3PO1B

Thrombin in complex with benzothiazole guanidine
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
147
structure length
147
Chain Sequence
b'IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thrombin light chain
publication title Discovery of benzothiazole guanidines as novel inhibitors of thrombin and trypsin IV.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 27
structure length 147
sequence length 147
ec nomenclature ec 3.4.21.5: Thrombin.
pdb deposition date 2010-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3po1B00
1QRZA 3BN9A 1AE8H 4HZHA 1Q3XA 1TMTH 1A5IA 3QWCH 4A92A 1O2TA 2NU4E 4WF8A 5LH8A 4YLUA 1SQOA 4O3UA 1YPKH 1PQAA 3MO6A 4Y10E 2UWOA 2OUAA 4MQAA 3EA9A 2BD5A 2EI8A 1QB6A 3IITA 2ZDAH 4QT8C 4KTCA 2PGQB 3A81A 3E3TA 5A0CA 1TNLA 5GDSH 3QTVH 1MTSA 3C1KA 1NC6A 5ESBA 2H6MA 2Q6DA 4X1RU 1EPTA 1VITF 2HNTC 1G32B 1V2ST 2H9TH 3LIWA 3P17H 4I8GA 3FAOA 1FN8A 3RXOA 1O30A 5C1YA 3TVJB 3VB4A 5E0HA 5EXLA 1ZGVA 2XC5A 4X6NA 4ZKSU 1BT7A 2G00A 1F0TA 4I31A 4M7GA 4ZXXH 2VIVA 2JKHA 4NFEA 1BCUH 4ABAA 4Q7YA 2FPZA 1GG6B 2BY8X 1GBFA 4CRGA 3O8CA 4IN1A 2ZGBH 1NZQH 4Y6DA 1VITH 2C8XB 1CHGA 1C5LH 2GMTB 3RXAA 4ZHMU 1KSNA 4MNXA 2ZDMA 1C1UH 2VIPA 1JOUB 1BTWA 4DW2U 3EYDA 1GGDC 4CH8B 1ZYOA 2QXJA 1TABE 1Y3UA 3BEFB 3L3TA 1ELVA 1ZMJA 4IBLH 4RN6A 3TGKE 2Z9LA 1IQKA 2ZU5A 1T8OA 1THRH 1N6YA 1C5OH 3M7UA 1AO5A 2V35A 2B5TB 1ELDE 1P2QA 4XE4A 1UVUH 1K21H 1L0ZA 4DCDA 1V2QT 1LVMA 1H8IH 1LCYA 1W7XH 1WQVH 1ANCA 2VWLA 1F0SA 3RXTA 4NIVA 3SORA 2TGPZ 3ODDA 4JK5A 1LPKB 1C1VH 2P3FH 3UY9A 3SU2A 1HYLA 4AZ2B 1CO7E 1A3EH 1OWKA 1NRSH 2FYRA 4ISIH 1QCPA 3A80A 1C2KA 1NESE 3A8BA 1DS2E 1BMMH 2Z94A 1MKWK 2OD3B 1P06A 2OXSA 2WUCA 2WV4A 3ENSB 2PW8H 3K65B 1HAVB 1GHWH 2BLOA 2O8MA 1TAWA 1GJ8B 4X6PA 3UREA 4WVPE 1G37A 3MU1A 1UO6A 3IWMA 2YNBA 1ID5H 1QNJA 3MFJA 3TH3H 1DWDH 1HNEE 1YPHE 1C2LA 1EAWA 1O36A 1P2MA 4MPXA 4THNH 4H6TA 2Z9KA 4OS4A 3SU6A 4ISLA 1TQ7B 3UUZA 1CGJE 1MZDA 1AI8H 1GDQA 1KLIH 3NWUA 2ZU2A 1O38A 2ODQA 3BIUH 1PPBH 3KQEA 1SHYA 1TOCB 5EG4A 2A1DB 1GJCB 2WPMS 1O5CB 3C27B 1GMCG 1SGIB 2Y6TA 1QR3E 2QCYA 5LPEA 5AFZH 5FCRA 1BJVA 1UTMA 2ZHDA 3ZV8A 4I7YH 1DDJA 3PWCA 2ODPA 1YCPK 1GJ9B 3TK6A 2O8WA 3I77A 3D65E 1MD8A 3RXBA 2PKSB 3P8NA 5GIBA 5HGGA 3BG4C 5A2MH 1NPMA 4SGBE 1GMHF 2BM2A 3A87A 1C5PA 1RS0A 3BTWE 2ZEBA 2A4OA 3FFGA 2V0BA 3MYWA 3MO3A 4JCNA 3ZZ6A 1O39A 7GCHG 2BOKA 1BRAA 2XXLA 1UCYE 1TRMA 1DUEA 4YM9A 1ZHPA 1SC8U 1K1IA 4Y71A 1Y3XA 1O37A 1LHDH 1F2SE 4ISOA 1SLXB 3ATWA 3MTYA 3R0FA 5T6GA 1HRTH 4DGJA 1GI5A 1DLEA 1GGDB 3TJNA 2ZF0H 3ZZCA 2GV7A 2VWOA 1MAYA 5C5NA 1TIOA 1YPHC 2J34A 1GI2A 1IQMA 1HAIH 2OBOA 3DA9B 3SV2H 5BPEA 2J38A 3SW2B 1G30B 1MQ5A 2F3CE 3ZZAA 1OKXA 3GCNA 1ELGA 1L4DA 1W0YH 3SV9A 1GBAA 1VR1H 1YCPH 1YLDA 3GY5A 1W3CA 2J4IA 1ETRH 2BYAX 1O3IA 1FQ3A 1G3BA 1NN6A 2C8WB 1P57B 1Z6EA 2J9NA 5DKMA 1GBJA 1BRUP 1Y3WA 1ZOMA 3U1IB 1V2OT 2AH4X 1HGTH 5ABWA 3QGJA 1A0LA 1GHAF 3T25A 2IPHA 2XTTB 1T7CA 1QRWA 1HJ8A 1HXFH 1HIAB 2ZQ2A 3GDUA 3HGPA 4D9QA 2PTCE 3B9FH 2QIQA 4MVNA 4Y8XA 4A1TA 1O3KA 4ZKRU 1B0FA 2G8TA 1TA2A 4B74A 3EAJA 3Q3XA 3MH5A 2I6QA 4XBBA 1W12U 3KIDU 1P2IA 1WTHD 1TGNA 5EOKA 3V12A 4U32A 5F6MA 1MTVA 3SUEA 1H9LB 1QGFA 2HWLB 4DY7B 4O97A 1GHBG 1CGHA 2C8ZB 5JDUB 1MKXK 1SOTA 2P94A 1A3BH 4KP0A 1EKBB 3GYMA 3U98H 3MWIU 1PPZA 1BITA 2ILNA 5JBAS 1DY8A 1K28D 4J2YB 3TK5A 3LGTA 5JB8S 1HJAC 2K1QA 2Q6FA 1TBZH 1LVBA 1VJ9U 2GDEH 1ELAA 1X7AC 2F91A 1CA0C 2F9PA 4ZMAH 4UEHH 3F9EA 1FIWA 3W95A 1O3HA 1C4V2 5E8EH 4CH2B 1O5GH 3GY7A 1OYTH 1NM6A 1D3QB 5IYTA 4FUCA 1EASA 1HLTH 1KTTB 3BTKE 3UOPA 3MNXA 1NFUA 3PMJA 8LPRA 3S9AA 2ZPRA 2VGCC 1YBWA 1FY3A 3T26A 1IQFA 1TX7A 4IS5A 1AFQC 1ORFA 2TGAA 1TMBH 3SJIA 1LPGB 1ZJKA 1FY8E 2AFQB 2BD3A 4BOHA 2R0LA 3QN7A 5JB9S 3P95A 1A61H 3TK9A 3M7TA 1Y3YA 1E35B 2QF0A 1LTOA 2CV3A 2ZTZA 3AW1A 3BTFE 3UFAA 1JWTA 4ABGA 3ZVFA 1MKXH 2CHAC 4K1TA 4B71A 2PUQH 5F03A 2BX3A 1A0HB 3RU4E 1OP0A 2AGIX 4Y8ZA 4U01A 2BLWA 2ZDLA 3CP7A 1C9TA 2Y82A 4FUBA 1BTHH 1SGQE 1SGFG 3LGIA 2SNVA 2HNTF 5EPNA 1SGTA 4FUIA 1FAKH 4FUJA 4FVDA 1AHTH 1P09A 3OY5U 2FXRA 2FOEA 1O2HA 2ZCLP 1GJ7B 3Q3YA 3GCTF 3SNDA 3E16B 3O8RA 2BQWB 7LPRA 1Z71A 1V2LT 1HAYB 1OSSA 1DANH 1YP9A 1GBMA 5FBIA 3RU4D 1IHTH 7ESTE 4OS2A 2QC2A 1F0RA 3Q77A 2PR3A 1AY6H 2I6SA 3CENA 4J1YA 2ANYA 1TFXA 4Y79A 1J14A 3URDA 1V2NT 1BBRH 1C2DA 1O3FA 1SI5H 4Q2KA 3PMHB 1SSXA 2TBSA 1EPTB 3B8JA 3E8LA 5C67A 1IHSH 3GDSA 1P03A 1TQ0B 1V2RT 1CBWB 2OLGA 4TY6A 2FI5E 2O8LA 3HGNA 4CBNA 3ZZ4A 3OU0A 1C4U2 2VIOA 2XCNA 7KMEH 5JYIA 3S9BA 1J16A 1O2GH 1E0FD 5DGJA 1QB1A 1DSUA 4DIIH 5HM9A 1P04A 1D4PB 3EA8A 1BUIA 1N8OB 2ODYB 5CMXH 1C5QA 2BD9A 4WH6A 1O2SA 5A09A 4ZUHA 1A7SA 1L1GA 2FOBA 3TU7H 2BVRH 4AGKA 2C8YB 1NFWA 4UDWH 1BMLA 1H9IE 1HV7A 4TYDA 2GKVE 5J4QA 4X8VH 4UFFH 4ABHA 4ISHH 1DE7H 1TA6A 1GJ6A 1E38B 2ZDVH 5AHGH 2VH0A 4K5ZA 3M37A 1C5XB 4FU7A 2ZQ1A 4MNVA 3M7QA 1TPPA 1MBQA 8ESTE 2W3KA 2EEKA 1BRBE 1MTWA 1FJSA 1C5ZB 1Y5UT 2WPIS 2ZG0H 3ATLA 1O2LA 2Z9JA 3E0PB 3TIUA 2VVUA 2BZ6H 3PYHA 4CRCA 4DT7B 1YC0A 6LPRA 1LDTT 1QQ4A 1CA0B 1XMNB 1YYY1 2F9NA 2Z3CA 3F6UH 1GBDA 1P8VC 1ZMLA 1KXAA 1C1WH 4ZHAA 3VPKA 1GVKB 2ZZUH 1UVTH 3D23A 