2IJOB

Crystal structure of the west nile virus ns2b-ns3 protease complexed with bovine pancreatic trypsin inhibitor
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
176
structure length
168
Chain Sequence
GGVLWKKGDTTTGVYRIMTRGLLGSYQAGAGVMVEGVFHTLWHTTKGAALMSGEGRLDPYWGSVKEDRLCYGGPWQLQHKWNGQDEVQMIVVEPGRNVKNVQTKPGVFKTPEGEIGAVTLDFPTGTSGSPIVDKNGDVIGLYGNGVIMPNGSYISAIVQGERMDEPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyprotein
publication title Structural evidence for regulation and specificity of flaviviral proteases and evolution of the Flaviviridae fold.
pubmed doi rcsb
source organism West nile virus
molecule tags Hydrolase/hydrolase inhibitor
total genus 29
structure length 168
sequence length 176
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00949 Peptidase_S7 Peptidase S7, Flavivirus NS3 serine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ijoB02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2ijoB01
2HRVA 5C5NA 1E34B 3MWIU 1UTPA 2CHAC 5E2OA 1H8DH 1GMDG 4FU9A 3RLYH 5HXFA 5I46H 1AB9C 1CE5A 3RXEA 4E7NA 2SNWA 5GCHG 1HBTH 4TYDA 2EI6A 1Y3WA 2CXVA 2BLQA 2DE8A 4GHQA 1XM1A 5JDUB 1V2NT 3PV4A 5DKMA 4U30A 1GCTB 5LPRA 2SGAA 1BHXF 3TITA 3PMAB 4PROA 2RA0A 2VINA 1QB9A 1ZPZA 2VH0A 1V2LT 3AASA 2I6QA 3LGYA 1YPGH 4FUCA 2G8TA 4ABAA 1GMHG 4CRBA 3F9FA 1FAXA 5TJXA 1K1NA 1JIRA 4CHAC 2ZGJA 3SU5A 1EUFA 1ZPBA 3SUDA 1TALA 4WVPE 1Z8GA 1XKBC 1L1GA 4E06H 1LCYA 1P12E 3GDSA 2ZCKP 1Y5BT 1DDJA 2GTBA 1XKAC 2GX4A 3GY4A 1HDTH 1GHXH 1BJUA 1C2DA 1UVTH 1V2WT 3AK5A 1XXDA 3IWMA 1JMOH 4CR9A 3L3TA 4I7YH 3Q77A 1FY8E 2IN2A 5DGJA 9LPRA 4AFSA 1K9OE 3QGJA 1KLJH 3MU0A 3DUXH 1FDPA 1V2QT 3JZ1B 1NFUA 1EZXC 3KQDA 1ZSJA 3SOSA 3TLOA 4YOJA 2AMPA 1V2KT 4AZ2B 3PROA 2BTCE 1WYKA 4CRGA 1BTHH 1SFIA 4ISHH 2H2ZA 3BTEE 4IBLH 1GBDA 1MCTA 1RTLA 1BIOA 2RDLA 1TLDA 2Z94A 1O3BA 4DT7B 3T29A 1GVZA 2H1UA 4SGAE 2Q6FA 3AW1A 2XC4A 1L4ZA 4X6OA 4DVAU 1UVOA 4ZXYH 1GJ8B 1C5SA 1MQ5A 4FU8A 2VJ1A 1O39A 3ZZ8A 3CP7A 4KTSA 2VWMA 1RFNA 3EA7A 1C4V2 3ZZ7A 1AKSB 2G55A 1H8IH 3RXFA 3TJNA 2Q6GA 1ELVA 1ZTLA 2PTCE 2QIQA 2VWNA 3RU4D 4ZMAH 4Y6DA 2XXLA 4NSVA 3A87A 2F9BH 1D3PB 3FFGA 4LXBH 4DG4A 1BMMH 4RKOB 1C5WB 1GHYH 1NROH 2G52A 4X0WU 3VB5A 2FOFA 2ZF0H 1XX9A 3RXGA 4FUIA 2O8MA 5JB9S 2A5AA 1HXEH 1GJBB 3EAJA 5DPAA 2ZCHP 3RMOH 1ELGA 3GY7A 2SGDE 2XCFA 3KQCA 3HK6B 1SHHB 2P16A 4F4OC 4NIYA 2ALVA 4NZQA 1C5OH 3RU4E 1DE7H 1EPTA 2OQ5A 2WPKS 1P2IA 3SV7A 5B6LA 2P93A 1PYTD 1TX7A 3PM3A 1ABIH 2C4FH 2Z3CA 4LZ1H 4WMDA 1HJAC 4OS1A 5GJ4B 4ZH8A 4XBCA 4H4FA 4NA9H 1XMNB 1TA6A 3SJ8A 3U69H 1LQEA 1CA0C 1ELAA 1O3KA 2JH0D 1YLCA 4MPVA 2J2UA 1INCA 1J14A 3U1JB 4BAMB 1AUTC 2PSYA 3LH3A 4RKJB 1YPKH 3RXVA 1PJPA 1NTPA 1ZJDA 2AGGX 2P3UB 4BTTB 2HNTF 3GYMA 1QURH 1MTSA 1B0FA 5BRRE 3NXPA 1TNKA 2ZHEH 3L6PA 4Y7BA 4ABHA 3O8DA 2J4IA 1C5XB 3MO3A 2R0LA 2V0BA 2A7JA 1GG6B 3LGTA 2J95A 2Z9LA 4GCHF 5EG4A 3Q00A 2ZP0H 2NU2E 5EU8A 1YM0A 1UK4A 3A7TA 1OKXA 4K69A 3A8AA 1G2MA 1VITG 1FV9A 3H5CB 1GI8B 3TK5A 1QL7A 4TWWA 3LGWA 1XUHA 4YLQH 2Z3DA 1P04A 1BRBE 4DURA 3PMBB 1BTXA 1YPMH 3ZZ3A 9ESTA 3UPEA 8ESTE 2VB0A 4I8LA 2FS9A 5A8XA 3SO3A 4NG9H 1AIXH 4CBOA 1BA8B 4ZKOU 3RM2H 1SHYA 2C8YB 3NK8A 2GCTB 3V7TA 2PGBB 5C2ZA 1F5LA 1KXDA 4NSYA 2XBYA 5FBEA 1MTNB 4D7FA 1MAXA 1PFXC 4NWLA 1BRCE 3TK9A 1LHFH 3ZVGA 3NPSA 4B73A 2PLXA 3ZZ9A 1EZSC 1JRTA 1UCYE 1ARCA 1T32A 4TY6A 3M3SA 4WWYA 4D9RA 2W26A 4O9VA 3A82A 4BXWA 1F0SA 3TJUA 2BZAA 1MBQA 1BDAA 3K65B 2J38A 2WUCA 1KXEA 4Y71A 1UCYK 1TYNA 3LT3A 1V2PT 2CGAA 2A0QB 3TH4H 2FLRH 1UTNA 1EASA 4K1SA 1O3PB 1FI8A 1YGCH 4BAHB 1IQKA 1NRRH 3SU2A 5AFYH 1FY4A 3NWUA 2AFQB 4KELA 1K2I1 1OYQA 1O3GA 1UTQA 1AO5A 2Y81A 1KYNA 1CBWB 2BDAA 2ZA5A 3GCHB 1NFYA 1O3CA 1DUAA 2ZU2A 1WCZA 4B2AA 1GI7B 1O31A 1LDTT 1J8AA 2V35A 4AB9A 1SGCA 4YTAA 3SNCA 3RXLA 1HFDA 4DIIH 2OC0A 1QJ1B 1PPZA 5AF9H 3KQEA 4AGKA 1F0TA 4XBBA 3B23B 4Q7ZA 1QHRB 1P57B 2Z9IA 3DFLA 3TK6A 1FY3A 2ZECA 2ZKSA 3MU5A 3UWJH 1DSUA 2VIVA 1ZHPA 4YZUA 3SJKA 1AZZA 1NFXA 1NRPH 2TGPZ 3DHKH 2BD8A 2ZQ2A 4Q7XA 4CR5A 1FY5A 1V2ST 2R3UA 2FODA 2ILNA 3BTDE 2V6NA 1C4U2 1AHTH 4IC6A 1CT2E 4K60A 1GHVH 1O33A 2ULLA 3SNBA 3MTYA 4CH8B 4INLA 1DWEH 1D9IA 1PQAA 2P95A 1MZAA 2O9QA 3D49H 1S84A 1LPGB 1J15A 2GCHG 3ENSB 1DANH 5CMXH 1SGQE 1UTLM 1DS2E 3BG4C 1ETSH 1AVWA 5JYIA 3P8OA 1CGJE 3MHWU 1P06A 3GICB 4X1RU 2FYRA 4WXVA 2G51A 4DCDA 6GCHF 4NCYA 1G2LA 4X1PU 1IQJA 2ZFTA 1O3AA 4B6FA 1IHSH 3SNEA 4MNWA 1L4DA 3A8DA 5ABWA 1HUTH 1O3FA 3RXBA 3DFJA 4IS5A 1O34A 4JZIA 3QK1A 3TGKE 1O2KA 3LOXA 1W7XH 5F03A 3SUEA 1ZJKA 1WQSA 1LPKB 5LPFA 2R9PA 1E36B 1OPHB 3UIRA 3ZZ6A 1P2MA 3ZVEA 1TX6A 1A46H 5AVDA 3M5LA 1HV7A 1C4Y2 1DX5M 4Q7YA 3MU1A 1GI0A 3ATMA 1YP9A 2YNBA 2XYAA 5LH8A 1EAWA 5FPTA 1SR5C 2G5NA 1THPB 2A5KA 2A4GA 1F0RA 4ISNA 6ESTA 1T4UH 2FTMA 1FONA 1T8LA 1E37B 4OS6A 5EOKA 1ESBA 1H9HE 1KSNA 1BZXE 1C1NA 4D76A 3RMMH 1KDQA 4ZROA 2OK5A 4B2BA 2ESTE 3Q3KA 3U8OH 1SC8U 1ZGIA 2WPJS 2PUQH 4H42U 3RXHA 1S5SA 1A5IA 1HIAA 1BB0B 1NN6A 3MU8A 3U1IB 1SGTA 2FZZA 3GCNA 1DICA 2CF8H 1MCVA 3ZZAA 3BN9A 1AVGH 1GI5A 4B71A 1UVSH 1G32B 6CHAB 5GCHF 1RJXB 2AEIH 3P92A 1BT7A 3D65E 2GT8A 4X8UH 3SN8A 1EJNA 5B6OA 2ZHFH 3PTBA 1X7AC 2SGPE 4I31A 1P05A 