2IJOB

Crystal structure of the west nile virus ns2b-ns3 protease complexed with bovine pancreatic trypsin inhibitor
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
176
structure length
168
Chain Sequence
GGVLWKKGDTTTGVYRIMTRGLLGSYQAGAGVMVEGVFHTLWHTTKGAALMSGEGRLDPYWGSVKEDRLCYGGPWQLQHKWNGQDEVQMIVVEPGRNVKNVQTKPGVFKTPEGEIGAVTLDFPTGTSGSPIVDKNGDVIGLYGNGVIMPNGSYISAIVQGERMDEPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyprotein
publication title Structural evidence for regulation and specificity of flaviviral proteases and evolution of the Flaviviridae fold.
pubmed doi rcsb
source organism West nile virus
molecule tags Hydrolase/hydrolase inhibitor
total genus 29
structure length 168
sequence length 176
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00949 Peptidase_S7 Peptidase S7, Flavivirus NS3 serine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ijoB02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2ijoB01
4YLUA 1AE8H 3MH7A 3JZ2B 4CHAB 1W7GH 3SZEA 1A0HB 2ZGXH 3PV4A 2JH6D 1A3BH 4AG1A 5DP6A 1S81A 3ITIA 3UR6A 3M35A 1V3XA 1CHOF 1O3DA 1QBOA 1CGIE 2Y7ZA 3Q00A 1V2QT 3BTDE 2PTNA 2HLCA 3SNBA 1QA0A 1F0SA 1ELBA 1W13U 4I32A 2G5NA 2BVXH 3UQOA 1SPJA 2PUQH 2HPPH 3PWBA 1AGJA 1EAIA 1QY6A 1O33A 4DIIH 2F9VA 5DP5A 4B75A 1TABE 1GHVH 1P06A 4DY7B 4FUBA 2BZ6H 2BDBA 2B9LA 1P3CA 4K60A 2FP7B 1F7ZA 3F1SB 1JIMA 1QR3E 4INLA 4BAQB 1FAXA 1SGRE 3KF2A 3MH5A 3SU4A 1YPJH 3EYDA 3SJIA 2ULLA 2BD5A 3GY3A 3BF6H 3S9BA 1TPSA 1GMDG 4TWYA 1G32B 4Q2KA 3RU4T 1J9CH 4ABBA 3P95A 3MH6A 1JBUH 3Q3XA 1WYKA 3MU0A 1XUKA 3DA9B 3GY8A 1OYTH 1YC0A 4B2BA 4MNYA 2D2DA 3LGIA 1Z8IB 2H9EH 1H8DH 4X2XA 1HIAB 4UDWH 1SHHB 5FHTA 3M36A 1SSXA 3M7QA 5FCRA 1GJDB 2XBXA 3F9HA 1FXYA 1D6RA 3GYMA 2GKVE 1EB1H 1EPTC 1V6DA 2BOHB 1P03A 2GT8A 5T6DA 4BTIB 5K7RA 4TPIZ 1HNEE 1ESTA 1CE5A 3ATLA 2BY5X 3U98H 3SGAE 3M5OA 1O5FH 2VNTA 5IDKA 5HMAA 2QF3A 2G81E 1GI3A 3GCHC 1H8IH 1S5SA 1BMNH 3UFAA 1HAVA 1TRMA 5JBTA 1YM0A 4KTCA 3ZYEA 3A7YA 1BMMH 4WH8A 2GD4B 1E36B 4E06H 1MU6B 4YOGA 2PLXA 3RXHA 1W11U 1GGDC 1ZSLA 4MNXA 3UWIA 3BV9B 1INCA 3GCNA 1LKAA 4A1TA 1BTZA 4R8TB 2VINA 1QL7A 4UFEH 1P0SH 5TCAA 2GT7A 2QAAA 2F4LA 2C90B 1ZHRA 5JBBS 1EOLA 5HGGA 3UIRA 2J4IA 2W7SA 2A5IA 2R2WU 1TQ0B 1BJUA 2BVRH 2SGFE 2AIQA 5JBCS 1SLVB 3A8BA 1O5AB 2Z9JA 2ZDLA 1UVOA 1SGQE 1CQQA 2G51A 1SQOA 1LO6A 1UCYK 2R0KA 4ZHAA 2GCHG 3MU5A 3TH2H 1GBDA 3TJOA 5GCHG 2Y6TA 4DIHH 3P92A 3A7TA 4U32A 5DPAA 1O2MA 5EXLA 1SGCA 2P8OC 3A7ZA 2QN5T 2VWLA 2YNAA 5EQRA 2PSXA 1RTKA 2ZC9H 1LKBA 3MU4A 5EXMA 1GHBG 1AN1E 2WINI 2FTLE 2J9NA 2ZCKP 3MU1A 3VEQB 2VWMA 3JZ1B 2WV5A 1AI8H 2I6QA 2SGQE 1GWAA 2SNWA 1RS0A 2G5VA 1K9OE 1D3PB 5F8TA 3SOSA 3F6UH 3U1JB 1O34A 1DPOA 4RKOB 2O9QA 1CA0B 1TPAE 3MOCA 4XE4A 3SV7A 5C3NA 1SGPE 1O3HA 2F9NA 3A82A 2AMPA 4BAOB 1VGCB 3S69A 1KSNA 4MPWA 1SG8B 3LPRA 1ELGA 1AU8A 1TNIA 2VWOA 1GBJA 4IC6A 2Y81A 1GI1A 4ZHMU 3M3TA 1Z8JB 2R3YA 1C4U2 2HVXA 4NA8A 4YZUA 4WY3A 1GMCG 2B5TB 4Q7YA 1MTNB 2CGAA 1C4Y2 3SJKA 2Y80A 4Y7AA 3PWCA 2O8TA 3QTVH 1TRYA 4BAHB 1NO9H 4JYUH 2OUAA 3D65E 1TPOA 3MO9A 2QXGA 1HAXB 4ISHH 1NTPA 3HGPA 3FAOA 4K1TA 1G3DA 4X8SH 4AGJA 1JRSA 1EB2A 1F0TA 2ZTYA 3V0XA 5GXPA 1C2JA 1A2CH 2ZGJA 4GSOA 4Q80A 2HNTE 4AORA 1QRWA 2GZ8A 5GIBA 1WQSA 3BTEE 1WBGB 3RXVA 3ZVEA 3GICB 3VXEH 1AKSB 1J8AA 1GBKA 2BYAX 2ZHWH 3DT0H 3OX7U 2BD8A 2QV1A 2BD7A 3R0FA 1BZXE 3S9AA 2J34A 5A0AE 1NRQH 1H9HE 4X6PA 3PO1B 1BTYA 4X1PU 1CGHA 2OBQA 3KN2A 3M61U 3C1KA 4VGCC 2OK5A 1C5MD 3S7KB 8GCHF 4AGKA 2Z3DA 4KTSA 1A5HA 1O2GH 2CV3A 2GVFA 3TK9A 4BTTB 1O3OA 1QJ1B 3QZQA 1F5RA 1SL3A 5F03A 1BUIA 1YCPK 1S84A 1OPHB 1DY9A 2STAE 1AZ8A 4ISNA 5EODA 1O2IA 2VIPA 5AF9H 2UWLA 1O3LA 2FI4E 2ZKSA 1O36A 4K1EA 1IHTH 1EATA 3FP7E 4R0IA 1BA8B 2OBOA 1V2TT 3E8LA 2R3UA 2ZECA 4YT7H 2FDAA 3B9FH 1CGJE 3K6YA 3M5NA 1BTPA 4B73A 2V3HH 1LHEH 1N8OC 2FWWA 2THFB 1QL9A 4X2WA 3LGWA 3T27A 1UK4A 1Y59T 1FDPA 1KLIH 1TWXB 1G36A 1OWDA 1S6FA 1P11E 1MBQA 1SC8U 2PV9B 1G3BA 1L0ZA 4H4FA 4BOHA 1E0FD 1GHWH 2C3SA 3HATH 1BB0B 5ESTE 1OKXA 1AFQC 3PROA 1DWCH 1H4WA 3UOPA 1TGCA 3KQCA 1UK3A 2BDGA 1BMAA 1FIZA 1O3KA 3GY6A 2FYQA 1PQ5A 2J38A 1A0JA 2PW8H 1TAWA 2OP9A 3U8OH 3ENSB 3GDVA 2ZO3H 5HM9A 1N6YA 1DS2E 2VVVA 5T3HA 1UMAH 1QB1A 4ZKRU 5C67A 1ZHPA 4WF8A 2AEIH 2A5AA 2ZFPH 3GOVB 3UOUA 1SGYE 5A0BA 5LH8A 4NFFA 1CT4E 4I8HA 1H1BA 2W26A 3BTWE 5ABWA 1IQHA 5DK1A 2PWXA 1PFXC 1O2ZA 4GUXA 4GCHG 2UWPA 2XC0A 1BOQA 1W14U 3SNDA 3DD2H 4TY6A 3AW1A 1MCTA 1HAPH 1GJ8B 2PKAA 2FOGA 1Y3XA 1VZQH 1DSUA 1NU7B 4A92A 1GMDF 1L2EA 1SGIB 4ZUHA 1UHBB 3AAUA 2WPJS 4X6MA 4CH2B 3M3SA 3R3GB 3SHCH 5J4QA 1LVOA 1C5VA 2XYAA 2OXSA 1QA7A 3B23B 3LGVA 1EAXA 2ZFTA 1LVMA 2ANWA 3EA9A 4H6TA 3E91A 4ZKNU 2A7JA 5EU8A 1GBEA 1ETRH 1WSSH 4FUCA 2ZTZA 4J1YA 4XOJA 1J16A 3PLBA 1TBZH 3ZVDA 4CBNA 4I7YH 2ZFRH 1HIAA 1Z1JA 3MHWU 1MUEB 1GJ5H 1OP0A 3OSYA 2B0FA 2BD4A 2VH6A 5E2OA 1OP8A 1HCGA 1TONA 1SB1H 3N7OA 3QK1A 1HJ8A 1P9SA 1OS8A 3Q76A 1CSOE 1GJBB 2WUCA 1MKXK 1LVYA 1YKTA 1UTNA 4OGYA 1GMHG 2ZU3A 4MLFB 5FBEA 1P8VC 4KKDA 4MPUA 1MD7A 2VBCA 1KIGH 2R0LA 4UFGH 5AFZH 1ANEA 1ZOMA 4MDSA 1NRNH 4TYDA 3RXFA 1GVLA 1ZRBA 2WPKS 4WXIA 3M3VA 1DWDH 3Q3YA 1NROH 1MTVA 2ALPA 4NIXA 5T1VA 