3PO1B

Thrombin in complex with benzothiazole guanidine
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
147
structure length
147
Chain Sequence
IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of benzothiazole guanidines as novel inhibitors of thrombin and trypsin IV.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Thrombin light chain
total genus 27
structure length 147
sequence length 147
ec nomenclature ec 3.4.21.5: Thrombin.
pdb deposition date 2010-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3po1B00
4B73A 1AB9B 2A2QH 1B7XB 3SU4A 3ZYDA 3PMJA 2PUXB 4HZHA 1C2DA 2BLQA 1QL9A 1G3CA 1DXWA 2BD2A 1C4U2 3U8TH 4INKA 2AIQA 2SGQE 5T6DA 1JBUH 3SOSA 3UR6A 2Z94A 3U9AH 2QF3A 1EOJA 2C8ZB 2A7JA 2M5TA 1MD8A 4JK5A 2B0FA 4XBDA 1NM6A 1HAGE 4HI3A 2OQUA 2DE9A 3R3GB 3QDZB 1SGPE 1O2LA 1V2WT 1Y8TA 1AMHA 2AGEX 6CHAC 3MO3A 3PM3A 4AG1A 5EXNA 1DICA 1UVPA 1MZDA 1C5XB 1C1UH 7ESTE 1GPZA 3V3MA 3HGPA 2SNVA 1DWCH 3MNSA 4X1NU 3SNAA 1YKTA 1ESAA 1GI4A 1GBEA 2OC1A 1O5EH 2TIOA 4DT7B 1MH0A 1ZGIA 2WV5A 1ZLRA 2ZHEH 3RMMH 3SGBE 2PUQH 1GJCB 3MNXA 1CO7E 3A84A 5LGOA 4Y71A 1W11U 4OS7A 4THNH 4Q7XA 1BMAA 1P9SA 4GSOA 4TYDA 1GHAG 1TNGA 2R0KA 5EQSA 2A4RA 1C2FA 2HPQH 2BQ7B 1CGIE 5E0HA 3GDUA 4NZLA 3BTGE 3ELAH 1KTTB 3RXDA 2BDCA 4Y79A 2OXSA 4WVPE 1LPZB 2QC2A 1TLDA 4AYVB 1UK3A 3RXKA 4K8YA 4K60A 4WH8A 1HGTH 2TGTA 1SBWA 2Z3DA 1O39A 4X6MA 1TX6A 1ZHRA 1UVOA 1QJ7B 5A2MH 2ODQA 3O8BA 5K7RA 1QRWA 1S0QA 4Y8ZA 5LPEA 3RMOH 4WMEA 4ZUHA 1P2QA 2ZHDA 3RXUA 2FM2A 5J4SA 1ESBA 2TGDA 1L0ZA 1BMNH 2W7UA 1TPOA 1YPKH 3E0NB 5IDKA 1GI2A 2BXUH 4K3JA 1K1IA 3ZV9A 3BEFB 1UTQA 1QQUA 1FY1A 1EX3A 1TQ0B 1AFEH 1AO5A 1LVBA 2BHGA 1CE5A 4GPGA 1AY6H 4LZ1H 1O3AA 4FUCA 1SGQE 1WTHD 1HJAC 2R9PA 3T2NA 5FBEA 3MMGA 4BXWA 3GDSA 1RTFB 4UFGH 5GCHF 3PMAB 5G4BA 3IITA 1YM0A 2BD7A 3L33A 1ABJH 3P92A 3SU3A 3MYWA 2ZFSA 1GHZA 2PKAB 2XNIA 3GY5A 3MFJA 1G2MA 1C2JA 3M7UA 2ZFTA 1KXBA 1BBRE 2FOMB 2JH6D 1VITH 1UTOA 2O8TA 2R3YA 2H2ZA 5JBTA 1TA2A 1EAXA 3RU4E 1G2LA 3NKKA 3SO3A 1LMWB 1T4VH 1NRRH 4Y10E 1GBTA 2HALA 3A8AA 1QRXA 1NFXA 1IQEA 4X2WA 4ZXXH 1FV9A 5DKMA 2BXTH 1CHGA 1LQDB 1OXGA 3FZZA 2Z3CA 3BIUH 3SUGA 5T6FA 1EPTC 4RKOB 3RXJA 2BMGB 5CMXH 1GI6A 1GJ5H 3M35A 4Q2KA 2QIQA 1GCTC 3GYMA 4NCYA 1JRSA 3GCTF 5BPEA 1UVTH 1Z1JA 4H4FA 3M3VA 1BBRH 3MHWU 3TNSA 2AYWA 2QY0B 4I33A 1O30A 2O8WA 1DOJA 1ELCA 1AB9C 2H9EH 2UWPA 1SPJA 1C5WB 3PYHA 4JYTA 1AKSA 5EW1H 1GHYH 1AVXA 1TABE 1AE5A 3K65B 2VVVA 1Z8JB 2FMJA 2O8UA 2EI7A 1GBCA 1Z6JH 1A46H 2LPRA 3M61U 4Y8XA 1GJ7B 5C1YA 2VVUA 1QY6A 1MZAA 2BYAX 3LPRA 1O34A 4B2BA 2W5EA 2XRCA 4ZKNU 3M7QA 1QNJA 4JYVH 2G81E 2BZ6H 2FX4A 1EQ9A 1DSTA 1P9UA 4AZ2B 1DX5M 4IMQA 3FP7E 1BTXA 4KTUA 2A5AA 1C5RA 4WMDA 4TWWA 5DO4H 5EODA 1CQQA 3SQEE 3ZVAA 5JYIA 1C9PA 3DUXH 5GPIB 3O8DA 2BD5A 4GHQA 1Y3UA 1RIWC 3FFGA 1YC0A 1Y5AT 4UFFH 2CHAB 1XX9A 3LGUA 4BAHB 1GGDC 3GCHC 3GY8A 1TMUH 1EAUA 3F68H 1YGCH 5JPMH 3D49H 2AFQB 1C4V2 4KKDA 1OYTH 5DG6A 1PFXC 2KAIB 1VCWA 3SV6A 1JIMA 2NWNA 4IN2A 2GDEH 3QGNB 1OWHA 1W12U 5L2ZH 4NIYA 2BQWB 4MVNA 1NU7B 2B9LA 4F4OC 1T8NA 5A0BA 1QFKH 4INLA 4ZHAA 2VIQA 5FAHA 1C1NA 1P2OA 3BTME 3KNXA 1F92A 2SGFE 7KMEH 4Y7AA 2VWMA 2CGAA 5K0HA 3FANA 1W7XH 4I8GA 3W94A 1K1JA 4D9RA 4CRGA 3S7HB 3URCA 1E35B 2C8XB 4YLUA 1EPTB 1YYY1 3OYPA 1EZQA 1O2JA 4YT6H 2Z9LA 1GCTB 1MUEB 3M3SA 2CF9H 2H9HA 3URDA 1NROH 4Y76A 4B75A 3M5OA 5GCHG 1DITH 4XDEA 1NESE 2ULLA 2F9NA 4ZKSU 5FPTA 2V0BA 3U8OH 2TPIZ 1LKAA 4H6SB 4VGCC 3MOCA 4KTCA 4ESTE 3F1SB 2Y82A 2ZDVH 1V2QT 2W3IA 3U98H 2JH5D 1P3EA 1O3CA 4AFUA 4FUEA 1O2TA 1TQ7B 4I8KA 3UWJH 2OD3B 3MH4A 1TNJA 2NU1E 3MU4A 1HJ8A 4O3TA 3UIRA 1GDQA 4OS5A 3UOPA 1OP8A 1SLXB 1CA0C 4CHAB 3MO9A 2OUAA 2PR3A 2BDYA 3SV2H 4DURA 1BOQA 4D8NA 1W8BH 3SGAE 3SJ9A 2ODPA 3PROA 2EEKA 2VB0A 3E16B 3MU8A 4YOGA 4YTAA 2SGPE 2RCEA 4E05H 2ZDAH 3O8CA 3VPKA 3A80A 2BD9A 3ZZAA 2ZTZA 3EA9A 3M5MA 4UFEH 4X6NA 2K1QA 4XBBA 1IQKA 2ZA5A 4LK4A 2VGCB 1ARBA 1P12E 3D65E 3KCGH 1W14U 4GCHF 4ABBA 3N7OA 3RXSA 2AEIH 3BTEE 3BG4B 1K22H 1P2MA 1T32A 4TWYA 3GCTG 1SSXA 1A5IA 1V2KT 5E0JA 5B6OA 4WWYA 1FUJA 3DA9B 1D3QB 1RIWB 3RXOA 4U30A 1QA7A 4YO9A 1PQ7A 3S69A 2I6QA 1JXPA 1O3EA 5FCKA 1SHYA 2BD3A 3RC4A 2ZTXA 2J2UA 2GMTB 1U6QA 1BQYA 1FNIA 1NRNH 2CJIA 1PPBH 2G5VA 5TCCA 1IHSH 1NU9A 1C5PA 2ZDLA 4NIVA 2V6NA 1O3KA 2Y5GA 1K21H 1OWKA 5C2ZA 1V2LT 2A7HA 1BBRK 2BDGA 3SJIA 1GVKB 1L2EA 2GD4B 1A61H 2W3KA 1C1OA 3RLYH 2HOBA 4Q7ZA 4K2YA 1P06A 3ATWA 5JBAS 3RXHA 4K69A 2VNTA 3F9GA 2ZECA 2BY7X 1KXEA 5A0CA 1F5RA 1S84A 1DXPA 1TE0A 2GT7A 2ZZUH 4U01A 3RC5A 2WPIS 1V2TT 1QA0A 1HAYB 3GY4A 1H8IH 5F03A 2BLVA 3PLBA 1TPAE 1HAPH 1S0RA 2AH4X 1BCUH 1A4WH 2R3UA 3GY7A 3ZZ6A 4J2YB 4AFQA 2XCNA 2BZAA 4X6OA 2IOTA 3A86A 3KF2A 3GY2A 1K2I1 2ZDKA 3STIA 2Y6TA 3BEIB 3VGCC 5SGAE 4ISNA 4AFSA 1MAYA 5E8EH 1IQFA 1O31A 1B0EA 3UR9A 4Z0KA 1QBNA 1IQNA 1C5YB 3HKJB 4H6TA 1DT2A 1K1MA 1QR3E 5L2YH 1HAOH 1P02A 2C90B 4CRAA 2OTVA 5F8TA 1Z8RA 3A7XA 2ANWA 1A0JA 1UCYE 1CGJE 2TGAA 3ODDA 1VCPA 5LH8A 1AVWA 2OC0A 2ZC9H 1W0ZU 2OP9A 3KGPA 3SV8A 2QYIA 4MNWA 4ZKRU 2D8WA 2FXRA 2J34A 1MTSA 4AFZA 1G36A 3BG4C 2BQ6B 2ZDMA 4JYUH 4TPYA 4E7RG 3ZZ8A 1CBWC 1OYQA 1E37B 