3PO1B

Thrombin in complex with benzothiazole guanidine
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
147
structure length
147
Chain Sequence
IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thrombin light chain
publication title Discovery of benzothiazole guanidines as novel inhibitors of thrombin and trypsin IV.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 27
structure length 147
sequence length 147
ec nomenclature ec 3.4.21.5: Thrombin.
pdb deposition date 2010-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3po1B00
6CHAB 4HGCA 5I46H 1C4U2 1OWKA 1GI9B 3MO3A 4ABHA 3TH4H 3ZZBA 4TY7A 2Y81A 1C4Y2 3PO1B 1GCDA 4WMDA 2YNBA 5HXFA 4DIIH 3PMAB 3NCLA 3ZZ5A 1C1OA 1CBWC 1EAXA 3CS0A 2PHBA 1P04A 1C2HA 2H5DA 5DKMA 1O36A 4AFUA 1Y5BT 1MH0A 1ZOMA 3E90B 3TJNA 1ANEA 2BZAA 3LH3A 5DP6A 1SR5C 3GICB 1MCTA 2XBWA 3QUMP 1MTNB 3NWUA 1DWDH 4FU7A 1D9IA 2ODPA 1GBKA 1CVWH 2NWNA 1UTMA 1F0RA 1AI8H 3SV8A 3RXUA 3M5MA 3SZNA 1AZ8A 4AYVB 4BAHB 2W26A 3PV4A 2C3SA 3SV7A 2GX4A 3SQEE 1CO7E 3GCHB 3SV6A 1QBVH 2PW8H 2HLCA 3ATWA 1HV7A 1PPZA 4Q7XA 1O3IA 2XWBI 3VGCC 1NM6A 1EASA 2OC1A 1TABE 5ABWA 3ATIA 3UY9A 2FOAA 4JZFH 1UK3A 5FBEA 2YOLA 1DX5M 2CF9H 1O2PA 2XC5A 3A83A 5GWZA 2QXJA 1EQ9A 1GG6B 2VIDA 3TLOA 5A8XA 1EB1H 3GY5A 1F0SA 1QJ1B 1RS0A 2G4TA 2B5TB 1O5EH 2G4UA 2BY6X 3ZZ8A 1TFXA 1BUIA 2AYWA 1QBOA 3FP6E 3ESTA 3LONA 1Y3YA 2F9OA 1HAVA 4ABJA 1YPGH 2BDIA 3SUGA 1C1RA 4LXBH 4ZROA 2BLOA 2QAAA 4ISHH 3E0PB 4ZKOU 1O5FH 3MU8A 1BQYA 1LVBA 1MBQA 3F1SB 1LDTT 1O2UA 1A46H 1VZQH 1HPGA 1BA8B 1U6QA 2WUBA 4X2VA 2I6QA 1F5RA 3SJ9A 1C1VH 1OSSA 3AVZA 3NPSA 2DE9A 3HK3B 3MH7A 5TJXA 4X6OA 1GL0E 4NZQA 3ZVAA 1AQ7A 1BBRH 3SQHE 3BTQE 3RU4T 2VWLA 1BRUP 3PB1E 5LPFA 3A82A 2G81E 1T8NA 3K9XB 1O3HA 3RLWH 4AX9H 1Y3UA 1BJUA 3EGKH 1HAVB 3DT0H 1CA8B 1P09A 2PLXA 1AE5A 3UNQA 2HALA 1MMJN 4XOJA 1M9UA 4O9VA 3KEEA 5GCHG 3BSQA 2BY7X 2VIWA 1PJPA 3RDZA 1Z6EA 4D9RA 3HK6B 1RTLA 3ZYEA 5FXLA 3RXHA 1P2KA 4MNWA 1V2KT 1FXYA 1EPTA 3M61U 1EZSC 4Y6DA 4AFQA 1SLXB 4BTTB 1VCQA 1QR3E 1O2VA 1TGTA 3UNRA 4ASHA 2FDAA 1EX3A 2THFB 2A4RA 1GGDB 2I6SA 3OY6U 1GJ9B 3ZZ9A 1G30B 1P2IA 4ZXXH 1GBIA 2FTLE 5GCHF 4I8JA 1LPKB 1TNIA 5A0CA 4FU8A 1J9CH 3M35A 5A09A 2QV1A 3A8DA 2UUYA 3MOCA 2ZQ2A 4XBDA 1ZSJA 1QJ7B 2PKAA 4OS1A 5BRRE 3K2UA 1QB9A 4INLA 3QGJA 2XW9A 4X2YA 1QRZA 2JH0D 3GDSA 1HAGE 1S84A 1C5XB 2P3TB 1EPTB 5L6NH 4Y0ZE 3UOPA 4Y71A 4YOJA 1O2IA 1KXDA 2XBVA 1FLEE 4Y8XA 1L4ZA 1JRTA 2AMQA 2FOFA 3HATH 1P2OA 2Z94A 1GBLA 2A45B 5DP4A 2P8OC 1PFXC 3ZZ6A 1C5QA 5AF9H 3ZZCA 2ZTXA 3ZZAA 1LKAA 2OC0A 4YO9A 2ZEBA 1LHEH 1TONA 3BTGE 4OS5A 1THSH 3PM3A 3SORA 5JBAS 2P59A 7ESTE 7KMEH 1SGYE 3E6PH 1N8OC 2ZGJA 3EE0B 5GPIB 5LPEA 5JPMH 2FO9A 1XVMA 1FQ3A 1ETSH 1HDTH 3P8NA 1C2JA 3AAUA 3S7KB 1S6FA 1LCYA 4IGDA 2J9NA 1W2KH 3SU5A 2K1QA 4NSVA 3M3VA 2GMTC 1OKXA 4ZHMU 3SJOA 2F9UA 4X6PA 1EOLA 3Q77A 1VR1H 5AHGH 5E0JA 2FI3E 2OINA 1G37A 4CREA 5DJ7A 1W0ZU 1Z6JH 3F68H 4PROA 3ZVFA 4YM9A 2ZHEH 4B71A 3RXFA 5C67A 1MKWH 2PR3A 4X1SU 3W94A 1YGCH 4VGCB 4UD9H 3A80A 2D8WA 1PYTC 2R2WU 3DA9B 1DY8A 4CR9A 7GCHG 1ACBE 2VWNA 3SV9A 1J14A 1PPFE 3OSYA 1G3DA 3GY7A 2C4FH 3P17H 1H9LB 1DY9A 1BMAA 4O3TA 3IWMA 1EJNA 3M37A 1T8MA 2GD4B 5ESTE 3RUOA 1EUFA 1ZZZA 4CHAB 1CQQA 4X1QU 1FN8A 1MTUA 1TMTH 1C2MA 1C1UH 4U30A 1QURH 2FOGA 3RC6A 1O3OA 4BNRA 3GCTG 1UTKA 4KTCA 4DGJA 1QHRB 2VVVA 5C1UA 1V2PT 2OC7A 1O2TA 1OWHA 7GCHF 1AWHB 1NU9A 4MPUA 1T7CA 5T3HA 2ZKSA 4ZKRU 1YYY1 2V35A 4NG9H 4K60A 3SHAH 1THPB 4MPWA 1C5YB 5E0GA 1G9IE 1P03A 1GHYH 2FIRH 4MLFB 4Y79A 3GY2A 3UUZA 5A8YA 1ARBA 2O8UA 1VGCB 1GBTA 2FOCA 4J1YA 1FY1A 3GCTF 4MPVA 1Y5UT 1E36B 1QL7A 1DDJA 1ZYOA 4B1TA 5JBTA 1MKXH 1BZXE 3RXIA 1UCYE 4SGBE 1FIZA 1C5PA 1O3MA 3ENSB 3Q76A 3SGAE 1KYNA 1ELFA 3SBKA 3P6ZB 3A8BA 3UR6A 4TPYA 1TX6A 1UJ1A 4KTSA 2WPHS 5F03A 1B0FA 2C90B 2HVXA 1SI5H 1SGFA 1IQMA 3P8OA 4Y11E 1FNIA 3JZ2B 4AOQA 3RU4E 2PSYA 4ZUHA 4Z0KA 2AFQB 2ZGHA 4H6SB 1QL9A 2FOBA 2LPRA 1CGJE 1LO6A 3SNEA 2A2XH 2DE8A 1S0RA 2ZIQH 1BTYA 4Y7BA 2FP7B 1DSTA 1MTNC 5C3NA 5DP5A 2ZFRH 1WQVH 1TX8A 4F4OC 4GHQA 4A1VA 1OP0A 1EXFA 1WTGH 2V3HH 1KXBA 2A7CA 1K22H 1PQ5A 1GDNA 3UREA 3GCHC 1SVPA 1BBRK 1W3CA 1HFDA 3A86A 3RXJA 2Q1JA 3EDXB 1C9PA 2P3UB 1SQOA 1K1OA 3QWCH 4Y8YA 1BB0B 1W13U 2HNTE 2ZQ1A 2W3KA 2DUCA 3P8FA 3TVJB 3LJOA 3MI4A 1O2LA 1DLKB 4K69A 4UEHH 3S7HB 1EKBB 2TRMA 3CENA 2EI7A 2H5CA 1AMHA 1C1PA 2QCYA 1ZRBA 3RXVA 3V0XA 2O8WA 1IQEA 3QGNB 1OYTH 1V2RT 1MZAA 2J95A 4OGYA 3GISB 2BQ6B 3U9AH 1LHFH 4MDSA 2H9TH 1BHXF 1XXDA 1GHXH 1A3EH 2AGGX 2ZO3H 2Y5GA 1HJAB 1HNEE 4X8SH 2QGRA 4GCHG 2A0QB 3LGYA 1C5OH 2QXGA 1MQ5A 1O3AA 2ZPRA 3D62A 1CA0B 1P2NA 2Y5HA 2G51A 4IN2A 1P3CA 1T4UH 1O2NA 1YP9A 1EB2A 1D4PB 2WPKS 1O3PB 1LPZB 2C8WB 2XBYA 3LGTA 4KELA 1KXFA 3U69H 2BB4A 4K8YA 2V0BA 5AFZH 1Y8TA 1GJ8B 2BX4A 2WPJS 4GCHF 1Y3XA 1BITA 1FPHH 3V3MA 1WBGB 4AORA 2TIOA 1NU7B 3IITA 1V2NT 1GDQA 1Q31A 1IAUA 3I77A 1UVOA 9LPRA 4FUJA 4K3JA 4IBLH 5SGAE 1C2KA 1TA6A 1O2RA 1ELEE 5J4QA 1D3PB 2ZI2H 2OUAA 1GI4A 2ZU4A 1TNHA 3H7TA 1O35A 4ZHAA 1NZQH 4XDEA 3BG4B 1MTSA 1EAUA 4B74A 1UVPA 1J8AA 3SHCH 1UTLM 1SGTA 4GUXA 3TITA 3T62A 1WUNH 3LGVA 2ALVA 3RP2A 4K8BA 