1D3TB 1GCDA 1HYLA 3SBKA 2Z3CA 1TX8A 1S6HA 2ZWLH 1RIWC 2ZFQH 4MNVA 3DFJA 2BD9A 3E0PB 4E7RG 1FN8A 1HDTH 3KQDA 1YCPH 2GTBA 2D26C 1NFXA 1KDQA 3RXCA 1G2MA 3I78A 4JZEH 2ZPSA 4DJZB 1HAOH 1GI5A 1YPHE 4BXSA 1FNIA 2ZFFH 1GBLA 1TNLA 3VGCC 2WUBA 2TGDA 4ABEA 2AGIX 3K65B 2ZQ1A 7ESTE 4I8LA 1NU9A 2GCHF 4NIYA 5GCHF 3SORA 3RXSA 1FIWA 3SV6A 1V2UT 4NWLA 1P3EA 1IQJA 1Y8TA 1UVPA 3ODFA 4GPGA 4XBDA 2PTCE 5JDUB 1DDJA 2W5EA 3WY8A 4JK5A 1EZSC 1D9IA 3TJVA 1T8NA 2VGCC 2FXRA 4OS1A 3V13A 1BQYA 4GHTA 4TPYA 1V2MT 1S0QA 1K1OA 1GHBF 1VITH 4NFEA 3EE0B 1FLEE 2Q1JA 3EA8A 1ABIH 2ZCLP 2Y5HA 3PV2A 2ASUB 4YO9A 1YGCH 1C5ZB 2AIPA 2H9HA 1BDAA 3LT3A 3E1XB 2FI5E 3D49H 5L6NH 3A88A 2AYWA 5HXFA 4THNH 2G55A 1TA2A 2NU0E 5DKMA 9ESTA 1P12E 1YBWA 1DT2A 1T4VH 3RXIA 3SI3H 4IGDA 5L30H 2Q6FA 1TNJA 3P8FA 1P10A 3V7TA 1LTOA 3SU3A 4WMEA 3DHKH 3TNSA 1XKBC 6GCHG 1PPEE 1TMTH 3TPIZ 1QQ4A 3A86A 1GMCF 2Z9IA 4U2WA 1F2SE 2BLOA 2GCTB 4SGBE 3BG4B 3SNEA 3KHVA 1C1UH 1SOZA 1GL0E 7KMEH 5A8ZA 4AYYB 1CHGA 2RA3A 1O2KA 2SNVA 2FOMB 1V2JT 1MD8A 4JZ1A 3LC5A 1SGNE 3PMBB 3UREA 1HAGE 1RTFB 1YYY1 4HZHA 1MU8B 1WU1A 2FS9A 2FOBA 1K1MA 1ZHMA 2XCFA 3MU8A 1ELAA 5T6GA 3ZZ9A 1TIOA 3RMOH 1PPCE 1EJAA 1P05A 5F8ZA 2GP9B 1A7SA 3RXGA 2P93A 1B0EA 2P94A 1AHTH 1OYQA 1PPZA 1ETSH 1W0YH 3M5MA 1OP2A 3PLKA 2VH0A 1AD8H 2ZHEH 1XUFA 2WZQA 1QJ6B 1PQAA 2R2MB 2BY6X 1O3PB 5JBAS 4B6EA 3NK8A 1DY8A 3VPKA 4BAKB 1LQEA 5GDSH 2IJD1 4RN6A 2ZDKA 1WUNH 1MKXH 1BRUP 1AKSA 1EOJA 4ABDA 1FY1A 7GCHG 5PTPA 1YLCA 3QGNB 3P6ZB 1IQMA 5FAHA 5EOKA 2ZNKH 1O37A 1BBRK 1C4V2 3SU5A 1GL1A 4X2VA 3E90B 2UUYA 1EAWA 3SGBE 3A8DA 1A61H 2ZU1A 2VIQA 2STBE 5HYOA 1C5QA 5EG4A 2VIWA 4DW2U 1PQ7A 1HBTH 1Q2WA 1HPGA 3RXQA 1GJ9B 1HAYB 3LC3A 4RSPA 1W3CA 3BIVH 4D7FA 4OS7A 1BRAA 3RXTA 2P16A 4FUDA 1RXPA 1GHAG 2GCTC 2FIRH 4Y79A 3MNCA 1FY8E 1C2MA 2XCNA 1G3CA 4XBCA 3F9FA 2AMQA 1AVGH 2BDHA 2BTCE 3VB6A 1C5UA 2XNIA 4ZKSU 3E3TA 3H5CB 4JCNA 1UTKA 2A2QH 3F9EA 4YLQH 1LMWB 3LH1A 1ZSJA 1C2IA 3W95A 1ELCA 4CRDA 3L33A 1C2HA 1DUAA 1WOFA 3TGKE 3RXJA 3RXBA 2LNCA 1C5YB 2H6MA 3NWUA 5G4BA 2UWOA 1DLEA 2C8WB 2NU1E 1D3QB 3NUMA 2FMJA 2CHAB 3MFJA 4NG9H 4A1XA 3EDXB 3RXLA 1BHXF 1P2KA 4CHAC 1Z71A 1T8MA 3PV5A 2VIOA 1C5TA 1E37B 1EJMA 2PKSB 5E0JA 3ZV8A 4ZH8A 1EXFA 1UJ1A 1FMGA 1CA8B 5E0GA 3KL6A 3SGQE 1EZQA 4ZHLU 1FPHH 2WHXA 1DFPA 1K1LA 2BLVA 4UE7H 1C2KA 4IBLH 2BLWA 2CXVA 3FZZA 1HLTH 3NCLA 2ZQ2A 4O97A 3TIUA 1LVBA 1XUGA 4OS5A 3AW0A 4ISOA 3UR9A 4NA7A 1L4DA 1ANDA 3P8OA 1UHBA 1GBMA 2JH0D 4ABFA 5DO4H 1GBCA 2XTTB 2GX4A 1DE7H 3RXDA 1C2GA 1ZSKA 5FX6A 1O39A 1O2XA 4PROA 6CHAB 4K2YA 3SUFA 1Y3WA 3V3MA 1ZMNA 1TMUH 1TGNA 2NWNA 5F8XA 5K0HA 1GBTA 3RC6A 5JB8S 1O5CB 1SLWB 2FOHA 1PQ8A 5SGAE 1S83A 2ZHFH 1GCTB 2ZP0H 1GI9B 3A83A 4TWWA 1TOCB 3CS7A 4INHA 1GHZA 3AK5A 4JMYA 3TH4H 5FBIA 3LGTA 1XXDA 5ESBA 1KLTA 3GY4A 4MPXA 2EEKA 1JMOH 1GBFA 3KIDU 4JYTA 1C9PA 1SFIA 1DXPA 2O8LA 3STJA 1L1JA 1SQAA 4D9RA 4M9FA 1YPLH 1BBRH 1C1OA 3RLYH 1MQ6A 4IMQA 1MTSA 3VB7A 2CF9H 5A8YA 2FLRH 1LPZB 2XWAA 2QF0A 1LCYA 2AH4X 2W3KA 1O2HA 1P2JA 1NRPH 3A84A 3LJJA 1TNHA 3FZDA 4J2YB 2XXLA 2Y5GA 4Z0KA 1P02A 5EQQA 2ZU4A 2J94A 3QTOH 2FOEA 1MBMA 3RXKA 2ZDVH 4AG2A 3ATMA 4Y10E 2GGVB 1D6WA 1TPPA 3A8AA 3O8DA 8KME2 4IS5A 3QDZB 2BDCA 1NZQH 1AWFH 1C1MA 3FVFB 3BTGE 2ZDMA 1NS3A 4B76A 1MCVA 4GHQA 1TRNA 2D8WA 3T5FH 4OGXA 1SGDE 3ZVFA 4AFUA 2ZG0H 2ALVA 1N6XA 5IYTA 2LPRA 3D23A 4X8VH 1GDQA 5CE1A 3ZZDA 1P2OA 1BRBE 1FPCH 3P8GA 1O3NA 1KTTB 3HPTB 5J4SA 3IWMA 3PM3A 4FU7A 1V2KT 2Q6GA 3GY2A 3BEFB 3FANA 2O8UA 1PJPA 3TGJE 5DP8A 1CU1A 1C9TA 4B2AA 2OC8A 3VB3A 1HJAB 1O2WA 2ZEBA 2FEQH 1BIOA 1CA0C 4K8BA 1O2PA 4X0WU 2A31A 1THPB 1KXDA 2ZHDA 1VGCC 1ARBA 4MNWA 1BMLA 3HK6B 3AAVA 3M5LA 2EC9H 2O8MA 3KEEA 1J14A 1DOJA 1EASA 1GI4A 3PMJA 4YESB 1J15A 2IJOB 1EX3A 1GI0A 2VIVA 4JZFH 4DOQA 2OLGA 3BSQA 3PB1E 4CREA 1MTNC 1O2SA 4F49A 1O2VA 4AFSA 4GLYA 4H42U 1O5GH 5DP7A 3I77A 1QJ7B 4CRCA 1AVWA 2OINA 2ZDAH 1GHXH 1EP5A 4ISIH 5JB9S 1SR5C 1VJ9U 2KAIA 1L1NA 3CS0A 1GJ4H 1C1TA 1P04A 2PFEA 3GCTG 1O31A 3STIA 1A4WH 7LPRA 1AO5A 1V2RT 1T8OA 1JIRA 3PMHB 3ZZ4A 3SJ9A 5CHAB 2VVUA 4Q7XA 1TNGA 1L4ZA 1TBQH 1CBWB 1V2WT 1YLDA 2A5KA 4AB9A 1J17T 4DG4A 1QIXB 1DITH 7GCHF 5FCKA 5EXNA 3T2NA 4X1NU 2IOTA 1K1JA 4XDEA 1GI8B 1PPFE 3MO6A 5T6FA 5DP3A 1CT2E 2XBVA 2Z3EA 1AB9B 4DVAU 1QRXA 1Z1IA 4CH8B 2FPZA 3PO1C 3AASA 4CRBA 2GV6A 1AFEH 2TBSA 4YT6H 1L1GA 1A5GH 4BNRA 4BTUB 1ESBA 4HGCA 1QB9A 1GG6B 2GDEH 1SOTA 4FUIA 1LDTT 2WPHS 4DGJA 2Y7XA 4I8KA 3U8TH 1PYTC 4F4OC 2ZI2H 1TALA 1O2OA 1GHAF 1NN6A 3MNBA 4ZAEA 3O8RA 4K1SA 2BB4A 4NZQA 4B6FA 4WH6A 4NZLA 4B71A 3RC4A 2HRVA 1VCWA 5DG6A 2YOLA 2SGEE 3TK5A 2BX3A 4FUFA 1SVPA 4KP0A 1TQ7B 1WXRA 3SQHE 1FAKH 3SO3A 5LPEA 1TFXA 2AERH 4K5ZA 1T4UH 6ESTA 3ELAH 5LGOA 3SHAH 3AVZA 3OU0A 1BTHH 3ATKA 2BXUH 5C5OA 1NESE 1OWEA 3GDUA 4WXVA 1Z6EA 1EKBB 3C27B 4AZ2B 4I33A 5EPNA 3A81A 3W94A 1A3EH 4WMFA 2ANMH 4YOJA 2BMGB 2A45B 1KYNA 4NGAH 5CMXH 3UNSA 4I8GA 1GHYH 2OCVB 1T8LA 3SW2B 1W0ZU 2G4TA 1SLUB 4RKJB 1MKWK 4LZ1H 3SUGA 2D1JA 2GMTB 2H5DA 3S7HB 1O32A 2ZGBH 1DXWA 3SV2H 4U30A 1FY5A 2XC4A 4ABGA 1TNKA 2TGTA 1AY6H 1MTUA 2A4RA 1C2LA 1DWEH 3I29A 1B0FA 1IQGA 1QCPA 2J2UA 2FM2A 1GI2A 4BAMB 1JOUB 4K8YA 3Q77A 5L2ZH 1FQ3A 1GJCB 