YGCH 3UTUH 3EA7A 2H6MA 1HFDA 2ZQ2A 4ACBA 5FCKA 3C27B 1C5VA 1ZPCA 2Z9IA 1H8DH 5H4IB 1A3EH 1GJ7B 2A7CA 1O2VA 1LHDH 1PYTD 3VB3A 3Q00A 2QE7D 2BDAA 2PUXB 1O3BA 2VVVA 4TT3D 4CHAB 1WOFA 2HNTE 3N7OA 2JIZD 1O5GH 1MKWK 3ZVAA 2UUFB 1C9TA 4K5ZA 3ZYDA 3SV8A 1FIZA 3GCHC 3QTOH 1SI5H 2VGCC 3BG4C 1SFQB 2QXGA 3SV6A 2QAAA 1EP6A 5A8YA 4MPVA 1O3NA 3F2FA 1TGCA 5AFZH 2ILNA 4MTBA 1IQGA 3KGPA 3F6UH 4Q7ZA 1O3IA 2GGVB 2GV7A 2WYJA 3O8DA 3RU4T 4XRNA 1SLXB 3V13A 1SOTA 1SBWA 5E0JA 2HPPH 1HAHH 5JBAS 1V2PT 1A5GH 1MCVA 1S81A 3ITIA 1GL1A 1HB0B 3B8JA 1P2JA 3EQ0H 4BOHA 1ZR0A 1AE8H 3A84A 5I25A 1YPHE 3KQDA 2UUJB 4ABIA 2AEIH 3ZZ3A 4Q4LA 1W0KD 1SGQE 2XRCA 3P8NA 3OE7D 1F5LA 1QR3E 2XXLA 5J4QA 4OS2A 1ABIH 1AN1E 1WBGB 2QCYA 4X1SU 5LGOA 1ZPZA 1V2UT 1ORFA 3SBKA 1DWEH 1TNLA 2ZGHA 4YO9A 2GD4B 5C94A 5IYTA 2PW8H 4FETA 3FKSD 3OTJE 4ACAA 1WUNH 1A5HA 1YCPK 3SNCA 1KY9A 1MKWH 2A0QB 3STJA 2C93B 1AGJA 2WZQA 5IDKA 1T8OA 2P16A 3M5OA 3MU8A 4A5TS 4D9QA 1NZQH 3SO3A 4AORA 1VJ9U 1GI6A 2TRMA 2J5UA 1PPEE 2DUCA 1PJPA 2QF3A 4K8BA 3K6YA 6CHAC 1CVWH 4BTIB 1EPTB 4X1NU 2A31A 5EJ1A 2Z9JA 2ZU1A 3A7ZA 3SV7A 2CF8H 1KIGH 3LC5A 4WXVA 3F0PA 1YPKH 3FN8A 3TPIZ 1GI5A 1CT4E 5CDFE 3SZNA 1NT1A 1H1BA 1BHXB 1TX8A 5EXMA 4AC9A 2BTCE 4K60A 2BY6X 4NA7A 2SGAA 4Y7AA 2HALA 1SL3A 2W26A 1MTWA 2ZPSA 2A4RA 1K1JA 3BIVH 2RDEA 4FUCA 3TH3H 3A7WA 1TX7A 3M3SA 2KM0A 4JCNA 3QN7A 4ABDA 2G52A 4X8SH 3LJJA 2EC9H 1FAKH 2KFWA 2ZDAH 3BTKE 4XE4A 3VFEA 4CH2B 1ABJH 4GCHF 1ETSH 1NROH 1XVOA 1EJMA 4BTUB 1ELVA 4K8YA 1O3CA 2WV9A 1Z6EA 2PP6A 4HZHA 3RXQA 4DJZB 3Q3KA 1YCPH 1O3HA 1W10U 2B5TB 2R3YA 1P57B 3OEHD 1ZSJA 4OS7A 4YESB 4NIWA 1SGDE 5T6DA 3UFAA 4ISIH 1O5CB 4O3UA 3MH4A 3TIUA 2BLWA 2KR7A 2P3UB 1MTUA 1ZSKA 3RC4A 1L4DA 3BF6H 3IITA 4ZUHA 5F03A 2XTTB 3PYHA 1O3LA 2ZQ1A 5JB8S 1TA6A 1T7CA 1VR1H 1P2NA 3NPSA 2A4OA 1RIWC 2Q6FA 2XNIA 2VIWA 3SW2B 1MAXA 5C0UA 2FODA 3F68H 1V2MT 5CMXH 4YXWD 2ZA5A 4UE7H 3WY8A 4FUFA 4D7GA 1JWTA 2HNTC 2GMTB 2BY7X 5F8TA 1CA8B 1TBRH 3NZIA 1YP9A 1ELEE 5F6MA 1GBDA 3SU6A 3V12A 1TOMH 4XSKU 4OGXA 3R0FA 2W7UA 2FP7B 1DUEA 1GBAA 4YZUA 1S85A 1UMAH 2D26C 8GCHF 9LPRA 4SGAE 1QNJA 4XFQA 2G5NA 2FESH 1ZMNA 2QC2A 3PMAB 1ANEA 1HAYB 1ZGVA 4PROA 5EXNA 4F49A 1P0SH 4X6OA 2BLOA 1Z8JB 5FBIA 3M7TA 