3PO1B

Thrombin in complex with benzothiazole guanidine
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
147
structure length
147
Chain Sequence
IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Thrombin light chain
publication title Discovery of benzothiazole guanidines as novel inhibitors of thrombin and trypsin IV.
pubmed doi rcsb
total genus 27
structure length 147
sequence length 147
ec nomenclature ec 3.4.21.5: Thrombin.
pdb deposition date 2010-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3po1B00
2SFAA 2FMJA 1GI7B 1C5NH 1LVOA 3KQCA 3R3GB 5DP3A 4GVUA 3GCTF 3SUEA 1HIAA 1GBJA 1QTFA 1SHHB 3ZVFA 1V2NT 2B0FA 2VIVA 4AFQA 1GJBB 1O5CB 1P2OA 3RXGA 4DIHH 3VB7A 1K9OE 4OS7A 1GI5A 3PTNA 2VGCB 3RU4D 1BRUP 1MTNB 2BY5X 2Q6FA 4ABEA 1F0RA 3RXEA 3QX5H 2C8YB 3PV4A 4TY7A 3F68H 3T25A 2ZKSA 1SGYE 3BF6H 3A7TA 1A3BH 2F9NA 2BX3A 2ANKH 4MPVA 4Y7BA 3KL6A 1RS0A 3S69A 3RXBA 2QXHA 1GCTC 1K28D 2H9TH 2STAE 2EI6A 2A5IA 5GCHF 1VGCC 1TRMA 3SU1A 1Q31A 1TNLA 4DIIH 5EQSA 1F5KU 1FDPA 4YTAA 5JDUB 1GHXH 2AS9A 3EGKH 3MNCA 1NRNH 5GXPA 3NK8A 4AOQA 2F9VA 1C1SA 3GDUA 1QY6A 2F91A 1EOLA 3LOXA 1EXFA 2SGDE 1GPZA 4OGYA 1SC8U 5C5NA 1XKBC 5J4QA 1BJVA 1TABE 4QT8C 3UWJH 1W11U 2LPRA 4JYUH 2P59A 4U2WA 4MQAA 1IQJA 3SUDA 5A8ZA 2KAIB 3U98H 5B6OA 4DVAU 1A1RA 4XSKU 1SQOA 3A7VA 4YESB 5A09A 4XBDA 5C1UA 3FFGA 1G3DA 2OC7A 1AKSA 4NFEA 1G36A 1GMDF 3TH3H 1FLEE 3QN7A 4ZKSU 5FPYA 3LDXH 1L0ZA 2WV4A 1EPTA 1XUFA 2W3IA 1K1IA 1S82A 5CHAB 1QFKH 1P02A 4CR5A 1E0FD 1C2FA 3ATIA 5ETXA 1QNJA 3TH2H 1C1NA 1O36A 3RXQA 1O3OA 1Y5AT 2ZG0H 1F2SE 5EXMA 3RXPA 3BG4B 1P05A 4UD9H 2BDYA 2BY7X 3P95A 1O2ZA 7GCHF 2FOFA 1EB2A 1LKBA 1OWKA 1P2JA 2I6SA 5DPAA 3QWCH 3RMLH 3UNRA 4WMDA 1BTHH 1DOJA 2AIQA 1O5BB 1GWAA 2ZI2H 1P11E 1W10U 2F9UA 2G8TA 2EC9H 4TPYA 3SUGA 4MNYA 2RA3A 1GL1A 1ZPCA 2A5KA 2Z9KA 3GY3A 3AVZA 1BRCE 1K1PA 2Y7ZA 4RSPA 2R0KA 1C2MA 3SNEA 4YM9A 1L1GA 2ZU1A 1MZAA 1CGHA 3SI3H 3SZNA 5IYTA 3GCOA 3H5CB 1O2QA 1BT7A 4MPWA 1KY9A 2PUXB 3GCTG 2BOHB 1RIWB 2AGGX 2FYQA 1C5YB 2J2UA 3SQEE 1G9IE 1TONA 2GT7A 1GBIA 1S81A 5FXLA 1PQ7A 4A5TS 1NRRH 2A4QA 3M37A 4AZ2B 1QRXA 3E0NB 3TPIZ 1C5MD 1D3TB 1SGCA 1AO5A 1Q3XA 2Y5HA 4X1NU 5GPIB 4NZLA 1RTLA 1P09A 2BXUH 4K1SA 1HAVA 1TRYA 3MI4A 1SG8B 3VFEA 1S83A 1T8NA 1O2YA 1V2JT 5C20A 1GBCA 1SSXA 5E0HA 4U32A 