1GVKB 1GDUA 3UNQA 2ZIQH 3EAJA 1QURH 2F9OA 1O5EH 4ABIA 1HAZB 1OOKB 1T31A 4Y76A 1TX7A 5A0CA 1JWTA 2JH5D 3ZV9A 2OC1A 4UD9H 2QYIA 3SV9A 2ZF0H 1DX5M 3FP6E 2VVCA 1F92A 2FI3E 3RP2A 1W8BH 2OQ5A 3F9GA 3RXAA 4XSKU 1NY22 3TJUA 3ESTA 4X6OA 5C5NA 1F5LA 1IAUA 1A0LA 2FO9A 1ZLRA 1FY4A 2GDDA 3BTHE 3KCGH 5FXLA 2QY0B 3UTUH 1XUIA 2C8XB 1NFWA 4A6LA 3KQEA 2V0BA 1ZMJA 5GWZA 5FPYA 2EA3A 2BY8X 1YPEH 3TGIE 1Z6JH 5AFYH 1IHSH 4JK6A 1RFNA 2J95A 3CP7A 4KGAA 4IN1A 4MQAA 1HB0B 1TGTA 3RXOA 5EW2H 4Y11E 2Z7FE 3A85A 1C2FA 3MWIU 2ZU2A 2XWBI 5EW1H 4XBBA 1O2UA 1QQUA 2P59A 2C93B 1HJ9A 1SGFG 3NXPA 2ZA5A 3A7WA 1ELTA 1UO6A 3A80A 1XM1A 4NIWA 5E2PA 2A1DB 1C5NH 3T28A 2WYGA 1UTQA 5GJ4B 3NPSA 3QO6A 1DVAH 2H5CA 2FYRA 1V2PT 4OM9A 3T62A 1QRZA 1BRCE 1K22H 1NFYA 2FOAA 4Y0YE 4D7GA 1ID5H 2AGEX 4A5TS 1SGEE 1KXBA 3RMLH 2JKHA 3D62A 3ZVGA 3K9XB 2ESTE 1O2JA 1O3GA 2V35A 3RXMA 2JETB 1O3EA 4INKA 1O2NA 1G2LA 3BTME 1Q31A 4IW4E 3ZVAA 3QZRA 1LHDH 4H6SB 1C2EA 1GDNA 1ZTLA 2FX4A 1Q3XA 2Z6BD 1Y3YA 2VJ1A 1LHFH 1SMFE 4AYVB 4DT7B 2C8YB 2WPLS 1HGTH 4A7IB 1K21H 3SQEE 3GDSA 2OC0A 3TNTA 3BEUA 2CN0H 1BJVA 1Z8RA 2ZDNA 5E0HA 5LPFA 2ZGCA 2Z9LA 1V2OT 3E16B 4WMDA 4UFFH 4FUEA 2C4FH 1MKWH 4Z6AH 1EPTB 3E0NB 1THRH 4FU8A 2WV4A 4ZXYH 4MPVA 3RC5A 3QN7A 1G30B 1W10U 4X8UH 5L2YH 3OTJE 4I8JA 1O2QA 1C1QA 3RXEA 1DSTA 5AHGH 3GCHB 1K1PA 3BTFE 1P57B 1BT7A 1UCYE 4UFDH 4ZXXH 1TGBA 1SLXB 1ZZZA 2F3CE 3EQ0H 4KTUA 5I46H 2BDYA 3GISB 1B5GH 3RXUA 1GGDB 5BPEA 3LOXA 2RDLA 4BANB 2FZZA 1ANBA 3BEIB 1QBVH 3BG4C 4Q7ZA 1OWIA 1ARCA 1ZGVA 4D8NA 1XKAC 3SN8A 3P8NA 3ZYDA 1K1IA 1NC6A 2PKAB 1RGQA 1UVSH 2V6NA 3URDA 5DP4A 2FOFA 4WWYA 1HXFH 2G00A 3GCTF 1E34B 3LGYA 2JETC 3HKJB 2BM2A 3LONA 4KELA 1P9UA 1O2YA 1DWBH 1O3BA 1GPZA 2Z9KA 1NM6A 1YPKH 3SV8A 3MNXA 8LPRA 2TIOA 3RM0H 1ELEE 1O3CA 1G9IE 2AFQB 4Y71A 2OC7A 4QT8C 4AB8A 1V2NT 3LU9B 2P8OB 3PLPA 5HM2A 1TX6A 1LHGH 1MQ5A 4CRAA 2FX6A 4D9QA 1EJNA 1FV9A 2ZCHP 5BRRE 4UEHH 1QFKH 2Y82A 2ODPA 5FX5A 3SNCA 3BN9A 3SZNA 2F83A 3M7UA 1U6QA 1Z8GA 4B1TA 1H9IE 1G3EA 1O35A 4GCHF 1O5BB 2ZHQH 1TE0A 1BTUA 3DUXH 1BITA 4MVNA 4FVDA 4Y6DA 1IOEA 1O0DH 2XBWA 2TGAA 4LZ4B 1S85A 4DCDA 3UWJH 1RD3B 5I25A 1VITG 1SFQB 1TLDA 3MO3A 4WVPE 1O2RA 4FVBA 1C5SA 2B7DH 1S0RA 1NRSH 2ZTXA 2VWNA 3RM2H 2NU2E 1XUJA 1ZGIA 1SQTA 3UNRA 5A09A 1KDQB 1EQ9A 3A7XA 1C5WB 1RJXB 1XXFA 3P17H 4WJG2 3EA7A 3QWCH 1CO7E 1CT0E 4HI3A 4I31A 2Q6DA 1ZMLA 2H1UA 2HGTH 2HNTC 3TITA 3U8RH 1D4PB 4Y8ZA 2VIDA 3MNSA 1HFDA 3RLWH 1YPMH 2WV9A 3LKWA 1C1NA 1Y5BT 1AE5A 3BTTE 4Y8YA 2BXTH 2Y5FA 1C1RA 1FUJA 1GMHF 2BZAA 1K2I1 1EZXC 4O9VA 2G8TA 1EZUC 1KXEA 1QB6A 2TRMA 4YTAA 1ZTKA 2BQ6B 2CHAC 1SGFA 4JZDH 2GV7A 2Z9GA 3SJ8A 4CRFA 4DURA 1THSH 2UUKB 2ILNA 1IQLA 1G37A 2CF8H 1TMBH 3BG8A 5DGJA 1MZDA 5GPIB 2AS9A 2PKSC 2WPMS 5AVDA 1K1NA 3T29A 1T7CA 4CR5A 5EPYA 1QBNA 1ZR0A 2ZZUH 2BD2A 2QIQA 2BQWB 2PSYA 4VGCB 3S9CA 1TOMH 2H9TH 3VFEA 1K28D 1SI5H 2ZFSA 1W7XH 4CBOA 1UTLM 3TJNA 4NWKA 1IQKA 1UVTH 2EI6A 2W7UA 4AN7A 2G4UA 3M7TA 2M5TA 1M9UA 3H7TA 1A46H 4ZKOU 2P3TB 2VU8E 1O3AA 4YOIA 3SUDA 3TU7H 2AMDA 4OS4A 4LOYH 2CMYA 1OWKA 4NCYA 1VCQA 1C2DA 2SGAA 5ETXA 5F6MA 2FTMA 3KQBA 4X8TH 2ZGHA 3QGJA 3QX5H 4OS6A 3IITA 1O30A 1C1SA 6CHAC 1UTJA 2ZU5A 2A4QA 1N8OB 3SUEA 2BOKA 3RDZA 4AFQA 5C2ZA 1V2VT 3TK6A 2GZ7A 4Y0ZE 4YM9A 4LK4A 2WYJA 4O03A 3O8BA 1TBRH 1GCTC 2BHGA 2ANKH 1ACBE 1IQNA 5FPSA 4K3JA 9LPRA 1QL8A 1AFQB 1C5RA 5C1YA 2Z94A 1AZZA 4ESTE 1BHXB 1C1PA 3TVJB 3ZZCA 1EUFA 1UTPA 1IQIA 1GJAB 2BD3A 1W2KH 2IN2A 1WAYB 1KXAA 1BTXA 1AVXA 2XBYA 5B6LA 3GYLB 3SU0A 4RI0A 3K2UA 4AOQA 4U01A 3LDXH 5GNDA 1PPGE 4LXBH 3OYPA 2QXHA 3TH3H 6GCHF 1UTMA 4Y8XA 1GBBA 2VB0A 2RCEA 3ZZAA 4ZMAH 1YP9A 3RXPA 3OY5U 2FESH 1ZRKA 1CHOG 1H9LB 2HPQH 6LPRA 1DM4B 3U1IB 1W12U 2SFAA 4XFQA 1ABJH 1KXFA 1QTFA 4SGAE 3MMGA 4O3TA 2B8OH 3A8CA 3QUMP 1UVUH 2IPHA 1T32A 1OX1A 4JYVH 5DJ7A 2A4GA 2PGBB 2ODQA 1P2NA 1WQVH 3IG6B 1S82A 4X1RU 1AIXH 2HWLB 3OTPA 2AGGX 4FXGH 4MTBA 2EI8A 1P2MA 2V3OH 3OY6U 3PTBA 3KGPA 5C20A 4FUJA 1PPBH 3ZZ5A 2BY9X 1UK2A 2OD3B 1C5XB 1KLJH 4E7NA 8ESTE 4X1SU 2F91A 1OWJA 1PYTD 1UCYH 1O3JA 1AQ7A 2UUFB 1DICA 2EI7A 5C1XA 1GJ6A 3ODDA 1DLKB 2PUXB 4HFPB 1XVOA 1NRRH 1LPKB 1EPTA 2F9PA 3SJOA 1VCPA 1Y5UT 3A87A 3S0NA 3CENA 3ZZ7A 1LPGB 3GY7A 3F68H 3O8CA 1A5IA 1FN6A 1C5PA 1AUTC 1HJAC 2NU4E 1GBAA 3SU2A 1ELFA 5A8XA 2RA0A 1C1WH 1HAVB 1ZYOA 2F9BH 3P70B 4Y7BA 1UTOA 2P3FH 1YPHC 1RTLA 1ZTJA 4X2YA 4OS2A 1RIWB 2A2XH 4NIVA 4ZROA 2GZ9A 5DP9A 3PYHA 3VB5A 4B2CA 3GY5A 2P95A 1WV7H 5JPMH 1EP6A 1JRTA 4ABAA 1E38B 4CR9A 2H2ZA 2P3UB 1XX9A 3SNAA 1HV7A 3E6PH 1VJAU 2QC2A 3VGCB 2SGPE 2I6SA 2YNBA 4K69A 1GI6A 4ISLA 2HOBA 1SBWA 4JZIA 1HAHH 1F0UA 1A1RA 3HKIB 3A7VA 4AX9H 1QNJA 2A32A 3L3TA 1V2LT 3ZVCA 5A2MH 3LGUA 4NSYA 5CHAC 3UQVA 1Y5AT 1WCZA 3BIUH 1CBWC 2PGQB 2VGCB 3LH3A 5LPRA 1CVWH 1MZAA 1ZPBA 1O3FA 2ANYA 4E05H 2SGDE 1NFUA 3U9AH 3UPEA 3H7OA 1SGTA 2FLBH 1O38A 1ELVA 2FS8A 2A0QB 1AB9C 2A4OA 3FP8E 4HTCH 5TCCA 1DUEA 3UY9A 2ODYB 1MH0A 1GBHA 1F5KU 4FUHA 3PTNA 4GAWA 3RU4D 1O5DH 2BLQA 3T26A 4ASHA 3DFLA 3MYWA 1GI7B 1VITF 2XW9A 4ABHA 3RUOA 1GG6C 1NPMA 4TY7A 1TB6H 2G52A 3ZVBA 4B74A 1P2IA 3ATWA 1ORFA 4AFZA 1HXEH 2F9UA 4D76A 3V12A 5TJXA 2BDIA 2A7CA 1IQEA 2BQ7B 3KNXA 2K1QA 5B6OA 