2TIOA 1O2OA 5T6FA 1CE5A 3U1JB 4MQAA 1EB1H 2OD3B 3RXGA 1D3PB 4BNRA 3RXAA 4D8NA 2ALVA 1QJ7B 3NUMA 1DITH 1GMHG 1O2TA 1QFKH 1YPHC 5JDUB 4X2WA 1ETRH 4ZHLU 5A2MH 5C0TA 3OYPA 1O3PB 2Z3CA 4OM9A 1YLDA 1KMHB 4WMFA 2VH0A 3D49H 1FY3A 2AERH 1EQ9A 2QGRA 1C5XB 4FU9A 3BEUA 1LKAA 1W8BH 1D3DB 2WUCA 3E3TA 5A0AE 1NPMA 1F5RA 2ANWA 3TVJB 4Y71A 1WAYB 1ELFA 2LELA 2P94A 4FU8A 4ZCNA 2CXVA 1EASA 1CT2E 1XUKA 4CR5A 1TFXA 1QTFA 1ZMLA 2G4UA 2XWAA 1GHZA 1L1JA 3BTDE 4K69A 3BSQA 1PQ5A 3LPRA 7LPRA 1NFUA 2GT8A 3H7OA 3BN9A 2NU1E 4H42U 4X8VH 3ZZ7A 3AASA 1EAUA 2P8OC 3A8BA 4AN7A 2XW9A 4A1VA 1J9CH 1W3CA 5T3HA 5EJLA 2A1DB 3QX5H 5E0GA 3QTVH 1UK2A 2Z9GA 5C20A 3BTWE 1NRPH 2QF5A 2QXHA 4FXGH 1EUFA 4X2YA 1EOJA 1O30A 3OY5U 1O2KA 1O33A 4NIVA 2C8WB 2WYGA 3PLBA 1QB1A 2VVUA 3S69A 3ZZAA 2EI8A 1H8ED 1C2GA 1LDTT 1B0EA 3PB1E 3E91A 1Z1JA 4RSPA 3MNBA 1A61H 5FX6A 1HAZB 3PMBB 1THPB 1P11E 5SGAE 1YPGH 1SGYE 3P70B 3TH4H 7GCHF 5K0HA 4BANB 2JH5D 5FPSA 1C2IA 4NCYA 3M3VA 1E0FD 1S83A 2Y6TA 4YLUA 1C5PA 1GCTC 5T6GA 4I8GA 4MVNA 4AFSA 3MNCA 2THFB 1CBWC 1BQYA 1DWCH 3SYJA 1W0ZU 3SU2A 2A7HA 1F0UA 3PO1B 1ANBA 2ZO3H 1UVSH 3OTPA 1O2LA 1NFWA 5G4BA 2LNCA 2BZAA 1BIOA 4JYTA 2BMGB 4AGJA 2BD2A 3DFJA 1MQ6A 2FPZA 2L74A 3GDVA 3QGNB 4KTCA 1LO6A 1E79D 1Z8IB 3F0OA 1VJAU 3UNRA 3V7TA 3OFND 3V3MA 3BTQE 4ZHMU 1FJSA 4M9FA 4Q80A 3U28C 1O0DH 1A1RA 1YYY1 1S84A 5A0BA 3I77A 1GVKB 1RFNA 5K7RA 2VNTA 3TLOA 1A46H 4X1PU 1SB1H 3PWCA 4A1XA 1HJ9A 1O2PA 3S9CA 1Y59T 1UK4A 1XMNB 1LVBA 3FVFB 1ZSLA 4K2YA 1G2MA 1Z8RA 4D76A 1QURH 2ZF0H 1YLCA 1O5EH 3SNBA 1ZHRA 1NU9A 1S82A 3FZDA 2ZEBA 1ACBE 2PHBA 1HBTH 1FY5A 4X0WU 1TQ0B 1NFYA 1COWD 2PFEA 4LZ4B 1AFQB 2F3CE 2O8UA 1C2KA 1CSOE 4FUGA 5DP7A 5FHTA 4ASHA 4CR9A 1J17T 3LONA 1TNJA 2ZHWH 2SGEE 1L0ZA 3RXJA 3OSYA 4RN6A 4HI3A 3ZVBA 1HIAA 3ZZ5A 1AY6H 1SQOA 2WUBA 3EDXB 4Q7XA 1BDAA 5HIYA 4MNYA 1D3QB 3ZZCA 2KCYA 3MU1A 4FVDA 4E7NA 2HOBA 1RTLA 2J38A 1MMJN 2OK5A 2QF4A 1C1NA 2DE8A 2W7SA 1IAUA 3S9BA 2I6SA 2YMSB 4ZHAA 3BIUH 1GHAF 3SJKA 5FPTA 3RLWH 1SGFA 3M61U 4UEHH 2BVSH 2RCEA 1HJ8A 1NFXA 1NBMD 4NIXA 2C4FH 2BXUH 2JETC 1VGCB 4INHA 4BAHB 1BCUH 4TWWA 1A4WH 3A86A 1EATA 3F9EA 1P2MA 3KQ5A 4OS1A 3MNXA 3FP6E 2O8WA 4ABAA 5GWZA 3QDZB 3A8AA 3ATLA 4WH6A 2B9LA 1SHYA 1DY9A 