2ASUB 2XRCA 2ZG0H 1WV7H 4FUEA 2GZ7A 3TGIE 1C1SA 1GDNA 1IQNA 1BMLA 2B8OH 5FX5A 3O8BA 2F9NA 1TWXB 2WYGA 1GBMA 1TNLA 1N8OB 3V12A 3SJIA 1VZQH 1Z8IB 1XUFA 1SGYE 3LC5A 2QN5T 1OS8A 1HJ8A 1D6WA 3A8BA 2ALPA 1BTZA 1P3CA 1DLKB 2AMDA 4WJG2 3ZZDA 5TCCA 5E0GA 3S69A 1GJ9B 1UHBB 2FI5E 3ZYDA 4WXIA 2A45B 3OTPA 2W7UA 2BY7X 2A7CA 2Z6BD 1ZSLA 3CS0A 2QY0B 5DP3A 2FI3E 1NZQH 6GCHG 2FDAA 1GI1A 2IPHA 1FXYA 3Q76A 1C5NH 5DP8A 1DITH 4U01A 1NU9A 4M9FA 1O2OA 2OD3B 4WY3A 1O30A 4ABDA 1CHGA 2A4OA 1C9TA 1PYTC 1GBAA 2JH5D 3VB7A 2QC2A 2ZPRA 1O2GH 2TGTA 3AVZA 3ZVAA 4MNXA 1HAHH 1RIWB 1OXGA 1SLUB 1WUNH 1V2JT 2FP7B 2BDCA 1CHOG 1K1OA 4JZ1A 4UFDH 3T62A 1LHDH 1MH0A 2GP9B 1V2RT 2FIRH 2ZEBA 1G37A 1YPEH 2VGCC 3MYWA 4D8NA 2HALA 1QBVH 2CMYA 4NIWA 1C2FA 3SZNA 4Q80A 3MH4A 1AUJA 3SV6A 3SYJA 1SGDE 1DM4B 1TNJA 3UWIA 3GY3A 1GI4A 1OWIA 2D2DA 1DFPA 1MQ6A 2XW9A 1CT0E 1O38A 3A7YA 2I6SA 4H6SB 3LJOA 1NO9H 4IN2A 2ANMH 2QCYA 4MTBA 1Y5UT 1MKWH 4JYTA 3KL6A 4OS2A 2SGFE 2VNTA 3GY2A 3ZVCA 2FO9A 3HPTB 1GHAG 2HVXA 1O36A 1TRNA 4TY7A 1QL8A 1WSSH 4X6MA 4ASHA 3GY6A 2FOMB 7GCHF 2H5DA 2XBXA 4K1TA 4Y7AA 1Z71A 1TGNA 3UNSA 2O8WA 3VFEA 1O2QA 2BXTH 4B1TA 2Z3EA 1A0HB 4JZFH 3P95A 3SU0A 2B5TB 1AE8H 3VPKA 1TE0A 1ZGVA 1SOZA 1QBNA 1GJDB 4A92A 3ATLA 2XCNA 4TPYA 3B8JA 1BBRH 2NU1E 1LVMA 2WPHS 4WMFA 3HGNA 3LC3A 1O35A 2C93B 2HGTH 1HJ9A 3S7HB 2BOKA 4Y76A 5AHGH 3UQVA 3QTVH 1SGIB 3SV8A 4UFEH 1BBRE 1JOUB 1TGSZ 2BD7A 3FP6E 5DP4A 3VEQB 1GBCA 3LGVA 3LH1A 1UJ1A 4MNVA 3BTHE 5CHAC 4XOJA 4MNYA 1BBRK 1O2HA 2PKSC 3TVJB 1QBOA 1IQMA 1HAVA 1DWDH 4UE7H 1QB6A 1A1RA 1G3EA 1LVBA 1ZLRA 2UWOA 4MPUA 2GMTB 1ACBE 3TU7H 3SUFA 2BD3A 1C5VA 1LO6A 2ZCLP 5L30H 4O97A 2TRMA 2BY8X 1TBRH 5EW1H 2BB4A 4U32A 2BDYA 1VITF 1GPZA 5EPNA 3P8FA 1P03A 1UVPA 1AWHB 3H09A 1JWTA 3OU0A 4UD9H 2FOGA 5T6FA 3SGAE 1ETRH 2WYJA 5FCKA 2BZ6H 2VH6A 4OGYA 2BLOA 1C5PA 1C5YB 1FUJA 2FPZA 4A1VA 1N8OC 1S0QA 1Y3VA 2CN0H 2GGVB 3CENA 3UR9A 1LVOA 3A7WA 3MH7A 4ZUHA 3VGCC 2PHBA 1EPTB 3FAOA 3SU6A 1MTVA 3GDVA 1HAGE 1LHEH 1SSXA 2OUAA 3ZV9A 1CA8B 3K6ZA 5K0HA 1MMJN 5GDSH 2DUCA 5H4IB 1RRKA 1PQ5A 2BOHB 1G3CA 2ZHQH 3F1SB 2FLBH 1KXCA 3OYPA 4X2XA 1EP5A 4B2CA 4K8YA 3TIUA 1L2EA 3RXIA 3S9AA 1TPAE 1SI5H 3BEIB 1ZRBA 1O2XA 4BTUB 4ZKRU 3RXQA 2AS9A 3MMGA 3SHCH 1W14U 2BVRH 3MOCA 3OY5U 3PLPA 2WPLS 4JZEH 4MG3A 2C90B 2FI4E 4NFFA 1IQFA 2BX3A 7GCHG 2BY9X 2FYQA 1BTPA 1A4WH 1O5DH 1Z7KA 2A2QH 2VVUA 1GL0E 2OCVB 4CRAA 4Y8XA 3VXEH 4ZHMU 1O2PA 3RP2A 1K1PA 2GZ9A 2F9OA 5J4QA 1XVMA 3V0XA 1HRTH 1V2MT 3JZ2B 3QLPH 1P8VC 1BQYA 3GCTG 2OQUA 1RTFB 3A7XA 5L6NH 3BTKE 1DLEA 1KLIH 2FXRA 4YOGA 3SNAA 1ZSKA 1SB1H 4ZHAA 1SGEE 3A83A 2GV6A 2W3IA 3BTQE 3T27A 1A7SA 1TNGA 1QIXB 1L1JA 1BTYA 2QAAA 1VJAU 3PO1B 4Y8YA 1C5UA 1RD3B 4ABBA 3LJJA 3UOPA 1YF4A 3QZRA 2D1JA 3TPIZ 1G9IE 4OM9A 1A5GH 1GJ7B 1GBJA 2AMQA 2ZQ1A 4K5ZA 2QF0A 5F8TA 4FUHA 5K7RA 5E0HA 4RSPA 2SFAA 2RG3A 1BTUA 3PV2A 1T8NA 1TMUH 2O8LA 4OS4A 4Y11E 3E3TA 1FN6A 1FZZA 2M5TA 1IOEA 1BCUH 3MNXA 2F9PA 1IQGA 2D26C 4JK6A 2V3OH 3I78A 1S6FA 4K8BA 1O2LA 1TIOA 1QJ7B 2CF9H 2WZQA 1H4WA 4B75A 3H7TA 1GCTC 4JK5A 3ATKA 2ZTZA 1PQ8A 3LGIA 1WXRA 1C5LH 4IMZA 1ANCA 1JXPA 4Y79A 1UK2A 3SI3H 1O2MA 1XUIA 3SGBE 1AZ8A 2DE9A 2GCHF 1B7XB 1OOKB 1B5GH 1YCPH 4X1NU 3LGUA 1GBFA 2QXIA 1C1QA 3QGNB 3KQBA 2GV7A 2AGEX 1LMWB 1T4VH 3SNDA 1T8OA 4WH6A 3FVFB 3ESTA 1FPHH 3LKWA 3ELAH 5JB8S 2SGQE 1AD8H 1V2UT 1N1LA 1MUEB 3MO9A 2OBQA 3BTGE 4FUFA 1MKXH 4A1XA 3A85A 4WH8A 3FP7E 5JPMH 1O3OA 1A0LA 2Y7ZA 2TGDA 1OSSA 4YT6H 3Q3XA 1FJSA 2XWAA 2R2MB 2XC5A 2YOLA 1G3DA 1BTWA 2ANKH 4CRDA 4ABGA 4VGCB 5C67A 4X2VA 1V6DA 1MD8A 1O2NA 3GOVB 2NU0E 2Y7XA 4A6LA 6LPRA 4O03A 4MQAA 3RXSA 2F83A 3DT0H 3QX5H 1Y3XA 5SGAE 3BTME 3BF6H 2W7SA 3URCA 3A80A 2BLVA 1SGRE 3MU4A 4RI0A 1EB1H 2F91A 1EJAA 4HI3A 1NFWA 4UONA 2AIPA 1TONA 2SNVA 3L33A 1CT4E 2BD4A 2BM2A 1BRAA 1SGFA 1UTKA 3ZV8A 4FXGH 1UMAH 2JETB 2WINI 2ZFFH 5EGMA 5EODA 3BEFB 1P2OA 2PW8H 1KY9A 2BX4A 4D9QA 2HPQH 2NWNA 1ZYOA 2ZGCA 1SMFE 3C27B 1KTTB 1P2QA 3P70B 3UOUA 5C20A 2FESH 3TGJE 2FX4A 2TGAA 1GGDB 1TQ7B 2C8XB 3HK3B 2OBOA 3SORA 1TGBA 2VBCA 3M3TA 4IMQA 2J94A 2THFB 3GY5A 1ANEA 1O3IA 2QV1A 5FAHA 1O2UA 3OX7U 3P8NA 4IC5A 1HAOH 1OWKA 2BVXH 1AFQB 1QA7A 2PUXB 3MNBA 1QRZA 5GNDA 2ZDAH 3Q3YA 3O8RA 3QN7A 2XBVA 3DA9B 1UO6A 1C9PA 2PR3A 4GHTA 1B0EA 1EAUA 4NIVA 5C1YA 3RDZA 2BQ6B 4BAQB 1TQ0B 4YT7H 1D3QB 1TOMH 1TPPA 3NKKA 1NS3A 1O3EA 4Q2KA 3E90B 4KKDA 1GMCG 1W13U 5A8ZA 3UREA 3R3GB 3PV5A 2P8OB 2UUYA 3M61U 3A88A 2TIOA 1HAXB 4B74A 3PWBA 2AIQA 1P2KA 1W3CA 3UUZA 1C2MA 1QCPA 1Y59T 2BQWB 3M5MA 4KGAA 1UK3A 1KDQB 2ZC9H 2LPRA 3ZZBA 4A1TA 2Y82A 1P9UA 5TCAA 2XC0A 4X1QU 1EZQA 3QTOH 3PLKA 1HIAB 4I33A 1IHTH 5T6GA 8GCHG 1WTGH 4XFQA 3D62A 4X8TH 1TBZH 3RU4T 2ZZUH 1XUGA 1NRSH 1ETTH 3E91A 2P94A 1C2JA 3A7ZA 3ITIA 5A8YA 3IITA 1OP8A 2H9HA 1HB0B 1RS0A 3VB4A 2XTTB 1MTUA 1GG6C 2CHAB 1FY1A 1AB9B 1ELEE 3SJOA 1CHOF 2IOTA 5ESTE 2Q6DA 4DW2U 5F6MA 1W8BH 3M37A 2H9EH 3RMLH 1K21H 2QYIA 3SGQE 3UQOA 2WPIS 1A5HA 8LPRA 1D3DB 1ZTJA 1F5KU 1SLXB 3SQEE 5C5OA 1D6RA 4MLFB 4I8GA 4X6NA 1NRNH 2C8WB 3G01A 1VCPA 5JBBS 2PGQB 3MNSA 2SGEE 4H6TA 3I77A 1Z6EA 1Z1JA 5J4SA 3E16B 1SQOA 2GCTC 3MI4A 1PPBH 5FCRA 3A84A 1GL1A 1TOCB 1K1LA 3U8RH 1PPFE 1NPMA 