2QCYA 1ZPZA 3Q3KA 1ELDE 1ETTH 1RRKA 2QA9E 2W3IA 3A89A 2XRCA 1YCPM 4A1VA 2FODA 3PMAB 1BBRE 2DUCA 3SYJA 2QGRA 1QGFA 3ATIA 3URCA 1O3MA 2BY7X 1FI8A 3RMMH 3LIWA 3VXFH 3MI4A 2HNTF 2DE8A 3HGNA 5JYIA 1JXPA 3SU1A 1LHCH 3G01A 1MAXA 2CJIA 1WTHD 1HUTH 1VR1H 2HALA 1X7AC 3L6PA 1O2TA 2PR3A 2DE9A 2R9PA 2QXIA 3NZIA 3TLOA 2OQUA 4GVUA 1FY3A 2GMTC 4FU9A 3M37A 2WPIS 1B7XB 3U69H 3MH4A 2BDAA 1QHRB 1GJ7B 1XUHA 3ZZ3A 4O3UA 1FJSA 1AMHA 1D3DB 5H4IB 1ESAA 3BTQE 3RXRA 1FONA 1OSSA 2TGPZ 1KTSB 1SHYA 1IQFA 1BCUH 1KY9A 2TPIZ 4X6NA 1V2ST 1P01A 2O8WA 2J92A 1XVMA 3ZZBA 3QLPH 4MG3A 2BX4A 1HRTH 1MAYA 2XC5A 4X1QU 1LQDB 1TA6A 3GCOA 1OXGA 2RG3A 1BTWA 3EGKH 3HK3B 3LJOA 1GVZA 1MMJN 5E8EH 1XMNB 2FOCA 4IC5A 8GCHG 3B8JA 3K6ZA 2NU3E 4FUGA 1YPGH 1AWHB 3UUZA 1O2LA 1ZJDA 3VB4A 2BVSH 4NA9H 5FPTA 1TYNA 1TGSZ 4NSVA 1Y3VA 2ZPRA 2OTVA 3NKKA 1F0RA 4IN2A 1NT1A 2C8ZB 3ZZ8A 4IMZA 3SU6A 1E35B 1WTGH 1P09A 1Y3UA 2PHBA 1C5OH 2ZPQA 4CRGA 1P2QA 1EAUA 1ZPCA 3T25A 1MTWA 2A7HA 2UUJB 1FZZA 1YF4A 2QXJA 5EGMA 3ZZ6A 1C1VH 4BXWA 5EQSA 4ABJA 1O3IA 3BTKE 3H09A 2KAIB 1AUJA 1PPHE 3RMNH 3RU4E 5C1UA 3SI4H 1C5LH 1DANH 1HAIH 1Z7KA 3FFGA 1OWHA 1KXCA 4UONA 1ZJKA 1N1LA 4M7GA 3MTYA 1ANCA 1GBIA
chains in the Genus database with same CATH superfamily
4YLUA 2L74A 1AE8H 3MH7A 3JZ2B 4CHAB 1W7GH 3SZEA 1A0HB 2ZGXH 4Z1MD 3PV4A 2JH6D 1A3BH 4AG1A 5DP6A 5KGOA 2RFKC 1S81A 3ITIA 3UR6A 3M35A 1V3XA 1CHOF 1O3DA 1QBOA 1CGIE 2Y7ZA 3Q00A 1V2QT 3BTDE 2PTNA 2HLCA 3SNBA 1QA0A 1F0SA 1OHHD 1ELBA 1W13U 4I32A 2G5NA 2BVXH 3UQOA 1SPJA 2PUQH 2HPPH 3PWBA 1AGJA 1EAIA 1QY6A 1O33A 4DIIH 1NBME 2F9VA 5DP5A 4B75A 1TABE 1GHVH 1P06A 4DY7B 4FUBA 2BZ6H 2BDBA 2B9LA 1P3CA 4K60A 2FP7B 1F7ZA 3F1SB 1JIMA 1QR3E 4INLA 4BAQB 1FAXA 1SGRE 3KF2A 3MH5A 3SU4A 1YPJH 3EYDA 3SJIA 2ULLA 2BD5A 3GY3A 3BF6H 3S9BA 1TPSA 2K8IA 1GMDG 4TWYA 1G32B 4Q2KA 3RU4T 1J9CH 4ABBA 2YMSB 3P95A 3MH6A 1JBUH 3Q3XA 1WYKA 3MU0A 1XUKA 3DA9B 3GY8A 1OYTH 1YC0A 3U28C 4B2BA 4MNYA 2D2DA 3LGIA 1Z8IB 2H9EH 1MABB 1H8DH 4X2XA 1HIAB 4UDWH 1SHHB 5FHTA 3M36A 1SSXA 3M7QA 5FCRA 1GJDB 2XBXA 3F9HA 1FXYA 1D6RA 3GYMA 2GKVE 1EB1H 1EPTC 1V6DA 2BOHB 1P03A 2GT8A 5T6DA 4BTIB 5K7RA 4TPIZ 1HNEE 1ESTA 1CE5A 3ATLA 2BY5X 3U98H 3SGAE 3M5OA 1O5FH 2VNTA 5IDKA 2CK3D 2QF3A 5HMAA 2G81E 1GI3A 3GCHC 1H8IH 1S5SA 1BMNH 3UFAA 1HAVA 1TRMA 5JBTA 1YM0A 4KTCA 3ZYEA 3A7YA 1BMMH 4WH8A 2GD4B 1E36B 4E06H 1MU6B 4YOGA 2PLXA 3RXHA 1W11U 1GGDC 1ZSLA 2WPDD 4MNXA 3UWIA 3BV9B 1INCA 3GCNA 1LKAA 4A1TA 1BTZA 4R8TB 2VINA 4TSFD 1QL7A 4UFEH 4ACBA 1P0SH 5TCAA 2GT7A 2QAAA 2F4LA 1W0JD 2C90B 1ZHRA 5JBBS 1EOLA 5HGGA 3UIRA 3UAIC 2J4IA 2W7SA 2A5IA 2R2WU 1E79D 1TQ0B 1BJUA 2BVRH 2SGFE 2AIQA 5JBCS 1SLVB 3A8BA 1O5AB 2Z9JA 2ZDLA 1UVOA 1SGQE 1CQQA 2G51A 1SQOA 1LO6A 4ZCNA 1UCYK 2R0KA 4ZHAA 2GCHG 3MU5A 3TH2H 1GBDA 3TJOA 5GCHG 2Y6TA 4DIHH 5EIYA 3P92A 3A7TA 4U32A 5DPAA 1O2MA 5EXLA 1SGCA 2P8OC 3A7ZA 2QN5T 2VWLA 2YNAA 5EQRA 1SQRA 2PSXA 1RTKA 2ZC9H 1LKBA 3MU4A 5EXMA 1GHBG 1AN1E 2WINI 2FTLE 2J9NA 2ZCKP 3MU1A 3VEQB 2VWMA 3JZ1B 2WV5A 1AI8H 2I6QA 2SGQE 1GWAA 2SNWA 1RS0A 2G5VA 1K9OE 1D3PB 5F8TA 3SOSA 3F6UH 3U1JB 1O34A 1DPOA 4RKOB 2O9QA 1CA0B 1TPAE 3MOCA 4XE4A 3SV7A 5C3NA 1SGPE 1O3HA 2F9NA 3A82A 2AMPA 4BAOB 1VGCB 3S69A 1KSNA 4MPWA 1SG8B 3LPRA 1ELGA 1AU8A 1TNIA 2KFWA 2VWOA 1GBJA 4IC6A 2Y81A 1GI1A 4ZHMU 3M3TA 1Z8JB 2R3YA 1C4U2 2HVXA 4NA8A 4YZUA 4WY3A 1GMCG 2B5TB 4Q7YA 1MTNB 2CGAA 1C4Y2 1YY3A 3SJKA 2Y80A 4Y7AA 3PWCA 2O8TA 3QTVH 1TRYA 4BAHB 1NO9H 4JYUH 2OUAA 3D65E 1TPOA 3MO9A 2QXGA 1HAXB 4ISHH 1NTPA 2XOKD 3HGPA 5DSFA 3FAOA 4K1TA 1G3DA 4X8SH 4AGJA 5KEDA 1JRSA 1EB2A 1F0TA 2ZTYA 3V0XA 5GXPA 1C2JA 1A2CH 2ZGJA 4GSOA 2JJ1D 4Q80A 2HNTE 4AORA 1QRWA 2GZ8A 5GIBA 1WQSA 3KQ5A 3BTEE 3UB0A 1WBGB 3RXVA 3ZVEA 3GICB 3VXEH 1AKSB 1J8AA 1GBKA 2BYAX 2ZHWH 3DT0H 3OX7U 2BD8A 2QV1A 2BD7A 3F2FA 1BZXE 3R0FA 3S9AA 2J34A 5A0AE 1NRQH 1H9HE 4X6PA 3PO1B 1BTYA 4X1PU 1CGHA 2OBQA 3KN2A 3M61U 3C1KA 4VGCC 2OK5A 1C5MD 1QZ8A 3S7KB 8GCHF 4AGKA 2Z3DA 4KTSA 1A5HA 1O2GH 2CV3A 2GVFA 3TK9A 4BTTB 1O3OA 1QJ1B 3QZQA 1F5RA 1SL3A 5F03A 1BUIA 1YCPK 1S84A 1OPHB 1DY9A 2STAE 1AZ8A 4ISNA 5EODA 4FETA 1O2IA 2VIPA 5AF9H 2UWLA 1O3LA 2FI4E 2ZKSA 1O36A 4K1EA 1IHTH 1EATA 3FP7E 4R0IA 1BA8B 2OBOA 1V2TT 3E8LA 2R3UA 2ZECA 4YT7H 2FDAA 3B9FH 1CGJE 3K6YA 3M5NA 1BTPA 4B73A 2V3HH 1LHEH 1N8OC 2FWWA 2THFB 1QL9A 4X2WA 3LGWA 3T27A 1UK4A 1Y59T 1FDPA 1KLIH 1TWXB 1G36A 1OWDA 1YLNA 1S6FA 1P11E 1MBQA 2KCPA 1SC8U 2PV9B 1G3BA 1L0ZA 4H4FA 4BOHA 1E0FD 1GHWH 2C3SA 3HATH 1BB0B 5ESTE 1OKXA 1AFQC 3PROA 1DWCH 1H4WA 3UOPA 1TGCA 3KQCA 1UK3A 2BDGA 1BMAA 1FIZA 1O3KA 3GY6A 2FYQA 1PQ5A 2J38A 1A0JA 2M2AA 2PW8H 1TAWA 2OP9A 3U8OH 3ENSB 3GDVA 2V3MA 2ZO3H 5HM9A 1N6YA 1DS2E 2VVVA 5T3HA 1UMAH 1QB1A 4ZKRU 5C67A 1ZHPA 4WF8A 2AEIH 2A5AA 1VKYA 2ZFPH 3GOVB 3UOUA 1SGYE 5A0BA 4Q4LA 5LH8A 4NFFA 1CT4E 4I8HA 1H1BA 2W26A 3BTWE 4P02A 5ABWA 1IQHA 5DK1A 2PWXA 1PFXC 1O2ZA 4GUXA 3MQKC 4GCHG 2UWPA 2XC0A 1BOQA 1W14U 3SNDA 3DD2H 4TY6A 3AW1A 2QF5A 3OEED 1MCTA 4XRNA 1GJ8B 1HAPH 2PKAA 2FOGA 1Y3XA 1VZQH 1DSUA 1NU7B 4A92A 1GMDF 1L2EA 1SGIB 4ZUHA 1UHBB 3AAUA 2WPJS 4X6MA 4CH2B 1E1QD 3M3SA 1KMHB 3R3GB 3SHCH 5J4QA 1LVOA 1C5VA 2XYAA 2OXSA 1QA7A 3B23B 3LGVA 1EAXA 