3ZVDA 3B9FH 1JMOH 3A7VA 4GPGA 1Q3XA 1PPGE 2TGTA 4GLYA 1W0YH 1TRNA 1VITH 4E7NA 1LTOA 4O03A 2Z3EA 2GZ9A 2BLWA 3ZZ7A 1TQ0B 3TNSA 3VPKA 4UFEH 3GY6A 2VIOA 5I25A 2OC8A 1TALA 1G2MA 3TK9A 4I32A 2Z6BD 4ZH8A 1PPEE 1SGRE 1ZJKA 1C2GA 3SNDA 3Q3KA 4UFGH 3BG8A 1EJMA 1INCA 4CH8B 1AU8A 4UONA 4Z6AH 3S9AA 4DURA 3LIWA 1TMBH 4K1EA 1C1QA 4DJZB 2BQ7B 5G4BA 2GV6A 1K9OE 2BVRH 1XUJA 1O2HA 3MYWA 2PTNA 3LU9B 3AAVA 1S6HA 3LOXA 2FLBH 1VITG 3PLPA 3UWJH 1K1MA 1V6DA 2BX3A 3ITIA 1E0FD 1H1BA 2STBE 3A85A 1K28D 2H6MA 2JETC 2VGCB 1ZHRA 2Z9KA 1O3EA 1FI8A 4MTBA 1CGHA 1YPJH 2RDLA 3LGUA 1NC6A 1TOCB 4FUDA 4I33A 5B6OA 3KN2A 1ZSKA 1ZTLA 2RCEA 5L2YH 2VIPA 5GJ4B 1C1WH 1ELAA 1A0JA 2BDBA 3F6UH 2ANYA 1IOEA 1GBBA 2CMYA 3SV2H 1VITF 2WPLS 2WV5A 1ANBA 4K2YA 2UWPA 1WV7H 3DUXH 1F5LA 2F91A 2SGQE 4NIXA 3L3TA 1YBWA 3BTDE 2ESTE 5DPAA 2QC2A 5CHAB 1H9IE 2BD9A 1QL8A 4NIWA 3PLBA 2ZZUH 4JZ1A 3URCA 5A2MH 3DFJA 1DANH 1IQNA 3KHVA 2WYGA 1HBTH 2F9VA 8ESTE 1MKXK 2BDYA 1TGBA 4XBCA 3RXPA 2B7DH 2ASUB 1SMFE 2O8MA 2Z9GA 4Q2KA 5FCKA 2ZFSA 2QYIA 2G00A 2SGFE 3FZDA 1TGSZ 2VVUA 3Q3YA 3RMNH 4CRAA 5C5NA 3O8BA 2R0KA 3E16B 1A5IA 3QTVH 3VXEH 3MO6A 2BXTH 4NSYA 1GJAB 1O30A 5BPEA 1QFKH 1W14U 2WINI 1GI5A 4FVBA 1V2VT 4IW4E 3Q3XA 1BT7A 2Y7XA 2XBXA 4JYVH 1GJDB 2ILNA 3Q00A 5EPNA 3G01A 1CE5A 1HXEH 2ZF0H 1T8LA 2QY0B 4XE4A 3ZVGA 3M7TA 5DK1A 2HOBA 5A8ZA 2Y6TA 1GBFA 1X7AC 1Y5AT 2PGBB 5LPRA 1SGQE 1XUGA 3BV9B 1SLUB 3SU2A 3LDXH 1MUEB 1Q2WA 1L1NA 1SOTA 2GP9B 3KQCA 1VJAU 1WYKA 3PMHB 3LT3A 4GSOA 2C93B 5JB8S 4YOGA 1KLTA 3SU6A 1RRKA 3ZV9A 1TBRH 5EW2H 1ESAA 1J15A 1AFQC 5EW1H 4JMYA 2HRVA 2CHAC 2FXRA 1CT2E 3STIA 3LC5A 1NS3A 1P2QA 4JK5A 3M5LA 3AW1A 1ELVA 2A31A 1V2MT 3SGQE 3KIDU 2LNCA 2BHGA 1P10A 2HGTH 2Z9LA 2BY8X 1TIOA 4K1SA 2FI5E 4AB8A 2WUCA 4GAWA 3RMLH 4Q7YA 4WH8A 1LVOA 1UK4A 2NU2E 1XM1A 1TBZH 1ELCA 2GDEH 4B75A 5IYTA 1SOZA 2ZDAH 1TGNA 3UTUH 2GT8A 2SGEE 5K7RA 4H6TA 1O3GA 1BMLA 1A5GH 1WQSA 1Z7KA 4FUBA 2F3CE 3RXAA 3SU0A 1GCTB 1MU6B 3S9BA 1V2LT 1JXPA 1Z8GA 4JZIA 1EZXC 2VIVA 2BOKA 4YESB 4AG1A 1TA2A 2R2MB 2G5VA 4WJG2 1LHCH 4RN6A 1UVUH 5EXMA 3HKJB 4K1TA 3BTTE 3RXQA 1D3QB 1HAYB 3ZZ3A 1GBHA 4FUGA 1YF4A 3LH1A 1TNGA 3F9EA 1ZPBA 4ZXYH 1MZDA 1L1GA 4IMZA 2PV9B 3VB3A 1T4VH 3O8CA 1KSNA 2FOMB 3MU5A 3U1JB 4WH6A 4SGAE 1TMUH 1KXAA 1RIWB 2B8OH 1AN1E 1G2LA 1O2MA 2P16A 2UUJB 3K6ZA 4I8GA 1GVZA 1IQIA 2EA3A 4BANB 2GGVB 1S82A 1WTHD 5CMXH 2ODQA 1DPOA 3GCOA 4NGAH 3TH3H 5CE1A 5DGJA 2BVSH 2PKAB 5E2OA 3ATMA 3EYDA 1DFPA 1NRQH 4NIYA 3E0NB 3LKWA 5EQRA 3N7OA 4A5TS 4A7IB 5JBBS 1C2EA 1TAWA 4KP0A 4B2AA 1SSXA 2ZDNA 1LQEA 3STJA 1O3KA 1TNLA 1NY22 2ZU2A 1VCWA 5E8EH 4CRCA 2TGDA 5GXPA 3TGIE 3S69A 1KTSB 1UO6A 1DICA 4NZLA 4XSKU 1DXPA 1W12U 1C5RA 2JKHA 5EXLA 1FN6A 2TPIZ 4OGXA 2VIQA 1QA0A 1GJBB 1E35B 2GZ8A 1S85A 2NU0E 1DVAH 4RKOB 4AB9A 5E2PA 1QY6A 1JOUB 1QQUA 1B0EA 6GCHG 1SGDE 1ZTJA 1CHOG 1O34A 3ODDA 1J17T 2BD3A 4OS7A 1AVGH 2OBQA 1LPGB 4F49A 1GI8B 4AFZA 4MPXA 4HTCH 1GBCA 3OY5U 4I31A 4TYDA 4KTUA 1FJSA 1AY6H 2EC9H 2XWAA 1ETTH 3MH4A 3S9CA 2BY9X 1BJVA 1IHSH 4YT7H 1O32A 3KCGH 1ZR0A 2PKSC 4X8TH 1UCYH 5PTPA 1MQ6A 2BD7A 2A5KA 1TLDA 2ULLA 6GCHF 1CHOF 3VGCB 1OYQA 1C4V2 1TWXB 2P94A 1NROH 1GVKB 1AFEH 3MNCA 1MTWA 1EOJA 2TGPZ 4ABGA 2ANMH 3T27A 1GJ4H 1KLIH 2PUXB 2J92A 4ZKNU 1GJ6A 1C2DA 1RFNA 5LH8A 1CGIE 4QT8C 2ZHWH 2ZWLH 1ZSLA 1NFYA 2BD2A 3T26A 2FOHA 1MAXA 2IOTA 3TPIZ 2BXUH 4DVAU 5FBIA 4BAKB 1ABIH 4AYYB 3RXTA 1JBUH 1P0SH 1DS2E 2FM2A 2SGPE 3SGBE 2W5EA 1Z8JB 1DWEH 3NK8A 4X1NU 1PPHE 5FPYA 1TYNA 4XBBA 3EAJA 6CHAC 3QZQA 2XC4A 4IC6A 2A7HA 2BD4A 1QIXB 1GJ7B 1SHYA 1V2TT 4E7RG 3PO1C 1FUJA 1BTXA 1O33A 3GY3A 1GVLA 2OCVB 4BTUB 3SUDA 1A2CH 2P93A 2CV3A 5GDSH 2AMPA 3KQDA 1IHTH 2ZFFH 1QCPA 1RGQA 3L6PA 1LMWB 1JIRA 1GWAA 7LPRA 1C5ZB 3MU1A 4HFPB 1A7SA 2V3OH 5FPSA 4CRFA 2FMJA 4X8UH 1NTPA 3TGJE 1AVXA 1QJ6B 1TPPA 2D2DA 1QRXA 1SG8B 2J34A 1Z8RA 3QDZB 1P12E 3ATKA 3UOUA 3C27B 4IS5A 1NO9H 2FEQH 1GMHG 1SFQB 2AMDA 3KF2A 3PMJA 1CT4E 1AUTC 1YCPH 4JYTA 3RMMH 3U8OH 4X8VH 1SGCA 1O5AB 1H4WA 4FVDA 4BAQB 2ZPSA 4GHTA 2O8TA 1AZZA 4WMEA 1C1NA 2FODA 1Y3VA 2UUFB 1RTKA 4DCDA 1MD8A 1ZPCA 5JBCS 2QXHA 3U8TH 1UTOA 2BYAX 1BRCE 4XFQA 3VB6A 4X2WA 5C20A 1GMHF 3ELAH 3MMGA 3A8CA 1Y59T 3ATLA 1FAXA 2F9BH 3RC5A 2FS9A 4X0WU 2PWXA 3LGIA 1H9HE 1GG6C 1G3CA 3OX7U 3URDA 4CRDA 3OTJE 3KQBA 4DT7B 1TQ7B 4NA9H 4A6LA 3ZV8A 2WYJA 1O2OA 5DP3A 2RG3A 3L33A 5LGOA 1GHWH 4NIVA 3BF6H 2AERH 2ZFPH 4KGAA 2AS9A 3ZVEA 4TPIZ 2HNTF 1DXWA 5FCRA 2R3YA 2A4QA 4O3UA 5ETXA 4ABIA 3B23B 2ZHQH 4Y7AA 4A92A 1C1MA 1O2SA 3QTOH 3BTHE 1YPKH 5JYIA 1F0TA 1SL3A 1BMNH 2BDAA 3SOSA 1HGTH 2P8OB 1K1NA 4FUEA 1SC8U 4MVNA 1BCUH 3ZVBA 4CBNA 1GMCG 1C5TA 1G3BA 2BVXH 1ESTA 1YPHE 3T2NA 1P05A 2G8TA 1O3BA 1AO5A 1XKAC 2UWLA 1N8OB 4FUHA 3A7WA 3E3TA 2QN5T 1PPBH 2H1UA 2F9NA 1IQFA 4ABDA 1CSOE 1T32A 1PQ7A 3RXEA 5L30H 1DITH 3BTEE 2FZZA 5F8ZA 1O3NA 2PFEA 1NT1A 3SJIA 1EAWA 2A2QH 4YT6H 1KTTB 1GMCF 1TE0A 1D6WA 1ZHMA 3DHKH 1W11U 2EEKA 3WY8A 2Z9IA 2GMTB 3SUEA 2WPIS 5A0BA 1EAIA 4YLUA 3RXOA 4THNH 5EXNA 3RMOH 4A1TA 1ID5H 3KL6A 3ZVCA 1XUIA 2UUKB 3HGNA 1ZRKA 6ESTA 1GHVH 2BTCE 2JH6D 5EOKA 1GGDC 3A7TA 4TWYA 3BEIB 3QZRA 5FAHA 1O5GH 1JRSA 1TNJA 1SFIA 