1MTNC 3KGPA 1ANBA 2ZNKH 2G4TA 1AU8A 4JCNA 1J16A 2QXGA 2BY5X 1DSTA 1LQDB 1GHAF 3FP8E 3K6YA 5DP5A 2VIDA 2AH4X 1VCQA 3F9GA 5F8ZA 1AGJA 5ESBA 2ZU3A 2G81E 3B9FH 5GXPA 1V2VT 2STBE 2ZFQH 1GHBG 4BAOB 3RXDA 3RC5A 4LOYH 4D7GA 1EAXA 4Z0KA 4GPGA 2Q1JA 4ZAEA 1C2HA 1O2ZA 1GBBA 3STIA 4YM9A 4A5TS 2HLCA 2VIQA 3ZVDA 1QY6A 1O5AB 2Y5FA 1DXWA 1CBWC 1O3DA 1GI9B 1XUKA 4AOQA 1BUIA 1V3XA 5DO4H 3GCHC 3MH5A 1TBQH 1WTHD 2A1DB 3RXPA 4QT8C 1WQVH 1FQ3A 5EQRA 1HCGA 1SG8B 5EXMA 5FPSA 1DWCH 4FVDA 1TGCA 1HLTH 2XNIA 4LK4A 3GISB 1SGNE 1JRSA 3N7OA 1WAYB 2WV5A 3VB3A 2BD2A 1RXPA 3SU1A 5HGGA 1DVAH 1P2JA 1RGQA 1HNEE 3SHAH 1W11U 2FOEA 3F68H 3NCLA 4JMYA 2ZPQA 3SZEA 2FOAA 1A61H 1F2SE 3KCGH 1BRUP 1C2EA 3IG6B 3EA9A 4CREA 3EE0B 1EJMA 1HXFH 1QL9A 1E38B 3ODDA 4NZLA 1GJ5H 1KXBA 1AFEH 3TH3H 3U8TH 1QQ4A 2H9TH 3MH6A 2H5CA 1EZUC 2BY6X 1AY6H 1DXPA 2W3KA 1ELBA 5DP6A 4TWYA 3K2UA 4MDSA 1O5GH 3E1XB 2C3SA 2VWLA 1CGIE 4ZXXH 3URDA 1F5RA 1GI3A 1HPGA 1GBLA 2J34A 1KIGH 4K1EA 1DPOA 2ANYA 1SGFG 1G3BA 4AFZA 1YCPM 1ZMLA 2UWPA 5HYOA 3W95A 2PFEA 3F9HA 1IQLA 1NESE 1GHWH 3V3MA 2TBSA 1S0RA 1YPHC 1ZOMA 4X1SU 3U98H 3PTNA 2JKHA 1ZPCA 3GCOA 4Y0YE 5EQQA 4UEHH 4BAKB 3ZYEA 1XXFA 5G4BA 1ORFA 1CA0B 2VIPA 3KN2A 2BYAX 1HAVB 3M7TA 5FXLA 3M5OA 1P3EA 3KNXA 4IW4E 4ZKNU 2OC1A 3RXAA 3T5FH 1OP0A 1LPZB 2B7DH 2FM2A 1HGTH 2KAIA 1MKWK 2STAE 1AMHA 2FS8A 1Q2WA 3AW0A 1HAZB 3QDZB 4I8JA 1O3NA 1O3LA 1VR1H 5HM9A 2QXJA 2ZGBH 5EW2H 1BOQA 3CS7A 1UTOA 3SQHE 1NC6A 1GVLA 3GCTF 3UY9A 4GUXA 1PPGE 4X2WA 3QO6A 1C1RA 3OTJE 1O37A 2BMGB 1GDQA 2BLWA 3LIWA 1TNIA 1A3EH 5E2PA 5DP9A 3PWCA 3ZZ4A 1QA0A 5HMAA 1BMAA 4Y0ZE 5IDKA 2FOHA 1VCWA 1C1VH 4ISIH 1NY22 5I25A 4X2YA 2VU8E 3M5NA 3LPRA 4E7RG 4DIHH 1JIMA 1QJ6B 3FZDA 1DY9A 4UDWH 1H1BA 6CHAC 1AE5A 1W2KH 1YYY1 2ODPA 4CRCA 3BTTE 2LNCA 1RTKA 1S85A 2R2WU 1PPHE 4AYYB 2Y80A 3EA8A 2G00A 1IAUA 2P3FH 1TMTH 4BXSA 5A09A 2AGIX 1ZTKA 3VXFH 2Z7FE 2WV9A 1F92A 1DUEA 2FTLE 3RMNH 5EQSA 1C5TA 1H9IE 3R0FA 2D8WA 1C2GA 1TRYA 1DT2A 2UWLA 4TPIZ 3K9XB 1THRH 2P59A 1CU1A 4NWKA 3BIVH 1C2KA 4A7IB 4RN6A 3S9CA 3FZZA 3GDUA 3KF2A 2HOBA 3WY8A 2A31A 1TGTA 4XSKU 3MO6A 2FX6A 2A7HA 3F6UH 1O3MA 1P10A 1ZR0A 1NRQH 4ESTE 2VWOA 3E0PB 1GI2A 2WUBA 1MBMA 3A7VA 1WU1A 3OY6U 1L1NA 1W10U 3P17H 1O2TA 1K28D 3SW2B 3EYDA 4NA8A 1FAKH 2OXSA 1YPJH 2VVVA 1TFXA 5EXNA 1MU6B 1QTFA 2GT7A 1LVYA 1LKBA 3KHVA 2BD9A 4OS7A 4U2WA 2OLGA 1TNHA 4JZDH 5L2YH 1QRXA 4X8VH 4GVUA 2VIWA 1VGCB 5T6DA 3LDXH 1RIWC 3PB1E 1JBUH 1S81A 2ZPSA 2G4UA 1GBTA 2OTVA 1EXFA 1THSH 1K22H 4AGJA 1FPCH 1O2YA 1O2SA 3PYHA 1S83A 3P6ZB 3A89A 1TMBH 1KXAA 2FMJA 4FUGA 1IQEA 1YLDA 1ZRKA 1ELTA 1GI6A 1GJ6A 3SV9A 3TNSA 1TX8A 1OWJA 1EAIA 1MZDA 1Y8TA 3BV9B 8KME2 3BG4B 1P01A 3RXCA 4IGDA 2F9VA 2Y6TA 4FUDA 1UTMA 1TABE 3TNTA 3NUMA 3ATIA 4JYUH 3TJVA 1AKSA 1SFQB 4ISOA 5GWZA 2W5EA 1FNIA 4GAWA 2PKAB 1G30B 1S6HA 3V13A 1GBHA 4ABEA 1Z6JH 1GDUA 1AWFH 2EC9H 2FEQH 3H7OA 2B0FA 2HNTC 2ZU5A 3M3VA 1QFKH 1TAWA 5HM2A 1Y3UA 3W94A 2Z9JA 1BJVA 1KTSB 3RM0H 4ZHLU 1FN8A 1HAYB 3RXKA 1NM6A 4I8KA 2R3YA 2OC8A 2XBWA 2Y5HA 2ZDMA 1K1MA 4INKA 3TH2H 1UVUH 3M35A 1W0YH 2ZDNA 1CO7E 1QQUA 2B9LA 2ZWLH 3MFJA 1GMCF 2ZHWH 1D4PB 4AB8A 4AORA 4WF8A 5PTPA 3RXOA 1F7ZA 1O3HA 2AERH 4Y10E 3ATWA 3MNCA 3S0NA 3RLWH 1Y3YA 4X6PA 3UNQA 2ZDKA 4KTUA 7ESTE 1HAIH 1FLEE 5GPIB 4AFQA 3ODFA 5JBAS 1EP6A 1WOFA 3SUGA 1SPJA 2NU4E 2BQ7B 1ESAA 4CH2B 4NFEA 4ABJA 2VVCA 1KXFA 3PMJA 1G36A 2J92A 4F49A 1YPHE 1YCPK 2PKAA 2Z9KA 8GCHF 4ABIA 4JYVH 4I8HA 1DOJA 2EI7A 1UCYH 1SL3A 3SU3A 4KTCA 1C1TA 1O5CB 1PPCE 1O0DH 1Q31A 1GCDA 2QF3A 1YBWA 2GMTC 2OC7A 3RXRA 1XVOA 1CQQA 1V2OT 1YC0A 1IQIA 4XBDA 2RA3A 3RXMA 4J1YA 4FUJA 1MKXK 2XWBI 1P02A 3PMHB 1C2IA 2R0KA 2ZGXH 5AFZH 5FHTA 4HZHA 1GBIA 1D3TB 4E05H 3RXTA 2ZO3H 2HWLB 2PTNA 4DGJA 2BDBA 2BDIA 1BITA 1GJCB 1O3JA 5FBIA 1O5FH 1NT1A 3HGPA 4YO9A 4FVBA 1TPSA 2ZTYA 2VIOA 3LU9B 2F9UA 1OWDA 1O2JA 2BDHA 1C1OA 2PWXA 2A2XH 5A2MH 1EPTC 1DY8A 2ZGHA 2BD5A 1WBGB 2ODYB 1QR3E 1P11E 4LZ4B 3EDXB 1ZMJA 2GD4B 2RCEA 4GLYA 2UUJB 2V3HH 2IJD1 1AI8H 2OP9A 4DJZB 3I29A 3RUOA 1KLTA 1AVXA 4AG2A 3NZIA 5E8EH 2A4RA 1O32A 2H6MA 3RC6A 1E35B 1GHBF 1C1MA 2FWWA 1LKAA 2EEKA 4BANB 3QZQA 3DD2H 4ZKSU 1ZHMA 2WHXA 1SLVB 1ZZZA 4R8TB 4ABFA 5LPEA 2IJOB 4HFPB 1EQ9A 4X8SH 1CVWH 5BPEA 3T25A 4AG1A 5A0AE 1A2CH 1VITH 1FMGA 1O5BB 5IYTA 1EATA 1VGCC 3STJA 1TPOA 3HKIB 1SLWB 4IN1A 1T31A 2ZIQH 1ELDE 5T1VA 4B76A 3A81A 3UR6A 3E0NB 3UTUH 2WV4A 1SQAA 5DK1A 5EPYA 2BXUH 3GY8A 3KIDU 1EOJA 4INHA 1J9CH 3SU4A 1LHGH 4GCHG 4THNH 1GJAB 3RXUA 1ANDA 3BG8A 2ZFSA 2FOBA 1L0ZA 2G5VA 1ZMNA 1O2RA 2VGCB 1SGPE 1ELCA 1SOTA 5DJ7A 4Y8ZA 3HKJB 1E0FD 3PO1C 1MTWA 3RXJA 3SJ9A 4I32A 1UTJA 1N6XA 7KMEH 1YPLH 2YNAA 3BTWE 1VJ9U 1GWAA 4UFGH 3UNRA 4DOQA 2P3TB 1HAPH 3TJOA 4AFUA 1U6QA 2ZHDA 5FX6A 4K3JA 1AQ7A 3O8CA 4BOHA 3BTFE 1Q3XA 4OGXA 2TPIZ 1K1JA 3KEEA 3S7KB 2UUFB 5GIBA 1A3BH 4O3UA 2ZTXA 1BMNH 1LHCH 1Z1IA 1C1UH 3T2NA 1J17T 3QWCH 2A32A 5DG6A 3RC4A 1EB2A 3BEUA 2ZFRH 5A0BA 4B6EA 1C5MD 1OWHA 1TA2A 3T28A 3OSYA 1BHXB 2EI8A 2QXHA 1OX1A 5EXLA 1OWEA 3T26A 4CHAB 4NGAH 1H9LB 3LONA 4XE4A 5A0CA 1FIZA 4CBNA 1CSOE 2EA3A 4NIXA 4YOIA 4K2YA 2GKVE 2GVFA 3QUMP 5CHAB 1C1WH 4YLUA 1W12U 4MPWA 2GDEH 3AAUA 5CE1A 3S9BA 2HPPH 1SQTA 