2IJOB

Crystal structure of the west nile virus ns2b-ns3 protease complexed with bovine pancreatic trypsin inhibitor
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
176
structure length
168
Chain Sequence
GGVLWKKGDTTTGVYRIMTRGLLGSYQAGAGVMVEGVFHTLWHTTKGAALMSGEGRLDPYWGSVKEDRLCYGGPWQLQHKWNGQDEVQMIVVEPGRNVKNVQTKPGVFKTPEGEIGAVTLDFPTGTSGSPIVDKNGDVIGLYGNGVIMPNGSYISAIVQGERMDEPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Polyprotein
publication title Structural evidence for regulation and specificity of flaviviral proteases and evolution of the Flaviviridae fold.
pubmed doi rcsb
source organism West nile virus
total genus 29
structure length 168
sequence length 176
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00949 Peptidase_S7 Peptidase S7, Flavivirus NS3 serine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ijoB02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2ijoB01
1EPTA 2VIVA 4HTCH 2FYRA 1OS8A 5GCHF 1P2KA 1THRH 1YPKH 3S9AA 1C5OH 4B1TA 4H6TA 3EA9A 3RMOH 3ATWA 3U8RH 1XUHA 2XXLA 2OQUA 2AGIX 4JZIA 4NGAH 5K0HA 3GCTG 2O8WA 4LOYH 1V2TT 1A2CH 1C5SA 1P2IA 2G8TA 3Q3KA 3OYPA 1ZRBA 2ALVA 2G52A 1E0FD 2Z3DA 2A45B 1C2FA 1PPBH 1RJXB 2ZCHP 3TLOA 2GZ9A 1NO9H 1WQVH 2C90B 2VU8E 1G2LA 1EZUC 2Y5HA 3SOSA 1IAUA 4NA7A 2R9PA 1NFWA 3KIDU 2ZU5A 5F8ZA 1DUAA 3O8CA 5GNDA 1Z8GA 1IQIA 2A5KA 1ZTKA 1O2VA 2PTNA 1QURH 3VFEA 1IQGA 1C5RA 3CS0A 1S6HA 1QIXB 2FZZA 1P2OA 1YPEH 3A7XA 3HATH 4FUBA 3TJOA 1CT0E 2P95A 1DT2A 2GGVB 4X1SU 2FDAA 1HAOH 3SI3H 1MZDA 1C2HA 3SV7A 3ATMA 2I6SA 3E3TA 4AZ2B 1NN6A 8KME2 1XUJA 2G81E 4B2BA 1TNKA 1H9LB 1LVMA 1ZMJA 1OWHA 1W7GH 2Y81A 2F9NA 3P8NA 3RXJA 2HVXA 4ESTE 1ANDA 3K6ZA 1A0HB 1UVSH 1ELFA 2R2WU 4X6NA 2ESTE 3SNCA 1MD8A 1CQQA 2UWPA 2VVUA 1VCPA 8LPRA 5GWZA 4CHAC 1Z71A 1LKAA 3ATIA 1TPAE 4XSKU 2ZPSA 5DP9A 1CHGA 1CA0B 3E90B 3KNXA 2UWLA 1S0RA 3VXEH 1MTUA 3BEIB 2XBYA 3OY5U 1ZSLA 2ZHEH 1SBWA 4SGBE 5FBIA 1BTUA 3UY9A 3ZZ4A 2WYGA 2A7CA 5FCKA 4DW2U 1AHTH 2HNTE 1GBEA 3LGVA 1P02A 1O3KA 1UTKA 3ZVBA 3E0PB 2FWWA 4X8SH 1QBNA 4NWKA 4ZKNU 1N6XA 3RXSA 1O2UA 8GCHF 1O2WA 3P8GA 1AVXA 4YESB 4Z0KA 1F92A 4BXSA 1GI0A 4DOQA 4LK4A 3WY8A 3M7TA 2PHBA 2PW8H 1EOLA 1ID5H 3GISB 4Y79A 4AX9H 1P3CA 1TNIA 3NKKA 1O2GH 2H2ZA 1UHBA 5FXLA 1O3PB 2STAE 1UTMA 1HXFH 2H1UA 2RCEA 1BTXA 1GJ8B 1EZXC 4B2AA 3SV9A 1NC6A 2P94A 1GJ9B 2FI3E 2HGTH 1MD7A 1UK4A 3VB7A 1VJAU 3GY2A 3TJNA 1G32B 4IC5A 1S82A 2C8WB 4WVPE 2OUAA 5DP6A 2B7DH 5BRRE 4BTIB 1L4DA 2Y80A 3M3VA 1TGTA 1WXRA 3NCLA 1BMNH 3BTTE 4JK6A 1QHRB 3H7TA 3RC5A 3M5OA 3TITA 2UUKB 1LHEH 1CHOG 4VGCB 4B75A 3UNRA 3HKIB 1AFQC 3AW0A 3SUGA 4TWYA 2Z9JA 2DUCA 3KEEA 2ZPRA 1GJAB 3LU9B 4ZKOU 1MU6B 7KMEH 1KTSB 3RXKA 1TMUH 3MNBA 4CRFA 1MTWA 1GL0E 1AE5A 1CHOF 2ZDAH 3PLPA 1KXAA 3T5FH 1SLUB 1AU8A 1YPJH 1HJ9A 3BF6H 1NPMA 1Y5BT 3VGCB 3F1SB 1UVTH 3MYWA 3QGNB 3A7TA 4O9VA 2GV7A 3TGIE 2PUQH 1O2SA 3RXUA 4X1NU 3DFLA 1T4VH 3ZZAA 4AG1A 4NG9H 2NWNA 1O2YA 1TA6A 3STIA 4Y7BA 4XBDA 2ZCLP 3BTWE 4IS5A 2B0FA 1IQLA 1GCTC 1QA7A 1GI4A 1ANCA 4GAWA 3O8RA 3VB4A 2BDYA 3FANA 1FN6A 4I32A 4ZHLU 1AWFH 2ANYA 3OY6U 1W8BH 2H9EH 3QUMP 1NRPH 5JDUB 1CBWB 3SZEA 1MKWH 1MKWK 1XKAC 1GI7B 2WYJA 5FHTA 2QAAA 3KHVA 1GGDC 9ESTA 1KXFA 3T26A 3SV6A 1SQAA 1V2UT 4IMZA 1O5CB 3OU0A 2GDDA 3STJA 4E06H 3BG4C 1Z6JH 2D26C 2AMQA 1XUGA 1LCYA 2C93B 2TIOA 4AFSA 5JBTA 1EXFA 1GI3A 1GBTA 1SOTA 4NIVA 4D9RA 2A7HA 1MBQA 2HRVA 1O3NA 1K9OE 4NA9H 4OGYA 4YOIA 3ZZCA 4CH2B 1EJAA 1VCWA 1FY1A 1O2LA 1TNGA 2BDCA 2BQ6B 4ABIA 1AIXH 5H4IB 1ETSH 2SGDE 1CGIE 3SW2B 1A5IA 1VGCC 1GJCB 1EP5A 3KCGH 1WSSH 1Z6EA 1AD8H 3RXBA 5B6OA 1WQSA 1BTWA 4LXBH 3MNSA 3A83A 5DP5A 4D7FA 1GVLA 3HK3B 1BBRE 1EZSC 5C67A 2FO9A 1TYNA 1D4PB 1GI1A 4OS4A 2FOEA 4ISHH 1AGJA 2ZGCA 3Q3YA 1P2JA 1GBMA 1OP8A 3D62A 1L4ZA 4ZXXH 1AI8H 3W95A 2Y7XA 1TIOA 2ZG0H 1FZZA 3LC5A 2C8XB 3GCNA 3DT0H 1W11U 1EJMA 1RD3B 3TH4H 1C5XB 1Z8IB 2C4FH 5DK1A 3T27A 1HAVB 5FX6A 1P12E 1GDUA 3BTDE 1BBRH 1BBRK 1HAVA 1HRTH 4YO9A 3LH3A 5E0HA 2O8LA 4WH6A 1AUTC 1DLEA 1YPHE 2WPLS 4IC6A 3ZYEA 3RM2H 2BZAA 1O2JA 1ZZZA 2HNTC 4JK5A 4IN1A 1GJ4H 1AFEH 1EAWA 1MTVA 2XC4A 1THPB 4J1YA 1DVAH 5AVDA 4DGJA 2J94A 4E7RG 3TIUA 2H9HA 3RMLH 1DXWA 2W3KA 3V13A 3P8FA 1TE0A 4DT7B 3MH7A 4NIYA 2VB0A 1KY9A 1C2GA 1BTHH 7ESTE 1V2PT 1M9UA 4X6MA 1FLEE 4GUXA 1WUNH 3RXIA 3BEUA 4AOQA 3EA8A 1LPKB 1QL7A 3FVFB 4F4OC 1ZYOA 1N8OB 4FUCA 1EX3A 1INCA 1J15A 1O38A 1SHHB 2EA3A 1EASA 3VB6A 1A5HA 2VH0A 3MOCA 3SQHE 3U8OH 1JMOH 4IN2A 2PFEA 2F9PA 4Y76A 4BAQB 5EGMA 3RLWH 4LZ4B 1O36A 1PYTC 3MTYA 1WV7H 3EQ0H 3OTPA 1GBAA 1OX1A 4TY6A 4M9FA 2R3UA 5IYTA 1SSXA 1C1UH 1P04A 1ZMLA 5FBEA 1BMMH 1C1QA 1V6DA 1YCPK 1CSOE 1BRBE 2Z9IA 4ISLA 1O3EA 3HPTB 1KSNA 3BSQA 1Y8TA 1SMFE 2OC7A 3BTME 1MQ6A 4XOJA 1A7SA 2F91A 1RRKA 2ZFTA 2ZNKH 3RXHA 1MTNB 3PTNA 2P8OC 2YOLA 1C1WH 1KLIH 3P6ZB 1ZJKA 1UTJA 4CR9A 1V2KT 3E1XB 1AUJA 2BD3A 3MO3A 3M3SA 3PMHB 1QJ6B 3EYDA 5ETXA 3UNSA 3S69A 2H5DA 1RTFB 1GHAG 1HCGA 2ULLA 3RXGA 3MO9A 1F5KU 4YM9A 5EXMA 1LQEA 3GY4A 1E37B 1V2NT 7GCHF 3MNXA 3A84A 4BANB 4TPIZ 1UTNA 2CHAB 4INLA 2ALPA 2Z9GA 2AMDA 4Y11E 1E36B 1EAUA 5E2PA 3K65B 3W94A 1O39A 1ORFA 1VITG 2FI5E 1IQMA 1QRXA 2GX4A 1D9IA 3NUMA 2AIQA 