2BQ7B 2NU3E 4ZHLU 1ANEA 2BD8A 1O2UA 2BM2A 3A89A 4CRFA 5DGJA 1HAHH 2FXRA 1EZUC 1ZGIA 1BHXF 1W12U 2H5DA 3RMNH 3MHWU 1GG6C 3TK6A 3BSQA 3P8GA 5C3NA 4NZQA 1P2KA 2ANWA 4ZH8A 3MU0A 5A0AE 6ESTA 1NRPH 1JMOH 5AFZH 1EZXC 2FS8A 3SNBA 2Q6DA 5F03A 3TJOA 2Z9IA 4DURA 3SO3A 1RRKA 1RD3B 1HJAC 3KQDA 3K2UA 3U9AH 1Q2WA 3NKKA 4YOJA 2UUJB 1BMAA 3UQOA 7ESTE 1A7SA 1P2MA 2GMTC 1XUGA 1VCQA 1TNHA 2ZU2A 1LDTT 4FU9A 3S9CA 1AGJA 4TPIZ 4AYVB 7GCHG 3A8AA 3AAUA 1LHFH 4CHAB 1TWXB 3ESTA 3TK5A 3UIRA 3IG6B 2Z7FE 4KELA 1LHDH 3RMMH 5C1YA 1BMMH 3ATKA 4IW4E 1D3DB 1MCTA 2Y5FA 4GUXA 1OP2A 3BG8A 4Q80A 4D7FA 1A2CH 5DP8A 1VITG 2FWWA 4K1EA 4NA9H 3MU4A 2B5TB 2VIQA 2Q6GA 5HXFA 2KAIA 5L30H 1MD7A 1UJ1A 3DD2H 1YPMH 2A5AA 1IQNA 5HGGA 1TNIA 3W94A 3RDZA 1UCYH 2ZCLP 4SGBE 1N8OC 1C1RA 1ESAA 1O3EA 4Z6AH 3D62A 1P01A 3KNXA 2QAAA 1TA6A 2BD7A 2BDIA 4SGAE 5DG6A 1O2OA 2HPPH 3Q76A 2AEIH 1UHBB 1O5FH 4WJG2 1TMBH 5EQQA 2R3YA 1YLCA 4HFPB 1MKXK 2HNTF 4KKDA 4ZHMU 1C5WB 4DCDA 1SGQE 3EA7A 3K6YA 1SLUB 4ZXXH 1FV9A 3TNTA 3QK1A 4X1PU 1VJAU 3BTDE 2HRVA 2QF0A 2TGTA 1BDAA 2FLRH 1WCZA 2CHAC 4BTTB 1OXGA 2BMGB 3AAVA 1CSOE 1GBAA 3RXIA 1O31A 2NU4E 2AMQA 5FHTA 1SOTA 3BTWE 2FZZA 2O8UA 3SHAH 1O5AB 5CE1A 4ISHH 1C1UH 1FJSA 1T32A 3MFJA 1ARBA 2GX4A 1Y3UA 1UO6A 4FU7A 3U1JB 1MU6B 3VB5A 1GHYH 1ZTKA 3MH6A 5J4SA 1NU7B 1XUKA 3D49H 1HIAB 1IQLA 1ZSLA 1G37A 2VWOA 1O2KA 1IQKA 4WF8A 2Z9JA 4CRBA 1GMHG 2ZZUH 1MTUA 3ODFA 1V2PT 3ZZDA 2J92A 2ZHFH 2O8WA 2SGAA 1AY6H 1O3JA 2RDLA 5T6GA 1WQVH 1GJ5H 4AGJA 3STJA 3RXHA 2H1UA 5EG4A 3VXEH 5L6NH 1D4PB 5LPEA 2WYGA 1DANH 2QC2A 3FZZA 2ZFQH 2ZPSA 1SB1H 3CP7A 5A0BA 3DA9B 1UK3A 1ELGA 3P8FA 1P2NA 3L3TA 2FDAA 4AB8A 2WPHS 2GT8A 1W7GH 1FPCH 1MQ6A 1O34A 1ABIH 2C8WB 3BN9A 4FUHA 4AN7A 2BDCA 1QBNA 4RKOB 2Z3CA 1C5ZB 4H6SB 1Z8RA 3M35A 1A0HB 1YBWA 3EYDA 2NU0E 1YLDA 1TB6H 4Y8XA 2G55A 5LGOA 1ZMNA 4O9VA 5LPRA 1O39A 1YCPH 4CRAA 1GBEA 1IQHA 1ZPZA 3ZZ4A 3ZZCA 1BJUA 1C1OA 2G4TA 3ELAH 2FLBH 3M5OA 1AIXH 2O8MA 1EAWA 1DWCH 3QDZB 3VGCC 1CU1A 4BNRA 1NZQH 1L1NA 4NFFA 4LOYH 3ZZBA 2GCTB 1P03A 3LGVA 4MPXA 3F6UH 1AKSB 2OUAA 4AB9A 1P57B 3UREA 3MNXA 2ZDVH 7KMEH 1AZ8A 3SV8A 2ZHQH 1GJ9B 2BVXH 1GJ7B 1ACBE 1TNJA 2AERH 1E34B 1J16A 4ABIA 1OWEA 5E0JA 5HM9A 2EI7A 2ULLA 2Y80A 1ELAA 2AFQB 1HCGA 5JBBS 3E0PB 1O37A 5E2PA 1J17T 4JMYA 4R8TB 1HUTH 1IAUA 3NWUA 3PLKA 