2IJOB

Crystal structure of the west nile virus ns2b-ns3 protease complexed with bovine pancreatic trypsin inhibitor
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
176
structure length
168
Chain Sequence
GGVLWKKGDTTTGVYRIMTRGLLGSYQAGAGVMVEGVFHTLWHTTKGAALMSGEGRLDPYWGSVKEDRLCYGGPWQLQHKWNGQDEVQMIVVEPGRNVKNVQTKPGVFKTPEGEIGAVTLDFPTGTSGSPIVDKNGDVIGLYGNGVIMPNGSYISAIVQGERMDEPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for regulation and specificity of flaviviral proteases and evolution of the Flaviviridae fold.
pubmed doi rcsb
source organism West nile virus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Polyprotein
total genus 29
structure length 168
sequence length 176
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00949 Peptidase_S7 Peptidase S7, Flavivirus NS3 serine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ijoB02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2ijoB01
1XUFA 4I7YH 1F7ZA 3ZV8A 4A1XA 2NU1E 1H1BA 2RDLA 5C5NA 4Y6DA 1BHXB 3SV9A 1Y8TA 2BD5A 1SLXB 1UTQA 1XXFA 4HZHA 1S6HA 1AFQC 2R0KA 2OK5A 3SHCH 1SL3A 3HKIB 1P09A 2J38A 1AI8H 1FIWA 3EA9A 1B0EA 1AIXH 1GBDA 2FX6A 1UCYE 3E0PB 3MH6A 1P04A 4VGCB 1C5ZB 4HGCA 3LGYA 4BTTB 1BMAA 1MKWK 3BTTE 2Y5FA 1RD3B 3FP6E 1DWBH 1RTLA 2AEIH 4DVAU 4TWWA 4UEHH 1EPTB 2R3UA 2CXVA 1O3KA 1T32A 2ZCHP 2OC8A 2FYQA 2FYRA 1C1VH 2PUXB 2BOKA 1EAIA 2OINA 2O8MA 1BTHH 1QQUA 1Y3VA 2THFB 1QCPA 2ZNKH 1GMCG 3KF2A 8GCHG 4DURA 2OLGA 2GCTC 1XUJA 1GBBA 4B74A 4Q7ZA 2AFQB 2EA3A 1BTXA 1CU1A 1V2PT 4K8YA 1ACBE 4MPXA 1FIZA 1UO6A 3ATWA 1NN6A 3ZVAA 1O2JA 2W26A 1EATA 4NA7A 1A3BH 1BHXF 1NFWA 4BAKB 1CHOF 1AKSA 5GDSH 2WZQA 5IDKA 2G4UA 1Y3XA 1ETRH 4JZDH 1WYKA 1UCYK 1PJPA 2PGBB 2HGTH 1KXAA 5J4QA 3SU5A 2EI7A 1C1RA 2ANWA 2XNIA 5GXPA 1CBWC 7LPRA 1Z8GA 4BXWA 2WPLS 1FPCH 3CS7A 1LPKB 1MTWA 1K1JA 2PTNA 1ORFA 3A82A 1GI3A 3M5NA 4QT8C 1EP6A 4Q2KA 3MO9A 3NPSA 2PW8H 1BBRK 1ZSKA 4ISOA 4UDWH 1AVWA 3K65B 2B7DH 2QF0A 1SGTA 5FBIA 1QFKH 1SGIB 1W7XH 2HRVA 4FUFA 1ANCA 3BTQE 2WV9A 2A2QH 1D4PB 1O3DA 1L4ZA 3SU6A 1AB9B 4ZKNU 3HK6B 3LGTA 2AMPA 1OPHB 1AHTH 1ELCA 5ETXA 4AB8A 1L4DA 3LGIA 1DANH 1UK4A 3QDZB 2BDYA 2VIDA 1UTOA 3UR9A 1UMAH 1BRCE 2ZTYA 2TGAA 1SI5H 1DWEH 1AKSB 1O3FA 2BVXH 2CHAC 2V6NA 2ZU5A 3SZEA 1PPGE 3SUGA 2WPMS 3NXPA 3JZ1B 1SFQB 4KGAA 1JBUH 3M7TA 4Y11E 1QGFA 1N8OC 2BZAA 2GX4A 3PROA 2ANKH 2ZFRH 4M9FA 1QL8A 1YCPK 1C2KA 1TRNA 5DGJA 1QJ1B 2ZHQH 2FOCA 1CGHA 4AGJA 1DITH 2CHAB 3RXKA 1GHWH 3SGAE 1T7CA 5A8YA 2GZ9A 3ZYEA 3TJUA 2VIWA 3I77A 1AZZA 1V6DA 2FOBA 1O39A 4DOQA 1PQ7A 1UTMA 1YPJH 2GT8A 2IJOB 3QO6A 4IS5A 3RMLH 1GHYH 3BTHE 3B9FH 2XC5A 3M61U 3ZZCA 4FUGA 1DFPA 3N7OA 5FCKA 3A8CA 1HUTH 3MMGA 1QBNA 3M3TA 1MAXA 3MOCA 5TCAA 1ARCA 2VVVA 4XBCA 4B2CA 1CA8B 1W12U 4KKDA 1O3IA 1EAXA 3GCHB 2ZTZA 4MDSA 3MFJA 4TY7A 2GP9B 1FV9A 3PTNA 4GAWA 3FAOA 1YPHE 1HAPH 2WUCA 3V0XA 5HYOA 1Z8IB 1GVLA 2ZDMA 3AW1A 4X1NU 4TPYA 1V2RT 3HK3B 3KQDA 2P3FH 3LIWA 2EI8A 5DP6A 3QLPH 2LNCA 2AS9A 1O3BA 1TNHA 3GY5A 1ELAA 1MD7A 1GDNA 2QF3A 2ZQ2A 2BDIA 3EAJA 2R2MB 4ISLA 2GTBA 4WF8A 2CN0H 3SJOA 3U1JB 3EGKH 1O2HA 1OSSA 4OS6A 4AX9H 1ZSJA 2FI4E 2QXIA 1QY6A 3U9AH 2F9UA 3AVZA 1AMHA 1O38A 1GL1A 3AW0A 3TK6A 4WH6A 3MO3A 4INHA 3K6ZA 1GJ4H 3SUDA 1QBVH 3S0NA 4XBDA 2TRMA 1L0ZA 2Y6TA 1C5XB 5FXLA 2XTTB 3T62A 4DIHH 1QIXB 1S85A 1P05A 1O2SA 1TNIA 4E7RG 2H1UA 3FZDA 5A0CA 3VXFH 3SJ9A 1BTYA 1D6RA 2BDAA 1MCVA 2BM2A 2P8OB 3T25A 3S69A 4NIVA 1BBRE 2BX4A 1C5NH 1P03A 3E91A 2RG3A 1ZTKA 3UREA 2PV9B 1XVOA 1Z8RA 1P57B 2J94A 3A89A 1UVOA 5E0JA 3BG4B 4NG9H 1HCGA 3H5CB 3FZZA 2R9PA 2A4GA 2QXJA 1O2VA 3TU7H 4WVPE 5DP4A 3G01A 4OGXA 1G36A 4ISHH 1ANDA 4D7GA 3P95A 2GZ8A 1D9IA 1C2MA 2TIOA 3Q77A 1UTPA 3PV4A 2ZDNA 1V2NT 4Q80A 2ZHFH 1P9SA 1V2LT 1UTNA 4GPGA 2HWLB 2PKSB 5EQRA 5C20A 2DE9A 1ESBA 2BZ6H 3URDA 1IQKA 1C1PA 3E3TA 3VB4A 4U30A 3A81A 2XCNA 4F49A 2XC0A 1HIAA 3U8RH 1V2ST 3ODDA 3ZVBA 1UCYH 5BPEA 5E0HA 3SOSA 1UJ1A 3ZVCA 1LVOA 4HFPB 1HB0B 1UVUH 5GJ4B 3M36A 5DK1A 2ZGXH 3ZZBA 5DO4H 1ANBA 1AVXA 4CH8B 3S7HB 4WMFA 3GDUA 4K5ZA 4CRGA 5DP9A 1AQ7A 1O3NA 3A8BA 4LZ4B 5GNDA 1A5HA 5C3NA 4B6FA 1ELTA 4DIIH 4ZHAA 3U8OH 1SLWB 1EAWA 1UHBB 2HOBA 2J4IA 1FI8A 1G32B 1INCA 3RXFA 3DFLA 1GBHA 1TGNA 1ELGA 1SFIA 5DP3A 1OXGA 4R8TB 3GYLB 5J4SA 1O35A 3VXEH 2ZA5A 1C1WH 5ABWA 1SGCA 3SU3A 2NU0E 4UFEH 2B5TB 2KAIB 5TJXA 1GBFA 2H9TH 3MU5A 1JIMA 4MNYA 3RU4E 1C9TA 2IJD1 3ITIA 1IQJA 4MPUA 4JZEH 2VNTA 1YGCH 1V2MT 2GCHG 4X2WA 1P2IA 4AORA 3GICB 4Y79A 1GHXH 1FQ3A 4M7GA 2FOHA 4YO9A 1O0DH 3SJIA 1GMHG 4X2XA 2PHBA 1SQAA 4MLFB 5LH8A 1TIOA 5G4BA 4DW2U 6CHAC 1X7AC 4K1TA 1AWFH 1P3CA 1QA7A 1ZMJA 4RKJB 4OGYA 3RXUA 1ABJH 1BRUP 1NFXA 2Z9IA 1O5CB 4VGCC 3B8JA 4X0WU 3SI3H 3L3TA 2JETC 1EX3A 1GJ8B 4MVNA 4K2YA 3LGWA 1B7XB 1TNLA 1DUAA 1GBCA 1CHOG 2FI5E 5EXNA 1KXFA 3CS0A 1FAKH 2TGPZ 4SGBE 2ODPA 1K1NA 2ZGCA 2UUYA 3UNRA 1QL7A 2BVSH 3D62A 1S83A 2OC1A 2LPRA 4WXIA 2FDAA 1HLTH 3QZQA 2IPHA 1VZQH 2D1JA 2H2ZA 2RA0A 1SOZA 1NPMA 1PFXC 2OD3B 5JB8S 2UWPA 1DS2E 2JKHA 1MQ6A 1BTPA 1WCZA 3HKJB 3KCGH 3UUZA 1O2XA 3QX5H 2PWXA 5HMAA 2VIQA 1RTKA 3BEUA 1HPGA 2GVFA 4E7NA 2SGQE 2QA9E 1PQAA 2BY9X 4BANB 1A5GH 3L33A 5DJ7A 5T1VA 3DHKH 2ZGJA 3LDXH 