2PLXA 2RDLA 1KXDA 3RXRA 3KN2A 1WBGB 2FP7B 4AYYB 2VGCC 3H7OA 1O5FH 4X8VH 2BMGB 1T8MA 3UR6A 1F0TA 4Y71A 3IITA 2FTLE 4B73A 1SL3A 1WTHD 2GCTC 1RIWB 4ISNA 1LKBA 5C1UA 5EPNA 3JZ1B 4FUJA 1Z7KA 2UUJB 1NU7B 4ZHMU 1NTPA 1O5AB 2A1DB 2ANKH 1TOCB 5AFYH 4NA8A 1SGQE 4KTCA 1Y3UA 1TGCA 1IOEA 1GI9B 1GCDA 3HK6B 1HAIH 1SLVB 3GCOA 3TU7H 1JIRA 1AB9B 1TMTH 1FUJA 1A61H 2DE9A 1W12U 3UWIA 4BAKB 4K1TA 1QB6A 3MU8A 6GCHG 3VGCC 1F0SA 1MBMA 1SGCA 1BTPA 2NU1E 1LPGB 1P2NA 1CT4E 1K1OA 2ZZUH 3ZZBA 2VH6A 2OC0A 1ELCA 1D3PB 1KIGH 1FAKH 1O2MA 1TOMH 2FX4A 1JRTA 3LGUA 5FPYA 2FOMB 1TQ7B 2ZKSA 2THFB 1TNLA 5LPFA 2BDHA 4Y6DA 2ZDNA 4OGXA 1ZTJA 3GDVA 3PO1B 5EQQA 5EG4A 3M7QA 3BTEE 3KQEA 4UE7H 1SGPE 2J34A 4WMEA 1GBJA 4ZMAH 1GG6B 3LDXH 4XBCA 3T28A 1BMLA 3ELAH 4NIWA 1TBQH 2BD9A 5BPEA 1LDTT 1D3TB 2F9UA 5JBAS 4I7YH 1G37A 3Q76A 3T2NA 1F5LA 4DIIH 4GVUA 4A6LA 1DLKB 1ELVA 3QK1A 1HBTH 2H5CA 2JETB 2GKVE 3CP7A 2ZECA 1DANH 4RN6A 3AAVA 1HFDA 3FZDA 1ANBA 3A86A 5EQRA 1Q3XA 1YYY1 1PFXC 1XXDA 2ODPA 5F8TA 1NT1A 2XBVA 4DY7B 4O97A 5TCCA 4IGDA 1FPHH 3RXFA 1ZHPA 2Z3EA 1O31A 1KTTB 5T6FA 4Q7YA 1JRSA 3PLBA 3GCTF 1B7XB 3U69H 5ABWA 1GI2A 4SGAE 1FPCH 5ESTE 1AMHA 1QFKH 1Z1JA 1TONA 1C1RA 1TPOA 1FY8E 1PPCE 3RXPA 5I25A 1QB1A 2VINA 1X7AC 3F6UH 3F9FA 4A1XA 1AVGH 2BD7A 3EDXB 5SGAE 1IQHA 1TAWA 1TX6A 3DHKH 1DOJA 3SNEA 2VIPA 4MDSA 3RUOA 5A09A 3F68H 1LVOA 2W26A 1GHZA 2J38A 1K1LA 2AGGX 1D3QB 3MFJA 4CRDA 3RMMH 1IQKA 1RGQA 1DE7H 2XWBI 3SNBA 3GCHC 2FLRH 1A46H 1QJ1B 3ZZ6A 1JOUB 1CGJE 3EA7A 2QYIA 3F9GA 1SLXB 2QC2A 3GY5A 3TNSA 3TGJE 2Q6GA 3E0NB 2ANWA 2BD8A 2BLVA 1C4Y2 1J17T 4X0WU 4Y8ZA 1ARBA 1C5VA 1LVYA 4FUFA 4K3JA 4X1PU 3A8AA 1GDNA 2GT7A 2Q6DA 2XBWA 3EAJA 4NZLA 2GMTC 3QZRA 1NFYA 1SFIA 1GJ5H 2BD4A 2BOHB 2EEKA 3QTOH 3SHAH 3GYLB 1FONA 5E0GA 3SQEE 3P17H 2CJIA 4MVNA 4AB9A 1DY8A 4JYUH 1V2MT 1W2KH 2SGQE 1IQFA 2GCHG 2ZQ2A 1GMDG 1OWEA 1K1JA 1HXEH 3K6YA 1E34B 2QA9E 1TBZH 3CS7A 3SU3A 1V2OT 2FS8A 1FIZA 1QQ4A 1ETTH 3SJ8A 5A0BA 1FNIA 2VWLA 3L3TA 1UHBB 1GMDF 4U30A 5CHAB 1XVMA 1ZPBA 4MPUA 1GJ7B 1VZQH 4FVBA 5T6DA 2IOTA 1FXYA 1H8DH 2BXUH 3GY3A 3U9AH 1DM4B 2XWAA 2GP9B 1W0YH 1BJUA 2EI8A 3LH1A 2OP9A 3SZNA 1L1GA 1TPPA 5F8XA 3SNDA 1PQAA 1TA2A 1V2ST 1LHCH 1C5ZB 4MNYA 1SGYE 2F4LA 2ODYB 5DJ7A 1ELEE 4X1RU 2PTCE 3VB5A 2XNIA 3MNCA 1ABJH 2BQ7B 1C4V2 1ZPZA 3PV2A 3TJVA 1RS0A 1UMAH 2ZA5A 1DDJA 4YOGA 3RXAA 2TBSA 1OPHB 1MKXH 1MKXK 1GBBA 2BLOA 5T3HA 1K1NA 2CF8H 4MG3A 3M37A 5DP4A 2ZTXA 3A81A 3TPIZ 1QBOA 3RXTA 3BIUH 2ZIQH 1EP6A 1XM1A 2QF3A 2TGPZ 3BIVH 1DY9A 1O32A 1BDAA 3HGNA 3R0FA 5HYOA 2A4RA 2C8ZB 3M35A 4MPXA 3SYJA 3PROA 4NSYA 3S7HB 1L2EA 1CE5A 3QTVH 2SGEE 3RC6A 2Q6FA 1ZTLA 4XE4A 4ZKRU 4FUIA 4DIHH 2ZDKA 1RTLA 3PV4A 1A4WH 1BTZA 5J4SA 1ARCA 4THNH 1ZMNA 3P95A 1GBFA 1DWDH 1IHTH 1C2KA 3A80A 2J9NA 3LKWA 4MLFB 5AFZH 3UPEA 3TNTA 3VEQB 4IW4E 2OINA 3RU4E 1NRNH 2O8MA 4OM9A 1MZAA 5C1YA 1GBHA 4AG2A 4MNXA 2A2XH 3SV2H 2NU4E 1UTQA 3L33A 4GCHG 2BQWB 2C3SA 3ZVGA 2HLCA 1WTGH 1HJAC 3DD2H 1BIOA 1Y59T 2Z9LA 3GY8A 1BHXB 1P2MA 3VXFH 1GMHG 4GLYA 6CHAB 3RC4A 1G3CA 2ZGHA 3RXEA 5T1VA 4Y0ZE 1QJ7B 1H1BA 2PUXB 2ZGJA 2LNCA 3DA9B 3ZVDA 1PQ8A 3ESTA 1FY4A 1QRZA 5A8ZA 5L6NH 2A0QB 1P8VC 1OP2A 5GXPA 2YNAA 4K60A 2A2QH 1EOJA 1XMNB 2JH0D 4AFZA 1KDQB 4DG4A 4E7NA 1KDQA 1TB6H 4WH8A 4CRAA 4DVAU 2BD2A 1CA8B 4FU9A 4ABJA 2CGAA 2HOBA 1YGCH 2WPMS 1DWCH 3B9FH 1O33A 1C5MD 1O2XA 1BJVA 4X2YA 1O2PA 2BVXH 1MAYA 1MH0A 4ABBA 2BVRH 4B6EA 1C5QA 2A7JA 1DX5M 4U32A 3A7WA 1J16A 4I8GA 5EQSA 1ZGVA 4IMQA 3M3TA 4NCYA 2BD5A 5EXNA 1HAXB 1V2RT 2OK5A 4ABDA 2A5AA 1S0QA 2QGRA 3LC3A 1QRWA 1T4UH 1P10A 3MWIU 5EXLA 3ZZ7A 3PLKA 1GHBG 1EUFA 2ZPQA 1T32A 5GIBA 1MAXA 2FODA 1SGDE 4ISOA 1DUEA 1O2NA 2ZFRH 2Z7FE 1T8OA 1SB1H 1XX9A 2G55A 3UTUH 2ZC9H 1EPTC 3SGBE 1ZOMA 5JBBS 1HAHH 1Y3XA 2RA0A 1ESTA 3PMBB 5HMAA 1F0RA 2VIOA 2F9BH 3RMNH 4BAHB 4B74A 5G4BA 1QBVH 3ZV9A 3SJKA 2ZDMA 3EGKH 4UEHH 3SV8A 3QLPH 1UJ1A 3SO3A 1KXEA 1D3DB 1RTKA 3ZZ9A 3Q77A 2ZU3A 1EAXA 2IJD1 1QA0A 1PPHE 1SGEE 5FPSA 1TX7A 2GZ7A 1S81A 1HIAA 1FAXA 2PR3A 1ELBA 3PWBA 1T7CA 4O03A 1O3OA 4YTAA 4CRCA 1Y5AT 2NU3E 1GBKA 4ISIH 4ZKSU 4I8HA 3FP6E 2HWLB 2OC8A 3BTKE 1UK2A 5HGGA 2HALA 1OWIA 2SNWA 3BV9B 5C20A 1SHYA 4CHAB 5JYIA 1SVPA 5EW2H 1A1RA 1SGFG 1C5TA 2G5NA 3BG8A 2VIDA 2BTCE 4OS1A 3QDZB 1Q31A 4WXVA 2A4GA 4UD9H 2QXGA 2J92A 4X2VA 4JYTA 2A31A 5JPMH 1SLWB 3A88A 1VJ9U 4A1VA 3ATKA 1JWTA 1YF4A 4OS5A 1O2IA 1AN1E 1UO6A 1GHYH 1HYLA 2CMYA 5DG6A 1EQ9A 2G00A 4UONA 3AAUA 1W0ZU 1G2MA 1AVWA 1G9IE 3O8BA 5ESBA 4E05H 4J2YB 1O34A 5FPTA 1NFXA 4X2WA 2XC0A 2ZCKP 2V3HH 2ZHDA 1BCUH 4JZDH 3SU2A 1PQ5A 4MNWA 4Y7AA 2BDIA 4ZXYH 1D6RA 3MH5A 2XTTB 1CA0C 2YNBA 1K1PA 3E91A 2ZTZA 1G3DA 4X2XA 2ZU1A 4ABAA 2VVCA 2FOHA 2PWXA 4XFQA 3SJIA 3RU4T 5HM9A 5EW1H 3KF2A 4D76A 1DICA 1QL9A 3SUFA 4A1TA 1J14A 1YC0A 1LO6A 3KQCA 1HAYB 1AFQB 1HB0B 5DP7A 3GDUA 2FXRA 3UREA 2BLQA 4CRGA 2W7SA 3JZ2B 1SQTA 2AYWA 1C2IA 4R0IA 1SOZA 1HJ8A 3A89A 3A7YA 1BHXF 4WF8A 1AKSA 3L6PA 1GHAF 2G5VA 3U8TH 2XRCA 4GPGA 1EB2A 5CHAC 1NROH 5DO4H 1S85A 1PPGE 4CBOA 5A8XA 4AORA 3ZZ8A 3SU1A 5L30H 1YM0A 1SQOA 1W13U 1AWHB 1YPMH 1YPLH 4U2WA 1GBDA 1VITF 2WV5A 4HGCA 4U01A 2A5IA 5A2MH 3PM3A 1MCTA 3H09A 1CU1A 1B5GH 1DWEH 5J4QA 3ZVCA 