4GSOA 4OS5A 2ZU1A 1MD7A 2J9NA 4ISLA 2PKSB 1MAYA 5C1UA 4VGCC 3SBKA 4SGBE 3SV2H 2HNTE 1GMDF 4BTIB 1TB6H 2A4QA 4HGCA 1QGFA 3EQ0H 1CGHA 4R0IA 1PQ7A 1W7GH 1T8MA 4MPXA 1P09A 2BVSH 2UUKB 1EX3A 4XDEA 1GBEA 3ZZ5A 3BIUH 3M7UA 3ZVFA 1ELFA 1O2IA 4J2YB 2OINA 2WPMS 2PSXA 1C5ZB 1OYTH 4AYVB 3PLBA 4BNRA 1C5QA 2JETC 1N6YA 3U9AH 3E8LA 1LTOA 1GMHF 1XUJA 1ID5H 2C8ZB 1DWBH 3VB6A 1YKTA 1GHZA 1S82A 2CJIA 3VGCB 1QRWA 2O8UA 5LGOA 4WMEA 3SI4H 1SVPA 3ZVBA 2ZDVH 2F4LA 5E0JA 1GVKB 1O2VA 4M7GA 1A0JA 1GGDC 1P0SH 1AN1E 2FOCA 2O8TA 4FU7A 3E6PH 4MVNA 3FANA 2ODQA 2GZ8A 4Z6AH 2A5IA 2QA9E 5F8XA 3HATH 4KP0A 4DY7B 1HYLA 1AFQC 1P9SA 5JBCS 2GDDA 1OP2A 7LPRA 4YESB 2Z9GA 2QGRA 3ZZCA 5JBTA 2ZDLA 1O2WA 2KAIB 5DP7A 3F9EA 2ZFPH 2CV3A 5ETXA 1O5EH 2Y5GA 3A8CA 4CRFA 1V2TT 1C2LA 3UFAA 4AN7A 1T7CA 1IQHA 4UFFH 1PPEE 1Z8RA 1TRMA 1GJ4H 1W0ZU 2P8OC 3P8GA 5C3NA 2PV9B 4AX9H 1EKBB 1ZHRA 1P2NA 1QB1A 1F0UA 2AYWA 2F3CE 3AAVA 1C5RA 1UHBA 3C1KA 3GYLB 1QNJA 1ARBA 1K1IA 1C1PA 2K1QA 2BDGA 5L2ZH 3M7QA 2BHGA 1HJAB 4FUBA 1M9UA 3D23A 3M36A 1ABJH 4HTCH 3A86A 2JH6D 4NA7A 1NU7B 1FIWA 2ANWA 3BSQA 5C1XA 2ZU4A 1SBWA 4O3TA 1GBKA 5T3HA 1EOLA 1Y5AT 1MU8B 5FPYA 1ESTA 3EGKH 2NU3E 2ZI2H 1Z8JB
chains in the Genus database with same CATH superfamily
2HRVA 5C5NA 1E34B 3MWIU 1UTPA 2CHAC 5E2OA 1H8DH 1GMDG 2L74A 4FU9A 3RLYH 5HXFA 5I46H 1AB9C 1CE5A 3RXEA 4E7NA 2SNWA 5GCHG 1HBTH 4F55A 4TYDA 2EI6A 1Y3WA 2CXVA 3OEHD 2BLQA 2DE8A 4GHQA 1XM1A 5JDUB 2EQNA 1V2NT 3PV4A 5DKMA 4U30A 1GCTB 5LPRA 2SGAA 1BHXF 3TITA 3PMAB 4PROA 2RA0A 2VINA 1QB9A 1ZPZA 2VH0A 1V2LT 3AASA 2I6QA 3LGYA 1YPGH 4FUCA 2G8TA 4I86A 3DSGA 4ABAA 1GMHG 4CRBA 3F9FA 1NBME 1FAXA 1S6LA 5TJXA 1K1NA 1JIRA 4CHAC 2ZGJA 3SU5A 1EUFA 1ZPBA 3F2HA 3SUDA 1TALA 4WVPE 1Z8GA 1XKBC 1L1GA 4E06H 1LCYA 1P12E 2PP6A 3GDSA 2ZCKP 1Y5BT 1DDJA 2GTBA 3DSOA 4ACAA 1XKAC 2GX4A 3GY4A 1HDTH 4AC9A 2WPDD 1GHXH 1BJUA 1C2DA 1UVTH 3OEED 1V2WT 3AK5A 1XXDA 3IWMA 1JMOH 4CR9A 3L3TA 4I7YH 3Q77A 1FY8E 2IN2A 5DGJA 9LPRA 4AFSA 1K9OE 3QGJA 1KLJH 3MU0A 3DUXH 1FDPA 1V2QT 3JZ1B 1NFUA 1MABB 1EZXC 3KQDA 1ZSJA 3SOSA 3TLOA 4YOJA 2AMPA 1V2KT 4AZ2B 3PROA 2BTCE 5KGOA 1WYKA 4CRGA 1BTHH 1SFIA 4ISHH 2H2ZA 3BTEE 4IBLH 1GBDA 1MCTA 1RTLA 1BIOA 2RDLA 1TLDA 2Z94A 1O3BA 4DT7B 3T29A 2KZ4A 1GVZA 2H1UA 4SGAE 2Q6FA 3AW1A 2XC4A 1L4ZA 4X6OA 4DVAU 1UVOA 4ZXYH 1GJ8B 1C5SA 1MQ5A 5FL7D 4FU8A 2VJ1A 1O39A 3ZZ8A 3CP7A 4KTSA 2VWMA 1RFNA 1OHHD 3EA7A 5HKKD 1C4V2 3ZZ7A 1AKSB 2G55A 1H8IH 3RXFA 3TJNA 2Q6GA 1ELVA 1ZTLA 2PTCE 1SQRA 2QIQA 2VWNA 3RU4D 4ZMAH 4Y6DA 2XXLA 4NSVA 3A87A 3EE7A 2F9BH 1D3PB 2V3MA 2V7QD 3FFGA 4LXBH 4DG4A 1BMMH 4RKOB 2KM0A 1C5WB 1GHYH 1NROH 2G52A 4X0WU 3VB5A 2FOFA 2ZF0H 1XX9A 3RXGA 4FUIA 2O8MA 5JB9S 2A5AA 1HXEH 1GJBB 3EAJA 5DPAA 4TT3D 2ZCHP 3RMOH 1ELGA 3GY7A 2SGDE 3OFND 2XCFA 3KQCA 3HK6B 1SHHB 2P16A 4F4OC 4NIYA 2ALVA 4NZQA 1C5OH 3RU4E 1DE7H 1EPTA 2OQ5A 2WPKS 1P2IA 3SV7A 5B6LA 2P93A 1PYTD 1TX7A 3PM3A 1ABIH 2C4FH 1EFRD 2Z3CA 1VKYA 4LZ1H 4WMDA 1HJAC 5EJ1A 4OS1A 5GJ4B 4ZH8A 4XBCA 4H4FA 4NA9H 1XMNB 1TA6A 3SJ8A 3U69H 1LQEA 1CA0C 1ELAA 1O3KA 2JH0D 1YLCA 4MPVA 2J2UA 1INCA 1J14A 3U1JB 4BAMB 1K0HA 1AUTC 2PSYA 3LH3A 4RKJB 1YPKH 3RXVA 1PJPA 1NTPA 1ZJDA 2AGGX 2P3UB 4BTTB 2HNTF 3GYMA 1QURH 1MTSA 1B0FA 5BRRE 3NXPA 1TNKA 2ZHEH 3L6PA 4Y7BA 4ABHA 3N99A 2J4IA 3O8DA 1C5XB 2HVYB 3MO3A 2R0LA 2V0BA 4ACBA 2A7JA 1GG6B 3LGTA 2J95A 2Z9LA 4GCHF 5EG4A 3Q00A 2ZP0H 2NU2E 5EU8A 1YM0A 1UK4A 3A7TA 1OKXA 4K69A 3A8AA 1G2MA 1VITG 1FV9A 3H5CB 1GI8B 3TK5A 1QL7A 4TWWA 3LGWA 1XUHA 4YLQH 2Z3DA 1P04A 1BRBE 4DURA 3PMBB 1BTXA 1YPMH 3ZZ3A 9ESTA 3UPEA 8ESTE 2VB0A 4I8LA 2FS9A 5A8XA 3SO3A 4NG9H 1AIXH 4CBOA 1BA8B 4ZKOU 3RM2H 1SHYA 2C8YB 3NK8A 2GCTB 3V7TA 2PGBB 5C2ZA 4DT4A 1F5LA 1KXDA 4NSYA 2XBYA 5FBEA 1MTNB 4D7FA 1MAXA 1PFXC 4NWLA 1BRCE 3TK9A 1LHFH 3ZVGA 3NPSA 4B73A 2PLXA 3ZZ9A 1EZSC 1JRTA 2JJ2D 1UCYE 1ARCA 1T32A 4TY6A 3M3SA 4WWYA 4D9RA 2W26A 4O9VA 3A82A 4BXWA 1F0SA 3TJUA 2BZAA 1MBQA 1BDAA 3K65B 2J38A 2WUCA 1KXEA 4Y71A 1UCYK 1TYNA 3LT3A 1V2PT 2CGAA 2A0QB 3TH4H 2FLRH 1UTNA 1EASA 4K1SA 1O3PB 1FI8A 1YGCH 4BAHB 1IQKA 1NRRH 3SU2A 5AFYH 1FY4A 3NWUA 2AFQB 4KELA 1K2I1 1OYQA 3N7EA 1O3GA 1UTQA 1AO5A 2Y81A 1KYNA 1CBWB 1KMHB 2BDAA 2ZA5A 1E1QD 3GCHB 1NFYA 1O3CA 1DUAA 2ZU2A 1WCZA 4B2AA 1GI7B 1O31A 1LDTT 1J8AA 2V35A 4Q63A 4AB9A 1SGCA 4YTAA 3SNCA 3RXLA 1HFDA 4DIIH 2OC0A 1QJ1B 2KCYA 1PPZA 5AF9H 3KQEA 4AGKA 1F0TA 4XBBA 3B23B 4Q7ZA 1QHRB 1P57B 2Z9IA 3DFLA 3TK6A 1FY3A 2ZECA 2ZKSA 3MU5A 3UWJH 1DSUA 2VIVA 1ZHPA 4YZUA 3SJKA 1AZZA 1NFXA 1NRPH 2TGPZ 3DHKH 2BD8A 2ZQ2A 4Q7XA 4CR5A 1FY5A 1V2ST 2R3UA 2FODA 2ILNA 3BTDE 2V6NA 1C4U2 1AHTH 4IC6A 1CT2E 4K60A 1YLNA 1GHVH 1O33A 2ULLA 3SNBA 3MTYA 4CH8B 4INLA 1DWEH 1D9IA 1PQAA 2P95A 1MZAA 2O9QA 3D49H 1S84A 1LPGB 1J15A 2GCHG 3ENSB 1DANH 5CMXH 1SGQE 1UTLM 1DS2E 3BG4C 1ETSH 4YXWD 1AVWA 5JYIA 3P8OA 1CGJE 3MHWU 3ZIAD 1P06A 3GICB 4X1RU 2FYRA 4WXVA 2G51A 4DCDA 6GCHF 4NCYA 1G2LA 4X1PU 1IQJA 2ZFTA 1O3AA 4B6FA 1IHSH 3SNEA 3UAIC 4MNWA 1L4DA 3A8DA 5ABWA 1HUTH 1O3FA 3RXBA 1BMFD 3DFJA 4IS5A 2QF4A 1O34A 4JZIA 3QK1A 3TGKE 1O2KA 3LOXA 1W7XH 5F03A 3SUEA 1ZJKA 1WQSA 1LPKB 5LPFA 2R9PA 1E36B 1OPHB 3UIRA 3ZZ6A 1P2MA 3ZVEA 1TX6A 1A46H 5AVDA 