3UY9A 1IQLA 3NWUA 1TRYA 3TH4H 2DUCA 2FIRH 4AB8A 1BDAA 3GICB 3ZV8A 3SJOA 3A7TA 1ZPBA 1WUNH 5I25A 1C2IA 2WPMS 1GMDG 3QWCH 2JETC 1HLTH 1AN1E 2GKVE 3CENA 1GJBB 4UDWH 2PHBA 3SU5A 4WJG2 2FPZA 1AD8H 2BY9X 1BRUP 1KIGH 1SFQB 1GJ4H 1BJVA 3PMHB 1PPFE 1SB1H 3S9CA 4VGCB 3M5LA 1TPSA 4BAMB 1ZZZA 1GHVH 1K1OA 3IG6B 2C8YB 3MH6A 3EDXB 3NK8A 2B7DH 2AGIX 2HWLB 2GZ7A 2VIVA 1LVYA 3K9XB 3Q76A 3E0PB 1NFYA 2XBYA 1KLJH 2FESH 3LGIA 1F0SA 5EXMA 5EXLA 6LPRA 1AZZA 3SI4H 1EASA 5GDSH 1UTLM 1ANCA 5EGMA 3KQDA 3ZVDA 1HAVA 2CF8H 5F6MA 1LPGB 3F9EA 2OLGA 1C5VA 3EA8A 3QUMP 4AOQA 1QIXB 2GT8A 1C1VH 1FN6A 1UJ1A 4ASHA 2JKHA 3SGQE 4JZDH 4AORA 4DOQA 1MTNB 1ORFA 1NRPH 3OU0A 1C1QA 1GMCG 3EA7A 1O3HA 3T27A 3SV7A 3UQVA 2Y81A 4X2VA 1Z71A 2Y7ZA 3C27B 5T6GA 3RU4T 1TMBH 3P8NA 1O3FA 3BTWE 1KXAA 2Z6BD 3MTYA 4K1SA 5CE1A 2GV6A 2JH0D 2OCVB 2ZFRH 1QB9A 3SU2A 1VR1H 1GI8B 1GBDA 5DK1A 3NXPA 1SFIA 2I6SA 3MI4A 1GDUA 1A3EH 3B23B 5AFYH 1C5LH 1OPHB 1WSSH 1FXYA 3KL6A 2Y80A 3K6YA 4HFPB 3PO1C 4FUGA 1BTPA 3KQCA 3ZVGA 1FY3A 4FUJA 2NU2E 2VGCC 4AGKA 1G3BA 1AUTC 2VH6A 4TY6A 1H9HE 1PPEE 1ZJKA 1G3DA 1YPHC 1EAWA 4FU9A 2UUYA 1EAIA 1QJ6B 4Q7YA 1P2KA 4FVDA 4JCNA 3VXEH 1F2SE 2STBE 7GCHF 2A2XH 1BTWA 1GJ6A 2SGDE 1XUKA 1S6FA 2HVXA 1AHTH 4OGXA 3A83A 4AGJA 2Q6GA 1BTYA 1EZSC 1T4UH 3RXGA 3VFEA 1GMHF 3RXTA 1GG6C 1IAUA 4X8SH 5HM9A 3UFAA 2XBWA 1EJNA 3A7ZA 1RS0A 4GAWA 3HKIB 1GMDF 1Q2WA 2GP9B 2GZ9A 1ZRKA 5HYOA 1VITG 3A8DA 2FX6A 1HIAB 1DUAA 3VGCB 2ZCLP 1UTPA 1H9IE 1GBBA 4YOJA 5A8XA 1FY8E 1XKBC 2EI8A 1CVWH 3NCLA 4FU7A 2WPHS 1C2HA 1HAVB 3CS0A 4IBLH 2ZPSA 1YPHE 1O2WA 2AMQA 3CP7A 2ZHWH 1WQVH 3WY8A 3Q3KA 1DPOA 3AAVA 3GY3A 1DY9A 1UTJA 1O2YA 3SUDA 3UNSA 3U8RH 5TCAA 1EZUC 4ABFA 4A7IB 3A7YA 3SN8A 2HLCA 3H7TA 1O36A 3PWBA 1GJDB 2OINA 1GI3A 2A45B 4JZFH 4ISLA 4PROA 1T8LA 1TAWA 1QRZA 1DY8A 1IQIA 4GVUA 2BX4A 2ZPRA 1TALA 1O3NA 1O3DA 1YCPK 4CRFA 3UPEA 1O3IA 1BHXF 2TRMA 1A7SA 4A5TS 1MBQA 1RGQA 2BM2A 3QO6A 1WAYB 1ZHPA 3AW1A 4JMYA 3DT0H 3QK1A 1EOLA 1V6DA 2GCTB 1J14A 2JETB 5DPAA 4Y0ZE 5EG4A 4DCDA 1WQSA 1EXFA 3RXPA 2TBSA 1KLIH 2SGEE 1EP5A 4ZROA 3GCNA 3TGIE 2IJOB 1LDTT 4YOIA 1NFWA 3UTUH 1A0LA 2HRVA 2Z9GA 1T31A 1C5TA 1HNEE 1SI5H 1MKXH 1BMMH 6CHAB 1OSSA 1S5SA 3TLOA 1J9CH 1KYNA 5L30H 4ZH8A 3M7TA 1LPKB 8KME2 1F0RA 4CH8B 1MD7A 1A1RA 1Z8GA 1MKXK 3Q00A 1O3MA 3ZVEA 3EQ0H 3U1JB 1AWFH 3I78A 3GOVB 1SL3A 2P95A 1HAXB 2CHAC 1ELFA 1M9UA 3LGTA 1P04A 1KTSB 1EB2A 1O3OA 1SGDE 2TGPZ 1VZQH 2FI4E 3P8GA 2FLRH 1N6YA 2PTNA 3GCHB 5EQQA 7GCHG 1PPGE 2FOGA 2D2DA 3L3TA 4BNRA 1F0TA 2AERH 2EC9H 1G37A 4WXVA 4DIHH 5FX5A 1MCTA 1C5ZB 1TBRH 2THFB 2G55A 3PB1E 4ABAA 1AKSB 5DP8A 4BTIB 2ZDNA 2EA3A 4ABGA 1TGCA 1EJMA 3T26A 4CREA 5EOKA 2ZHQH 4FU8A 1YPMH 3AW0A 2XCFA 4MPUA 1EKBB 5IYTA 2GVFA 1WYKA 3ZZBA 3S9AA 1LVOA 1G3EA 1B0FA 1S6HA 8LPRA 4U2WA 1HXEH 1O2NA 1SMFE 2R0LA 3KQEA 2Q1JA 1J16A 1UTMA 2IPHA 1Z8IB 3LC5A 2FLBH 1FQ3A 1FAXA 1V2ST 2G52A 2SGAA 4UD9H 5AHGH 3TK5A 1Z1IA 3HK6B 4RSPA 3MU5A 1KSNA 1OS8A 3NZIA 1GJ8B 1Y5BT 2P16A 3SNDA 5FBIA 1TMTH 2UUKB 4WF8A 3BF6H 3GYLB 1CBWB 5DP6A 3HPTB 1N8OB 3TJNA 1UHBB 5FHTA 1XXDA 3ZYEA 1O5GH 4JZEH 1AE8H 1P2IA 3ZVBA 4B71A 1CSOE 1BRCE 4DGJA 1FDPA 1BTZA 4ISHH 1G9IE 1EATA 1ACBE 4DY7B 3T29A 2BVRH 1S81A 1GHBF 3RXIA 1D4PB 1ARCA 3BTKE 1ELDE 1O5CB 2G51A 1GI9B 1E38B 1YPEH 1TONA 2AMPA 2GGVB 1DLKB 1GBIA 1D3DB 1XVMA 2WPLS 1XUHA 4CRCA 2XC5A 5FPYA 1HAHH 4D76A 1BT7A 2ANKH 1DSUA 4BAOB 2XWBI 3A82A 2FYRA 1LCYA 1ETTH 1AFQB 1OX1A 1P3CA 3VB3A 1V2NT 4E7NA 3LU9B 1DWEH 5EW2H 1C5MD 3H7OA 4NG9H 3PTNA 1RFNA 1F0UA 2NU3E 1A3BH 1EUFA 1FONA 3MWIU 4IMZA 4DVAU 4ABDA 2ZHFH 2ZGBH 3GISB 1NRQH 2ALVA 2FOHA 2ZGHA 3D23A 4FUBA 3P70B 4IS5A 3ATLA 5EPNA 1DWBH 3BV9B 5AVDA 2ZPQA 1H4WA 2QAAA 1TRMA 4LOYH 1FAKH 3RM0H 3ZZ5A 4NIWA 1P03A 3SI3H 4XE4A 3VB4A 5C3NA 3KIDU 3O8RA 1YCPH 5BRRE 3LKWA 1V2OT 2H5DA 2ANYA 2PSXA 1J15A 1BUIA 2BDIA 2BOHB 3E91A 1S83A 4CRBA 3ESTA 2AIPA 1DUEA 1UHBA 1E34B 2ZO3H 2FDAA 4IN1A 3CS7A 1W10U 1LQEA 1MU6B 3I77A 1NN6A 3E90B 8GCHG 1HXFH 2J38A 3P8FA 3TGJE 3M37A 4BTUB 1O33A 4R8TB 1XMNB 1F5LA 1S85A 4FUHA 1TGNA 4FVBA 1TYNA 4MLFB 1QBOA 3LONA 2ZQ1A 1B5GH 1AZ8A 1P01A 2BD4A 1WCZA 4O03A 5CHAB 3RXQA 3G01A 2P93A 3OY6U 1YP9A 2G4UA 2PW8H 4BAKB 1RJXB 4JZIA 3QX5H 1QL8A 1XUIA 1PYTC 4FUIA 1P05A 2B5TB 3V0XA 1GL1A 2BOKA 5C20A 1XXFA 1ZTJA 3GDVA 4BXSA 1O2HA 1K1NA 1TBZH 2NU4E 3OX7U 1C5SA 4INHA 2FI3E 3E6PH 4RN6A 1PQ8A 1LTOA 1TGTA 5DP7A 4GCHG 1V2UT 3RXCA 5T3HA 2Q6DA 2NU0E 2WUBA 4CHAC 1RD3B 1UCYK 1K1LA 4WY3A 2ESTE 1ZR0A 1P8VC 3LGWA 1MTWA 3A8CA 4Y0YE 3ZZ9A 2AS9A 1Y3WA 1UO6A 2O9QA 1P10A 3SJKA 2G00A 1L1NA 1QB1A 1OP0A 4X1SU 2FEQH 3LH1A 2Z3EA 3SHCH 1NS3A 1GCDA 2QN5T 1FPHH 1SLVB 1O2VA 5F8ZA 2P59A 1L4ZA 1RTLA 2FTLE 2GCHF 1OP2A 2FOCA 4CBNA 3LGYA 3RXRA 1XUGA 3BIVH 1O2UA 2C8WB 2VINA 1ELVA 1UK4A 3AVZA 8ESTE 2D1JA 3A7VA 3QZQA 1ZPCA 2YNBA 2QV1A 4D9QA 2A7CA 3RDZA 2SFAA 3M5NA 3TGKE 5FPSA 1SC8U 1Z7KA 1AI8H 4IW4E 4B76A 2XC4A 1GL0E 3UWIA 2C4FH 3T62A 1A0HB 4A1TA 1V2MT 4U32A 4CBOA 1AUJA 1O3GA 1W0YH 3A88A 3RP2A 3VB7A 3RXLA 1Q31A 9ESTA 1AIXH 4XBCA 1BTUA 1O32A 2J4IA 4X2XA 3TU7H 5AFZH 5DGJA 2G5NA 3A85A 1ANBA 2GCTC 3TK6A 1DWDH 4I8LA 3S7KB 1AWHB 1UVSH 3K6ZA 