2ZFTA 1LVMA 2ANWA 3EA9A 4H6TA 3E91A 4ZKNU 2A7JA 5EU8A 1GBEA 1ETRH 1WSSH 4FUCA 2ZTZA 4J1YA 4XOJA 1J16A 3PLBA 1TBZH 3ZVDA 4CBNA 4I7YH 2ZFRH 1HIAA 1Z1JA 1WDIA 3MHWU 1MUEB 1GJ5H 1OP0A 3OSYA 2B0FA 2BD4A 2VH6A 5E2OA 1OP8A 1HCGA 1TONA 1SB1H 3N7OA 3QK1A 1HJ8A 1P9SA 1OS8A 3Q76A 1CSOE 1GJBB 2WUCA 1MKXK 5IK2D 3FKSD 1LVYA 1YKTA 1UTNA 4OGYA 1GMHG 2ZU3A 3NRLA 4MLFB 5FBEA 1P8VC 5C94A 4KKDA 2VBCA 1MD7A 4MPUA 1KIGH 2R0LA 4UFGH 5AFZH 1ANEA 1ZOMA 4MDSA 1NRNH 4TYDA 3RXFA 1GVLA 1ZRBA 2WPKS 4WXIA 3M3VA 1DWDH 3Q3YA 1NROH 1MTVA 2ALPA 4NIXA 5T1VA 1D3TB 1GCDA 1HYLA 3SBKA 2Z3CA 1TX8A 1S6HA 2ZWLH 1RIWC 2ZFQH 4MNVA 3DFJA 2BD9A 4XD7D 3E0PB 4E7RG 1FN8A 1HDTH 3KQDA 1YCPH 2GTBA 2D26C 1NFXA 1KDQA 3RXCA 1G2MA 3I78A 4JZEH 2ZPSA 4DJZB 1HAOH 1GI5A 1YPHE 4BXSA 1FNIA 2ZFFH 1GBLA 1TNLA 3VGCC 2WUBA 2TGDA 4ABEA 2AGIX 3K65B 2ZQ1A 7ESTE 4I8LA 1NU9A 2GCHF 4NIYA 5GCHF 3SORA 3RXSA 1FIWA 3SV6A 2KCAA 1V2UT 2EY4C 4NWLA 1P3EA 1IQJA 1Y8TA 1UVPA 3ODFA 4GPGA 4F55A 4XBDA 2PTCE 5JDUB 1DDJA 2W5EA 3WY8A 4JK5A 1EZSC 1D9IA 3TJVA 1T8NA 2VGCC 2FXRA 4OS1A 3V13A 1BQYA 4GHTA 4TPYA 1V2MT 1S0QA 1K1OA 1GHBF 1VITH 4NFEA 3EE0B 1FLEE 2Q1JA 3EA8A 1ABIH 2ZCLP 5EJ1A 2Y5HA 3PV2A 2ASUB 4YO9A 1YGCH 1C5ZB 2AIPA 2H9HA 4RT0A 1BDAA 3LT3A 3E1XB 2FI5E 3D49H 5L6NH 3A88A 2AYWA 5HXFA 4THNH 2G55A 1TA2A 2NU0E 5DKMA 9ESTA 1P12E 1YBWA 1DT2A 1T4VH 3RXIA 3SI3H 4IGDA 5L30H 2Q6FA 1TNJA 3P8FA 1P10A 3V7TA 1LTOA 3SU3A 4WMEA 3DHKH 3TNSA 1XKBC 6GCHG 1PPEE 1TMTH 3TPIZ 1QQ4A 3A86A 1GMCF 2Z9IA 4U2WA 1F2SE 2BLOA 2GCTB 4SGBE 3OEHD 3BG4B 3SNEA 3KHVA 1C1UH 1SOZA 1GL0E 7KMEH 5A8ZA 4AYYB 1CHGA 2RA3A 1O2KA 2SNVA 2FOMB 1V2JT 1MD8A 4JZ1A 3LC5A 1SGNE 3PMBB 3UREA 1HAGE 1RTFB 1YYY1 4HZHA 1MU8B 1WU1A 2FS9A 2FOBA 1K1MA 1ZHMA 2XCFA 3MU8A 1ELAA 5T6GA 3ZZ9A 1TIOA 3RMOH 1PPCE 1EJAA 1P05A 5F8ZA 2GP9B 1A7SA 3RXGA 2P93A 1B0EA 2P94A 1AHTH 1OYQA 1PPZA 1ETSH 1W0YH 3M5MA 1OP2A 3PLKA 2VH0A 1AD8H 2ZHEH 1XUFA 2WZQA 1QJ6B 1PQAA 2R2MB 2BY6X 1O3PB 4B6EA 5JBAS 3NK8A 1DY8A 3VPKA 4BAKB 1LQEA 5GDSH 2IJD1 4RN6A 2ZDKA 1WUNH 1MKXH 1BRUP 1AKSA 1EOJA 4ABDA 1FY1A 7GCHG 5PTPA 1YLCA 3QGNB 3P6ZB 3N99A 1IQMA 5FAHA 5EOKA 3N7EA 2ZNKH 1O37A 1BBRK 1C4V2 3SU5A 1GL1A 4X2VA 4RT1A 3E90B 2UUYA 1EAWA 3SGBE 5F53A 3A8DA 5FL7D 1A61H 2ZU1A 2VIQA 2STBE 5HYOA 1C5QA 5EG4A 2VIWA 4DW2U 1PQ7A 1HBTH 1Q2WA 1HPGA 3RXQA 1GJ9B 1HAYB 3LC3A 4RSPA 1W3CA 3BIVH 4D7FA 4OS7A 1BRAA 3RXTA 2P16A 4FUDA 1RXPA 3DSOA 1GHAG 2GCTC 4TT3D 2LP6A 2FIRH 4Y79A 3MNCA 1FY8E 1C2MA 2XCNA 1G3CA 4XBCA 3F9FA 2AMQA 1AVGH 2BDHA 2BTCE 3VB6A 5HIYA 1C5UA 2XNIA 4ZKSU 3E3TA 3H5CB 4JCNA 1UTKA 2A2QH 3F9EA 4YLQH 1LMWB 3LH1A 1ZSJA 1C2IA 3W95A 1ELCA 4CRDA 3L33A 1C2HA 1DUAA 1WOFA 3TGKE 3RXJA 3RXBA 2LNCA 1C5YB 2H6MA 3NWUA 5G4BA 2UWOA 1DLEA 2C8WB 2NU1E 1D3QB 3NUMA 2FMJA 2CHAB 3MFJA 4NG9H 4A1XA 3EDXB 4ASUD 3RXLA 1BHXF 1P2KA 4CHAC 1Z71A 1T8MA 3PV5A 2VIOA 2JDID 1C5TA 1E37B 1EJMA 2PKSB 5E0JA 3ZV8A 4ZH8A 1EXFA 1UJ1A 1FMGA 1CA8B 5E0GA 3KL6A 3SGQE 1EZQA 3F0PA 4ZHLU 2YMSD 1FPHH 2WHXA 1DFPA 1K1LA 2BLVA 4UE7H 1C2KA 5DN6D 2RDEA 4IBLH 2BLWA 2CXVA 3FZZA 1HLTH 3NCLA 2ZQ2A 4O97A 3TIUA 1LVBA 1XUGA 4OS5A 3AW0A 4ISOA 3UR9A 4NA7A 1L4DA 1ANDA 1H8ED 2AHME 3P8OA 1UHBA 1GBMA 2JH0D 4ABFA 2WSSD 5DO4H 1GBCA 2XTTB 2GX4A 1DE7H 3RXDA 1C2GA 1ZSKA 5FX6A 1O39A 1O2XA 2YMSC 4PROA 5EJLA 6CHAB 4K2YA 3SUFA 1Y3WA 3V3MA 1ZMNA 1TMUH 1TGNA 2NWNA 5F8XA 5K0HA 1GBTA 3RC6A 5JB8S 1O5CB 1SLWB 2FOHA 1PQ8A 2J98B 5SGAE 4Q63A 1S83A 2ZHFH 1GCTB 2ZP0H 1GI9B 3A83A 4TWWA 1TOCB 3CS7A 4INHA 1GHZA 3AK5A 1W0KD 4JMYA 3TH4H 5FBIA 3LGTA 1XXDA 5ESBA 1KLTA 3GY4A 4MPXA 2EEKA 1JMOH 1GBFA 3CNRA 3KIDU 4JYTA 1C9PA 1SFIA 1DXPA 2O8LA 3STJA 1L1JA 3PRDA 1SQAA 4D9RA 4M9FA 1YPLH 1BBRH 1C1OA 3RLYH 1MQ6A 4IMQA 1MTSA 3VB7A 2CF9H 5A8YA 2FLRH 5EJZA 1LPZB 2XWAA 2QF0A 1LCYA 2AH4X 2W3KA 1O2HA 1P2JA 1NRPH 3A84A 3LJJA 1TNHA 3FZDA 4J2YB 2XXLA 4FOUC 2Y5GA 4Z0KA 1P02A 5EQQA 2ZU4A 2J94A 3QTOH 2FOEA 4HG6A 1MBMA 3RXKA 2ZDVH 1H8HD 4AG2A 3ATMA 4Y10E 2GGVB 3F0OA 1D6WA 1TPPA 3A8AA 3O8DA 8KME2 4IS5A 3QDZB 2BDCA 1NZQH 1AWFH 1C1MA 3FVFB 5HIZA 3BTGE 2ZDMA 1NS3A 2KM0A 4B76A 1MCVA 4GHQA 1TRNA 2D8WA 3T5FH 4OGXA 1SGDE 3ZVFA 4AFUA 2ZG0H 2ALVA 1N6XA 5IYTA 2LPRA 3D23A 4X8VH 1GDQA 5CE1A 3ZZDA 1P2OA 1BRBE 1FPCH 3P8GA 1O3NA 1KTTB 3HPTB 5J4SA 3IWMA 3PM3A 4FU7A 1V2KT 2Q6GA 3GY2A 3BEFB 3FANA 2O8UA 1PJPA 3TGJE 5DP8A 1CU1A 1C9TA 3KYFA 4B2AA 2OC8A 3VB3A 1HJAB 1O2WA 2ZEBA 2FEQH 1BIOA 1CA0C 4K8BA 1O2PA 4X0WU 2A31A 1THPB 1KXDA 2ZHDA 1VGCC 1ARBA 4MNWA 1BMLA 3HK6B 3FOAA 3AAVA 3M5LA 2EC9H 2O8MA 3KEEA 1J14A 1DOJA 1EASA 1GI4A 3PMJA 4YESB 1J15A 2IJOB 1EX3A 1GI0A 2VIVA 4JZFH 1YWUA 2OLGA 4DOQA 3BSQA 5C17A 3PB1E 4CREA 1MTNC 4I86A 1O2SA 4F49A 1O2VA 4AFSA 4GLYA 4H42U 1O5GH 5DP7A 3I77A 1QJ7B 4CRCA 1AVWA 2OINA 2ZDAH 1GHXH 1EP5A 4ISIH 5JB9S 1SR5C 1VJ9U 2KAIA 1L1NA 3GS9A 3CS0A 1GJ4H 1C1TA 1P04A 2PFEA 3GCTG 5CHBA 1O31A 3STIA 1A4WH 7LPRA 1AO5A 1V2RT 1T8OA 1JIRA 3PMHB 3ZZ4A 3SJ9A 5CHAB 2VVUA 4Q7XA 3VG8A 1TNGA 1L4ZA 1TBQH 1CBWB 1V2WT 1YLDA 2A5KA 4AB9A 1J17T 4DG4A 1QIXB 1DITH 7GCHF 5FCKA 5EXNA 3T2NA 3F3BA 4X1NU 2IOTA 1K1JA 4XDEA 1GI8B 1PPFE 1BMFD 3MO6A 5DP3A 5T6FA 1CT2E 2XBVA 2Z3EA 1AB9B 4DVAU 1QRXA 1Z1IA 4CH8B 2FPZA 3PO1C 3AASA 