5C67A 3U8TH 4YZUA 1V3XA 4AX9H 3SNDA 9LPRA 1S6FA 1GDUA 1Z1IA 2F9BH 3MO3A 3A88A 3MWIU 2FTMA 2Z3EA 3UOUA 1TAWA 2CMYA 4XFQA 2VWMA 2R3UA 4IBLH 3RP2A 1CGIE 5C2ZA 1QB1A 1A5IA 3GISB 1QGFA 3KF2A 2NWNA 3JZ1B 2BY9X 3G01A 2TRMA 3MNBA 3L33A 4WXIA 3T27A 1E35B 3FVFB 4LK4A 4MNWA 2GZ7A 3T28A 2EI8A 4FXGH 5FPSA 1V6DA 1C2KA 2BTCE 2FODA 1B5GH 3A8DA 3RC6A 5SGAE 2J95A 1H9IE 2ZFRH 1O3MA 3TGIE 3SJKA 1AE8H 3GOVB 4K60A 3P17H 1UCYE 3FANA 1MCVA 4KP0A 1SI5H 1KLJH 4UONA 3MU5A 2BYAX 1FAXA 3BIUH 4UFEH 1EJMA 5EU8A 3ZV8A 1O2NA 1GI3A 1UVPA 1BTYA 5JPMH 1C2DA 1MMJN 2OC8A 1ANDA 1SGFA 3LC3A 2PGBB 4BAOB 1T8OA 3DFLA 2ANMH 1P3CA 1TBZH 3DHKH 4GCHG 4NIVA 4WY3A 1O3FA 3MOCA 1FPHH 2R2MB 1PPCE 2WUCA 1VZQH 2GCHG 5TJXA 2Q1JA 3E6PH 4A7IB 3HK3B 1OSSA 3RXMA 1T8MA 4OS6A 3VB3A 1Z1JA 1SMFE 3O8BA 5EPYA 2ZGHA 1C5OH 2J4IA 2C90B 4UFFH 2O8TA 1Z8IB 1GGDB 2IJOB 4K8YA 2Z94A 1GI0A 2GP9B 2HLCA 4AFZA 3M5LA 1DLKB 1YPJH 1FY1A 2ODQA 2FIRH 4VGCC 1KTTB 3EA9A 1QCPA 2A7JA 1O2PA 5A0CA 2A4OA 2YNBA 3EAJA 1XUJA 4OS1A 2J94A 1ELFA 1FI8A 4J1YA 5EXNA 3U8RH 2A32A 2PKAA 1C4V2 1SGFG 2BY6X 1BRBE 1ELVA 1FUJA 4K1TA 1GDNA 1GBKA 3UFAA 1DY8A 1XVOA 1WV7H 1BITA 2OBQA 3LH3A 1OPHB 3VB4A 1O2WA 1TOMH 4ABDA 3F9GA 1ETSH 1QA0A 1GCTB 1MKWK 4JYTA 3E3TA 1BUIA 3PMHB 3SU4A 1G3CA 4X6MA 1VGCB 5DP5A 4LXBH 1HLTH 4YLQH 1BBRK 1ESBA 4R0IA 1QQUA 3FP7E 1G3BA 4OS5A 4O03A 1LQDB 4ZAEA 4X6PA 4XBCA 1O2IA 2Y6TA 3MO6A 5T3HA 3GCNA 5AVDA 1TMTH 3PROA 2A4GA 1G2MA 2SNWA 2IPHA 3N7OA 2PKSC 4DJZB 3RU4T 2W26A 2BY8X 1V2RT 2QXGA 2H9HA 1AN1E 1DFPA 4AG1A 3A85A 1ZJKA 2OD3B 1WAYB 4A1TA 4CR9A 1TA2A 2TBSA 5GWZA 1C2EA 1QJ6B 3Q77A 3LGWA 3EA8A 3M5MA 1YPEH 5T6DA 5JB8S 1CT2E 1PYTC 1BTXA 1Z7KA 1JWTA 1O3HA 4YLUA 5EODA 2ZCHP 1J8AA 1V2UT 1GBHA 1W8BH 4OGXA 4CRDA 5F8XA 3STIA 2ZFFH 1C1MA 2FOHA 4BXWA 1W2KH 1TNKA 2FX6A 1D6WA 5EQRA 6CHAC 1IQIA 1O2JA 4FVBA 4D7GA 2GDDA 1C5RA 3KEEA 1MTVA 2EA3A 1O5DH 1FN8A 3F9HA 2FM2A 1KIGH 1EB1H 1M9UA 2D26C 3C1KA 2XWBI 3HKJB 5L2YH 1CT0E 5ESTE 3RXOA 1V2MT 3S0NA 2ANYA 1VITF 3GCHC 1QIXB 2GZ8A 2XBXA 2JETC 1FONA 3FZDA 1TQ7B 2V3OH 2HPQH 3LKWA 4AYYB 1FZZA 2YNAA 1UTLM 4UE7H 2BB4A 1LVMA 3RXSA 4MVNA 3UNSA 4ZXYH 2BVRH 3ZZ6A 2H9EH 3KN2A 3SJOA 4Q7ZA 2BVSH 2BD2A 1CBWC 3ITIA 2R9PA 5FAHA 1GBDA 1Y59T 1DY9A 4NIXA 3SNCA 4BAQB 1SQAA 2OP9A 4HZHA 1W14U 2OQ5A 3LC5A 1LKAA 2WYJA 4NA7A 1GBFA 5K0HA 