1GMHF 4B76A 1C4V2 1SGEE 1SOTA 1TPAE 3MTYA 2C8ZB 1P06A 4O9VA 3QGNB 3RXHA 1TABE 3DD2H 1MD8A 2F83A 1SHYA 1DWCH 3PMHB 2BQWB 3A8AA 1CQQA 1TMBH 2B8OH 4H6TA 1NM6A 1GDUA 2FMJA 1BUIA 2CMYA 4GHQA 4I8LA 2H9HA 1T8OA 3TGJE 1QJ6B 1E37B 2G55A 1EJAA 4BAQB 1DSTA 4Y0YE 4BNRA 1IQLA 1GI2A 2ZZUH 2K1QA 2PR3A 4ZXYH 4NFEA 3PMBB 4ABFA 1MZAA 2BXTH 2P93A 2ZFSA 4DG4A 1GI6A 1JXPA 1TBQH 1UK3A 5C1UA 4YESB 1S6FA 3GCTG 1WXRA 1L2EA 2ZO3H 1GJ5H 1K1MA 3P8NA 3M3SA 5B6OA 1EJNA 5JBBS 3Q3XA 1K9OE 1O31A 4LXBH 4ZKRU 4BTIB 5C67A 4CBNA 2ASUB 1DX5M 3OX7U 2BD8A 2ZWLH 5EQQA 1NROH 3U98H 1OOKB 2V3HH 2NWNA 1QJ7B 2BY7X 2C8YB 1MTVA 1ZGVA 1K1LA 1TX8A 4B1TA 2QXHA 3ZVGA 3T27A 1C2IA 4AFSA 1O2RA 5CMXH 4X6PA 1TRMA 3U8TH 3PLKA 1O2MA 2WYJA 1E35B 1HAGE 1ZRBA 2A5AA 2Z3EA 1YPLH 1BRBE 1O2KA 4OS7A 2GCTB 4ABGA 1RIWC 4X6MA 5DP5A 1SGQE 1EPTC 3PTBA 1OYTH 1UTJA 4WJG2 1ZR0A 4AZ2B 2FOMB 1EXFA 1G3DA 1WAYB 3W94A 1O32A 4ZMAH 3EYDA 1EJMA 3SN8A 1C5YB 2J2UA 4TYDA 1ZRKA 1BTWA 2EEKA 3F9FA 5EU8A 2XWBI 1IQFA 4OS1A 3RXEA 3TGKE 3MYWA 1VJAU 4Y0ZE 1O5GH 3TVJB 4CR9A 4H4FA 1TWXB 2Z9KA 3UPEA 2IOTA 2XBWA 3Q3KA 3RXLA 3VFEA 1HRTH 2VIVA 5EXMA 1QBOA 1BITA 1Y3UA 2GDDA 1UK2A 3E8LA 3SW2B 4AYYB 1TRYA 4GSOA 1LQDB 2ALPA 4ZKSU 1SQOA 1BOQA 1Q2WA 2C8XB 1THPB 4JK6A 1B5GH 1S0QA 2O8TA 3QTOH 4U2WA 2FTLE 1ID5H 1W2KH 1TPOA 2JH5D 1MTNC 2BTCE 1AFEH 2GD4B 4GCHF 3S9AA 1C5WB 2ZFQH 1BZXE 5ESTE 3A80A 1T8MA 3BN9A 2F9NA 4J1YA 3PB1E 3RXIA 2OC7A 1KXCA 2YNAA 2NU2E 4AGKA 3DUXH 3MNXA 1EZXC 3PO1C 2F9VA 2BY6X 1GBMA 1SGDE 2BDCA 2SGFE 1LVBA 4Y7AA 4BAHB 2FP7B 3LOXA 3LC5A 1W14U 1SMFE 5HM9A 2SGEE 2WV5A 1C5TA 1L1JA 5JPMH 1GHVH 1G9IE 1EUFA 2HPPH 2QYIA 4YM9A 2GGVB 3HATH 3F9EA 4I32A 1V2WT 2BX3A 2AMDA 2VJ1A 1O3GA 4GHTA 2QXGA 1OWHA 1TQ7B 2BD9A 2VB0A 4F4OC 3QWCH 1TFXA 1H9IE 2Y5HA 1HAOH 2OBQA 3QGJA 1K22H 1SGFG 1XMNB 3ENSB 3RXPA 2FOEA 3VGCC 2A32A 1XM1A 2BLOA 4FUBA 2ZEBA 3QUMP 1QB9A 2R3YA 5A2MH 3RMNH 4CRCA 1IQIA 2BLQA 4NWLA 4NIYA 2YNBA 1NESE 1AE5A 1J8AA 2W7SA 2P94A 3BTDE 1P2OA 1P2NA 3M3VA 3QTVH 2VWMA 3V7TA 1SLUB 4DY7B 1AFQB 3UWIA 2ZECA 3SNAA 4CHAB 1YCPH 3GYMA 1SGPE 2W3IA 2VU8E 5BRRE 1P02A 3PYHA 2CGAA 1TX6A 1GJAB 7GCHG 5L30H 2W7UA 5F8ZA 4WY3A 1Z6JH 2FPZA 1C5PA 1TA6A 4O3TA 1QRWA 1DM4B 1WTHD 4IC6A 3BV9B 3S7KB 1UVPA 1TGCA 1F92A 1FMGA 1JRSA 1EQ9A 1WU1A 3RXJA 4Y8YA 2ZCKP 3KL6A 4FVDA 1O5EH 2QIQA 1BDAA 1F5LA 3QN7A 1G3BA 2ZTXA 4OS5A 4R0IA 1HAHH 3OTPA 1DUEA 2V35A 2BMGB 1XKBC 3OY5U 2VH6A 1GHBF 4X6NA 1AGJA 3EDXB 5AHGH 3TH3H 1A46H 3BIVH 3GCHC 4NSYA 3A83A 1DT2A 3UOPA 1OKXA 1THRH 3DA9B 1IHSH 2O9QA 5I46H 2A45B 1LVYA 4E05H 1PPEE 1IQNA 5C5OA 3A88A 1CT2E 1KLJH 1P2QA 2ZG0H 1OX1A 3FP8E 1H8DH 4AN7A 1ELDE 3RXDA 1SC8U 1CSOE 3P8FA 3QK1A 1ZTLA 2TPIZ 1FY8E 1PQ5A 4IMQA 4XSKU 1NO9H 1NFYA 4NIWA 2BD7A 1GI7B 1HDTH 4Y10E 1WQVH 5C1YA 1AUTC 1V2TT 4ZHLU 3F68H 1SGNE 1Q3XA 5B6LA 3NKKA 4AB9A 1A1RA 1OWDA 3B23B 2ZHWH 1A2CH 3RXCA 2UWLA 1CA0C 2V0BA 1QHRB 1MU8B 2FOGA 1SGRE 1PPCE 3I78A 2ZU3A 2AGEX 5DKMA 3GY4A 4ISNA 1HJAB 5JB9S 2EC9H 3UY9A 1TBRH 3S9BA 2OBOA 1DDJA 1GMDF 4E06H 5EGMA 1IQGA 1C2GA 3KQCA 2O8UA 4MNWA 3SNEA 1BA8B 3NZIA 1EAUA 3KIDU 1ELVA 2OC0A 1JIRA 3MNSA 3SORA 3RP2A 1THSH 3P8GA 1ABIH 4THNH 1ZHRA 3FP7E 2ZHEH 3UQVA 1C5OH 1C2DA 3GISB 4ABHA 3MH7A 1T4VH 3PWCA 1TGBA 1KXBA 3C27B 3GCOA 1QL9A 4RKOB 2ZFTA 1YPMH 2FODA 4PROA 3RU4D 1PPFE 3F9HA 4TPIZ 1LPZB 1TE0A 2Y82A 3BEIB 3TJVA 1TLDA 2FTMA 1BJUA 3NK8A 3A8DA 3ZZ8A 4MPVA 1YYY1 1LQEA 3TGIE 3FVFB 4XDEA 2Y7ZA 2V3OH 3RM0H 1XXDA 1VITG 2D26C 1MBMA 3SZNA 1V2KT 3P70B 4YOJA 2Z9LA 3ATKA 2VGCC 1E38B 4D9QA 1MKXK 2OXSA 2ZPQA 3A7ZA 1TOMH 2Y5GA 4ABAA 1DY9A 3DT0H 1L1GA 1MTUA 2BQ6B 3SU1A 2GZ7A 4X2VA 3UQOA 1C5MD 1K2I1 1KYNA 1GI4A 4CR5A 3LKWA 4U01A 3KHVA 4UFGH 1J14A 3RXQA 3V3MA 4GLYA 4XBBA 1AWHB 1WBGB 1U6QA 1P10A 3M7UA 2C3SA 1WOFA 2GDEH 1ARBA 1TAWA 3URCA 1DLKB 4I8GA 1N6XA 4BXSA 1O2YA 1KLIH 4GVUA 2I6QA 3M7QA 1S81A 1O36A 7ESTE 1BCUH 4LK4A 2CF9H 2QV1A 5C1XA 1TMUH 4RSPA 1ZPZA 2G5VA 1DE7H 3Q00A 3RLYH 1D3TB 2Z3DA 4ABEA 5A8XA 2Y81A 1PPZA 3BTEE 5T6GA 6LPRA 3SU4A 4D9RA 1O2GH 2FM2A 3VB3A 4TWYA 2BHGA 3OY6U 1XKAC 5EODA 5L6NH 4H42U 4WMEA 4KTCA 1Z7KA 1FONA 2Y80A 1W0ZU 2B0FA 1HIAB 1CA0B 2HLCA 1NY22 2PKAB 3SBKA 4BOHA 4CRDA 1QQ4A 3IG6B 1C1TA 2FZZA 1RJXB 1LMWB 2G51A 2ZU4A 4B71A 4O97A 5ESBA 1C5UA 1HGTH 3GY3A 1P2JA 1NC6A 4NCYA 1BMLA 3UR6A 5HXFA 1EZSC 3HGPA 1FN8A 5LGOA 3H09A 2ZGHA 5AVDA 1IAUA 1AE8H 3SO3A 2GT7A 2H6MA 4A1VA 1GJCB 4Z0KA 3PV5A 1ELBA 5SGAE 1SHHB 3SV6A 2VWNA 4FXGH 4NA8A 3UOUA 1ZHPA 3ZV9A 3SV2H 1O3OA 3OSYA 4WXVA 1LHCH 4AG2A 2Y7XA 4B6EA 3E90B 5T3HA 1SVPA 1GBTA 5DG6A 1DPOA 3HGNA 1GBLA 2C93B 2QCYA 2FLBH 3P17H 3A85A 2CJIA 3TK9A 1C5VA 4NGAH 1V2OT 1H9LB 2GV7A 1EOLA 1FY1A 5EW2H 2UWOA 2OCVB 2C8WB 1CHGA 4UE7H 5GCHG 5LPRA 1NT1A 3LH1A 4H6SB 3MU1A 1SLVB 5JYIA 2WPHS 3SNCA 1GI0A 5FPYA 3ZVFA 1RRKA 1CGJE 1DWDH 4FVBA 2PFEA 1VGCC 2BLWA 1N6YA 1NU9A 2ZKSA 1O3PB 1UVTH 1HJ8A 3BEFB 3PLBA 4MNVA 3U1IB 5JBTA 1UTKA 1A4WH 1GWAA 3LC3A 4IN2A 2F91A 3BG8A 5FX6A 2WUBA 1GCTB 5GCHF 2AYWA 1O3AA 4MNXA 4A5TS 1YPEH 3LGUA 1S0RA 1IHTH 3MO6A 1V2JT 3MU0A 1Q31A 2VVUA 1O2TA 4IGDA 5DPAA 2ZDAH 2OP9A 4BAMB 1Y3YA 4Y7BA 2NU4E 3VEQB 2WYGA 3SQEE 3TLOA 1O3MA 2EI6A 1G3CA 1FXYA 4YLUA 1DICA 1CGIE 