2FIRH 4ZAEA 4WY3A 1CSOE 2XYAA 3ZVBA 1NY22 1FY5A 1MU8B 1DY9A 4K1SA 4K2YA 1AFQB 4NA8A 3SU5A 1UHBA 3MU5A 1KLTA 3T28A 3BTME 1MTNC 4HGCA 1DOJA 2VNTA 1P2OA 6GCHF 1A5GH 2P3UB 1GI6A 2VU8E 4K3JA 5I25A 2STBE 3ZVEA 1V2TT 2OINA 2QYIA 4MG3A 1GI4A 2QY0B 3MMGA 1DXWA 3S0NA 2SNWA 1DXPA 3DFJA 8GCHF 1XUHA 6CHAC 1Y59T 1ABJH 1FV9A 1O2RA 2FDAA 2GTBA 2ZFRH 4Y7AA 2FWWA 1SLWB 1V2KT 3A8DA 1YGCH 2AGGX 3RXGA 3UTUH 1QTFA 4GSOA 1MU6B 3SU4A 4GVUA 1FIZA 1LHCH 1ZGIA 3GCOA 1GCTB 2XBVA 1TWXB 1Y8TA 1GL0E 1TE0A 1UK3A 2NU0E 3S69A 1RTFB 2V3HH 5DP5A 2FO9A 1NRNH 1XVOA 1D3PB 2YOLA 4JZDH 1TB6H 2FS9A 2G52A 1IQLA 4A7IB 1PPGE 4AG1A 3SNEA 2AYWA 2PUXB 4X1NU 2AGEX 3E0NB 2BDAA 1Z8RA 2GV6A 3OTJE 3CS7A 1C2IA 4B76A 4GUXA 2WPLS 2FP7B 2O8UA 3GY6A 3QTOH 3BV9B 5DP7A 1SQAA 1C5MD 3MU0A 4SGAE 4D7GA 1JRTA 1GJ5H 4CRAA 3TLOA 1EAIA 1RXPA 3NKKA 3LGUA 1A5HA 3RXUA 2A7HA 2DE8A 2J95A 1GDUA 4AYYB 1QHRB 1P2NA 2W7SA 1C1MA 4K8BA 2ESTE 2STAE 1Z1JA 1JMOH 1OWDA 1TBRH 6ESTA 1F5LA 1O3MA 3I78A 3LKWA 1AN1E 2VIDA 1CU1A 2ZO3H 4ASHA 2P8OB 4R8TB 1WBGB 1QJ1B 2G5VA 1H1BA 4BAMB 1AVGH 4WXVA 3LJJA 5F8ZA 2XNIA 2F9UA 1QRXA 4NGAH 1TGSZ 1HAOH 4DVAU 2BDIA 4FUDA 1XXDA 2WPKS 1EZQA 1O3EA 3PO1C 1BDAA 1HFDA 1GI7B 5EW1H 2GCHF 4BTIB 5EPYA 2VB0A 3UWIA 1D3DB 2XRCA 4A1XA 1A0JA 2BDGA 4Z6AH 1PPCE 1D9IA 1YKTA 4MDSA 1EX3A 3ZVGA 3T2NA 3EA7A 3IG6B 3PB1E 1O2OA 1THPB 3BSQA 2OC7A 3U69H 2PLXA 2XBYA 3F9GA 5SGAE 1O2ZA 4XBCA 3RXFA 1O33A 4HFPB 2F9VA 4A1VA 3DD2H 3KNXA 3D49H 2GVFA 3GY2A 3MU8A 2DE9A 2Y5HA 2NWNA 4X1SU 3SV8A 3A7ZA 1T8LA 3A84A 1K1OA 2GCTC 3WY8A 1AFEH 1KLJH 4WH8A 1O3BA 3BG8A 1H8DH 1S82A 2B9LA 4NIXA 2ZDNA 4RKJB 1XUKA 4NSYA 1OYQA 3BTHE 1C1TA 3OYPA 2ZGJA 3A8AA 1QURH 3LC5A 3E1XB 2NU1E 1CVWH 2A31A 1IQGA 1TOMH 3BTEE 4ESTE 2QXGA 3FZDA 1BRCE 1W11U 1GHZA 1L1JA 3FVFB 1OX1A 2F9OA 1UVPA 1Z8JB 2FX4A 1TONA 3QX5H 2ZFSA 2FOHA 5DK1A 4E06H 1RGQA 3FP7E 1GJDB 1QBOA 1GBLA 4B1TA 1A2CH 1LQDB 3I29A 1O2NA 2CN0H 5ETXA 4NIYA 1K1NA 3SQHE 4INHA 1GBHA 1V2JT 3MI4A 4AB9A 4D8NA 1FMGA 1ACBE 5GCHG 1MD7A 1C1SA 1THSH 1AU8A 4ABJA 3P8FA 5HXFA 3KGPA 3ZZBA 1V2VT 1LPZB 5FBEA 3RXIA 1HCGA 1TMUH 3GYLB 1ZPCA 4CHAC 4IMQA 1C2HA 1EXFA 1O3LA 1QL9A 3M3SA 1C1QA 3PMAB 3AAVA 1ELEE 1W10U 1GJBB 2BD8A 4ZKOU 4O9VA 2BZAA 3T27A 1NRPH 1A4WH 1EUFA 2WV5A 1JIRA 1VJAU 1O3DA 3LU9B 2XC4A 2XWAA 4AB8A 1T8NA 1Y3VA 1LVYA 4RKOB 1IOEA 5FAHA 3VFEA 3LPRA 3A89A 1ZHRA 2VH6A 1ZSLA 1DITH 1C2GA 3PM3A 3OX7U 4AFQA 5TJXA 4XBDA 4OGXA 3LGVA 4UFDH 4TWYA 3S9CA 3SGBE 2YNAA 2H2ZA 2AEIH 3PTNA 5EQQA 1FPHH 3ZZ5A 3ATKA 3TNSA 2BLVA 1V2UT 2FS8A 1OWIA 1QL8A 3M5NA 1ANDA 2P59A 1BTZA 1UTOA 3BIVH 5F8TA 1O3GA 1HAPH 1C1PA 2HOBA 1RIWC 1PJPA 3ODFA 3V0XA 1XUJA 3ZZ7A 2R3YA 5EGMA 1FN6A 2UUKB 2W7UA 1B5GH 1F0UA 4BTTB 3PO1B 1MUEB 1B0EA 4GCHF 4AG2A 1WYKA 4HI3A 1FPCH 5H4IB 2SGFE 2C93B 3ATIA 1VITG 4BAHB 3QZQA 4MPWA 4R0IA 1SPJA 2H9HA 1TX6A 1UTQA 3LDXH 2CMYA 1O2WA 1P10A 3MNSA 4JYUH 1HPGA 3SNAA 2QXHA 1LMWB 2THFB 1WUNH 3FP6E 3VB5A 3RU4T 1NU7B 1Z8GA 3AW0A 4DIHH 2LNCA 2FYQA 3F9HA 2Y7ZA 3F9FA 1ESBA 1V6DA 3EQ0H 2B7DH 2RDLA 3PV4A 3TGJE 2BD4A 1TBQH 3RXJA 2PV9B 2VINA 4WWYA 3TNTA 1GHYH 1YCPM 2GCTB 2IOTA 4BTUB 1CHOF 4X8SH 1YM0A 1O5DH 4X2WA 1GHVH 1YPLH 2QV1A 1ELTA 3UR6A 1V2WT 1PPEE 1UVOA 4H4FA 1QFKH 4PROA 2AMQA 1AD8H 1BZXE 1D6WA 3VB7A 1SLUB 2BD2A 1SVPA 2QAAA 1UMAH 4MPVA 2CGAA 2G51A 2GCHG 2GZ9A 4NA9H 3PLKA 3KEEA 4NIWA 1F92A 4X2YA 3RXQA 5L6NH 1ZSJA 5EW2H 1YPMH 1FXYA 3RXKA 1PQ5A 2A4GA 4AFSA 3RMLH 1BMNH 1P9UA 1JIMA 4Y76A 4UE7H 5GJ4B 3JZ2B 1MTUA 1HXEH 2UUFB 3UNQA 3GDVA 3KL6A 1RFNA 3UR9A 5JPMH 1C5YB 2EI6A 1SQTA 1SGRE 2JETC 1GI1A 2AMDA 3T29A 1AGJA 2ANMH 2M5TA 1KXFA 1PYTD 3JZ1B 1S83A 3GCHC 5T3HA 1EP5A 4CRFA 1BTUA 4YOIA 2ZU1A 3ZYDA 4CHAB 4Q7ZA 2R3UA 4CBOA 3RC6A 5A0AE 3RXSA 1L4ZA 3SJOA 1UHBB 2D1JA 2BHGA 1XX9A 2VWMA 3SI4H 3A7VA 3ESTA 3OY6U 4IGDA 4YOGA 1C9PA 2EA3A 3U8RH 4BXSA 3RLYH 2PFEA 1AE5A 2D2DA 4LK4A 3ZVCA 2BQ7B 1M9UA 1RTLA 2R2MB 3BG4B 1O2KA 3A82A 3DUXH 1BBRK 4KTUA 4XDEA 2ZWLH 3SUGA 1ZTJA 2ASUB 3AVZA 5CHAC 1TYNA 4B75A 3BF6H 1BTPA 3SU3A 1ZTKA 3E91A 4UD9H 2FOAA 2WPJS 3CS0A 3RMNH 1EOJA 1AZ8A 4JK6A 4H6SB 2BOHB 3SO3A 4GPGA 1HAXB 3U8OH 1NTPA 1XUFA 4XOJA 4X6OA 1IQIA 3SUFA 1FNIA 2C3SA 1D3TB 3SN8A 2W5EA 9ESTA 3QGNB 2OQUA 5LGOA 4X6MA 1MH0A 1BB0B 1GJAB 1W0ZU 1O3NA 1RIWB 1V3XA 4OS7A 2JH0D 4A5TS 3LC3A 2FOFA 2BVSH 1TALA 3SJKA 5AFYH 2ZFFH 1PYTC 2FTMA 4K8YA 2OP9A 4WMDA 1S0QA 1O5EH 2FI3E 2OCVB 3ZV9A 5LPRA 4IMZA 2FX6A 2V6NA 1L1NA 4X2VA 2HVXA 1GMHG 1CT0E 2QN5T 4I32A 5FX6A 3M3VA 3P70B 1AMHA 3A88A 2FOCA 2GZ8A 1SLVB 2DUCA 2CF8H 3RXMA 1T4VH 3SU0A 2OQ5A 2PSXA 2BMGB 4FUEA 5EODA 1ESTA 2BXTH 3RXEA 3G01A 2XW9A 1SR5C 2G5NA 1ZZZA 1TNKA 1SGNE 3SQEE 1AWFH 3TPIZ 2ZFQH 1J17T 3FZZA 4GHQA 2QGRA 4LOYH 1C2MA 1S85A 1ZMNA 3K6YA 4YT7H 1QBVH 3DT0H 1J8AA 2HALA 3UNRA 3RMOH 4DG4A 1YPEH 3AASA 3NUMA 2LPRA 3P92A 1TPAE 1P02A 1E34B 1AUJA 2CF9H 3BEIB 2ZNKH 1GI0A 3QZRA 5FHTA 4FXGH 5E0JA 1BIOA 1PFXC 3M3TA 2WYJA 3UOUA 4FUFA 3STJA 1OWEA 2TRMA 2VJ1A 4ABDA 1EP6A 3KHVA 5C2ZA 3URCA 3PTBA 1MAXA 1FDPA 4FU8A 3RXHA 5B6OA 4B2CA 1HAGE 3PMBB 1Q2WA 4X0WU 1ZR0A 2SGEE 1VZQH 1ZRBA 3L33A 2P3TB 4INLA 5G4BA 1GG6C 1RJXB 2Y81A 1UTJA 1ZHMA 2FLRH 1GHAG 