1V2KT 4NWLA 2P3TB 2G5VA 2JKHA 1P9UA 1T4UH 5DP6A 2ZWLH 1T31A 1UTQA 1A61H 2LNCA 4OS2A 1F0SA 1YPHC 2SGEE 2WPKS 3BTGE 5EPNA 4BAHB 2IN2A 4Y0ZE 1AWHB 2VIDA 4ABJA 2ZIQH 3SW2B 1ZR0A 1SPJA 5DP4A 2J38A 2NU1E 3O8DA 3ZZ9A 1GBBA 3IITA 3QO6A 5HM2A 4TWWA 4Q7YA 1THSH 2ZC9H 4I8KA 1KXAA 2GKVE 3SV6A 3BTME 3ATMA 5T6FA 1Y3WA 2F3CE 1ZMJA 2XYAA 4X8TH 2JH6D 2HNTC 2XCFA 4HGCA 1ELEE 4YT7H 3TU7H 2A45B 2JH5D 4U01A 1F92A 3RLYH 3I78A 1O3GA 4ABFA 4A1XA 1TBQH 1HAXB 2P93A 2THFB 4INKA 4X1SU 1YGCH 5EW1H 2QF3A 1GG6B 3Q3XA 1NESE 1Y5UT 1GMHF 1MBMA 1Y3XA 3RM2H 2V35A 3P6ZB 1HJ9A 2IOTA 3DUXH 2C8XB 3SHCH 3LGTA 3OY5U 2DUCA 1SLVB 3MH4A 5F8ZA 3KCGH 3GY2A 1W0YH 1GVZA 1SL3A 1AQ7A 5BPEA 1PPZA 1YPHE 1HJAB 4Q7XA 2PHBA 3SNAA 3UR9A 3KHVA 1GJ6A 3A86A 1HB0B 4Y8ZA 2Y82A 1PPGE 3T26A 5LPFA 2OXSA 1NFXA 2WPMS 3I29A 1NO9H 2A2QH 1GJDB 9ESTA 2TIOA 2ZHWH 3B23B 1QA7A 2P16A 2V6NA 1TPPA 4XBBA 3IWMA 1ZTLA 1GJ4H 2HNTE 1F5LA 3QUMP 4IN1A 4Y76A 1P10A 1BOQA 4PROA 1QL8A 1MKXH 1O3DA 1WTGH 2J9NA 2B8OH 4XOJA 1DICA 1KXDA 3BV9B 3NXPA 1CA0B 1LTOA 5DKMA 1MBQA 1FNIA 2ZDNA 2RCEA 3T29A 3R0FA 1AB9C 1RTKA 3MNSA 1H9LB 4NIWA 4Q2KA 1AFQC 1GBTA 2FI4E 4K8BA 1S0QA 1QHRB 1UTNA 3PLBA 1JIRA 4IS5A 1QBOA 1EAUA 3O8RA 1V2OT 1NY22 4CREA 1OKXA 2BQWB 3V12A 1N8OB 4WH8A 5FX5A 2SGFE 4JYVH 3BEUA 2GD4B 4JK6A 1UTJA 5JYIA 1GI8B 3LJOA 5CMXH 1BMLA 4A92A 1TQ0B 3Q3YA 1ETTH 4WVPE 3GY6A 4YOIA 4AG2A 1EX3A 1BTUA 1FAKH 1V2ST 1ZGVA 3QZRA 2H5CA 2PLXA 5L2ZH 2WPJS 2UWOA 4NGAH 1XXFA 3I77A 1FQ3A 1NPMA 1TGSZ 2GV7A 2HOBA 3OSYA 4Z0KA 5F6MA 4K5ZA 4E7RG 1H8DH 3TITA 1T7CA 3V13A 2ZU5A 1LHEH 2PTCE 1JOUB 1WTHD 2A1DB 2WPLS 3MMGA 4ABBA 2GTBA 1C2GA 1K22H 4KGAA 1JXPA 4I7YH 2O8LA 1SOZA 1ZSJA 2W5EA 4BOHA 1GBMA 2OC0A 1A5HA 3HPTB 2CHAB 1L4DA 4IN2A 3AASA 4A1VA 1SLXB 2XBYA 3ZYEA 1MTWA 1PFXC 4MG3A 1XVMA 1TNGA 4A6LA 4D8NA 5AFYH 1O3IA 2ZFTA 1QJ7B 4D76A 1C5VA 1BQYA 1DPOA 1MD8A 1GI4A 4JZEH 1FY8E 3LGUA 2BLVA 1N1LA 1OS8A 1P3EA 2VJ1A 2VIOA 1O2VA 4F49A 1NU9A 1PPFE 4O3UA 3D23A 2C4FH 4F4OC 1EOJA 2PKAB 3RUOA 3DT0H 1UVOA 4FUDA 3RXRA 2ZU3A 3DFJA 1F5RA 1QBVH 2GDEH 2XTTB 1W3CA 3E16B 1MAXA 4LZ1H 3MU1A 4ABAA 4GLYA 2ZTYA 3P8OA 2UWLA 2BDBA 2ZA5A 2WV5A 1OYTH 4U30A 4AFSA 8GCHF 2ZFSA 3CS7A 3M36A 4DT7B 1K1JA 3ZZ3A 2XWAA 2OINA 3GY5A 1WYKA 4GCHF 4KTSA 2BZ6H 2ODPA 1SGNE 2TGPZ 1GHBF 1DUAA 1DXPA 4INLA 1LPKB 1DWDH 