1TYNA 4ABJA 5E0GA 3BIUH 4B75A 4D8NA 1FJSA 1C2LA 4DT7B 4X8TH 1O2OA 5A0AE 3V12A 5TCCA 1KDQA 5FPTA 1YP9A 4O03A 3GY8A 1P2KA 1TNKA 1CT0E 2ZIQH 3LJOA 2B9LA 4B2BA 1VJ9U 2FXRA 1BTUA 2KAIA 2A2XH 2A4QA 1TQ0B 2ZI2H 3M35A 3K6YA 2IN2A 4MQAA 1FNIA 3A7VA 3DFJA 1A0LA 1HNEE 1NRQH 1YKTA 2VIOA 2VBCA 3EA7A 1AO5A 1GVKB 3ZVDA 3K9XB 2PSXA 1UHBA 2FOAA 3D49H 2ZPRA 3NWUA 8KME2 3ATIA 4LZ1H 1QA0A 1XUIA 3FANA 4K1EA 1T31A 1O34A 3UWJH 3LONA 3SNDA 4INLA 1D3DB 4NZLA 4A92A 1HXEH 1SGYE 5HM2A 3ODFA 2BB4A 2BYAX 3VB6A 3H7OA 3Q76A 1RGQA 2ZHDA 4FU7A 4I8HA 2HNTE 1ZSLA 1C2JA 2Z9JA 1E0FD 3Q3YA 4MPWA 3SJKA 2VINA 3TIUA 4Q7YA 3ZZDA 4YT7H 4ABIA 3PV2A 1T8NA 1C1SA 4A1TA 3KNXA 1M9UA 3MNCA 1C1MA 2ALVA 1ZZZA 4Y8XA 1OP8A 5F03A 3RU4T 2D2DA 1Y3WA 3PMJA 1IQMA 1O2QA 1QB1A 1W8BH 5H4IB 1GG6C 2WINI 4YTAA 2G5NA 3RXBA 2TGDA 3TH4H 1RS0A 1NS3A 4FU8A 2WHXA 2BDBA 2FS8A 1O2PA 3KGPA 1O5DH 1ZOMA 2QY0B 1DOJA 2J92A 3RMMH 1K1PA 3U69H 1LDTT 2BOHB 6GCHG 1GG6B 1ZGIA 1G2MA 1VGCB 2BDHA 4YOIA 3PO1B 3K2UA 4I31A 2J9NA 2I6SA 4JZ1A 1AB9C 1O5BB 2PTCE 4XOJA 1NU7B 1GHAG 3I29A 2BVRH 1AU8A 1AUJA 1RXPA 5DP7A 1C4Y2 4U32A 1TOCB 1J16A 2SNVA 2Q1JA 1SR5C 1G2LA 3RXOA 1MTNB 3M5OA 2BQ7B 2AIQA 4FUHA 1MKXH 1YPKH 2UUKB 2FI3E 1LTOA 4ZAEA 5PTPA 3A7YA 5CHAB 1T4UH 4A7IB 1JWTA 4KP0A 1LHDH 3AAUA 1JRTA 2STBE 1QNJA 1N8OB 1GI5A 4NZQA 2BY8X 4JZFH 2BD3A 1ZLRA 3F6UH 1FUJA 1OP0A 1OWIA 2WV4A 5GPIB 5JBAS 1L1NA 4ZKOU 3ZZ7A 3SU0A 5FHTA 5A09A 4INKA 1YPGH 2QC2A 4DGJA 1GBAA 5CE1A 2Z7FE 4X6OA 3SGQE 4XFQA 1AY6H 3AASA 4CBOA 2ZQ1A 2XBYA 2XW9A 3GCTF 1VCWA 3LT3A 1HAVA 1NTPA 1ZMLA 3RC4A 5T6DA 4MG3A 1C1NA 3WY8A 2JH0D 4IMZA 3RLWH 3C1KA 1PPHE 1BB0B 5FBEA 2GMTB 2A7JA 1TA2A 4CRBA 2ZU1A 1ZTJA 2OTVA 4ASHA 1IQHA 1Z1JA 1EPTA 1TGSZ 2GCHF 3D23A 1OWJA 3NCLA 1SSXA 2BDGA 1TMTH 2Q6DA 4I33A 5E2OA 3ZZ3A 4WH8A 4KTUA 2XBXA 1TNGA 3PWBA 2A0QB 2F9PA 1BMMH 2GMTC 1WTGH 1A0JA 3MH5A 4CHAC 1XUKA 1D3QB 1ELEE 3E0NB 1GJBB 3MHWU 1BRAA 1AVGH 3OU0A 1PYTC 2G00A 1TBZH 1MZDA 3P8OA 1OWKA 3O8BA 1ZHMA 5IYTA 1B0FA 2Z6BD 4UONA 1Y5UT 1GVZA 3GY2A 2NU3E 2ZDLA 3KN2A 1GHZA 1P01A 2GV6A 3UIRA 3MH4A 3STJA 5FCRA 1BQYA 3AAVA 1LPGB 1EOJA 1MU6B 1HYLA 1TALA 3QZRA 2R2WU 2PSYA 2H5DA 2XWAA 1LVMA 4NFFA 2J34A 3T5FH 3S9CA 1ESAA 4WMDA 2FLRH 1HBTH 4FUJA 1HAYB 1MUEB 1HJ9A 4CRAA 1C2EA 1GI8B 3M37A 1Y5BT 1LHGH 2YOLA 1ZYOA 2DUCA 4Q7XA 3O8RA 3SV8A 4OS4A 4IN1A 1TB6H 2A1DB 4OM9A 5GWZA 4K3JA 2SFAA 1ETSH 1CT4E 3GDVA 1YPHC 2ESTE 5L2ZH 4X1SU 1Y59T 3ESTA 4CH2B 2RA3A 3R0FA 1G30B 3ZZ6A 3RC5A 4ZXXH 4D76A 2G8TA 2HALA 1O2WA 3CENA 1Z6EA 2QN5T 3ZVEA 4NA9H 5L2YH 2C4FH 1GJ9B 2FS9A 1P11E 5CHAC 5E2PA 1HJAC 1O3CA 1KSNA 1TX7A 1AN1E 2ZDVH 3RC6A 4HI3A 1SPJA 2Z3CA 1Z71A 1J17T 2QAAA 1F0UA 4AFZA 1HXFH 2BD4A 6GCHF 4Y8ZA 1P9UA 1MMJN 3TNSA 1LCYA 1C5LH 3O8DA 4X8SH 2WPKS 2BXUH 1V2VT 3CP7A 3IITA 1FY4A 4JZIA 1GCDA 2XCFA 1HFDA 3RXMA 4Y76A 4JMYA 4ZH8A 2R0LA 3TH2H 3R3GB 1ANEA 3SGBE 3TPIZ 3D65E 1K1IA 2J95A 3MU4A 1F5RA 3GY6A 1MAYA 1PQ8A 1KTSB 1PPBH 2QGRA 2XC4A 3A87A 5HGGA 4JYVH 3ATLA 1NFUA 4FUCA 3RMOH 3VGCB 5EPYA 5K7RA 4WWYA 2A7HA 2SNWA 1GBEA 4ZUHA 1ZPCA 2VIPA 2W5EA 1BMNH 1GPZA 4NSVA 3STIA 1DVAH 4UFFH 1GDQA 4UD9H 1ZPBA 3BTGE 1O37A 1O3JA 2Q6FA 1W7GH 2WPIS 5JDUB 1K28D 1WUNH 1HAIH 4Y71A 1YC0A 5EG4A 2P16A 2OUAA 2A4RA 1FPHH 2H5CA 2ODYB 2VGCB 2ZFFH 1QRXA 1QURH 1YLDA 5EPNA 1FY3A 3FFGA 2VWLA 1FZZA 1C5QA 1YBWA 6ESTA 1LKAA 2PGQB 3BTFE 1NRNH 4AFQA 5AFZH 1TONA 2ZU2A 1C5RA 4GUXA 2AERH 3RXRA 1NRPH 1WV7H 1GJ6A 2VH0A 1W3CA 3T28A 8ESTE 4RI0A 1EKBB 4LOYH 1C9PA 1OS8A 1LHFH 2ILNA 3UFAA 1OYQA 1CBWB 2FX4A 1BT7A 4X8VH 3OTJE 2HPQH 5F8TA 4ZHMU 5JBCS 4BTUB 1O2UA 1KY9A 1XVMA 1GJDB 5A8ZA 1RFNA 1KXEA 1NRRH 3VB7A 1DLEA 1FN6A 3ZZ4A 4X1RU 3SUFA 1KDQB 2D8WA 4ABBA 3LPRA 1VCQA 1QRZA 2F9OA 2GKVE 3TJOA 1MQ5A 1W0YH 4Z6AH 1GI9B 1CE5A 4K1SA 2G81E 3P92A 4K60A 4IBLH 1H9HE 1A7SA 1W11U 1SQTA 3T26A 1BJVA 2XRCA 5EOKA 2OQUA 2M5TA 2O8WA 4YLQH 4HTCH 1YLCA 1GMDG 4X2YA 1S82A 1T8LA 3BG4C 4YZUA 3A86A 2RCEA 1GMCF 1NRSH 8GCHF 1V3XA 1UVSH 2A5KA 1C1QA 2TBSA 2P95A 1GHBG 3GCNA 3MWIU 5LPEA 4K8BA 1KTTB 2STAE 3F9GA 2ZFPH 1VCPA 2XBVA 1E36B 2SGPE 3JZ2B 1WQSA 1S5SA 1HAXB 2WPJS 1Z1IA 1MH0A 1C5SA 4D7FA 4KELA 1O5AB 1G3EA 2A5IA 1SG8B 4YOGA 2A4OA 2P3TB 4OS2A 3E1XB 1GBJA 4JK5A 2P8OC 4FUIA 5T6FA 5DP8A 1FAXA 1LKBA 2H9EH 1EASA 1DY8A 1GGDB 2VVCA 1ELFA 1BTZA 2PUQH 1O30A 3GOVB 1BBRH 3TNTA 1G37A 2ZF0H 4NIXA 2ANYA 1IQEA 2ZP0H 3RXAA 1HV7A 5FAHA 2HNTC 2O8LA 2A7CA 1NZQH 3SQHE 3L6PA 1C2HA 1XX9A 1SBWA 2AIPA 1CO7E 1P12E 4AYVB 1LHEH 2VWOA 4UFDH 1O2IA 2PKSC 4JYTA 5GIBA 1HAVB 4B2AA 3BTME 1K21H 1O3EA 4KTSA 4X1PU 1JMOH 3KQBA 3BF6H 3LGVA 1DXPA 1W13U 3EE0B 1SGFA 4AOQA 4TY6A 3SJ8A 1ZJDA 2F9BH 3F1SB 1QR3E 4FU9A 3LJJA 1TGTA 1FDPA 4O3UA 4SGAE 3VPKA 5A0BA 1E34B 1O2LA 1TPSA 1O3HA 7KMEH 2G52A 3UNSA 5EQSA 5AF9H 2AMQA 3HPTB 4DJZB 1EP5A 2PKAA 4ISIH 3MU8A 2HNTF 3RM2H 1C1UH 1HAZB 5EW1H 1A61H 1D6WA 3SYJA 3A84A 1EZQA 1FY5A 3O8CA 3M5MA 3SNBA 3RXSA 1RTFB 3AK5A 1TNJA 2HVXA 2W3KA 1VITH 4DCDA 2BLVA 4AG1A 4XE4A 1FLEE 5EXLA 2FWWA 9LPRA 2Z94A 1C4U2 1J9CH 4JCNA 3ZZAA 3PM3A 2ZDKA 2P59A 4NWKA 2UUJB 1Y5AT 2FIRH 4I8KA 1TPPA 7GCHF 1AD8H 5AFYH 3LH3A 3BTWE 5FPSA 3W95A 1GJ7B 4X8UH 1KXDA 1EB1H 1KIGH 1LO6A 4ZROA 3SU2A 1F0RA 2JETB 