3M5LA 1HV7A 1C4Y2 1DX5M 4Q7YA 3MU1A 1GI0A 3ATMA 1YP9A 2YNBA 2XYAA 5LH8A 1EAWA 5FPTA 1SR5C 2G5NA 1THPB 2A5KA 2A4GA 1F0RA 4ISNA 6ESTA 1T4UH 2FTMA 3WWFA 1FONA 1T8LA 1E37B 4OS6A 5EOKA 1ESBA 1H9HE 1KSNA 2L6OA 1BZXE 1C1NA 4D76A 3RMMH 1KDQA 4ZROA 2OK5A 4B2BA 2ESTE 3Q3KA 3U8OH 1SC8U 1ZGIA 2WPJS 2PUQH 4H42U 3RXHA 1S5SA 1A5IA 2KCPA 1HIAA 1BB0B 1NN6A 3MU8A 3U1IB 1SGTA 2FZZA 2HLDD 3GCNA 1DICA 2CF8H 1MCVA 3ZZAA 3BN9A 1AVGH 1COWD 1GI5A 4B71A 1UVSH 1G32B 6CHAB 5GCHF 1RJXB 2AEIH 3FN8A 3P92A 1BT7A 3D65E 2GT8A 4X8UH 3SN8A 1EJNA 5B6OA 2ZHFH 3PTBA 1X7AC 2SGPE 4I31A 1P05A 2ASUB 2XRCA 2ZG0H 1WV7H 4FUEA 2GZ7A 3TGIE 1C1SA 1GDNA 1IQNA 1BMLA 2B8OH 5FX5A 3O8BA 2F9NA 1TWXB 2WYGA 1GBMA 1TNLA 1N8OB 3V12A 3SJIA 1VZQH 1Z8IB 1XUFA 1SGYE 2XNDD 3LC5A 2QN5T 1OS8A 1HJ8A 1D6WA 3A8BA 2ALPA 1BTZA 1P3CA 1DLKB 2AMDA 4WJG2 3ZZDA 5TCCA 5E0GA 3S69A 1GJ9B 1UHBB 2FI5E 3ZYDA 4WXIA 2A45B 3OTPA 2W7UA 2BY7X 3UB0A 2A7CA 2Z6BD 1ZSLA 3CS0A 2QY0B 5DP3A 2FI3E 1NZQH 6GCHG 2FDAA 1GI1A 2IPHA 1FXYA 3Q76A 1C5NH 5DP8A 1DITH 5C94A 4U01A 1NU9A 4M9FA 1O2OA 2OD3B 4WY3A 1O30A 4ABDA 1CHGA 2A4OA 1C9TA 1PYTC 1GBAA 2JH5D 3VB7A 2QC2A 2ZPRA 1O2GH 2TGTA 3AVZA 3ZVAA 2QE7D 4MNXA 1HAHH 1RIWB 1OXGA 1SLUB 1WUNH 1V2JT 2FP7B 2BDCA 1CHOG 1K1OA 4JZ1A 4UFDH 3T62A 1LHDH 1MH0A 2GP9B 1V2RT 2FIRH 2ZEBA 1G37A 1YPEH 2VGCC 3MYWA 4D8NA 2HALA 1QBVH 2CMYA 4NIWA 1C2FA 3SZNA 4Q80A 3MH4A 1AUJA 3SV6A 3SYJA 1SGDE 1DM4B 1TNJA 3UWIA 3GY3A 1GI4A 1OWIA 2D2DA 1DFPA 1MQ6A 2XW9A 1CT0E 1O38A 3A7YA 3F2FA 2I6SA 4H6SB 3LJOA 1NO9H 3KYGA 2ANMH 2QCYA 4IN2A 1Y5UT 4MTBA 1MKWH 4JYTA 3KL6A 4OS2A 2SGFE 2VNTA 3GY2A 3ZVCA 2FO9A 3HPTB 1GHAG 2HVXA 1O36A 1TRNA 4TY7A 5DSFA 1QL8A 1WSSH 1H8HD 4X6MA 4ASHA 3GY6A 3FKSD 2FOMB 7GCHF 2JJ1D 2H5DA 2XBXA 4K1TA 4Y7AA 1Z71A 1TGNA 3UNSA 2O8WA 3VFEA 1O2QA 2BXTH 4B1TA 2Z3EA 1A0HB 4JZFH 3P95A 1YWUA 3SU0A 2B5TB 1AE8H 3VPKA 1TE0A 2JDID 1ZGVA 1SOZA 1QBNA 1GJDB 4A92A 3ATLA 2XCNA 4TPYA 3B8JA 1BBRH 2NU1E 1LVMA 2WPHS 4WMFA 3HGNA 3LC3A 1O35A 2C93B 2HGTH 1HJ9A 3S7HB 2BOKA 4Y76A 5AHGH 3UQVA 3QTVH 1SGIB 3SV8A 4UFEH 1BBRE 1JOUB 1TGSZ 2BD7A 3FP6E 5DP4A 3VEQB 1GBCA 3LGVA 2KR7A 1WDIA 1UJ1A 3LH1A 4MNVA 3BTHE 5CHAC 4XOJA 4MNYA 1BBRK 3DSPA 1O2HA 2PKSC 3TVJB 1QBOA 1IQMA 1HAVA 4XD7D 1DWDH 4UE7H 1QB6A 1A1RA 1G3EA 1LVBA 1ZLRA 2UWOA 4MPUA 2GMTB 1ACBE 3TU7H 3SUFA 2BD3A 1C5VA 1LO6A 2ZCLP 5L30H 4O97A 2TRMA 2BY8X 1TBRH 5EW1H 2BB4A 4U32A 2BDYA 1VITF 1GPZA 5EPNA 3P8FA 1P03A 1UVPA 1AWHB 3H09A 1JWTA 3OU0A 4UD9H 2FOGA 5T6FA 3SGAE 1ETRH 2WYJA 5FCKA 2BZ6H 2VH6A 4OGYA 2BLOA 1C5PA 1C5YB 1FUJA 2FPZA 4A1VA 1N8OC 1S0QA 1Y3VA 2J5UA 2CN0H 2GGVB 3CENA 3UR9A 1LVOA 3A7WA 3MH7A 4ZUHA 3VGCC 2PHBA 1EPTB 3FAOA 3SU6A 3VG8A 1MTVA 3GDVA 1HAGE 1LHEH 1SSXA 2OUAA 3ZV9A 1CA8B 3K6ZA 5K0HA 1MMJN 5GDSH 2DUCA 5H4IB 1RRKA 1PQ5A 2BOHB 1G3CA 2ZHQH 3F1SB 2FLBH 1KXCA 3OYPA 4X2XA 1EP5A 4B2CA 4K8YA 3TIUA 1L2EA 3RXIA 3S9AA 1TPAE 1SI5H 3BEIB 1ZRBA 1O2XA 4BTUB 4ZKRU 3RXQA 2AS9A 3MMGA 3SHCH 1W14U 2BVRH 3MOCA 3OY5U 3PLPA 2WPLS 4JZEH 4MG3A 2C90B 2FI4E 4NFFA 1IQFA 2BX3A 7GCHG 2BY9X 2FYQA 1BTPA 1A4WH 1O5DH 1Z7KA 2A2QH 4ZCNA 2VVUA 1GL0E 2OCVB 4CRAA 4Y8XA 3VXEH 4ZHMU 1O2PA 3RP2A 1K1PA 2GZ9A 2F9OA 5J4QA 1XVMA 3V0XA 1HRTH 1V2MT 3JZ2B 3QLPH 1P8VC 5EJZA 1BQYA 3GCTG 2OQUA 1RTFB 3A7XA 5L6NH 3BTKE 1DLEA 1KLIH 3WWBA 2FXRA 2KX4A 4YOGA 3SNAA 1ZSKA 1SB1H 4ZHAA 1SGEE 3A83A 2GV6A 2W3IA 3BTQE 3T27A 1A7SA 1TNGA 1QIXB 1L1JA 1BTYA 2QAAA 1VJAU 3PO1B 4Y8YA 1C5UA 1RD3B 4ABBA 3LJJA 3UOPA 1YF4A 3QZRA 2D1JA 1SKYE 3TPIZ 1G9IE 4OM9A 1A5GH 1GJ7B 1GBJA 2AMQA 2ZQ1A 3OE7D 2QF0A 4K5ZA 5F8TA 4FUHA 5K7RA 5E0HA 4RSPA 2SFAA 2RG3A 1BTUA 3PV2A 1T8NA 1TMUH 2O8LA 4OS4A 4Y11E 3E3TA 1FN6A 1FZZA 2M5TA 1IOEA 1BCUH 3MNXA 2F9PA 1IQGA 2D26C 4JK6A 2V3OH 3I78A 1S6FA 4K8BA 1O2LA 1TIOA 1QJ7B 2CF9H 2WZQA 1H4WA 4B75A 3H7TA 1GCTC 4JK5A 3ATKA 2ZTZA 1PQ8A 3LGIA 1WXRA 1C5LH 4IMZA 1ANCA 1JXPA 4Y79A 1UK2A 3SI3H 1O2MA 1XUIA 3SGBE 1AZ8A 2DE9A 2GCHF 1B7XB 1OOKB 1B5GH 1YCPH 4X1NU 3LGUA 3NRLA 1GBFA 2QXIA 1C1QA 3QGNB 3KQBA 2GV7A 2AGEX 1LMWB 1T4VH 3SNDA 1T8OA 4WH6A 3FVFB 3ESTA 1FPHH 3LKWA 3ELAH 4P02A 5JB8S 2SGQE 1AD8H 1V2UT 1N1LA 1MUEB 3MO9A 4XRNA 2OBQA 3BTGE 4FUFA 1MKXH 4A1XA 3A85A 4WH8A 3FP7E 5JPMH 1O3OA 1A0LA 2Y7ZA 2TGDA 1E79D 1OSSA 4YT6H 3Q3XA 1FJSA 2XWAA 2R2MB 2XC5A 2YOLA 1G3DA 1BTWA 2ANKH 4CRDA 4ABGA 4VGCB 2IPQX 5C67A 4X2VA 2RFKC 1V6DA 1MD8A 1O2NA 2QF5A 3GOVB 2NU0E 2AHME 2Y7XA 4A6LA 5C0TA 6LPRA 4O03A 4MQAA 3RXSA 2F83A 3DT0H 2KFWA 1Y3XA 3QX5H 5C17A 5SGAE 3BTME 3BF6H 2W7SA 3URCA 3A80A 2BLVA 1SGRE 3MU4A 4RI0A 1EB1H 2F91A 1EJAA 4HI3A 1NFWA 4UONA 2AIPA 2J97A 1TONA 2SNVA 3L33A 1CT4E 2BD4A 2BM2A 1BRAA 1SGFA 1UTKA 3ZV8A 4FXGH 1UMAH 2JETB 2WINI 2ZFFH 5EGMA 5KEDA 5EODA 3BEFB 1P2OA 2PW8H 1KY9A 2BX4A 4D9QA 2HPQH 2NWNA 1ZYOA 2ZGCA 1SMFE 3C27B 1KTTB 1P2QA 3P70B 3UOUA 5C20A 2FESH 3TGJE 2FX4A 2TGAA 1GGDB 1TQ7B 2C8XB 3HK3B 2OBOA 3SORA 1TGBA 2VBCA 3M3TA 4IMQA 2J94A 2THFB 3GY5A 1ANEA 1O3IA 2QV1A 5FAHA 1O2UA 3OX7U 3P8NA 4IC5A 1HAOH 1OWKA 2BVXH 1AFQB 1QA7A 2PUXB 3MNBA 5CHBA 1QRZA 5GNDA 2ZDAH 3Q3YA 3O8RA 3QN7A 2XBVA 3DA9B 1UO6A 2YMSB 1C9PA 3PRBA 2PR3A 4GHTA 1B0EA 1EAUA 4NIVA 5C1YA 3RDZA 2BQ6B 4BAQB 1TQ0B 4YT7H 1D3QB 1TOMH 