1GBCA 1T31A 3GCTG 1KXFA 3QZQA 1GI1A 2FTLE 2VINA 2FI3E 3TGIE 1KXBA 2J98A 2Y5FA 1MCTA 2VWMA 2ZFRH 1TB6H 1KDQA 3ZV8A 1GDUA 1T8LA 1N8OC 3VXEH 1T4VH 1KLTA 1SQTA 5DGJA 1ESAA 3ODFA 2JJ2D 3SUGA 3ZZBA 2PTNA 2PTCE 5DP3A 2Y81A 2AGEX 3TJVA 2XYAA 2F9NA 4WWYA 5HMAA 2H9HA 1Y3YA 4GHTA 2WPMS 1O31A 3P8OA 2V6NA 2GZ7A 1NY22 2ZFPH 2ZPQA 3RXCA 4FOUC 1GVLA 1O36A 3EA8A 3EE7A 1HAVA 1UVPA 3AVZA 4ISLA 1YKTA 2SFAA 3RMLH 4JZ1A 2ZC9H 1TAWA 1GWAA 2EY4C 2TPIZ 1YCPM 1BITA 4MDSA 3LGVA 1NN6A 3JZ2B 4O03A 3S9AA 1RJXB 4UFGH 4ABEA 4GLYA 1BMMH 3GY7A 4TY7A 2BD5A 3CNRA 3MO9A 1UVOA 4OS4A 1GDNA 1HV7A 1O3MA 3GDSA 4FU7A 6GCHG 1CHOF 3DA9B 1FONA 1IHSH 1WYKA 5L2ZH 1OWJA 1JRTA 3P6ZB 2A32A 1P3EA 1L1GA 1J14A 3SU0A 1V2QT 5E2PA 5ESBA 2TGDA 1GGDC 1BJVA 4F48B 1GJ8B 1Q2WA 1WTGH 1KTTB 3L3TA 1KYNA 1S6LA 2EI6A 1P01A 2CHAC 3D23A 3L6PA 1EXFA 3UQVA 3SUEA 3WW7A 1A5IA 1S6FA 2Y7XA 3V0XA 1XKAC 4THNH 3TGJE 1HAPH 2GZ8A 1ELGA 1VITH 1CGHA 5A0CA 3NK8A 1QA7A 4I33A 1HPGA 5DPAA 5CHBA 2ZHFH 3M7UA 4DURA 2F83A 5C1UA 5EQQA 2P59A 1W0YH 1G3BA 5AVDA 1M9UA 1O2UA 3OU0A 3Q76A 1MZAA 1HIAB 4YLQH 2ZFQH 1CA0B 1GHWH 2BM2A 2OC1A 3UR9A 1Z8GA 1FQ3A 1GI4A 1UTMA 1GJAB 1P8VC 1E35B 2OBQA 1C5SA 3VB4A 1BJUA 5F8XA 1D6WA 3NCLA 3A87A 3UWIA 2WPIS 1IQJA 2R2WU 3QO6A 1PPHE 4NA9H 4B1TA 1EZSC 5C3NA 1BTUA 2GCHF 4ZAEA 4DG4A 1VCPA 1A0HB 1PFXC 1QRWA 1T32A 1UTOA 4R8TB 4YT7H 4KTUA 1CO7E 2BD8A 3I78A 4X2VA 1KLJH 2AS9A 4YOGA 1G37A 3KQEA 2B0FA 3M3TA 5E2OA 4HTCH 4I32A 1QJ6B 3RXVA 3T62A 1ELCA 4X1QU 3T27A 3IWMA 1GBLA 4JK6A 3ESTA 4Y11E 1HAOH 3LH1A 5DN6D 1GI7B 1C5ZB 2ZECA 5LH8A 3SN8A 1KDQB 2V7QD 1TNIA 4E05H 3VGCB 2FOMB 3A7YA 1KLIH 5HXFA 3CP7A 2ZKSA 4X2XA 5EOKA 1HYLA 3PMHB 1DFPA 1KXDA 1DXWA 1C4V2 1O2NA 2M2AA 3RXDA 3BEFB 1GBIA 1GBTA 1Z6JH 6ESTA 2Z94A 2OBOA 2JDID 2Z9KA 2XBWA 1EZXC 1UJ1A 1HAVB 1YPLH 2HLCA 4X8TH 1DX5M 1TA2A 1GJ5H 2NU4E 1O5BB 1PQAA 2C8XB 2ZPRA 3SJ8A 5EQSA 1INCA 1TMTH 2GVFA 2P3FH 1TIOA 3SV2H 1TBQH 3MQKC 1HAIH 4CRCA 3PV2A 2IPHA 1C5WB 2YMSD 4IC6A 1TWXB 1C4Y2 2F4LA 3SNAA 3WWFA 3JZ1B 4I86A 3AW1A 2FYRA 2J2UA 3SU5A 3VG8A 3DUXH 5GCHG 4ZMAH 1PPFE 4HGCA 3UY9A 3RXRA 3URCA 1N1LA 4WH8A 1O2HA 1SLUB 1BHXF 4H6TA 8ESTE 2YNAA 2H5DA 5GXPA 1FUJA 3BV9B 1SLVB 4B73A 2KAIA 4BXSA 1SPJA 1P06A 4RT0A 1K21H 