3KN2A 5A8YA 2ZGJA 3E8LA 2BD8A 1C1SA 1VCQA 3SUEA 1Y59T 2XWAA 3A87A 3B9FH 2FI5E 4ISOA 4SGBE 1C5OH 1MTUA 5AF9H 1O5BB 1AFQC 1NC6A 3QN7A 4MNVA 1O2RA 1O3PB 2CXVA 4GLYA 2F9PA 4ZAEA 3LJOA 2GDDA 2FOBA 3TJVA 1GBFA 3HK3B 4H42U 1WOFA 3PV4A 3UUZA 1W7GH 1BHXB 2BLWA 4MPXA 4WMFA 1RXPA 1ZTKA 1P57B 1C2MA 3RMNH 5FXLA 3BTFE 1TOMH 1IOEA 2H5CA 1BIOA 4NIXA 1NT1A 1E0FD 1W3CA 1LHDH 2ZU3A 3MO6A 1CHOF 1AU8A 3TJUA 4A1VA 5C1XA 4D7GA 2BVXH 3RLWH 1ID5H 1O2SA 1PQAA 3DFJA 1LHCH 1DANH 4LXBH 1D3TB 1MQ5A 3F9HA 3D62A 5FX6A 1HAIH 1UTNA 1TNKA 1AGJA 5PTPA 3SNEA 2BTCE 1BA8B 4ISIH 5F8XA 1HJ9A 4ZXYH 2WYJA 2ZCKP 4XSKU 4XOJA 2D26C 4B74A 1BB0B 1GHBG 5ABWA 4X1QU 3TH3H 1INCA 1YPGH 1DFPA 4OS4A 1CT2E 4NWKA 2XW9A 4ZHMU 1DS2E 2A32A 4CRDA 4CH2B 3LIWA 2UWOA 4UEHH 1OWEA 3JZ1B 2WUCA 2J95A 1A5HA 1C2LA 4OGYA 3SUFA 1SOTA 1TGBA 2J94A 4MG3A 1NY22 3V12A 1QTFA 5CHAC 1PPZA 4AX9H 1H8DH 5JDUB 1GVZA 2Q6FA 1MTNC 1JIRA 4JK6A 3Q3YA 4ZHLU 1KLTA 1W13U 1JRTA 2HNTC 1O2MA 1QQ4A 1V2PT 1HBTH 1KDQA 2PKAA 4JZ1A 3Q3XA 3RXVA 2H9TH 1OKXA 1YPLH 3DHKH 1RRKA 5EU8A 4DW2U 2PGQB 3SJ8A 3RXEA 4A1XA 1HJAB 4BANB 1MMJN 4RKJB 3Q77A 1C1MA 4WH6A 3A7WA 4I7YH 1RTKA 1SQAA 2J9NA 2UUFB 3SV9A 5ESBA 3QLPH 3FZDA 1HCGA 2Y7XA 4M7GA 4ZMAH 3MNBA 3SNBA 1TFXA 3M3TA 1P2JA 3GY6A 4I8JA 2A5IA 1GI7B 1C4Y2 1N1LA 1S82A 1SVPA 3ZZCA 3ZZ3A 1XVOA 2FWWA 1BRAA 1O0DH 1GBJA 1VJAU 4NA8A 1XM1A 2G8TA 1C2KA 1NZQH 4R0IA 4KTSA 2QXIA 3KEEA 4YLQH 1C5QA 1FZZA 5DP9A 4FXGH 1TX7A 1ZMJA 1C2EA 2OC7A 4Y11E 2P3TB 1CT4E 3A89A 1EZXC 3QGJA 3SQHE 1HFDA 2LNCA 2SNWA 2EI6A 1PPCE 5ESTE 4XFQA 1QJ1B 2ODYB 2G4TA 4DIIH 2ZTYA 1O2KA 3EGKH 1HB0B 1Y3YA 2GV7A 1MQ6A 1O3LA 5HXFA 2XC0A 3FP6E 2XBXA 1XUJA 2BY5X 2AMDA 1T7CA 1ZYOA 4J1YA 3HGNA 5GXPA 1MCVA 2BDHA 1EJAA 2C93B 3RM2H 3PWCA 1TPPA 2Z9KA 1GWAA 3SORA 1TA6A 4DJZB 4ZKOU 2P8OC 2Y5FA 1ZHMA 1SLWB 2GCHG 4UONA 3PO1B 1SGIB 3E1XB 2QGRA 4MDSA 5DJ7A 2ZGXH 2FP7B 2FS8A 2ZFPH 3LT3A 1NO9H 2PKSC 2ZWLH 1ZMLA 3P8OA 3MNCA 1OWDA 2FOEA 2F9OA 4K1TA 2ASUB 2A4GA 3DFLA 2W7SA 5JB9S 1YF4A 3LJJA 1TGSZ 2PLXA 4HGCA 1SGNE 2QXJA 3TVJB 1SGRE 4NGAH 1LVMA 1PQ5A 1GG6B 2FOAA 3ATKA 2H1UA 3A8BA 1JOUB 1THRH 1A5GH 1FIWA 2ZG0H 2VWNA 1CHOG 2ZU1A 4B2CA 1BTHH 2XTTB 2BDBA 3F9FA 2ANMH 4I8HA 1ZPZA 5HMAA 1TNIA 3T28A 1P0SH 4OS1A 1UCYH 4TY7A 1DDJA 2FTMA 2QCYA 3EYDA 5E0GA 3TIUA 5A8ZA 3ZVFA 1CA8B 1Z6EA 3RC6A 5I46H 2A5KA 5DP5A 1GBAA 1C2GA 1C5NH 1H9LB 2BX3A 3H5CB 2A4QA 1GVLA 4A92A 1GGDB 3OTJE 1D3PB 1OWJA 1SGFG 2VU8E 1KXFA 1Y3XA 1ELBA 1TRNA 2V35A 1C1PA 2ZFFH 2A1DB 1O5AB 1K28D 1VITF 2VIOA 1THSH 5HGGA 1C5UA 4X2YA 5A0AE 2ZNKH 2ALPA 2WPKS 4ABEA 1O35A 3PLPA 2HGTH 2IN2A 2C3SA 4X8VH 2ZKSA 1YLCA 1V2VT 5C67A 2GZ8A 1AVGH 1ZGVA 4I32A 2FZZA 1GI0A 2HNTE 3BTTE 5DP3A 4MNXA 2OBOA 4NSVA 5JBCS 1HDTH 4KGAA 1VJ9U 1SOZA 2ZU2A 3UREA 1ANDA 1ZRBA 2F91A 1N8OC 4GUXA 1UTKA 1SR5C 5H4IB 4NFFA 4B2AA 1J17T 4O97A 5LPFA 5LPRA 3SU1A 1DLEA 1P2NA 2PSYA 4YM9A 2BY8X 2QA9E 2RDLA 3P95A 3SZNA 2Z9IA 3SU6A 1T8OA 2VWLA 3BEUA 2GMTC 1O3JA 1XUFA 2RA0A 1O38A 6GCHF 2P8OB 1UMAH 2DE8A 1SGEE 2ILNA 2V3OH 3S0NA 4K8BA 5EPYA 3RMLH 1VGCC 3BTQE 3S9BA 2Y5HA 2A31A 4MTBA 1SLUB 4MNYA 5TJXA 2ZU4A 1TNLA 2ZQ2A 1GI1A 4MPWA 4Y6DA 3W95A 4GHTA 1O2IA 1BJUA 1ZJDA 3FP8E 1TWXB 2B8OH 5GIBA 1FJSA 1SQOA 4KELA 3VB5A 2VWOA 4X6PA 3LC3A 4NFEA 4AYYB 1PPHE 5A09A 4X8UH 1V3XA 1QHRB 2XXLA 1O3BA 3U1IB 3TJOA 2ZGCA 1MTVA 1F7ZA 3RXAA 1O2PA 2BVSH 1C1RA 1WV7H 1J8AA 2HPPH 3QTOH 1OOKB 3PMBB 3PLKA 1FY5A 2WINI 1ZOMA 2QXGA 2CV3A 9LPRA 1IQGA 1IQHA 1GHWH 2PFEA 5EQRA 4ABHA 3EE0B 1YLDA 3UQOA 1JWTA 4X1RU 1D6RA 1CT0E 1FMGA 4YESB 1KDQB 1BRBE 4AN7A 3LH3A 2UWLA 4X0WU 3P17H 5C5OA 1CA0B 1L4DA 1ELTA 1ZSKA 1ELAA 4UE7H 3MH5A 1MKWH 3ZZ7A 4FUDA 1SGYE 1IQJA 4B1TA 1SG8B 2ZI2H 4KP0A 1CGHA 3ENSB 4ABIA 1IQMA 1EPTA 1GJ9B 2HNTF 2FYQA 5E2PA 1FN8A 1C1TA 1BMLA 1LO6A 2RA3A 3MU1A 3NPSA 3ZZ4A 1K1PA 3ATIA 1LHEH 4A6LA 4MPVA 3SBKA 2ZEBA 3E3TA 1ZSLA 2ZIQH 2PTCE 1ZMNA 4YZUA 3LDXH 5FCRA 3OY5U 1DVAH 4IC6A 1ESTA 2R2MB 1QBVH 3AAUA 1PJPA 3UNQA 2OBQA 4LZ4B 2PGBB 4UFDH 2VIDA 3TNTA 1FIZA 1XKAC 3KQBA 2O8LA 2KAIA 2WV4A 3R0FA 1TNHA 1MKWK 3AASA 1SHHB 3IWMA 1ELGA 2Z9JA 3LGVA 3LOXA 1TX8A 1HIAA 4Y8YA 3RXBA 8GCHF 1O2XA 4AB9A 6ESTA 3T5FH 2F9UA 1ETRH 5HM2A 1KXDA 1L1JA 4K5ZA 3VB6A 2AGGX 2ZCHP 4F49A 4OS6A 3JZ2B 4BTTB 2F9BH 2P3UB 4X1PU 2QXHA 4IGDA 2BLOA 4NA7A 3V13A 2FODA 1VGCB 1C9TA 1GBKA 1LHFH 1GI5A 2VVCA 1GHAF 3QTVH 4Q80A 3P6ZB 2FS9A 2ZFQH 1O2GH 2PKSB 5GWZA 2R2WU 2GTBA 3BTHE 1GBHA 1O5FH 3A81A 5C1UA 4IC5A 1O2ZA 2ZU5A 1MU8B 1A2CH 2P94A 3UNRA 3NUMA 1D9IA 3U69H 1ABIH 3SU0A 1SGCA 3C1KA 2GX4A 1G30B 2W26A 1OWIA 2QF0A 1TB6H 3TPIZ 2BY6X 2XBVA 2ZF0H 4X8TH 3SW2B 2XYAA 1YCPM 1HV7A 3PTBA 3BSQA 1E36B 1QCPA 2STAE 3KHVA 1HAZB 2CN0H 2PV9B 2P3FH 1BITA 1NFUA 2F9VA 1FY4A 1O37A 2UUJB 7LPRA 1Y5UT 5DP4A 2RG3A 4BOHA 4Z6AH 4NSYA 3HATH 2A0QB 3F6UH 2FOFA 3BN9A 3OSYA 1TBQH 4NWLA 2WYGA 4HTCH 4WXIA 1O2QA 1WU1A 1X7AC 1JMOH 3EAJA 1KY9A 1WBGB 1KXCA 1FI8A 3MH7A 1Y3VA 1BZXE 1H1BA 4E06H 1TOCB 2BDAA 1TIOA 2PWXA 4FUFA 5J4QA 4TPIZ 4ABJA 3V7TA 3B8JA 3MU0A 4AG2A 1GBLA 3VEQB 2OC8A 1MAXA 1D6WA 4MQAA 3SNCA 5GJ4B 2O8MA 5JBBS 1ETSH 2VIWA 1K9OE 1UK2A 1V2RT 3ATMA 2OQ5A 1FLEE 3RUOA 3M36A 2YOLA 3TK9A 1O5DH 4BAQB 1THPB 1NPMA 3I29A 3BTDE 3ODFA 4NA9H 1LKBA 1HPGA 1NRSH 1MBMA 1QURH 1ANEA 3TH2H 5L6NH 3ITIA 1GHXH 1YPJH 1PYTD 1T8MA 2WPJS 1QB6A 5E2OA 1GBMA 2VIPA 5ETXA 3TITA 4O3UA 4OS2A 3K2UA 1G32B 3FAOA 1IHTH 1QGFA 1DM4B 4I31A 4D7FA 4CR9A 4Y7BA 1ZSJA 3L6PA 2V3HH 1P09A 3VXFH 1SGFA 3RXMA 3RU4D 2VH0A 1HUTH 2ZP0H 5C5NA 1C1WH 1ZTLA 4QT8C 3BG8A 3ZVCA 4DG4A 3QZRA 1SQTA 3T25A 1GDNA 1O2OA 2FO9A 4NZQA 1YBWA 2F3CE 1CU1A 3DD2H 6GCHG 1GMCF 1Q3XA 1LHGH 1F5KU 1SGTA 2CMYA 1EP6A 1UVUH 2YNAA 4K1EA 4YT7H 1QL7A 3FVFB 1GJAB 3STJA 1N6XA 4SGAE 1HYLA 1GMHG 3UOUA 4CR5A 3GCOA 1HRTH 1L1GA 3ZZDA 2F83A 1ELEE 2Z7FE 1EB1H 2BB4A 5JB8S 2H6MA 2A4OA 1FPCH 1AQ7A 1NTPA 3SHAH 1V2JT 1W2KH 1DE7H 1P11E 4O9VA 3RXFA 2J92A 2VJ1A 1WTGH