2HNTC 4NFFA 4Y8ZA 2XC0A 2J38A 1QB1A 1AE8H 2ODYB 3MNBA 1HYLA 3EQ0H 1V2WT 4ISIH 1ZJDA 2XCNA 3KGPA 5F8TA 1TRMA 2R3UA 2W7SA 1F0UA 1OWIA 1THRH 4H42U 3E8LA 3LJJA 1O2XA 2HPPH 5DP9A 2R0LA 3RC4A 2OQUA 3HPTB 2VB0A 1SGPE 1FONA 2XTTB 4MNYA 1GDUA 3TK6A 1N1LA 1EPTC 1OOKB 2OLGA 4BOHA 3FZZA 1W8BH 2CGAA 2Z7FE 1W7GH 1DUAA 3D65E 1HJ8A 1MKWK 1GBEA 5L2ZH 1ZPZA 4MG3A 1YKTA 3RLYH 1RIWC 4IC5A 5E0HA 4Y10E 2A32A 2ZDVH 3TJOA 3PLKA 1O5CB 1TX7A 2WPMS 1HB0B 3U1IB 4JZDH 2G5NA 2J94A 3SJKA 2A4GA 1O5BB 2FYQA 3TH2H 2ANWA 3P95A 1YPMH 3NUMA 1YPEH 2P3FH 1O3FA 2AH4X 3RXRA 2OBOA 3M36A 1C2LA 1A0LA 1CT0E 1MD7A 1UCYK 1DM4B 1ABJH 1TNKA 4Q80A 1O3CA 5C5OA 1WAYB 2AEIH 2ZP0H 1P8VC 1FPCH 1QQ4A 1TB6H 1TPAE 5K0HA 1BIOA 2ANKH 1C5LH 3M3SA 1Z8IB 3GY8A 2EI6A 1XXFA 1K1PA 2GCTB 4RKJB 4CBOA 1ELDE 2FS8A 4HZHA 4I7YH 1AUJA 1OS8A 4YOIA 4WMFA 5FPTA 1KXEA 3A7ZA 1C2IA 4YTAA 1GI2A 3MWIU 3UR9A 4Y0YE 4YLQH 1C1SA 3S0NA 3M5NA 2D26C 1O0DH 3BTFE 4WXIA 1QRWA 5TCAA 1Z1IA 3RM0H 1AKSA 3SI4H 2QF0A 4I8HA 3VB4A 3TGKE 1MAYA 4VGCC 2J4IA 1XVOA 1DE7H 2SNWA 4WF8A 3K65B 1JIMA 4MQAA 1ZTKA 2VU8E 1SQTA 3K6YA 1C2FA 2CF8H 2A1DB 1ELBA 3MTYA 1HRTH 2PGQB 1K1LA 4OS6A 2CJIA 1C5UA 1NESE 4JCNA 4U32A 1S0QA 1P02A 2RA0A 4DOQA 1SGFG 2BMGB 2ZCHP 1UTNA 3E1XB 1OPHB 2BQWB 1GI6A 2AGEX 4CRBA 2BLVA 4CHAC 2FX4A 3OU0A 3PWCA 3HGPA 1LKBA 3M3TA 2GTBA 1ETRH 1FIWA 1HIAA 3MO9A 3TJUA 3VB7A 5FX5A 3TIUA 4D7FA 2ZGCA 1AKSB 2NU3E 2BM2A 2EI8A 1YCPK 1MBMA 3V12A 2XRCA 2FYRA 1C5SA 2VH0A 4JZEH 4BAOB 2Y82A 5H4IB 1AB9B 1GI7B 2XCFA 3D49H 3ZYDA 3UQVA 4UDWH 1O2QA 2UWOA 1VCPA 1HAHH 1GBMA 4J2YB 1T31A 1VGCC 2OTVA 3RXLA 1B7XB 2VVCA 5ESBA 1P11E 3GDVA 3IG6B 5EQSA 1HIAB 5AFYH 4R0IA 5HMAA 1ANDA 1O3LA 2V6NA 1SPJA 3TK5A 1E37B 2ZHDA 1KIGH 1SGIB 2YNAA 5AVDA 1QA7A 3A7YA 3BIUH 1GI0A 4TY6A 2SGAA 1ZGIA 4R8TB 1PQAA 3F9FA 2O8LA 3SI3H 1K21H 2A7JA 2TGAA 3V7TA 1RD3B 1EP5A 5EPYA 1UHBA 3I29A 4B73A 5EGMA 3MH6A 2Z3DA 4AGJA 4DW2U 1LQDB 2R9PA 1P57B 2C8YB 3MNXA 2GV7A 4JK6A 2A5IA 4K5ZA 3UFAA 4OS4A 4INHA 1N6XA 1MCVA 2AIPA 4ZAEA 1AWFH 1OP8A 1HAIH 1RJXB 2HWLB 3EA7A 4IMQA 3TJVA 2ZECA 2VH6A 4B2CA 5GIBA 3PROA 1D6RA 1Z71A 1V3XA 1H8IH 3RXDA 3SNCA 2GT7A 2TBSA 3RXCA 1E38B 3VB5A 1SGNE 4X1RU 4CH2B 3U98H 1BHXB 1PQ8A 1GI3A 1S5SA 1TPSA 2GVFA 1UTPA 4D76A 5IDKA 1ZLRA 1BBRE 1UHBB 1AD8H 1FY3A 2IJOB 3PWBA 2QA9E 1NRNH 2FI4E 5C1YA 3RM2H 1F7ZA 3A88A 3BN9A 1PYTD 1XX9A 3DD2H 4U2WA 5FX6A 2VWOA 1HJ9A 1WU1A 1TBQH 3BIVH 5JB9S 1HJAC 4DIHH 3UQOA 2ZTZA 1ZHPA 3A8AA 2ZDMA 4NWLA 1FMGA 1GHAG 3KNXA 1FY5A 3BTWE 1ELTA 1O2WA 4UFFH 2G52A 3MU4A 4D9QA 1SHHB 2VNTA 4OS2A 1NRSH 1BOQA 1LVMA 1T8OA 3FP8E 1O31A 1CA0C 1IQGA 1VJ9U 2BDGA 4B76A 2WV4A 2ZFTA 3BEUA 4FXGH 4D8NA 3EA9A 3UIRA 1P3EA 2ZU3A 1N6YA 3V13A 1C9TA 1MTVA 3AW0A 2G55A 3H7OA 1KDQA 1O2YA 2GKVE 4MNVA 3SU1A 1S83A 1EZQA 1GHAF 1DSUA 1UMAH 2A4OA 5T6FA 1C5WB 2VWMA 8GCHG 4H4FA 1GMDG 3VEQB 1A61H 1AVWA 2JETB 1MU8B 2ZNKH 2F9PA 3B8JA 1HXFH 4AG2A 6LPRA 1CBWB 1NRPH 1L2EA 1BTZA 1QTFA 4ABBA 4X6MA 3FP7E 1PPCE 3GCNA 2PTCE 3QN7A 3PTBA 3A81A 1D3DB 3UNSA 1NFWA 3A84A 4DY7B 1O38A 1P9SA 2XXLA 3QX5H 4IN1A 1FZZA 2CN0H 2IPHA 2ZCLP 4AGKA 1O3JA 2ZHFH 1KDQB 1GI1A 3P92A 3BG4C 1BRBE 3RXMA 1GMDF 8GCHF 4MNXA 4LOYH 1ZMNA 1NRRH 3P70B 2AIQA 1BTUA 1K1IA 1QBNA 2F83A 2RA3A 3GYMA 3ZZ4A 4M7GA 2QIQA 5C2ZA 3PYHA 3RXBA 1O37A 1C5MD 1F2SE 1V2UT 4UFDH 3A89A 2Q6GA 1V2JT 2BD8A 3QLPH 2B9LA 1BRAA 1EZUC 5EU8A 1XKBC 9ESTA 1JWTA 2JH5D 1IQJA 1W10U 2Z3CA 1EP6A 1DUEA 4ISLA 4B2BA 2J2UA 2XYAA 4FUIA 3QK1A 1LVYA 1HAPH 2OD3B 5T6GA 3SN8A 1L4DA 1IQLA 3FFGA 2D1JA 1O3DA 1P2MA 3U8RH 2ZPQA 3A87A 5HGGA 3PMBB 1UTQA 5FHTA 1BTWA 1HAOH 2GDDA 5A0AE 2H2ZA 2FPZA 2P95A 3GDUA 4I8LA 1O2JA 2ZGBH 1KXCA 2O9QA 2PSXA 2ZA5A 3LC3A 5HM9A 2SFAA 2VGCC 3VFEA 2ZGXH 1O2KA 2STAE 1G3EA 1SLWB 2ZTYA 1RTFB 2ZFQH 2H9EH 3DFLA 1E34B 4U01A 3GY4A 3ODFA 1EJAA 1SBWA 5T6DA 3HKIB 2ZCKP 3RXGA 4CRGA 1O2ZA 4CR5A 3RXSA 1UVTH 1A3BH 1IQHA 3NZIA 5EODA 1TGCA 1AFQB 2BDHA 2GCTC 1Z1JA 4O97A 2CHAB 4WY3A 3T5FH 1AHTH 1HAXB 3MH5A 1A0HB 2OP9A 2FESH 3SNAA 2A5AA 1GBAA 1QB6A 1UK2A 3GYLB 1FV9A 1O39A 3FVFB 5CHAC 1YCPM 1A4WH 1QNJA 1V2OT 1WOFA 4ISNA 4AZ2B 1RXPA 1GJCB 3MFJA 1DWCH 4DG4A 1J16A 5F6MA 1FY4A 2Z9JA 3T29A 5JDUB 1YLDA 5DO4H 1P01A 1CU1A 1NFUA 1ESBA 3RU4D 3CS7A 2BZ6H 2OXSA 3E91A 2VJ1A 4JYUH 2AGIX 1ZMLA 3KQEA 4AFSA 4UE7H 1G36A 1S81A 1HAZB 4X1PU 1ZGVA 1NFXA 4FUCA 5C1XA 4ABFA 2M5TA 3A7XA 1O2GH 1O5DH 1L1JA 1BMMH 4ISOA 1DWBH 2GCHG 2CXVA 4BTIB 2W7UA 4LK4A 4ABAA 3M5OA 1EATA 1FAKH 2XNIA 1CHGA 3P8GA 1OWEA 2Y5FA 1G32B 4YZUA 5TCCA 4ESTE 1A1RA 1ARCA 4NCYA 1C1TA 1W7XH 4LZ4B 1B5GH 2H9HA 1GL1A 4A1XA 1L0ZA 1K1JA 4AN7A 1XUKA 5EQQA 1OP2A 1GHZA 3JZ1B 1F5KU 4INKA 1AB9C 4ZHLU 4NWKA 2C8ZB 2FX6A 3UWIA 4KKDA 4NA7A 1TPOA 1OXGA 3UPEA 2GCHF 2ZG0H 3SU3A 4BXSA 1DOJA 2QF3A 1Y3WA 3F9HA 1V2ST 1WSSH 3MHWU 2FLRH 2PUQH 1OX1A 3T25A 5DP8A 1H8DH 2OQ5A 1XUFA 1YLCA 2BD5A 2ZC9H 3D23A 3R0FA 4HI3A 5HYOA 1BTPA 2ZU5A 4NA8A 2NU1E 1DLEA 3SW2B 2FTMA 1GHBG 3OYPA 5F8XA 2QXIA 2BY5X 3EA8A 4RSPA 3NXPA 3GOVB 2SGDE 3PTNA 4WXVA 3ZZDA 3O8DA 4FUFA 2Y7ZA 4X6NA 1LHGH 1QGFA 4BXWA 1C5NH 3M7UA 2KAIA 3SJ8A 1ORFA 1NPMA 1P2JA 1SQAA 3QO6A 1OWJA 3MNSA 1ANCA 2HPQH 3BEFB 3M7QA 2Q6FA 1LHDH 1F92A 1GPZA 1ELGA 1HLTH 1P9UA 3NKKA 4Y76A 1BTHH 1ZMJA 4TWWA 1TOMH 3LGWA 1UTJA 1A5HA 1FY8E 1TRYA 8KME2 2Q6DA 2ZU1A 1V2QT 4NFEA 1GHBF 3SO3A 4E05H 3T28A 2BLQA 4X2XA 1YC0A 3H5CB 5DG6A 3FANA 2ZDLA 5HM2A 1GBJA 4ABEA 2BOHB 2VINA 1GCTC 3C1KA 3FAOA 3BTKE 1HCGA 4FU9A 3SNBA 1YPLH 1C5VA 1KLJH 2KAIB 2FWWA 4I8KA 1FDPA 5J4SA 1P06A 4WWYA 2Y80A 4Q7ZA 3VXFH 3R3GB 2BDCA 1NN6A 1GBDA 1UVSH 2NU4E 3O8RA 2PKSB 2SNVA 3TU7H 4WVPE 3MU0A 4BAMB 5EG4A 1SGEE 1D3TB 1KY9A 2B0FA 2W3IA 3SU4A 1OWDA 2ALPA 3RXKA 4LZ1H 2IN2A 3BTME 2GZ7A 3LPRA 2FOEA 3F9GA 4GVUA 5DP7A 1YM0A 1GJ5H 1WCZA 3W95A 8LPRA 1SB1H 1AGJA 2C8XB 4D7GA 1SLVB 1DT2A 3SUFA 1XMNB 1XUHA 2ZDKA 4E06H 1BDAA 3TNTA 1YPHC 1IQKA 1AIXH 4ZMAH 3I78A 1HUTH 3AASA 4ZKSU 1K2I1 3CP7A