2C8ZB 4ZXYH 3HATH 1NTPA 1O34A 2BY5X 1C2LA 1ZTJA 1SFIA 2SGQE 4JZIA 2XBYA 2BD4A 1SGNE 1GBEA 4HFPB 2ANMH 1TGBA 3A80A 4A6LA 1P04A 5KGOA 5E0HA 1O5FH 3A7TA 1DXPA 4MPWA 1OWKA 1QCPA 1OX1A 2ZFTA 3BTGE 1THSH 4AG1A 2OCVB 3K2UA 4IGDA 5GDSH 3RC6A 3PWBA 2FO9A 2JJ1D 1T4UH 4F4OC 4I7YH 3AAVA 1OXGA 4SGBE 1IQFA 2XC4A 3RMMH 3MH6A 1LVMA 1TRYA 1DUAA 5TCCA 1QL9A 2PKSC 4U32A 4Y0ZE 1DANH 5EJZA 3U69H 1O37A 2FOHA 4X8UH 5HGGA 1K28D 1TONA 1GHBF 3RUOA 2OC7A 3ZZ8A 1ZHMA 5BRRE 3GCHB 4RKJB 2ZNKH 2Q6GA 3DFLA 3HK6B 2VGCB 3BG4B 4Y8ZA 5C1YA 3KF2A 2AYWA 1TGTA 3PTNA 2PWXA 2FOCA 4IW4E 1QBVH 2ZTYA 4KP0A 3FFGA 3SHCH 1GBHA 4CBOA 5F53A 2W3IA 4NGAH 3PRDA 4DT7B 4RI0A 1GVZA 4AYVB 1MUEB 1EX3A 3EYDA 4Z6AH 1TYNA 2XC5A 2ODQA 2GJGA 3LGIA 1V2VT 5I46H 3BTFE 2ZDVH 1O5DH 2VB0A 3VEQB 2OQ5A 5A8ZA 1H4WA 3MYWA 1GDQA 5C1XA 3RXHA 2J34A 1BTXA 1SGRE 1O2WA 2BVRH 1V2JT 1ZTLA 3A7XA 2ZDKA 4NFFA 1HNEE 1ZPBA 2PV9B 2JH0D 4U2WA 2IPQX 2VWOA 3MHWU 3SNEA 2Z7FE 1G3DA 1OP0A 4DVAU 1HGTH 2M5TA 4TSFD 4FUEA 1GMCF 2HLDD 4TY6A 7KMEH 1BRBE 3O8RA 4NZQA 2ZFSA 2PLXA 1C4U2 1EJNA 2ANYA 1YLNA 1D3TB 1BRAA 1QQ4A 1GJBB 3FZZA 2GKVE 4R0IA 5B6LA 3RXBA 2XCNA 1NM6A 3N99A 1C1TA 4ABGA 1KSNA 1FMGA 1A0JA 4ZXXH 4DIIH 3LGTA 1ZJDA 6CHAB 4FVBA 1DY8A 1D9IA 3L33A 1PYTC 5EG4A 5ESTE 3UIRA 2PGQB 4GPGA 2R9PA 2Y5HA 1NO9H 1DT2A 2VIOA 3SGAE 1T8MA 3HGPA 2DE9A 2LPRA 4GSOA 5EQRA 1SKYE 1C2JA 1JMOH 2FX6A 1C1OA 1LHEH 2NU0E 3AW0A 3P8FA 1HAXB 2FOAA 5TCAA 3K65B 4UONA 1BRUP 1HRTH 2ZIQH 4X6MA 4AYYB 5B6OA 5FAHA 1TPAE 1WQSA 2ZGJA 1C1UH 4AFUA 1D6RA 2EQNA 5JB9S 2KAIB 5GPIB 1BZXE 4OS5A 2H2ZA 1NS3A 3F9FA 1CU1A 1Y5AT 2STAE 4AG2A 1K0HA 3RU4D 3GY2A 2HVYB 2AMPA 4I8LA 3PRBA 4BAKB 1Z7KA 2OUAA 1O2RA 3FO8D 2GCTC 2ZGXH 2ZTZA 3A8CA 3LGWA 4BXWA 3T26A 3D65E 4I31A 2WINI 1P2OA 1E1RD 3FOAA 4JYVH 1ZRBA 1CQQA 5CHAC 3PV5A 1SOZA 1GBFA 1IQIA 3RMOH 2GDDA 2QY0B 1D4PB 1GHXH 3G01A 1N6YA 4VGCC 3ELAH 5CE1A 5JBTA 2QYIA 1ZLRA 1BMNH 4K1EA 1RIWB 1C5QA 5F8ZA 1E1QD 2P95A 4B71A 3ENSB 1HUTH 1E36B 4DGJA 4WXIA 1W0JD 4WMEA 3UR6A 4LK4A 4IMZA 3RM2H 4O97A 1BUIA 1HJAC 3E6PH 5T1VA 2FX4A 3DCLA 1Y3VA 1LMWB 2D2DA 2BY8X 1GBBA 1OPHB 3UWJH 1C5LH 2Z6BD 1KXCA 3ZYEA 1C5RA 4DW2U 4IS5A 4ISOA 2ZU2A 3TK9A 1C5UA 2H9EH 3B23B 1AI8H 2OC0A 2XOKD 2Y7ZA 3UREA 