3IWMA 3VB5A 1GBIA 3A7WA 3GY7A 1MTSA 1OWEA 1GL0E 3A7XA 4GCHG 3MNBA 1JOUB 2PLXA 2UUFB 3LU9B 3KQEA 1MCTA 4MTBA 3NUMA 3ZZ5A 4X1QU 1QTFA 3P6ZB 2ODQA 1ETTH 1RIWB 2A31A 1EZUC 6CHAB 8LPRA 3TITA 3ELAH 2BY5X 4I8JA 3M5LA 1UTLM 3RXVA 1V2UT 2FOFA 1V2QT 3TK5A 2FO9A 2XYAA 1DSUA 1MBQA 1VITF 3A7TA 4K69A 2CF8H 2C90B 1H8IH 3ZZ9A 1C2FA 1VR1H 2ZPSA 3RUOA 2ANMH 3RDZA 2XXLA 4YT6H 1DXWA 1A5IA 3SV7A 2TGTA 4AFUA 1F2SE 2ZGBH 3OYPA 1A0HB 9ESTA 4J2YB 4A6LA 5K0HA 1W10U 4JYUH 1F5KU 1KLTA 1S84A 3T2NA 1K1OA 3TJNA 3V13A 4CREA 2FESH 3RXGA 1GGDC 2OQ5A 2SGAA 3H7TA 1O33A 2CV3A 2SGDE 3SI4H 1WSSH 1ZMNA 3SUEA 5FX5A 2P3UB 2F3CE 1P2MA 3PLPA 1ESTA 1XUHA 1C1OA 2BD2A 2Q6GA 2ZCLP 3KEEA 1YM0A 1ZJKA 1P3EA 5LPFA 1YCPM 3EQ0H 1A3EH 4FUEA 4IW4E 3GDSA 1IOEA 1BIOA 1O3LA 2FEQH 1D3PB 2JH6D 5F8XA 1PYTD 3E16B 1N1LA 1P8VC 1O2ZA 1YF4A 3RXTA 3MI4A 4ESTE 3ATMA 1F0TA 2AGIX 4CRFA 3E6PH 2AGGX 1P0SH 3PMAB 3BSQA 3UTUH 3EA8A 1GBKA 3BTKE 1O2NA 1AZ8A 1EB2A 1OP2A 4RN6A 2Z9GA 1SB1H 1GHAF 1J15A 2DE8A 2ZC9H 3UNQA 2G4TA 1H4WA 4FUDA 5I25A 5C2ZA 2F4LA 3ZYDA 5F6MA 2AH4X 5E8EH 3T29A 1MKWH 4IC5A 1XUGA 4BAOB 3SHAH 1GI1A 1QB6A 4B73A 1F0SA 1GCTC 1O5FH 1CVWH 1Z8JB 2ULLA 4ABDA
chains in the Genus database with same CATH superfamily
1XUFA 4I7YH 1F7ZA 3ZV8A 4A1XA 4YXWD 2NU1E 1H1BA 2RDLA 1H8ED 5C5NA 4Y6DA 1BHXB 3SV9A 1Y8TA 2BD5A 1SLXB 1UTQA 1XXFA 4HZHA 1S6HA 1AFQC 2R0KA 2OK5A 3SHCH 1SL3A 3HKIB 1P09A 2J38A 1AI8H 1FIWA 3EA9A 1B0EA 5HIZA 1AIXH 1GBDA 2FX6A 2J97A 1UCYE 3E0PB 3MH6A 1P04A 4VGCB 1C5ZB 1MABB 4HGCA 3LGYA 4BTTB 2KM0A 1BMAA 1MKWK 3BTTE 2Y5FA 1RD3B 3FP6E 1DWBH 1RTLA 2AEIH 4DVAU 4TWWA 4UEHH 1EPTB 2R3UA 2CXVA 1O3KA 1T32A 2ZCHP 2OC8A 2FYQA 2FYRA 1C1VH 2PUXB 2BOKA 1EAIA 2OINA 2O8MA 1BTHH 1QQUA 1Y3VA 2THFB 1QCPA 2ZNKH 1GMCG 3KF2A 8GCHG 4DURA 2OLGA 2GCTC 1XUJA 1GBBA 4B74A 4Q7ZA 2AFQB 2EA3A 1BTXA 1K0HA 1CU1A 1V2PT 4K8YA 1ACBE 4MPXA 1FIZA 1UO6A 3ATWA 1NN6A 3ZVAA 1O2JA 2W26A 3WWBA 1EATA 4NA7A 1A3BH 1BHXF 1NFWA 4BAKB 1CHOF 1AKSA 2WZQA 5GDSH 5IDKA 2G4UA 1NBMD 1Y3XA 1ETRH 4JZDH 1WYKA 1UCYK 1PJPA 2PGBB 2HGTH 1KXAA 5J4QA 3SU5A 2EI7A 1C1RA 2ANWA 2XNIA 5GXPA 2JIZD 1CBWC 7LPRA 1Z8GA 1SKYE 4BXWA 2WPLS 1FPCH 3CS7A 1LPKB 1MTWA 1K1JA 2PTNA 1ORFA 3A82A 1GI3A 3M5NA 4QT8C 1EP6A 4Q2KA 3MO9A 3NPSA 2PW8H 1BBRK 1ZSKA 4ISOA 4UDWH 1AVWA 3K65B 2B7DH 2QF0A 1SGTA 5FBIA 1QFKH 1SGIB 1W7XH 2HRVA 3PRDA 4FUFA 1ANCA 3BTQE 2WV9A 2A2QH 2XOKD 1D4PB 1O3DA 1L4ZA 3SU6A 1AB9B 4ZKNU 3HK6B 3LGTA 2AMPA 1OPHB 1AHTH 1ELCA 5ETXA 4AB8A 1L4DA 3LGIA 1DANH 1UK4A 3QDZB 2BDYA 2VIDA 1UTOA 3UR9A 1UMAH 1BRCE 2ZTYA 2TGAA 1SI5H 1DWEH 1AKSB 1O3FA 2BVXH 2CHAC 2V6NA 2ZU5A 3SZEA 1PPGE 3SUGA 2WPMS 5DN6D 3NXPA 3JZ1B 1SFQB 4KGAA 1JBUH 3M7TA 4Y11E 1QGFA 1N8OC 2BZAA 2GX4A 3PROA 2ANKH 2ZFRH 4M9FA 1QL8A 1YCPK 1C2KA 1TRNA 5DGJA 1QJ1B 2ZHQH 2FOCA 1CGHA 4AGJA 1DITH 2CHAB 3RXKA 1NBME 1GHWH 3SGAE 1T7CA 5A8YA 2GZ9A 3ZYEA 3TJUA 2VIWA 3I77A 1AZZA 1V6DA 2FOBA 1O39A 5C17A 4DOQA 1PQ7A 1UTMA 1YPJH 2GT8A 2IJOB 3QO6A 4IS5A 3RMLH 1GHYH 3BTHE 3B9FH 2XC5A 3M61U 3ZZCA 2HVYB 4FUGA 1DFPA 3N7OA 5FCKA 3A8CA 1HUTH 3MMGA 1QBNA 3M3TA 1MAXA 3MOCA 5TCAA 4P00A 1ARCA 2VVVA 4XBCA 4B2CA 1CA8B 1W12U 4KKDA 1O3IA 1EAXA 3GCHB 2ZTZA 4MDSA 3MFJA 4TY7A 2GP9B 1FV9A 3PTNA 4GAWA 3FAOA 1YPHE 1HAPH 2WUCA 3V0XA 5HYOA 1Z8IB 1GVLA 2ZDMA 3AW1A 4X1NU 4TPYA 1V2RT 3HK3B 3KQDA 2P3FH 3LIWA 2EI8A 5DP6A 3QLPH 2LNCA 2AS9A 3F0OA 4DT4A 1O3BA 1TNHA 3GY5A 1ELAA 1MD7A 1GDNA 2QF3A 2ZQ2A 4P02A 2BDIA 3EAJA 2R2MB 4ISLA 2GTBA 4WF8A 2CN0H 3SJOA 3U1JB 2K8IA 3EGKH 1O2HA 1OSSA 4OS6A 4AX9H 1ZSJA 2FI4E 1QZ8A 2QXIA 1QY6A 3U9AH 2F9UA 3AVZA 1AMHA 1O38A 1GL1A 3AW0A 3TK6A 4WH6A 3MO3A 4INHA 3K6ZA 1GJ4H 3SUDA 1QBVH 3S0NA 4XBDA 2TRMA 1L0ZA 2Y6TA 1C5XB 5FXLA 2XTTB 3T62A 4Z1MD 4DIHH 1QIXB 1S85A 1P05A 1O2SA 1TNIA 4E7RG 2H1UA 3FZDA 5A0CA 3VXFH 3SJ9A 1BTYA 1D6RA 2J98B 2BDAA 1MCVA 2YMSC 2RDEA 2BM2A 2P8OB 3T25A 3S69A 4NIVA 1BBRE 2BX4A 1C5NH 1P03A 3MQKC 1COWD 3E91A 2RG3A 1ZTKA 3UREA 3OAAD 2PV9B 1XVOA 1Z8RA 5HIYA 1P57B 2J94A 3A89A 1UVOA 5E0JA 3BG4B 4NG9H 1HCGA 3H5CB 3FZZA 2R9PA 2A4GA 2QXJA 1O2VA 3TU7H 4WVPE 5DP4A 3G01A 4OGXA 1G36A 4ISHH 1ANDA 4D7GA 3P95A 2GZ8A 1D9IA 1C2MA 2TIOA 3Q77A 1UTPA 3PV4A 2ZDNA 1V2NT 4Q80A 2ZHFH 5CDFE 1P9SA 5EJ1A 1V2LT 1UTNA 4GPGA 2HWLB 2PKSB 3F0PA 5EQRA 5C20A 2DE9A 1ESBA 2BZ6H 3URDA 1IQKA 1C1PA 3E3TA 3VB4A 4U30A 3A81A 2KCOA 2XCNA 4F49A 2XC0A 1HIAA 3U8RH 1V2ST 3ODDA 3ZVBA 1UCYH 5BPEA 5E0HA 3SOSA 1UJ1A 3ZVCA 1LVOA 4HFPB 1HB0B 1UVUH 5GJ4B 3M36A 5DK1A 2ZGXH 3ZZBA 5DO4H 1ANBA 1AVXA 4CH8B 3S7HB 4WMFA 3U28C 3GDUA 4K5ZA 4CRGA 5DP9A 1AQ7A 1O3NA 3A8BA 4LZ4B 5GNDA 1A5HA 4B6FA 5C3NA 1ELTA 4DIIH 4ZHAA 3U8OH 1SLWB 1EAWA 1UHBB 2HOBA 2J4IA 4Q4LA 1FI8A 1G32B 1UW7A 1INCA 3RXFA 3DFLA 1GBHA 1TGNA 1ELGA 1SFIA 5DP3A 1OXGA 4R8TB 3GYLB 5J4SA 1O35A 3VXEH 2ZA5A 1C1WH 1FX0B 5ABWA 1SGCA 3SU3A 2NU0E 4UFEH 2B5TB 2KAIB 5TJXA 1GBFA 2H9TH 3MU5A 1JIMA 4MNYA 3RU4E 1C9TA 2IJD1 3ITIA 1IQJA 1VKYA 4MPUA 4JZEH 2VNTA 1YGCH 1V2MT 2GCHG 4X2WA 1P2IA 4AORA 3GICB 4Y79A 1GHXH 1FQ3A 4M7GA 2FOHA 4YO9A 1O0DH 3SJIA 1GMHG 4X2XA 2PHBA 1SQAA 2K0QA 4MLFB 5LH8A 1TIOA 5G4BA 4DW2U 6CHAC 1X7AC 4K1TA 1AWFH 1P3CA 1QA7A 1ZMJA 4RKJB 5C0UA 4OGYA 3RXUA 1ABJH 