2FOGA 4MLFB 1HJAB 1NROH 1UTPA 3TGIE 2C4FH 1CQQA 2FESH 1WCZA 1GBEA 4GLYA 5C5OA 4HTCH 5JBBS 5FPYA 4VGCC 3V13A 1C1OA 3V3MA 1GBBA 1RTKA 2G55A 2A5IA 4NSVA 1DSTA 1OXGA 1WOFA 2VGCB 2BY5X 4NA7A 1FAXA 3MO9A 5C20A 2RG3A 5GWZA 1ARCA 4JYTA 2BXUH 2VIQA 3U1JB 1B7XB 4JZEH 3BTGE 5CHAB 1QY6A 2FMJA 2PGBB 2SGAA 3HK3B 3F1SB 3SNCA 1K1JA 1P3EA 3GY8A 3NXPA 4WMEA 1SB1H 2CHAB 1LHFH 3SV7A 4YT6H 2P16A 3VXEH 3B23B 5A8ZA 1O3CA 1N6XA 5A8YA 3VXFH 1A46H 1O3PB 2BY6X 1NO9H 1K9OE 2OC8A 4INKA 5FXLA 4AGJA 1BJUA 1O2MA 2ZCHP 1YPJH 1NFYA 1C4Y2 3QDZB 4NWKA 2H5CA 2TPIZ 5FPTA 1FY4A 2B8OH 3M5MA 1PPHE 1O2XA 4AX9H 2FODA 3UIRA 2Q6GA 3SBKA 5C1XA 2A4RA 1QIXB 4IW4E 1ZPBA 1AVXA 1OP2A 2GD4B 1GWAA 1O0DH 2A7JA 1XUGA 2ZPSA 4OS1A 4KKDA 1GMDF 2Z7FE 4Y7BA 1K1PA 3E90B 1G2MA 3A7TA 1VCPA 7GCHF 3ZZ9A 1GI9B 4IN2A 4B2AA 3SJ9A 2SGQE 4B73A 4OGYA 4MTBA 3K6ZA 1O3OA 1T4UH 1PQ8A 1DX5M 2Y80A 1OWHA 2W26A 1CT4E 2ZFTA 4ABIA 2GDDA 1PPFE 1WV7H 1LHGH 1AVWA 5E0GA 1J9CH 2ZHQH 2PTNA 1O2QA 1AQ7A 3Q3KA 1EZUC 2A4QA 3LGWA 2F83A 1O35A 3GCTG 4AORA 3F68H 5EU8A 4ZXYH 2ZGCA 3BTQE 3LOXA 3GY3A 1EAXA 1OWJA 2PKSC 1HUTH 1F5RA 1LO6A 3LONA 1IQEA 3MH6A 3STIA 4JZFH 1UCYK 5DO4H 4YESB 1E37B 2XCFA 3TITA 3UQOA 1DFPA 3P8OA 1OOKB 4IC6A 4BNRA 4FUGA 4JZ1A 1UTLM 4YO9A 2QXIA 1O2YA 2CXVA 2A2QH 1XXFA 3QLPH 1GCDA 3PROA 4UFGH 1FONA 4FU9A 1C5RA 1S84A 3VB3A 4K1EA 3TJVA 3ATMA 3K2UA 4Q7XA 1SMFE 3Q00A 4CR9A 1EZSC 1KY9A 4VGCB 4Y11E 4X8TH 1JBUH 2D26C 2TGDA 3QO6A 1P2KA 4NFFA 1OS8A 1VGCC 1EAUA 2FLBH 5DG6A 3ZVAA 1LHEH 2HRVA 2BLQA 1OP8A 1WSSH 4AN7A 3ITIA 1GHBF 3UPEA 1MTNB 3SZNA 2HPPH 2TGTA 1ARBA 1QB9A 1P01A 1G3EA 1UCYH 2O9QA 1EJMA 4IC5A 1BTYA 3L6PA 3SUDA 1HDTH 4CR5A 4K69A 1O5BB 4DJZB 5AF9H 2XC0A 4U2WA 1C2EA 1XKBC 1KXDA 4D9RA 5EXMA 6CHAB 1YF4A 3ZVDA 3ELAH 2BB4A 1O5FH 4OS6A 1EB2A 4NG9H 3GICB 1UK4A 3A7XA 4U30A 5JBCS 2AMPA 2GP9B 4CRDA 4O03A 1H9HE 1W7GH 1KXEA 1MQ6A 1AKSA 3M35A 1ZPZA 2KAIB 1KDQA 2OC0A 1C5UA 1C5VA 1O2JA 1EJNA 2GGVB 1YLCA 3N7OA 1J15A 2R9PA 5L2YH 1G36A 3MH4A 3O8BA 5J4SA 1NRQH 3P8GA 4TPYA 2HLCA 4X1PU 2ZHEH 2XBXA 2G4TA 1K22H 1XM1A 3SHAH 1UTKA 2AERH 1G3CA 3KN2A 6GCHG 1SGFA 4E7NA 3A85A 2BDYA 1UTNA 4ABEA 2G4UA 1FZZA 1S81A 1HAZB 1UVSH 1QA7A 3A7YA 1O2PA 5K0HA 3VEQB 1N1LA 4Y0YE 1NFXA 8GCHG 2WUBA 1TGCA 2IJOB 1DT2A 2SGPE 1ZTLA 3HK6B 3RXLA 1DM4B 1HJ9A 3GISB 2XBWA 2A5AA 1C5SA 2ZTYA 4YOJA 1O34A 1MKWH 2SGDE 1AZZA 2OBQA 1ELFA 1CT2E 3D62A 2PSYA 2WYGA 1TGTA 1SL3A 1TNJA 3RXCA 1SBWA 4JZIA 3T5FH 4BAKB 2Y5GA 5DP9A 4I8HA 1GVLA 1TX8A 5DP3A 3BTDE 4KGAA 2FM2A 2FI4E 1BMAA 1QL7A 1FUJA 1CA8B 3MU4A 1GMDG 3MNCA 1NT1A 4X2XA 4E05H 1GDNA 1GBKA 2HPQH 4OS5A 1NRRH 2J2UA 4X8UH 4GHTA 4CRBA 1LQEA 2IN2A 2PHBA 3KF2A 5BRRE 2FZZA 3UQVA 5HYOA 4FVBA 1ANEA 1RD3B 2H1UA 1S5SA 3A8CA 4E7RG 1VCWA 2A45B 5C1UA 1Z7KA 1TGBA 5A8XA 4FUHA 2NU2E 2ANWA 3A83A 1SHHB 1GI3A 1O2IA 4KTSA 4I8LA 1TNIA 1DWBH 4WJG2 1S6FA 3HATH 1IQNA 5JBTA 3KQCA 5LPFA 2RCEA 2FTLE 3LT3A 1EATA 3M61U 3SNBA 1VGCB 1SG8B 3MNBA 3E6PH 1YPGH 2ZA5A 4UONA 1A1RA 2Q1JA 1FY1A 3SOSA 4Y8YA 4K60A 4ZH8A 1XKAC 1Y5BT 2BY9X 2ZU4A 5A0BA 4O3TA 3GY4A 4UFEH 2TIOA 1F5KU 2XWBI 1IQHA 1ANBA 2G81E 2ZDKA 2A7CA 1SGDE 1EPTC 2PKAB 1ELBA 2P93A 5E2OA 1C5TA 1O31A 4NZLA 1CBWC 1T8MA 2H5DA 5EXNA 1BA8B 2GZ7A 5TCCA 2AIPA 2R0KA 4DURA 1P0SH 4I8KA 1GL1A 2WINI 5FCKA 1SGYE 1SGEE 4NWLA 1SFQB 5DP8A 5DP4A 4D7FA 1VCQA 4B2BA 1D6RA 1HB0B 3TH4H 1CGIE 1N8OC 3SGAE 3HKJB 1EZXC 1HAVA 2ULLA 3M5OA 2KAIA 3VGCC 1JRSA 1T31A 3LJOA 1C1NA 1C5WB 3EGKH 5F8XA 3FP8E 1QQUA 4ABFA 1SFIA 1BOQA 1TPOA 1C2JA 3NZIA 3H7OA 4JYVH 2VIWA 1G9IE 1P12E 2RA3A 3RP2A 1EJAA 3MOCA 1P9SA 1ZRKA 1MMJN 2D8WA 4ISNA 3SU1A 4WMFA 1P05A 5L30H 3NPSA 3LH1A 1GBIA 1TPSA 1W13U 1UJ1A 1TNGA 1H4WA 3S7KB 1EB1H 5AVDA 3SHCH 1L2EA 4X1QU 2F9BH 3RXVA 4A6LA 3H5CB 4H42U 9LPRA 3QK1A 1DICA 2A32A 1V2MT 1DPOA 1WAYB 2Z9IA 2ZC9H 2J94A 3H7TA 1DWEH 4NCYA 4YZUA 4TPIZ 3PWBA 4KELA 1ESAA 2BD7A 2ZCKP 1BHXB 3TJUA 1AUTC 3ZYEA 2BDCA 4Z0KA 3RM0H 3RUOA 3NCLA 2WPHS 4LZ4B 5PTPA 5FPSA 3KQDA 2FEQH 1WQSA 1W2KH 2BX4A 2JH5D 4XSKU 2Z3DA 5IDKA 1IQJA 1QA0A 1LKBA 2ALVA 3SGQE 1O3AA 3MHWU 1BQYA 2ZKSA 2GT8A 4ZKNU 1XUIA 3M5LA 5DJ7A 2SFAA 2JH6D 1ZSKA 1V2PT 3KCGH 3PLPA 1P3CA 4Y0ZE 3RXDA 2W3IA 1AB9C 2ZGXH 1Z1IA 4LXBH 2EC9H 1GCTC 2ZP0H 2A0QB 5GPIB 1MCVA 2ALPA 2GX4A 4DOQA 2ZGHA 4D76A 4LZ1H 1O5AB 1TLDA 1ZJDA 2AS9A 2ZPQA 2H9EH 4JMYA 1GI8B 2UUYA 2Z6BD 1SOZA 1DLKB 3S7HB 1G3DA 5L2ZH 3EDXB 2V3OH 1QBNA 3RDZA 3DHKH 3DFLA 5DP6A 1XVMA 5GXPA 2VWNA 4AOQA 4BAOB 1PQ7A 1INCA 1ZLRA 2BDHA 4GCHG 2C90B 1E36B 1SGPE 3RC5A 3V7TA 1O2UA 2PKAA 3OSYA 1DWCH 3R3GB 3RXRA 1ETSH 3A86A 3TJOA 1C1RA 1ABIH 4F49A 3FANA 3K9XB 2UUJB 4YTAA 5E2PA 1OPHB 3LH3A 2HGTH 2OTVA 3Q76A 1HIAA 1HAHH 1JXPA 5T6DA 2EI7A 1K1MA 4I8JA 2ANKH 1WU1A 1BTXA 1KXBA 4MNYA 1ELCA 5ESTE 1QJ7B 1KIGH 5TCAA 5T6FA 2OC1A 4MPUA 3RMMH 2AIQA 2R2WU 3SV6A 8KME2 2ZI2H 1P2JA 3LGYA 3VGCB 3EE0B 2GMTC 2JETB 2P95A 2P8OC 1GVZA 2QA9E 1S6HA 1WTGH 2UWLA 4AYVB 2QF3A 5C3NA 3GCHB 1NU9A 5DPAA 3P6ZB 4RSPA 3AAUA 1CHOG 1GBTA 3TH2H 1MCTA 2UWPA 2CJIA 2Z3EA 5K7RA 1Q31A 1TRYA 2A2XH 2BDBA 1Z6JH 1KXCA 1O2VA 3ZZDA 2ZECA 5HMAA 1S0RA 2Y5FA 3U9AH 5CE1A 2Y7XA 4CREA 1GPZA 3QUMP 1GBCA 3RM2H 1QJ6B 1W14U 1ETTH 1Y5AT 1MBMA 1C5NH 1G2LA 4TY7A 1F7ZA 4BAQB 2BVXH 1UK2A 2VVVA 4F4OC 3U8TH 2O8TA 2HNTE 4AFZA 3W94A 1EQ9A 5FX5A 1DVAH 3HPTB 1AIXH 3BTTE 2ZIQH 1BBRE 3GOVB 1EOLA 2J92A 5GCHF 2BY7X 4NZQA 3SJ8A 2GT7A 1O32A 2ZHFH 1NS3A 1AKSB 1O3JA 3MH7A 1KDQB 1LKAA 3RLWH 1MZAA 4XFQA 1GMCF 5EQSA 1HBTH 4BANB 1FI8A 3NK8A 5EQRA 3UWJH 1LVOA 1TNHA 4MNWA 1Z8IB 2RA0A 1W8BH 3O8DA 1CE5A 2B0FA 1KYNA 2ZTXA 4ZHLU 1DUAA 1TRNA 1AWHB 1P11E 3ZZ3A 4WXIA 4ZROA 1C2FA 3T62A 1U6QA 2ZFPH 3ZZ8A 1RRKA 3SI3H 2VVCA 3A7WA 2BQ6B 3RC4A 4I33A 1FLEE 1BHXF 4BXWA 2NU3E 3UNSA 1T32A 2Z9GA 1GJ4H 1KTSB 4Q80A 4YLQH 1AB9B 5HM2A 1SGCA 4AFUA 2PWXA 3KQBA 2FOMB 3VB6A 1GHXH 4GAWA 5I46H 3HKIB 1K2I1 3PLBA 3BEUA 3M36A 1K1LA 2A5KA 1IAUA 2BTCE 2ZHWH 3RXPA 2ZU3A 4ABBA 4TWWA