4CRBA 2GV6A 4F48B 4AC9A 1AFEH 2TBSA 4YT6H 1L1GA 1A5GH 4BNRA 4BTUB 1ESBA 4ACAA 4HGCA 1QB9A 1GG6B 2GDEH 1SOTA 4FUIA 1LDTT 2WPHS 4DGJA 2Y7XA 4I8KA 3U8TH 1PYTC 4F4OC 2ZI2H 1TALA 1O2OA 1GHAF 1NN6A 3MNBA 4ZAEA 3O8RA 4K1SA 2BB4A 4NZQA 4B6FA 4WH6A 4NZLA 4B71A 3RC4A 2HRVA 1VCWA 5DG6A 2YOLA 2SGEE 3TK5A 2BX3A 4FUFA 1SVPA 4KP0A 1TQ7B 1WXRA 3SQHE 1FAKH 3SO3A 5LPEA 1TFXA 2AERH 4K5ZA 1T4UH 6ESTA 3ELAH 5LGOA 3SHAH 3AVZA 3OU0A 1BTHH 3ATKA 2BXUH 5C5OA 1NESE 1OWEA 3GDUA 4WXVA 1Z6EA 1EKBB 3C27B 4AZ2B 4I33A 5EPNA 3A81A 3W94A 1A3EH 4WMFA 2ANMH 4YOJA 2BMGB 2A45B 1KYNA 4NGAH 5CMXH 3UNSA 4I8GA 1GHYH 2OCVB 1T8LA 3SW2B 1W0ZU 2G4TA 1SLUB 4RKJB 1MKWK 4LZ1H 3SUGA 2D1JA 2GMTB 2H5DA 3S7HB 1O32A 2ZGBH 1DXWA 3SV2H 4U30A 1FY5A 2XC4A 4ABGA 1TNKA 2TGTA 1AY6H 1MTUA 2A4RA 1C2LA 1DWEH 3I29A 1B0FA 1IQGA 1QCPA 2J2UA 2FM2A 1GI2A 4BAMB 1JOUB 4K8YA 3Q77A 5L2ZH 1FQ3A 1GJCB 1GVKB 1GDUA 3UNQA 2XNDD 2ZIQH 2EQNA 3EAJA 1QURH 2F9OA 1O5EH 4ABIA 1HAZB 1OOKB 2W6ID 1T31A 4Y76A 4DT4A 2HLDD 1TX7A 4YXWD 5A0CA 1JWTA 2JH5D 3ZV9A 2OC1A 4UD9H 2QYIA 3SV9A 2ZF0H 3F2GA 1DX5M 3FP6E 2VVCA 1F92A 2FI3E 3RP2A 1W8BH 2OQ5A 3F9GA 3RXAA 4XSKU 1NY22 3TJUA 2J98A 3ESTA 4X6OA 5C5NA 1F5LA 1IAUA 1A0LA 2FO9A 1ZLRA 1FY4A 2GDDA 3BTHE 3KCGH 5FXLA 2QY0B 3UTUH 1XUIA 2C8XB 1NFWA 4A6LA 3KQEA 2V0BA 1ZMJA 5GWZA 5FPYA 2EA3A 2BY8X 1YPEH 3TGIE 1Z6JH 5AFYH 1IHSH 4JK6A 1RFNA 2J95A 3CP7A 4KGAA 4IN1A 4MQAA 1HB0B 1TGTA 3RXOA 5EW2H 4Y11E 2Z7FE 3A85A 1C2FA 3MWIU 2ZU2A 2XWBI 5EW1H 4XBBA 1O2UA 1QQUA 2P59A 2C93B 1HJ9A 1SGFG 3NXPA 2ZA5A 3A7WA 1ELTA 1UO6A 2W6JD 3A80A 1XM1A 3OE7D 4NIWA 5E2PA 2A1DB 1C5NH 3T28A 2WYGA 1UTQA 5GJ4B 3NPSA 3QO6A 1DVAH 2H5CA 2FYRA 1V2PT 2PP6A 4OM9A 3T62A 1QRZA 1BRCE 1K22H 1NFYA 2FOAA 4Y0YE 4D7GA 1ID5H 2AGEX 4A5TS 1SGEE 1KXBA 3W1EA 3RMLH 2JKHA 3D62A 3ZVGA 3K9XB 2ESTE 1O2JA 2KR7A 1O3GA 2V35A 3RXMA 2JETB 1O3EA 4INKA 1O2NA 1G2LA 3BTME 1Q31A 4IW4E 3ZVAA 3QZRA 1LHDH 4H6SB 2L6OA 3EE7A 2IPQX 1C2EA 1GDNA 1ZTLA 2FX4A 1Q3XA 2Z6BD 1Y3YA 2VJ1A 1LHFH 1SMFE 4AYVB 4DT7B 2C8YB 4P00A 2WPLS 1HGTH 4A7IB 1K21H 2JIZD 3GDSA 3SQEE 2OC0A 3TNTA 3BEUA 2CN0H 1BJVA 1Z8RA 2ZDNA 5E0HA 5LPFA 2ZGCA 2Z9LA 1V2OT 3E16B 4WMDA 4UFFH 4FUEA 2C4FH 1MKWH 4Z6AH 1EPTB 3E0NB 1THRH 4FU8A 2WV4A 4ZXYH 4MPVA 3RC5A 3QN7A 1G30B 1W10U 4X8UH 5L2YH 2KZ4A 3OTJE 3PRBA 4I8JA 1O2QA 1C1QA 3RXEA 1DSTA 3KYGA 5AHGH 3FO8D 3GCHB 1K1PA 3BTFE 1P57B 1BT7A 1UCYE 4UFDH 4ZXXH 1TGBA 1SLXB 1ZZZA 2F3CE 3EQ0H 4KTUA 3WWFA 5I46H 5C0UA 2BDYA 3GISB 1B5GH 3RXUA 1GGDB 5BPEA 3LOXA 2RDLA 4BANB 2FZZA 1ANBA 3BEIB 1QBVH 3BG4C 4Q7ZA 1OWIA 1ARCA 1ZGVA 4D8NA 1XKAC 2F43B 3SN8A 3P8NA 3ZYDA 1K1IA 1NC6A 1RGQA 1UVSH 2PKAB 2V6NA 3URDA 5DP4A 2FOFA 4WWYA 1HXFH 2G00A 3GCTF 1E34B 3LGYA 2JETC 3HKJB 2BM2A 3LONA 4KELA 1P9UA 1O2YA 1DWBH 1O3BA 1GPZA 2Z9KA 1NM6A 1YPKH 3SV8A 3MNXA 8LPRA 2TIOA 3RM0H 3F2HA 1ELEE 1O3CA 1G9IE 2AFQB 4Y71A 2OC7A 4QT8C 4AB8A 1V2NT 3LU9B 2P8OB 3PLPA 5HM2A 1TX6A 1LHGH 1MQ5A 4CRAA 2FX6A 4D9QA 1EJNA 1FV9A 2ZCHP 5BRRE 4UEHH 1QFKH 2Y82A 2ODPA 5FX5A 3SNCA 3BN9A 3SZNA 2F83A 3M7UA 1U6QA 1Z8GA 4B1TA 1H9IE 5C0TA 1G3EA 1O35A 4GCHF 2J5UA 1O5BB 2K0QA 2ZHQH 1TE0A 2LELA 1BTUA 3DUXH 1BITA 4MVNA 4FVDA 4Y6DA 1IOEA 1O0DH 3DSGA 2XBWA 2TGAA 4LZ4B 1S85A 4DCDA 3UWJH 1RD3B 5I25A 1VITG 1SFQB 1TLDA 3MO3A 4WVPE 1O2RA 4FVBA 1C5SA 1FX0B 2B7DH 1S0RA 1NRSH 2ZTXA 2VWNA 3RM2H 2NU2E 1XUJA 1ZGIA 1SQTA 3UNRA 5A09A 1KDQB 1EQ9A 3A7XA 1C5WB 1RJXB 1XXFA 3P17H 4WJG2 1SKYE 3EA7A 3QWCH 1CO7E 1CT0E 4HI3A 4I31A 2Q6DA 1ZMLA 2KX4A 2H1UA 2HGTH 2HNTC 3TITA 3U8RH 1D4PB 4Y8ZA 2VIDA 3MNSA 1HFDA 3RLWH 1YPMH 2WV9A 3LKWA 1C1NA 1Y5BT 1AE5A 3BTTE 4Y8YA 1EFRD 2BXTH 3DCLA 2Y5FA 1C1RA 1FUJA 1GMHF 2BZAA 1K2I1 1EZXC 4O9VA 2G8TA 1EZUC 1KXEA 1QB6A 2TRMA 4YTAA 1ZTKA 2BQ6B 2CHAC 1SGFA 4JZDH 2GV7A 2Z9GA 3SJ8A 4CRFA 4DURA 1THSH 2UUKB 2ILNA 1IQLA 1G37A 2CF8H 2QF4A 1TMBH 3BG8A 5DGJA 2V7QD 1MZDA 5GPIB 2AS9A 2PKSC 2WPMS 5HKKD 5AVDA 1K1NA 3T29A 1T7CA 4CR5A 5EPYA 1QBNA 1ZR0A 2ZZUH 2BD2A 2QIQA 2BQWB 2PSYA 1K0HA 4VGCB 3S9CA 1TOMH 2H9TH 3VFEA 1K28D 1SI5H 2ZFSA 1W7XH 4CBOA 1UTLM 3TJNA 4NWKA 1IQKA 1UVTH 2EI6A 2W7UA 4AN7A 2G4UA 3M7TA 3OAAD 2M5TA 1M9UA 3H7TA 1A46H 4ZKOU 2P3TB 2VU8E 1O3AA 4YOIA 3SUDA 3WWBA 3TU7H 2AMDA 4OS4A 4LOYH 2CMYA 1OWKA 4NCYA 1VCQA 1C2DA 2SGAA 5ETXA 5F6MA 2FTMA 3ZIAD 3KQBA 4X8TH 2ZGHA 3QGJA 3QX5H 4OS6A 3WW7A 3IITA 1O30A 1C1SA 6CHAC 1UTJA 2ZU5A 2A4QA 1N8OB 3SUEA 2BOKA 3RDZA 4AFQA 5C2ZA 1V2VT 3TK6A 2GZ7A 4Y0ZE 4YM9A 4LK4A 2WYJA 4O03A 3O8BA 1TBRH 1GCTC 2BHGA 2ANKH 1ACBE 1IQNA 5FPSA 4K3JA 9LPRA 1QL8A 1AFQB 1C5RA 5C1YA 2Z94A 1AZZA 4ESTE 1BHXB 1C1PA 3TVJB 3ZZCA 1EUFA 1UTPA 1IQIA 1GJAB 1S6LA 2BD3A 1W2KH 2IN2A 1WAYB 1KXAA 1BTXA 1AVXA 2XBYA 5B6LA 3GYLB 4RI0A 3SU0A 2QE7D 3K2UA 4AOQA 4U01A 3LDXH 5GNDA 1PPGE 4LXBH 3OYPA 2QXHA 3TH3H 6GCHF 1UTMA 4Y8XA 1GBBA 2VB0A 2RCEA 5KECA 3ZZAA 4ZMAH 1YP9A 3RXPA 3OY5U 2FESH 2JJ2D 1ZRKA 1CHOG 1H9LB 2HPQH 6LPRA 1DM4B 3U1IB 1W12U 2SFAA 4XFQA 1ABJH 1KXFA 1QTFA 4SGAE 3MMGA 4O3TA 2B8OH 3A8CA 3QUMP 1UVUH 2IPHA 1T32A 1OX1A 4JYVH 5DJ7A 2A4GA 2PGBB 2ODQA 1P2NA 1WQVH 3IG6B 1S82A 4X1RU 1AIXH 2HWLB 3OTPA 2AGGX 4FXGH 4MTBA 2EI8A 1P2MA 2V3OH 3OY6U 3PTBA 3KGPA 5C20A 4FUJA 1PPBH 3ZZ5A 2BY9X 