chains in the Genus database with same CATH superfamily
6CHAB 4HGCA 5I46H 1C4U2 1OWKA 1GI9B 3MO3A 4ABHA 3TH4H 3ZZBA 4TY7A 2Y81A 1C4Y2 3PO1B 1GCDA 4WMDA 2YNBA 5HXFA 4DIIH 1YLNA 3PMAB 3NCLA 3ZZ5A 1C1OA 1CBWC 1EAXA 3CS0A 2PHBA 1P04A 1C2HA 2H5DA 5DKMA 1O36A 4AFUA 1Y5BT 1MH0A 1ZOMA 2F4LA 3E90B 3TJNA 1ANEA 2BZAA 3LH3A 5DP6A 1SR5C 3GICB 1MCTA 2RDEA 5EJZA 2XBWA 3QUMP 1MTNB 3NWUA 1DWDH 4FU7A 1D9IA 2ODPA 1GBKA 1CVWH 2NWNA 1UTMA 1F0RA 4XRNA 1AI8H 3SV8A 3RXUA 3M5MA 3SZNA 1AZ8A 4AYVB 4BAHB 2W26A 3PV4A 2C3SA 3SV7A 2GX4A 3SQEE 1CO7E 3GCHB 5EJLA 4YXWD 3SV6A 1QBVH 2PW8H 2HLCA 2XOKD 3ATWA 1HV7A 1PPZA 1QZ8A 4Q7XA 1O3IA 2XWBI 3VGCC 1NM6A 1EASA 2OC1A 1TABE 5ABWA 3ATIA 3UY9A 2FOAA 4JZFH 1UK3A 5FBEA 2YOLA 1DX5M 2CF9H 1O2PA 2XC5A 3A83A 5GWZA 2QXJA 1EQ9A 1GG6B 2VIDA 3TLOA 5A8XA 1EB1H 3GY5A 1F0SA 1QJ1B 1RS0A 2G4TA 2B5TB 1O5EH 2G4UA 2BY6X 3ZZ8A 1TFXA 1BUIA 2AYWA 1QBOA 3FP6E 5C0TA 3CNRA 3ESTA 3LONA 1Y3YA 2F9OA 1HAVA 4ABJA 1YPGH 2BDIA 3SUGA 1C1RA 2IPQX 4LXBH 4ZROA 2BLOA 3KYGA 2QAAA 4ISHH 3E0PB 2KCAA 4ZKOU 1O5FH 3MU8A 1BQYA 1LVBA 1MBQA 3F1SB 1LDTT 5EIYA 1O2UA 1A46H 1VZQH 1HPGA 1BA8B 1U6QA 2WUBA 4X2VA 2I6QA 1F5RA 3SJ9A 1C1VH 3OE7D 1OSSA 3AVZA 3NPSA 3ZIAD 2DE9A 3HK3B 3MH7A 5TJXA 2WV9A 4X6OA 1GL0E 4NZQA 3ZVAA 1AQ7A 1BBRH 3SQHE 3BTQE 3RU4T 2VWLA 1BRUP 3PB1E 5LPFA 3A82A 3KQ5A 2G81E 1T8NA 3K9XB 1O3HA 3RLWH 4AX9H 3KYFA 1Y3UA 1BJUA 3EGKH 4F48B 1HAVB 3DT0H 4AC9A 1CA8B 2RFKC 1P09A 2PLXA 1AE5A 3UNQA 2HALA 1MMJN 4XOJA 1M9UA 4O9VA 3KEEA 5GCHG 3BSQA 2KFWA 2BY7X 2VIWA 2GJGA 1PJPA 3RDZA 1Z6EA 4D9RA 3HK6B 1RTLA 3ZYEA 5FXLA 3RXHA 1P2KA 3FKSD 4MNWA 1V2KT 1FXYA 1EPTA 3M61U 1EZSC 4Y6DA 4AFQA 1SLXB 4BTTB 1VCQA 1QR3E 1O2VA 1TGTA 3UNRA 4ASHA 2FDAA 4P00A 1EX3A 2THFB 2A4RA 1GGDB 2I6SA 3OY6U 1GJ9B 3ZZ9A 1G30B 1P2IA 4ZXXH 1GBIA 2FTLE 5GCHF 4I8JA 1LPKB 1TNIA 5A0CA 4FU8A 1J9CH 3M35A 5A09A 2QV1A 3A8DA 2UUYA 3MOCA 2ZQ2A 4XBDA 1ZSJA 1QJ7B 2PKAA 4OS1A 5BRRE 3K2UA 1QB9A 4INLA 3QGJA 2XW9A 4X2YA 1QRZA 2JH0D 3GDSA 1HAGE 1S84A 2PP6A 1C5XB 2P3TB 4B6FA 2WHXA 1EPTB 5L6NH 4Y0ZE 3UOPA 4Y71A 4YOJA 1O2IA 1KXDA 2XBVA 1FLEE 3W1EA 4Y8XA 1L4ZA 1JRTA 1E79D 3U28C 2AMQA 2FOFA 3HATH 1P2OA 2Z94A 1GBLA 2A45B 5DP4A 2P8OC 1PFXC 3ZZ6A 1C5QA 5AF9H 3ZZCA 2ZTXA 3ZZAA 1LKAA 2OC0A 4YO9A 2ZEBA 1LHEH 1TONA 3BTGE 4OS5A 1THSH 3PM3A 3SORA 5JBAS 2P59A 7ESTE 7KMEH 1SGYE 3E6PH 1N8OC 2ZGJA 3EE0B 5GPIB 5LPEA 5JPMH 2FO9A 1XVMA 3F0OA 1FQ3A 1ETSH 1HDTH 3P8NA 1C2JA 3AAUA 3S7KB 1S6FA 5EJ1A 1LCYA 4IGDA 2J9NA 1W2KH 3SU5A 2K1QA 4NSVA 3M3VA 2GMTC 1OKXA 4ZHMU 3SJOA 2F9UA 4X6PA 1EOLA 3Q77A 1VR1H 5AHGH 5E0JA 2FI3E 2OINA 3N99A 1G37A 4CREA 5DJ7A 1W0ZU 1Z6JH 3F68H 4PROA 3ZVFA 3PV5A 4YM9A 2ZHEH 4B71A 3RXFA 5C67A 1MKWH 4Z1MD 2PR3A 4X1SU 3W94A 1YGCH 4VGCB 4UD9H 3A80A 5DSFA 2D8WA 1PYTC 2R2WU 3DA9B 1DY8A 4CR9A 7GCHG 1ACBE 2VWNA 3SV9A 1J14A 1PPFE 3OSYA 1G3DA 3GY7A 2C4FH 3P17H 1H9LB 1DY9A 1BMAA 4O3TA 3IWMA 1EJNA 3M37A 1T8MA 2GD4B 5ESTE 3RUOA 1EUFA 1ZZZA 4CHAB 1CQQA 4X1QU 1FN8A 1MTUA 1TMTH 1C2MA 1C1UH 4U30A 1QURH 2FOGA 3RC6A 1O3OA 4BNRA 3GCTG 1UTKA 4KTCA 4DGJA 1QHRB 2VVVA 5C1UA 2WSSD 1V2PT 2OC7A 1O2TA 1OWHA 7GCHF 1AWHB 1NU9A 4MPUA 1T7CA 5T3HA 2ZKSA 4ZKRU 1YYY1 2V35A 4NG9H 4K60A 5HIZA 3SHAH 1THPB 4MPWA 1C5YB 5E0GA 1G9IE 1P03A 1GHYH 2FIRH 4MLFB 4Y79A 3GY2A 3UUZA 5A8YA 1ARBA 2O8UA 1VGCB 1GBTA 2FOCA 4J1YA 1FY1A 3GCTF 4MPVA 1Y5UT 1E36B 1QL7A 1DDJA 1ZYOA 4B1TA 5JBTA 1MKXH 1BZXE 3RXIA 1UCYE 4SGBE 1FIZA 1C5PA 1O3MA 3ENSB 3Q76A 3PRDA 3SGAE 1KYNA 1ELFA 3SBKA 3P6ZB 3A8BA 3UR6A 4TPYA 1TX6A 1UJ1A 4KTSA 2WPHS 5F03A 1B0FA 2EY4C 2C90B 2HVXA 1SI5H 4DT4A 1SGFA 1IQMA 3DSPA 3P8OA 4Y11E 1FNIA 3JZ2B 1S6LA 4AOQA 3RU4E 2PSYA 4ZUHA 4Z0KA 2AFQB 2ZGHA 4H6SB 1QL9A 2FOBA 2LPRA 1CGJE 1LO6A 3SNEA 2A2XH 2DE8A 1S0RA 3FO8D 2ZIQH 1BTYA 4Y7BA 2FP7B 4F55A 1DSTA 1MTNC 3FN8A 5C3NA 5DP5A 2ZFRH 1WQVH 1TX8A 4F4OC 4GHQA 4A1VA 1OP0A 1EXFA 1WTGH 2V3HH 1KXBA 2A7CA 1K22H 1PQ5A 1GDNA 3UREA 3GCHC 1SVPA 1BBRK 1W3CA 1HFDA 3A86A 2KM0A 3RXJA 2KZ4A 2Q1JA 3EDXB 1C9PA 2P3UB 1SQOA 1K1OA 3QWCH 4Y8YA 1BB0B 1W13U 2HNTE 2ZQ1A 2W3KA 2DUCA 1WDIA 3P8FA 3TVJB 3LJOA 3MI4A 1O2LA 1DLKB 4K69A 4XD7D 4UEHH 1COWD 3S7HB 1EKBB 2TRMA 3CENA 2EI7A 2H5CA 1AMHA 1C1PA 2QCYA 1ZRBA 3RXVA 3V0XA 2O8WA 1IQEA 3QGNB 1OYTH 1V2RT 1MZAA 2W6JD 2J95A 4OGYA 3GISB 2BQ6B 3U9AH 1LHFH 4MDSA 2H9TH 1BHXF 1XXDA 4P02A 1GHXH 1A3EH 2AGGX 2ZO3H 2Y5GA 1HJAB 1HNEE 4X8SH 