1TPPA 3NKKA 1NS3A 1O3EA 4Q2KA 3E90B 4KKDA 1GMCG 1W13U 5A8ZA 3UREA 3R3GB 3PV5A 2P8OB 2UUYA 3M61U 3A88A 2TIOA 1HAXB 4B74A 3PWBA 2AIQA 1P2KA 1W3CA 3UUZA 1C2MA 1QCPA 1Y59T 2BQWB 3M5MA 4KGAA 1UK3A 1KDQB 2ZC9H 2LPRA 3ZZBA 4A1TA 2Y82A 1P9UA 5TCAA 2XC0A 4X1QU 1UW7A 1EZQA 3QTOH 3PLKA 1HIAB 4I33A 1IHTH 5T6GA 8GCHG 1WTGH 5IK2D 5HIZA 4XFQA 3D62A 4X8TH 1TBZH 3RU4T 2ZZUH 3FO8D 1XUGA 1NRSH 1ETTH 3E91A 2P94A 1C2JA 3A7ZA 3ITIA 5A8YA 3IITA 1OP8A 2H9HA 1HB0B 1RS0A 3VB4A 2XTTB 1MTUA 1GG6C 2CHAB 1FY1A 1AB9B 1ELEE 3SJOA 1CHOF 2IOTA 5ESTE 3KQ5A 2Q6DA 4DW2U 5F6MA 1W8BH 3M37A 2H9EH 3RMLH 1K21H 2QYIA 3SGQE 3UQOA 2WPIS 5F53A 1A5HA 8LPRA 1D3DB 3PRDA 1ZTJA 1F5KU 1SLXB 3SQEE 5C5OA 1D6RA 4MLFB 3N7DA 4I8GA 4X6NA 1NRNH 2C8WB 3G01A 1VCPA 5JBBS 2PGQB 3MNSA 2SGEE 4H6TA 3I77A 1Z6EA 1Z1JA 5J4SA 3E16B 1SQOA 2GCTC 3MI4A 1PPBH 5FCRA 1E1RD 3A84A 1GL1A 1TOCB 1K1LA 3U8RH 1PPFE 1NPMA 1MTNC 3KGPA 1ANBA 2ZNKH 2G4TA 1AU8A 4JCNA 1J16A 2QXGA 2BY5X 2W6JD 1DSTA 1LQDB 1GHAF 3FP8E 3K6YA 5DP5A 2VIDA 2AH4X 1VCQA 3F9GA 5F8ZA 1AGJA 5ESBA 2ZU3A 2G81E 3B9FH 5GXPA 1V2VT 2STBE 2ZFQH 1GHBG 4BAOB 3RXDA 3RC5A 4LOYH 4D7GA 1EAXA 4Z0KA 4GPGA 2Q1JA 4ZAEA 1C2HA 1O2ZA 1GBBA 3STIA 4YM9A 4A5TS 2HLCA 2VIQA 3ZVDA 1QY6A 1O5AB 2Y5FA 1DXWA 1CBWC 1O3DA 1GI9B 1XUKA 4AOQA 1BUIA 1V3XA 5DO4H 3GCHC 3MH5A 1TBQH 1WTHD 2A1DB 3RXPA 4QT8C 1WQVH 1FQ3A 5EQRA 1HCGA 1SG8B 5EXMA 2KCAA 5FPSA 5DN6D 1DWCH 4FVDA 1TGCA 1HLTH 2XNIA 4LK4A 3GISB 1SGNE 1JRSA 3N7OA 1WAYB 2WV5A 3VB3A 2BD2A 1RXPA 3SU1A 5HGGA 1DVAH 1P2JA 1RGQA 1HNEE 3SHAH 1W11U 2FOEA 3F68H 4TSFD 3NCLA 4JMYA 2ZPQA 3SZEA 2FOAA 1A61H 1F2SE 3KCGH 1BRUP 1C2EA 3IG6B 3EA9A 4CREA 3EE0B 1EJMA 1HXFH 1QL9A 1E38B 3ODDA 4NZLA 1GJ5H 1KXBA 1AFEH 3TH3H 3U8TH 1QQ4A 2H9TH 3MH6A 2H5CA 2RDEA 1EZUC 2BY6X 1AY6H 1DXPA 2W3KA 1ELBA 2GJGA 5DP6A 4TWYA 3K2UA 4MDSA 1O5GH 3E1XB 2C3SA 2VWLA 1CGIE 4ZXXH 3URDA 1F5RA 1GI3A 1HPGA 1GBLA 2J34A 1KIGH 4K1EA 1DPOA 2ANYA 1SGFG 1G3BA 4AFZA 1YCPM 1ZMLA 2UWPA 5HYOA 3W95A 2PFEA 3F9HA 1IQLA 1NESE 4FETA 1GHWH 3V3MA 2TBSA 1S0RA 1YPHC 1ZOMA 4X1SU 3U98H 3PTNA 2JKHA 1ZPCA 3GCOA 4Y0YE 5EQQA 4UEHH 4BAKB 3ZYEA 1XXFA 5G4BA 1ORFA 1CA0B 2VIPA 3KN2A 2BYAX 1HAVB 3M7TA 5FXLA 3M5OA 1P3EA 3KNXA 4IW4E 4ZKNU 2OC1A 3RXAA 3T5FH 1OP0A 1LPZB 2B7DH 2FM2A 1HGTH 2KAIA 1MKWK 2STAE 1AMHA 2FS8A 1Q2WA 3AW0A 1NBMD 1HAZB 3QDZB 4I8JA 1O3NA 1O3LA 1VR1H 5HM9A 2QXJA 2ZGBH 5EW2H 1BOQA 3CS7A 1UTOA 3SQHE 1NC6A 1GVLA 3GCTF 3UY9A 4GUXA 1PPGE 2LELA 4X2WA 2J98A 3QO6A 1C1RA 3OTJE 1O37A 2BMGB 3F0PA 1GDQA 2BLWA 3LIWA 1TNIA 1A3EH 5E2PA 5DP9A 3PWCA 3ZZ4A 1QA0A 5HMAA 1BMAA 4Y0ZE 5IDKA 2FOHA 1VCWA 1C1VH 4ISIH 1NY22 5I25A 4X2YA 2VU8E 3M5NA 3LPRA 4E7RG 4DIHH 1JIMA 1QJ6B 3FZDA 1DY9A 4UDWH 1H1BA 6CHAC 1AE5A 4Z1MD 1W2KH 1YYY1 2ODPA 4CRCA 3BTTE 2LNCA 1RTKA 1S85A 2R2WU 1PPHE 4AYYB 2Y80A 3EA8A 2G00A 1IAUA 2P3FH 1TMTH 4BXSA 5A09A 2AGIX 1ZTKA 2LP6A 3VXFH 2Z7FE 3W1EA 2WV9A 1F92A 1DUEA 2FTLE 3RMNH 5EQSA 3GS9A 1C5TA 1H9IE 3R0FA 2D8WA 1C2GA 1TRYA 1DT2A 2UWLA 4TPIZ 3K9XB 1THRH 2P59A 1CU1A 4NWKA 3WW7A 3BIVH 1C2KA 4A7IB 4RN6A 3S9CA 3FZZA 3GDUA 3KF2A 2HOBA 3WY8A 2A31A 1TGTA 4XSKU 3MO6A 2FX6A 2A7HA 3F6UH 1O3MA 1P10A 1ZR0A 1NRQH 4ESTE 2VWOA 3E0PB 1GI2A 2WUBA 1MBMA 3A7VA 1WU1A 3OY6U 1L1NA 1W10U 3P17H 4ASUD 1O2TA 1K28D 2CK3D 3SW2B 3EYDA 4NA8A 5EIYA 1FAKH 1FX0B 2OXSA 1YPJH 2VVVA 1TFXA 5EXNA 1MU6B 1QTFA 2GT7A 1LVYA 1LKBA 3KHVA 2BD9A 4OS7A 4U2WA 2OLGA 1TNHA 4JZDH 5L2YH 1QRXA 4X8VH 4GVUA 2VIWA 1VGCB 5T6DA 3LDXH 1RIWC 3PB1E 1JBUH 1S81A 2ZPSA 2G4UA 1GBTA 3F0OA 2OTVA 1EXFA 1THSH 1K22H 4AGJA 1FPCH 1O2YA 1O2SA 3PYHA 1S83A 3P6ZB 3A89A 1TMBH 1KXAA 2FMJA 2JIZD 4FUGA 1IQEA 1YLDA 1ZRKA 1ELTA 1GI6A 1GJ6A 3SV9A 3TNSA 1TX8A 1OWJA 1EAIA 1MZDA 1Y8TA 3BV9B 4FOUC 8KME2 3BG4B 2YMSD 1P01A 3RXCA 4IGDA 2F9VA 2Y6TA 4FUDA 1UTMA 1TABE 3TNTA 1W0JD 3NUMA 3ATIA 4JYUH 3TJVA 1AKSA 1SFQB 4ISOA 5GWZA 2W5EA 1FNIA 4GAWA 2PKAB 5EJLA 1G30B 1S6HA 3V13A 1GBHA 4ABEA 1Z6JH 1GDUA 1AWFH 2EC9H 2F43B 2FEQH 3H7OA 2B0FA 2HNTC 2ZU5A 3M3VA 1QFKH 1TAWA 5HM2A 1Y3UA 3W94A 2Z9JA 1BJVA 1KTSB 3RM0H 4ZHLU 5C0UA 1FN8A 1HAYB 3RXKA 1NM6A 4I8KA 2R3YA 2OC8A 2XBWA 2Y5HA 2ZDMA 1K1MA 4INKA 3TH2H 1UVUH 3M35A 1W0YH 2ZDNA 1CO7E 1QQUA 2B9LA 2ZWLH 3MFJA 1GMCF 2ZHWH 1D4PB 4AB8A 4AORA 4WF8A 5PTPA 3RXOA 1F7ZA 1O3HA 2AERH 4Y10E 3ATWA 3MNCA 5CDFE 3S0NA 3RLWH 1Y3YA 4X6PA 3UNQA 2ZDKA 4KTUA 7ESTE 1HAIH 1FLEE 5GPIB 4AFQA 3KYFA 3ODFA 5JBAS 1EP6A 1WOFA 3SUGA 1SPJA 2NU4E 2BQ7B 1ESAA 4CH2B 4NFEA 4ABJA 2VVCA 1KXFA 3PMJA 1G36A 2J92A 4F49A 1YPHE 1YCPK 2PKAA 2Z9KA 8GCHF 4ABIA 4JYVH 4I8HA 1DOJA 2EI7A 1UCYH 1SL3A 3SU3A 4KTCA 1C1TA 1O5CB 1PPCE 1O0DH 4HG6A 1Q31A 1GCDA 2QF3A 1YBWA 2GMTC 2OC7A 3RXRA 1XVOA 1CQQA 4RT1A 1V2OT 1YC0A 1IQIA 4XBDA 2RA3A 3RXMA 4J1YA 2EY4C 4FUJA 1MKXK 2XWBI 1P02A 3PMHB 1C2IA 4F48B 2R0KA 2ZGXH 5AFZH 5FHTA 4HZHA 1GBIA 1D3TB 4E05H 3RXTA 2ZO3H 2HWLB 2PTNA 4DGJA 2BDBA 2BDIA 1BITA 1GJCB 1O3JA 5FBIA 1O5FH 1NT1A 3HGPA 4YO9A 4FVBA 1TPSA 2ZTYA 2VIOA 3LU9B 2F9UA 1OWDA 1O2JA 2BDHA 1C1OA 2PWXA 2A2XH 5A2MH 1EPTC 1DY8A 2ZGHA 2BD5A 1WBGB 2ODYB 1QR3E 1P11E 4LZ4B 3EDXB 1ZMJA 2GD4B 2RCEA 4GLYA 2UUJB 2V3HH 2IJD1 1AI8H 2OP9A 4DJZB 3I29A 3RUOA 5HIYA 1KLTA 1AVXA 4AG2A 3CNRA 