chains in the Genus database with same CATH superfamily
4B73A 1AB9B 2A2QH 1B7XB 3SU4A 3ZYDA 3PMJA 2PUXB 4HZHA 4ACAA 1C2DA 2BLQA 1QL9A 1G3CA 1DXWA 2BD2A 1C4U2 3U8TH 4INKA 2M2AA 2AIQA 2SGQE 5T6DA 1JBUH 3SOSA 3UR6A 2Z94A 3U9AH 2QF3A 1EOJA 2C8ZB 2A7JA 2M5TA 1MD8A 3W1EA 4JK5A 2B0FA 4XBDA 1NM6A 1YLNA 1HAGE 4HI3A 2OQUA 2DE9A 3R3GB 3FN8A 3QDZB 1SGPE 1O2LA 1V2WT 1Y8TA 1AMHA 2AGEX 6CHAC 3MO3A 3PM3A 4AG1A 5EXNA 1DICA 1UVPA 3KYFA 1MZDA 1C5XB 1C1UH 7ESTE 1GPZA 3V3MA 3HGPA 2SNVA 1DWCH 3MNSA 4X1NU 2QE7D 3SNAA 1YKTA 1ESAA 1GI4A 1GBEA 2OC1A 1O5EH 2TIOA 4DT7B 1MH0A 1ZGIA 2WV5A 1ZLRA 2ZHEH 3RMMH 3SGBE 2PUQH 1GJCB 3MNXA 1CO7E 3A84A 5LGOA 4Y71A 1W11U 4OS7A 4THNH 4Q7XA 1BMAA 1P9SA 4GSOA 4TYDA 1GHAG 1TNGA 2R0KA 5EQSA 2A4RA 1C2FA 2HPQH 2BQ7B 1CGIE 1MABB 5E0HA 3GDUA 4NZLA 3BTGE 3ELAH 1KTTB 3RXDA 2BDCA 2WPDD 4Y79A 2OXSA 4WVPE 1LPZB 2QC2A 1TLDA 4AYVB 1UK3A 3RXKA 4K8YA 4K60A 4WH8A 1HGTH 2TGTA 1SBWA 2Z3DA 1O39A 4X6MA 1TX6A 1ZHRA 1UVOA 4OM9A 1QJ7B 5A2MH 2ODQA 3O8BA 5K7RA 1QRWA 2KM0A 1S0QA 5FL7D 3PRBA 4Y8ZA 5LPEA 3RMOH 4WMEA 4ZUHA 1P2QA 2ZHDA 3RXUA 2FM2A 5J4SA 1ESBA 2TGDA 1L0ZA 3OTPA 5KECA 1OHHD 1BMNH 2W7UA 1TPOA 1YPKH 3E0NB 5IDKA 1GI2A 2BXUH 3DSGA 4K3JA 1K1IA 3ZV9A 3BEFB 1UTQA 1QQUA 1FY1A 1EX3A 1TQ0B 1AFEH 4ACBA 1AO5A 1LVBA 2BHGA 1CE5A 4GPGA 1AY6H 4LZ1H 1O3AA 4FUCA 1SGQE 1WTHD 2QF5A 1HJAC 2R9PA 3T2NA 5FBEA 5DSFA 5C0TA 3MMGA 4BXWA 3GDSA 1RTFB 4UFGH 5GCHF 3PMAB 5G4BA 3IITA 1YM0A 2BD7A 3L33A 1ABJH 3P92A 3SU3A 3MYWA 2ZFSA 1GHZA 2PKAB 2XNIA 3GY5A 3MFJA 1G2MA 1C2JA 3M7UA 3DCLA 2ZFTA 1KXBA 1BBRE 2FOMB 2JH6D 1VITH 1UTOA 2O8TA 2R3YA 2H2ZA 5JBTA 1TA2A 1EAXA 3RU4E 1G2LA 3NKKA 3SO3A 1LMWB 1T4VH 1NRRH 4Y10E 1GBTA 2HALA 3A8AA 4B6EA 1QRXA 1NFXA 1IQEA 4X2WA 2XOKD 4ZXXH 1FV9A 5DKMA 2BXTH 1CHGA 1LQDB 1OXGA 3FZZA 2Z3CA 3BIUH 3SUGA 5T6FA 1EPTC 4RKOB 3RXJA 2BMGB 5CMXH 4TT3D 1GI6A 1GJ5H 3M35A 4Q2KA 2QIQA 1GCTC 3GYMA 4NCYA 1JRSA 4F48B 3GCTF 5BPEA 1UVTH 1Z1JA 4H4FA 3M3VA 1BBRH 3MHWU 3TNSA 2AYWA 2QY0B 4I33A 1O30A 2O8WA 1DOJA 1ELCA 1AB9C 2H9EH 2UWPA 4RT1A 1SPJA 1C5WB 3PYHA 4JYTA 1AKSA 5EW1H 1GHYH 1AVXA 1TABE 1AE5A 3K65B 2VVVA 1NBMD 1Z8JB 2FMJA 2O8UA 2EI7A 1GBCA 1Z6JH 1A46H 2LPRA 3M61U 4Y8XA 1NBME 1GJ7B 5C1YA 2VVUA 1QY6A 1MZAA 2BYAX 3LPRA 1O34A 4B2BA 2W5EA 2XRCA 4ZKNU 3M7QA 1QNJA 4JYVH 2G81E 1UW7A 2BZ6H 2FX4A 1EQ9A 1DSTA 1P9UA 2VBCA 5KEDA 4AZ2B 1DX5M 4IMQA 1W0KD 1BTXA 3FP7E 4KTUA 2A5AA 1C5RA 4WMDA 4TWWA 5DO4H 5EODA 1CQQA 3SQEE 3ZVAA 5JYIA 1C9PA 3DUXH 5GPIB 2WHXA 3O8DA 2BD5A 4GHQA 1Y3UA 1RIWC 3FFGA 1YC0A 1Y5AT 5EJLA 4UFFH 2CHAB 1XX9A 3LGUA 4BAHB 1GGDC 4HG6A 3GCHC 3GY8A 1TMUH 1EAUA 3F68H 1YGCH 5JPMH 3D49H 2AFQB 1C4V2 4KKDA 1OYTH 5DG6A 1PFXC 2KAIB 1VCWA 3SV6A 1JIMA 2NWNA 4IN2A 2GDEH 3QGNB 1OWHA 1W12U 5L2ZH 4NIYA 2BQWB 2J98A 4MVNA 1NU7B 2B9LA 4F4OC 1T8NA 5A0BA 1QFKH 4INLA 4ZHAA 2VIQA 5FAHA 1C1NA 1P2OA 3BTME 3KNXA 1F92A 2SGFE 7KMEH 4Y7AA 2VWMA 2CGAA 5K0HA 3FANA 1W7XH 4I8GA 3W94A 1K1JA 4D9RA 4CRGA 3S7HB 3URCA 1E35B 1E1QD 2C8XB 4YLUA 1EPTB 1YYY1 3OYPA 1EZQA 1O2JA 4YT6H 2Z9LA 1GCTB 1MUEB 3M3SA 2CF9H 2H9HA 3URDA 4Z1MD 1NROH 4Y76A 4B75A 3M5OA 5GCHG 1DITH 4XDEA 1NESE 2ULLA 2F9NA 4ZKSU 5FPTA 2V0BA 3U8OH 2TPIZ 4F55A 1LKAA 4Q63A 4H6SB 4VGCC 3MOCA 4KTCA 4ESTE 3F1SB 2Y82A 2ZDVH 1V2QT 2W3IA 3U98H 2JH5D 1P3EA 1O3CA 4AFUA 4FUEA 1O2TA 1TQ7B 4I8KA 3UWJH 2OD3B 3MH4A 1TNJA 2NU1E 3MU4A 1HJ8A 4O3TA 3UIRA 1GDQA 4OS5A 3UOPA 1OP8A 1SLXB 1CA0C 4CHAB 3MO9A 2OUAA 2PR3A 2BDYA 3SV2H 4DURA 1BOQA 4D8NA 1W8BH 2YMSB 5CHBA 3SGAE 3SJ9A 2ODPA 3PROA 2EEKA 2VB0A 3E16B 3MU8A 4YOGA 4YTAA 2SGPE 1K0HA 2RCEA 4E05H 2ZDAH 3O8CA 3VPKA 3A80A 2BD9A 3ZZAA 2ZTZA 3EA9A 3M5MA 4UFEH 4X6NA 2K1QA 4XBBA 1IQKA 2ZA5A 4LK4A 2VGCB 1ARBA 1P12E 3D65E 3KCGH 1W14U 4GCHF 4ABBA 3N7OA 3RXSA 2AEIH 3BTEE 3BG4B 1K22H 1P2MA 1T32A 2WV9A 4TWYA 3GCTG 1SSXA 1A5IA 1V2KT 5E0JA 5B6OA 4WWYA 1FUJA 3DA9B 1D3QB 1RIWB 3RXOA 4U30A 1QA7A 4YO9A 1PQ7A 2XNDD 3S69A 2I6QA 1JXPA 1O3EA 3FKSD 5FCKA 1SHYA 2BD3A 3RC4A 2ZTXA 2J2UA 2GMTB 1U6QA 1BQYA 1FNIA 1NRNH 2CJIA 1PPBH 2G5VA 5TCCA 1IHSH 1NU9A 1C5PA 2ZDLA 4NIVA 2V6NA 1O3KA 2Y5GA 1K21H 1OWKA 5C2ZA 1V2LT 2A7HA 1BBRK 2BDGA 3SJIA 1GVKB 1L2EA 2GD4B 1A61H 2W3KA 1C1OA 2F43B 3RLYH 2HOBA 4Q7ZA 4K2YA 1P06A 3ATWA 5JBAS 3H09A 3RXHA 4K69A 2VNTA 3F9GA 2ZECA 2BY7X 1KXEA 5A0CA 1F5RA 1S84A 1DXPA 1VKYA 1TE0A 2GT7A 2ZZUH 4U01A 3RC5A 2WPIS 1V2TT 1QA0A 1HAYB 3GY4A 2LELA 