4KTSA 1ZLRA 2JKHA 1TQ0B 2DE8A 2CXVA 4Y10E 2RA3A 1K2I1 4WJG2 4F49A 4D8NA 2WHXA 3KGPA 4O3TA 1TRYA 3SU5A 1O2HA 4UFFH 4AGJA 1MTSA 1AZ8A 1OSSA 2P3UB 1O3BA 1SI5H 3SJOA 4VGCC 1XUKA 3PMAB 1GCTB 4RSPA 4ABEA 1O5DH 2KAIA 2BY5X 5B6LA 1XXFA 2UUYA 6ESTA 4YZUA 1S84A 2H6MA 2ZFSA 3K2UA 3ZV8A 5TCAA 3P70B 1GMCG 3A7ZA 1QY6A 2O9QA 1GGDB 1PQ7A 5GDSH 2J2UA 3HKJB 3TJUA 1BRCE 4WXIA 1TPSA 2WUBA 5DKMA 1RXPA 1ZSJA 1P3EA 1E38B 3BG4B 1W3CA 3E8LA 1FIWA 2OQ5A 1Y3WA 3TK6A 3K9XB 1LQDB 1B0EA 1NU9A 3BTHE 1MQ5A 1PJPA 2R0KA 1KLJH 6GCHF 1AO5A 2J95A 2F9VA 2Z9KA 1EZQA 2R0LA 2AMPA 1NZQH 4Y0YE 3A7VA 1ZGIA 1SR5C 1ZJDA 2V3OH 2FI4E 3AK5A 2TRMA 1VGCB 1TALA 1BA8B 2ZO3H 4HZHA 2PGBB 1UK3A 1SGTA 1SPJA 4JCNA 1V2VT 2PSYA 1C5WB 3D23A 1E35B 3UOUA 4K5ZA 5K7RA 1ABIH 1BRUP 5CMXH 1CBWC 6CHAC 1K22H 1N6YA 1A5GH 2GTBA 3OX7U 1FQ3A 4D9QA 2W7UA 2F9OA 1BQYA 4CR5A 3RXQA 2BY9X 2P16A 1FMGA 5GCHG 3D65E 1YPGH 4MPWA 1P03A 1C2EA 2FPZA 1A0LA 3AVZA 2WINI 2B5TB 4X8TH 3SU4A 3ZYDA 1XVOA 1IQNA 1OWJA 1GPZA 1S6FA 3PB1E 1ZR0A 4ZHAA 1NS3A 3KL6A 2QV1A 4FUGA 4FUDA 1EATA 1YCPM 2FESH 5FCRA 4X8UH 5C2ZA 1IQEA 2UWOA 1FN8A 1WU1A 4KTUA 1KLTA 3MHWU 4K1SA 1TLDA 2TGTA 4X6OA 1P01A 3S9BA 3PYHA 4AFUA 2BVSH 7LPRA 1IQJA 1O3AA 2HPQH 2SGPE 4GHTA 1C5UA 2NU2E 2BX4A 1MCVA 5L2YH 4BTUB 4UFGH 1P2QA 1OOKB 1O3CA 4NFEA 1C2LA 3BTGE 3A82A 2XCNA 4RI0A 3RXLA 1ZHRA 3M61U 1K21H 5LPEA 1D6WA 1GHVH 3RXOA 2D1JA 2JH6D 5DP8A 2R2MB 1EAIA 1K1IA 1O3LA 2BOKA 1BITA 4Q7XA 4I8LA 2ZTYA 2AS9A 1TX8A 1O2KA 4JZEH 2ZHQH 2FX6A 2STBE 3C27B 3R3GB 1F0UA 4H4FA 5E2OA 4B71A 1LHGH 2FTMA 1GJBB 3TVJB 1C2MA 2JH5D 1VR1H 5E8EH 1O2RA 9LPRA 1YP9A 2FOFA 5F03A 1ESBA 2FOBA 5C3NA 2VJ1A 3HGPA 4KELA 2ZFPH 5E0JA 1ZHMA 1O37A 2A4OA 3A8BA 1O3MA 1XKBC 3RXDA 3ZZ3A 1O2OA 4OS6A 2SGAA 3TK9A 2XCFA 1QGFA 1ZRKA 3CENA 4ZROA 4H6SB 4JMYA 5IDKA 1HAGE 1A3EH 2B9LA 3U1JB 2G4TA 4OS7A 5I46H 1FY5A 1OKXA 4AN7A 2SNVA 2AH4X 3SUEA 3U1IB 1UCYE 4JYVH 3SU0A 4I8JA 3SUDA 1TFXA 1N8OC 1ELGA 3GY6A 1Y5UT 2SGFE 1L0ZA 8ESTE 8GCHG 2XW9A 4INKA 5LPRA 2P8OB 2Z6BD 3BTQE 4INHA 1F2SE 2ZI2H 1W14U 3B8JA 1O2TA 1PYTD 2VVVA 2XYAA 2G4UA 2Z3CA 3RDZA 3SNAA 2GCHF 2QXIA 4FU7A 1BRAA 4GSOA 2VBCA 1SGIB 3S7KB 1GBIA 3E6PH 1QCPA 4ZH8A 2FEQH 3A87A 1DXPA 2BB4A 1UCYH 1UCYK 1Y3VA 2ASUB 1Z8RA 2TPIZ 4FXGH 3SI4H 5TJXA 4CBNA 5FAHA 4QT8C 1PPFE 3PV5A 4O3UA 1P09A 1P05A 1O5EH 1QR3E 1TNJA 5GPIB 3AASA 2WPJS 1P11E 1OWKA 4K2YA 1GJDB 2AIPA 3Q00A 2ZFQH 4K69A 4TY7A 3T62A 4AFQA 1SGFA 4TPYA 1H9IE 2VGCB 1H9HE 1JBUH 1DFPA 4TWWA 4M7GA 2ZHWH 4A5TS 4CH8B 1GVKB 2H9TH 3BN9A 1DS2E 1MTNC 2AFQB 2GCTB 4ABGA 2FOGA 2IN2A 2BY6X 3RU4D 4Y8XA 5HXFA 1BOQA 3DFJA 2PKAB 5L2ZH 2BX3A 2PKAA 1AE8H 1FI8A 2Q1JA 2ZQ1A 2ZP0H 1C1NA 2WV9A 4NSVA 3LPRA 3M5LA 3FP7E 4YT7H 2ZDVH 2K1QA 2FOCA 2J4IA 4X6PA 2CHAC 1BB0B 2PV9B 5PTPA 2EI6A 1TBRH 2PKSB 5C5OA 3RXCA 5JBCS 1O5GH 2XBXA 2GZ8A 1HDTH 4Y8YA 3QZQA 3SU6A 2O8TA 2P93A 2W3IA 3A8CA 3GY7A 3LGYA 4MQAA 1GHXH 2Y5FA 1O3JA 1XUIA 1DSTA 1THSH 4XBBA 1KXCA 1TGBA 3ODFA 1DSUA 1O30A 2OC1A 2Y7ZA 1GI5A 3ZVFA 4YLQH 3LGWA 4CRBA 4B76A 1C2JA 1V2JT 4WMDA 1RIWC 1YBWA 4Q7ZA 3GYMA 1HLTH 3NWUA 3NXPA 4GCHF 5EODA 5EU8A 1C9PA 2HNTF 1EKBB 3RLYH 3FZZA 3EE0B 2VNTA 3ZVEA 2VWMA 1O3FA 2GT8A 3A8DA 1C1SA 1PPEE 5EPYA 1F5RA 4H42U 1GMHF 1WCZA 1UVOA 2BDAA 1O2ZA 1AB9C 1GDQA 2GD4B 2WV4A 2VWOA 2WPKS 1YLCA 3ENSB 4B2CA 1ESAA 2D2DA 4YOJA 1DWBH 5LGOA 1CT2E 3I78A 1OXGA 1V2QT 1MUEB 1UTLM 5GJ4B 1K1MA 1LVBA 4AGKA 1ZSKA 1C1OA 3GICB 1V2LT 4BNRA 3I77A 1YLDA 3M36A 3FFGA 3SN8A 2ZEBA 1P9UA 2FS9A 3ODDA 3PTBA 3OSYA 1OWDA 1C1VH 1P06A 1T8NA 5T6GA 1J9CH 2A4QA 1NY22 1GI6A 3MH4A 3V3MA 1LHDH 1TRMA 3BTFE 1TRNA 2PSXA 1HGTH 1F7ZA 5DGJA 3QN7A 1C9TA 3PO1C 2ZGXH 1SGRE 2QY0B 2WPIS 2QIQA 2BXTH 4TYDA 1UTPA 2ILNA 2WPHS 3VPKA 1GG6C 2BYAX 1BUIA 1S83A 1SFQB 2ZWLH 3T29A 3UNQA 1Z1IA 2WUCA 2ZHFH 2BZ6H 1NRQH 1WOFA 2EC9H 1H4WA 1GHBF 1OYTH 3F9HA 1TGNA 1P57B 5JB9S 1ACBE 4R8TB 2Y82A 3SJ9A 4NIXA 2G51A 4Q80A 3V7TA 5F6MA 1UVUH 1ELTA 2JETC 3M5MA 3Q3XA 1TABE 1ANEA 2FIRH 1DPOA 2GV6A 1LTOA 2ZU4A 2OXSA 2OD3B 3LGTA 2ZF0H 3C1KA 4B6FA 3H5CB 4YT6H 4BAOB 1HIAB 4FVDA 3TH3H 3QO6A 5HM2A 2RG3A 1GHWH 2P3TB 2OLGA 3GCHB 2OBOA 3T25A 2O8UA 1C4U2 3B23B 2M5TA 1FJSA 4FUHA 3MMGA 2VIQA 1T8LA 4A7IB 6LPRA 3GDSA 3LGIA 2C8YB 3LJOA 3MU1A 4BXWA 5A0AE 3ZZDA 4DCDA 1T31A 4ABFA 1O3DA 1AZZA 3MU5A 1TNHA 1QQUA 3ATLA 1JXPA 2BDBA 5C5NA 1GBLA 2GMTB 1C2DA 1MMJN 5LH8A 3MH6A 3SORA 1LMWB 1V3XA 2BY7X 4ZAEA 2QXHA 2R3YA 4I8KA 1GBCA 1WYKA 1L1JA 2ZGBH 3GOVB 4RKJB 2ODQA 2XC5A 2FM2A 3SGQE 1SGNE 1VITH 4JZFH 3MO6A 1GWAA 2OCVB 4KP0A 3NPSA 2V0BA 3NZIA 4JZ1A 4NZQA 3V12A 3SBKA 1HV7A 4MNVA 2F3CE 4DURA 5CE1A 2B8OH 4ABHA 3ZZ5A 3QWCH 4OS2A 4BOHA 1U6QA 1P9SA 4X1QU 4I33A 2GDEH 1CVWH 3D49H 1BTYA 3A85A 3IG6B 3LJJA 3V0XA 3LONA 2QCYA 3G01A 4Q2KA 4KKDA 4GHQA 1OYQA 1NRSH 4AB8A 4WMFA 5EOKA 4UFEH 3MU4A 3ITIA 1C5PA 1OP0A 2FOAA 4LZ1H 1Z8JB 2GVFA 1HPGA 2V6NA 1N1LA 4MPVA 3FAOA 1YCPH 3URCA 1RFNA 2Z94A 2BY8X 4NWLA 2VIWA 3PMJA 4BAMB 2TGDA 5AHGH 1NESE 3P92A 1HNEE 1MU8B 1NFUA 3UFAA 1TGSZ 2AGEX 2CV3A 1SC8U 3TGKE 2CN0H 1ELAA 4WWYA 1BZXE 4CREA 1AKSB 1SG8B 2TGAA 7GCHG 1G30B 1QB9A 4YLUA 2AEIH 1GI8B 1B0FA 3RXVA 2BLWA 4FU8A 2D8WA 5DPAA 1ELDE 1VCQA 5C1XA 1ZPCA 3NK8A 1QL8A 