chains in the Genus database with same CATH superfamily
1QRZA 3BN9A 1AE8H 4HZHA 1Q3XA 1TMTH 1A5IA 3QWCH 4A92A 1O2TA 2NU4E 4WF8A 5LH8A 4YLUA 1SQOA 4O3UA 1YPKH 1PQAA 3MO6A 4Y10E 5C94A 2UWOA 2OUAA 4MQAA 3EA9A 2BD5A 4RT0A 2EI8A 1QB6A 3IITA 2ZDAH 4QT8C 4KTCA 2PGQB 1E1QD 3A81A 3E3TA 5A0CA 1TNLA 2KR7A 5GDSH 3QTVH 1MTSA 3C1KA 1NC6A 5ESBA 2H6MA 2Q6DA 4X1RU 1EPTA 1VITF 2HNTC 1G32B 1V2ST 2H9TH 3LIWA 3P17H 4I8GA 3FAOA 1FN8A 3RXOA 1O30A 5C1YA 3TVJB 3VB4A 3DSPA 5E0HA 5EXLA 1ZGVA 2XC5A 4X6NA 4ZKSU 1BT7A 2G00A 1F0TA 4I31A 4M7GA 4ZXXH 2VIVA 2JKHA 4NFEA 1BCUH 4XRNA 4ABAA 4Q7YA 2FPZA 1GG6B 2BY8X 1GBFA 4CRGA 2YMSB 3PRDA 3O8CA 4IN1A 2ZGBH 1NZQH 4Y6DA 1VITH 2C8XB 1CHGA 1C5LH 2GMTB 3RXAA 4ZHMU 1KSNA 4MNXA 2ZDMA 1C1UH 2VIPA 1JOUB 1BTWA 4DW2U 3EYDA 1GGDC 4CH8B 1ZYOA 2QXJA 1TABE 1Y3UA 1FX0B 3BEFB 3L3TA 1ELVA 1ZMJA 4IBLH 4RN6A 3TGKE 2Z9LA 3DCLA 3NRLA 1IQKA 2ZU5A 1T8OA 1THRH 1N6YA 1C5OH 3M7UA 1AO5A 2V35A 2B5TB 1ELDE 1P2QA 4XE4A 1UVUH 1K21H 1L0ZA 4DCDA 1V2QT 1LVMA 1H8IH 1LCYA 1W7XH 1WQVH 1ANCA 2VWLA 1F0SA 3RXTA 4NIVA 3SORA 2TGPZ 3FOAA 3ODDA 4JK5A 1LPKB 1C1VH 2P3FH 3UY9A 3SU2A 1HYLA 4AZ2B 1CO7E 1A3EH 1OWKA 1NRSH 2FYRA 4ISIH 1QCPA 3A80A 1C2KA 1NESE 1EFRD 3A8BA 1DS2E 1BMMH 2Z94A 1MKWK 2OD3B 1P06A 2OXSA 2WUCA 2WV4A 3ENSB 2PW8H 3K65B 1HAVB 1GHWH 2L6OA 2BLOA 2O8MA 1TAWA 3GS9A 1GJ8B 4X6PA 3UREA 4WVPE 1G37A 3MU1A 1UO6A 3IWMA 2YNBA 1ID5H 4F55A 1QNJA 3MFJA 3TH3H 1DWDH 1HNEE 1YPHE 1C2LA 1EAWA 1O36A 1P2MA 4MPXA 4THNH 4H6TA 2Z9KA 4OS4A 3SU6A 4ISLA 1TQ7B 3UUZA 2JDID 1CGJE 1MZDA 1AI8H 1GDQA 1KLIH 3NWUA 2ZU2A 3N7EA 1O38A 2ODQA 3BIUH 1PPBH 3KQEA 1SHYA 1TOCB 5EG4A 2A1DB 1GJCB 2WPMS 1O5CB 3C27B 1H8ED 1GMCG 1SGIB 2Y6TA 1QR3E 2QCYA 3CNRA 5LPEA 5AFZH 5FCRA 1BJVA 1UTMA 2ZHDA 3ZV8A 4I7YH 1DDJA 3PWCA 2ODPA 1YCPK 1GJ9B 3TK6A 2O8WA 3I77A 3D65E 1MD8A 3RXBA 2PKSB 2W6ID 3P8NA 5GIBA 5HGGA 3BG4C 5GNDA 5A2MH 1NPMA 4SGBE 1GMHF 2BM2A 3A87A 1C5PA 1RS0A 3BTWE 2ZEBA 2A4OA 3FFGA 2V0BA 3MYWA 3MO3A 4JCNA 3ZZ6A 1O39A 7GCHG 2BOKA 1BRAA 2XXLA 1UCYE 1TRMA 1DUEA 4YM9A 1ZHPA 5B6LA 1SC8U 1K1IA 4Y71A 1Y3XA 5CDFE 1O37A 1LHDH 1F2SE 4ISOA 1SLXB 3ATWA 3MTYA 3R0FA 5T6GA 1HRTH 4DGJA 1GI5A 1DLEA 1GGDB 3TJNA 5DSFA 2ZF0H 3ZZCA 3FO8D 2GV7A 2VWOA 1MAYA 5C5NA 1TIOA 1YPHC 2J34A 1GI2A 1IQMA 1HAIH 2OBOA 3DA9B 3SV2H 5BPEA 2LP6A 2J38A 3SW2B 1G30B 1MQ5A 2F3CE 3ZZAA 1OKXA 3GCNA 1ELGA 1L4DA 1W0YH 3SV9A 1GBAA 1VR1H 1YCPH 1YLDA 3GY5A 1W3CA 3VG8A 2J4IA 1ETRH 2BYAX 1O3IA 1FQ3A 1G3BA 1NN6A 2C8WB 1P57B 1Z6EA 2J9NA 4P02A 5DKMA 1GBJA 1BRUP 1Y3WA 1ZOMA 3U1IB 1V2OT 2AH4X 1HGTH 5ABWA 3QGJA 1A0LA 1GHAF 3T25A 2IPHA 2XTTB 1T7CA 1QRWA 1HJ8A 1HXFH 1HIAB 2ZQ2A 3GDUA 3HGPA 2K8IA 4D9QA 2PTCE 3B9FH 2QIQA 4MVNA 4Y8XA 4A1TA 1O3KA 4ZKRU 1B0FA 2G8TA 1TA2A 4B74A 3EAJA 3Q3XA 3MH5A 2I6QA 4XBBA 3OE7D 1UW7A 1W12U 3KIDU 1P2IA 1WTHD 1TGNA 5EOKA 3V12A 4U32A 5F6MA 1MTVA 3SUEA 1H9LB 1QGFA 2HWLB 4DY7B 4O97A 1GHBG 1CGHA 2C8ZB 5JDUB 1MKXK 1SOTA 2P94A 1A3BH 4KP0A 1EKBB 3GYMA 3U98H 3MWIU 1PPZA 1BITA 2ILNA 5JBAS 1DY8A 1K28D 4J2YB 3TK5A 3LGTA 5JB8S 1HJAC 2K1QA 2Q6FA 4P00A 1TBZH 1LVBA 1VJ9U 2GDEH 1ELAA 1X7AC 2F91A 1CA0C 2F9PA 4ZMAH 4UEHH 3F9EA 1FIWA 3W95A 1O3HA 1C4V2 5E8EH 4CH2B 1O5GH 3GY7A 2OK5A 1OYTH 1NM6A 1D3QB 5IYTA 4FUCA 1EASA 1HLTH 1KTTB 3BTKE 3UOPA 3MNXA 1NFUA 3PMJA 8LPRA 3S9AA 2ZPRA 2F4LA 2VGCC 1YBWA 1FY3A 3T26A 1IQFA 1TX7A 4IS5A 4B6EA 1AFQC 1ORFA 2TGAA 1TMBH 3SJIA 1LPGB 1ZJKA 1FY8E 2AFQB 2BD3A 4BOHA 2R0LA 3QN7A 5JB9S 3P95A 1A61H 3TK9A 3M7TA 1Y3YA 1E35B 2QF0A 1LTOA 5DN6D 2CV3A 2ZTZA 3AW1A 3BTFE 3UFAA 1JWTA 4ABGA 3ZVFA 1MKXH 2CHAC 4K1TA 4B71A 2PUQH 5F03A 2BX3A 1A0HB 3RU4E 1OP0A 2AGIX 4Y8ZA 4U01A 2BLWA 2ZDLA 3CP7A 1C9TA 2Y82A 4FUBA 1BTHH 1SGQE 1YY3A 1SGFG 3LGIA 2SNVA 2HNTF 5EPNA 1VKYA 1SGTA 4FUIA 1FAKH 4FUJA 4FVDA 1AHTH 3UB0A 1P09A 3OY5U 2FXRA 2FOEA 1O2HA 2ZCLP 1GJ7B 3Q3YA 3GCTF 3SNDA 3E16B 3O8RA 2BQWB 7LPRA 1Z71A 1V2LT 1HAYB 1OSSA 1DANH 1YP9A 1GBMA 5FBIA 3RU4D 1IHTH 7ESTE 4OS2A 2QC2A 1F0RA 3Q77A 2PR3A 1AY6H 2I6SA 3CENA 4J1YA 2ANYA 1TFXA 4Y79A 1J14A 3URDA 1V2NT 1BBRH 1C2DA 1O3FA 1SI5H 3F3BA 4Q2KA 3PMHB 1SSXA 2TBSA 1EPTB 3B8JA 3E8LA 5C67A 1IHSH 3GDSA 1P03A 1TQ0B 1V2RT 3SYJA 1CBWB 2OLGA 4TY6A 2FI5E 2O8LA 3HGNA 4CBNA 3ZZ4A 3OU0A 4F48B 1C4U2 2VIOA 2XCNA 7KMEH 5JYIA 1QZ8A 3S9BA 1J16A 1E79D 1O2GH 1E0FD 5DGJA 1QB1A 1DSUA 4DIIH 5HM9A 1P04A 1D4PB 3EA8A 1BUIA 2RFKC 1N8OB 2ODYB 5CMXH 