2QGRA 4GCHG 2A0QB 3LGYA 1C5OH 2QXGA 1MQ5A 1VKYA 1O3AA 2ZPRA 3D62A 1CA0B 1P2NA 2Y5HA 2G51A 4IN2A 1P3CA 1H8ED 1T4UH 1O2NA 1YP9A 1EB2A 1D4PB 2EQNA 2WPKS 1O3PB 1LPZB 2C8WB 2XBYA 3LGTA 4KELA 1KXFA 2V7QD 3U69H 2BB4A 3OAAD 2V0BA 4K8YA 1Y8TA 5AFZH 1GJ8B 2BX4A 2WPJS 4GCHF 1Y3XA 1BITA 1FPHH 3V3MA 1WBGB 4AORA 2TIOA 1NU7B 3IITA 1V2NT 1GDQA 1Q31A 1IAUA 3I77A 1UVOA 9LPRA 4FUJA 4K3JA 4IBLH 5SGAE 4ACBA 1C2KA 1TA6A 1O2RA 1ELEE 5J4QA 1D3PB 2ZI2H 2OUAA 1GI4A 2ZU4A 1TNHA 3H7TA 1O35A 4ZHAA 1NZQH 3OEHD 4XDEA 3BG4B 1YWUA 1MTSA 1EAUA 4B74A 1UVPA 1J8AA 3SHCH 1UTLM 1W0JD 1SGTA 4GUXA 3F2HA 3EE7A 3TITA 3T62A 1WUNH 3LGVA 2ALVA 3RP2A 4K8BA 3ZVDA 3B9FH 1JMOH 2VBCA 1MABB 3A7VA 1Q3XA 4GPGA 1PPGE 2TGTA 4GLYA 1W0YH 1TRNA 1VITH 4E7NA 1LTOA 4O03A 2Z3EA 4HG6A 2GZ9A 2BLWA 3ZZ7A 1TQ0B 3TNSA 3VPKA 4UFEH 3GY6A 2VIOA 5I25A 2OC8A 1TALA 1G2MA 3TK9A 5FL7D 4I32A 2YMSD 2Z6BD 4ZH8A 1PPEE 1SGRE 1ZJKA 1C2GA 3SNDA 2LELA 3Q3KA 4UFGH 3BG8A 1KMHB 1EJMA 1INCA 4CH8B 1AU8A 4UONA 4Z6AH 3S9AA 4DURA 3LIWA 3DCLA 1TMBH 4K1EA 1C1QA 4DJZB 2BQ7B 5G4BA 2GV6A 1K9OE 2BVRH 1XUJA 1O2HA 3MYWA 2PTNA 3LU9B 3AAVA 1S6HA 3LOXA 2FLBH 1VITG 3F0PA 3PLPA 3UWJH 1K1MA 1V6DA 2BX3A 3ITIA 1E0FD 1H1BA 2STBE 3A85A 1K28D 2H6MA 2JETC 2VGCB 1ZHRA 2Z9KA 1O3EA 1FI8A 4MTBA 1CGHA 1YPJH 3FOAA 2RDLA 3LGUA 1NC6A 1TOCB 4FUDA 4I33A 5B6OA 3KN2A 1ZSKA 2IJD1 1ZTLA 2RCEA 5L2YH 2VIPA 5GJ4B 1C1WH 1ELAA 4I86A 1A0JA 2BDBA 3F6UH 2ANYA 1IOEA 1GBBA 2CMYA 3SV2H 1VITF 2WPLS 2WV5A 1ANBA 4K2YA 2UWPA 1WV7H 3DUXH 1F5LA 2F91A 2SGQE 4NIXA 3L3TA 1YBWA 3BTDE 2ESTE 5DPAA 2QC2A 5CHAB 1H9IE 2BD9A 1QL8A 4NIWA 3WW7A 3PLBA 2ZZUH 4JZ1A 3URCA 5A2MH 3DFJA 1DANH 1IQNA 3KHVA 2WYGA 1HBTH 5HKKD 2F9VA 8ESTE 1MKXK 2BDYA 1TGBA 4XBCA 3RXPA 2B7DH 2ASUB 1SMFE 2O8MA 2Z9GA 4Q2KA 5FCKA 2ZFSA 2QYIA 2G00A 2SGFE 3FZDA 1TGSZ 2VVUA 3Q3YA 3RMNH 4CRAA 5C5NA 3O8BA 2R0KA 3E16B 1A5IA 3QTVH 3VXEH 3MO6A 2BXTH 4NSYA 1GJAB 1O30A 5BPEA 1QFKH 1W14U 2WINI 2WZQA 1GI5A 4FVBA 1V2VT 4IW4E 3Q3XA 1BT7A 2Y7XA 2XBXA 4JYVH 1GJDB 2ILNA 3Q00A 5EPNA 3G01A 2KCOA 1CE5A 1HXEH 2ZF0H 1T8LA 2QY0B 4XE4A 3ZVGA 3M7TA 5DK1A 2HOBA 5A8ZA 2Y6TA 1GBFA 1X7AC 1Y5AT 2PGBB 3F3BA 1SGQE 5LPRA 1XUGA 3BV9B 1SLUB 3SU2A 3LDXH 1MUEB 1Q2WA 3AK5A 1L1NA 1SOTA 2GP9B 3KQCA 1VJAU 1WYKA 3PMHB 3LT3A 4GSOA 2C93B 5JB8S 4YOGA 1KLTA 3SU6A 1RRKA 3ZV9A 1TBRH 5EW2H 1ESAA 1J15A 1AFQC 5EW1H 4JMYA 2HRVA 2CHAC 2FXRA 1CT2E 3STIA 3LC5A 1NS3A 1P2QA 4JK5A 3M5LA 3AW1A 1ELVA 2A31A 1V2MT 3SGQE 1SKYE 4RT1A 3KIDU 2LNCA 2BHGA 1P10A 2HGTH 2Z9LA 2BY8X 1TIOA 4K1SA 2FI5E 4AB8A 2WUCA 4GAWA 3RMLH 4Q7YA 4WH8A 1LVOA 1UK4A 2NU2E 1H8HD 1TBZH 1XM1A 1ELCA 2GDEH 4B75A 5IYTA 1SOZA 2ZDAH 1TGNA 3UTUH 2GT8A 2SGEE 5K7RA 4H6TA 1O3GA 1BMLA 1A5GH 1WQSA 1WXRA 1Z7KA 4FUBA 2F3CE 1UW7A 3RXAA 3SU0A 1GCTB 1MU6B 3S9BA 1V2LT 1JXPA 1Z8GA 4JZIA 1EZXC 2VIVA 2BOKA 4YESB 4AG1A 1TA2A 2R2MB 2G5VA 4WJG2 1LHCH 4RN6A 1UVUH 5EXMA 3HKJB 4K1TA 3BTTE 3RXQA 1D3QB 1HAYB 4M9FA 3ZZ3A 1GBHA 4FUGA 1YF4A 3LH1A 1TNGA 3F9EA 1ZPBA 4ZXYH 3F2FA 1MZDA 1L1GA 4IMZA 2PV9B 3VB3A 1T4VH 3O8CA 1KSNA 1FX0B 2FOMB 3MU5A 2J97A 4Q63A 3U1JB 4WH6A 4SGAE 1TMUH 3PRBA 1KXAA 1RIWB 2B8OH 1AN1E 1G2LA 1O2MA 2P16A 2UUJB 3K6ZA 4I8GA 1GVZA 1OHHD 1IQIA 2EA3A 4BANB 2GGVB 1S82A 1WTHD 5CMXH 2ODQA 1DPOA 3GCOA 4NGAH 3TH3H 5CE1A 5DGJA 2BVSH 2PKAB 3DSGA 5E2OA 3ATMA 3EYDA 1DFPA 1NRQH 4NIYA 3E0NB 3LKWA 5EQRA 3N7OA 4A5TS 4A7IB 5JBBS 1C2EA 1TAWA 4KP0A 4B2AA 1SSXA 2ZDNA 1LQEA 3STJA 1O3KA 1TNLA 1NY22 2ZU2A 4Q4LA 1VCWA 5E8EH 4CRCA 2TGDA 5GXPA 3TGIE 3S69A 1KTSB 1UO6A 1DICA 4NZLA 4XSKU 1DXPA 1W12U 1C5RA 2JKHA 5EXLA 1FN6A 2TPIZ 4OGXA 2VIQA 1QA0A 1GJBB 1E35B 2GZ8A 1S85A 2NU0E 1DVAH 4RKOB 4AB9A 5E2PA 1QY6A 1JOUB 1QQUA 1B0EA 6GCHG 1SGDE 1ZTJA 1CHOG 1O34A 3ODDA 1J17T 2BD3A 4OS7A 1AVGH 2OBQA 1LPGB 4F49A 1GI8B 4AFZA 4MPXA 4HTCH 1GBCA 3OY5U 4I31A 4TYDA 4KTUA 5CHBA 1FJSA 1AY6H 2EC9H 2XWAA 1ETTH 2K8IA 3MH4A 2BY9X 3S9CA 1BJVA 1IHSH 4YT7H 1O32A 3KCGH 2YMSB 1ZR0A 2PKSC 4X8TH 1UCYH 5PTPA 1MQ6A 2CK3D 2BD7A 2A5KA 1TLDA 2ULLA 6GCHF 1CHOF 3VGCB 1OYQA 1C4V2 1TWXB 2HLDD 2P94A 1NROH 1GVKB 1AFEH 3MNCA 1MTWA 1EOJA 2TGPZ 4ABGA 2ANMH 3T27A 1GJ4H 1KLIH 2PUXB 2J92A 4ZKNU 1GJ6A 1C2DA 1RFNA 5LH8A 1CGIE 4QT8C 2ZHWH 2ZWLH 1ZSLA 1NFYA 2BD2A 3T26A 2FOHA 1W0KD 1MAXA 2IOTA 3TPIZ 2BXUH 4DVAU 5FBIA 4BAKB 1ABIH 4AYYB 3RXTA 1JBUH 1P0SH 1DS2E 2FM2A 2SGPE 3SGBE 2W5EA 1Z8JB 1DWEH 3NK8A 4X1NU 1PPHE 5FPYA 1TYNA 4XBBA 3EAJA 4RI0A 6CHAC 3QZQA 2XC4A 2V3MA 4IC6A 2A7HA 2BD4A 3OFND 1QIXB 1GJ7B 1SHYA 1V2TT 1SQRA 4E7RG 3PO1C 2F43B 1FUJA 1BTXA 1O33A 3GY3A 1GVLA 2OCVB 4BTUB 3SUDA 1A2CH 2P93A 2CV3A 5GDSH 2AMPA 3KQDA 1IHTH 2ZFFH 1QCPA 1RGQA 3L6PA 1LMWB 1JIRA 1GWAA 7LPRA 1C5ZB 3MU1A 4HFPB 1A7SA 2V3OH 5FPSA 4CRFA 2FMJA 4X8UH 1NTPA 3TGJE 1AVXA 1QJ6B 1TPPA 2D2DA 1QRXA 1SG8B 2J34A 1Z8RA 3QDZB 1P12E 3ATKA 3UOUA 3C27B 4IS5A 1NO9H 2FEQH 1GMHG 1SFQB 2AMDA 3KF2A 3PMJA 1CT4E 1AUTC 1YCPH 4JYTA 3RMMH 3U8OH 4X8VH 1SGCA 1O5AB 1H4WA 4FVDA 4BAQB 3F2GA 2ZPSA 4GHTA 2O8TA 1AZZA 4WMEA 1C1NA 2FODA 1Y3VA 2UUFB 1RTKA 4DCDA 1MD8A 1ZPCA 5JBCS 2QXHA 3U8TH 1UTOA 2BYAX 2J98A 1BRCE 4XFQA 3VB6A 4X2WA 5C20A 1GMHF 3ELAH 3MMGA 3A8CA 1Y59T 3ATLA 