1ETRH 2UUFB 1V2WT 4MTBA 1C5YB 2NU0E 2EI7A 2CF9H 1O5BB 2BDGA 1BMAA 4NFFA 1TWXB 4D7GA 4A92A 4BTTB 1C5NH 4RKOB 1C5LH 1HAZB 3LOXA 3UWJH 3S9CA 1O3IA 1O35A 2SFAA 3PWCA 4IBLH 1G3BA 2V35A 1Q2WA 1QTFA 2HPPH 4HI3A 3OTJE 3FP8E 1PPZA 2WZQA 4XDEA 3LT3A 1EJNA 1A3BH 1O0DH 4K1EA 1EB1H 1QNJA 2KAIB 2Y5GA 3TH2H 1HJAB 2IJOB 1AY6H 1H8IH 3MU0A 4DJZB 2FLBH 4HFPB 1IHSH 3QGJA 1W7XH 2BM2A 2P3FH 3RP2A 5A8YA 3E16B 2ZDLA 1BT7A 1KYNA 2OTVA 1JIMA 1UVPA 1C1PA 3UUZA 1P0SH 3SGAE 3S0NA 4AYVB 3SHCH 4UDWH 2LPRA 2I6QA 1L1NA 1GMCF 1FDPA 1NRRH 4PROA 2P59A 1O3HA 1A0JA 3LIWA 4KGAA 2PKSC 2Y6TA 1GVZA 3M5NA 1C1MA 5AF9H 3IWMA 1O2QA 3UIRA 3AW1A 2ZFFH 5DP3A 3DUXH 1CO7E 2BHGA 2QXJA 1NM6A 1UTOA 2OBQA 1O3GA 3RM0H 2ANMH 3M7UA 1HUTH 1TMBH 3UR9A 1YKTA 5JB8S 3F9EA 1FV9A 3P8OA 1G3EA 2AERH 2PGQB 3KQBA 5FX5A 1Y3YA 1C1TA 4ASHA 4ZUHA 1J8AA 4FUEA 1HAPH 2FMJA 1GL1A 2QF0A 1FY3A 4Z6AH 1K28D 1G36A 3N7OA 2IPHA 2W5EA 3O8DA 3U98H 1WAYB 1DITH 2F83A 3KQDA 3TK5A 5A0CA 2VWNA 3VB3A 3UQOA 3UQVA 1W10U 1AQ7A 4I31A 4UFDH 3UOPA 1LPZB 3ZVAA 1GJ6A 3BEFB 2QN5T 1YPHC 4WY3A 3I29A 3RXMA 3URDA 1XUFA 3MI4A 3QX5H 2A32A 1CGHA 2ZU2A 4K8YA 1LHFH 2FYQA 4K8BA 1EPTB 1S5SA 1KXBA
chains in the Genus database with same CATH superfamily
1EPTA 2VIVA 4HTCH 2FYRA 1OS8A 5GCHF 5KEDA 1P2KA 1THRH 1YPKH 3S9AA 1C5OH 4B1TA 4H6TA 3EA9A 3RMOH 3ATWA 3U8RH 5KGOA 1XUHA 2XXLA 2OQUA 2AGIX 4JZIA 4NGAH 3FOAA 5K0HA 3GCTG 2O8WA 5EJ1A 4LOYH 1V2TT 1A2CH 1C5SA 1P2IA 2G8TA 3Q3KA 3OYPA 1ZRBA 2ALVA 2G52A 1E0FD 2Z3DA 2A45B 1C2FA 1PPBH 1RJXB 2ZCHP 3TLOA 2GZ9A 1NO9H 1WQVH 2C90B 2VU8E 1G2LA 1EZUC 2Y5HA 3SOSA 1IAUA 4NA7A 2R9PA 1NFWA 3KIDU 2ZU5A 5F8ZA 1DUAA 3O8CA 5GNDA 1Z8GA 1IQIA 2A5KA 1ZTKA 1O2VA 2PTNA 1QURH 3VFEA 1IQGA 1C5RA 3CS0A 1S6HA 1QIXB 2FZZA 1P2OA 1YPEH 3A7XA 3HATH 3OAAD 4FUBA 3TJOA 1CT0E 2P95A 1DT2A 2KM0A 2GGVB 4X1SU 2FDAA 1HAOH 3SI3H 1MZDA 1C2HA 3SV7A 3ATMA 2I6SA 3E3TA 4AZ2B 1NN6A 8KME2 1XUJA 2G81E 4B2BA 1TNKA 1H9LB 1LVMA 1ZMJA 1OWHA 1W7GH 2Y81A 2F9NA 3P8NA 3RXJA 2HVXA 4ESTE 1ANDA 3K6ZA 1A0HB 1UVSH 1ELFA 2R2WU 4X6NA 2ESTE 3SNCA 1MD8A 1CQQA 2UWPA 4AC9A 2VVUA 1VCPA 8LPRA 5GWZA 4CHAC 1Z71A 1LKAA 3ATIA 1TPAE 4XSKU 2ZPSA 5DP9A 1CHGA 4Z1MD 1CA0B 3E90B 3KNXA 2UWLA 1S0RA 4TT3D 3VXEH 1MTUA 3BEIB 2XBYA 3OY5U 1ZSLA 2ZHEH 1SBWA 4SGBE 5FBIA 1BTUA 3UY9A 3ZZ4A 2WYGA 2A7CA 5FCKA 4DW2U 1AHTH 2HNTE 1GBEA 3LGVA 2QF5A 1P02A 1O3KA 1UTKA 3ZVBA 3E0PB 2FWWA 4X8SH 1QBNA 3CNRA 2V7QD 4NWKA 4ZKNU 1N6XA 3RXSA 1O2UA 8GCHF 1O2WA 3P8GA 1AVXA 4YESB 4Z0KA 1F92A 4BXSA 1GI0A 1NBMD 4DOQA 4LK4A 3WY8A 3M7TA 2PHBA 2PW8H 1EOLA 1ID5H 3GISB 4Y79A 4AX9H 1P3CA 1TNIA 3NKKA 1O2GH 2H2ZA 1UHBA 5FXLA 1O3PB 2STAE 1UTMA 1HXFH 2H1UA 3KQ5A 2RCEA 1BTXA 1GJ8B 1EZXC 4B2AA 3SV9A 1NC6A 1YLNA 2P94A 1GJ9B 2FI3E 2HGTH 1MD7A 1UK4A 3VB7A 1VJAU 3GY2A 3TJNA 1G32B 4IC5A 1S82A 2C8WB 4WVPE 2OUAA 5DP6A 2B7DH 5BRRE 4BTIB 1L4DA 2Y80A 3M3VA 1TGTA 1WXRA 3NCLA 1BMNH 3BTTE 4JK6A 1QHRB 3H7TA 3RC5A 3M5OA 3TITA 2UUKB 1LHEH 1CHOG 4VGCB 4B75A 3UNRA 3HKIB 1AFQC 3AW0A 3SUGA 4TWYA 2Z9JA 3F2FA 2DUCA 3KEEA 2ZPRA 1GJAB 3DSGA 3LU9B 4ZKOU 1MU6B 7KMEH 1KTSB 3RXKA 1TMUH 3MNBA 4CRFA 1MTWA 1GL0E 1AE5A 1CHOF 2ZDAH 4ACBA 3PLPA 1KXAA 3T5FH 1SLUB 1AU8A 1YPJH 1HJ9A 3BF6H 1NPMA 1Y5BT 3VGCB 3F1SB 1UVTH 3MYWA 3QGNB 2WPDD 3A7TA 5EJLA 4O9VA 2GV7A 3TGIE 2PUQH 1O2SA 3RXUA 4X1NU 3DFLA 1T4VH 3ZZAA 4AG1A 4NG9H 2NWNA 1O2YA 3F2HA 1TA6A 3STIA 4Y7BA 4XBDA 2ZCLP 3BTWE 4IS5A 2B0FA 1IQLA 1GCTC 1QA7A 1GI4A 1ANCA 4GAWA 5KECA 3O8RA 2V3MA 3VB4A 2BDYA 3FANA 1FN6A 4I32A 4ZHLU 1AWFH 2ANYA 3OY6U 1W8BH 2H9EH 3QUMP 1NRPH 5JDUB 1CBWB 3SZEA 1MKWH 1MKWK 1XKAC 1GI7B 2WYJA 5FHTA 2QAAA 3KHVA 1GGDC 9ESTA 2RFKC 1KXFA 3T26A 3SV6A 1SQAA 1V2UT 4IMZA 1O5CB 3OU0A 2GDDA 3STJA 4E06H 3BG4C 1Z6JH 1SQRA 2AMQA 2D26C 1XUGA 1LCYA 2C93B 2TIOA 4AFSA 1H8HD 5JBTA 1EXFA 1GI3A 1GBTA 1SOTA 4NIVA 4D9RA 2A7HA 1MBQA 2HRVA 1O3NA 1K9OE 4NA9H 4OGYA 4YOIA 3ZZCA 4CH2B 1EJAA 1VCWA 1FY1A 1O2LA 1TNGA 2BDCA 2BQ6B 4ABIA 4ACAA 1AIXH 5H4IB 1ETSH 2SGDE 1CGIE 3SW2B 1A5IA 1VGCC 2KCAA 1GJCB 1EP5A 3DSPA 3KCGH 1WSSH 1Z6EA 1AD8H 3RXBA 5B6OA 1WQSA 1BTWA 4LXBH 3MNSA 3A83A 5DP5A 2EY4C 4D7FA 1GVLA 3HK3B 1BBRE 1EZSC 5C67A 2FO9A 1TYNA 1D4PB 1GI1A 4OS4A 2FOEA 4ISHH 1AGJA 2ZGCA 3Q3YA 1P2JA 1GBMA 1OP8A 3DSOA 3D62A 1L4ZA 4ZXXH 1E79D 1AI8H 3W95A 2Y7XA 1TIOA 2ZG0H 1FZZA 3LC5A 2C8XB 3GCNA 3DT0H 1W11U 1EJMA 1RD3B 3TH4H 1C5XB 1Z8IB 3WWBA 2C4FH 5DK1A 3T27A 1HAVB 5FX6A 1P12E 1GDUA 3BTDE 1BBRH 1BBRK 1HAVA 1HRTH 4YO9A 3LH3A 5E0HA 2O8LA 4WH6A 1AUTC 1DLEA 1YPHE 2WPLS 4IC6A 3ZYEA 3RM2H 2BZAA 1O2JA 1ZZZA 2HNTC 4JK5A 4IN1A 1GJ4H 1AFEH 1EAWA 1MTVA 2XC4A 1THPB 3F3BA 4J1YA 1DVAH 5AVDA 4DGJA 2J94A 3KYGA 4E7RG 3TIUA 2H9HA 3RMLH 1DXWA 2W3KA 3V13A 3P8FA 1TE0A 1VKYA 4DT7B 3MH7A 4NIYA 2VB0A 1KY9A 1C2GA 1BTHH 7ESTE 1V2PT 1M9UA 4X6MA 1FLEE 4GUXA 1WUNH 3RXIA 3BEUA 4AOQA 3EA8A 1LPKB 1QL7A 3FVFB 3OFND 4F4OC 1ZYOA 1N8OB 4FUCA 1EX3A 1INCA 1J15A 1O38A 1SHHB 2EA3A 1EASA 3VB6A 1A5HA 2VH0A 3MOCA 3SQHE 5IK2D 3U8OH 1JMOH 4IN2A 2PFEA 2F9PA 4Y76A 4BAQB 5EGMA 3RLWH 4LZ4B 1O36A 1PYTC 3MTYA 1WV7H 3EQ0H 3OTPA 1GBAA 1OX1A 2J97A 4TY6A 4M9FA 2R3UA 5IYTA 1SSXA 1C1UH 1P04A 1ZMLA 5FBEA 1BMMH 1C1QA 1V6DA 5HIYA 1YCPK 1CSOE 