3F2GA 1C5QA 2BD9A 4WH6A 1O2SA 5A09A 4ZUHA 1A7SA 1L1GA 3WW7A 2FOBA 3TU7H 2L74A 2BVRH 4AGKA 2C8YB 1NFWA 4UDWH 1BMLA 1H9IE 1HV7A 4TYDA 2GKVE 5J4QA 4X8VH 4UFFH 4ABHA 4ISHH 1DE7H 1TA6A 1GJ6A 1E38B 2ZDVH 5AHGH 2VH0A 4K5ZA 3M37A 1C5XB 4FU7A 2ZQ1A 4MNVA 3M7QA 1TPPA 1MBQA 8ESTE 2W3KA 2EEKA 1BRBE 1MTWA 1FJSA 1C5ZB 1Y5UT 2WPIS 2ZG0H 3ATLA 1O2LA 2Z9JA 3E0PB 3TIUA 2VVUA 2BZ6H 3PYHA 4CRCA 4DT7B 1YC0A 6LPRA 1LDTT 1QQ4A 1CA0B 2M2AA 1XMNB 1YYY1 2F9NA 2Z3CA 3F6UH 1GBDA 1P8VC 1ZMLA 1KXAA 1C1WH 4ZHAA 3N7DA 1GVKB 2ZZUH 1UVTH 3VPKA 3D23A 2FIRH 4ZAEA 4WY3A 1CSOE 2XYAA 3ZVBA 1NY22 1FY5A 1MU8B 1DY9A 4K1SA 4K2YA 1AFQB 3KYFA 4NA8A 3SU5A 1UHBA 3MU5A 2WSSD 1KLTA 3T28A 3BTME 1MTNC 4HGCA 1DOJA 2VNTA 4I86A 1P2OA 6GCHF 1A5GH 2P3UB 1GI6A 2VU8E 4K3JA 5I25A 2STBE 3ZVEA 1V2TT 2OINA 2QYIA 4MG3A 1GI4A 2QY0B 3MMGA 1DXWA 3S0NA 2SNWA 1DXPA 3DFJA 8GCHF 1XUHA 6CHAC 1Y59T 1ABJH 1FV9A 1O2RA 2FDAA 2GTBA 2ZFRH 4Y7AA 1W0JD 2FWWA 1SLWB 1V2KT 3A8DA 1YGCH 2AGGX 5HKKD 2V7QD 3RXGA 3UTUH 1QTFA 4GSOA 1MU6B 3SU4A 2VBCA 4GVUA 1FIZA 1LHCH 1ZGIA 3GCOA 3DSOA 1GCTB 2XBVA 1TWXB 1Y8TA 1GL0E 1TE0A 1UK3A 2NU0E 3S69A 1RTFB 2V3HH 5DP5A 2FO9A 1NRNH 1XVOA 1D3PB 2YOLA 4JZDH 1TB6H 2FS9A 2G52A 1IQLA 3W1EA 4A7IB 2AHME 1PPGE 4AG1A 3SNEA 2AYWA 2PUXB 4HG6A 4X1NU 2AGEX 3E0NB 2BDAA 1Z8RA 2GV6A 3OTJE 3CS7A 1C2IA 4B76A 4GUXA 2J5UA 2WPLS 2FP7B 2KCYA 2O8UA 3GY6A 3QTOH 3BV9B 5DP7A 1SQAA 1C5MD 3MU0A 4SGAE 4D7GA 1JRTA 1GJ5H 4CRAA 3TLOA 1EAIA 1RXPA 3NKKA 3LGUA 1A5HA 3RXUA 2A7HA 2DE8A 2J95A 1GDUA 4AYYB 1QHRB 1P2NA 2W7SA 1C1MA 4K8BA 2ESTE 2STAE 1Z1JA 1JMOH 1OWDA 1TBRH 6ESTA 1F5LA 1O3MA 3I78A 3LKWA 1AN1E 2VIDA 1CU1A 2ZO3H 4ASHA 2P8OB 4R8TB 1WBGB 1QJ1B 2G5VA 1H1BA 4BAMB 1AVGH 4WXVA 3LJJA 3OEED 5F8ZA 2XNIA 2F9UA 1QRXA 4NGAH 1TGSZ 1HAOH 4DVAU 2BDIA 4FUDA 1XXDA 2WPKS 1EZQA 1O3EA 3PO1C 1BDAA 1HFDA 1GI7B 5EW1H 2GCHF 4BTIB 5EPYA 2VB0A 3UWIA 1D3DB 2XRCA 2KX4A 4A1XA 1A0JA 2BDGA 1KMHB 4Z6AH 1PPCE 1D9IA 1YKTA 4MDSA 1EX3A 3ZVGA 3T2NA 3EA7A 2IJD1 3IG6B 3PB1E 1O2OA 1THPB 3BSQA 2OC7A 3U69H 2PLXA 2XBYA 3F9GA 5SGAE 1O2ZA 4XBCA 3RXFA 1O33A 4HFPB 2F9VA 4A1VA 3DD2H 3KNXA 3D49H 2GVFA 2K0QA 3GY2A 3MU8A 2DE9A 2Y5HA 2NWNA 4X1SU 3SV8A 3A7ZA 1T8LA 3A84A 4FETA 1K1OA 2GCTC 3WY8A 1AFEH 1KLJH 4WH8A 1O3BA 3BG8A 1H8DH 1S82A 2B9LA 4NIXA 2ZDNA 4RKJB 1XUKA 4NSYA 1OYQA 3BTHE 1C1TA 3OYPA 2ZGJA 3A8AA 1QURH 3LC5A 3E1XB 5EJLA 2NU1E 1CVWH 2A31A 1IQGA 1TOMH 3BTEE 4ESTE 2QXGA 3FZDA 1BRCE 1W11U 1GHZA 1L1JA 3FVFB 1OX1A 2CK3D 2F9OA 1UVPA 1Z8JB 2FX4A 1TONA 3U28C 3QX5H 2ZFSA 2FOHA 5DK1A 4E06H 1RGQA 3FP7E 4ZCNA 1GJDB 1QBOA 1GBLA 4B1TA 1A2CH 1LQDB 3I29A 1O2NA 2CN0H 5ETXA 4NIYA 1K1NA 3SQHE 4INHA 1GBHA 1V2JT 3MI4A 3OTPA 4AB9A 4D8NA 1FMGA 1ACBE 5GCHG 1MD7A 1C1SA 4ASUD 1THSH 1AU8A 4ABJA 3P8FA 5HXFA 3KGPA 3ZZBA 1V2VT 1LPZB 5FBEA 3RXIA 1HCGA 1TMUH 3GYLB 1ZPCA 4CHAC 4IMQA 1C2HA 1EXFA 1O3LA 1QL9A 3M3SA 1C1QA 3PMAB 3AAVA 1ELEE 1W10U 1GJBB 2BD8A 4ZKOU 5KEDA 4O9VA 2BZAA 3PRBA 1NRPH 3T27A 1A4WH 1EUFA 2WV5A 1JIRA 1VJAU 1O3DA 3LU9B 4DT4A 2XC4A 2XWAA 4AB8A 1T8NA 1Y3VA 2KCOA 1LVYA 4RKOB 1IOEA 5FAHA 3F0PA 3VFEA 3LPRA 3A89A 1ZHRA 2VH6A 1ZSLA 1DITH 1C2GA 3PM3A 3OX7U 4AFQA 4Q63A 5TJXA 4XBDA 3F2FA 4OGXA 3LGVA 4UFDH 4TWYA 3S9CA 3SGBE 2YNAA 2H2ZA 2AEIH 3PTNA 5EQQA 1FPHH 5C0UA 3ZZ5A 3ATKA 3TNSA 2BLVA 1V2UT 2FS8A 1OWIA 1QL8A 3M5NA 1ANDA 2P59A 1BTZA 1UTOA 3BIVH 5F8TA 1O3GA 1HAPH 1C1PA 2HOBA 1RIWC 1PJPA 3ODFA 3V0XA 2JJ1D 1XUJA 3ZZ7A 2R3YA 5EGMA 5HIZA 1FN6A 2UUKB 2W7UA 1B5GH 1F0UA 4BTTB 3PO1B 1MUEB 1B0EA 4GCHF 4AG2A 1WYKA 4HI3A 1FPCH 5H4IB 2SGFE 2C93B 3ATIA 1VITG 4BAHB 3QZQA 4MPWA 4R0IA 1SPJA 1BMFD 2H9HA 1TX6A 1UTQA 3LDXH 2CMYA 3DSGA 1O2WA 1P10A 3MNSA 4JYUH 1HPGA 3SNAA 2QXHA 1LMWB 2THFB 1WUNH 3FP6E 2WHXA 3F0OA 3RU4T 1NU7B 3VB5A 1Z8GA 3AW0A 5IK2D 4DIHH 2LNCA 2FYQA 3F9HA 2Y7ZA 3F9FA 1ESBA 1V6DA 3EQ0H 2B7DH 2RDLA 3PV4A 3TGJE 2BD4A 1TBQH 3RXJA 2PV9B 2VINA 4WWYA 3TNTA 1GHYH 1YCPM 2GCTB 2IOTA 4BTUB 1CHOF 4X8SH 1YM0A 1O5DH 4X2WA 1GHVH 1YPLH 2QV1A 1ELTA 3UR6A 1V2WT 1PPEE 1UVOA 4H4FA 1QFKH 4PROA 2AMQA 1AD8H 1BZXE 1D6WA 3VB7A 1SLUB 2BD2A 2V3MA 1SVPA 2QAAA 1UMAH 4MPVA 2CGAA 2G51A 2GCHG 2GZ9A 4NA9H 3PLKA 3KEEA 4NIWA 1F92A 4X2YA 3RXQA 5L6NH 1ZSJA 5EW2H 1YPMH 1FXYA 3RXKA 1PQ5A 2A4GA 4AFSA 3RMLH 1BMNH 4M9FA 1P9UA 1JIMA 4Y76A 4UE7H 5GJ4B 3JZ2B 1MTUA 1HXEH 2UUFB 3UNQA 3GDVA 3KL6A 3KYGA 1RFNA 3UR9A 5JPMH 4YXWD 2WPDD 1C5YB 2EI6A 1SQTA 1SGRE 2JETC 1GI1A 1NBME 2AMDA 3T29A 1AGJA 2ANMH 2M5TA 1KXFA 1PYTD 3JZ1B 1S83A 3GCHC 2PP6A 3OFND 5T3HA 1EP5A 4CRFA 1BTUA 4YOIA 2ZU1A 3ZYDA 4CHAB 4Q7ZA 2R3UA 4CBOA 3RC6A 5A0AE 1S6LA 3RXSA 1L4ZA 3SJOA 1UHBB 2D1JA 2BHGA 1XX9A 2VWMA 3SI4H 3A7VA 3ESTA 3OY6U 4IGDA 4YOGA 1C9PA 2EA3A 3U8RH 4BXSA 3RLYH 2PFEA 1AE5A 2D2DA 4LK4A 3ZVCA 1NBMD 1M9UA 1RTLA 2BQ7B 2R2MB 3BG4B 4TT3D 1O2KA 3A82A 3DUXH 1BBRK 4KTUA 4XDEA 2KCAA 2ZWLH 3SUGA 1ZTJA 2ASUB 3AVZA 5CHAC 1TYNA 4B75A 3BF6H 1BTPA 3SU3A 1OHHD 1ZTKA 3E91A 4UD9H 2FOAA 2WPJS 3CS0A 3RMNH 1EOJA 1AZ8A 4JK6A 4H6SB 2BOHB 3OAAD 3SO3A 4GPGA 1HAXB 3U8OH 1NTPA 1XUFA 4XOJA 4X6OA 1IQIA 1MABB 3SUFA 1FNIA 2C3SA 1D3TB 3SN8A 2KM0A 2W5EA 9ESTA 3QGNB 2OQUA 5LGOA 4X6MA 1MH0A 1BB0B 