1BRUP 1NFXA 2Z9IA 1O5CB 2F43B 4VGCC 3B8JA 4X0WU 3SI3H 3L3TA 3NRLA 2JETC 1EX3A 1GJ8B 4MVNA 4K2YA 3LGWA 1B7XB 1TNLA 1DUAA 1GBCA 1CHOG 2FI5E 5EXNA 1KXFA 3CS0A 1FAKH 2TGPZ 4SGBE 2ODPA 1K1NA 2ZGCA 2UUYA 3UNRA 1QL7A 2BVSH 3D62A 1S83A 2OC1A 2W6ID 2LPRA 4WXIA 2FDAA 1HLTH 3QZQA 2IPHA 1VZQH 2D1JA 2H2ZA 2RA0A 1SOZA 1NPMA 1PFXC 2OD3B 5JB8S 2UWPA 1DS2E 2JKHA 1MQ6A 1BTPA 1WCZA 3HKJB 3KCGH 3UUZA 1O2XA 3QX5H 2PWXA 5HMAA 2VIQA 1RTKA 3BEUA 1HPGA 2GVFA 4ACAA 2SGQE 4E7NA 2QA9E 1PQAA 2BY9X 4BANB 1A5GH 3L33A 5DJ7A 5T1VA 3DHKH 2ZGJA 3LDXH 1GMHF 4B76A 1C4V2 1SGEE 1SOTA 1TPAE 3MTYA 2C8ZB 1P06A 4O9VA 3QGNB 3RXHA 1TABE 3DD2H 1MD8A 2F83A 1SHYA 1DWCH 3PMHB 2BQWB 3A8AA 1CQQA 1TMBH 2B8OH 4H6TA 1NM6A 1GDUA 2FMJA 1BUIA 2CMYA 4GHQA 4I8LA 2H9HA 1T8OA 3TGJE 1QJ6B 1E37B 2G55A 1EJAA 4BAQB 1DSTA 4Y0YE 4BNRA 1IQLA 1GI2A 4I86A 2ZZUH 2K1QA 5EJZA 2PR3A 4ZXYH 4NFEA 3PMBB 4ABFA 1MZAA 2BXTH 2P93A 2ZFSA 4DG4A 1GI6A 1JXPA 1TBQH 1UK3A 3EE7A 5C1UA 4YESB 1S6FA 3GCTG 4F48B 1WXRA 3UAIC 1L2EA 2ZO3H 1GJ5H 1K1MA 3P8NA 3M3SA 5B6OA 1EJNA 5JBBS 3Q3XA 1K9OE 1O31A 4LXBH 4ZKRU 4BTIB 5C67A 4CBNA 2ASUB 2QE7D 1DX5M 3OX7U 2BD8A 2ZWLH 5EQQA 1NROH 3U98H 1OOKB 2V3HH 2NWNA 1QJ7B 2BY7X 2C8YB 1MTVA 1ZGVA 1K1LA 1TX8A 4B1TA 2QXHA 3ZVGA 3T27A 1C2IA 4AFSA 1O2RA 5CMXH 4X6PA 1TRMA 3U8TH 3PLKA 1O2MA 2WYJA 1E35B 1HAGE 1ZRBA 2A5AA 2Z3EA 1YPLH 1BRBE 1O2KA 4OS7A 3DSGA 2GCTB 4ABGA 1RIWC 4X6MA 5DP5A 5EIYA 1SGQE 1EPTC 3PTBA 1OYTH 1UTJA 4WJG2 1ZR0A 4AZ2B 2FOMB 1EXFA 1G3DA 1WAYB 3W94A 1O32A 4ZMAH 3EYDA 1EJMA 3SN8A 1C5YB 2J2UA 4TYDA 1ZRKA 1BTWA 2EEKA 3F9FA 5EU8A 2XWBI 1IQFA 4OS1A 3RXEA 3TGKE 3MYWA 1VJAU 4Y0ZE 1O5GH 3TVJB 4CR9A 4H4FA 3CNRA 1TWXB 2Z9KA 3UPEA 2IOTA 2XBWA 3Q3KA 3RXLA 3VFEA 1HRTH 2VIVA 5EXMA 1QBOA 1BITA 1Y3UA 2GDDA 1UK2A 3E8LA 3SW2B 4AYYB 1TRYA 3VG8A 4GSOA 1LQDB 2ALPA 4ZKSU 2QF4A 1SQOA 1BOQA 3KQ5A 1Q2WA 2C8XB 1THPB 4JK6A 1B5GH 1S0QA 2O8TA 3QTOH 4U2WA 2FTLE 1ID5H 1W2KH 1TPOA 2JH5D 1MTNC 2BTCE 1AFEH 2GD4B 4GCHF 3S9AA 1C5WB 1S6LA 1BZXE 2ZFQH 5ESTE 3A80A 1T8MA 3BN9A 2F9NA 4J1YA 3PB1E 3RXIA 2OC7A 1KXCA 2YNAA 2NU2E 4AGKA 3DUXH 3MNXA 1EZXC 3PO1C 2F9VA 2BY6X 5KGOA 1GBMA 1SGDE 2BDCA 2SGFE 1LVBA 4Y7AA 4BAHB 2FP7B 3LOXA 3LC5A 1W14U 3F2FA 1SMFE 5HM9A 2SGEE 2WV5A 1C5TA 1L1JA 5JPMH 1GHVH 1G9IE 1EUFA 2HPPH 2QYIA 5CHBA 4YM9A 2GGVB 3HATH 3F9EA 4I32A 1V2WT 2BX3A 2AMDA 2RFKC 2VJ1A 2KZ4A 1O3GA 4GHTA 2QXGA 1OWHA 1TQ7B 2BD9A 2VB0A 4F4OC 3QWCH 1TFXA 1H9IE 2Y5HA 1HAOH 2OBQA 3QGJA 1K22H 1SGFG 1XMNB 3ENSB 3RXPA 2FOEA 3VGCC 2A32A 1XM1A 2BLOA 4FUBA 2ZEBA 3QUMP 1QB9A 2R3YA 5A2MH 3RMNH 4CRCA 1IQIA 2BLQA 4NWLA 4NIYA 2YNBA 1NESE 1AE5A 1J8AA 2W7SA 1OHHD 2P94A 3BTDE 1P2OA 1P2NA 3M3VA 3QTVH 2VWMA 3V7TA 1SLUB 4DY7B 1AFQB 3UWIA 2ZECA 3SNAA 4CHAB 1YCPH 3GYMA 1SGPE 2W3IA 2VU8E 5BRRE 1P02A 3PYHA 2CGAA 1TX6A 1GJAB 7GCHG 5L30H 2W7UA 5F8ZA 4WY3A 1Z6JH 2FPZA 1C5PA 1TA6A 4O3TA 1QRWA 1YWUA 1DM4B 1WTHD 4IC6A 3BV9B 3S7KB 1UVPA 1TGCA 1F92A 1FMGA 1JRSA 1EQ9A 1WU1A 3RXJA 4Y8YA 2ZCKP 3KL6A 4FVDA 1O5EH 2QIQA 1BDAA 1F5LA 3QN7A 1G3BA 2ZTXA 4OS5A 3OTPA 1HAHH 4R0IA 1DUEA 2V35A 2BMGB 1XKBC 3OY5U 2VH6A 1GHBF 4X6NA 1EFRD 1AGJA 3EDXB 5AHGH 3TH3H 5FL7D 1A46H 3BIVH 3ZIAD 3GCHC 4NSYA 3A83A 1E79D 1DT2A 3UOPA 1OKXA 1THRH 3DA9B 1IHSH 2O9QA 5I46H 2A45B 1LVYA 4E05H 1PPEE 1IQNA 5C5OA 3A88A 1CT2E 1KLJH 1P2QA 2ZG0H 1OX1A 3FP8E 4Q63A 1H8DH 4AN7A 1ELDE 3RXDA 1SC8U 1CSOE 3P8FA 3QK1A 1ZTLA 2TPIZ 1FY8E 1PQ5A 4IMQA 4XSKU 1NO9H 1NFYA 4NIWA 2BD7A 1GI7B 1HDTH 4Y10E 1WQVH 5C1YA 1AUTC 3UB0A 1V2TT 4ZHLU 3DSOA 3F68H 1SGNE 1Q3XA 5B6LA 3NKKA 4AB9A 1A1RA 1OWDA 3B23B 2ZHWH 1A2CH 3RXCA 2UWLA 1CA0C 2V0BA 1QHRB 1MU8B 2FOGA 1SGRE 1PPCE 4ZCNA 3I78A 2ZU3A 2AGEX 5DKMA 3GY4A 4ISNA 1HJAB 5JB9S 2EC9H 3UY9A 1TBRH 3S9BA 2OBOA 1DDJA 1GMDF 2L74A 4E06H 5EGMA 1IQGA 2KFWA 1E1RD 1C2GA 3KQCA 2O8UA 4MNWA 3SNEA 1BA8B 3NZIA 1EAUA 3KIDU 3FN8A 1ELVA 2OC0A 1JIRA 3MNSA 3SORA 3RP2A 1THSH 3P8GA 1ABIH 4THNH 1ZHRA 3FP7E 2ZHEH 5HKKD 3UQVA 1C5OH 1C2DA 3GISB 4ABHA 3MH7A 1T4VH 3PWCA 1TGBA 1KXBA 3C27B 3GCOA 1QL9A 4RKOB 2ZFTA 1YPMH 2FODA 4PROA 3RU4D 1PPFE 3F9HA 2HLDD 4TPIZ 1LPZB 1TE0A 2Y82A 3BEIB 3TJVA 1TLDA 2FTMA 1BJUA 3NK8A 3A8DA 3ZZ8A 4MPVA 1YYY1 1LQEA 3TGIE 3FVFB 4XDEA 2Y7ZA 2V3OH 3RM0H 1XXDA 1VITG 2D26C 1MBMA 3SZNA 1V2KT 3P70B 4YOJA 2Z9LA 3ATKA 2VGCC 1E38B 4D9QA 1MKXK 2OXSA 2ZPQA 3A7ZA 3OEED 1TOMH 2Y5GA 4ABAA 1DY9A 3DT0H 1L1GA 1MTUA 2BQ6B 3SU1A 2GZ7A 4X2VA 3UQOA 1C5MD 1K2I1 1KYNA 1GI4A 4CR5A 3LKWA 4U01A 3KHVA 4UFGH 1J14A 3RXQA 3V3MA 4GLYA 4XBBA 1AWHB 1WBGB 1U6QA 1P10A 3M7UA 2C3SA 1WOFA 2GDEH 1ARBA 1TAWA 3URCA 1DLKB 4I8GA 1N6XA 4BXSA 1O2YA 1KLIH 4GVUA 1BMFD 3F2HA 2I6QA 3M7QA 1S81A 1O36A 7ESTE 1BCUH 4LK4A 4AC9A 2CF9H 2QV1A 5C1XA 1TMUH 4RSPA 1ZPZA 4XD7D 2G5VA 1DE7H 3Q00A 3RLYH 1D3TB 2Z3DA 4ABEA 5F53A 5A8XA 2Y81A 1PPZA 3BTEE 3DSPA 5T6GA 4XRNA 6LPRA 3SU4A 4D9RA 1O2GH 2FM2A 3VB3A 4TWYA 2BHGA 3OY6U 1XKAC 5EODA 5L6NH 4H42U 4WMEA 4KTCA 1Z7KA 1FONA 5C94A 2KX4A 2Y80A 1W0ZU 2B0FA 1HIAB 1CA0B 2HLCA 1NY22 2PKAB 3SBKA 3WWFA 4BOHA 4FETA 4CRDA 1QQ4A 3IG6B 1C1TA 2FZZA 1RJXB 1LMWB 2G51A 2ZU4A 4B71A 4O97A 5ESBA 1C5UA 1HGTH 3GY3A 1P2JA 1NC6A 4NCYA 1BMLA 3UR6A 5HXFA 1EZSC 3HGPA 1FN8A 3H09A 