1BRBE 2Z9IA 4ISLA 1O3EA 3OEED 3HPTB 1KSNA 3BSQA 1Y8TA 1SMFE 2OC7A 3BTME 1MQ6A 4XOJA 1A7SA 2F91A 1RRKA 2ZFTA 2ZNKH 3RXHA 1MTNB 3PTNA 2P8OC 2YOLA 1C1WH 1KLIH 3P6ZB 1ZJKA 1UTJA 4CR9A 1V2KT 3E1XB 1AUJA 2BD3A 3MO3A 3M3SA 3PMHB 1QJ6B 3EYDA 5ETXA 3UNSA 3S69A 2H5DA 1RTFB 1GHAG 1HCGA 2ULLA 3RXGA 3MO9A 1F5KU 4YM9A 5EXMA 1LQEA 3GY4A 1E37B 1V2NT 4ASUD 7GCHF 3MNXA 3A84A 4BANB 4TPIZ 1UTNA 2CHAB 4INLA 2ALPA 2Z9GA 2AMDA 4Y11E 1E36B 1EAUA 5E2PA 3K65B 3W94A 1O39A 1ORFA 1VITG 2FI5E 1IQMA 1QRXA 2GX4A 1D9IA 3NUMA 2AIQA 2PLXA 2RDLA 1KXDA 3RXRA 3KN2A 1WBGB 2FP7B 4AYYB 2VGCC 3H7OA 1O5FH 4X8VH 2BMGB 1T8MA 3UR6A 1F0TA 4Y71A 2J98A 3IITA 2FTLE 4B73A 1SL3A 1WTHD 2GCTC 1YWUA 1RIWB 4ISNA 1LKBA 5C1UA 4Q4LA 5EPNA 3JZ1B 4FUJA 1Z7KA 2UUJB 1NU7B 4ZHMU 1NTPA 1O5AB 2A1DB 2ANKH 1TOCB 5AFYH 4NA8A 1SGQE 4KTCA 1Y3UA 3DCLA 1TGCA 1IOEA 2K0QA 1GI9B 1GCDA 3HK6B 1HAIH 1SLVB 3GCOA 3TU7H 1JIRA 1AB9B 1TMTH 1FUJA 1A61H 2DE9A 1W12U 3UWIA 4BAKB 4K1TA 1QB6A 3MU8A 6GCHG 1BMFD 1F0SA 1MBMA 3VGCC 1SGCA 1BTPA 2NU1E 1LPGB 1P2NA 1CT4E 1K1OA 2ZZUH 3ZZBA 2VH6A 2OC0A 1ELCA 1D3PB 1KIGH 1FAKH 1O2MA 1TOMH 2FX4A 1JRTA 3LGUA 5FPYA 2FOMB 3F0OA 1TQ7B 5CHBA 2ZKSA 2THFB 1TNLA 5LPFA 2BDHA 4Y6DA 2ZDNA 4OGXA 1ZTJA 3GDVA 3PO1B 5EQQA 5EG4A 3M7QA 3BTEE 3KQEA 4UE7H 1SGPE 2J34A 4WMEA 1GBJA 4ZMAH 1GG6B 3LDXH 4XBCA 3T28A 1BMLA 3ELAH 4NIWA 1TBQH 2BD9A 5BPEA 1LDTT 1D3TB 2F9UA 5JBAS 4I7YH 1G37A 3Q76A 3T2NA 1F5LA 2YMSB 4DIIH 4GVUA 5DSFA 4A6LA 1DLKB 1ELVA 3QK1A 1HBTH 2H5CA 2JETB 2GKVE 3CP7A 2ZECA 1DANH 4RN6A 3AAVA 1HFDA 3FZDA 1ANBA 3A86A 5EQRA 1Q3XA 1YYY1 1PFXC 1XXDA 2ODPA 5F8TA 1NT1A 2XBVA 4DY7B 4O97A 5TCCA 4IGDA 1FPHH 3RXFA 1ZHPA 2Z3EA 1O31A 1KTTB 5T6FA 4Q7YA 1JRSA 3PLBA 3GCTF 1B7XB 3U69H 5ABWA 1GI2A 2YMSD 4SGAE 1FPCH 5ESTE 1AMHA 1QFKH 1Z1JA 1TONA 1C1RA 1TPOA 1FY8E 2QF4A 1PPCE 3RXPA 5I25A 1QB1A 2VINA 1X7AC 3F6UH 3F9FA 4A1XA 1AVGH 2BD7A 3EDXB 5SGAE 1IQHA 1TAWA 1TX6A 3DHKH 1DOJA 3SNEA 2VIPA 4MDSA 1QZ8A 3RUOA 5A09A 3F68H 1LVOA 2W26A 1GHZA 2J38A 1K1LA 2AGGX 1D3QB 3MFJA 4CRDA 3RMMH 1IQKA 1RGQA 1DE7H 2XWBI 3SNBA 3GCHC 2FLRH 1A46H 1QJ1B 3ZZ6A 1JOUB 1CGJE 3EA7A 2QYIA 3F9GA 1SLXB 2QC2A 3GY5A 3TNSA 3TGJE 2Q6GA 3E0NB 2ANWA 2BD8A 2BLVA 1C4Y2 1J17T 4X0WU 4Y8ZA 1ARBA 1C5VA 1LVYA 4FUFA 4K3JA 4X1PU 3A8AA 1GDNA 5C17A 2GT7A 2Q6DA 2XBWA 3EAJA 4NZLA 2GMTC 3QZRA 1NFYA 1SFIA 1GJ5H 2BD4A 2BOHB 2EEKA 3QTOH 3SHAH 3GYLB 1FONA 5E0GA 3SQEE 3P17H 2CJIA 4MVNA 4AB9A 1DY8A 4JYUH 1V2MT 1W2KH 2SGQE 1IQFA 2GCHG 2ZQ2A 1GMDG 1OWEA 1K1JA 1HXEH 2QE7D 3K6YA 3F0PA 1E34B 2QA9E 1TBZH 3CS7A 3SU3A 1V2OT 2FS8A 1FIZA 1QQ4A 1ETTH 3SJ8A 5A0BA 1FNIA 2VWLA 4F48B 3L3TA 1UHBB 1GMDF 4U30A 5CHAB 1XVMA 1ZPBA 4MPUA 1GJ7B 1VZQH 4FVBA 5T6DA 2IOTA 1FXYA 1H8DH 2BXUH 3GY3A 3U9AH 1DM4B 2XWAA 2GP9B 1W0YH 1BJUA 2EI8A 3LH1A 2OP9A 3SZNA 1L1GA 1TPPA 5F8XA 3SNDA 1PQAA 1TA2A 1V2ST 1LHCH 1C5ZB 4MNYA 1SGYE 2F4LA 2ODYB 5DJ7A 1ELEE 4X1RU 2PTCE 3VB5A 2XNIA 3MNCA 1ABJH 2BQ7B 1C4V2 1ZPZA 3PV2A 3TJVA 1RS0A 1UMAH 2ZA5A 1DDJA 4YOGA 5C0TA 3RXAA 2TBSA 4F55A 1OPHB 1MKXH 1MKXK 1GBBA 2BLOA 5T3HA 1K1NA 2CF8H 4MG3A 3M37A 5DP4A 2ZTXA 3A81A 3TPIZ 1QBOA 3RXTA 3BIUH 2ZIQH 1EP6A 1XM1A 2QF3A 2TGPZ 1W0JD 1DY9A 1O32A 3BIVH 1BDAA 3HGNA 3R0FA 5HYOA 2A4RA 2C8ZB 3M35A 4MPXA 3SYJA 3PROA 4NSYA 2L6OA 3S7HB 1L2EA 1CE5A 3QTVH 2SGEE 3RC6A 2Q6FA 1ZTLA 4XE4A 2EQNA 4ZKRU 4FUIA 4DIHH 2ZDKA 1RTLA 3PV4A 1A4WH 1BTZA 5J4SA 1ARCA 3N99A 4THNH 1ZMNA 3P95A 1GBFA 1DWDH 1IHTH 5DN6D 1C2KA 3A80A 2J9NA 3LKWA 4MLFB 5AFZH 3UPEA 3TNTA 3VEQB 4IW4E 2OINA 3RU4E 1NRNH 2O8MA 4OM9A 1MZAA 5C1YA 1GBHA 4AG2A 4MNXA 2A2XH 4XD7D 3SV2H 2NU4E 1UTQA 3L33A 4GCHG 2BQWB 2C3SA 3ZVGA 2HLCA 1WTGH 1HJAC 3DD2H 1BIOA 1Y59T 2Z9LA 3GY8A 1BHXB 1P2MA 3VXFH 1GMHG 4GLYA 6CHAB 3RC4A 1G3CA 2ZGHA 3RXEA 5T1VA 4Y0ZE 1QJ7B 1H1BA 2L74A 2PUXB 2ZGJA 2LNCA 3DA9B 3ZVDA 1PQ8A 3ESTA 1FY4A 1QRZA 5A8ZA 5L6NH 2A0QB 1P8VC 1OP2A 5GXPA 2YNAA 4K60A 2A2QH 1EOJA 1XMNB 2JH0D 4AFZA 1KDQB 4DG4A 4E7NA 1KDQA 1TB6H 4WH8A 4CRAA 4DVAU 2BD2A 1CA8B 4FU9A 4ABJA 2CGAA 2HOBA 1YGCH 2WPMS 1DWCH 3B9FH 1O33A 1C5MD 2JJ2D 1O2XA 1BJVA 4X2YA 1O2PA 2BVXH 1K0HA 1MAYA 5HKKD 1MH0A 4ABBA 2BVRH 4B6EA 1C5QA 2A7JA 1DX5M 4U32A 3A7WA 1J16A 4I8GA 5EQSA 1ZGVA 4IMQA 3M3TA 4NCYA 2BD5A 5EXNA 1HAXB 1V2RT 2OK5A 4ABDA 2A5AA 1S0QA 2QGRA 3LC3A 1QRWA 1T4UH 1P10A 3MWIU 5EXLA 3ZZ7A 3PLKA 1GHBG 1EUFA 2ZPQA 1T32A 5GIBA 1MAXA 2FODA 1SGDE 3FO8D 4ISOA 1DUEA 1O2NA 2ZFRH 2Z7FE 5EJZA 1T8OA 1SB1H 1XX9A 2G55A 3UTUH 5C0UA 3OE7D 2ZC9H 1EPTC 3SGBE 1ZOMA 5JBBS 1HAHH 1Y3XA 2RA0A 1ESTA 3PMBB 5HMAA 1F0RA 2VIOA 2F9BH 3RMNH 4BAHB 4B74A 5G4BA 1QBVH 3ZV9A 3SJKA 2ZDMA 3EGKH 4UEHH 3SV8A 3QLPH 1UJ1A 3OEHD 3SO3A 1KXEA 1D3DB 1RTKA 3ZZ9A 3Q77A 2ZU3A 1EAXA 2IJD1 1QA0A 1PPHE 1SGEE 5FPSA 1TX7A 2GZ7A 1S81A 1HIAA 1FAXA 2PR3A 1ELBA 3PWBA 1T7CA 4O03A 1O3OA 5FL7D 4YTAA 4CRCA 1Y5AT 2NU3E 1GBKA 4FETA 4ISIH 4ZKSU 4I8HA 3FP6E 2HWLB 2OC8A 3BTKE 1UK2A 5HGGA 2HALA 1OWIA 2SNWA 3BV9B 5C20A 1SHYA 4CHAB 5JYIA 1SVPA 5EW2H 1EFRD 1A1RA 2IPQX 1SGFG 1C5TA 2G5NA 3BG8A 2VIDA 2BTCE 4OS1A 3QDZB 1Q31A 4WXVA 2A4GA 4UD9H 2QXGA 2J92A 2M2AA 4X2VA 4JYTA 2A31A 5JPMH 1SLWB 3A88A 1VJ9U 4A1VA 1KMHB 3ATKA 1JWTA 1YF4A 4OS5A 1O2IA 1AN1E 1UO6A 