1H8IH 5F03A 2BLVA 3PLBA 1TPAE 1HAPH 1S0RA 2AH4X 2HLDD 1BCUH 1A4WH 2R3UA 4M9FA 3GY7A 3ZZ6A 4J2YB 4AFQA 2XCNA 2BZAA 4X6OA 2IOTA 3A86A 3KF2A 3GY2A 1K2I1 2ZDKA 3STIA 2Y6TA 3BEIB 3VGCC 5SGAE 4ISNA 4AFSA 1MAYA 5E8EH 5IK2D 5T1VA 1IQFA 1O31A 1B0EA 3UR9A 4Z0KA 1QBNA 1IQNA 1C5YB 3HKJB 4H6TA 1DT2A 1K1MA 1QR3E 5L2YH 1HAOH 1P02A 2C90B 4CRAA 2OTVA 5F8TA 1Z8RA 3A7XA 2ANWA 3DSPA 1A0JA 2KCPA 1UCYE 1CGJE 2TGAA 3ODDA 1VCPA 5LH8A 1AVWA 2OC0A 2ZC9H 1W0ZU 2OP9A 3KGPA 3SV8A 2QYIA 4MNWA 4ASUD 4ZKRU 2D8WA 2FXRA 2J34A 1MTSA 4AFZA 1G36A 3BG4C 2BQ6B 2ZDMA 4JYUH 4TPYA 4E7RG 3ZZ8A 1CBWC 1OYQA 1E37B 3UY9A 1IQLA 3NWUA 1TRYA 3TH4H 2DUCA 2FIRH 4AB8A 1BDAA 3GICB 3ZV8A 3SJOA 3A7TA 1ZPBA 1WUNH 5I25A 1C2IA 2WPMS 1GMDG 3QWCH 2JETC 1HLTH 1AN1E 2GKVE 3CENA 1GJBB 4UDWH 2PHBA 3SU5A 4WJG2 2FPZA 1AD8H 2BY9X 1EFRD 3OFND 1BRUP 1KIGH 1SFQB 1GJ4H 1BJVA 3PMHB 1PPFE 1SB1H 3OEED 3S9CA 2V3MA 4VGCB 3M5LA 1TPSA 4BAMB 1ZZZA 1GHVH 1K1OA 3IG6B 2C8YB 3MH6A 3EDXB 3NK8A 2B7DH 2AGIX 2L74A 2HWLB 2GZ7A 2VIVA 1LVYA 3K9XB 3Q76A 3E0PB 1NFYA 2XBYA 1KLJH 2FESH 3LGIA 1F0SA 5EXMA 5EXLA 6LPRA 1AZZA 3SI4H 1EASA 5HIYA 5GDSH 1UTLM 1ANCA 5EGMA 3KQDA 3ZVDA 1HAVA 2CF8H 5F6MA 1LPGB 3F9EA 2OLGA 1C5VA 3EA8A 3QUMP 4AOQA 1QIXB 2GT8A 1C1VH 1FN6A 1UJ1A 4ASHA 2JKHA 3SGQE 4JZDH 4AORA 4DOQA 1MTNB 1ORFA 1NRPH 3OU0A 1C1QA 1GMCG 3EA7A 1O3HA 3T27A 3SV7A 3UQVA 5F53A 2Y81A 4X2VA 1Z71A 2Y7ZA 3C27B 5T6GA 3RU4T 5HIZA 1TMBH 3P8NA 1O3FA 3BTWE 1KXAA 2Z6BD 3MTYA 4K1SA 5CE1A 2GV6A 2JH0D 2J5UA 2OCVB 2ZFRH 1QB9A 3SU2A 1VR1H 1GI8B 1GBDA 5DK1A 3NXPA 1SFIA 2I6SA 3MI4A 1GDUA 1A3EH 3B23B 5AFYH 3F3BA 1C5LH 1OPHB 1WSSH 1FXYA 3KL6A 2Y80A 3K6YA 4HFPB 3PO1C 4FUGA 1S6LA 1BTPA 3KQCA 3ZVGA 1FY3A 4FUJA 2NU2E 2VGCC 4AGKA 1G3BA 3F2HA 1AUTC 2VH6A 4TY6A 1H9HE 1PPEE 1ZJKA 1G3DA 1YPHC 1EAWA 4FU9A 2UUYA 1EAIA 1QJ6B 4Q7YA 1P2KA 4FVDA 4JCNA 3VXEH 1F2SE 2STBE 7GCHF 2A2XH 1QZ8A 1BTWA 1GJ6A 2SGDE 1XUKA 1S6FA 2HVXA 5EJZA 1AHTH 4OGXA 3A83A 4AGJA 2Q6GA 1BTYA 1EZSC 1T4UH 3RXGA 3VFEA 1GMHF 3RXTA 1GG6C 1IAUA 4X8SH 5HM9A 3UFAA 2XBWA 1EJNA 3A7ZA 1RS0A 4GAWA 3HKIB 1GMDF 1Q2WA 2GP9B 2GZ9A 1ZRKA 5HYOA 1VITG 3A8DA 2FX6A 1HIAB 1DUAA 3VGCB 2ZCLP 1UTPA 1H9IE 1GBBA 4YOJA 5A8XA 1FY8E 1XKBC 2EI8A 1CVWH 3NCLA 4FU7A 2WPHS 1C2HA 1HAVB 3CS0A 4IBLH 2ZPSA 1YPHE 1O2WA 2AMQA 3CP7A 3N7EA 2ZHWH 1WQVH 3WY8A 3Q3KA 1DPOA 3AAVA 3GY3A 1DY9A 1UTJA 1O2YA 3SUDA 3UNSA 3U8RH 5TCAA 1EZUC 4ABFA 4A7IB 3A7YA 3SN8A 2HLCA 3H7TA 1O36A 3PWBA 1GJDB 4FETA 2OINA 1GI3A 2A45B 4JZFH 4ISLA 4PROA 1T8LA 1TAWA 1QRZA 1DY8A 1IQIA 4GVUA 2BX4A 2ZPRA 1TALA 1O3NA 1O3DA 1YCPK 4CRFA 3UPEA 1O3IA 1BHXF 2TRMA 1A7SA 4A5TS 1YWUA 1MBQA 1RGQA 2BM2A 3QO6A 1WAYB 1ZHPA 4XRNA 3AW1A 4JMYA 3DT0H 3QK1A 1EOLA 1V6DA 2GCTB 1J14A 2JETB 5DPAA 4Y0ZE 5EG4A 4DCDA 1WQSA 2KX4A 1EXFA 3RXPA 2TBSA 1KLIH 2SGEE 1EP5A 4ZROA 3GCNA 3TGIE 3AK5A 2IJOB 1LDTT 4YOIA 1NFWA 3UTUH 1A0LA 2HRVA 2Z9GA 1T31A 3KYGA 1C5TA 1HNEE 1SI5H 1MKXH 1BMMH 6CHAB 3PRDA 1OSSA 1S5SA 3TLOA 1J9CH 1KYNA 5L30H 4ZH8A 3M7TA 1LPKB 8KME2 2AHME 1F0RA 4CH8B 1MD7A 1A1RA 1Z8GA 1MKXK 3Q00A 1O3MA 3ZVEA 3OE7D 3EQ0H 3U1JB 1AWFH 3I78A 3GOVB 1SL3A 2P95A 1HAXB 2CHAC 1ELFA 1M9UA 3LGTA 1P04A 1KTSB 1EB2A 1O3OA 1SGDE 2TGPZ 1VZQH 2FI4E 3P8GA 2FLRH 1N6YA 2PTNA 3GCHB 5EQQA 7GCHG 1PPGE 2FOGA 2D2DA 5EIYA 3L3TA 4BNRA 1F0TA 2AERH 2EC9H 1G37A 4WXVA 4DIHH 5FX5A 1MCTA 1C5ZB 1TBRH 2THFB 2G55A 3PB1E 4ABAA 1AKSB 5DP8A 4BTIB 2ZDNA 2EA3A 4ABGA 1TGCA 1EJMA 3T26A 4CREA 5EOKA 2ZHQH 4FU8A 3CNRA 1YPMH 3AW0A 2XCFA 4MPUA 1EKBB 5IYTA 1BMFD 2GVFA 1WYKA 3ZZBA 3S9AA 5C17A 1LVOA 1G3EA 1B0FA 1S6HA 8LPRA 4U2WA 1HXEH 1O2NA 1SMFE 2R0LA 3KQEA 2Q1JA 1J16A 1UTMA 2IPHA 1Z8IB 3LC5A 2FLBH 1FQ3A 1FAXA 1V2ST 2G52A 2SGAA 4UD9H 5AHGH 3TK5A 1Z1IA 3HK6B 4RSPA 3MU5A 1KSNA 1OS8A 3NZIA 1GJ8B 1Y5BT 5EJ1A 2P16A 3SNDA 5FBIA 1TMTH 2UUKB 4WF8A 3VG8A 3BF6H 3GYLB 1CBWB 5DP6A 3HPTB 1N8OB 3TJNA 1UHBB 5FHTA 1XXDA 3ZYEA 1O5GH 2RFKC 4JZEH 1AE8H 1P2IA 3ZVBA 4B71A 1CSOE 1BRCE 4DGJA 1FDPA 1BTZA 4ISHH 1G9IE 1EATA 3PV2A 1ACBE 4DY7B 3ZIAD 3T29A 2BVRH 1S81A 1GHBF 3RXIA 1D4PB 1ARCA 3BTKE 1ELDE 1H8HD 1O5CB 2G51A 1GI9B 1E38B 1YPEH 1TONA 2AMPA 2GGVB 1DLKB 1GBIA 1D3DB 1XVMA 2WPLS 1XUHA 4CRCA 2XC5A 5FPYA 1HAHH 4D76A 1BT7A 2ANKH 1DSUA 4BAOB 2XWBI 3A82A 2FYRA 1LCYA 1ETTH 1AFQB 1OX1A 1P3CA 3VB3A 1V2NT 4E7NA 3LU9B 1DWEH 5EW2H 1C5MD 3H7OA 4NG9H 3PTNA 1RFNA 1F0UA 4I86A 2NU3E 1A3BH 1EUFA 1FONA 2RDEA 3MWIU 4IMZA 4DVAU 3N7DA 4ABDA 2ZHFH 2ZGBH 3GISB 1NRQH 2ALVA 2FOHA 2ZGHA 3D23A 4FUBA 3P70B 4IS5A 3ATLA 5EPNA 1DWBH 3BV9B 5AVDA 2ZPQA 1KMHB 1H4WA 2QAAA 1TRMA 4LOYH 2QF4A 1FAKH 3RM0H 2OK5A 3ZZ5A 4NIWA 1P03A 3SI3H 2JJ1D 4XE4A 3VB4A 5C3NA 3KIDU 3O8RA 1YCPH 5BRRE 3LKWA 1V2OT 3UB0A 2H5DA 2ANYA 2PSXA 1J15A 1BUIA 2BDIA 2BOHB 3E91A 1S83A 2KCAA 3FO8D 4CRBA 3ESTA 2AIPA 1DUEA 1UHBA 2J97A 1E34B 2ZO3H 2FDAA 4IN1A 3CS7A 1W10U 1LQEA 1MU6B 3I77A 1NN6A 3E90B 8GCHG 1HXFH 2J38A 3P8FA 3TGJE 3M37A 4BTUB 1O33A 4R8TB 1XMNB 1F5LA 1S85A 4FUHA 1TGNA 4FVBA 1TYNA 4MLFB 1QBOA 3DSOA 3WWFA 3LONA 2ZQ1A 1B5GH 3EE7A 1AZ8A 1P01A 2BD4A 1WCZA 4O03A 5CHAB 3RXQA 3G01A 2P93A 3OY6U 1YP9A 2G4UA 2PW8H 4BAKB 1RJXB 4JZIA 3QX5H 1QL8A 1XUIA 