1MTNC 4TPIZ 3ZZ4A 3GY4A 3RXEA 1MAYA 3P8GA 4A7IB 3CS7A 2ZI2H 9ESTA 4XBCA 4NIYA 4UDWH 1G2LA 2BD3A 3UOUA 3SUDA 3E8LA 2QXIA 2W3KA 1TLDA 1O2QA 1ELDE 2PUQH 3LDXH 3DSGA 1LVOA 4YOJA 3U9AH 5C5OA 4AX9H 4ABJA 4ESTE 3AK5A 2CN0H 1BTYA 1UVTH 4IN1A 1EAXA 1EJAA 3M35A 4CRFA 1UTNA 3RXMA 3A81A 1P10A 1L1NA 1QHRB 1FX0B 4NSVA 3VB5A 3RMNH 1F5KU 1YPMH 4O9VA 3PROA 1BMLA 4K3JA 2GV6A 2ZGCA 4B6FA 3SI4H 3N7DA 1C5OH 3P95A 3ZZDA 1TPOA 1C1RA 5ABWA 2BDYA 5E8EH 3E1XB 1YPEH 3NRLA 1DPOA 1DICA 1EFRD 2EEKA 4UFFH 1TMBH 1BBRH 2P8OB 5GNDA 1LPKB 2RG3A 4DOQA 1TNKA 1V2ST 3K9XB 3PTBA 1OWHA 2WV5A 2RDLA 3MNSA 1IQHA 4GUXA 2QA9E 1PPBH 2BXTH 3SJIA 1QQUA 3W94A 1N6XA 1G3CA 1XKBC 4TWYA 3LJOA 5HM2A 1B0FA 1AD8H 1AB9C 1GPZA 3QWCH 2ZU4A 3SQHE 3TGKE 1F92A 1BBRE 4NFEA 1SGPE 1QGFA 2J92A 2O9QA 2IOTA 2A5KA 3STIA 1AZZA 1C1VH 3M5MA 1ARCA 3EA9A 1O2IA 2H9TH 2XC0A 4BAQB 3MH5A 3GICB 1GI3A 4Y76A 4CBNA 1MKXH 3CS0A 1C1QA 1GCTB 3HK3B 1C2HA 1GI8B 3MTYA 4GCHG 3S7KB 4B2CA 1C5MD 4Y6DA 1P2KA 1V2WT 2AGGX 1FI8A 1CBWB 2G51A 1IQMA 1J15A 1C2EA 1IHTH 1O3AA 2BB4A 1BTWA 4WVPE 3M7QA 4B2BA
chains in the Genus database with same CATH topology
1ZTKA 3SNDA 2WPDD 2O8LA 1BMAA 2Y80A 2WPJS 2K8IA 2BQ6B 2NU3E 3GY6A 3RXFA 3ZVEA 3M36A 3W1EA 1GG6C 1UTLM 4NZLA 5PTPA 1ZHPA 1G32B 5JPMH 3E0NB 3IG6B 1SGEE 4H6SB 4A92A 1FV9A 1NBME 2EA3A 1RRKA 4E7RG 1W2KH 3MU4A 3ZZ6A 1GI2A 1GI9B 3HKJB 4NWKA 3A88A 1L4ZA 4FUBA 4FUJA 1LPGB 2ALPA 3ATWA 3U8RH 3RDZA 4KKDA 1FN8A 1ANDA 2V0BA 2W6ID 1NRRH 4IMQA 1GJDB 1TE0A 4WF8A 1V2RT 2H1UA 2PSYA 3SHAH 2BLQA 1W11U 3EE0B 3EAJA 4CHAC 2FWWA 4MNVA 8GCHG 3E16B 5L6NH 1UO6A 1NESE 3RXIA 3A85A 3PLPA 1Q3XA 3UQOA 5DP9A 1ZMJA 5EXLA 1U6QA 3OY6U 2PKAA 1H9HE 5JBBS 1ZYOA 1SLWB 4NA8A 3LC3A 3GYMA 3PMJA 3MU5A 3WWBA 2ZTXA 3TH2H 1JXPA 3BTTE 2FS9A 2Z9LA 2O8MA 2ZCHP 3SGQE 2TGTA 1UK3A 2IJD1 4E06H 2B7DH 3S0NA 1TBZH 1TX6A 4CH8B 1UVUH 4MNWA 5JBCS 3RXPA 2G00A 3GISB 1Z1IA 4NG9H 4J2YB 2PSXA 3LGYA 2G5VA 4FUIA 3M5LA 1CT0E 3EGKH 2BDCA 1FDPA 4I8HA 5AFYH 5L2YH 1UCYE 1O3FA 1EPTA 4DY7B 1A3BH 4GVUA 1LQEA 4MG3A 3GCNA 1SSXA 1J16A 1RXPA 1W13U 4Z1MD 2JETB 3DD2H 1RTFB 2VIDA 1FY8E 3HGNA 1ETTH 3QUMP 1HXEH 2BZ6H 4KGAA 2D8WA 1IQNA 4UD9H 4X6NA 2HWLB 1CHGA 1C5TA 3RXSA 3TNSA 4I8JA 1CGJE 1K1LA 2A5IA 