1GHYH 1HYLA 2CMYA 5DG6A 1EQ9A 2G00A 4UONA 3AAUA 1W0ZU 1G2MA 1AVWA 1G9IE 3O8BA 5ESBA 4E05H 3U28C 4J2YB 1O34A 5FPTA 1NFXA 5C94A 4X2WA 2XC0A 2ZCKP 2V3HH 2ZHDA 1BCUH 4JZDH 3SU2A 1PQ5A 4MNWA 4Y7AA 2BDIA 4ZXYH 1D6RA 3MH5A 2XTTB 1CA0C 2YNBA 1K1PA 3E91A 2ZTZA 1G3DA 4X2XA 2ZU1A 4Q63A 4ABAA 2VVCA 2FOHA 2PWXA 4XFQA 3SJIA 4P02A 3RU4T 5HM9A 5EW1H 3KF2A 4D76A 1DICA 1QL9A 3SUFA 4A1TA 1J14A 1YC0A 1LO6A 2WSSD 3KQCA 1HAYB 1AFQB 1HB0B 5DP7A 3GDUA 2FXRA 3UREA 2BLQA 4CRGA 2W7SA 2AHME 3JZ2B 1SQTA 2AYWA 1C2IA 4R0IA 1SOZA 1HJ8A 3A89A 3A7YA 1BHXF 4WF8A 1AKSA 3L6PA 1GHAF 2F43B 2G5VA 3U8TH 2XRCA 2HLDD 4GPGA 4RT0A 1EB2A 5CHAC 1NROH 5DO4H 1S85A 1PPGE 4CBOA 1MABB 5A8XA 4AORA 3ZZ8A 3SU1A 5L30H 1YM0A 1SQOA 1W13U 1AWHB 1YPMH 1YPLH 4U2WA 1GBDA 1VITF 2J98B 2WV5A 4HGCA 4U01A 2A5IA 5A2MH 3PM3A 1MCTA 3H09A 1CU1A 1B5GH 1DWEH 5J4QA 3ZVCA 4KTSA 1ZLRA 2JKHA 1TQ0B 3NRLA 2DE8A 2CXVA 4Y10E 2RA3A 1K2I1 4WJG2 4F49A 2WHXA 4D8NA 3KGPA 4O3TA 1TRYA 3SU5A 1O2HA 4UFFH 4AGJA 1MTSA 1AZ8A 1OSSA 2P3UB 1O3BA 1SI5H 3SJOA 4VGCC 1XUKA 3PMAB 1GCTB 4RSPA 4ABEA 1O5DH 2KAIA 2BY5X 5B6LA 1XXFA 2UUYA 4I86A 6ESTA 4YZUA 1S84A 2H6MA 2ZFSA 3EE7A 3K2UA 3ZV8A 5TCAA 3P70B 1GMCG 3A7ZA 1QY6A 2O9QA 1GGDB 1PQ7A 5GDSH 2J2UA 3HKJB 3TJUA 1SKYE 1BRCE 4WXIA 3PRDA 1TPSA 2J5UA 3GS9A 2WUBA 5DKMA 1RXPA 1ZSJA 1P3EA 1E38B 3BG4B 1W3CA 3E8LA 1FIWA 1WDIA 2OQ5A 1Y3WA 3TK6A 3K9XB 1LQDB 1B0EA 1NU9A 3BTHE 1MQ5A 1PJPA 2R0KA 1KLJH 6GCHF 1AO5A 2J95A 2F9VA 2Z9KA 1EZQA 2R0LA 2AMPA 1NZQH 4Y0YE 3A7VA 1ZGIA 2KFWA 1SR5C 1ZJDA 2V3OH 2FI4E 3AK5A 2TRMA 1VGCB 2XNDD 1TALA 1BA8B 2ZO3H 4HZHA 2PGBB 1UK3A 1SGTA 1SPJA 4JCNA 1V2VT 2PSYA 1C5WB 3D23A 1E35B 3UOUA 4K5ZA 5K7RA 1ABIH 1BRUP 5CMXH 1CBWC 6CHAC 1K22H 1N6YA 1A5GH 2GTBA 3OX7U 1FQ3A 4D9QA 4RT1A 2W7UA 2F9OA 1BQYA 4CR5A 3RXQA 2BY9X 2P16A 1FMGA 5GCHG 1COWD 3D65E 1YPGH 4MPWA 1P03A 1C2EA 2FPZA 1A0LA 3AVZA 3MQKC 2WINI 2B5TB 4X8TH 3SU4A 3ZYDA 1XVOA 1IQNA 1OWJA 1GPZA 1S6FA 3PB1E 1ZR0A 4ZHAA 1NS3A 3KL6A 2QV1A 4FUGA 4FUDA 4FOUC 1EATA 1YCPM 2FESH 5FCRA 4X8UH 5C2ZA 1IQEA 2UWOA 3F2GA 1FN8A 1WU1A 4KTUA 1KLTA 3MHWU 4K1SA 1TLDA 2LELA 2TGTA 4X6OA 1P01A 3S9BA 3PYHA 4AFUA 2BVSH 4XRNA 7LPRA 1IQJA 1O3AA 2HPQH 2SGPE 4GHTA 1C5UA 2NU2E 2BX4A 1MCVA 5L2YH 3WWFA 4BTUB 4UFGH 1P2QA 1OOKB 1O3CA 4NFEA 1C2LA 3BTGE 3A82A 2XCNA 4RI0A 3RXLA 1ZHRA 3M61U 1K21H 5LPEA 1D6WA 1GHVH 3RXOA 2D1JA 2JH6D 5DP8A 2R2MB 1EAIA 4YXWD 1K1IA 1O3LA 2BOKA 1BITA 4Q7XA 4I8LA 2ZTYA 2AS9A 1TX8A 1O2KA 4JZEH 2ZHQH 2FX6A 2STBE 3C27B 3R3GB 1F0UA 4H4FA 5E2OA 4B71A 1LHGH 2FTMA 1GJBB 3TVJB 1C2MA 2JH5D 1VR1H 5E8EH 1O2RA 9LPRA 1YP9A 2FOFA 5F03A 1ESBA 2FOBA 5C3NA 2VJ1A 3HGPA 4KELA 2ZFPH 5E0JA 1ZHMA 1O37A 2A4OA 3A8BA 1O3MA 1XKBC 3RXDA 3ZZ3A 1O2OA 4OS6A 2SGAA 3TK9A 2XCFA 2JJ1D 3FKSD 1QGFA 1ZRKA 3CENA 4ZROA 4H6SB 4JMYA 1UW7A 5IDKA 1HAGE 1A3EH 2B9LA 3U1JB 4TSFD 2G4TA 4OS7A 5I46H 1FY5A 1OKXA 4AN7A 2SNVA 2AH4X 3SUEA 3U1IB 1UCYE 4JYVH 3SU0A 4I8JA 3SUDA 1TFXA 1N8OC 1ELGA 3GY6A 1Y5UT 2SGFE 1L0ZA 8ESTE 8GCHG 2XW9A 4INKA 5LPRA 2P8OB 2Z6BD 3BTQE 4INHA 1F2SE 2ZI2H 1W14U 3B8JA 1O2TA 1PYTD 2VVVA 2XYAA 2G4UA 2Z3CA 3RDZA 3SNAA 2GCHF 2QXIA 4FU7A 1BRAA 4GSOA 2VBCA 1SGIB 3S7KB 1GBIA 3E6PH 1QCPA 4ZH8A 2FEQH 3A87A 1DXPA 3UB0A 2BB4A 1UCYH 1UCYK 1Y3VA 2ASUB 1Z8RA 2TPIZ 3PV5A 4FXGH 5TJXA 3SI4H 4CBNA 4QT8C 1PPFE 5FAHA 4O3UA 1P09A 1P05A 1O5EH 1QR3E 1TNJA 5GPIB 3AASA 2WPJS 1P11E 1OWKA 4K2YA 1GJDB 2AIPA 3Q00A 2ZFQH 4K69A 4TY7A 3T62A 4AFQA 1SGFA 4TPYA 1H9IE 2VGCB 1H9HE 1JBUH 1DFPA 2PP6A 4TWWA 4M7GA 2ZHWH 4A5TS 4CH8B 1GVKB 2H9TH 3BN9A 1DS2E 1MTNC 2AFQB 2GCTB 4ABGA 2FOGA 2IN2A 1NBME 2BY6X 4Y8XA 3RU4D 5HXFA 1BOQA 3DFJA 2PKAB 5L2ZH 2KR7A 2BX3A 2PKAA 1AE8H 1FI8A 2Q1JA 2ZQ1A 2ZP0H 1C1NA 2WV9A 4NSVA 3LPRA 3M5LA 3FP7E 4YT7H 2ZDVH 2K1QA 2FOCA 2J4IA 4X6PA 2CHAC 1BB0B 2PV9B 5PTPA 2EI6A 2LP6A 1TBRH 3N7EA 2PKSB 5C5OA 3RXCA 5JBCS 1O5GH 2XBXA 2GZ8A 1HDTH 4Y8YA 3QZQA 3SU6A 2O8TA 2P93A 2W3IA 3A8CA 3GY7A 3LGYA 4MQAA 1GHXH 2Y5FA 1O3JA 1XUIA 1DSTA 1THSH 4XBBA 1KXCA 3VG8A 1TGBA 3ODFA 1DSUA 1O30A 2OC1A 2Y7ZA 1GI5A 3ZVFA 4YLQH 3LGWA 4CRBA 4B76A 1C2JA 1V2JT 4WMDA 1RIWC 1YBWA 1FX0B 4Q7ZA 3GYMA 1HLTH 3NWUA 3NXPA 4HG6A 4GCHF 5EODA 5EU8A 1C9PA 2HNTF 5EIYA 1EKBB 3RLYH 3FZZA 3EE0B 2VNTA 3ZVEA 2VWMA 1O3FA 2GT8A 3A8DA 1C1SA 1PPEE 5EPYA 1F5RA 4H42U 1GMHF 1WCZA 1UVOA 2BDAA 1O2ZA 1S6LA 4ZCNA 1AB9C 1GDQA 2GD4B 2WV4A 2VWOA 2WPKS 1YLCA 3ENSB 4B2CA 1ESAA 2D2DA 4YOJA 1DWBH 5LGOA 1CT2E 3I78A 1OXGA 1V2QT 1MUEB 1UTLM 5GJ4B 1K1MA 1LVBA 4AGKA 1ZSKA 1C1OA 3GICB 1V2LT 4BNRA 2KCPA 3I77A 1YLDA 3M36A 3FFGA 3SN8A 2ZEBA 1P9UA 2FS9A 3ODDA 2JIZD 3PTBA 3OSYA 1OWDA 1C1VH 1P06A 1T8NA 2W6JD 5T6GA 1J9CH 2A4QA 1NY22 1GI6A 3MH4A 3V3MA 1LHDH 1TRMA 3BTFE 1TRNA 2PSXA 1HGTH 1F7ZA 5DGJA 3QN7A 1C9TA 3PO1C 2ZGXH 1SGRE 2QY0B 1YY3A 2WPIS 2QIQA 2BXTH 4TYDA 1UTPA 2ILNA 2WPHS 3VPKA 1GG6C 2BYAX 1BUIA 1S83A 1SFQB 2ZWLH 3T29A 3UNQA 1Z1IA 2WUCA 2ZHFH 2BZ6H 1NRQH 1WOFA 2EC9H 5CDFE 1H4WA 1GHBF 1OYTH 3F9HA 1TGNA 1P57B 5JB9S 1ACBE 4R8TB 2Y82A 2YMSC 3SJ9A 4NIXA 2G51A 4Q80A 3V7TA 5F6MA 1UVUH 1ELTA 2JETC 3M5MA 3Q3XA 1TABE 1ANEA 2FIRH 1DPOA 2GV6A 1LTOA 2KCYA 2OXSA 2OD3B 2ZU4A 3LGTA 2ZF0H 3C1KA 4B6FA 3H5CB 4YT6H 4BAOB 