1FAXA 2F9BH 3RC5A 2FS9A 4X0WU 2PWXA 3LGIA 1H9HE 1GG6C 1G3CA 3OX7U 3URDA 4CRDA 3OTJE 3KQBA 4DT7B 1TQ7B 4NA9H 4A6LA 3ZV8A 2WYJA 4B6EA 1O2OA 5DP3A 2RG3A 3L33A 5LGOA 1GHWH 4NIVA 3BF6H 2AERH 2ZFPH 4KGAA 2AS9A 3ZVEA 4TPIZ 2HNTF 1DXWA 5FCRA 2R3YA 2A4QA 4O3UA 5ETXA 4ABIA 3B23B 2ZHQH 4Y7AA 4A92A 1C1MA 1O2SA 3QTOH 3BTHE 1YPKH 5JYIA 1F0TA 1SL3A 3UB0A 1BMNH 2BDAA 3SOSA 1HGTH 2P8OB 1K1NA 4FUEA 1SC8U 4MVNA 1BCUH 3ZVBA 4CBNA 1GMCG 1C5TA 1G3BA 2BVXH 1ESTA 1YPHE 3T2NA 3OTPA 1P05A 2G8TA 1O3BA 1AO5A 4FOUC 1XKAC 2UWLA 1N8OB 4FUHA 3A7WA 3E3TA 2QN5T 1PPBH 2H1UA 2F9NA 1IQFA 4ABDA 1CSOE 1T32A 1NBMD 1PQ7A 3RXEA 5L30H 1DITH 3BTEE 2FZZA 5F8ZA 1O3NA 2PFEA 1NT1A 3SJIA 1EAWA 2A2QH 4YT6H 1KTTB 1GMCF 1TE0A 1D6WA 1ZHMA 3DHKH 1W11U 2EEKA 2WPDD 3WY8A 2Z9IA 2GMTB 3SUEA 2WPIS 5A0BA 1EAIA 4YLUA 3RXOA 4THNH 5EXNA 3RMOH 4A1TA 1ID5H 3KL6A 3ZVCA 1XUIA 2UUKB 3HGNA 1ZRKA 6ESTA 1GHVH 2BTCE 2JH6D 5EOKA 1GGDC 3A7TA 4TWYA 3BEIB 3QZRA 5FAHA 1O5GH 1JRSA 1TNJA 1SFIA 2HNTC 4NFFA 4Y8ZA 2XC0A 2J38A 1QB1A 1AE8H 2ODYB 3MNBA 1HYLA 3EQ0H 1V2WT 4ISIH 1ZJDA 2XCNA 3KGPA 5F8TA 1TRMA 2R3UA 2W7SA 1F0UA 1OWIA 1THRH 4H42U 3E8LA 3LJJA 1O2XA 2HPPH 5DP9A 2R0LA 3RC4A 2OQUA 5IK2D 3HPTB 2VB0A 1SGPE 1FONA 1K0HA 2XTTB 4MNYA 1GDUA 3TK6A 1N1LA 1EPTC 1OOKB 2OLGA 3SZEA 4BOHA 3FZZA 1W8BH 2CGAA 2Z7FE 1W7GH 1DUAA 3D65E 1HJ8A 1MKWK 1GBEA 5L2ZH 1ZPZA 4MG3A 1EFRD 1YKTA 3RLYH 1RIWC 4IC5A 5E0HA 4Y10E 2A32A 2ZDVH 3TJOA 3PLKA 5C17A 1O5CB 1TX7A 2WPMS 1HB0B 3U1IB 4JZDH 2G5NA 2J94A 3SJKA 2A4GA 1O5BB 2FYQA 1E1QD 2ANWA 3TH2H 3P95A 1YPMH 3NUMA 3NRLA 1YPEH 2P3FH 1O3FA 2AH4X 3RXRA 2OBOA 3M36A 1C2LA 1A0LA 3OEED 1CT0E 1MD7A 1UCYK 1DM4B 1ABJH 1TNKA 3UAIC 4Q80A 1O3CA 5C5OA 1WAYB 2AEIH 2ZP0H 1P8VC 3N7DA 1FPCH 1QQ4A 1TB6H 1TPAE 5K0HA 1BIOA 2ANKH 1C5LH 3M3SA 1Z8IB 2QE7D 3GY8A 2M2AA 2EI6A 1XXFA 1K1PA 2GCTB 4RKJB 4CBOA 1ELDE 2FS8A 5HIYA 4HZHA 4I7YH 1AUJA 1OS8A 4YOIA 4WMFA 2QF4A 5FPTA 1KXEA 3A7ZA 1C2IA 4YTAA 1GI2A 3MWIU 3UR9A 4Y0YE 4YLQH 1C1SA 3S0NA 2JIZD 3M5NA 2D26C 1O0DH 3BTFE 4WXIA 1QRWA 5TCAA 1Z1IA 3RM0H 1AKSA 3SI4H 2QF0A 2L74A 4I8HA 3VB4A 3TGKE 1MAYA 4VGCC 2J4IA 1XVOA 1DE7H 2SNWA 4WF8A 3K65B 1JIMA 4MQAA 1ZTKA 2VU8E 1SQTA 3K6YA 1C2FA 2CF8H 2A1DB 1ELBA 3MTYA 1HRTH 2PGQB 1K1LA 4OS6A 2CJIA 1C5UA 1NESE 4JCNA 4U32A 1S0QA 3N7EA 1P02A 2RA0A 4DOQA 1SGFG 2BMGB 2ZCHP 1UTNA 4TT3D 2YMSC 3E1XB 5GNDA 2HVYB 1OPHB 2BQWB 1GI6A 2AGEX 4ASUD 4CRBA 2BLVA 4CHAC 2FX4A 3OU0A 3PWCA 3HGPA 1LKBA 3M3TA 2OK5A 2GTBA 1ETRH 1FIWA 1HIAA 3MO9A 3TJUA 3VB7A 5FX5A 3TIUA 4D7FA 2ZGCA 1AKSB 2NU3E 2BM2A 2EI8A 1YCPK 1MBMA 2KCPA 3V12A 2XRCA 2FYRA 1C5SA 2VH0A 4JZEH 4BAOB 2Y82A 5H4IB 1AB9B 1GI7B 2XCFA 3D49H 3ZYDA 3UQVA 4UDWH 1O2QA 2UWOA 1VCPA 3PV2A 1HAHH 1GBMA 4J2YB 1T31A 4FETA 1VGCC 2OTVA 3RXLA 4TSFD 2L6OA 1B7XB 2VVCA 5ESBA 1P11E 3GDVA 3IG6B 5EQSA 5CDFE 1HIAB 5AFYH 4R0IA 3WWFA 5HMAA 1ANDA 1O3LA 2V6NA 1SPJA 3TK5A 1E37B 2ZHDA 1KIGH 1SGIB 2YNAA 5AVDA 1QA7A 3A7YA 3BIUH 1GI0A 1BMFD 4TY6A 2SGAA 1ZGIA 4R8TB 1PQAA 3F9FA 2O8LA 3SI3H 1K21H 2A7JA 2TGAA 3V7TA 1RD3B 5C0UA 1EP5A 5EPYA 1UHBA 3I29A 4B73A 5EGMA 3MH6A 2Z3DA 4AGJA 4DW2U 4OM9A 1LQDB 2R9PA 1P57B 2C8YB 3MNXA 2GV7A 4JK6A 3DSOA 2A5IA 4K5ZA 3UFAA 4OS4A 4INHA 1N6XA 1MCVA 2AIPA 4ZAEA 1AWFH 1OP8A 1HAIH 1RJXB 2HWLB 3EA7A 4IMQA 3TJVA 2ZECA 2VH6A 4B2CA 5GIBA 3PROA 1D6RA 1Z71A 1V3XA 1H8IH 3RXDA 3SNCA 2GT7A 2TBSA 3RXCA 1E38B 3VB5A 1SGNE 4RT0A 4X1RU 3H09A 4CH2B 3U98H 1BHXB 1PQ8A 1GI3A 1S5SA 1TPSA 2GVFA 1UTPA 4D76A 5IDKA 1ZLRA 1BBRE 1UHBB 1AD8H 1FY3A 2IJOB 3PWBA 2QA9E 1NRNH 2FI4E 5C1YA 3RM2H 1F7ZA 3A88A 3BN9A 1PYTD 1XX9A 3VG8A 2QF5A 3DD2H 4U2WA 5FX6A 2VWOA 1HJ9A 1WU1A 1TBQH 3BIVH 5JB9S 1HJAC 4DIHH 3UQOA 2ZTZA 1ZHPA 3A8AA 2ZDMA 4NWLA 1FMGA 1GHAG 3KNXA 5KEDA 1FY5A 3BTWE 1ELTA 1O2WA 4UFFH 2G52A 3MU4A 4D9QA 1SHHB 2JJ1D 2VNTA 4OS2A 1NRSH 1BOQA 1LVMA 1T8OA 3FP8E 1O31A 1CA0C 1IQGA 1VJ9U 2BDGA 4B76A 2WV4A 2ZFTA 3BEUA 4FXGH 4D8NA 3EA9A 3UIRA 1P3EA 2ZU3A 1N6YA 3V13A 1C9TA 1MTVA 3AW0A 5F53A 2G55A 5C94A 3H7OA 1KDQA 1O2YA 2GKVE 4MNVA 3SU1A 1S83A 1EZQA 1GHAF 1DSUA 1UMAH 2A4OA 5T6FA 1C5WB 2VWMA 8GCHG 4H4FA 1GMDG 3VEQB 1A61H 1AVWA 2JETB 1MU8B 2ZNKH 2F9PA 3B8JA 1HXFH 3SYJA 4AG2A 6LPRA 1CBWB 1NRPH 1L2EA 1BTZA 1QTFA 4ABBA 4X6MA 3FP7E 1PPCE 3GCNA 2PTCE 3QN7A 3PTBA 3A81A 1D3DB 3UNSA 1NFWA 3A84A 4DY7B 1O38A 1P9SA 2XXLA 3QX5H 4IN1A 1FZZA 2CN0H 2IPHA 2ZCLP 4AGKA 1O3JA 2ZHFH 1KDQB 1GI1A 3P92A 3BG4C 1BRBE 3RXMA 1GMDF 8GCHF 4MNXA 4LOYH 1ZMNA 1NRRH 3P70B 2AIQA 1BTUA 1K1IA 1QBNA 2F83A 2RA3A 3GYMA 3ZZ4A 4M7GA 2QIQA 5C2ZA 3PYHA 3RXBA 1O37A 1C5MD 1F2SE 1V2UT 4UFDH 3A89A 2Q6GA 1V2JT 4ACAA 2BD8A 3QLPH 2B9LA 1BRAA 1EZUC 5EU8A 3WWBA 1XKBC 9ESTA 1JWTA 2JH5D 1IQJA 1W10U 2Z3CA 1EP6A 1DUEA 4ISLA 4B2BA 2J2UA 2XYAA 4FUIA 3QK1A 1LVYA 1HAPH 2OD3B 1YY3A 5T6GA 3SN8A 1L4DA 1IQLA 3FFGA 2D1JA 1O3DA 1P2MA 3U8RH 2ZPQA 3A87A 5HGGA 3PMBB 1UTQA 3GS9A 5FHTA 2KR7A 2LP6A 1BTWA 5KECA 1HAOH 2GDDA 5A0AE 2H2ZA 2FPZA 2P95A 3GDUA 4I8LA 1O2JA 2ZGBH 1KXCA 2JDID 2O9QA 2PSXA 2ZA5A 3LC3A 5HM9A 2SFAA 2VGCC 3VFEA 2ZGXH 1O2KA 2STAE 1G3EA 1SLWB 2ZTYA 1RTFB 2ZFQH 2H9EH 3DFLA 1E34B 4U01A 3GY4A 3ODFA 1EJAA 1SBWA 5T6DA 3HKIB 