3NZIA 5E8EH 2A4RA 1O32A 2H6MA 3RC6A 1E35B 1GHBF 1C1MA 2FWWA 1LKAA 2EEKA 3DCLA 3QZQA 4BANB 3DD2H 4ZKSU 4RT0A 1ZHMA 2WHXA 1SLVB 1ZZZA 4R8TB 4ABFA 5LPEA 2IJOB 4HFPB 1EQ9A 4X8SH 4P00A 1CVWH 3F2GA 5BPEA 3T25A 4AG1A 5A0AE 1A2CH 1VITH 1FMGA 1O5BB 5IYTA 1EATA 1YY3A 1VGCC 3STJA 3OAAD 1TPOA 3HKIB 1SLWB 4IN1A 1T31A 2ZIQH 1ELDE 5T1VA 4B76A 3A81A 3UR6A 3E0NB 3UTUH 2WV4A 1SQAA 5DK1A 5EPYA 2BXUH 3F3BA 3GY8A 3KIDU 1EOJA 4INHA 1J9CH 1QZ8A 3SU4A 1LHGH 4GCHG 4THNH 1GJAB 3RXUA 1ANDA 3BG8A 2ZFSA 2FOBA 2K8IA 1L0ZA 2G5VA 1ZMNA 1O2RA 2VGCB 1SGPE 1ELCA 1SOTA 5DJ7A 4Y8ZA 3HKJB 1E0FD 3PO1C 1MTWA 3RXJA 3SJ9A 4I32A 1UTJA 1N6XA 7KMEH 1YPLH 2YNAA 3BTWE 1VJ9U 1GWAA 4UFGH 3UNRA 4DOQA 2P3TB 1HAPH 3TJOA 4AFUA 1U6QA 2ZHDA 5FX6A 4K3JA 1AQ7A 3O8CA 4BOHA 3BTFE 1Q3XA 4OGXA 2TPIZ 1K1JA 2KCOA 3KEEA 3S7KB 5KECA 2UUFB 5GIBA 1A3BH 4O3UA 2ZTXA 1BMNH 1LHCH 1Z1IA 1C1UH 3T2NA 1J17T 3QWCH 2A32A 5DG6A 3RC4A 1EB2A 3BEUA 2ZFRH 4B6EA 5A0BA 1C5MD 1OWHA 1TA2A 3T28A 3OSYA 1BHXB 2EI8A 2QXHA 1OX1A 5EXLA 1OWEA 3T26A 4CHAB 4NGAH 1H9LB 3LONA 4XE4A 5A0CA 1FIZA 4CBNA 2W6ID 1CSOE 2EA3A 4NIXA 2WSSD 4YOIA 4K2YA 2GKVE 2GVFA 3QUMP 5CHAB 1C1WH 4YLUA 1W12U 4MPWA 2GDEH 3AAUA 5CE1A 3S9BA 2XOKD 2HPPH 1SQTA 4GSOA 4OS5A 2ZU1A 1MD7A 2J9NA 4ISLA 2PKSB 1MAYA 5C1UA 4VGCC 3SBKA 4SGBE 3SV2H 2HNTE 1GMDF 4BTIB 1TB6H 2A4QA 4HGCA 1QGFA 3EQ0H 1CGHA 4R0IA 1PQ7A 1W7GH 2K0QA 1T8MA 4MPXA 1P09A 2BVSH 2UUKB 1EX3A 4XDEA 1GBEA 3ZZ5A 3BIUH 3M7UA 3ZVFA 1ELFA 1O2IA 4J2YB 2OINA 2WPMS 2PSXA 1C5ZB 1OYTH 4AYVB 3PLBA 4BNRA 1C5QA 2JETC 1N6YA 3U9AH 3E8LA 1LTOA 1GMHF 1XUJA 1ID5H 2C8ZB 1DWBH 3VB6A 1YKTA 1GHZA 1S82A 2CJIA 3VGCB 1QRWA 2O8UA 5LGOA 4WMEA 3SI4H 1SVPA 3ZVBA 2F4LA 2ZDVH 5E0JA 1GVKB 1O2VA 3FOAA 4M7GA 1A0JA 1GGDC 1P0SH 1AN1E 2FOCA 2O8TA 4FU7A 3E6PH 4MVNA 3FANA 2ODQA 2GZ8A 4Z6AH 2A5IA 2QA9E 5F8XA 3HATH 4KP0A 4DY7B 1HYLA 1AFQC 1P9SA 5JBCS 2GDDA 1OP2A 7LPRA 4YESB 2YMSC 2Z9GA 2QGRA 3ZZCA 1H8ED 5JBTA 2ZDLA 1O2WA 2KAIB 5DP7A 3F9EA 2ZFPH 2CV3A 5ETXA 1O5EH 2Y5GA 3A8CA 4CRFA 2M2AA 1V2TT 1C2LA 3UFAA 4AN7A 1T7CA 1IQHA 4UFFH 1PPEE 1Z8RA 1TRMA 1GJ4H 1W0ZU 2P8OC 2J98B 3P8GA 5C3NA 2PV9B 4AX9H 1EKBB 1ZHRA 1P2NA 1QB1A 1F0UA 2AYWA 2F3CE 3AAVA 1C5RA 1UHBA 3C1KA 3GYLB 3U28C 1QNJA 1W0KD 1ARBA 1K1IA 1C1PA 2K1QA 2BDGA 5L2ZH 3M7QA 4Q4LA 2BHGA 1HJAB 4FUBA 1M9UA 3D23A 3M36A 1ABJH 4HTCH 3A86A 2JH6D 4NA7A 1NU7B 1FIWA 2ANWA 3BSQA 5C1XA 2ZU4A 1SBWA 4O3TA 1GBKA 5T3HA 1EOLA 1Y5AT 1MU8B 5FPYA 1ESTA 3EGKH 2NU3E 2ZI2H 1Z8JB 3MQKC
chains in the Genus database with same CATH topology
2HRVA 5C5NA 1E34B 3MWIU 1UTPA 2CHAC 5E2OA 1H8DH 1GMDG 4FU9A 3RLYH 5HXFA 5I46H 1AB9C 1CE5A 3RXEA 4E7NA 2SNWA 5GCHG 1HBTH 4F55A 4TYDA 2EI6A 1Y3WA 2CXVA 3OEHD 2BLQA 2DE8A 4GHQA 1XM1A 5JDUB 1V2NT 3PV4A 5DKMA 4U30A 1GCTB 5LPRA 2SGAA 1BHXF 3TITA 3PMAB 4PROA 2RA0A 2VINA 1QB9A 1ZPZA 2VH0A 1V2LT 3AASA 2I6QA 3LGYA 1YPGH 4FUCA 2G8TA 4ABAA 1GMHG 4CRBA 3F9FA 1NBME 1FAXA 5TJXA 1S6LA 1K1NA 1JIRA 4CHAC 2ZGJA 3SU5A 1EUFA 1ZPBA 3SUDA 3F2HA 1TALA 4WVPE 1Z8GA 1XKBC 1L1GA 4E06H 1LCYA 1P12E 3GDSA 2ZCKP 1Y5BT 1DDJA 2GTBA 3DSOA 1XKAC 2GX4A 3GY4A 1HDTH 2WPDD 1GHXH 1BJUA 1C2DA 1UVTH 3OEED 1V2WT 3AK5A 1XXDA 3IWMA 1JMOH 4CR9A 3L3TA 4I7YH 3Q77A 1FY8E 2IN2A 5DGJA 9LPRA 4AFSA 1K9OE 3QGJA 1KLJH 3MU0A 3DUXH 1FDPA 1V2QT 3JZ1B 1NFUA 1MABB 1EZXC 3KQDA 1ZSJA 3SOSA 3TLOA 4YOJA 2AMPA 1V2KT 4AZ2B 3PROA 2BTCE 1WYKA 4CRGA 1BTHH 1SFIA 4ISHH 2H2ZA 3BTEE 4IBLH 1GBDA 1MCTA 1RTLA 1BIOA 2RDLA 1TLDA 2Z94A 1O3BA 4DT7B 3T29A 2KZ4A 1GVZA 2H1UA 4SGAE 2Q6FA 3AW1A 2XC4A 1L4ZA 4X6OA 4DVAU 1UVOA 4ZXYH 1GJ8B 1C5SA 1MQ5A 5FL7D 4FU8A 2VJ1A 1O39A 3ZZ8A 3CP7A 4KTSA 2VWMA 1RFNA 1OHHD 3EA7A 5HKKD 1C4V2 3ZZ7A 1AKSB 2G55A 1H8IH 3RXFA 3TJNA 2Q6GA 1ELVA 1ZTLA 2PTCE 2QIQA 2VWNA 3RU4D 4ZMAH 4Y6DA 2XXLA 4NSVA 3A87A 2F9BH 1D3PB 2V7QD 3FFGA 4LXBH 4DG4A 1BMMH 4RKOB 2KM0A 1C5WB 1GHYH 1NROH 2G52A 4X0WU 3VB5A 2FOFA 2ZF0H 1XX9A 3RXGA 4FUIA 2O8MA 5JB9S 2A5AA 1HXEH 1GJBB 3EAJA 5DPAA 4TT3D 2ZCHP 3RMOH 1ELGA 3GY7A 2SGDE 3OFND 2XCFA 3KQCA 3HK6B 1SHHB 2P16A 4F4OC 4NIYA 2ALVA 4NZQA 1C5OH 3RU4E 1DE7H 1EPTA 2OQ5A 2WPKS 1P2IA 3SV7A 5B6LA 2P93A 1PYTD 1TX7A 3PM3A 1ABIH 2C4FH 2Z3CA 1EFRD 4LZ1H 4WMDA 1HJAC 4OS1A 5GJ4B 4ZH8A 4XBCA 4H4FA 4NA9H 1XMNB 1TA6A 3SJ8A 3U69H 1LQEA 1CA0C 1ELAA 1O3KA 2JH0D 1YLCA 4MPVA 2J2UA 1INCA 1J14A 3U1JB 4BAMB 1AUTC 2PSYA 3LH3A 4RKJB 1YPKH 3RXVA 1PJPA 1NTPA 1ZJDA 2AGGX 2P3UB 4BTTB 2HNTF 3GYMA 1QURH 1MTSA 1B0FA 5BRRE 3NXPA 1TNKA 2ZHEH 3L6PA 4Y7BA 4ABHA 3O8DA 2J4IA 3N99A 1C5XB 3MO3A 2R0LA 2V0BA 2A7JA 1GG6B 3LGTA 2J95A 2Z9LA 4GCHF 5EG4A 3Q00A 2ZP0H 2NU2E 5EU8A 1YM0A 1UK4A 3A7TA 1OKXA 4K69A 3A8AA 1G2MA 1VITG 1FV9A 3H5CB 1GI8B 3TK5A 1QL7A 4TWWA 3LGWA 1XUHA 4YLQH 2Z3DA 1P04A 1BRBE 4DURA 3PMBB 1BTXA 1YPMH 3ZZ3A 9ESTA 3UPEA 8ESTE 2VB0A 4I8LA 2FS9A 5A8XA 3SO3A 4NG9H 1AIXH 4CBOA 1BA8B 4ZKOU 3RM2H 1SHYA 2C8YB 3NK8A 2GCTB 3V7TA 2PGBB 5C2ZA 4DT4A 1F5LA 1KXDA 4NSYA 2XBYA 5FBEA 1MTNB 4D7FA 1MAXA 1PFXC 4NWLA 1BRCE 3TK9A 1LHFH 3ZVGA 3NPSA 4B73A 2PLXA 3ZZ9A 1EZSC 1JRTA 2JJ2D 1UCYE 1ARCA 1T32A 4TY6A 3M3SA 4WWYA 4D9RA 2W26A 4O9VA 3A82A 4BXWA 1F0SA 3TJUA 2BZAA 1MBQA 1BDAA 3K65B 2J38A 2WUCA 1KXEA 4Y71A 1UCYK 1TYNA 3LT3A 