1GJAB 1W0ZU 1O3NA 1RIWB 1V3XA 4OS7A 2JH0D 4A5TS 3LC3A 2FOFA 2BVSH 1TALA 3SJKA 5AFYH 2ZFFH 1PYTC 2FTMA 4K8YA 2OP9A 4WMDA 1S0QA 1O5EH 2FI3E 2OCVB 3ZV9A 5LPRA 4IMZA 2FX6A 2V6NA 1L1NA 4X2VA 2HVXA 1GMHG 1CT0E 2QN5T 4I32A 5FX6A 3M3VA 3P70B 1AMHA 2YMSD 3A88A 2FOCA 2GZ8A 1SLVB 2DUCA 2CF8H 3RXMA 2WV9A 1T4VH 3SU0A 2OQ5A 2PSXA 2BMGB 4FUEA 5EODA 1ESTA 2BXTH 3RXEA 3G01A 2XW9A 1SR5C 2G5NA 1ZZZA 1TNKA 1SGNE 3SQEE 1AWFH 3TPIZ 2ZFQH 1J17T 3FZZA 4GHQA 2QGRA 4LOYH 1C2MA 1S85A 1ZMNA 3K6YA 4Q4LA 4YT7H 1QBVH 3DT0H 1J8AA 2HALA 3UNRA 3RMOH 4DG4A 1YPEH 3AASA 3NUMA 2LPRA 3P92A 1TPAE 1P02A 1E34B 1AUJA 2CF9H 3BEIB 2XOKD 2ZNKH 1GI0A 3QZRA 5FHTA 4FXGH 5EJZA 5E0JA 1BIOA 1PFXC 3M3TA 2WYJA 3UOUA 4FUFA 5EJ1A 3STJA 1OWEA 2TRMA 2VJ1A 4ABDA 1EP6A 3KHVA 5C2ZA 3URCA 3PTBA 1MAXA 1FDPA 4FU8A 3RXHA 5B6OA 4B2CA 1HAGE 3PMBB 1Q2WA 4X0WU 1ZR0A 2SGEE 1VZQH 1ZRBA 3L33A 2P3TB 4INLA 5G4BA 1GG6C 1RJXB 2Y81A 1UTJA 1ZHMA 2FLRH 1GHAG 2FOGA 4MLFB 1HJAB 1NROH 1UTPA 3TGIE 2C4FH 1CQQA 2FESH 1WCZA 1GBEA 4GLYA 5C5OA 4HTCH 5JBBS 5FPYA 4VGCC 3V13A 1C1OA 3V3MA 1GBBA 1RTKA 2G55A 2A5IA 4NSVA 1DSTA 1OXGA 1WOFA 2VGCB 2BY5X 4NA7A 1FAXA 3MO9A 5C20A 2RG3A 5GWZA 1ARCA 4JYTA 2BXUH 2VIQA 3U1JB 1B7XB 4JZEH 3BTGE 5CHAB 1QY6A 2FMJA 2PGBB 4XD7D 2SGAA 1YWUA 3HK3B 3F1SB 1COWD 3SNCA 1K1JA 1P3EA 3GY8A 3NXPA 4WMEA 1SB1H 2CHAB 1LHFH 3SV7A 4YT6H 2P16A 3VXEH 3B23B 5A8ZA 1O3CA 1N6XA 5A8YA 3VXFH 1A46H 1O3PB 2BY6X 1NO9H 1K9OE 3F2HA 2OC8A 4INKA 5FXLA 4AGJA 1BJUA 1O2MA 2ZCHP 1YPJH 2KZ4A 1NFYA 5T1VA 1C4Y2 3QDZB 3ZIAD 4NWKA 2H5CA 2TPIZ 5FPTA 1FY4A 2B8OH 3M5MA 1PPHE 1O2XA 4AX9H 2FODA 3UIRA 2Q6GA 3SBKA 5C1XA 2A4RA 1QIXB 4IW4E 1ZPBA 1AVXA 1OP2A 2GD4B 1GWAA 1O0DH 2A7JA 1XUGA 2ZPSA 4OS1A 2LELA 4KKDA 5C0TA 1GMDF 2Z7FE 4Y7BA 1K1PA 3E90B 1G2MA 3A7TA 1VCPA 7GCHF 3ZZ9A 1GI9B 4IN2A 4B2AA 3SJ9A 2HLDD 2SGQE 4B73A 4OGYA 4MTBA 3K6ZA 1O3OA 1T4UH 2IPQX 1PQ8A 4AC9A 1DX5M 2Y80A 1OWHA 2J97A 2W26A 1CT4E 2ZFTA 4ABIA 2GDDA 1PPFE 1WV7H 1LHGH 1AVWA 5E0GA 1J9CH 2ZHQH 2PTNA 1O2QA 1AQ7A 3Q3KA 1EZUC 2A4QA 3LGWA 2F83A 1O35A 3GCTG 4AORA 3F68H 5EU8A 5HIYA 4ZXYH 2ZGCA 3BTQE 3LOXA 3GY3A 1EAXA 1OWJA 2PKSC 4FOUC 1HUTH 1F5RA 1LO6A 3LONA 1IQEA 3MH6A 3STIA 4JZFH 1UCYK 5DO4H 4YESB 1E37B 2XCFA 3TITA 3UQOA 1DFPA 3P8OA 1OOKB 4IC6A 2WZQA 4BNRA 4FUGA 4TSFD 4JZ1A 1UTLM 4YO9A 5F53A 2QXIA 1O2YA 2CXVA 2A2QH 1XXFA 3QLPH 1GCDA 3PROA 4UFGH 1FONA 4FU9A 1C5RA 1S84A 3VB3A 4K1EA 2KCPA 3TJVA 3ATMA 3K2UA 4Q7XA 1SMFE 3Q00A 4CR9A 1EZSC 1KY9A 4VGCB 4Y11E 4X8TH 1JBUH 2D26C 2TGDA 3QO6A 1P2KA 4NFFA 1OS8A 1VGCC 2W6JD 1YLNA 1EAUA 2FLBH 5DG6A 3ZVAA 1LHEH 2HRVA 2BLQA 1OP8A 1WSSH 4AN7A 3ITIA 1GHBF 3UPEA 1MTNB 3SZNA 2HPPH 2TGTA 1ARBA 1QB9A 1P01A 1G3EA 1UCYH 2O9QA 1EJMA 4IC5A 1BTYA 3L6PA 3SUDA 2KFWA 2J98A 1HDTH 4CR5A 4Z1MD 4K69A 1O5BB 4DJZB 5AF9H 2XC0A 4U2WA 1C2EA 1XKBC 1KXDA 4D9RA 5EXMA 6CHAB 1YF4A 3ZVDA 3ELAH 2BB4A 1O5FH 4OS6A 1EB2A 4NG9H 1W0KD 3GICB 1UK4A 3A7XA 4U30A 5JBCS 2AMPA 2GP9B 4CRDA 4O03A 1H9HE 1W7GH 2EQNA 1KXEA 1MQ6A 1AKSA 3M35A 1ZPZA 2KAIB 5KGOA 1KDQA 2OC0A 1C5UA 1C5VA 1O2JA 1EJNA 2GGVB 1YLCA 3N7OA 1J15A 2R9PA 5L2YH 1H8HD 1G36A 3MH4A 3O8BA 5J4SA 1NRQH 3P8GA 4TPYA 2HLCA 4X1PU 2ZHEH 2XBXA 2G4TA 1K22H 1XM1A 3SHAH 1UTKA 2AERH 1G3CA 3KN2A 6GCHG 1SGFA 4E7NA 3A85A 2BDYA 1UTNA 2QE7D 4ABEA 2G4UA 1FZZA 1S81A 1HAZB 1UVSH 1QA7A 3A7YA 1O2PA 5K0HA 1WDIA 3VEQB 1N1LA 4Y0YE 1NFXA 8GCHG 2WUBA 1TGCA 2IJOB 1DT2A 2SGPE 1ZTLA 3HK6B 3RXLA 1DM4B 1HJ9A 3GISB 3MQKC 2XBWA 2A5AA 1C5SA 2ZTYA 4YOJA 1O34A 1MKWH 2RDEA 2SGDE 1AZZA 2OBQA 1ELFA 1CT2E 3D62A 2PSYA 3PV2A 2WYGA 1TGTA 1SL3A 1TNJA 3RXCA 1SBWA 3UAIC 4JZIA 3T5FH 4BAKB 2Y5GA 5DP9A 4I8HA 1GVLA 1TX8A 5DP3A 3BTDE 4KGAA 2FM2A 2FI4E 1BMAA 1QL7A 1FUJA 1CA8B 3MU4A 1GMDG 3MNCA 1NT1A 4X2XA 4E05H 1GDNA 1GBKA 2HPQH 4OS5A 1NRRH 2J2UA 4X8UH 4GHTA 4CRBA 1LQEA 2IN2A 2PHBA 3KF2A 5BRRE 2FZZA 3UQVA 3EE7A 5HYOA 4FVBA 1ANEA 1RD3B 2H1UA 5FL7D 1S5SA 3A8CA 5C17A 4E7RG 1VCWA 2A45B 5C1UA 1Z7KA 1TGBA 5A8XA 4FUHA 2NU2E 2ANWA 3A83A 1SHHB 1GI3A 1O2IA 4KTSA 4I8LA 1TNIA 1DWBH 4WJG2 1S6FA 3HATH 1IQNA 5JBTA 3KQCA 5LPFA 2RCEA 2FTLE 3LT3A 1EATA 3M61U 3PV5A 3SNBA 1VGCB 2GJGA 1SG8B 3MNBA 3E6PH 1YPGH 2ZA5A 4UONA 1A1RA 2Q1JA 1FY1A 3SOSA 4Y8YA 4K60A 3H09A 4ZH8A 1XKAC 1Y5BT 2BY9X 2ZU4A 5A0BA 4O3TA 3GY4A 4UFEH 2TIOA 1F5KU 2XWBI 1IQHA 1ANBA 2G81E 2ZDKA 2A7CA 1SGDE 2EY4C 1EPTC 2PKAB 2JIZD 1ELBA 2P93A 5E2OA 1C5TA 1O31A 4NZLA 1CBWC 1T8MA 2H5DA 5EXNA 1BA8B 2GZ7A 5TCCA 2AIPA 2R0KA 4DURA 1P0SH 4I8KA 1GL1A 2WINI 3WWBA 5FCKA 1SGYE 1SGEE 4NWLA 1SFQB 2QF5A 5DP8A 5DP4A 4D7FA 1VCQA 4B2BA 1D6RA 1HB0B 3TH4H 1CGIE 1N8OC 3SGAE 3HKJB 1EZXC 1HAVA 2ULLA 3M5OA 2KAIA 3VGCC 1JRSA 1T31A 3LJOA 1C1NA 1C5WB 3EGKH 5F8XA 3FP8E 1QQUA 4ABFA 1SFIA 1BOQA 1TPOA 4B6FA 1C2JA 3NZIA 3H7OA 4JYVH 2VIWA 1G9IE 1P12E 2RA3A 3RP2A 5CHBA 1EJAA 3MOCA 2JJ2D 1P9SA 1ZRKA 1MMJN 4ACAA 2D8WA 4ISNA 3SU1A 4WMFA 1P05A 5L30H 3NPSA 3LH1A 1GBIA 1TPSA 1W13U 1UJ1A 1TNGA 1H4WA 3S7KB 1EB1H 3N99A 5AVDA 3SHCH 1L2EA 4X1QU 4RT1A 2F9BH 3RXVA 4A6LA 3H5CB 4H42U 1SQRA 9LPRA 2QF4A 3QK1A 1DICA 2A32A 1V2MT 3FKSD 1DPOA 1WAYB 2Z9IA 2ZC9H 2J94A 3H7TA 1DWEH 4NCYA 4YZUA 4TPIZ 3PWBA 