1SGIB 1ID5H 1QRXA 3S7HB 2BOKA 2A7JA 3BTHE 4INKA 1GMDF 5ETXA 1N8OB 2R0KA 3U8TH 1XX9A 2VU8E 1EPTC 1WU1A 3LGUA 2BDIA 1X7AC 2IJOB 1EAIA 3SV9A 1V2LT 7GCHG 1CGIE 3QGJA 3UUZA 1E37B 3U8OH 3OAAD 4Y8XA 2HPQH 3KQCA 1FZZA 1K1NA 5GIBA 4XBDA 2GX4A 2OQUA 4UFDH 2STBE 1LKBA 3TK5A 1LHFH 1H8IH 5FPYA 1KXEA 3UOPA 1EAWA 4GHQA 2JH6D 1ZOMA 4ZKOU 2J9NA 3FAOA 2CMYA 2SGDE 2A4GA 1K22H 4I8KA 4JZEH 1BTHH 1P09A 2CGAA 3GY8A 2FM2A 3O8CA 3KNXA 2A2QH 1SG8B 1AUTC 2J94A 4AZ2B 1MQ5A 3GYLB 4ZKRU 1LCYA 4U30A 2R2MB 2O8TA 1HAGE 4Y7BA 5FXLA 2A5AA 4JYUH 1FY4A 3T2NA 1W7GH 2VWLA 3MO3A 3F3BA 2SGPE 5J4SA 1GCDA 1DSTA 3K6ZA 1DWDH 5EPYA 3GY3A 1GGDB 1BB0B 1AQ7A 5LPFA 1Y3XA 4AB9A 2HRVA 5DP6A 2CJIA 2CHAB 2AIQA 2F9OA 2L6OA 2GMTC 4XBBA 1ESBA 1P12E 4D9RA 3RXKA 1GJ6A 2WSSD 2FXRA 1HCGA 1GJ4H 2AH4X 3LU9B 3M37A 2PKAB 1MBMA 1C9PA 2FI4E 1MD8A 1DLKB 5DP8A 2FOFA 2XBVA 2PR3A 4CREA 1C5NH 4X6PA 1UTPA 1BTPA 3D62A 1B5GH 1TQ7B 3TNTA 5FCRA 1HLTH 1F0RA 2VJ1A 4CRBA 2ESTE 4YTAA 2FEQH 3MU0A 4B74A 1LPZB 2A2XH 5C67A 5DO4H 2GDEH 2ODPA 3QZRA 1WV7H 1XM1A 1GI0A 1FLEE 1MU6B 2CV3A 1GHAG 2QIQA 2XCFA 4M7GA 1AVWA 1VZQH 1G30B 1BTZA 3SOSA 1ZRKA 5DJ7A 1O32A 5C2ZA 5HKKD 1EP5A 3RM0H 4YT6H 3ZVDA 4MNXA 2V35A 3ATMA 2G55A 4B2AA 1QL7A 3SJ9A 4ABHA 2J95A 3B9FH 1FXYA 3SQEE 2XBXA 4YOIA 3VPKA 2ZDLA 1S5SA 3T5FH 2BHGA 1ESTA 5DKMA 1QBOA 2Y5GA 3ZV9A 1K1IA 1XXFA 1AHTH 2ZCLP 2OLGA 1DVAH 3F9GA 1PQ8A 2WHXA 3ZIAD 3BTME 1TGNA 1F7ZA 1RS0A 5C17A 1C2MA 1NRNH 1P05A 4WY3A 5DP5A 2AMQA 2A4QA 4NWLA 1YC0A 3Q77A 4TPYA 3PV4A 3ATIA 4ABBA 1FIWA 3GCTF 3KQBA 1FN6A 1LHGH 3DSPA 1RTKA 1DOJA 2I6QA 1JOUB 2F91A 3PLKA 1K2I1 2AMDA 2F43B 2ZU3A 4Y0YE 4BAOB 3LIWA 2YNBA 2C90B 4XD7D 1DSUA 3T29A 2C8YB 2XWBI 1V6DA 2FZZA 1GBJA 2JKHA 1GJ9B 4FUDA 5FBEA 3T28A 2K0QA 4MPXA 2ZP0H 4WJG2 1O3OA 1Y3WA 4LOYH 1O3DA 1XUFA 3O8BA 1AWHB 2R0LA 1IOEA 1KXAA 2TBSA 4J1YA 3MOCA 4AB8A 5HYOA 3AAUA 1QJ1B 1O3KA 3LKWA 4CRAA 1TABE 2GTBA 1OWIA 1IQEA 2EI7A 1AFEH 3FP7E 3SGBE 3SV6A 1O3GA 1FPCH 2FYQA 4UFEH 3PO1C 3TJNA 1FNIA 1B7XB 2ZHDA 2FTMA 2FOEA 3TJUA 1YPJH 4U01A 1QY6A 4AGKA 1SR5C 1SMFE 1CHOG 2PGBB 1Y5UT 3FANA 4ZKSU 1AMHA 4BTTB 1TRMA 1F2SE 4FUHA 2WPHS 6GCHF 1J8AA 3OX7U 1DS2E 3Q3XA 2GZ9A 3MI4A 1EKBB 3GDUA 1TALA 3QLPH 4ZH8A 2BDGA 3MFJA 4CRDA 