1NT1A 1ZJDA 2A31A 2GCHF 1CA8B 2ALVA 4Y79A 6GCHG 2UUFB 1GVLA 1FIZA 4NCYA 1CE5A 1YCPM 2VINA 2CN0H 3ENSB 1Z8GA 3VEQB 5EW2H 4IGDA 2HWLB 2VIWA 1IQGA 5DP7A 2WUBA 3T2NA 1TPSA 1WOFA 4AGKA 1O2TA 1ELDE 3F9EA 3LT3A 1TYNA 1GI2A 1O3LA 1VITH 3A7ZA 2PWXA 5H4IB 1E36B 1QB6A 3CENA 1S85A 2UUYA 1UTPA 3VGCB 2G4UA 1O3KA 2XRCA 1OWHA 4FUCA 3S7HB 4B71A 3QTVH 1H8IH 3PMAB 1L2EA 1UTKA 3E1XB 4YOGA 5PTPA 1BB0B 4IC6A 4Y71A 2BD3A 3A7YA 1AI8H 1QL9A 1TLDA 3UQVA 2PR3A 3KQBA 3SGQE 1SGDE 3PO1C 4D9RA 1MZDA 1ZZZA 3BIVH 3PM3A 2XBWA 1EATA 3QZQA 1K1MA 5ESBA 1C4Y2 1XUHA 1F0TA 1K1OA 5A8XA 2HVXA 1E38B 1EPTC 1NFWA 4AORA 1LVYA 1FY3A 1AHTH 2EEKA 4HTCH 1EJNA 3B9FH 1NRQH 1DWBH 4GSOA 4X2WA 5E2OA 4X2VA 3SORA 1YCPK 2ZDLA 3M3TA 4JZDH 3RXVA 4I8LA 1KLIH 1Z6JH 2QV1A 4ISIH 1KLTA 2AYWA 2G52A 3MH5A 1GMCF 2ODYB 1BTZA 2SNVA 5DJ7A 4GAWA 1OP0A 1HRTH 2I6QA 2QYIA 1XM1A 3GY7A 5E8EH 4X6OA 2XC5A 1FXYA 3E90B 3E91A 1XMNB 1TGNA 2ZECA 1FMGA 2ZGBH 2STBE 2V3HH 5AHGH 1AE5A 1SGTA 5GDSH 3UTUH 2BLOA 1SGEE 2ZP0H 2A2XH 1TX7A 3ZZ8A 1UVSH 2TGDA 1Y8TA 3RM0H 2FOEA 3V3MA 1SGRE 1KDQA 1O2MA 4ZKRU 1BIOA 5HYOA 1EKBB 3VPKA 4B75A 1ETRH 1YYY1 1CGJE 1EZSC 8LPRA 1S5SA 1OX1A 1C1TA 3SQHE 8GCHG 1O35A 1LMWB 2ILNA 1HDTH 1KXBA 4B1TA 2BX4A 1ANBA 1DX5M 4BXSA 2ASUB 4JCNA 1A46H 4LZ4B 5A8YA 1UTOA 1GHBG 2BZAA 3HATH 2Y7XA 4UFGH 1TOCB 2CF9H 1HNEE 1DS2E 1QB9A 1JRSA 4X1QU 2M5TA 5FPTA 5JBAS 5DK1A 4B76A 3RC4A 3QLPH 4BANB 2B9LA 3RXCA 4JK5A 3SU2A 4ZKNU 1YPKH 1NC6A 3M61U 5EGMA 2P8OC 4CRGA 4NSVA 1BBRH 3VB6A 3TIUA 2FOBA 1O2SA 1NRSH 1H9HE 1HFDA 4VGCB 5GJ4B 4I8JA 2B7DH 1QL7A 3A7XA 1ZTJA 1DXWA 2FTLE 1U6QA 4INHA 3HK6B 3RXUA 1FN6A 1AVWA 3M3SA 3FAOA 2R0LA 2BD5A 2ZDAH 2XC4A 3EE0B 3M7QA 1TBRH 1OWIA 1WUNH 2BDHA 1UMAH 2QN5T 2VGCC 1TPAE 1MTNC 1O0DH 2F9OA 1BCUH 4UFDH 2FOMB 2UUKB 1ELBA 1SGPE 2OCVB 4JZFH 1O3CA 3RLWH 2VH0A 4IMQA 5A2MH 4MLFB 1GHZA 2XNIA 2G51A 1HJ8A 1CO7E 1ID5H 1HAOH 2AGEX 2FOGA 1KXFA 2FS9A 1C5LH 3BTTE 2OC1A 3ZVAA 1V2TT 1O2HA 1AU8A 2ZDMA 1C2IA 4FUJA 1CHGA 1GHAF 2XXLA 1O5GH 3MYWA 1GMCG 1ESTA 2W7SA 3TJUA 3RU4E 1HAIH 3JZ2B 1IQEA 1GHVH 2QA9E 4RKJB 4IMZA 3SU3A 1XKAC 1EAXA 2D1JA 1O3BA 1YF4A 3AW0A 3A83A 1TGTA 2PKSB 2ZGXH 2PUQH 3UR6A 1AUTC 2QIQA 4NIYA 1C4U2 1DUEA 4Y0YE 3QGNB 2A4RA 2ZFPH 4BTUB 4ZMAH 1C9PA 1LO6A 1V2QT 2G5NA 3KQEA 1ZOMA 1W7XH 1DT2A 3OU0A 2V0BA 3SV7A 4E7NA 1T4VH 