1V2PT 2CGAA 2A0QB 3TH4H 2FLRH 1UTNA 1EASA 4K1SA 1O3PB 1FI8A 1YGCH 4BAHB 1IQKA 1NRRH 3SU2A 5AFYH 1FY4A 3NWUA 2AFQB 4KELA 1K2I1 1OYQA 3N7EA 1O3GA 1UTQA 1AO5A 2Y81A 1KYNA 1CBWB 1KMHB 2BDAA 2ZA5A 1E1QD 3GCHB 1NFYA 1O3CA 1DUAA 2ZU2A 1WCZA 4B2AA 1GI7B 1O31A 1LDTT 1J8AA 2V35A 4Q63A 4AB9A 1SGCA 4YTAA 3SNCA 3RXLA 1HFDA 4DIIH 2OC0A 1QJ1B 2KCYA 1PPZA 5AF9H 3KQEA 4AGKA 1F0TA 4XBBA 3B23B 4Q7ZA 1QHRB 1P57B 2Z9IA 3DFLA 3TK6A 1FY3A 2ZECA 2ZKSA 3MU5A 3UWJH 1DSUA 2VIVA 1ZHPA 4YZUA 3SJKA 1AZZA 1NFXA 1NRPH 2TGPZ 3DHKH 2BD8A 2ZQ2A 4Q7XA 4CR5A 1FY5A 1V2ST 2R3UA 2FODA 2ILNA 3BTDE 2V6NA 1C4U2 1AHTH 4IC6A 1CT2E 4K60A 1GHVH 1O33A 2ULLA 3SNBA 3MTYA 4CH8B 4INLA 1DWEH 1D9IA 1PQAA 2P95A 1MZAA 2O9QA 3D49H 1S84A 1LPGB 1J15A 2GCHG 3ENSB 1DANH 5CMXH 1SGQE 1UTLM 1DS2E 3BG4C 1ETSH 4YXWD 1AVWA 5JYIA 3P8OA 1CGJE 3MHWU 3ZIAD 1P06A 3GICB 4X1RU 2FYRA 4WXVA 2G51A 4DCDA 6GCHF 4NCYA 1G2LA 4X1PU 1IQJA 2ZFTA 1O3AA 4B6FA 1IHSH 3SNEA 4MNWA 1L4DA 3A8DA 5ABWA 1HUTH 1O3FA 3RXBA 1BMFD 3DFJA 4IS5A 2QF4A 1O34A 4JZIA 3QK1A 3TGKE 1O2KA 3LOXA 1W7XH 5F03A 3SUEA 1ZJKA 1WQSA 1LPKB 5LPFA 2R9PA 1E36B 1OPHB 3UIRA 3ZZ6A 1P2MA 3ZVEA 1TX6A 1A46H 5AVDA 3M5LA 1HV7A 1C4Y2 1DX5M 4Q7YA 3MU1A 1GI0A 3ATMA 1YP9A 2YNBA 2XYAA 5LH8A 1EAWA 5FPTA 1SR5C 2G5NA 1THPB 2A5KA 2A4GA 1F0RA 4ISNA 6ESTA 1T4UH 2FTMA 3WWFA 1FONA 1T8LA 1E37B 4OS6A 5EOKA 1ESBA 1H9HE 1KSNA 2L6OA 1BZXE 1C1NA 4D76A 3RMMH 1KDQA 4ZROA 2OK5A 4B2BA 2ESTE 3Q3KA 3U8OH 1SC8U 1ZGIA 2WPJS 2PUQH 4H42U 3RXHA 1S5SA 1A5IA 2KCPA 1HIAA 1BB0B 1NN6A 3MU8A 3U1IB 1SGTA 2FZZA 2HLDD 3GCNA 1DICA 2CF8H 1MCVA 3ZZAA 3BN9A 1AVGH 1COWD 1GI5A 4B71A 1UVSH 1G32B 6CHAB 5GCHF 1RJXB 2AEIH 3P92A 3FN8A 1BT7A 3D65E 2GT8A 4X8UH 3SN8A 1EJNA 5B6OA 2ZHFH 3PTBA 1X7AC 2SGPE 4I31A 1P05A 2ASUB 2XRCA 2ZG0H 1WV7H 4FUEA 2GZ7A 3TGIE 1C1SA 1GDNA 1IQNA 1BMLA 2B8OH 5FX5A 3O8BA 2F9NA 1TWXB 2WYGA 1GBMA 1TNLA 1N8OB 3V12A 3SJIA 1VZQH 1Z8IB 1XUFA 1SGYE 3LC5A 2XNDD 2QN5T 1OS8A 1HJ8A 1D6WA 3A8BA 2ALPA 1BTZA 1P3CA 1DLKB 2AMDA 4WJG2 3ZZDA 5TCCA 5E0GA 3S69A 1GJ9B 1UHBB 2FI5E 3ZYDA 4WXIA 2A45B 3OTPA 2W7UA 2BY7X 3UB0A 2A7CA 2Z6BD 1ZSLA 3CS0A 2QY0B 5DP3A 2FI3E 1NZQH 6GCHG 2FDAA 1GI1A 2IPHA 1FXYA 3Q76A 1C5NH 5DP8A 1DITH 4U01A 1NU9A 4M9FA 1O2OA 2OD3B 4WY3A 1O30A 4ABDA 1CHGA 2A4OA 1C9TA 1PYTC 1GBAA 2JH5D 3VB7A 2QC2A 2ZPRA 1O2GH 2TGTA 3AVZA 3ZVAA 4MNXA 2QE7D 1HAHH 1RIWB 1OXGA 1SLUB 1WUNH 1V2JT 2FP7B 2BDCA 1CHOG 1K1OA 4JZ1A 4UFDH 3T62A 1LHDH 1MH0A 2GP9B 1V2RT 2FIRH 2ZEBA 1G37A 1YPEH 2VGCC 3MYWA 4D8NA 2HALA 1QBVH 2CMYA 4NIWA 1C2FA 3SZNA 4Q80A 3MH4A 1AUJA 3SV6A 3SYJA 1SGDE 1DM4B 1TNJA 3UWIA 3GY3A 1GI4A 1OWIA 2D2DA 1DFPA 1MQ6A 2XW9A 1CT0E 1O38A 3A7YA 3F2FA 2I6SA 4H6SB 3LJOA 1NO9H 4IN2A 2ANMH 2QCYA 4MTBA 1Y5UT 1MKWH 4JYTA 3KL6A 4OS2A 2SGFE 2VNTA 3GY2A 3ZVCA 2FO9A 3HPTB 1GHAG 2HVXA 1O36A 1TRNA 4TY7A 5DSFA 1QL8A 1WSSH 1H8HD 4X6MA 4ASHA 3GY6A 3FKSD 2FOMB 7GCHF 2JJ1D 2H5DA 2XBXA 4K1TA 4Y7AA 1Z71A 1TGNA 3UNSA 2O8WA 3VFEA 1O2QA 2BXTH 4B1TA 2Z3EA 1A0HB 4JZFH 3P95A 3SU0A 2B5TB 1AE8H 3VPKA 1TE0A 1ZGVA 2JDID 1SOZA 1QBNA 1GJDB 4A92A 3ATLA 2XCNA 4TPYA 3B8JA 1BBRH 2NU1E 1LVMA 2WPHS 4WMFA 3HGNA 3LC3A 1O35A 2C93B 2HGTH 1HJ9A 3S7HB 2BOKA 4Y76A 5AHGH 3UQVA 3QTVH 1SGIB 3SV8A 4UFEH 1BBRE 1JOUB 1TGSZ 2BD7A 3FP6E 5DP4A 3VEQB 1GBCA 3LGVA 2KR7A 3LH1A 1UJ1A 4MNVA 3BTHE 5CHAC 4XOJA 4MNYA 1BBRK 3DSPA 1O2HA 2PKSC 3TVJB 1QBOA 1IQMA 1HAVA 4XD7D 1DWDH 4UE7H 1QB6A 1A1RA 1G3EA 1LVBA 1ZLRA 2UWOA 4MPUA 2GMTB 1ACBE 3TU7H 3SUFA 2BD3A 1C5VA 1LO6A 2ZCLP 5L30H 4O97A 2TRMA 2BY8X 1TBRH 5EW1H 2BB4A 4U32A 2BDYA 1VITF 1GPZA 5EPNA 3P8FA 1P03A 1UVPA 1AWHB 3H09A 1JWTA 3OU0A 4UD9H 2FOGA 5T6FA 3SGAE 1ETRH 2WYJA 5FCKA 2BZ6H 2VH6A 4OGYA 2BLOA 1C5PA 1C5YB 1FUJA 2FPZA 4A1VA 1N8OC 1S0QA 1Y3VA 2J5UA 2CN0H 2GGVB 3CENA 3UR9A 1LVOA 3A7WA 3MH7A 4ZUHA 3VGCC 2PHBA 1EPTB 3FAOA 3SU6A 3VG8A 1MTVA 3GDVA 1HAGE 1LHEH 1SSXA 2OUAA 3ZV9A 1CA8B 3K6ZA 5K0HA 1MMJN 5GDSH 2DUCA 5H4IB 1RRKA 1PQ5A 2BOHB 1G3CA 2ZHQH 3F1SB 2FLBH 1KXCA 3OYPA 4X2XA 1EP5A 4B2CA 4K8YA 3TIUA 1L2EA 3RXIA 3S9AA 1TPAE 1SI5H 3BEIB 1ZRBA 1O2XA 4BTUB 4ZKRU 3RXQA 2AS9A 3MMGA 3SHCH 1W14U 2BVRH 3MOCA 3OY5U 3PLPA 2WPLS 4JZEH 4MG3A 2C90B 2FI4E 4NFFA 1IQFA 2BX3A 7GCHG 2BY9X 2FYQA 1BTPA 1A4WH 1O5DH 1Z7KA 2A2QH 4ZCNA 2VVUA 1GL0E 2OCVB 4CRAA 4Y8XA 3VXEH 4ZHMU 1O2PA 3RP2A 1K1PA 2GZ9A 2F9OA 5J4QA 1XVMA 3V0XA 1HRTH 1V2MT 3JZ2B 3QLPH 1P8VC 1BQYA 3GCTG 2OQUA 1RTFB 3A7XA 5L6NH 3BTKE 1DLEA 1KLIH 3WWBA 2FXRA 4YOGA 3SNAA 1ZSKA 1SB1H 4ZHAA 1SGEE 3A83A 2GV6A 2W3IA 3BTQE 3T27A 1A7SA 1TNGA 1QIXB 1L1JA 1BTYA 2QAAA 1VJAU 3PO1B 4Y8YA 1C5UA 1RD3B 4ABBA 3LJJA 3UOPA 1YF4A 3QZRA 2D1JA 1SKYE 3TPIZ 1G9IE 4OM9A 1A5GH 1GJ7B 1GBJA 2AMQA 2ZQ1A 4K5ZA 2QF0A 5F8TA 3OE7D 4FUHA 5K7RA 5E0HA 4RSPA 2SFAA 2RG3A 1BTUA 3PV2A 1T8NA 1TMUH 2O8LA 4OS4A 4Y11E 3E3TA 1FN6A 1FZZA 2M5TA 1IOEA 1BCUH 3MNXA 2F9PA 1IQGA 2D26C 4JK6A 2V3OH 3I78A 1S6FA 4K8BA 1O2LA 1TIOA 1QJ7B 2CF9H 2WZQA 1H4WA 4B75A 3H7TA 1GCTC 4JK5A 3ATKA 2ZTZA 1PQ8A 3LGIA 1WXRA 1C5LH 4IMZA 1ANCA 1JXPA 4Y79A 1UK2A 3SI3H 1O2MA 1XUIA 3SGBE 1AZ8A 2DE9A 2GCHF 1B7XB 1OOKB 1B5GH 1YCPH 4X1NU 3LGUA 3NRLA 1GBFA 2QXIA 1C1QA 3QGNB 3KQBA 2GV7A 2AGEX 1LMWB 1T4VH 3SNDA 1T8OA