2VH6A 1W14U 1F0SA 2OP9A 1OKXA 4A1TA 1MTVA 1O5AB 1VITF 2FMJA 5A8XA 3KN2A 2FLBH 1K1MA 2B8OH 2BLVA 2WV4A 1A7SA 3ZZ9A 1C1PA 2KCOA 3LOXA 3W95A 4AOQA 1TPPA 1BRCE 2BX3A 2P93A 1C2FA 2IN2A 1SGFG 1AFQC 3MH7A 2FOBA 2UUYA 3F1SB 1HDTH 1FY1A 1Q31A 1O2SA 2VIPA 2ZCKP 2PKSB 2BOHB 5A09A 2W5EA 2G81E 3RLYH 1MD7A 1SHHB 1EZQA 1JBUH 3F9HA 1O2YA 1GMDG 2KCAA 3BEIB 2HNTF 2GT7A 4NSYA 2BDBA 2UWLA 2F9VA 4Q2KA 1VCQA 2V3OH 1A2CH 1AIXH 1C2DA 2GCHG 4IN2A 3UNSA 2YMSC 3CENA 2TGAA 1UTKA 3UNQA 2OTVA 2TGPZ 4OGYA 2ZDMA 1S0RA 4B76A 3VB7A 5L30H 3DSOA 1GHVH 8LPRA 5DG6A 3A83A 4WMDA 2AFQB 1RD3B 1ELBA 1VGCC 2OINA 5GJ4B 3SUFA 4ISNA 2BYAX 5AHGH 3UB0A 1L2EA 1QB9A 3F2HA 3KEEA 1UHBA 3RP2A 2V3HH 1E38B 2QF0A 3MWIU 3BTEE 5TJXA 1K9OE 1LQDB 4XDEA 1BBRK 1MBQA 1S0QA 4JZFH 1EZUC 3RU4E 1K1PA 1GBMA 5EGMA 1SVPA 4ASUD 2SGFE 2ZHQH 1RGQA 4GAWA 1TGSZ 1LVYA 1V2KT 4ISHH 4LZ1H 2BD9A 1DDJA 1QBNA 1KTSB 5DK1A 3SJOA 3ZVGA 3ZVCA 3GY5A 3R3GB 1S6HA 1O2XA 5EW1H 1PPZA 3MMGA 1WTHD 2CK3D 4Z0KA 1QIXB 2F9PA 3KL6A 3MO6A 4IC5A 2HGTH 2GP9B 2Y82A 3RXUA 3TU7H 5FL7D 3RXTA 2ZZUH 1ANCA 2Z3DA 1OYTH 1QA0A 1C1SA 1O2ZA 3LT3A 3ZVFA 3FP8E 1P2IA 4ABFA 1YBWA 3P92A 4IBLH 1MKXK 3NKKA 2YOLA 4JMYA 1O3JA 5BPEA 1WXRA 4KTSA 1NRSH 1AUJA 2QXJA 7ESTE 1QL8A 4H4FA 1O35A 1LHCH 1MH0A 3U98H 2W6JD 2ZG0H 3ATKA 1O3EA 5LPRA 2NU2E 3DT0H 1C1MA 4OS6A 2AIPA 3A8DA 3PM3A 1XVMA 4Y8YA 1H8HD 2UWOA 1OWEA 1YF4A 2RA0A 1T8NA 2UUKB 3VB6A 1JIRA 1WQVH 5GCHF 2KCPA 5LPEA 1XUGA 1XUJA 3GCOA 1THRH 2Q6DA 2BD7A 2QN5T 5FX5A 3P17H 5AF9H 1TNGA 3SU4A 1PPCE 3GS9A 3SI3H 3BG8A 1W7XH 1XXDA 4DCDA 3M5NA 2KZ4A 3GOVB 3N7EA 4O3TA 1TNHA 2GCTB 3QK1A 4BAMB 4QT8C 1MABB 3NWUA 1V2NT 3U1IB 2BDHA 3KCGH 4K1SA 4Y10E 2UWPA 2ZFFH 5CHAB 1NU7B 1GJCB 1P9SA 1GHYH 1TOCB 2CF9H 3A82A 1Y5BT 1MTSA 4K1TA 2VBCA 3SU3A 1AKSA 4VGCB 2QV1A 1MU8B 6LPRA 2ASUB 1QB6A 4D7FA 4JZDH 1PPGE 1AZ8A 2ULLA 1TRNA 2G8TA 3OEED 1MZDA 1O39A 1HJAB 4LXBH 1UTQA 1G36A 1V2OT 1GHBG 1UCYK 1BT7A 5EU8A 1G3EA 1CA0C 3ODDA 1ZGIA 4Q7YA 4DT4A 2P3TB 2ZDNA 2BY9X 2FS8A 2OC8A 1OS8A 1HXFH 1GBKA 2ANKH 2ODYB 1H9IE 3KHVA 1DLEA 1O38A 2FLRH 1SQAA 5DSFA 1BA8B 2ZGBH 2ZU5A 3H5CB 3RXOA 1W12U 1MTNB 2ZWLH 5HM9A 1P03A 3TK6A 1Y8TA 1P3CA 4INLA 1F0TA 1WCZA 1O2MA 2D1JA 2WPKS 2OXSA 1P2QA 2FIRH 2G4TA 