3GDSA 3SGAE 2XCNA 1BA8B 1P0SH 4X0WU 3BTKE 5BRRE 1HXFH 1S84A 1KTSB 1C5QA 3TVJB 2FP7B 1AWFH 1NTPA 5DP9A 1K1NA 4B2CA 1E37B 5C5OA 1BHXB 1ZHRA 4DOQA 2F9PA 5LH8A 2R2WU 1QQ4A 2ZF0H 3GDVA 1Z71A 1EJAA 2TPIZ 3HGPA 5CHAC 4B74A 6CHAB 3SI4H 2ZDKA 1A0JA 4BTIB 1G2LA 5JBTA 2FOAA 1TFXA 2ZGJA 3ZV9A 1PJPA 2C8ZB 4K3JA 3ZZ5A 1NM6A 3BG4C 1LHCH 1DITH 4X2XA 3RC5A 5I25A 2RA0A 3SJIA 1PYTD 2BLQA 5TCAA 3PYHA 1ZHPA 2RG3A 4DGJA 4FUGA 4CH2B 2O9QA 3A8BA 1H4WA 3GCHB 3A7WA 3O8CA 1J15A 2W3KA 1C1QA 1O38A 3VXFH 2JETB 1BTPA 1V2VT 1QRWA 2PGQB 3HKIB 3A81A 1G30B 1CQQA 1A4WH 4TY6A 4IC5A 3LONA 1OWDA 4H6TA 5DO4H 4MNVA 2FPZA 2C3SA 3OY6U 2BXTH 3MU8A 5JB9S 3SGBE 4E06H 2AH4X 2TGAA 3NPSA 1DE7H 4GHQA 1XXDA 1RIWC 1PPEE 1CBWB 3ZVCA 1NFYA 1UVUH 1GJCB 1C2JA 1K21H 1AFEH 2VU8E 3V7TA 2VVCA 2Z9LA 3S9BA 3UPEA 1C5UA 2ZNKH 1O32A 1WSSH 1W0ZU 1ELTA 1OYQA 3Q3KA 3GYMA 1GL0E 2VIPA 1IQFA 3URDA 3PTBA 1SFIA 1ANCA 3UUZA 3T62A 3V0XA 3HGNA 1SHYA 3WY8A 1O2RA 1C5XB 1ZRKA 1HXEH 1YC0A 5E0GA 1BTWA 5GCHG 1NFUA 1GHAG 1INCA 1Y3YA 3LGIA 1VJ9U 1LHGH 4FUBA 3EQ0H 1WU1A 4AFUA 3SJ8A 1P2IA 2CXVA 1LVBA 2PSXA 1LPGB 4ASHA 1N6XA 1IHTH 4ZKOU 3C27B 1DM4B 4H4FA 1Y3VA 1PQ5A 3SN8A 1MU8B 1IOEA 3PWCA 4I33A 1OP8A 1A5GH 2FESH 1NROH 1MTSA 1DSUA 1BBRE 2BQ6B 1P06A 2GGVB 2PSYA 1DWEH 4X8SH 3UY9A 5ABWA 4HI3A 1NN6A 1VCPA 2OBOA 1TALA 2CGAA 2FI5E 2Y81A 3TLOA 5G4BA 1MQ5A 3GICB 1ZPBA 1BZXE 1GMDG 1CHOF 5GIBA 2ZU4A 2QXIA 2GV6A 2GMTB 5C1XA 4I8HA 1RFNA 2OTVA 2ZGCA 3M5NA 4ISOA 1GJ8B 2VVVA 3ATLA 4ZHAA 4ABGA 5EOKA 3GYLB 3LU9B 2P95A 4GPGA 4BAMB 1OWJA 3M3VA 2OLGA 2CV3A 6GCHF 1HAPH 1YKTA 4X2YA 1XUIA 1K1LA 3K9XB 2AMPA 4FUIA 3PLPA 2XC0A 4FU8A 3URCA 2BLWA 1TE0A 2A0QB 2ZTXA 1HV7A 4CHAC 1Z6EA 4YO9A 1O30A 3BTQE 1QR3E 4NWKA 1G3EA 1BMNH 3NZIA 1D6RA 3P92A 4CRCA 1AB9B 3LGYA 3SV2H 3KGPA 1AD8H 1CA0C 1GJAB 1AFQB 3TGKE 4MTBA 3K6ZA 2PV9B 5JBCS 1JRTA 1CVWH 1N6YA 1P04A 4UEHH 1C1WH 2Z6BD 1ARCA 3S7KB 2Z9GA 4DY7B 3QTOH 1OOKB 1CT4E 1O2XA 1YPLH 3FP8E 2FYRA 4CH8B 2K1QA 2DE8A 2QXJA 1KDQB 4ESTE 4WMFA 1FY5A 3LH1A 3ZZAA 1GBLA 2H6MA 1G32B 4FVDA 3P8NA 4OS4A 2ZHEH 4ABHA 3T5FH 2PFEA 1GVKB 4ISLA 2BDGA 3LJJA 4TYDA 2HGTH 1UK4A 4JZIA 1T8LA 3F9FA 4Y10E 7LPRA 2C93B 8ESTE 1DVAH 2ZQ2A 3L6PA 1C2LA 3A82A 1HPGA 4I32A 1AVGH 2YOLA 2WINI 1C5TA 1ZHMA 2P3FH 3RXLA 4H42U 2ZQ1A 1ZSKA 3A87A 1H1BA 4D9QA 1A0LA 2AMDA 4Y6DA 