1HIAB 4FVDA 3TH3H 3QO6A 5HM2A 2RG3A 1GHWH 2P3TB 2OLGA 3GCHB 2OBOA 3T25A 2O8UA 1C4U2 3B23B 2M5TA 1FJSA 4FUHA 3MMGA 2VIQA 1T8LA 4A7IB 6LPRA 2RDEA 3GDSA 3LGIA 2C8YB 3LJOA 3MU1A 4BXWA 5A0AE 3ZZDA 4DCDA 1T31A 5HIZA 4ABFA 1O3DA 1AZZA 3N7DA 3MU5A 1TNHA 1QQUA 3ATLA 1JXPA 2BDBA 3W1EA 5C5NA 1GBLA 2GMTB 1C2DA 1MMJN 5LH8A 3MH6A 3SORA 1LMWB 1V3XA 2BY7X 4ZAEA 2QXHA 2R3YA 4I8KA 1GBCA 1WYKA 1L1JA 2ZGBH 3GOVB 4RKJB 4DT4A 2ODQA 2XC5A 2FM2A 3SGQE 1SGNE 1VITH 4JZFH 3MO6A 1GWAA 2JDID 2OCVB 4KP0A 3NPSA 2V0BA 3NZIA 4JZ1A 4NZQA 3V12A 2GJGA 3SBKA 1HV7A 4MNVA 2F3CE 4DURA 5CE1A 2W6ID 2B8OH 4ABHA 3ZZ5A 3QWCH 4OS2A 4BOHA 1U6QA 1P9SA 4X1QU 4I33A 2GDEH 1CVWH 3D49H 1BTYA 3A85A 1H8ED 3IG6B 3LJJA 3V0XA 3LONA 2QCYA 3G01A 4Q2KA 4KKDA 4GHQA 1OYQA 1NRSH 4AB8A 4WMFA 5EOKA 4UFEH 2KZ4A 3MU4A 3ITIA 1C5PA 1OP0A 2FOAA 4LZ1H 1Z8JB 2GVFA 1HPGA 2V6NA 1N1LA 4MPVA 3FAOA 1YCPH 3URCA 1RFNA 2Z94A 2BY8X 4NWLA 2VIWA 3PMJA 4BAMB 2TGDA 5AHGH 3KYFA 1NESE 3P92A 1HNEE 1MU8B 1NFUA 3UFAA 1TGSZ 2AGEX 2CV3A 1SC8U 3TGKE 2CN0H 1ELAA 3PRBA 1BZXE 4WWYA 4CREA 1AKSB 1SG8B 2TGAA 7GCHG 1G30B 1QB9A 4YLUA 2AEIH 1GI8B 1B0FA 3RXVA 2BLWA 3UAIC 4FU8A 1W0KD 2D8WA 5DPAA 3WW7A 1ELDE 1VCQA 5C1XA 1ZPCA 3NK8A 1QL8A 1ETRH 2UUFB 1V2WT 4MTBA 5F53A 1C5YB 2NU0E 2EI7A 2CF9H 1O5BB 2BDGA 1BMAA 4NFFA 1TWXB 4D7GA 4A92A 4BTTB 1C5NH 4P00A 4RKOB 1C5LH 1HAZB 3LOXA 3UWJH 3S9CA 1O3IA 2CK3D 1O35A 2SFAA 3PWCA 4IBLH 1G3BA 2V35A 1Q2WA 1QTFA 2HPPH 4HI3A 3OTJE 3FP8E 1PPZA 2WZQA 4XDEA 3LT3A 3FN8A 1EJNA 1A3BH 1O0DH 4K1EA 1EB1H 1QNJA 2KAIB 2Y5GA 3TH2H 2KCOA 1HJAB 2IJOB 1AY6H 1H8IH 3MU0A 4DJZB 2FLBH 4HFPB 1IHSH 3QGJA 1W7XH 2BM2A 2P3FH 3RP2A 5A8YA 3E16B 2ZDLA 1BT7A 1KYNA 2OTVA 1JIMA 1UVPA 1C1PA 3UUZA 1P0SH 2XOKD 3SGAE 3S0NA 4AYVB 1E1QD 4UDWH 3SHCH 3ZIAD 2LPRA 2I6QA 1L1NA 1GMCF 1FDPA 1NRRH 4PROA 2P59A 1O3HA 1A0JA 3LIWA 4KGAA 2PKSC 2Y6TA 1GVZA 3M5NA 2K8IA 1C1MA 5AF9H 3IWMA 1O2QA 3UIRA 3AW1A 2ZFFH 5DP3A 3DUXH 1CO7E 2BHGA 2QXJA 1NM6A 1UTOA 2OBQA 1O3GA 3RM0H 2ANMH 3M7UA 1HUTH 1TMBH 3UR9A 1YKTA 5JB8S 3F9EA 1FV9A 3P8OA 1G3EA 2AERH 2PGQB 3KQBA 5FX5A 1Y3YA 1C1TA 4ASHA 4ZUHA 1J8AA 4FUEA 1HAPH 2FMJA 1GL1A 2QF0A 1FY3A 1OHHD 4Z6AH 1K28D 1G36A 3N7OA 2IPHA 2W5EA 3O8DA 3U98H 1WAYB 1DITH 2F83A 3KQDA 3TK5A 5A0CA 2VWNA 3VB3A 3UQOA 3UQVA 1E1RD 1AQ7A 1W10U 4I31A 4UFDH 3UOPA 1LPZB 3ZVAA 1GJ6A 3BEFB 2HVYB 2QN5T 1YPHC 4WY3A 3I29A 2KX4A 3RXMA 3URDA 1XUFA 3MI4A 3QX5H 2A32A 1CGHA 2ZU2A 4K8YA 1LHFH 2FYQA 4K8BA 1EPTB 1S5SA 1KXBA
chains in the Genus database with same CATH topology
1EPTA 2VIVA 4HTCH 2FYRA 1OS8A 5GCHF 1P2KA 1THRH 1YPKH 3S9AA 1C5OH 4B1TA 4H6TA 3EA9A 3RMOH 3ATWA 3U8RH 1XUHA 2XXLA 2OQUA 2AGIX 4JZIA 4NGAH 3FOAA 5K0HA 3GCTG 2O8WA 4LOYH 1V2TT 1A2CH 1C5SA 1P2IA 2G8TA 3Q3KA 3OYPA 1ZRBA 2ALVA 2G52A 1E0FD 2Z3DA 2A45B 1C2FA 1PPBH 1RJXB 2ZCHP 3TLOA 2GZ9A 1NO9H 1WQVH 2C90B 2VU8E 1G2LA 1EZUC 2Y5HA 3SOSA 1IAUA 4NA7A 2R9PA 1NFWA 3KIDU 2ZU5A 5F8ZA 1DUAA 3O8CA 5GNDA 1Z8GA 1IQIA 2A5KA 1ZTKA 1O2VA 2PTNA 1QURH 3VFEA 1IQGA 1C5RA 3CS0A 1S6HA 1QIXB 2FZZA 1P2OA 1YPEH 3A7XA 3HATH 3OAAD 4FUBA 3TJOA 1CT0E 2P95A 1DT2A 2KM0A 2GGVB 4X1SU 2FDAA 1HAOH 3SI3H 1MZDA 1C2HA 3SV7A 3ATMA 2I6SA 3E3TA 4AZ2B 1NN6A 8KME2 1XUJA 2G81E 4B2BA 1TNKA 1H9LB 1LVMA 1ZMJA 1OWHA 1W7GH 2Y81A 2F9NA 3P8NA 3RXJA 2HVXA 4ESTE 1ANDA 3K6ZA 1A0HB 1UVSH 1ELFA 2R2WU 4X6NA 2ESTE 3SNCA 1MD8A 1CQQA 2UWPA 2VVUA 1VCPA 8LPRA 5GWZA 4CHAC 1Z71A 1LKAA 3ATIA 1TPAE 4XSKU 2ZPSA 5DP9A 1CHGA 4Z1MD 1CA0B 3E90B 3KNXA 2UWLA 1S0RA 4TT3D 3VXEH 1MTUA 3BEIB 2XBYA 3OY5U 1ZSLA 2ZHEH 1SBWA 4SGBE 5FBIA 1BTUA 3UY9A 3ZZ4A 2WYGA 2A7CA 5FCKA 4DW2U 1AHTH 2HNTE 1GBEA 3LGVA 2QF5A 1P02A 1O3KA 1UTKA 3ZVBA 3E0PB 2FWWA 4X8SH 1QBNA 2V7QD 4NWKA 4ZKNU 1N6XA 3RXSA 1O2UA 8GCHF 1O2WA 3P8GA 1AVXA 4YESB 4Z0KA 1F92A 4BXSA 1GI0A 4DOQA 1NBMD 4LK4A 3WY8A 3M7TA 2PHBA 2PW8H 1EOLA 1ID5H 3GISB 4Y79A 4AX9H 1P3CA 1TNIA 3NKKA 1O2GH 2H2ZA 1UHBA 5FXLA 1O3PB 2STAE 1UTMA 1HXFH 2H1UA 2RCEA 1BTXA 1GJ8B 1EZXC 4B2AA 3SV9A 1NC6A 2P94A 1GJ9B 2FI3E 2HGTH 1MD7A 1UK4A 3VB7A 1VJAU 3GY2A 3TJNA 1G32B 4IC5A 1S82A 2C8WB 4WVPE 2OUAA 5DP6A 2B7DH 5BRRE 4BTIB 1L4DA 2Y80A 3M3VA 1TGTA 1WXRA 3NCLA 1BMNH 3BTTE 4JK6A 1QHRB 3H7TA 3RC5A 3M5OA 3TITA 2UUKB 1LHEH 1CHOG 4VGCB 4B75A 3UNRA 3HKIB 1AFQC 3AW0A 3SUGA 4TWYA 2Z9JA 3F2FA 2DUCA 3KEEA 2ZPRA 1GJAB 3LU9B 4ZKOU 1MU6B 7KMEH 1KTSB 3RXKA 1TMUH 3MNBA 4CRFA 1MTWA 1GL0E 1AE5A 1CHOF 2ZDAH 3PLPA 1KXAA 3T5FH 1SLUB 1AU8A 1YPJH 1HJ9A 3BF6H 1NPMA 1Y5BT 3VGCB 3F1SB 1UVTH 3MYWA 3QGNB 3A7TA 2WPDD 4O9VA 2GV7A 3TGIE 2PUQH 1O2SA 3RXUA 4X1NU 3DFLA 1T4VH 3ZZAA 4AG1A 4NG9H 2NWNA 1O2YA 3F2HA 1TA6A 3STIA 4Y7BA 4XBDA 2ZCLP 3BTWE 4IS5A 2B0FA 1IQLA 1GCTC 1QA7A 1GI4A 1ANCA 4GAWA 3O8RA 3VB4A 2BDYA 3FANA 1FN6A 4I32A 4ZHLU 1AWFH 2ANYA 3OY6U 1W8BH 2H9EH 3QUMP 1NRPH 5JDUB 1CBWB 3SZEA 1MKWH 1MKWK 1XKAC 1GI7B 2WYJA 5FHTA 2QAAA 3KHVA 1GGDC 9ESTA 1KXFA 3T26A 3SV6A 1SQAA 1V2UT 4IMZA 1O5CB 3OU0A 2GDDA 3STJA 4E06H 3BG4C 1Z6JH 2D26C 2AMQA 1XUGA 1LCYA 2C93B 2TIOA 4AFSA 1H8HD 5JBTA 1EXFA 1GI3A 1GBTA 1SOTA 4NIVA 4D9RA 2A7HA 1MBQA 2HRVA 1O3NA 1K9OE 4NA9H 4OGYA 4YOIA 3ZZCA 4CH2B 1EJAA 1VCWA 1FY1A 1O2LA 1TNGA 2BDCA 2BQ6B 4ABIA 1AIXH 5H4IB 1ETSH 