2ZCKP 3RXGA 4CRGA 1O2ZA 4CR5A 3RXSA 1UVTH 1A3BH 1IQHA 3NZIA 5EODA 1TGCA 1AFQB 2BDHA 2GCTC 1Z1JA 4O97A 2CHAB 4WY3A 3T5FH 1AHTH 1HAXB 3MH5A 1A0HB 2OP9A 2FESH 3SNAA 2A5AA 1GBAA 4ZCNA 1QB6A 1UK2A 3GYLB 1FV9A 1O39A 3FVFB 5CHAC 1YCPM 1A4WH 1QNJA 1V2OT 1WOFA 4ISNA 4AZ2B 1RXPA 1GJCB 3MFJA 1DWCH 4DG4A 1J16A 2KX4A 5F6MA 1FY4A 2Z9JA 3T29A 5JDUB 1YLDA 5DO4H 2JJ2D 1P01A 1CU1A 1NFUA 1ESBA 3RU4D 3CS7A 2BZ6H 2OXSA 3E91A 2VJ1A 4JYUH 2AGIX 1ZMLA 3KQEA 4AFSA 4UE7H 2K0QA 1G36A 1S81A 1HAZB 4X1PU 1ZGVA 1NFXA 4FUCA 5C1XA 4ABFA 5T1VA 2M5TA 3A7XA 1O2GH 1O5DH 1L1JA 1BMMH 4ISOA 1DWBH 2GCHG 2CXVA 4BTIB 2W7UA 4LK4A 4ABAA 3M5OA 1EATA 1FAKH 2XNIA 1CHGA 3P8GA 1OWEA 2Y5FA 1G32B 4YZUA 5TCCA 4ESTE 1A1RA 1ARCA 4NCYA 1C1TA 1W7XH 5KGOA 4LZ4B 1B5GH 2H9HA 1GL1A 4A1XA 1L0ZA 1K1JA 4AN7A 1XUKA 5EQQA 1OP2A 1GHZA 3JZ1B 1F5KU 4INKA 2J98B 1AB9C 5B6LA 4ZHLU 4NWKA 2FX6A 2C8ZB 3UWIA 4KKDA 4NA7A 2KCYA 1TPOA 1OXGA 3UPEA 2GCHF 2ZG0H 3SU3A 4BXSA 1DOJA 2QF3A 1Y3WA 3F9HA 1V2ST 1WSSH 3MHWU 2FLRH 2PUQH 1OX1A 3T25A 5DP8A 1H8DH 2OQ5A 5DN6D 1XUFA 1YLCA 2BD5A 2ZC9H 3D23A 3R0FA 4HI3A 5HYOA 1BTPA 2ZU5A 4NA8A 1NBME 2NU1E 1DLEA 3SW2B 2FTMA 1GHBG 3OYPA 5F8XA 1E1RD 2QXIA 2BY5X 3EA8A 4RSPA 3NXPA 3GOVB 2SGDE 3PTNA 4WXVA 3ZZDA 3O8DA 4FUFA 2Y7ZA 4X6NA 1LHGH 1QGFA 4BXWA 1C5NH 3M7UA 2KAIA 2J5UA 3SJ8A 1ORFA 1NPMA 1P2JA 1SQAA 3QO6A 1OWJA 3MNSA 1ANCA 2HPQH 3BEFB 3M7QA 3MQKC 2Q6FA 1LHDH 1F92A 1GPZA 1ELGA 1HLTH 1P9UA 3NKKA 4Y76A 1BTHH 1ZMJA 4TWWA 1TOMH 3LGWA 1UTJA 1A5HA 1FY8E 1TRYA 8KME2 2Q6DA 2ZU1A 1V2QT 4NFEA 1GHBF 2W6ID 3SO3A 4E05H 3T28A 2BLQA 4X2XA 1YC0A 3H5CB 5DG6A 3FANA 2ZDLA 5HM2A 1GBJA 4ABEA 2BOHB 2VINA 1GCTC 3C1KA 3FAOA 3BTKE 1HCGA 2AHME 4FU9A 1YPLH 3SNBA 1C5VA 1KLJH 2KAIB 2FWWA 4I8KA 1FDPA 5J4SA 1P06A 4WWYA 2Y80A 4Q7ZA 3VXFH 3R3GB 2BDCA 1NN6A 1GBDA 1UVSH 2NU4E 3O8RA 2PKSB 2SNVA 3TU7H 4WVPE 3MU0A 4BAMB 5EG4A 1SGEE 1D3TB 1KY9A 2B0FA 2W3IA 3SU4A 1OWDA 2ALPA 3RXKA 4LZ1H 2IN2A 3BTME 2GZ7A 3LPRA 2XNDD 2FOEA 3F9GA 4GVUA 5DP7A 1YM0A 1GJ5H 1WCZA 3W95A 8LPRA 1SB1H 1AGJA 2C8XB 4D7GA 1SLVB 1DT2A 3SUFA 1XMNB 1XUHA 2ZDKA 4E06H 1BDAA 3TNTA 1YPHC 1IQKA 1AIXH 4ZMAH 3I78A 1HUTH 3AASA 4ZKSU 1K2I1 3CP7A
chains in the Genus database with same CATH topology
6CHAB 4HGCA 5I46H 1C4U2 1OWKA 1GI9B 3MO3A 4ABHA 3TH4H 3ZZBA 4TY7A 2Y81A 1C4Y2 3PO1B 1GCDA 4WMDA 2YNBA 5HXFA 4DIIH 3PMAB 3NCLA 3ZZ5A 1C1OA 1CBWC 1EAXA 3CS0A 2PHBA 1P04A 1C2HA 2H5DA 5DKMA 1O36A 4AFUA 1Y5BT 1MH0A 1ZOMA 3E90B 3TJNA 1ANEA 2BZAA 3LH3A 5DP6A 1SR5C 3GICB 1MCTA 2XBWA 3QUMP 1MTNB 3NWUA 1DWDH 4FU7A 1D9IA 2ODPA 1GBKA 1CVWH 2NWNA 1UTMA 1F0RA 1AI8H 3SV8A 3RXUA 3M5MA 3SZNA 1AZ8A 4AYVB 4BAHB 2W26A 3PV4A 2C3SA 3SV7A 2GX4A 3SQEE 1CO7E 3GCHB 3SV6A 1QBVH 2PW8H 2HLCA 3ATWA 1HV7A 1PPZA 4Q7XA 1O3IA 2XWBI 3VGCC 1NM6A 1EASA 2OC1A 1TABE 5ABWA 3ATIA 3UY9A 2FOAA 4JZFH 1UK3A 5FBEA 2YOLA 1DX5M 2CF9H 1O2PA 2XC5A 3A83A 5GWZA 2QXJA 1EQ9A 1GG6B 2VIDA 3TLOA 5A8XA 1EB1H 3GY5A 1F0SA 1QJ1B 1RS0A 2G4TA 2B5TB 1O5EH 2G4UA 2BY6X 3ZZ8A 1TFXA 1BUIA 2AYWA 1QBOA 3FP6E 3ESTA 3LONA 1Y3YA 2F9OA 1HAVA 4ABJA 1YPGH 2BDIA 3SUGA 1C1RA 4LXBH 4ZROA 2BLOA 2QAAA 4ISHH 3E0PB 4ZKOU 1O5FH 3MU8A 1BQYA 1LVBA 1MBQA 3F1SB 1LDTT 1O2UA 1A46H 1VZQH 1HPGA 1BA8B 1U6QA 2WUBA 4X2VA 2I6QA 1F5RA 3SJ9A 1C1VH 1OSSA 3AVZA 3NPSA 2DE9A 3HK3B 3MH7A 5TJXA 4X6OA 1GL0E 4NZQA 3ZVAA 1AQ7A 1BBRH 3SQHE 3BTQE 3RU4T 2VWLA 1BRUP 3PB1E 5LPFA 3A82A 2G81E 1T8NA 3K9XB 1O3HA 3RLWH 4AX9H 1Y3UA 1BJUA 3EGKH 1HAVB 3DT0H 1CA8B 1P09A 2PLXA 1AE5A 3UNQA 2HALA 1MMJN 4XOJA 1M9UA 4O9VA 3KEEA 5GCHG 3BSQA 2BY7X 2VIWA 1PJPA 3RDZA 1Z6EA 4D9RA 3HK6B 1RTLA 3ZYEA 5FXLA 3RXHA 1P2KA 4MNWA 1V2KT 1FXYA 1EPTA 3M61U 1EZSC 4Y6DA 4AFQA 1SLXB 4BTTB 1VCQA 1QR3E 1O2VA 1TGTA 3UNRA 4ASHA 2FDAA 1EX3A 2THFB 2A4RA 1GGDB 2I6SA 3OY6U 1GJ9B 3ZZ9A 1G30B 1P2IA 4ZXXH 1GBIA 2FTLE 5GCHF 4I8JA 1LPKB 1TNIA 5A0CA 4FU8A 1J9CH 3M35A 5A09A 2QV1A 3A8DA 2UUYA 3MOCA 2ZQ2A 4XBDA 1ZSJA 1QJ7B 2PKAA 4OS1A 5BRRE 3K2UA 1QB9A 4INLA 3QGJA 2XW9A 4X2YA 1QRZA 2JH0D 3GDSA 1HAGE 1S84A 1C5XB 2P3TB 1EPTB 5L6NH 4Y0ZE 3UOPA 4Y71A 4YOJA 1O2IA 1KXDA 2XBVA 1FLEE 4Y8XA 1L4ZA 1JRTA 2AMQA 2FOFA 3HATH 1P2OA 2Z94A 1GBLA 2A45B 5DP4A 2P8OC 1PFXC 3ZZ6A 1C5QA 5AF9H 3ZZCA 2ZTXA 3ZZAA 1LKAA 2OC0A 4YO9A 2ZEBA 1LHEH 1TONA 3BTGE 4OS5A 1THSH 3PM3A 3SORA 5JBAS 2P59A 7ESTE 7KMEH 1SGYE 3E6PH 1N8OC 2ZGJA 3EE0B 5GPIB 5LPEA 5JPMH 2FO9A 1XVMA 1FQ3A 1ETSH 1HDTH 3P8NA 1C2JA 3AAUA 3S7KB 1S6FA 1LCYA 4IGDA 2J9NA 1W2KH 3SU5A 2K1QA 4NSVA 3M3VA 2GMTC 1OKXA 4ZHMU 3SJOA 2F9UA 4X6PA 1EOLA 3Q77A 1VR1H 5AHGH 5E0JA 2FI3E 2OINA 1G37A 4CREA 5DJ7A 1W0ZU 1Z6JH 3F68H 4PROA 3ZVFA 4YM9A 2ZHEH 4B71A 3RXFA 5C67A 1MKWH 2PR3A 4X1SU 3W94A 1YGCH 4VGCB 4UD9H 3A80A 2D8WA 1PYTC 2R2WU 3DA9B 1DY8A 4CR9A 7GCHG 1ACBE 2VWNA 3SV9A 1J14A 1PPFE 3OSYA 1G3DA 3GY7A 2C4FH 3P17H 1H9LB 1DY9A 1BMAA 4O3TA 3IWMA 1EJNA 3M37A 1T8MA 2GD4B 5ESTE 3RUOA 1EUFA 1ZZZA 4CHAB 1CQQA 4X1QU 1FN8A 1MTUA 1TMTH 1C2MA 1C1UH 4U30A 1QURH 2FOGA 3RC6A 1O3OA 4BNRA 3GCTG 1UTKA 4KTCA 4DGJA 1QHRB 2VVVA 5C1UA 1V2PT 2OC7A 1O2TA 1OWHA 7GCHF 1AWHB 1NU9A 4MPUA 1T7CA 5T3HA 2ZKSA 4ZKRU 1YYY1 2V35A 4NG9H 4K60A 3SHAH 1THPB 4MPWA 