5LGOA 2ZGHA 5AVDA 1IAUA 1AE8H 3SO3A 2GT7A 2H6MA 4A1VA 1GJCB 4Z0KA 3PV5A 1ELBA 5SGAE 1SHHB 3SV6A 2VWNA 4FXGH 3N7EA 4NA8A 3UOUA 1ZHPA 2GJGA 3ZV9A 3SV2H 1O3OA 3OSYA 4WXVA 1LHCH 4AG2A 2Y7XA 4B6EA 3E90B 5T3HA 1SVPA 1GBTA 5DG6A 1DPOA 3HGNA 1GBLA 2C93B 2QCYA 2FLBH 3P17H 3A85A 2CJIA 3TK9A 1C5VA 4NGAH 1V2OT 1H9LB 2GV7A 1EOLA 1FY1A 5EW2H 2UWOA 2OCVB 2C8WB 1CHGA 4UE7H 5GCHG 5LPRA 1NT1A 3LH1A 4H6SB 3MU1A 1SLVB 5JYIA 2WPHS 3SNCA 1GI0A 5FPYA 3ZVFA 1RRKA 1CGJE 1DWDH 4FVBA 2PFEA 1VGCC 2BLWA 1N6YA 1NU9A 2ZKSA 1O3PB 1UVTH 1HJ8A 3BEFB 3PLBA 4MNVA 3U1IB 5JBTA 1UTKA 4HG6A 1A4WH 3KYGA 1GWAA 3LC3A 4IN2A 5IK2D 2F91A 3BG8A 5FX6A 2WUBA 1GCTB 5GCHF 2AYWA 1O3AA 4MNXA 4A5TS 1YPEH 3LGUA 1S0RA 1IHTH 3MO6A 1V2JT 3MU0A 4ASUD 1Q31A 2VVUA 1O2TA 4IGDA 5DPAA 2ZDAH 2OP9A 4BAMB 2V3MA 1Y3YA 2IPQX 2NU4E 4Y7BA 3VEQB 2WYGA 3SQEE 3TLOA 1O3MA 2EI6A 1G3CA 1FXYA 4YLUA 1DICA 1CGIE 1TYNA 3FOAA 4ABJA 5E0GA 3BIUH 4B75A 4D8NA 1FJSA 1C2LA 4DT7B 4X8TH 1O2OA 5A0AE 3V12A 5TCCA 1KDQA 5FPTA 1YP9A 4O03A 3GY8A 1P2KA 1TNKA 5KECA 1CT0E 2ZIQH 3LJOA 2B9LA 4B2BA 1VJ9U 2FXRA 2J98A 1BTUA 2KAIA 2A2XH 2A4QA 1TQ0B 2ZI2H 4RT1A 3M35A 3K6YA 2IN2A 4MQAA 1FNIA 3A7VA 3DFJA 1A0LA 1HNEE 2V7QD 1NRQH 1YKTA 2VIOA 2VBCA 3EA7A 1AO5A 1GVKB 3ZVDA 3K9XB 2PSXA 1UHBA 2FOAA 3D49H 2ZPRA 3NWUA 8KME2 3ATIA 4LZ1H 1QA0A 1XUIA 3FANA 4K1EA 1T31A 1O34A 2YMSD 3UWJH 3LONA 3SNDA 4INLA 1D3DB 4NZLA 4A92A 1HXEH 5KEDA 1SGYE 5HM2A 3ODFA 2BB4A 2BYAX 3VB6A 3H7OA 3Q76A 3WW7A 1RGQA 2ZHDA 4FU7A 4I8HA 2HNTE 1ZSLA 1C2JA 2Z9JA 1E0FD 3Q3YA 4MPWA 3SJKA 2VINA 3TIUA 4Q7YA 3ZZDA 4YT7H 4ABIA 3PV2A 1T8NA 1C1SA 4A1TA 3KNXA 1M9UA 3MNCA 1C1MA 2ALVA 1ZZZA 4Y8XA 1OP8A 5F03A 3RU4T 2D2DA 1Y3WA 3PMJA 1IQMA 1O2QA 1QB1A 1W8BH 5H4IB 1GG6C 2WINI 4YTAA 2JJ2D 2G5NA 3RXBA 2TGDA 3TH4H 1RS0A 1NS3A 2WHXA 4FU8A 5EJLA 2BDBA 2FS8A 1O2PA 3KGPA 1O5DH 1ZOMA 2QY0B 1DOJA 2J92A 3RMMH 1K1PA 1YY3A 3U69H 1LDTT 2BOHB 6GCHG 1GG6B 1ZGIA 1G2MA 1VGCB 2BDHA 4YOIA 3PO1B 3K2UA 4I31A 2J9NA 2I6SA 4JZ1A 1AB9C 1O5BB 2PTCE 4XOJA 1NU7B 1GHAG 2QF5A 3I29A 2BVRH 1AU8A 3OFND 1AUJA 1RXPA 5DP7A 1C4Y2 4U32A 1TOCB 1J16A 2SNVA 2Q1JA 1SR5C 1G2LA 3RXOA 1MTNB 3M5OA 2BQ7B 2AIQA 4FUHA 1MKXH 1YPKH 2UUKB 2FI3E 1LTOA 4ZAEA 5PTPA 3A7YA 5CHAB 1T4UH 4A7IB 1JWTA 4KP0A 1LHDH 3AAUA 1JRTA 2STBE 1QNJA 1N8OB 1GI5A 4NZQA 2BY8X 4JZFH 2BD3A 1ZLRA 3F6UH 1FUJA 1OP0A 1OWIA 2WV4A 5GPIB 5JBAS 1L1NA 3OE7D 4ZKOU 3ZZ7A 3SU0A 5FHTA 5A09A 4INKA 1YPGH 2QC2A 4DGJA 1GBAA 5CE1A 2Z7FE 4X6OA 3SGQE 4XFQA 1AY6H 3AASA 4CBOA 2ZQ1A 2XBYA 2XW9A 3GCTF 1VCWA 2PP6A 3LT3A 1HAVA 1NTPA 1ZMLA 3RC4A 1H8HD 5T6DA 4MG3A 1C1NA 3WY8A 2JH0D 4IMZA 3RLWH 3C1KA 1PPHE 1BB0B 5FBEA 2GMTB 2A7JA 1TA2A 4CRBA 2ZU1A 1ZTJA 2OTVA 4ASHA 1IQHA 1Z1JA 1EPTA 1TGSZ 2GCHF 2XNDD 3D23A 1OWJA 3NCLA 1SSXA 2BDGA 1TMTH 2Q6DA 4I33A 5E2OA 3ZZ3A 4WH8A 4KTUA 2XBXA 1TNGA 3PWBA 5C0TA 2A0QB 2F9PA 1BMMH 2GMTC 1WTGH 1A0JA 3MH5A 4CHAC 1XUKA 1D3QB 1ELEE 3E0NB 1GJBB 3MHWU 1BRAA 1AVGH 3OU0A 1PYTC 2G00A 1TBZH 1MZDA 3P8OA 1YLNA 1OWKA 3O8BA 1ZHMA 5IYTA 2KR7A 1B0FA 2Z6BD 2LELA 4UONA 1Y5UT 1GVZA 3GY2A 2JJ1D 2NU3E 2ZDLA 3KN2A 1GHZA 1P01A 2GV6A 3UIRA 3MH4A 3STJA 5FCRA 1BQYA 3AAVA 1LPGB 1EOJA 1MU6B 1HYLA 1TALA 3QZRA 1SQRA 2R2WU 2EY4C 2PSYA 2H5DA 2XWAA 1LVMA 4NFFA 2J34A 3T5FH 3S9CA 2WSSD 1ESAA 4WMDA 2FLRH 1HBTH 4FUJA 1HAYB 1MUEB 1HJ9A 4CRAA 1C2EA 1GI8B 3M37A 1Y5BT 1LHGH 2YOLA 1ZYOA 2DUCA 4Q7XA 3O8RA 2J5UA 4TT3D 3SV8A 4OS4A 4IN1A 1TB6H 2A1DB 4OM9A 2LP6A 5GWZA 4K3JA 2JDID 2SFAA 1ETSH 1CT4E 3GDVA 1YPHC 2ESTE 5L2ZH 4X1SU 1Y59T 3ESTA 4CH2B 2W6JD 2RA3A 3R0FA 1G30B 3ZZ6A 3RC5A 4ZXXH 4D76A 2G8TA 2HALA 1O2WA 3CENA 1Z6EA 2QN5T 3ZVEA 4NA9H 5L2YH 2C4FH 1GJ9B 2FS9A 4TSFD 1P11E 5CHAC 5E2PA 1HJAC 1O3CA 1KSNA 1TX7A 1AN1E 2ZDVH 3RC6A 4HI3A 1SPJA 2Z3CA 1Z71A 1J17T 2QAAA 1F0UA 4AFZA 1HXFH 2BD4A 6GCHF 4Y8ZA 1P9UA 1MMJN 3TNSA 1LCYA 1C5LH 3O8DA 4X8SH 2WPKS 2BXUH 1V2VT 3CP7A 3IITA 1FY4A 4JZIA 1GCDA 2AHME 1HFDA 2XCFA 3RXMA 4Y76A 4JMYA 4ZH8A 2R0LA 3TH2H 3R3GB 1ANEA 3SGBE 3TPIZ 3D65E 1K1IA 2J95A 3MU4A 1F5RA 3GY6A 1MAYA 1PQ8A 1KTSB 1PPBH 2QGRA 2XC4A 3A87A 3F2GA 5HGGA 4JYVH 3ATLA 1NFUA 4FUCA 3RMOH 3VGCB 5EPYA 5K7RA 4WWYA 2A7HA 2SNWA 1GBEA 4ZUHA 1ZPCA 2VIPA 2W5EA 1BMNH 1GPZA 4NSVA 3STIA 1DVAH 4UFFH 1GDQA 4UD9H 1ZPBA 3BTGE 1O37A 1O3JA 2Q6FA 1W7GH 2WPIS 5JDUB 1K28D 1WUNH 1HAIH 4Y71A 1YC0A 5EG4A 2P16A 2OUAA 2A4RA 1FPHH 2H5CA 2ODYB 2VGCB 2ZFFH 1QRXA 2KCAA 1QURH 1YLDA 5EPNA 4RT0A 4ACBA 1FY3A 3FFGA 2VWLA 1FZZA 1C5QA 1YBWA 6ESTA 1LKAA 2PGQB 3BTFE 1NRNH 4AFQA 5AFZH 1TONA 2ZU2A 1C5RA 4GUXA 3GS9A 2AERH 3RXRA 1NRPH 1WV7H 1GJ6A 2VH0A 1W3CA 3T28A 8ESTE 4RI0A 1EKBB 4FOUC 4LOYH 1C9PA 1OS8A 1LHFH 2ILNA 3UFAA 1OYQA 1CBWB 2FX4A 3N7DA 1BT7A 4X8VH 3OTJE 2HPQH 5F8TA 4ZHMU 5JBCS 4BTUB 1O2UA 1KY9A 1XVMA 1GJDB 5A8ZA 1RFNA 1KXEA 1NRRH 3VB7A 1DLEA 1FN6A 3ZZ4A 4X1RU 3SUFA 1KDQB 2D8WA 4ABBA 3LPRA 2EQNA 1VCQA 2YMSB 1QRZA 2F9OA 2GKVE 3TJOA 1MQ5A 1W0YH 3OEHD 4Z6AH 1GI9B 1CE5A 1KMHB 4K1SA 2G81E 3P92A 4K60A 4IBLH 1H9HE 1A7SA 1W11U 1SQTA 2KCYA 1BJVA 3T26A 2XRCA 5EOKA 2OQUA 2M5TA 2O8WA 4YLQH 3F3BA 4HTCH 1YLCA 1GMDG 4X2YA 1S82A 1T8LA 3BG4C 4YZUA 3A86A 2RCEA 1GMCF 1NRSH 8GCHF 1V3XA 1UVSH 2A5KA 1C1QA 2TBSA 3N99A 2P95A 