2SGDE 1CGIE 3SW2B 1A5IA 1VGCC 2KCAA 1GJCB 1EP5A 3DSPA 3KCGH 1WSSH 1Z6EA 1AD8H 3RXBA 5B6OA 1WQSA 1BTWA 4LXBH 3MNSA 3A83A 5DP5A 4D7FA 1GVLA 3HK3B 1BBRE 1EZSC 5C67A 2FO9A 1TYNA 1D4PB 1GI1A 4OS4A 2FOEA 4ISHH 1AGJA 2ZGCA 3Q3YA 1P2JA 1GBMA 1OP8A 3DSOA 3D62A 1L4ZA 4ZXXH 1E79D 1AI8H 3W95A 2Y7XA 1TIOA 2ZG0H 1FZZA 3LC5A 2C8XB 3GCNA 3DT0H 1W11U 1EJMA 1RD3B 3TH4H 1C5XB 1Z8IB 3WWBA 2C4FH 5DK1A 3T27A 1HAVB 5FX6A 1P12E 1GDUA 3BTDE 1BBRH 1BBRK 1HAVA 1HRTH 4YO9A 3LH3A 5E0HA 2O8LA 4WH6A 1AUTC 1DLEA 1YPHE 2WPLS 4IC6A 3ZYEA 3RM2H 2BZAA 1O2JA 1ZZZA 2HNTC 4JK5A 4IN1A 1GJ4H 1AFEH 1EAWA 1MTVA 2XC4A 1THPB 3F3BA 4J1YA 1DVAH 5AVDA 4DGJA 2J94A 4E7RG 3TIUA 2H9HA 3RMLH 1DXWA 2W3KA 3V13A 3P8FA 1TE0A 4DT7B 3MH7A 4NIYA 2VB0A 1KY9A 1C2GA 1BTHH 7ESTE 1V2PT 1M9UA 4X6MA 1FLEE 4GUXA 1WUNH 3RXIA 3BEUA 4AOQA 3EA8A 1LPKB 1QL7A 3FVFB 3OFND 4F4OC 1ZYOA 1N8OB 4FUCA 1EX3A 1INCA 1J15A 1O38A 1SHHB 2EA3A 1EASA 3VB6A 1A5HA 2VH0A 3MOCA 3SQHE 5IK2D 3U8OH 1JMOH 4IN2A 2PFEA 2F9PA 4Y76A 4BAQB 5EGMA 3RLWH 4LZ4B 1O36A 1PYTC 3MTYA 1WV7H 3EQ0H 3OTPA 1GBAA 1OX1A 4TY6A 4M9FA 2R3UA 5IYTA 1SSXA 1C1UH 1P04A 1ZMLA 5FBEA 1BMMH 1C1QA 1V6DA 1YCPK 1CSOE 1BRBE 2Z9IA 4ISLA 1O3EA 3OEED 3HPTB 1KSNA 3BSQA 1Y8TA 1SMFE 2OC7A 3BTME 1MQ6A 4XOJA 1A7SA 2F91A 1RRKA 2ZFTA 2ZNKH 3RXHA 1MTNB 3PTNA 2P8OC 2YOLA 1C1WH 1KLIH 3P6ZB 1ZJKA 1UTJA 4CR9A 1V2KT 3E1XB 1AUJA 2BD3A 3MO3A 3M3SA 3PMHB 1QJ6B 3EYDA 5ETXA 3UNSA 3S69A 2H5DA 1RTFB 1GHAG 1HCGA 2ULLA 3RXGA 3MO9A 1F5KU 4YM9A 5EXMA 1LQEA 3GY4A 1E37B 1V2NT 4ASUD 7GCHF 3MNXA 3A84A 4BANB 4TPIZ 1UTNA 2CHAB 4INLA 2ALPA 2Z9GA 2AMDA 4Y11E 1E36B 1EAUA 5E2PA 3K65B 3W94A 1O39A 1ORFA 1VITG 2FI5E 1IQMA 1QRXA 2GX4A 1D9IA 3NUMA 2AIQA 2PLXA 2RDLA 1KXDA 3RXRA 3KN2A 1WBGB 2FP7B 4AYYB 2VGCC 3H7OA 1O5FH 4X8VH 2BMGB 1T8MA 3UR6A 1F0TA 4Y71A 3IITA 2FTLE 4B73A 1SL3A 1WTHD 2GCTC 1RIWB 4ISNA 1LKBA 5C1UA 5EPNA 4Q4LA 3JZ1B 4FUJA 1Z7KA 2UUJB 1NU7B 4ZHMU 1NTPA 1O5AB 2A1DB 2ANKH 1TOCB 5AFYH 4NA8A 1SGQE 4KTCA 1Y3UA 3DCLA 1TGCA 1IOEA 2K0QA 1GI9B 1GCDA 3HK6B 1HAIH 1SLVB 3GCOA 3TU7H 1JIRA 1AB9B 1TMTH 1FUJA 1A61H 2DE9A 1W12U 3UWIA 4BAKB 4K1TA 1QB6A 3MU8A 6GCHG 3VGCC 1F0SA 1MBMA 1BMFD 1SGCA 1BTPA 2NU1E 1LPGB 1P2NA 1CT4E 1K1OA 2ZZUH 3ZZBA 2VH6A 2OC0A 1ELCA 1D3PB 1KIGH 1FAKH 1O2MA 1TOMH 2FX4A 1JRTA 3LGUA 5FPYA 2FOMB 3F0OA 1TQ7B 5CHBA 2ZKSA 2THFB 1TNLA 5LPFA 2BDHA 4Y6DA 2ZDNA 4OGXA 1ZTJA 3GDVA 3PO1B 5EQQA 5EG4A 3M7QA 3BTEE 3KQEA 4UE7H 1SGPE 2J34A 4WMEA 1GBJA 4ZMAH 1GG6B 3LDXH 4XBCA 3T28A 1BMLA 3ELAH 4NIWA 1TBQH 2BD9A 5BPEA 1LDTT 1D3TB 2F9UA 5JBAS 4I7YH 1G37A 3Q76A 3T2NA 1F5LA 2YMSB 4DIIH 4GVUA 5DSFA 4A6LA 1DLKB 1ELVA 3QK1A 1HBTH 2H5CA 2JETB 2GKVE 3CP7A 2ZECA 1DANH 4RN6A 3AAVA 1HFDA 3FZDA 1ANBA 3A86A 5EQRA 1Q3XA 1YYY1 1PFXC 1XXDA 2ODPA 5F8TA 1NT1A 2XBVA 4DY7B 4O97A 5TCCA 4IGDA 1FPHH 3RXFA 1ZHPA 2Z3EA 1O31A 1KTTB 5T6FA 4Q7YA 1JRSA 3PLBA 3GCTF 1B7XB 3U69H 5ABWA 1GI2A 2YMSD 4SGAE 1FPCH 5ESTE 1AMHA 1QFKH 1Z1JA 1TONA 1C1RA 1TPOA 1FY8E 2QF4A 1PPCE 3RXPA 5I25A 1QB1A 2VINA 1X7AC 3F6UH 3F9FA 4A1XA 1AVGH 2BD7A 3EDXB 5SGAE 1IQHA 1TAWA 1TX6A 3DHKH 1DOJA 3SNEA 2VIPA 4MDSA 3RUOA 5A09A 3F68H 1LVOA 2W26A 1GHZA 2J38A 1K1LA 2AGGX 1D3QB 3MFJA 4CRDA 3RMMH 1IQKA 1RGQA 1DE7H 2XWBI 3SNBA 3GCHC 2FLRH 1A46H 1QJ1B 3ZZ6A 1JOUB 1CGJE 3EA7A 2QYIA 3F9GA 1SLXB 2QC2A 3GY5A 3TNSA 3TGJE 2Q6GA 3E0NB 2ANWA 2BD8A 2BLVA 1C4Y2 1J17T 4X0WU 4Y8ZA 1ARBA 1C5VA 1LVYA 4FUFA 4K3JA 4X1PU 3A8AA 1GDNA 5C17A 2GT7A 2Q6DA 2XBWA 3EAJA 4NZLA 2GMTC 3QZRA 1NFYA 1SFIA 1GJ5H 2BD4A 2BOHB 2EEKA 3QTOH 3SHAH 3GYLB 1FONA 5E0GA 3SQEE 3P17H 2CJIA 4MVNA 4AB9A 1DY8A 4JYUH 1V2MT 1W2KH 2SGQE 1IQFA 2GCHG 2ZQ2A 1GMDG 1OWEA 1K1JA 1HXEH 3K6YA 2QE7D 3F0PA 1E34B 2QA9E 1TBZH 3CS7A 3SU3A 1V2OT 2FS8A 1FIZA 1QQ4A 1ETTH 3SJ8A 5A0BA 1FNIA 2VWLA 3L3TA 1UHBB 1GMDF 4U30A 5CHAB 1XVMA 1ZPBA 4MPUA 1GJ7B 1VZQH 4FVBA 5T6DA 2IOTA 1FXYA 1H8DH 2BXUH 3GY3A 3U9AH 1DM4B 2XWAA 2GP9B 1W0YH 1BJUA 2EI8A 3LH1A 2OP9A 3SZNA 1L1GA 1TPPA 5F8XA 3SNDA 1PQAA 1TA2A 1V2ST 1LHCH 1C5ZB 4MNYA 1SGYE 2F4LA 2ODYB 5DJ7A 1ELEE 4X1RU 2PTCE 3VB5A 2XNIA 3MNCA 1ABJH 2BQ7B 1C4V2 1ZPZA 3PV2A 3TJVA 1RS0A 1UMAH 2ZA5A 1DDJA 4YOGA 5C0TA 3RXAA 2TBSA 4F55A 1OPHB 1MKXH 1MKXK 1GBBA 2BLOA 5T3HA 1K1NA 2CF8H 4MG3A 3M37A 5DP4A 2ZTXA 3A81A 3TPIZ 1QBOA 3RXTA 3BIUH 2ZIQH 1EP6A 1XM1A 2QF3A 2TGPZ 3BIVH 1DY9A 1O32A 1W0JD 1BDAA 3HGNA 3R0FA 5HYOA 2A4RA 2C8ZB 3M35A 4MPXA 3SYJA 3PROA 4NSYA 2L6OA 3S7HB 1L2EA 1CE5A 3QTVH 2SGEE 3RC6A 2Q6FA 1ZTLA 4XE4A 4ZKRU 4FUIA 4DIHH 2ZDKA 1RTLA 3PV4A 1A4WH 1BTZA 5J4SA 1ARCA 3N99A 4THNH 1ZMNA 3P95A 1GBFA 1DWDH 1IHTH 5DN6D 1C2KA 3A80A 2J9NA 3LKWA 4MLFB 5AFZH 3UPEA 3TNTA 3VEQB 4IW4E 2OINA 3RU4E 1NRNH 2O8MA 4OM9A 1MZAA 5C1YA 1GBHA 4AG2A 4MNXA 2A2XH 4XD7D 3SV2H 2NU4E 1UTQA 3L33A 4GCHG 2BQWB 2C3SA 3ZVGA 2HLCA 1WTGH 1HJAC 3DD2H 1BIOA 1Y59T 2Z9LA 3GY8A 1BHXB 1P2MA 3VXFH 1GMHG 4GLYA 6CHAB 3RC4A 1G3CA 2ZGHA 3RXEA 5T1VA 4Y0ZE 1QJ7B 1H1BA 2PUXB 2ZGJA 2LNCA 3DA9B 3ZVDA 1PQ8A 3ESTA 1FY4A 1QRZA 5A8ZA 5L6NH 2A0QB 1P8VC 1OP2A 5GXPA 2YNAA 4K60A 2A2QH 1EOJA 1XMNB 2JH0D 4AFZA 1KDQB 4DG4A 4E7NA 1KDQA 1TB6H 4WH8A 4CRAA 4DVAU 2BD2A 1CA8B 4FU9A 4ABJA 2CGAA 2HOBA 1YGCH 2WPMS 1DWCH 3B9FH