4KELA 1ESAA 2BD7A 2ZCKP 1BHXB 3TJUA 1AUTC 3ZYEA 2BDCA 4Z0KA 3RM0H 3RUOA 3NCLA 2WPHS 4LZ4B 5PTPA 2XNDD 5FPSA 3KQDA 2FEQH 1WQSA 1W2KH 2BX4A 2JH5D 4XSKU 2Z3DA 5IDKA 1IQJA 1QA0A 1LKBA 2ALVA 3SGQE 1O3AA 3FN8A 3MHWU 1BQYA 2ZKSA 2GT8A 4ZKNU 1XUIA 3M5LA 5DJ7A 2SFAA 2JH6D 1ZSKA 1V2PT 3KCGH 3PLPA 1P3CA 4Y0ZE 3RXDA 2W3IA 1AB9C 2ZGXH 1Z1IA 4LXBH 2EC9H 1GCTC 2ZP0H 2A0QB 5GPIB 1MCVA 2ALPA 2GX4A 4DOQA 2ZGHA 4D76A 4LZ1H 1O5AB 1TLDA 1ZJDA 2AS9A 2ZPQA 2H9EH 4JMYA 1GI8B 2UUYA 2Z6BD 1SOZA 1DLKB 3S7HB 1G3DA 5L2ZH 3EDXB 2V3OH 1QBNA 3RDZA 3DHKH 3DFLA 5DP6A 1XVMA 5GXPA 2VWNA 4AOQA 4BAOB 1PQ7A 1INCA 1ZLRA 2BDHA 4GCHG 2C90B 1E36B 1SGPE 3RC5A 3V7TA 1O2UA 2PKAA 3OSYA 1DWCH 3R3GB 3RXRA 1ETSH 3A86A 3TJOA 1C1RA 1ABIH 4F49A 3FANA 3K9XB 2UUJB 4YTAA 5E2PA 1OPHB 3LH3A 2HGTH 2OTVA 3Q76A 1HIAA 1HAHH 1JXPA 5T6DA 2EI7A 1K1MA 4I8JA 1K0HA 2ANKH 1WU1A 1BTXA 1KXBA 4MNYA 1ELCA 5ESTE 2HVYB 1QJ7B 1KIGH 5TCAA 5T6FA 2YMSC 2OC1A 4MPUA 3RMMH 2AIQA 2R2WU 3SV6A 8KME2 2ZI2H 1P2JA 3LGYA 3VGCB 3EE0B 2GMTC 2JETB 2P95A 2P8OC 1GVZA 2QA9E 1S6HA 1WTGH 2UWLA 4AYVB 2QF3A 5C3NA 3GCHB 1NU9A 5DPAA 3P6ZB 4RSPA 3AAUA 1CHOG 1GBTA 3TH2H 1MCTA 2UWPA 2CJIA 2Z3EA 5K7RA 1Q31A 1TRYA 2A2XH 2BDBA 1Z6JH 1KXCA 1O2VA 3WWFA 2ZECA 3ZZDA 5HMAA 1S0RA 2Y5FA 3U9AH 5CE1A 2Y7XA 4CREA 1GPZA 3QUMP 3AK5A 1GBCA 3RM2H 1QJ6B 1W14U 1ETTH 1Y5AT 1MBMA 1C5NH 1G2LA 4TY7A 1F7ZA 2J98B 4BAQB 2BVXH 1UK2A 2VVVA 4ACBA 4F4OC 3U8TH 2O8TA 2HNTE 4AFZA 4OM9A 3W94A 1EQ9A 5FX5A 3OEHD 1DVAH 2F43B 3HPTB 1AIXH 3BTTE 2ZIQH 1BBRE 3GOVB 4RI0A 1EOLA 3SZEA 2J92A 5GCHF 2BY7X 4NZQA 3SJ8A 2GT7A 1O32A 2ZHFH 1NS3A 1AKSB 1O3JA 3MH7A 1KDQB 1LKAA 3RLWH 1MZAA 4XFQA 1GMCF 5EQSA 1HBTH 4BANB 1FI8A 3NK8A 5EQRA 3UWJH 1LVOA 1TNHA 4MNWA 1Z8IB 2RA0A 1W8BH 3O8DA 1CE5A 2B0FA 1KYNA 2ZTXA 4ZHLU 1DUAA 1TRNA 1SKYE 1AWHB 1P11E 3ZZ3A 4WXIA 4ZROA 1C2FA 3T62A 1U6QA 1E1RD 2ZFPH 1RRKA 3ZZ8A 3SI3H 2VVCA 3A7WA 2BQ6B 3RC4A 4I33A 1FLEE 1BHXF 4BXWA 2NU3E 3UNSA 1T32A 2Z9GA 1GJ4H 1KTSB 4Q80A 3KQ5A 1AB9B 4YLQH 1SGCA 5HM2A 4AFUA 2PWXA 3KQBA 2FOMB 3VB6A 1GHXH 5EIYA 5KECA 1WXRA 4GAWA 5I46H 3HKIB 1K2I1 3PLBA 3BEUA 3M36A 1K1LA 2A5KA 1IAUA 2BTCE 2ZHWH 3RXPA 2ZU3A 4ABBA 4TWWA
chains in the Genus database with same CATH topology
1QRZA 3BN9A 1AE8H 4HZHA 1Q3XA 1TMTH 1A5IA 3QWCH 4A92A 1O2TA 2NU4E 4WF8A 5LH8A 4YLUA 1SQOA 4O3UA 1YPKH 1PQAA 3MO6A 4Y10E 2UWOA 2OUAA 4MQAA 3EA9A 2BD5A 2EI8A 1QB6A 3IITA 2ZDAH 4QT8C 4KTCA 2PGQB 3A81A 3E3TA 5A0CA 1TNLA 5GDSH 3QTVH 1MTSA 3C1KA 1NC6A 5ESBA 2H6MA 2Q6DA 4X1RU 1EPTA 1VITF 2HNTC 1G32B 1V2ST 2H9TH 3LIWA 3P17H 4I8GA 3FAOA 1FN8A 3RXOA 1O30A 5C1YA 3TVJB 3VB4A 5E0HA 5EXLA 1ZGVA 2XC5A 4X6NA 4ZKSU 1BT7A 2G00A 1F0TA 4I31A 4M7GA 4ZXXH 2VIVA 2JKHA 4NFEA 1BCUH 4ABAA 4Q7YA 2FPZA 1GG6B 2BY8X 1GBFA 4CRGA 3O8CA 4IN1A 2ZGBH 1NZQH 4Y6DA 1VITH 2C8XB 1CHGA 1C5LH 2GMTB 3RXAA 4ZHMU 1KSNA 4MNXA 2ZDMA 1C1UH 2VIPA 1JOUB 1BTWA 4DW2U 3EYDA 1GGDC 4CH8B 1ZYOA 2QXJA 1TABE 1Y3UA 3BEFB 3L3TA 1ELVA 1ZMJA 4IBLH 4RN6A 3TGKE 2Z9LA 1IQKA 2ZU5A 1T8OA 1THRH 1N6YA 1C5OH 3M7UA 1AO5A 2V35A 2B5TB 1ELDE 1P2QA 4XE4A 1UVUH 1K21H 1L0ZA 4DCDA 1V2QT 1LVMA 1H8IH 1LCYA 1W7XH 1WQVH 1ANCA 2VWLA 1F0SA 3RXTA 4NIVA 3SORA 2TGPZ 3ODDA 4JK5A 1LPKB 1C1VH 2P3FH 3UY9A 3SU2A 1HYLA 4AZ2B 1CO7E 1A3EH 1OWKA 1NRSH 2FYRA 4ISIH 1QCPA 3A80A 1C2KA 1NESE 3A8BA 1DS2E 1BMMH 2Z94A 1MKWK 2OD3B 1P06A 2OXSA 2WUCA 2WV4A 3ENSB 2PW8H 3K65B 1HAVB 1GHWH 2BLOA 2O8MA 1TAWA 1GJ8B 4X6PA 3UREA 4WVPE 1G37A 3MU1A 1UO6A 3IWMA 2YNBA 1ID5H 1QNJA 3MFJA 3TH3H 1DWDH 1HNEE 1YPHE 1C2LA 1EAWA 1O36A 1P2MA 4MPXA 4THNH 4H6TA 2Z9KA 4OS4A 3SU6A 4ISLA 1TQ7B 3UUZA 1CGJE 1MZDA 1AI8H 1GDQA 1KLIH 3NWUA 2ZU2A 1O38A 2ODQA 3BIUH 1PPBH 3KQEA 1SHYA 1TOCB 5EG4A 2A1DB 1GJCB 2WPMS 1O5CB 3C27B 1GMCG 1SGIB 2Y6TA 1QR3E 2QCYA 5LPEA 5AFZH 5FCRA 1BJVA 1UTMA 2ZHDA 3ZV8A 4I7YH 1DDJA 3PWCA 2ODPA 1YCPK 1GJ9B 3TK6A 2O8WA 3I77A 3D65E 1MD8A 3RXBA 2PKSB 3P8NA 5GIBA 5HGGA 3BG4C 5A2MH 1NPMA 4SGBE 1GMHF 2BM2A 3A87A 1C5PA 1RS0A 3BTWE 2ZEBA 2A4OA 3FFGA 2V0BA 3MYWA 3MO3A 4JCNA 3ZZ6A 1O39A 7GCHG 2BOKA 1BRAA 2XXLA 1UCYE 1TRMA 1DUEA 4YM9A 1ZHPA 1SC8U 1K1IA 4Y71A 1Y3XA 1O37A 1LHDH 1F2SE 4ISOA 1SLXB 3ATWA 3MTYA 3R0FA 5T6GA 1HRTH 4DGJA 1GI5A 1DLEA 1GGDB 3TJNA 2ZF0H 3ZZCA 2GV7A 2VWOA 1MAYA 5C5NA 1TIOA 1YPHC 2J34A 1GI2A 1IQMA 1HAIH 2OBOA 3DA9B 3SV2H 5BPEA 2J38A 3SW2B 1G30B 1MQ5A 2F3CE 3ZZAA 1OKXA 3GCNA 1ELGA 1L4DA 1W0YH 3SV9A 1GBAA 1VR1H 1YCPH 1YLDA 3GY5A 1W3CA 2J4IA 1ETRH 2BYAX 1O3IA 1FQ3A 1G3BA 1NN6A 2C8WB 1P57B 1Z6EA 2J9NA 5DKMA 1GBJA 1BRUP 1Y3WA 1ZOMA 3U1IB 1V2OT 2AH4X 1HGTH 5ABWA 3QGJA 1A0LA 1GHAF 3T25A 2IPHA 2XTTB 1T7CA 1QRWA 1HJ8A 1HXFH 1HIAB 2ZQ2A 3GDUA 3HGPA 4D9QA 2PTCE 3B9FH 2QIQA 4MVNA 4Y8XA 4A1TA 1O3KA 4ZKRU 1B0FA 2G8TA 1TA2A 4B74A 3EAJA 3Q3XA 3MH5A 2I6QA 4XBBA 1W12U 3KIDU 1P2IA 1WTHD 1TGNA 5EOKA 3V12A 4U32A 5F6MA 1MTVA 3SUEA 1H9LB 1QGFA 2HWLB 4DY7B 4O97A 1GHBG 1CGHA 2C8ZB 5JDUB 1MKXK 1SOTA 2P94A 1A3BH 4KP0A 1EKBB 3GYMA 3U98H 3MWIU 1PPZA 1BITA 2ILNA 5JBAS 1DY8A 1K28D 4J2YB 3TK5A 3LGTA 5JB8S 1HJAC 2K1QA 2Q6FA 1TBZH 1LVBA 1VJ9U 2GDEH 1ELAA 1X7AC 2F91A 1CA0C 2F9PA 4ZMAH 4UEHH 3F9EA 1FIWA 3W95A 1O3HA 1C4V2 