1GHBG 3GCNA 3MWIU 5LPEA 4K8BA 1KTTB 2STAE 3F9GA 2ZFPH 1VCPA 2XBVA 1E36B 2SGPE 3JZ2B 1WQSA 1S5SA 1HAXB 2WPJS 1Z1IA 1MH0A 1C5SA 4D7FA 4KELA 1O5AB 1G3EA 2A5IA 1SG8B 4YOGA 2A4OA 2P3TB 4OS2A 3E1XB 1GBJA 4JK5A 2P8OC 4FUIA 5T6FA 5DP8A 1FAXA 1LKBA 2H9EH 1EASA 1DY8A 2KCPA 1GGDB 2VVCA 1ELFA 1BTZA 2PUQH 1O30A 3GOVB 1BBRH 3TNTA 1G37A 2ZF0H 4NIXA 2ANYA 1IQEA 2ZP0H 3RXAA 1HV7A 5FAHA 2HNTC 2O8LA 2A7CA 1NZQH 3SQHE 3L6PA 1C2HA 1XX9A 1SBWA 2AIPA 1CO7E 1P12E 4AYVB 1LHEH 2VWOA 4UFDH 1O2IA 2PKSC 4JYTA 5GIBA 1HAVB 4B2AA 3BTME 1K21H 1O3EA 4KTSA 4X1PU 1JMOH 3KQBA 3BF6H 3LGVA 1DXPA 1W13U 3EE0B 1SGFA 4AOQA 4TY6A 3SJ8A 1ZJDA 2F9BH 3F1SB 1QR3E 1W0JD 3KYFA 4FU9A 3LJJA 1TGTA 1FDPA 4O3UA 4SGAE 3VPKA 5A0BA 4F55A 5DSFA 1E34B 1O2LA 1TPSA 1O3HA 7KMEH 2G52A 3UNSA 5EQSA 5AF9H 2AMQA 3HPTB 3FKSD 4DJZB 1EP5A 2PKAA 4ISIH 3MU8A 2HNTF 3RM2H 1C1UH 1HAZB 5EW1H 1A61H 1D6WA 3SYJA 3A84A 1EZQA 1FY5A 3O8CA 3M5MA 3SNBA 1W0KD 3RXSA 1RTFB 3AK5A 1TNJA 2HVXA 2W3KA 1VITH 4DCDA 2BLVA 4AG1A 4XE4A 1FLEE 5EXLA 2FWWA 9LPRA 2Z94A 1C4U2 1J9CH 4JCNA 3ZZAA 3PM3A 2ZDKA 2P59A 4NWKA 2UUJB 1Y5AT 2FIRH 2M2AA 1TPPA 4I8KA 7GCHF 1WDIA 1AD8H 5AFYH 3LH3A 3BTWE 5FPSA 3W95A 1GJ7B 4X8UH 1KXDA 1EB1H 1KIGH 1LO6A 4ZROA 3SU2A 1F0RA 2JETB 3IWMA 3VB5A 1GBIA 3A7WA 3GY7A 1MTSA 1OWEA 1GL0E 3A7XA 4GCHG 3MNBA 1JOUB 2PLXA 2UUFB 3LU9B 3KQEA 1MCTA 4MTBA 3NUMA 3ZZ5A 4X1QU 1QTFA 3P6ZB 2ODQA 1ETTH 1RIWB 2A31A 1EZUC 6CHAB 8LPRA 3TITA 3ELAH 2BY5X 4I8JA 3M5LA 1UTLM 3RXVA 1V2UT 2FOFA 1V2QT 3TK5A 2FO9A 2XYAA 1DSUA 1MBQA 1VITF 3A7TA 4K69A 2CF8H 2C90B 1H8IH 3ZZ9A 1C2FA 1VR1H 2WPDD 1E1QD 2ZPSA 3RUOA 2ANMH 3RDZA 2XXLA 4YT6H 1DXWA 1A5IA 3SV7A 2TGTA 4AFUA 1F2SE 2ZGBH 3OYPA 1A0HB 9ESTA 4J2YB 4A6LA 5K0HA 1W10U 4JYUH 1F5KU 1KLTA 1S84A 3T2NA 1K1OA 3TJNA 3V13A 4CREA 2FESH 3RXGA 1GGDC 2OQ5A 2SGAA 3H7TA 1O33A 2CV3A 2SGDE 3SI4H 1WSSH 1ZMNA 3SUEA 5FX5A 2P3UB 2F3CE 1P2MA 3PLPA 1ESTA 1XUHA 1C1OA 2BD2A 2Q6GA 2ZCLP 3KEEA 1YM0A 1ZJKA 1P3EA 5LPFA 1YCPM 3FO8D 3EQ0H 1A3EH 4FUEA 4IW4E 3GDSA 1IOEA 1BIOA 1O3LA 2FEQH 3W1EA 1D3PB 2JH6D 2L6OA 5F8XA 1PYTD 3E16B 1N1LA 1P8VC 1O2ZA 1YF4A 3RXTA 3MI4A 4ESTE 3ATMA 1F0TA 2AGIX 4CRFA 3E6PH 2AGGX 1P0SH 3PMAB 3BSQA 3UTUH 3EA8A 1GBKA 3BTKE 1O2NA 1AZ8A 1EB2A 1OP2A 4RN6A 2Z9GA 1SB1H 1GHAF 1J15A 2DE8A 2ZC9H 3UNQA 2G4TA 1H4WA 4FUDA 5I25A 5C2ZA 2F4LA 3ZYDA 5F6MA 2AH4X 5E8EH 3T29A 1MKWH 4IC5A 1XUGA 3PRBA 4BAOB 3SHAH 1GI1A 2CK3D 1QB6A 4B73A 3DCLA 1F0SA 1GCTC 1O5FH 1CVWH 1Z8JB 2ULLA 4ABDA
chains in the Genus database with same CATH topology
1XUFA 4I7YH 1F7ZA 3ZV8A 4A1XA 4YXWD 2NU1E 1H1BA 2RDLA 1H8ED 5C5NA 4Y6DA 1BHXB 3SV9A 1Y8TA 2BD5A 1SLXB 1UTQA 1XXFA 4HZHA 1S6HA 1AFQC 2R0KA 2OK5A 3SHCH 1SL3A 3HKIB 1P09A 2J38A 1AI8H 1FIWA 3EA9A 1B0EA 1AIXH 1GBDA 2FX6A 1UCYE 3E0PB 3MH6A 1P04A 4VGCB 1C5ZB 4HGCA 1MABB 3LGYA 4BTTB 2KM0A 1BMAA 1MKWK 3BTTE 2Y5FA 1RD3B 3FP6E 1DWBH 1RTLA 2AEIH 4DVAU 4TWWA 4UEHH 1EPTB 2R3UA 2CXVA 1O3KA 1T32A 2ZCHP 2OC8A 2FYQA 2FYRA 1C1VH 2PUXB 2BOKA 1EAIA 2OINA 2O8MA 1BTHH 1QQUA 1Y3VA 2THFB 1QCPA 2ZNKH 1GMCG 3KF2A 8GCHG 4DURA 2OLGA 2GCTC 1XUJA 1GBBA 4B74A 4Q7ZA 2AFQB 2EA3A 1BTXA 1CU1A 1V2PT 4K8YA 1ACBE 4MPXA 1FIZA 1UO6A 3ATWA 1NN6A 3ZVAA 1O2JA 2W26A 3WWBA 1EATA 4NA7A 1A3BH 1BHXF 1NFWA 4BAKB 1CHOF 1AKSA 5GDSH 2WZQA 5IDKA 2G4UA 1NBMD 1Y3XA 1ETRH 4JZDH 1WYKA 1UCYK 1PJPA 2PGBB 2HGTH 1KXAA 5J4QA 3SU5A 2EI7A 1C1RA 2ANWA 2XNIA 5GXPA 2JIZD 1CBWC 7LPRA 1Z8GA 1SKYE 4BXWA 2WPLS 1FPCH 3CS7A 1LPKB 1MTWA 1K1JA 2PTNA 1ORFA 3A82A 1GI3A 3M5NA 4QT8C 1EP6A 4Q2KA 3MO9A 3NPSA 2PW8H 1BBRK 1ZSKA 4ISOA 4UDWH 1AVWA 3K65B 2B7DH 2QF0A 1SGTA 5FBIA 1QFKH 1SGIB 1W7XH 2HRVA 4FUFA 3PRDA 1ANCA 3BTQE 2WV9A 2A2QH 2XOKD 1D4PB 1O3DA 1L4ZA 3SU6A 1AB9B 4ZKNU 3HK6B 3LGTA 2AMPA 1OPHB 1AHTH 1ELCA 5ETXA 4AB8A 1L4DA 3LGIA 1DANH 1UK4A 3QDZB 2BDYA 2VIDA 1UTOA 3UR9A 1UMAH 1BRCE 2ZTYA 2TGAA 1SI5H 1DWEH 1AKSB 1O3FA 2BVXH 2CHAC 2V6NA 2ZU5A 3SZEA 1PPGE 3SUGA 2WPMS 5DN6D 3NXPA 3JZ1B 1SFQB 4KGAA 1JBUH 3M7TA 4Y11E 1QGFA 1N8OC 2BZAA 2GX4A 3PROA 2ANKH 2ZFRH 4M9FA 1QL8A 1YCPK 1C2KA 1TRNA 5DGJA 1QJ1B 2ZHQH 2FOCA 1CGHA 4AGJA 1DITH 2CHAB 3RXKA 1NBME 1GHWH 3SGAE 1T7CA 5A8YA 2GZ9A 3ZYEA 3TJUA 2VIWA 3I77A 1AZZA 1V6DA 2FOBA 1O39A 5C17A 4DOQA 1PQ7A 1UTMA 1YPJH 2GT8A 2IJOB 3QO6A 4IS5A 3RMLH 1GHYH 3BTHE 3B9FH 2XC5A 3M61U 3ZZCA 4FUGA 1DFPA 3N7OA 5FCKA 3A8CA 1HUTH 3MMGA 1QBNA 3M3TA 1MAXA 3MOCA 5TCAA 1ARCA 2VVVA 4XBCA 4B2CA 1CA8B 1W12U 4KKDA 1O3IA 1EAXA 3GCHB 2ZTZA 4MDSA 3MFJA 4TY7A 2GP9B 1FV9A 3PTNA 4GAWA 3FAOA 1YPHE 1HAPH 2WUCA 3V0XA 5HYOA 1Z8IB 1GVLA 2ZDMA 3AW1A 4X1NU 4TPYA 1V2RT 3HK3B 3KQDA 2P3FH 3LIWA 2EI8A 5DP6A 3QLPH 2LNCA 2AS9A 3F0OA 4DT4A 1O3BA 1TNHA 3GY5A 1ELAA 1MD7A 1GDNA 2QF3A 2ZQ2A 2BDIA 3EAJA 2R2MB 4ISLA 2GTBA 4WF8A 2CN0H 3SJOA 3U1JB 2K8IA 3EGKH 1O2HA 1OSSA 4OS6A 4AX9H 1ZSJA 2FI4E 2QXIA 1QY6A 3U9AH 2F9UA 3AVZA 1AMHA 1O38A 1GL1A 3AW0A 3TK6A 4WH6A 3MO3A 4INHA 3K6ZA 1GJ4H 3SUDA 1QBVH 3S0NA 4XBDA 2TRMA 1L0ZA 2Y6TA 1C5XB 5FXLA 2XTTB 3T62A 4Z1MD 4DIHH 1QIXB 1S85A 1P05A 1O2SA 1TNIA 4E7RG 2H1UA 3FZDA 5A0CA 3VXFH 3SJ9A 1BTYA 1D6RA 2BDAA 1MCVA 2YMSC 2BM2A 2P8OB 3T25A 3S69A 4NIVA 1BBRE 2BX4A 1C5NH 1P03A 1COWD 3E91A 2RG3A 1ZTKA 