1ORFA 1TPOA 3TK9A 3GY8A 1O3NA 2AGIX 1J14A 4Y11E 1JBUH 1UCYK 1P2QA 1QRZA 2ZEBA 3RXKA 1QURH 3BTEE 3H7OA 4FUEA 1GI1A 2FEQH 3QGJA 1S6HA 3A8CA 1O2GH 2D8WA 3SU5A 1TX6A 3RXJA 3B8JA 3A84A 1SQTA 1DDJA 3SBKA 6LPRA 5FCKA 1IQMA 4FUFA 2XBVA 4XDEA 4B2BA 3P70B 1B7XB 1F7ZA 2VVUA 2G00A 2UWPA 5IDKA 3MTYA 3OYPA 2Z3DA 1YP9A 1DLEA 1WBGB 1FIWA 3ZVDA 4ISNA 4YT6H 1AMHA 1PQ8A 2SGQE 4KTCA 1CHOG 2FO9A 2J34A 1MAYA 4WH6A 3NCLA 5F8TA 2GZ9A 1FY4A 2OQUA 1RTFB 1GI6A 1Z8JB 1IHSH 3U1IB 1EAIA 3TJVA 1VCWA 4MPUA 1SGIB 2SGPE 3TGJE 3S9AA 4NSYA 5FX6A 4MDSA 1SFQB 1C1VH 1DSTA 1SVPA 3RMOH 1D9IA 4DW2U 1K2I1 2QCYA 3BEFB 2QY0B 1TIOA 3PMBB 5I46H 4X6NA 1V2WT 4O3TA 2DE9A 1C1PA 3SUFA 1L4ZA 1PPHE 4CBOA 1LCYA 1O33A 2JH0D 1J9CH 1TMUH 1KXEA 4B73A 4KTUA 2ZO3H 1LPZB 1C9TA 1P8VC 1TGBA 3MO9A 4Y7AA 1KYNA 1EASA 4TWYA 1ZMLA 3TJNA 3D65E 4ZROA 1L1JA 3BTFE 2A7HA 4DG4A 2PW8H 4WWYA 1F0UA 1GCDA 1W13U 2AIPA 1MUEB 2GCTC 1LQEA 4NA8A 4Y8YA 1KXCA 1O3PB 1UVTH 2FX4A 1KSNA 1PPBH 2ZTZA 4X8VH 3BEIB 1P12E 1RXPA 1YPGH 3PO1B 1A3EH 1JIMA 1HYLA 2P3UB 2XW9A 3OTJE 1RJXB 3ZZ7A 3PB1E 3ODDA 3RXTA 1B0EA 1UTMA 2BD9A 4M7GA 3SV9A 1EQ9A 2BOKA 3K65B 4CBNA 1EPTB 2G81E 1C5PA 1GHWH 1HAYB 2W7UA 1MH0A 3W95A 3PMJA 1B0FA 1EZQA 1Y5BT 1ELCA 3TH4H 4X1RU 4I31A 1AZZA 2VB0A 2QGRA 1HGTH 4B2AA 5FBIA 1TGCA 1XX9A 3RXAA 1YM0A 2ZPQA 3TNSA 3AW1A 3SU0A 3BTHE 4GHTA 2VWNA 3RXDA 2FI3E 2BHGA 4JZ1A 2VNTA 4O97A 2Y5GA 1GI9B 1VR1H 1D3QB 1D3PB 2CJIA 3A80A 2F83A 1ZYOA 1GDQA 3SU6A 3PWBA 2NU2E 3SJ9A 2GVFA 4WXVA 4K69A 3U69H 1O3AA 2D2DA 1EUFA 2CF8H 2ZCKP 4XE4A 5K7RA 4WMEA 1C2HA 4I8GA 3U8OH 2HALA 1V2LT 2P94A 1C5SA 2VWLA 1SR5C 3GY4A 1HAGE 4J2YB 3RXFA 1QJ1B 1EP5A 3UOPA 3LIWA 5EXLA 1RGQA 3E8LA 1AVXA 1X7AC 1WQSA 1BRAA 1ABJH 3KIDU 1UHBA 4RN6A 3ATWA 1UK2A 1PQAA 1SBWA 5FCRA 3F1SB 3LPRA 2ESTE 1HBTH 1S0RA 1TRNA 2VH6A 2PTNA 1THRH 3MH7A 5FBEA 3OX7U 3EDXB 2H2ZA 3ZVEA 4K2YA 1EP6A 4NG9H 2ZHDA 2BDAA 4UDWH 2A7CA 8KME2 1ZRBA 1O2LA 4THNH 5AF9H 1ZLRA 3H7TA 2ALPA 2BD4A 3M7UA 5HMAA 3UWIA 2WPIS 1NS3A 1HAVB 3UNQA 3FP6E 1MKWH 3SOSA 5TCCA 1THPB 2ZPRA 1HAZB 1AUJA 1TX8A 1O5EH 1P9SA 4X8UH 3NUMA 4E05H 3CS0A 2P8OB 3ZVBA 2FOCA 1GGDC 4ZUHA 4MNXA 3Q00A 4BAKB 3M7TA 3ZVGA 3ZYDA 1SLWB
chains in the Genus database with same CATH superfamily