1PYTC 4FUIA 1P05A 2B5TB 3V0XA 1GL1A 2BOKA 5C20A 1XXFA 1ZTJA 3GDVA 3SZEA 4BXSA 1O2HA 1K1NA 1TBZH 2NU4E 3OX7U 1C5SA 4INHA 2FI3E 3E6PH 4RN6A 1PQ8A 1LTOA 1TGTA 5DP7A 4GCHG 1V2UT 3RXCA 5T3HA 2Q6DA 2NU0E 2WUBA 4CHAC 1RD3B 1UCYK 1K1LA 5GNDA 3MQKC 1YY3A 4WY3A 2ESTE 1ZR0A 1P8VC 3LGWA 1MTWA 3A8CA 4Y0YE 3ZZ9A 2AS9A 1Y3WA 1UO6A 2O9QA 1P10A 3SJKA 2G00A 1L1NA 1QB1A 1OP0A 4X1SU 2FEQH 3LH1A 2Z3EA 3UAIC 3SHCH 1NS3A 1GCDA 2GJGA 2QN5T 1FPHH 1SLVB 1O2VA 5F8ZA 2P59A 1L4ZA 1RTLA 2FTLE 1H8ED 2GCHF 1OP2A 3OAAD 1E1RD 2FOCA 4CBNA 3LGYA 3RXRA 1XUGA 3BIVH 1O2UA 2C8WB 2VINA 2WZQA 1ELVA 1UK4A 3AVZA 2KZ4A 2WSSD 8ESTE 2D1JA 3A7VA 3QZQA 1ZPCA 2YNBA 2J98B 2QV1A 4D9QA 2A7CA 3RDZA 2SFAA 3M5NA 3TGKE 5FPSA 1SC8U 1Z7KA 1AI8H 4IW4E 4B76A 2XC4A 1GL0E 3UWIA 2C4FH 3T62A 1A0HB 4A1TA 1V2MT 4U32A 4CBOA 1AUJA 1O3GA 1W0YH 3A88A 3RP2A 3VB7A 3RXLA 1Q31A 9ESTA 1AIXH 4XBCA 1BTUA 1O32A 2J4IA 4X2XA 3TU7H 5AFZH 5DGJA 2G5NA 3A85A 1ANBA 2GCTC 3TK6A 1DWDH 4I8LA 3S7KB 1AWHB 1UVSH 2KR7A 3K6ZA 3KN2A 5A8YA 2ZGJA 3E8LA 2YMSC 2BD8A 1C1SA 1VCQA 3SUEA 1Y59T 2XWAA 3A87A 3B9FH 2FI5E 4ISOA 4XD7D 4SGBE 1C5OH 1MTUA 5AF9H 1O5BB 1AFQC 1NC6A 3QN7A 4MNVA 1O2RA 1O3PB 2CXVA 4GLYA 1SKYE 2F9PA 4ZAEA 2F4LA 3LJOA 2GDDA 2FOBA 3TJVA 1GBFA 3F0OA 3HK3B 4H42U 1WOFA 3PV4A 3UUZA 1W7GH 2YMSD 1BHXB 2BLWA 4TSFD 4MPXA 4RI0A 4WMFA 1RXPA 1ZTKA 1P57B 1C2MA 3RMNH 5FXLA 3BTFE 1TOMH 1IOEA 2HVYB 2H5CA 1BIOA 4NIXA 1NT1A 1E0FD 1W3CA 1LHDH 2ZU3A 3MO6A 1CHOF 1AU8A 3TJUA 4A1VA 5C1XA 4D7GA 2BVXH 3RLWH 1ID5H 1O2SA 1PQAA 3DFJA 1LHCH 1DANH 4LXBH 5KGOA 1D3TB 1MQ5A 3F9HA 3D62A 5FX6A 4B6FA 1HAIH 1UTNA 1TNKA 1AGJA 5PTPA 3SNEA 2BTCE 1BA8B 4ISIH 5F8XA 1HJ9A 4ZXYH 2WYJA 2ZCKP 4XSKU 1COWD 4XOJA 2D26C 4B74A 1BB0B 1GHBG 5ABWA 4X1QU 3TH3H 1INCA 1YPGH 1DFPA 4OS4A 1CT2E 4NWKA 2XW9A 4ZHMU 1DS2E 2A32A 4CRDA 4CH2B 3LIWA 2UWOA 4UEHH 1OWEA 3JZ1B 2WUCA 3WW7A 1SQRA 5C94A 2J95A 1A5HA 1C2LA 4OGYA 3SUFA 1SOTA 1TGBA 2J94A 4MG3A 1NY22 3V12A 1QTFA 5CHAC 1PPZA 4AX9H 1H8DH 5JDUB 1GVZA 2Q6FA 1MTNC 1JIRA 4JK6A 3Q3YA 4ZHLU 1KLTA 1W13U 1JRTA 2HNTC 1O2MA 1QQ4A 1V2PT 1HBTH 1KDQA 2PKAA 4JZ1A 3Q3XA 3RXVA 2H9TH 1OKXA 1YPLH 3DHKH 1RRKA 5EU8A 4DW2U 2PGQB 3SJ8A 3RXEA 4A1XA 1HJAB 4BANB 1MMJN 4RKJB 3Q77A 1C1MA 4WH6A 3A7WA 4I7YH 1RTKA 1SQAA 2J9NA 2UUFB 3SV9A 5ESBA 3QLPH 3FZDA 1WDIA 1HCGA 2Y7XA 4M7GA 4ZMAH 3MNBA 4ZCNA 3SNBA 1TFXA 3M3TA 1P2JA 3GY6A 4I8JA 2A5IA 1GI7B 1C4Y2 1N1LA 1S82A 1SVPA 3ZZCA 3ZZ3A 1XVOA 2FWWA 1BRAA 1O0DH 1GBJA 1VJAU 2EQNA 4NA8A 1XM1A 2G8TA 1C2KA 1NZQH 4R0IA 4KTSA 2QXIA 3KEEA 4YLQH 1C5QA 1FZZA 5HKKD 5DP9A 4FXGH 1TX7A 1ZMJA 1C2EA 2OC7A 4Y11E 2P3TB 1CT4E 3A89A 1EZXC 3QGJA 3SQHE 1HFDA 2LNCA 2SNWA 2EI6A 1PPCE 5ESTE 4XFQA 1QJ1B 2ODYB 2G4TA 4DIIH 2ZTYA 1O2KA 3EGKH 1HB0B 1Y3YA 2GV7A 1MQ6A 1O3LA 5HXFA 2XC0A 3FP6E 2XBXA 1XUJA 2BY5X 2AMDA 1T7CA 1ZYOA 4J1YA 3HGNA 2CK3D 5GXPA 1MCVA 2BDHA 1EJAA 2C93B 3RM2H 3PWCA 1TPPA 2Z9KA 1GWAA 3SORA 1TA6A 4DJZB 4ZKOU 2P8OC 2Y5FA 1ZHMA 1SLWB 2GCHG 5C0UA 4UONA 3PO1B 1SGIB 3E1XB 2QGRA 4MDSA 5DJ7A 4Q4LA 3SYJA 2ZGXH 2FP7B 2FS8A 3WWBA 2ZFPH 3LT3A 1NO9H 2PKSC 2ZWLH 1ZMLA 3P8OA 3MNCA 4AC9A 1OWDA 2FOEA 2F9OA 4K1TA 2K8IA 2ASUB 2A4GA 3DFLA 2W7SA 5JB9S 1YF4A 3LJJA 1TGSZ 2PLXA 4HGCA 1SGNE 2QXJA 3TVJB 1SGRE 4NGAH 1LVMA 1PQ5A 1GG6B 2FOAA 3ATKA 2H1UA 3A8BA 1JOUB 1THRH 1A5GH 1FIWA 2ZG0H 2VWNA 3PV5A 1CHOG 2ZU1A 4B2CA 1BTHH 2XTTB 2BDBA 3F9FA 2ANMH 4I8HA 1ZPZA 5HMAA 1TNIA 3T28A 1P0SH 4OS1A 1UCYH 4TY7A 1DDJA 2FTMA 2QCYA 3EYDA 5E0GA 3TIUA 4YXWD 5A8ZA 3ZVFA 1CA8B 1Z6EA 3KQ5A 3RC6A 5I46H 2A5KA 5DP5A 1GBAA 1C2GA 1C5NH 1H9LB 2BX3A 3H5CB 2A4QA 1GVLA 4A92A 1GGDB 3OTJE 1D3PB 1OWJA 1SGFG 2VU8E 1KXFA 1Y3XA 1ELBA 1TRNA 2V35A 1C1PA 2ZFFH 2A1DB 3F2FA 1O5AB 1K28D 1VITF 2VIOA 1THSH 5HGGA 1C5UA 4X2YA 5A0AE 2ZNKH 2ALPA 2WPKS 4ABEA 1O35A 3PLPA 2HGTH 2IN2A 2C3SA 4X8VH 2ZKSA 1YLCA 1V2VT 5C67A 2GZ8A 1AVGH 1ZGVA 4I32A 2FZZA 1GI0A 2HNTE 3BTTE 5DP3A 4MNXA 2KFWA 2OBOA 4NSVA 5JBCS 1HDTH 4KGAA 1VJ9U 1SOZA 2ZU2A 3UREA 1ANDA 1ZRBA 2F91A 3F2GA 1N8OC 4GUXA 1UTKA 1SR5C 5H4IB 4NFFA 4B2AA 1J17T 4O97A 4DT4A 5LPFA 5LPRA 2W6ID 3SU1A 1DLEA 1P2NA 2PSYA 4YM9A 2BY8X 2QA9E 2RDLA 3P95A 3SZNA 1FX0B 2Z9IA 3SU6A 1T8OA 2VWLA 3BEUA 2GMTC 1O3JA 2RA0A 1XUFA 2K0QA 1O38A 6GCHF 4RT0A 2P8OB 1UMAH 2DE8A 1SGEE 2ILNA 2V3OH 3S0NA 4K8BA 5EPYA 3RMLH 1VGCC 3BTQE 3S9BA 2A31A 2Y5HA 4MTBA 1SLUB 4MNYA 5TJXA 2ZU4A 1TNLA 2ZQ2A 1GI1A 4MPWA 4Y6DA 3W95A 4GHTA 2JJ2D 1O2IA 1BJUA 1ZJDA 3FP8E 1TWXB 2B8OH 5GIBA 1FJSA 1SQOA 4KELA 3VB5A 2VWOA 4X6PA 3LC3A 4NFEA 4AYYB 1PPHE 2IPQX 5A09A 2JDID 4X8UH 1V3XA 1QHRB 2XXLA 1O3BA 2PP6A 3U1IB 3TJOA 2ZGCA 1MTVA 1F7ZA 3RXAA 1O2PA 2BVSH 1C1RA 1WV7H 1J8AA 2HPPH 3QTOH 1OOKB 3PMBB 3PLKA 1FY5A 2WINI 1ZOMA 2QXGA 2CV3A 9LPRA 1IQGA 1IQHA 1GHWH 2PFEA 5EQRA 4ABHA 2LP6A 3EE0B 1YLDA 3UQOA 1JWTA 4X1RU 1D6RA 1CT0E 1FMGA 4YESB 1KDQB 1BRBE 4AN7A 3LH3A 2UWLA 4X0WU 3P17H 3N99A 5C5OA 1CA0B 1L4DA 1ELTA 1ZSKA 1ELAA 4UE7H 3MH5A 1MKWH 3ZZ7A 4FUDA 1SGYE 1IQJA 4B1TA 1SG8B 2ZI2H 4KP0A 1CGHA 4P02A 3ENSB 4ABIA 1IQMA 1EPTA 1GJ9B 3NRLA 2HNTF 2FYQA 5E2PA 1FN8A 1C1TA 1BMLA 1LO6A 2RA3A 3MU1A 3NPSA 3ZZ4A 1K1PA 2JIZD 1LHEH 3ATIA 4MPVA 4A6LA 