3UREA 3OAAD 2PV9B 1XVOA 1Z8RA 1P57B 2J94A 3A89A 1UVOA 5E0JA 3BG4B 4NG9H 1HCGA 3H5CB 3FZZA 2R9PA 2A4GA 2QXJA 1O2VA 3TU7H 4WVPE 5DP4A 3G01A 4OGXA 1G36A 4ISHH 1ANDA 4D7GA 3P95A 2GZ8A 1D9IA 1C2MA 2TIOA 3Q77A 1UTPA 3PV4A 2ZDNA 1V2NT 4Q80A 2ZHFH 5CDFE 1P9SA 1V2LT 1UTNA 4GPGA 2HWLB 2PKSB 3F0PA 5EQRA 5C20A 2DE9A 1ESBA 2BZ6H 3URDA 1IQKA 1C1PA 3E3TA 3VB4A 4U30A 3A81A 2KCOA 2XCNA 4F49A 2XC0A 1HIAA 3U8RH 1V2ST 3ODDA 3ZVBA 1UCYH 5BPEA 5E0HA 3SOSA 1UJ1A 3ZVCA 1LVOA 4HFPB 1HB0B 1UVUH 5GJ4B 3M36A 5DK1A 2ZGXH 3ZZBA 5DO4H 1ANBA 1AVXA 4CH8B 3S7HB 4WMFA 3GDUA 4K5ZA 4CRGA 5DP9A 1AQ7A 1O3NA 3A8BA 4LZ4B 5GNDA 1A5HA 5C3NA 4B6FA 1ELTA 4DIIH 4ZHAA 3U8OH 1SLWB 1EAWA 1UHBB 2HOBA 2J4IA 4Q4LA 1FI8A 1G32B 1INCA 3RXFA 3DFLA 1GBHA 1TGNA 1ELGA 1SFIA 5DP3A 1OXGA 4R8TB 3GYLB 5J4SA 1O35A 3VXEH 2ZA5A 1C1WH 1FX0B 5ABWA 1SGCA 3SU3A 2NU0E 4UFEH 2B5TB 2KAIB 5TJXA 1GBFA 2H9TH 3MU5A 1JIMA 4MNYA 3RU4E 1C9TA 2IJD1 3ITIA 1IQJA 4MPUA 4JZEH 2VNTA 1YGCH 1V2MT 2GCHG 4X2WA 1P2IA 4AORA 3GICB 4Y79A 1GHXH 1FQ3A 4M7GA 2FOHA 4YO9A 1O0DH 3SJIA 1GMHG 4X2XA 2PHBA 1SQAA 2K0QA 4MLFB 5LH8A 1TIOA 5G4BA 4DW2U 6CHAC 1X7AC 4K1TA 1AWFH 1P3CA 1QA7A 1ZMJA 4RKJB 5C0UA 4OGYA 3RXUA 1ABJH 1BRUP 1NFXA 2Z9IA 1O5CB 2F43B 4VGCC 3B8JA 4X0WU 3SI3H 3L3TA 3NRLA 2JETC 1EX3A 1GJ8B 4MVNA 4K2YA 3LGWA 1B7XB 1TNLA 1DUAA 1GBCA 1CHOG 2FI5E 5EXNA 1KXFA 3CS0A 1FAKH 2TGPZ 4SGBE 2ODPA 1K1NA 2ZGCA 2UUYA 3UNRA 1QL7A 2BVSH 3D62A 1S83A 2OC1A 2W6ID 2LPRA 4WXIA 2FDAA 1HLTH 3QZQA 2IPHA 1VZQH 2D1JA 2H2ZA 2RA0A 1SOZA 1NPMA 1PFXC 2OD3B 5JB8S 2UWPA 1DS2E 2JKHA 1MQ6A 1BTPA 1WCZA 3HKJB 3KCGH 3UUZA 1O2XA 3QX5H 2PWXA 5HMAA 2VIQA 1RTKA 3BEUA 1HPGA 2GVFA 4E7NA 2SGQE 2QA9E 1PQAA 2BY9X 4BANB 1A5GH 3L33A 5DJ7A 5T1VA 3DHKH 2ZGJA 3LDXH 1GMHF 4B76A 1C4V2 1SGEE 1SOTA 1TPAE 3MTYA 2C8ZB 1P06A 4O9VA 3QGNB 3RXHA 1TABE 3DD2H 1MD8A 2F83A 1SHYA 1DWCH 3PMHB 2BQWB 3A8AA 1CQQA 1TMBH 2B8OH 4H6TA 1NM6A 1GDUA 2FMJA 1BUIA 2CMYA 4GHQA 4I8LA 2H9HA 1T8OA 3TGJE 1QJ6B 1E37B 2G55A 1EJAA 4BAQB 1DSTA 4Y0YE 4BNRA 1IQLA 1GI2A 2ZZUH 2K1QA 2PR3A 4ZXYH 4NFEA 3PMBB 4ABFA 1MZAA 2BXTH 2P93A 2ZFSA 4DG4A 1GI6A 1JXPA 1TBQH 1UK3A 5C1UA 4YESB 1S6FA 3GCTG 1WXRA 1L2EA 2ZO3H 1GJ5H 1K1MA 3P8NA 3M3SA 5B6OA 1EJNA 5JBBS 3Q3XA 1K9OE 1O31A 4LXBH 4ZKRU 4BTIB 5C67A 4CBNA 2ASUB 2QE7D 1DX5M 3OX7U 2BD8A 2ZWLH 5EQQA 1NROH 3U98H 1OOKB 2V3HH 2NWNA 1QJ7B 2BY7X 2C8YB 1MTVA 1ZGVA 1K1LA 1TX8A 4B1TA 2QXHA 3ZVGA 3T27A 1C2IA 4AFSA 1O2RA 5CMXH 4X6PA 1TRMA 3U8TH 3PLKA 1O2MA 2WYJA 1E35B 1HAGE 1ZRBA 2A5AA 2Z3EA 1YPLH 1BRBE 1O2KA 4OS7A 2GCTB 4ABGA 1RIWC 4X6MA 5DP5A 1SGQE 1EPTC 3PTBA 1OYTH 1UTJA 4WJG2 1ZR0A 4AZ2B 2FOMB 1EXFA 1G3DA 1WAYB 3W94A 1O32A 4ZMAH 3EYDA 1EJMA 3SN8A 1C5YB 2J2UA 4TYDA 1ZRKA 1BTWA 2EEKA 3F9FA 5EU8A 2XWBI 1IQFA 4OS1A 3RXEA 3TGKE 3MYWA 1VJAU 4Y0ZE 1O5GH 3TVJB 4CR9A 4H4FA 1TWXB 2Z9KA 3UPEA 2IOTA 2XBWA 3Q3KA 3RXLA 3VFEA 1HRTH 2VIVA 5EXMA 1QBOA 1BITA 1Y3UA 2GDDA 1UK2A 3E8LA 3SW2B 4AYYB 1TRYA 3VG8A 4GSOA 1LQDB 2ALPA 4ZKSU 2QF4A 1SQOA 1BOQA 1Q2WA 2C8XB 1THPB 4JK6A 1B5GH 1S0QA 2O8TA 3QTOH 4U2WA 2FTLE 1ID5H 1W2KH 1TPOA 2JH5D 1MTNC 2BTCE 1AFEH 2GD4B 4GCHF 3S9AA 1C5WB 2ZFQH 1BZXE 1S6LA 5ESTE 3A80A 1T8MA 3BN9A 2F9NA 4J1YA 3PB1E 3RXIA 2OC7A 1KXCA 2YNAA 2NU2E 4AGKA 3DUXH 3MNXA 1EZXC 3PO1C 2F9VA 2BY6X 1GBMA 1SGDE 2BDCA 2SGFE 1LVBA 4Y7AA 4BAHB 2FP7B 3LOXA 3LC5A 1W14U 3F2FA 1SMFE 5HM9A 2SGEE 2WV5A 1C5TA 1L1JA 5JPMH 1GHVH 1G9IE 1EUFA 2HPPH 2QYIA 4YM9A 5CHBA 2GGVB 3HATH 3F9EA 4I32A 1V2WT 2BX3A 2AMDA 2VJ1A 2KZ4A 1O3GA 4GHTA 2QXGA 1OWHA 1TQ7B 2BD9A 2VB0A 4F4OC 3QWCH 1TFXA 1H9IE 2Y5HA 1HAOH 2OBQA 3QGJA 1K22H 1SGFG 1XMNB 3ENSB 3RXPA 2FOEA 3VGCC 2A32A 1XM1A 2BLOA 4FUBA 2ZEBA 3QUMP 1QB9A 2R3YA 5A2MH 3RMNH 4CRCA 1IQIA 2BLQA 4NWLA 4NIYA 2YNBA 1NESE 1AE5A 1J8AA 2W7SA 1OHHD 2P94A 3BTDE 1P2OA 1P2NA 3M3VA 3QTVH 2VWMA 3V7TA 1SLUB 4DY7B 1AFQB 3UWIA 2ZECA 3SNAA 4CHAB 1YCPH 3GYMA 1SGPE 2W3IA 2VU8E 5BRRE 1P02A 3PYHA 2CGAA 1TX6A 1GJAB 7GCHG 5L30H 2W7UA 5F8ZA 4WY3A 1Z6JH 2FPZA 1C5PA 1TA6A 4O3TA 1QRWA 1DM4B 1WTHD 4IC6A 3BV9B 3S7KB 1UVPA 1TGCA 1F92A 1FMGA 1JRSA 1EQ9A 1WU1A 3RXJA 4Y8YA 2ZCKP 3KL6A 4FVDA 1O5EH 2QIQA 1BDAA 1F5LA 3QN7A 1G3BA 2ZTXA 4OS5A 4R0IA 1HAHH 3OTPA 1DUEA 2V35A 2BMGB 1XKBC 3OY5U 2VH6A 1GHBF 4X6NA 1EFRD 1AGJA 3EDXB 5AHGH 3TH3H 5FL7D 1A46H 3BIVH 3ZIAD 3GCHC 4NSYA 3A83A 1E79D 1DT2A 3UOPA 1OKXA 1THRH 3DA9B 1IHSH 2O9QA 5I46H 2A45B 1LVYA 4E05H 1PPEE 1IQNA 5C5OA 3A88A 1CT2E 1KLJH 1P2QA 2ZG0H 1OX1A 3FP8E 4Q63A 1H8DH 4AN7A 1ELDE 3RXDA 1SC8U 1CSOE 3P8FA 3QK1A 1ZTLA 2TPIZ 1FY8E 1PQ5A 4IMQA 4XSKU 1NO9H 1NFYA 4NIWA 2BD7A 1GI7B 1HDTH 4Y10E 1WQVH 5C1YA 1AUTC 3UB0A 1V2TT 4ZHLU 3DSOA 3F68H 1SGNE 1Q3XA 5B6LA 3NKKA 4AB9A 1A1RA 1OWDA 3B23B 2ZHWH 1A2CH 3RXCA 2UWLA 1CA0C 2V0BA 1QHRB 1MU8B 2FOGA 1SGRE 1PPCE 4ZCNA 3I78A 2ZU3A 2AGEX 5DKMA 3GY4A 4ISNA 1HJAB 5JB9S 2EC9H 3UY9A 1TBRH 3S9BA 2OBOA 1DDJA 1GMDF 4E06H 5EGMA 1IQGA 2KFWA 1E1RD 1C2GA 3KQCA 2O8UA 4MNWA 3SNEA 1BA8B 3NZIA 1EAUA 3KIDU 3FN8A 1ELVA 2OC0A 1JIRA 3MNSA 3SORA 3RP2A 1THSH 3P8GA 1ABIH 4THNH 1ZHRA 3FP7E 2ZHEH 5HKKD 3UQVA 1C5OH 1C2DA 3GISB 4ABHA 3MH7A 1T4VH 3PWCA 1TGBA 1KXBA 3C27B 3GCOA 1QL9A 4RKOB 2ZFTA 1YPMH 2FODA 4PROA 3RU4D