1C5YB 5E0GA 1G9IE 1P03A 1GHYH 2FIRH 4MLFB 4Y79A 3GY2A 3UUZA 5A8YA 1ARBA 2O8UA 1VGCB 1GBTA 2FOCA 4J1YA 1FY1A 3GCTF 4MPVA 1Y5UT 1E36B 1QL7A 1DDJA 1ZYOA 4B1TA 5JBTA 1MKXH 1BZXE 3RXIA 1UCYE 4SGBE 1FIZA 1C5PA 1O3MA 3ENSB 3Q76A 3SGAE 1KYNA 1ELFA 3SBKA 3P6ZB 3A8BA 3UR6A 4TPYA 1TX6A 1UJ1A 4KTSA 2WPHS 5F03A 1B0FA 2C90B 2HVXA 1SI5H 1SGFA 1IQMA 3P8OA 4Y11E 1FNIA 3JZ2B 4AOQA 3RU4E 2PSYA 4ZUHA 4Z0KA 2AFQB 2ZGHA 4H6SB 1QL9A 2FOBA 2LPRA 1CGJE 1LO6A 3SNEA 2A2XH 2DE8A 1S0RA 2ZIQH 1BTYA 4Y7BA 2FP7B 1DSTA 1MTNC 5C3NA 5DP5A 2ZFRH 1WQVH 1TX8A 4F4OC 4GHQA 4A1VA 1OP0A 1EXFA 1WTGH 2V3HH 1KXBA 2A7CA 1K22H 1PQ5A 1GDNA 3UREA 3GCHC 1SVPA 1BBRK 1W3CA 1HFDA 3A86A 3RXJA 2Q1JA 3EDXB 1C9PA 2P3UB 1SQOA 1K1OA 3QWCH 4Y8YA 1BB0B 1W13U 2HNTE 2ZQ1A 2W3KA 2DUCA 3P8FA 3TVJB 3LJOA 3MI4A 1O2LA 1DLKB 4K69A 4UEHH 3S7HB 1EKBB 2TRMA 3CENA 2EI7A 2H5CA 1AMHA 1C1PA 2QCYA 1ZRBA 3RXVA 3V0XA 2O8WA 1IQEA 3QGNB 1OYTH 1V2RT 1MZAA 2J95A 4OGYA 3GISB 2BQ6B 3U9AH 1LHFH 4MDSA 2H9TH 1BHXF 1XXDA 1GHXH 1A3EH 2AGGX 2ZO3H 2Y5GA 1HJAB 1HNEE 4X8SH 2QGRA 4GCHG 2A0QB 3LGYA 1C5OH 2QXGA 1MQ5A 1O3AA 2ZPRA 3D62A 1CA0B 1P2NA 2Y5HA 2G51A 4IN2A 1P3CA 1T4UH 1O2NA 1YP9A 1EB2A 1D4PB 2WPKS 1O3PB 1LPZB 2C8WB 2XBYA 3LGTA 4KELA 1KXFA 3U69H 2BB4A 4K8YA 2V0BA 5AFZH 1Y8TA 1GJ8B 2BX4A 2WPJS 4GCHF 1Y3XA 1BITA 1FPHH 3V3MA 1WBGB 4AORA 2TIOA 1NU7B 3IITA 1V2NT 1GDQA 1Q31A 1IAUA 3I77A 1UVOA 9LPRA 4FUJA 4K3JA 4IBLH 5SGAE 1C2KA 1TA6A 1O2RA 1ELEE 5J4QA 1D3PB 2ZI2H 2OUAA 1GI4A 2ZU4A 1TNHA 3H7TA 1O35A 4ZHAA 1NZQH 4XDEA 3BG4B 1MTSA 1EAUA 4B74A 1UVPA 1J8AA 3SHCH 1UTLM 1SGTA 4GUXA 3TITA 3T62A 1WUNH 3LGVA 2ALVA 3RP2A 4K8BA 3ZVDA 3B9FH 1JMOH 3A7VA 4GPGA 1Q3XA 1PPGE 2TGTA 4GLYA 1W0YH 1TRNA 1VITH 4E7NA 1LTOA 4O03A 2Z3EA 2GZ9A 2BLWA 3ZZ7A 1TQ0B 3TNSA 3VPKA 4UFEH 3GY6A 2VIOA 5I25A 2OC8A 1TALA 1G2MA 3TK9A 4I32A 2Z6BD 4ZH8A 1PPEE 1SGRE 1ZJKA 1C2GA 3SNDA 3Q3KA 4UFGH 3BG8A 1EJMA 1INCA 4CH8B 1AU8A 4UONA 4Z6AH 3S9AA 4DURA 3LIWA 1TMBH 4K1EA 1C1QA 4DJZB 2BQ7B 5G4BA 2GV6A 1K9OE 2BVRH 1XUJA 1O2HA 3MYWA 2PTNA 3LU9B 3AAVA 1S6HA 3LOXA 2FLBH 1VITG 3PLPA 3UWJH 1K1MA 1V6DA 2BX3A 3ITIA 1E0FD 1H1BA 2STBE 3A85A 1K28D 2H6MA 2JETC 2VGCB 1ZHRA 2Z9KA 1O3EA 1FI8A 4MTBA 1CGHA 1YPJH 2RDLA 3LGUA 1NC6A 1TOCB 4FUDA 4I33A 5B6OA 3KN2A 1ZSKA 1ZTLA 2RCEA 5L2YH 2VIPA 5GJ4B 1C1WH 1ELAA 1A0JA 2BDBA 3F6UH 2ANYA 1IOEA 1GBBA 2CMYA 3SV2H 1VITF 2WPLS 2WV5A 1ANBA 4K2YA 2UWPA 1WV7H 3DUXH 1F5LA 2F91A 2SGQE 4NIXA 3L3TA 1YBWA 3BTDE 2ESTE 5DPAA 2QC2A 5CHAB 1H9IE 2BD9A 1QL8A 4NIWA 3PLBA 2ZZUH 4JZ1A 3URCA 5A2MH 3DFJA 1DANH 1IQNA 3KHVA 2WYGA 1HBTH 2F9VA 8ESTE 1MKXK 2BDYA 1TGBA 4XBCA 3RXPA 2B7DH 2ASUB 1SMFE 2O8MA 2Z9GA 4Q2KA 5FCKA 2ZFSA 2QYIA 2G00A 2SGFE 3FZDA 1TGSZ 2VVUA 3Q3YA 3RMNH 4CRAA 5C5NA 3O8BA 2R0KA 3E16B 1A5IA 3QTVH 3VXEH 3MO6A 2BXTH 4NSYA 1GJAB 1O30A 5BPEA 1QFKH 1W14U 2WINI 1GI5A 4FVBA 1V2VT 4IW4E 3Q3XA 1BT7A 2Y7XA 2XBXA 4JYVH 1GJDB 2ILNA 3Q00A 5EPNA 3G01A 1CE5A 1HXEH 2ZF0H 1T8LA 2QY0B 4XE4A 3ZVGA 3M7TA 5DK1A 2HOBA 5A8ZA 2Y6TA 1GBFA 1X7AC 1Y5AT 2PGBB 5LPRA 1SGQE 1XUGA 3BV9B 1SLUB 3SU2A 3LDXH 1MUEB 1Q2WA 1L1NA 1SOTA 2GP9B 3KQCA 1VJAU 1WYKA 3PMHB 3LT3A 4GSOA 2C93B 5JB8S 4YOGA 1KLTA 3SU6A 1RRKA 3ZV9A 1TBRH 5EW2H 1ESAA 1J15A 1AFQC 5EW1H 4JMYA 2HRVA 2CHAC 2FXRA 1CT2E 3STIA 3LC5A 1NS3A 1P2QA 4JK5A 3M5LA 3AW1A 1ELVA 2A31A 1V2MT 3SGQE 3KIDU 2LNCA 2BHGA 1P10A 2HGTH 2Z9LA 2BY8X 1TIOA 4K1SA 2FI5E 4AB8A 2WUCA 4GAWA 3RMLH 4Q7YA 4WH8A 1LVOA 1UK4A 2NU2E 1XM1A 1TBZH 1ELCA 2GDEH 4B75A 5IYTA 1SOZA 2ZDAH 1TGNA 3UTUH 2GT8A 2SGEE 5K7RA 4H6TA 1O3GA 1BMLA 1A5GH 1WQSA 1Z7KA 4FUBA 2F3CE 3RXAA 3SU0A 1GCTB 1MU6B 3S9BA 1V2LT 1JXPA 1Z8GA 4JZIA 1EZXC 2VIVA 2BOKA 4YESB 4AG1A 1TA2A 2R2MB 2G5VA 4WJG2 1LHCH 4RN6A 1UVUH 5EXMA 3HKJB 4K1TA 3BTTE 3RXQA 1D3QB 1HAYB 3ZZ3A 1GBHA 4FUGA 1YF4A 3LH1A 1TNGA 3F9EA 1ZPBA 4ZXYH 1MZDA 1L1GA 4IMZA 2PV9B 3VB3A 1T4VH 3O8CA 1KSNA 2FOMB 3MU5A 3U1JB 4WH6A 4SGAE 1TMUH 1KXAA 1RIWB 2B8OH 1AN1E 1G2LA 1O2MA 2P16A 2UUJB 3K6ZA 4I8GA 1GVZA 1IQIA 2EA3A 4BANB 2GGVB 1S82A 1WTHD 5CMXH 2ODQA 1DPOA 3GCOA 4NGAH 3TH3H 5CE1A 5DGJA 2BVSH 2PKAB 5E2OA 3ATMA 3EYDA 1DFPA 1NRQH 4NIYA 3E0NB 3LKWA 5EQRA 3N7OA 4A5TS 4A7IB 5JBBS 1C2EA 1TAWA 4KP0A 4B2AA 1SSXA 2ZDNA 1LQEA 3STJA 1O3KA 1TNLA 1NY22 2ZU2A 1VCWA 5E8EH 4CRCA 2TGDA 5GXPA 3TGIE 3S69A 1KTSB 1UO6A 1DICA 4NZLA 4XSKU 1DXPA 1W12U 1C5RA 2JKHA 5EXLA 1FN6A 2TPIZ 4OGXA 2VIQA 1QA0A 1GJBB 1E35B 2GZ8A 1S85A 2NU0E 1DVAH 4RKOB 4AB9A 5E2PA 1QY6A 1JOUB 1QQUA 1B0EA 6GCHG 1SGDE 1ZTJA 1CHOG 1O34A 3ODDA 1J17T 2BD3A 4OS7A 1AVGH 2OBQA 1LPGB 4F49A 1GI8B 4AFZA 4MPXA 4HTCH 1GBCA 3OY5U 4I31A 4TYDA 4KTUA 1FJSA 1AY6H 2EC9H 2XWAA 1ETTH 3MH4A 3S9CA 2BY9X 1BJVA 1IHSH 4YT7H 1O32A 3KCGH 1ZR0A 2PKSC 4X8TH 1UCYH 5PTPA 1MQ6A 2BD7A 2A5KA 1TLDA 2ULLA 6GCHF 1CHOF 3VGCB 1OYQA 1C4V2 1TWXB 2P94A 1NROH 1GVKB 1AFEH 3MNCA 1MTWA 1EOJA 2TGPZ 4ABGA 2ANMH 3T27A 1GJ4H 1KLIH 2PUXB 2J92A 4ZKNU 1GJ6A 1C2DA 1RFNA 5LH8A 1CGIE 4QT8C 2ZHWH 2ZWLH 1ZSLA 1NFYA 2BD2A 3T26A 2FOHA 1MAXA 2IOTA 3TPIZ 2BXUH 4DVAU 5FBIA 4BAKB 1ABIH 4AYYB 3RXTA 1JBUH 1P0SH 1DS2E 2FM2A 2SGPE 3SGBE 2W5EA 1Z8JB 1DWEH 3NK8A 4X1NU 1PPHE 5FPYA 1TYNA <