3SBKA 2ZEBA 3E3TA 1ZSLA 2ZIQH 2PTCE 1ZMNA 4YZUA 3LDXH 5FCRA 3OY5U 1DVAH 4IC6A 1ESTA 2R2MB 1QBVH 3AAUA 1PJPA 3UNQA 2OBQA 4LZ4B 2PGBB 1W0JD 4UFDH 2VIDA 3TNTA 1FIZA 1XKAC 3KQBA 2O8LA 2KAIA 2WV4A 3R0FA 1E79D 1TNHA 1MKWK 3AASA 1SHHB 3IWMA 1ELGA 2Z9JA 3LGVA 3LOXA 1TX8A 1HIAA 4Y8YA 3RXBA 8GCHF 1O2XA 4AB9A 6ESTA 3T5FH 2F9UA 1ETRH 5HM2A 1KXDA 1L1JA 4K5ZA 3VB6A 2AGGX 2ZCHP 4F49A 4OS6A 3JZ2B 4BTTB 2F9BH 2P3UB 4X1PU 2QXHA 4IGDA 2BLOA 4NA7A 3V13A 2FODA 1VGCB 2IJD1 1C9TA 1GBKA 3GS9A 1LHFH 5DN6D 1GI5A 2VVCA 1GHAF 3QTVH 4Q80A 2L6OA 3P6ZB 2FS9A 2ZFQH 2EY4C 1O2GH 2PKSB 5GWZA 2R2WU 2GTBA 3BTHE 1GBHA 1O5FH 3A81A 5C1UA 4IC5A 1O2ZA 2ZU5A 1MU8B 1A2CH 2P94A 3UNRA 3NUMA 1D9IA 3U69H 1ABIH 3SU0A 1SGCA 3C1KA 2GX4A 1G30B 2W26A 5B6LA 1OWIA 3FOAA 2QF0A 1TB6H 3TPIZ 2BY6X 2XBVA 2ZF0H 4X8TH 3SW2B 2XYAA 1YCPM 1HV7A 3PTBA 3BSQA 1E36B 1QCPA 2STAE 3KHVA 1HAZB 2CN0H 2PV9B 2KCOA 2P3FH 1BITA 1NFUA 2F9VA 1FY4A 1O37A 2UUJB 3OEHD 7LPRA 1Y5UT 5DP4A 2RG3A 4BOHA 4Z6AH 4NSYA 3HATH 2A0QB 3F6UH 2FOFA 3BN9A 3OSYA 1TBQH 4NWLA 2WYGA 4HTCH 4WXIA 1O2QA 1WU1A 1X7AC 1JMOH 3U28C 3EAJA 1KY9A 1WBGB 1KXCA 1FI8A 3MH7A 1Y3VA 1BZXE 1H1BA 4E06H 1TOCB 2BDAA 4P00A 1TIOA 2PWXA 4FUFA 5J4QA 4TPIZ 4ABJA 3V7TA 3B8JA 2KCYA 3MU0A 4AG2A 1GBLA 3VEQB 2OC8A 1MAXA 1D6WA 4MQAA 3SNCA 5GJ4B 2O8MA 5JBBS 1ETSH 2VIWA 1K9OE 1UK2A 1V2RT 3ATMA 2OQ5A 1FLEE 3RUOA 3M36A 2YOLA 3TK9A 1O5DH 2W6JD 1THPB 4BAQB 1NPMA 3I29A 3BTDE 3ODFA 4NA9H 1LKBA 1HPGA 1NRSH 1MBMA 1QURH 1ANEA 3TH2H 5L6NH 3ITIA 1GHXH 1YPJH 1PYTD 1T8MA 2WPJS 1QB6A 5E2OA 1GBMA 2VIPA 5ETXA 3TITA 4O3UA 4OS2A 3K2UA 1G32B 3FAOA 1IHTH 1QGFA 3F0PA 1DM4B 4I31A 4D7FA 1WXRA 4CR9A 4Y7BA 1ZSJA 3L6PA 2V3HH 1P09A 3VXFH 1SGFA 3RXMA 3RU4D 2VH0A 1HUTH 2ZP0H 5C5NA 1C1WH 1ZTLA 4QT8C 3BG8A 3ZVCA 4DG4A 3QZRA 1SQTA 3T25A 1GDNA 1O2OA 2FO9A 4NZQA 1YBWA 2F3CE 1CU1A 3DD2H 6GCHG 1GMCF 1Q3XA 1LHGH 1F5KU 1SGTA 2CMYA 1EP6A 1UVUH 2YNAA 4K1EA 4YT7H 1QL7A 5CDFE 3FVFB 1GJAB 3STJA 1N6XA 4SGAE 1HYLA 1GMHG 3UOUA 4CR5A 3GCOA 1HRTH 1L1GA 3ZZDA 2F83A 1ELEE 2Z7FE 4FOUC 1EB1H 2BB4A 5JB8S 2H6MA 2A4OA 1FPCH 1AQ7A 1NTPA 3SHAH 1V2JT 1W2KH 1DE7H 1P11E 4O9VA 3RXFA 2J92A 2V7QD 2VJ1A 1WTGH
chains in the Genus database with same CATH topology
4B73A 1AB9B 2A2QH 1B7XB 3SU4A 3ZYDA 3PMJA 2PUXB 4HZHA 1C2DA 2BLQA 1QL9A 1G3CA 1DXWA 2BD2A 1C4U2 3U8TH 4INKA 2AIQA 2SGQE 5T6DA 1JBUH 3SOSA 3UR6A 2Z94A 3U9AH 2QF3A 1EOJA 2C8ZB 2A7JA 2M5TA 1MD8A 4JK5A 2B0FA 4XBDA 1NM6A 1HAGE 4HI3A 2OQUA 2DE9A 3R3GB 3QDZB 1SGPE 1O2LA 1V2WT 1Y8TA 1AMHA 2AGEX 6CHAC 3MO3A 3PM3A 4AG1A 5EXNA 1DICA 1UVPA 1MZDA 1C5XB 1C1UH 7ESTE 1GPZA 3V3MA 3HGPA 2SNVA 1DWCH 3MNSA 4X1NU 3SNAA 1YKTA 1ESAA 1GI4A 1GBEA 2OC1A 1O5EH 2TIOA 4DT7B 1MH0A 1ZGIA 2WV5A 1ZLRA 2ZHEH 3RMMH 3SGBE 2PUQH 1GJCB 3MNXA 1CO7E 3A84A 5LGOA 4Y71A 1W11U 4OS7A 4THNH 4Q7XA 1BMAA 1P9SA 4GSOA 4TYDA 1GHAG 1TNGA 2R0KA 5EQSA 2A4RA 1C2FA 2HPQH 2BQ7B 1CGIE 5E0HA 3GDUA 4NZLA 3BTGE 3ELAH 1KTTB 3RXDA 2BDCA 4Y79A 2OXSA 4WVPE 1LPZB 2QC2A 1TLDA 4AYVB 1UK3A 3RXKA 4K8YA 4K60A 4WH8A 1HGTH 2TGTA 1SBWA 2Z3DA 1O39A 4X6MA 1TX6A 1ZHRA 1UVOA 1QJ7B 5A2MH 2ODQA 3O8BA 5K7RA 1QRWA 1S0QA 4Y8ZA 5LPEA 3RMOH 4WMEA 4ZUHA 1P2QA 2ZHDA 3RXUA 2FM2A 5J4SA 1ESBA 2TGDA 1L0ZA 1BMNH 2W7UA 1TPOA 1YPKH 3E0NB 5IDKA 1GI2A 2BXUH 4K3JA 1K1IA 3ZV9A 3BEFB 1UTQA 1QQUA 1FY1A 1EX3A 1TQ0B 1AFEH 1AO5A 1LVBA 2BHGA 1CE5A 4GPGA 1AY6H 4LZ1H 1O3AA 4FUCA 1SGQE 1WTHD 1HJAC 2R9PA 3T2NA 5FBEA 3MMGA 4BXWA 3GDSA 1RTFB 4UFGH 5GCHF 3PMAB 5G4BA 3IITA 1YM0A 2BD7A 3L33A 1ABJH 3P92A 3SU3A 3MYWA 2ZFSA 1GHZA 2PKAB 2XNIA 3GY5A 3MFJA 1G2MA 1C2JA 3M7UA 2ZFTA 1KXBA 1BBRE 2FOMB 2JH6D 1VITH 1UTOA 2O8TA 2R3YA 2H2ZA 5JBTA 1TA2A 1EAXA 3RU4E 1G2LA 3NKKA 3SO3A 1LMWB 1T4VH 1NRRH 4Y10E 1GBTA 2HALA 3A8AA 1QRXA 1NFXA 1IQEA 4X2WA 4ZXXH 1FV9A 5DKMA 2BXTH 1CHGA 1LQDB 1OXGA 3FZZA 2Z3CA 3BIUH 3SUGA 5T6FA 1EPTC 4RKOB 3RXJA 2BMGB 5CMXH 1GI6A 1GJ5H 3M35A 4Q2KA 2QIQA 1GCTC 3GYMA 4NCYA 1JRSA 3GCTF 5BPEA 1UVTH 1Z1JA 4H4FA 3M3VA 1BBRH 3MHWU 3TNSA 2AYWA 2QY0B 4I33A 1O30A 2O8WA 1DOJA 1ELCA 1AB9C 2H9EH 2UWPA 1SPJA 1C5WB 3PYHA 4JYTA 1AKSA 5EW1H 1GHYH 1AVXA 1TABE 1AE5A 3K65B 2VVVA 1Z8JB 2FMJA 2O8UA 2EI7A 1GBCA 1Z6JH 1A46H 2LPRA 3M61U 4Y8XA 1GJ7B 5C1YA 2VVUA 1QY6A 1MZAA 2BYAX 3LPRA 1O34A 4B2BA 2W5EA 2XRCA 4ZKNU 3M7QA 1QNJA 4JYVH 2G81E 2BZ6H 2FX4A 1EQ9A 1DSTA 1P9UA 4AZ2B 1DX5M 4IMQA 3FP7E 1BTXA 4KTUA 2A5AA 1C5RA 4WMDA 4TWWA 5DO4H 5EODA 1CQQA 3SQEE 3ZVAA 5JYIA 1C9PA 3DUXH 5GPIB 3O8DA 2BD5A 4GHQA 1Y3UA 1RIWC 3FFGA 1YC0A 1Y5AT 4UFFH 2CHAB 1XX9A 3LGUA 4BAHB 1GGDC 3GCHC 3GY8A 1TMUH 1EAUA 3F68H 1YGCH 5JPMH 3D49H 2AFQB 1C4V2 4KKDA 1OYTH 5DG6A 1PFXC 2KAIB 1VCWA 3SV6A 1JIMA 2NWNA 4IN2A 2GDEH 3QGNB 1OWHA 1W12U 5L2ZH 4NIYA 2BQWB 4MVNA 1NU7B 2B9LA 4F4OC 1T8NA 5A0BA 1QFKH 4INLA 4ZHAA 2VIQA 5FAHA 1C1NA 1P2OA 3BTME 3KNXA 1F92A 2SGFE 7KMEH 4Y7AA 2VWMA 2CGAA 5K0HA 3FANA 1W7XH 4I8GA 3W94A 1K1JA 4D9RA 4CRGA 3S7HB 3URCA 1E35B 2C8XB 4YLUA 1EPTB 1YYY1 3OYPA 1EZQA 1O2JA 4YT6H 2Z9LA 1GCTB 1MUEB 3M3SA 2CF9H 2H9HA 3URDA 1NROH 4Y76A 4B75A 3M5OA 5GCHG 1DITH 4XDEA 1NESE 2ULLA 2F9NA 4ZKSU 5FPTA 2V0BA 3U8OH 2TPIZ 1LKAA 4H6SB 4VGCC 3MOCA 