1UK2A 2OD3B 1C5XB 1KLJH 4E7NA 8ESTE 4X1SU 2F91A 1OWJA 1PYTD 1UCYH 1COWD 1O3JA 1AQ7A 2UUFB 1DICA 2EI7A 5C1XA 1GJ6A 3ODDA 1DLKB 2PUXB 4HFPB 1XVOA 1NRRH 2KCOA 5CDFE 1LPKB 1EPTA 2F9PA 3SJOA 1VCPA 1Y5UT 3A87A 3S0NA 3CENA 3ZZ7A 1LPGB 3GY7A 3F68H 3O8CA 1A5IA 1FN6A 1C5PA 1AUTC 1HJAC 2NU4E 1GBAA 3SU2A 1ELFA 5A8XA 2RA0A 1C1WH 1HAVB 1ZYOA 2F9BH 3P70B 4Y7BA 1UTOA 2P3FH 1YPHC 1RTLA 1ZTJA 4X2YA 4OS2A 1RIWB 2A2XH 4NIVA 4ZROA 2GZ9A 5DP9A 3PYHA 3VB5A 4B2CA 3GY5A 2P95A 1WV7H 5JPMH 1EP6A 1JRTA 4ABAA 1E38B 4CR9A 2H2ZA 2P3UB 1XX9A 3SNAA 1E1RD 1HV7A 3E6PH 1VJAU 2QC2A 3VGCB 2SGPE 2I6SA 2YNBA 4K69A 1GI6A 4ISLA 2HOBA 1SBWA 4JZIA 1HAHH 1F0UA 1A1RA 3HKIB 3A7VA 4AX9H 1QNJA 2A32A 3L3TA 1V2LT 3ZVCA 5A2MH 3LGUA 4NSYA 5CHAC 3UQVA 1Y5AT 1WCZA 3BIUH 3N7DA 1CBWC 2PGQB 2VGCB 3LH3A 5LPRA 1CVWH 1MZAA 1ZPBA 1O3FA 2ANYA 2J97A 4E05H 2SGDE 1NFUA 3U9AH 3UPEA 3H7OA 1SGTA 2FLBH 1O38A 1ELVA 2FS8A 2A0QB 1AB9C 2A4OA 3FP8E 4HTCH 5TCCA 1DUEA 3UY9A 2ODYB 1MH0A 2HVYB 1GBHA 1F5KU 4FUHA 3PTNA 4GAWA 3RU4D 1O5DH 2BLQA 3T26A 4ASHA 3DFLA 3MYWA 1GI7B 1VITF 2XW9A 4ABHA 3RUOA 1GG6C 1NPMA 4TY7A 1TB6H 2G52A 2GJGA 3ZVBA 4B74A 1P2IA 3ATWA 1ORFA 4AFZA 1HXEH 2F9UA 4D76A 3V12A 5TJXA 2BDIA 2A7CA 1IQEA 2BQ7B 3KNXA 1UW7A 2K1QA 5B6OA 2QCYA 1ZPZA 3Q3KA 1ELDE 1ETTH 1RRKA 2QA9E 2W3IA 3A89A 2XRCA 1YCPM 4A1VA 2FODA 1NBMD 1BBRE 2DUCA 3PMAB 3SYJA 2QGRA 1QGFA 3ATIA 3URCA 1O3MA 2BY7X 1FI8A 3RMMH 3LIWA 3VXFH 3MI4A 2HNTF 2DE8A 3HGNA 5JYIA 1JXPA 3SU1A 1LHCH 3G01A 1MAXA 2CJIA 1WTHD 1HUTH 1VR1H 2HALA 1X7AC 2KCYA 3FN8A 3L6PA 1O2TA 2PR3A 2DE9A 2R9PA 2QXIA 3NZIA 3TLOA 2OQUA 3OFND 1FY3A 2GMTC 4GVUA 4FU9A 3M37A 2WPIS 1B7XB 3U69H 3MH4A 2BDAA 1QHRB 1GJ7B 1XUHA 3ZZ3A 4O3UA 1FJSA 1AMHA 1D3DB 5H4IB 1ESAA 3BTQE 3RXRA 1FONA 1OSSA 2TGPZ 1KTSB 1SHYA 1IQFA 1BCUH 1KY9A 2TPIZ 4X6NA 1V2ST 1P01A 2O8WA 2J92A 1XVMA 3ZZBA 3DSPA 3QLPH 4MG3A 2BX4A 1HRTH 1MAYA 2XC5A 4X1QU 1LQDB 1TA6A 3GCOA 1OXGA 2RG3A 1BTWA 3EGKH 3HK3B 3LJOA 1GVZA 1MMJN 5E8EH 1XMNB 2FOCA 4IC5A 8GCHG 3B8JA 3K6ZA 2NU3E 4FUGA 1YPGH 1AWHB 3UUZA 1O2LA 1ZJDA 3VB4A 2BVSH 4NA9H 5FPTA 1TYNA 1TGSZ 4NSVA 1Y3VA 2ZPRA 2OTVA 3NKKA 1F0RA 4IN2A 1NT1A 2C8ZB 3ZZ8A 4IMZA 3SU6A 1E35B 1WTGH 1P09A 1Y3UA 2PHBA 1C5OH 2ZPQA 4CRGA 1P2QA 1EAUA 1ZPCA 3T25A 1MTWA 2A7HA 2UUJB 1FZZA 1YF4A 2QXJA 5EGMA 3ZZ6A 1C1VH 4BXWA 5EQSA 4ABJA 1O3IA 3BTKE 3H09A 2KAIB 1AUJA 1PPHE 3RMNH 3RU4E 5C1UA 3SI4H 1C5LH 1DANH 1HAIH 1Z7KA 3FFGA 1OWHA 1KXCA 4UONA 1ZJKA 1N1LA 4M7GA 3MTYA 1ANCA 1GBIA
chains in the Genus database with same CATH topology
4YLUA 1AE8H 3MH7A 3JZ2B 4CHAB 1W7GH 3SZEA 1A0HB 2ZGXH 4Z1MD 3PV4A 2JH6D 1A3BH 4AG1A 5DP6A 1S81A 3ITIA 3UR6A 3M35A 1V3XA 1CHOF 1O3DA 1QBOA 1CGIE 2Y7ZA 3Q00A 1V2QT 3BTDE 2PTNA 2HLCA 3SNBA 1QA0A 1F0SA 1OHHD 1ELBA 1W13U 4I32A 2G5NA 2BVXH 3UQOA 1SPJA 2PUQH 2HPPH 3PWBA 1AGJA 1EAIA 1QY6A 1O33A 4DIIH 2F9VA 1NBME 5DP5A 4B75A 1TABE 1GHVH 1P06A 4DY7B 4FUBA 2BZ6H 2BDBA 2B9LA 1P3CA 4K60A 2FP7B 1F7ZA 3F1SB 1JIMA 1QR3E 4INLA 4BAQB 1FAXA 1SGRE 3KF2A 3MH5A 3SU4A 1YPJH 3EYDA 3SJIA 2ULLA 2BD5A 3GY3A 3BF6H 3S9BA 1TPSA 2K8IA 1GMDG 4TWYA 1G32B 4Q2KA 3RU4T 1J9CH 4ABBA 3P95A 2YMSB 3MH6A 1JBUH 3Q3XA 1WYKA 3MU0A 1XUKA 3DA9B 3GY8A 1OYTH 1YC0A 4B2BA 4MNYA 2D2DA 3LGIA 1Z8IB 2H9EH 1MABB 1H8DH 4X2XA 1HIAB 4UDWH 1SHHB 5FHTA 3M36A 1SSXA 3M7QA 5FCRA 1GJDB 2XBXA 3F9HA 1FXYA 1D6RA 3GYMA 2GKVE 1EB1H 1EPTC 1V6DA 2BOHB 1P03A 2GT8A 5T6DA 4BTIB 5K7RA 4TPIZ 1HNEE 1ESTA 1CE5A 3ATLA 2BY5X 3U98H 3SGAE 3M5OA 1O5FH 2VNTA 5IDKA 5HMAA 2QF3A 2CK3D 2G81E 1GI3A 3GCHC 1H8IH 1S5SA 1BMNH 3UFAA 1HAVA 1TRMA 5JBTA 1YM0A 4KTCA 3ZYEA 3A7YA 1BMMH 4WH8A 2GD4B 1E36B 4E06H 1MU6B 4YOGA 2PLXA 3RXHA 1W11U 1GGDC 1ZSLA 4MNXA 3UWIA 2WPDD 3BV9B 1INCA 3GCNA 1LKAA 4A1TA 1BTZA 4R8TB 2VINA 4TSFD 1QL7A 4UFEH 1P0SH 5TCAA 2GT7A 2QAAA 2F4LA 1W0JD 2C90B 1ZHRA 5JBBS 1EOLA 5HGGA 3UIRA 2J4IA 2W7SA 2A5IA 2R2WU 1TQ0B 1E79D 1BJUA 2BVRH 2SGFE 2AIQA 5JBCS 1SLVB 3A8BA 1O5AB 2Z9JA 2ZDLA 1UVOA 1SGQE 1CQQA 2G51A 1SQOA 1LO6A 4ZCNA 1UCYK 2R0KA 4ZHAA 2GCHG 3MU5A 3TH2H 1GBDA 3TJOA 5GCHG 2Y6TA 4DIHH 3P92A 3A7TA 4U32A 5DPAA 1O2MA 5EXLA 1SGCA 2P8OC 3A7ZA 2QN5T 2VWLA 2YNAA 5EQRA 2PSXA 1RTKA 2ZC9H 1LKBA 3MU4A 5EXMA 1GHBG 1AN1E 2WINI 2FTLE 2J9NA 2ZCKP 3MU1A 3VEQB 2VWMA 3JZ1B 2WV5A 1AI8H 2I6QA 2SGQE 1GWAA 2SNWA 1RS0A 2G5VA 1K9OE 1D3PB 5F8TA 3SOSA 3F6UH 3U1JB 1O34A 1DPOA 4RKOB 2O9QA 1CA0B 1TPAE 3MOCA 4XE4A 3SV7A 5C3NA 1SGPE 1O3HA 2F9NA 3A82A 2AMPA 4BAOB 1VGCB 3S69A 1KSNA 4MPWA 1SG8B 3LPRA 1ELGA 1AU8A 1TNIA 2VWOA 2KFWA 1GBJA 4IC6A 2Y81A 1GI1A 4ZHMU 3M3TA 1Z8JB 2R3YA 1C4U2 2HVXA 4NA8A 4YZUA 4WY3A 1GMCG 2B5TB 4Q7YA 1MTNB 2CGAA 1C4Y2 3SJKA 2Y80A 4Y7AA 3PWCA 2O8TA 3QTVH 1TRYA 4BAHB 1NO9H 4JYUH 2OUAA 3D65E 1TPOA 3MO9A 2QXGA 1HAXB 4ISHH 1NTPA 2XOKD 3HGPA 5DSFA 3FAOA 4K1TA 1G3DA 4X8SH 4AGJA 1JRSA 1EB2A 1F0TA 2ZTYA 3V0XA 5GXPA 1C2JA 1A2CH 2ZGJA 4GSOA 2JJ1D 4Q80A 2HNTE 4AORA 1QRWA 2GZ8A 5GIBA 1WQSA 3BTEE 3UB0A 1WBGB 3RXVA 3ZVEA 3GICB 3VXEH 1AKSB 1J8AA 1GBKA 2BYAX 2ZHWH 3DT0H 3OX7U 2BD8A 2QV1A 2BD7A 3R0FA 1BZXE 3F2FA 3S9AA 2J34A 5A0AE 1NRQH 1H9HE 4X6PA 3PO1B 1BTYA 4X1PU 1CGHA 2OBQA 3KN2A 3M61U 3C1KA 4VGCC 2OK5A 1C5MD 3S7KB 8GCHF 4AGKA 2Z3DA 4KTSA 