1ARBA 1FPHH 1DM4B 1NRQH 1SGTA 1AVGH 1UHBB 1Y3UA 2K1QA 3H09A 3UPEA 1AU8A 1O2GH 1OP8A 4F55A 5JYIA 1YM0A 1GMCG 2ZHEH 2RA3A 3Q3YA 4Y79A 2A45B 1GL0E 1OOKB 5EPNA 4AFZA 2Z3EA 4CRGA 2F9UA 1AVXA 1P9UA 3VGCC 3RXLA 1OWDA 1SGCA 1BMFD 5EW2H 4JK5A 1AO5A 1UCYH 1JRSA 3I29A 1LTOA 1OP2A 3A7VA 1PQ7A 1K1OA 4ZROA 1P02A 2SNVA 1EB2A 1NC6A 5IK2D 1ELTA 1H9LB 1DE7H 2R3UA 1GMHF 2SNWA 3HKIB 1AE5A 1FAXA 3VXFH 1C1WH 4KELA 3KIDU 8KME2 1OHHD 1AB9B 1QRZA 1WSSH 1ZJKA 1VITG 2FOGA 2NWNA 1IQLA 4TYDA 3HPTB 2C3SA 1DWBH 2F9BH 2VIQA 2BQWB 2FDAA 3SU1A 4MPUA 3H7TA 4ZKNU 3DHKH 4MLFB 1E34B 2AHME 3A89A 1SC8U 1TPSA 1IQKA 2H5CA 2WPLS 1ELAA 2HVXA 1ZZZA 2J4IA 1A0LA 4DIHH 3URDA 2FI5E 1C5YB 1VCWA 3C1KA 4RKOB 4XOJA 3TJOA 4X1RU 1V2TT 1V3XA 3T25A 1O2JA 3SORA 4B75A 3F2GA 1XUIA 1OSSA 2VIVA 3TITA 3NXPA 1Z71A 3E90B 1JIMA 3RC5A 1EOLA 2BVXH 1TMUH 4Q63A 3E0PB 4AFQA 1OYQA 2VWNA 1G9IE 1GG6B 2Q1JA 2BX4A 5EODA 1AWFH 2XNDD 5DP4A 2BQ7B 5C5NA 4B6EA 1AKSB 2VVCA 4YM9A 1UTJA 1XUHA 2AGIX 1BOQA 3LH3A 1YGCH 3UTUH 3EA7A 2H6MA 1HFDA 2ZQ2A 5FCKA 3C27B 1C5VA 1ZPCA 2Z9IA 1H8DH 5H4IB 1A3EH 1GJ7B 2A7CA 1O2VA 1LHDH 1PYTD 3VB3A 3Q00A 2QE7D 2BDAA 2PUXB 1O3BA 2VVVA 4TT3D 4CHAB 1WOFA 2HNTE 3N7OA 2JIZD 1O5GH 1MKWK 3ZVAA 2UUFB 1C9TA 4K5ZA 3ZYDA 3SV8A 1FIZA 3GCHC 3QTOH 1SI5H 2VGCC 3BG4C 1SFQB 2QXGA 2QAAA 1EP6A 5A8YA 4MPVA 1O3NA 3F2FA 1TGCA 5AFZH 2ILNA 4MTBA 1IQGA 3KGPA 3F6UH 4Q7ZA 1O3IA 2GGVB 2GV7A 2WYJA 3O8DA 3RU4T 1SLXB 3V13A 1SOTA 1SBWA 5E0JA 2HPPH 1HAHH 5JBAS 1V2PT 1A5GH 1MCVA 1S81A 3ITIA 1GL1A 1HB0B 3B8JA 1P2JA 3EQ0H 4BOHA 1ZR0A 1AE8H 3A84A 5I25A 1YPHE 3KQDA 2UUJB 4ABIA 2AEIH 3ZZ3A 4Q4LA 1W0KD 1SGQE 2XRCA 3P8NA 3OE7D 1F5LA 1QR3E 2XXLA 5J4QA 4OS2A 1ABIH 1AN1E 1WBGB 2QCYA 4X1SU 5LGOA 1ZPZA 1V2UT 1ORFA 3SBKA 1DWEH 1TNLA 2ZGHA 4YO9A 2GD4B 5IYTA 2PW8H 4FETA 3FKSD 3OTJE 1WUNH 1A5HA 1YCPK 3SNCA 1KY9A 1MKWH 2A0QB 3STJA 2C93B 1AGJA 5IDKA 2WZQA 2P16A 1T8OA 3M5OA 3MU8A 4A5TS 4D9QA 1NZQH 3SO3A 4AORA 1VJ9U 1GI6A 2TRMA 2J5UA 1PPEE 2DUCA 1PJPA 2QF3A 4K8BA 3K6YA 6CHAC 1CVWH 4BTIB 1EPTB 4X1NU 2A31A 2Z9JA 2ZU1A 3A7ZA 3SV7A 2CF8H 1KIGH 3LC5A 4WXVA 3F0PA 1YPKH 3FN8A 3TPIZ 1GI5A 1CT4E 5CDFE 3SZNA 1NT1A 1H1BA 1BHXB 1TX8A 5EXMA 2BTCE 4K60A 2BY6X 4NA7A 2SGAA 4Y7AA 2HALA 1SL3A