4KTCA 4ESTE 3F1SB 2Y82A 2ZDVH 1V2QT 2W3IA 3U98H 2JH5D 1P3EA 1O3CA 4AFUA 4FUEA 1O2TA 1TQ7B 4I8KA 3UWJH 2OD3B 3MH4A 1TNJA 2NU1E 3MU4A 1HJ8A 4O3TA 3UIRA 1GDQA 4OS5A 3UOPA 1OP8A 1SLXB 1CA0C 4CHAB 3MO9A 2OUAA 2PR3A 2BDYA 3SV2H 4DURA 1BOQA 4D8NA 1W8BH 3SGAE 3SJ9A 2ODPA 3PROA 2EEKA 2VB0A 3E16B 3MU8A 4YOGA 4YTAA 2SGPE 2RCEA 4E05H 2ZDAH 3O8CA 3VPKA 3A80A 2BD9A 3ZZAA 2ZTZA 3EA9A 3M5MA 4UFEH 4X6NA 2K1QA 4XBBA 1IQKA 2ZA5A 4LK4A 2VGCB 1ARBA 1P12E 3D65E 3KCGH 1W14U 4GCHF 4ABBA 3N7OA 3RXSA 2AEIH 3BTEE 3BG4B 1K22H 1P2MA 1T32A 4TWYA 3GCTG 1SSXA 1A5IA 1V2KT 5E0JA 5B6OA 4WWYA 1FUJA 3DA9B 1D3QB 1RIWB 3RXOA 4U30A 1QA7A 4YO9A 1PQ7A 3S69A 2I6QA 1JXPA 1O3EA 5FCKA 1SHYA 2BD3A 3RC4A 2ZTXA 2J2UA 2GMTB 1U6QA 1BQYA 1FNIA 1NRNH 2CJIA 1PPBH 2G5VA 5TCCA 1IHSH 1NU9A 1C5PA 2ZDLA 4NIVA 2V6NA 1O3KA 2Y5GA 1K21H 1OWKA 5C2ZA 1V2LT 2A7HA 1BBRK 2BDGA 3SJIA 1GVKB 1L2EA 2GD4B 1A61H 2W3KA 1C1OA 3RLYH 2HOBA 4Q7ZA 4K2YA 1P06A 3ATWA 5JBAS 3RXHA 4K69A 2VNTA 3F9GA 2ZECA 2BY7X 1KXEA 5A0CA 1F5RA 1S84A 1DXPA 1TE0A 2GT7A 2ZZUH 4U01A 3RC5A 2WPIS 1V2TT 1QA0A 1HAYB 3GY4A 1H8IH 5F03A 2BLVA 3PLBA 1TPAE 1HAPH 1S0RA 2AH4X 1BCUH 1A4WH 2R3UA 3GY7A 3ZZ6A 4J2YB 4AFQA 2XCNA 2BZAA 4X6OA 2IOTA 3A86A 3KF2A 3GY2A 1K2I1 2ZDKA 3STIA 2Y6TA 3BEIB 3VGCC 5SGAE 4ISNA 4AFSA 1MAYA 5E8EH 1IQFA 1O31A 1B0EA 3UR9A 4Z0KA 1QBNA 1IQNA 1C5YB 3HKJB 4H6TA 1DT2A 1K1MA 1QR3E 5L2YH 1HAOH 1P02A 2C90B 4CRAA 2OTVA 5F8TA 1Z8RA 3A7XA 2ANWA 1A0JA 1UCYE 1CGJE 2TGAA 3ODDA 1VCPA 5LH8A 1AVWA 2OC0A 2ZC9H 1W0ZU 2OP9A 3KGPA 3SV8A 2QYIA 4MNWA 4ZKRU 2D8WA 2FXRA 2J34A 1MTSA 4AFZA 1G36A 3BG4C 2BQ6B 2ZDMA 4JYUH 4TPYA 4E7RG 3ZZ8A 1CBWC 1OYQA 1E37B 3UY9A 1IQLA 3NWUA 1TRYA 3TH4H 2DUCA 2FIRH 4AB8A 1BDAA 3GICB 3ZV8A 3SJOA 3A7TA 1ZPBA 1WUNH 5I25A 1C2IA 2WPMS 1GMDG 3QWCH 2JETC 1HLTH 1AN1E 2GKVE 3CENA 1GJBB 4UDWH 2PHBA 3SU5A 4WJG2 2FPZA 1AD8H 2BY9X 1BRUP 1KIGH 1SFQB 1GJ4H 1BJVA 3PMHB 1PPFE 1SB1H 3S9CA 4VGCB 3M5LA 1TPSA 4BAMB 1ZZZA 1GHVH 1K1OA 3IG6B 2C8YB 3MH6A 3EDXB 3NK8A 2B7DH 2AGIX 2HWLB 2GZ7A 2VIVA 1LVYA 3K9XB 3Q76A 3E0PB 1NFYA 2XBYA 1KLJH 2FESH 3LGIA 1F0SA 5EXMA 5EXLA 6LPRA 1AZZA 3SI4H 1EASA 5GDSH 1UTLM 1ANCA 5EGMA 3KQDA 3ZVDA 1HAVA 2CF8H 5F6MA 1LPGB 3F9EA 2OLGA 1C5VA 3EA8A 3QUMP 4AOQA 1QIXB 2GT8A 1C1VH 1FN6A 1UJ1A 4ASHA 2JKHA 3SGQE 4JZDH 4AORA 4DOQA 1MTNB 1ORFA 1NRPH 3OU0A 1C1QA 1GMCG 3EA7A 1O3HA 3T27A 3SV7A 3UQVA 2Y81A 4X2VA 1Z71A 2Y7ZA 3C27B 5T6GA 3RU4T 1TMBH 3P8NA 1O3FA 3BTWE 1KXAA 2Z6BD 3MTYA 4K1SA 5CE1A 2GV6A 2JH0D 2OCVB 2ZFRH 1QB9A 3SU2A 1VR1H 1GI8B 1GBDA 5DK1A 3NXPA 1SFIA 2I6SA 3MI4A 1GDUA 1A3EH 3B23B 5AFYH 1C5LH 1OPHB 1WSSH 1FXYA 3KL6A 2Y80A 3K6YA 4HFPB 3PO1C 4FUGA 1BTPA 3KQCA 3ZVGA 1FY3A 4FUJA 2NU2E 2VGCC 4AGKA 1G3BA 1AUTC 2VH6A 4TY6A 1H9HE 1PPEE 1ZJKA 1G3DA 1YPHC 1EAWA 4FU9A 2UUYA 1EAIA 1QJ6B 4Q7YA 1P2KA 4FVDA 4JCNA 3VXEH 1F2SE 2STBE 7GCHF 2A2XH 1BTWA 1GJ6A 2SGDE 1XUKA 1S6FA 2HVXA 1AHTH 4OGXA 3A83A 4AGJA 2Q6GA 1BTYA 1EZSC 1T4UH 3RXGA 3VFEA 1GMHF 3RXTA 1GG6C 1IAUA 4X8SH 5HM9A 3UFAA 2XBWA 1EJNA 3A7ZA 1RS0A 4GAWA 3HKIB 1GMDF 1Q2WA 2GP9B 2GZ9A 1ZRKA 5HYOA 1VITG 3A8DA 2FX6A 1HIAB 1DUAA 3VGCB 2ZCLP 1UTPA 1H9IE 1GBBA 4YOJA 5A8XA 1FY8E 1XKBC 2EI8A 1CVWH 3NCLA 4FU7A 2WPHS 1C2HA 1HAVB 3CS0A 4IBLH 2ZPSA 1YPHE 1O2WA 2AMQA 3CP7A 2ZHWH 1WQVH 3WY8A 3Q3KA 1DPOA 3AAVA 3GY3A 1DY9A 1UTJA 1O2YA 3SUDA 3UNSA 3U8RH 5TCAA 1EZUC 4ABFA 4A7IB 3A7YA 3SN8A 2HLCA 3H7TA 1O36A 3PWBA 1GJDB 2OINA 1GI3A 2A45B 4JZFH 4ISLA 4PROA 1T8LA 1TAWA 1QRZA 1DY8A 1IQIA 4GVUA 2BX4A 2ZPRA 1TALA 1O3NA 1O3DA 1YCPK 4CRFA 3UPEA 1O3IA 1BHXF 2TRMA 1A7SA 4A5TS 1MBQA 1RGQA 2BM2A 3QO6A 1WAYB 1ZHPA 3AW1A 4JMYA 3DT0H 3QK1A 1EOLA 1V6DA 2GCTB 1J14A 2JETB 5DPAA 4Y0ZE 5EG4A 4DCDA 1WQSA 1EXFA 3RXPA 2TBSA 1KLIH 2SGEE 1EP5A 4ZROA 3GCNA 3TGIE 2IJOB 1LDTT 4YOIA 1NFWA 3UTUH 1A0LA 2HRVA 2Z9GA 1T31A 1C5TA 1HNEE 1SI5H 1MKXH 1BMMH 6CHAB 1OSSA 1S5SA 3TLOA 1J9CH 1KYNA 5L30H 4ZH8A 3M7TA 1LPKB 8KME2 1F0RA 4CH8B 1MD7A 1A1RA 1Z8GA 1MKXK 3Q00A 1O3MA 3ZVEA 3EQ0H 3U1JB 1AWFH 3I78A 3GOVB 1SL3A 2P95A 1HAXB 2CHAC 1ELFA 1M9UA 3LGTA 1P04A 1KTSB 1EB2A 1O3OA 1SGDE 2TGPZ 1VZQH 2FI4E 3P8GA 2FLRH 1N6YA 2PTNA 3GCHB 5EQQA 7GCHG 1PPGE 2FOGA 2D2DA 3L3TA 4BNRA 1F0TA 2AERH 2EC9H 1G37A 4WXVA 4DIHH 5FX5A 1MCTA 1C5ZB 1TBRH 2THFB 2G55A 3PB1E 4ABAA 1AKSB 5DP8A 4BTIB 2ZDNA 2EA3A 4ABGA 1TGCA 1EJMA 3T26A 4CREA 5EOKA 2ZHQH 4FU8A 1YPMH 3AW0A 2XCFA 4MPUA 1EKBB 5IYTA 2GVFA 1WYKA 3ZZBA 3S9AA 1LVOA 1G3EA 1B0FA 1S6HA 8LPRA 4U2WA 1HXEH 1O2NA 1SMFE 2R0LA 3KQEA 2Q1JA 1J16A 1UTMA 2IPHA 1Z8IB 3LC5A 2FLBH 1FQ3A 1FAXA 1V2ST 2G52A 2SGAA 4UD9H 5AHGH 3TK5A 1Z1IA 3HK6B 4RSPA 3MU5A 1KSNA 1OS8A 3NZIA 1GJ8B 1Y5BT 2P16A 3SNDA 5FBIA 1TMTH 2UUKB 4WF8A 3BF6H 3GYLB 1CBWB 5DP6A 3HPTB 1N8OB 3TJNA 1UHBB 5FHTA 1XXDA 3ZYEA 1O5GH 4JZEH 1AE8H 1P2IA 3ZVBA 4B71A 1CSOE 1BRCE 4DGJA 1FDPA 1BTZA 4ISHH 1G9IE 1EATA 1ACBE 4DY7B 3T29A 2BVRH 1S81A 1GHBF 3RXIA 1D4PB 1ARCA 3BTKE 1ELDE 1O5CB 2G51A 1GI9B 1E38B 1YPEH 1TONA 2AMPA 2GGVB 1DLKB 1GBIA 1D3DB 1XVMA 2WPLS 1XUHA 4CRCA 2XC5A 5FPYA 1HAHH 4D76A 1BT7A 2ANKH 1DSUA 4BAOB 2XWBI 3A82A 2FYRA 1LCYA 1ETTH 1AFQB 1OX1A 1P3CA 3VB3A 1V2NT 4E7NA 3LU9B