1A5HA 1O2GH 2CV3A 2GVFA 3TK9A 4BTTB 1O3OA 1QJ1B 3QZQA 1F5RA 1SL3A 5F03A 1BUIA 1YCPK 1S84A 1OPHB 1DY9A 2STAE 1AZ8A 4ISNA 5EODA 4FETA 1O2IA 2VIPA 5AF9H 2UWLA 1O3LA 2FI4E 2ZKSA 1O36A 4K1EA 1IHTH 1EATA 3FP7E 4R0IA 1BA8B 2OBOA 1V2TT 3E8LA 2R3UA 2ZECA 4YT7H 2FDAA 3B9FH 1CGJE 3K6YA 3M5NA 1BTPA 4B73A 2V3HH 1LHEH 1N8OC 2FWWA 2THFB 1QL9A 4X2WA 3LGWA 3T27A 1UK4A 1Y59T 1FDPA 1KLIH 1TWXB 1G36A 1OWDA 1S6FA 1P11E 1MBQA 2KCPA 1SC8U 2PV9B 1G3BA 1L0ZA 4H4FA 4BOHA 1E0FD 1GHWH 2C3SA 3HATH 1BB0B 5ESTE 1OKXA 1AFQC 3PROA 1DWCH 1H4WA 3UOPA 1TGCA 3KQCA 1UK3A 2BDGA 1BMAA 1FIZA 1O3KA 3GY6A 2FYQA 1PQ5A 2J38A 1A0JA 2M2AA 2PW8H 1TAWA 2OP9A 3U8OH 3ENSB 3GDVA 2ZO3H 5HM9A 1N6YA 1DS2E 2VVVA 5T3HA 1UMAH 1QB1A 4ZKRU 5C67A 1ZHPA 4WF8A 2AEIH 2A5AA 2ZFPH 3GOVB 3UOUA 1SGYE 5A0BA 5LH8A 4Q4LA 4NFFA 1CT4E 4I8HA 1H1BA 2W26A 3BTWE 5ABWA 1IQHA 5DK1A 2PWXA 1PFXC 1O2ZA 4GUXA 4GCHG 2UWPA 2XC0A 1BOQA 1W14U 3SNDA 3DD2H 4TY6A 3AW1A 2QF5A 3OEED 1MCTA 1HAPH 1GJ8B 2PKAA 2FOGA 1Y3XA 1VZQH 1DSUA 1NU7B 4A92A 1GMDF 1L2EA 1SGIB 4ZUHA 1UHBB 3AAUA 2WPJS 4X6MA 4CH2B 1E1QD 3M3SA 1KMHB 3R3GB 3SHCH 5J4QA 1LVOA 1C5VA 2XYAA 2OXSA 1QA7A 3B23B 3LGVA 1EAXA 2ZFTA 1LVMA 2ANWA 3EA9A 4H6TA 3E91A 4ZKNU 2A7JA 5EU8A 1GBEA 1ETRH 1WSSH 4FUCA 2ZTZA 4J1YA 4XOJA 1J16A 3PLBA 1TBZH 3ZVDA 4CBNA 4I7YH 2ZFRH 1HIAA 1Z1JA 3MHWU 1MUEB 1GJ5H 1OP0A 3OSYA 2B0FA 2BD4A 2VH6A 5E2OA 1OP8A 1HCGA 1TONA 1SB1H 3N7OA 3QK1A 1HJ8A 1P9SA 1OS8A 3Q76A 1CSOE 1GJBB 2WUCA 1MKXK 5IK2D 3FKSD 1LVYA 1YKTA 1UTNA 4OGYA 1GMHG 2ZU3A 3NRLA 4MLFB 5FBEA 1P8VC 4KKDA 4MPUA 1MD7A 2VBCA 1KIGH 2R0LA 4UFGH 5AFZH 1ANEA 1ZOMA 4MDSA 1NRNH 4TYDA 3RXFA 1GVLA 1ZRBA 2WPKS 4WXIA 3M3VA 1DWDH 3Q3YA 1NROH 1MTVA 2ALPA 4NIXA 5T1VA 1D3TB 1GCDA 1HYLA 3SBKA 2Z3CA 1TX8A 1S6HA 2ZWLH 1RIWC 2ZFQH 4MNVA 3DFJA 2BD9A 4XD7D 3E0PB 4E7RG 1FN8A 1HDTH 3KQDA 1YCPH 2GTBA 2D26C 1NFXA 1KDQA 3RXCA 1G2MA 3I78A 4JZEH 2ZPSA 4DJZB 1HAOH 1GI5A 1YPHE 4BXSA 1FNIA 2ZFFH 1GBLA 1TNLA 3VGCC 2WUBA 2TGDA 4ABEA 2AGIX 3K65B 2ZQ1A 7ESTE 4I8LA 1NU9A 2GCHF 4NIYA 5GCHF 3SORA 3RXSA 1FIWA 3SV6A 2KCAA 1V2UT 4NWLA 1P3EA 1IQJA 1Y8TA 1UVPA 3ODFA 4GPGA 4F55A 4XBDA 2PTCE 5JDUB 1DDJA 2W5EA 3WY8A 4JK5A 1EZSC 1D9IA 3TJVA 1T8NA 2VGCC 2FXRA 4OS1A 3V13A 1BQYA 4GHTA 4TPYA 1V2MT 1S0QA 1K1OA 1GHBF 1VITH 4NFEA 3EE0B 1FLEE 2Q1JA 3EA8A 1ABIH 2ZCLP 2Y5HA 3PV2A 2ASUB 4YO9A 1YGCH 1C5ZB 2AIPA 2H9HA 1BDAA 3LT3A 3E1XB 2FI5E 3D49H 5L6NH 3A88A 2AYWA 5HXFA 4THNH 2G55A 1TA2A 2NU0E 5DKMA 9ESTA 1P12E 1YBWA 1DT2A 1T4VH 3RXIA 3SI3H 4IGDA 5L30H 2Q6FA 1TNJA 3P8FA 1P10A 3V7TA 1LTOA 3SU3A 4WMEA 3DHKH 3TNSA 1XKBC 6GCHG 1PPEE 1TMTH 3TPIZ 1QQ4A 3A86A 1GMCF 2Z9IA 4U2WA 1F2SE 2BLOA 2GCTB 4SGBE 3OEHD 3BG4B 3SNEA 3KHVA 1C1UH 1SOZA 1GL0E 7KMEH 5A8ZA 4AYYB 1CHGA 2RA3A 1O2KA 2SNVA 2FOMB 1V2JT 1MD8A 4JZ1A 3LC5A 1SGNE 3PMBB 3UREA 1HAGE 1RTFB 1YYY1 4HZHA 1MU8B 1WU1A 2FS9A 2FOBA 1K1MA 1ZHMA 2XCFA 3MU8A 1ELAA 5T6GA 3ZZ9A 1TIOA 3RMOH 1PPCE 1EJAA 1P05A 5F8ZA 2GP9B 1A7SA 3RXGA 2P93A 1B0EA 2P94A 1AHTH 1OYQA 1PPZA 1ETSH 1W0YH 3M5MA 1OP2A 3PLKA 2VH0A 1AD8H 2ZHEH 1XUFA 2WZQA 1QJ6B 1PQAA 2R2MB 2BY6X 1O3PB 5JBAS 4B6EA 3NK8A 1DY8A 3VPKA 4BAKB 1LQEA 5GDSH 2IJD1 4RN6A 2ZDKA 1WUNH 1MKXH 1BRUP 1AKSA 1EOJA 4ABDA 1FY1A 7GCHG 5PTPA 1YLCA 3QGNB 3P6ZB 3N99A 1IQMA 5FAHA 5EOKA 3N7EA 2ZNKH 1O37A 1BBRK 1C4V2 3SU5A 1GL1A 4X2VA 3E90B 2UUYA 1EAWA 3SGBE 5F53A 3A8DA 5FL7D 1A61H 2ZU1A 2VIQA 2STBE 5HYOA 1C5QA 5EG4A 2VIWA 4DW2U 1PQ7A 1HBTH 1Q2WA 1HPGA 3RXQA 1GJ9B 1HAYB 3LC3A 4RSPA 1W3CA 3BIVH 4D7FA 4OS7A 1BRAA 3RXTA 2P16A 4FUDA 1RXPA 3DSOA 1GHAG 2GCTC 4TT3D 2FIRH 4Y79A 3MNCA 1FY8E 1C2MA 2XCNA 1G3CA 4XBCA 3F9FA 2AMQA 1AVGH 2BDHA 2BTCE 3VB6A 1C5UA 2XNIA 4ZKSU 3E3TA 3H5CB 4JCNA 1UTKA 2A2QH 3F9EA 4YLQH 1LMWB 3LH1A 1ZSJA 1C2IA 3W95A 1ELCA 4CRDA 3L33A 1C2HA 1DUAA 1WOFA 3TGKE 3RXJA 3RXBA 2LNCA 1C5YB 2H6MA 3NWUA 5G4BA 2UWOA 1DLEA 2C8WB 2NU1E 1D3QB 3NUMA 2FMJA 2CHAB 3MFJA 4NG9H 4A1XA 3EDXB 4ASUD 3RXLA 1BHXF 1P2KA 4CHAC 1Z71A 1T8MA 3PV5A 2VIOA 2JDID 1C5TA 1E37B 1EJMA 2PKSB 5E0JA 3ZV8A 4ZH8A 1EXFA 1UJ1A 1FMGA 1CA8B 5E0GA 3KL6A 3SGQE 1EZQA 3F0PA 4ZHLU 2YMSD 1FPHH 2WHXA 1DFPA 1K1LA 2BLVA 4UE7H 1C2KA 5DN6D 4IBLH 2BLWA 2CXVA 3FZZA 1HLTH 3NCLA 2ZQ2A 4O97A 3TIUA 1LVBA 1XUGA 4OS5A 3AW0A 4ISOA 3UR9A 4NA7A 1L4DA 1ANDA 1H8ED 2AHME 3P8OA 1UHBA 1GBMA 2JH0D 4ABFA 2WSSD 5DO4H 1GBCA 2XTTB 2GX4A 1DE7H 3RXDA 1C2GA 1ZSKA 5FX6A 1O39A 1O2XA 4PROA 2YMSC 6CHAB 4K2YA 3SUFA 1Y3WA 3V3MA 1ZMNA 1TMUH 1TGNA 2NWNA 5F8XA 5K0HA 1GBTA 3RC6A 5JB8S 1O5CB 1SLWB 2FOHA 1PQ8A 5SGAE 4Q63A 1S83A 2ZHFH 1GCTB 2ZP0H 1GI9B 3A83A 4TWWA 1TOCB 3CS7A 4INHA 1GHZA 3AK5A 1W0KD 4JMYA 3TH4H 5FBIA 3LGTA 1XXDA 5ESBA 1KLTA 3GY4A 4MPXA 2EEKA 1JMOH 1GBFA 3KIDU 4JYTA 1C9PA 1SFIA 1DXPA 2O8LA 3STJA 1L1JA 3PRDA 1SQAA 4D9RA 4M9FA 1YPLH 1BBRH 1C1OA 3RLYH 1MQ6A 4IMQA 1MTSA 3VB7A 2CF9H 5A8YA 2FLRH 1LPZB 2XWAA 2QF0A 1LCYA 2AH4X 2W3KA 1O2HA 1P2JA 1NRPH 3A84A 3LJJA 1TNHA 3FZDA 4J2YB 2XXLA 2Y5GA 4Z0KA 1P02A 5EQQA 2ZU4A 2J94A 3QTOH 2FOEA 1MBMA 3RXKA 2ZDVH 1H8HD 4AG2A 3ATMA 4Y10E 2GGVB 3F0OA 1D6WA 1TPPA 3A8AA 3O8DA 8KME2 4IS5A 3QDZB 2BDCA 1NZQH 1AWFH 1C1MA 3FVFB 3BTGE 2ZDMA 1NS3A 2KM0A 4B76A 1MCVA 4GHQA 1TRNA 2D8WA 3T5FH