5E8EH 4CH2B 1O5GH 3GY7A 1OYTH 1NM6A 1D3QB 5IYTA 4FUCA 1EASA 1HLTH 1KTTB 3BTKE 3UOPA 3MNXA 1NFUA 3PMJA 8LPRA 3S9AA 2ZPRA 2VGCC 1YBWA 1FY3A 3T26A 1IQFA 1TX7A 4IS5A 1AFQC 1ORFA 2TGAA 1TMBH 3SJIA 1LPGB 1ZJKA 1FY8E 2AFQB 2BD3A 4BOHA 2R0LA 3QN7A 5JB9S 3P95A 1A61H 3TK9A 3M7TA 1Y3YA 1E35B 2QF0A 1LTOA 2CV3A 2ZTZA 3AW1A 3BTFE 3UFAA 1JWTA 4ABGA 3ZVFA 1MKXH 2CHAC 4K1TA 4B71A 2PUQH 5F03A 2BX3A 1A0HB 3RU4E 1OP0A 2AGIX 4Y8ZA 4U01A 2BLWA 2ZDLA 3CP7A 1C9TA 2Y82A 4FUBA 1BTHH 1SGQE 1SGFG 3LGIA 2SNVA 2HNTF 5EPNA 1SGTA 4FUIA 1FAKH 4FUJA 4FVDA 1AHTH 1P09A 3OY5U 2FXRA 2FOEA 1O2HA 2ZCLP 1GJ7B 3Q3YA 3GCTF 3SNDA 3E16B 3O8RA 2BQWB 7LPRA 1Z71A 1V2LT 1HAYB 1OSSA 1DANH 1YP9A 1GBMA 5FBIA 3RU4D 1IHTH 7ESTE 4OS2A 2QC2A 1F0RA 3Q77A 2PR3A 1AY6H 2I6SA 3CENA 4J1YA 2ANYA 1TFXA 4Y79A 1J14A 3URDA 1V2NT 1BBRH 1C2DA 1O3FA 1SI5H 4Q2KA 3PMHB 1SSXA 2TBSA 1EPTB 3B8JA 3E8LA 5C67A 1IHSH 3GDSA 1P03A 1TQ0B 1V2RT 1CBWB 2OLGA 4TY6A 2FI5E 2O8LA 3HGNA 4CBNA 3ZZ4A 3OU0A 1C4U2 2VIOA 2XCNA 7KMEH 5JYIA 3S9BA 1J16A 1O2GH 1E0FD 5DGJA 1QB1A 1DSUA 4DIIH 5HM9A 1P04A 1D4PB 3EA8A 1BUIA 1N8OB 2ODYB 5CMXH 1C5QA 2BD9A 4WH6A 1O2SA 5A09A 4ZUHA 1A7SA 1L1GA 2FOBA 3TU7H 2BVRH 4AGKA 2C8YB 1NFWA 4UDWH 1BMLA 1H9IE 1HV7A 4TYDA 2GKVE 5J4QA 4X8VH 4UFFH 4ABHA 4ISHH 1DE7H 1TA6A 1GJ6A 1E38B 2ZDVH 5AHGH 2VH0A 4K5ZA 3M37A 1C5XB 4FU7A 2ZQ1A 4MNVA 3M7QA 1TPPA 1MBQA 8ESTE 2W3KA 2EEKA 1BRBE 1MTWA 1FJSA 1C5ZB 1Y5UT 2WPIS 2ZG0H 3ATLA 1O2LA 2Z9JA 3E0PB 3TIUA 2VVUA 2BZ6H 3PYHA 4CRCA 4DT7B 1YC0A 6LPRA 1LDTT 1QQ4A 1CA0B 1XMNB 1YYY1 2F9NA 2Z3CA 3F6UH 1GBDA 1P8VC 1ZMLA 1KXAA 1C1WH 4ZHAA 3VPKA 1GVKB 2ZZUH 1UVTH 3D23A 2FIRH 4ZAEA 4WY3A 1CSOE 2XYAA 3ZVBA 1NY22 1FY5A 1MU8B 1DY9A 4K1SA 4K2YA 1AFQB 4NA8A 3SU5A 1UHBA 3MU5A 1KLTA 3T28A 3BTME 1MTNC 4HGCA 1DOJA 2VNTA 1P2OA 6GCHF 1A5GH 2P3UB 1GI6A 2VU8E 4K3JA 5I25A 2STBE 3ZVEA 1V2TT 2OINA 2QYIA 4MG3A 1GI4A 2QY0B 3MMGA 1DXWA 3S0NA 2SNWA 1DXPA 3DFJA 8GCHF 1XUHA 6CHAC 1Y59T 1ABJH 1FV9A 1O2RA 2FDAA 2GTBA 2ZFRH 4Y7AA 2FWWA 1SLWB 1V2KT 3A8DA 1YGCH 2AGGX 3RXGA 3UTUH 1QTFA 4GSOA 1MU6B 3SU4A 4GVUA 1FIZA 1LHCH 1ZGIA 3GCOA 1GCTB 2XBVA 1TWXB 1Y8TA 1GL0E 1TE0A 1UK3A 2NU0E 3S69A 1RTFB 2V3HH 5DP5A 2FO9A 1NRNH 1XVOA 1D3PB 2YOLA 4JZDH 1TB6H 2FS9A 2G52A 1IQLA 4A7IB 1PPGE 4AG1A 3SNEA 2AYWA 2PUXB 4X1NU 2AGEX 3E0NB 2BDAA 1Z8RA 2GV6A 3OTJE 3CS7A 1C2IA 4B76A 4GUXA 2WPLS 2FP7B 2O8UA 3GY6A 3QTOH 3BV9B 5DP7A 1SQAA 1C5MD 3MU0A 4SGAE 4D7GA 1JRTA 1GJ5H 4CRAA 3TLOA 1EAIA 1RXPA 3NKKA 3LGUA 1A5HA 3RXUA 2A7HA 2DE8A 2J95A 1GDUA 4AYYB 1QHRB 1P2NA 2W7SA 1C1MA 4K8BA 2ESTE 2STAE 1Z1JA 1JMOH 1OWDA 1TBRH 6ESTA 1F5LA 1O3MA 3I78A 3LKWA 1AN1E 2VIDA 1CU1A 2ZO3H 4ASHA 2P8OB 4R8TB 1WBGB 1QJ1B 2G5VA 1H1BA 4BAMB 1AVGH 4WXVA 3LJJA 5F8ZA 2XNIA 2F9UA 1QRXA 4NGAH 1TGSZ 1HAOH 4DVAU 2BDIA 4FUDA 1XXDA 2WPKS 1EZQA 1O3EA 3PO1C 1BDAA 1HFDA 1GI7B 5EW1H 2GCHF 4BTIB 5EPYA 2VB0A 3UWIA 1D3DB 2XRCA 4A1XA 1A0JA 2BDGA 4Z6AH 1PPCE 1D9IA 1YKTA 4MDSA 1EX3A 3ZVGA 3T2NA 3EA7A 3IG6B 3PB1E 1O2OA 1THPB 3BSQA 2OC7A 3U69H 2PLXA 2XBYA 3F9GA 5SGAE 1O2ZA 4XBCA 3RXFA 1O33A 4HFPB 2F9VA 4A1VA 3DD2H 3KNXA 3D49H 2GVFA 3GY2A 3MU8A 2DE9A 2Y5HA 2NWNA 4X1SU 3SV8A 3A7ZA 1T8LA 3A84A 1K1OA 2GCTC 3WY8A 1AFEH 1KLJH 4WH8A 1O3BA 3BG8A 1H8DH 1S82A 2B9LA 4NIXA 2ZDNA 4RKJB 1XUKA 4NSYA 1OYQA 3BTHE 1C1TA 3OYPA 2ZGJA 3A8AA 1QURH 3LC5A 3E1XB 2NU1E 1CVWH 2A31A 1IQGA 1TOMH 3BTEE 4ESTE 2QXGA 3FZDA 1BRCE 1W11U 1GHZA 1L1JA 3FVFB 1OX1A 2F9OA 1UVPA 1Z8JB 2FX4A 1TONA 3QX5H 2ZFSA 2FOHA 5DK1A 4E06H 1RGQA 3FP7E 1GJDB 1QBOA 1GBLA 4B1TA 1A2CH 1LQDB 3I29A 1O2NA 2CN0H 5ETXA 4NIYA 1K1NA 3SQHE 4INHA 1GBHA 1V2JT 3MI4A 4AB9A 4D8NA 1FMGA 1ACBE 5GCHG 1MD7A 1C1SA 1THSH 1AU8A 4ABJA 3P8FA 5HXFA 3KGPA 3ZZBA 1V2VT 1LPZB 5FBEA 3RXIA 1HCGA 1TMUH 3GYLB 1ZPCA 4CHAC 4IMQA 1C2HA 1EXFA 1O3LA 1QL9A 3M3SA 1C1QA 3PMAB 3AAVA 1ELEE 1W10U 1GJBB 2BD8A 4ZKOU 4O9VA 2BZAA 3T27A 1NRPH 1A4WH 1EUFA 2WV5A 1JIRA 1VJAU 1O3DA 3LU9B 2XC4A 2XWAA 4AB8A 1T8NA 1Y3VA 1LVYA 4RKOB 1IOEA 5FAHA 3VFEA 3LPRA 3A89A 1ZHRA 2VH6A 1ZSLA 1DITH 1C2GA 3PM3A 3OX7U 4AFQA 5TJXA 4XBDA 4OGXA 3LGVA 4UFDH 4TWYA 3S9CA 3SGBE 2YNAA 2H2ZA 2AEIH 3PTNA 5EQQA 1FPHH 3ZZ5A 3ATKA 3TNSA 2BLVA 1V2UT 2FS8A 1OWIA 1QL8A 3M5NA 1ANDA 2P59A 1BTZA 1UTOA 3BIVH 5F8TA 1O3GA 1HAPH 1C1PA 2HOBA 1RIWC 1PJPA 3ODFA 3V0XA 1XUJA 3ZZ7A 2R3YA 5EGMA 1FN6A 2UUKB 2W7UA 1B5GH 1F0UA 4BTTB 3PO1B 1MUEB 1B0EA 4GCHF 4AG2A 1WYKA 4HI3A 1FPCH 5H4IB 2SGFE 2C93B 3ATIA 1VITG 4BAHB 3QZQA 4MPWA 4R0IA 1SPJA 2H9HA 1TX6A 1UTQA 3LDXH 2CMYA 1O2WA 1P10A 3MNSA 4JYUH 1HPGA 3SNAA 2QXHA 1LMWB 2THFB 1WUNH 3FP6E 3VB5A 3RU4T 1NU7B 1Z8GA 3AW0A 4DIHH 2LNCA 2FYQA 3F9HA 2Y7ZA 3F9FA 1ESBA 1V6DA 3EQ0H 2B7DH 2RDLA 3PV4A 3TGJE 2BD4A 1TBQH 3RXJA 2PV9B 2VINA 4WWYA 3TNTA 1GHYH 1YCPM 2GCTB 2IOTA 4BTUB 1CHOF 4X8SH 1YM0A 1O5DH 4X2WA 1GHVH 1YPLH 2QV1A 1ELTA 3UR6A 1V2WT 1PPEE 1UVOA 4H4FA 1QFKH 4PROA 2AMQA 1AD8H 1BZXE 1D6WA 3VB7A 1SLUB 2BD2A 1SVPA 2QAAA 1UMAH 4MPVA 2CGAA 2G51A 2GCHG 2GZ9A 4NA9H 3PLKA 3KEEA 4NIWA 1F92A 4X2YA 3RXQA 5L6NH 1ZSJA 5EW2H 1YPMH 1FXYA 3RXKA 1PQ5A 2A4GA 4AFSA 3RMLH 1BMNH 1P9UA 1JIMA 4Y76A 4UE7H 5GJ4B 3JZ2B 1MTUA 1HXEH 2UUFB