2SFAA 2FMJA 1GI7B 1C5NH 1LVOA 3KQCA 3R3GB 5DP3A 4GVUA 3GCTF 3SUEA 1HIAA 1GBJA 1QTFA 4I86A 1SHHB 1K0HA 3ZVFA 1V2NT 2B0FA 2VIVA 4AFQA 1GJBB 1O5CB 1P2OA 3RXGA 4DIHH 3VB7A 1K9OE 4ASUD 5EJLA 4OS7A 1GI5A 3PTNA 2VGCB 3RU4D 1BRUP 1MTNB 2BY5X 2Q6FA 4ABEA 1F0RA 3RXEA 3QX5H 2C8YB 3PV4A 4TY7A 3F68H 3T25A 2ZKSA 1SGYE 3BF6H 3A7TA 1A3BH 2F9NA 2BX3A 2ANKH 4MPVA 4Y7BA 3KL6A 1RS0A 3FKSD 3S69A 3RXBA 2QXHA 1GCTC 1K28D 2H9TH 2STAE 2EI6A 2A5IA 5GCHF 4RI0A 1VGCC 1TRMA 3SU1A 1Q31A 1TNLA 4DIIH 5EQSA 1F5KU 1FDPA 3PRDA 4YTAA 5JDUB 1GHXH 2AS9A 3EGKH 3MNCA 1NRNH 5GXPA 3NK8A 4AOQA 2F9VA 1C1SA 5DN6D 3GDUA 1QY6A 2F91A 1EOLA 3LOXA 1EXFA 2SGDE 1GPZA 4OGYA 1SC8U 5C5NA 1XKBC 5J4QA 1BJVA 1TABE 4QT8C 3UWJH 1W11U 2LPRA 4JYUH 2P59A 4U2WA 4MQAA 1IQJA 3SUDA 5A8ZA 2KAIB 3U98H 5B6OA 5EJ1A 4DVAU 1A1RA 4XSKU 1SQOA 3A7VA 4YESB 5A09A 4XBDA 5C1UA 3FFGA 1G3DA 2OC7A 1AKSA 4NFEA 1G36A 1GMDF 2WV9A 3TH3H 1FLEE 3QN7A 4ZKSU 5FPYA 3SZEA 3LDXH 1L0ZA 2WV4A 1EPTA 1XUFA 2W3IA 1K1IA 1S82A 5CHAB 1QFKH 1P02A 4CR5A 1E0FD 1C2FA 3ATIA 5ETXA 1QNJA 3TH2H 1C1NA 1O36A 3RXQA 1O3OA 1Y5AT 2JIZD 2ZG0H 1F2SE 5EXMA 3RXPA 3BG4B 1P05A 4UD9H 2BDYA 2BY7X 3P95A 1O2ZA 7GCHF 2FOFA 1EB2A 1LKBA 1OWKA 1P2JA 2I6SA 5DPAA 3QWCH 3RMLH 3UNRA 4WMDA 1BTHH 1DOJA 2AIQA 1O5BB 1GWAA 2ZI2H 2LP6A 2L74A 1P11E 1W10U 2F9UA 2G8TA 2EC9H 4TPYA 3SUGA 4MNYA 2RA3A 1GL1A 1ZPCA 2A5KA 2Z9KA 3GY3A 3AVZA 1BRCE 1K1PA 2Y7ZA 4RSPA 3H09A 2R0KA 1C2MA 3SNEA 4YM9A 1L1GA 2ZU1A 1MZAA 1CGHA 3SI3H 3SZNA 5IYTA 3GCOA 3H5CB 1O2QA 1BT7A 4MPWA 1KY9A 2PUXB 3GCTG 2BOHB 1RIWB 2AGGX 2FYQA 1C5YB 2J2UA 3SQEE 1G9IE 1TONA 2GT7A 1GBIA 1S81A 5FXLA 1PQ7A 4A5TS 1NRRH 2A4QA 3M37A 2J97A 4AZ2B 3OEED 1QRXA 3E0NB 4RT0A 3TPIZ 1C5MD 1D3TB 1SGCA 1AO5A 1Q3XA 2Y5HA 4X1NU 5GPIB 5HKKD 4NZLA 3OTPA 1RTLA 3PV2A 2GJGA 1P09A 2BXUH 4K1SA 1HAVA 1TRYA 3MI4A 1SG8B 3VFEA 1S83A 1T8NA 1O2YA 1V2JT 4F48B 5C20A 1GBCA 1SSXA 5E0HA 4U32A 2BQ7B 2NU3E 4ZHLU 1ANEA 2BD8A 2M2AA 1O2UA 2BM2A 3A89A 4CRFA 5DGJA 1HAHH 2FXRA 1EZUC 1ZGIA 1BHXF 3VG8A 1W12U 2XNDD 2H5DA 3RMNH 3MHWU 1GG6C 3TK6A 3BSQA 3P8GA 5C3NA 4NZQA 1P2KA 2ANWA 4ZH8A 3MU0A 5A0AE 6ESTA 1NRPH 1JMOH 5AFZH 1EZXC 2FS8A 3SNBA 2Q6DA 5F03A 3TJOA 2Z9IA 4DURA 3SO3A 1RRKA 1RD3B 1HJAC 3KQDA 2W6JD 3K2UA 3U9AH 1Q2WA 3NKKA 4YOJA 2W6ID 2UUJB 1BMAA 4FETA 3UQOA 7ESTE 4Z1MD 1A7SA 1P2MA 2GMTC 1XUGA 1VCQA 1TNHA 2ZU2A 1LDTT 4FU9A 3S9CA 1AGJA 4TPIZ 4AYVB 7GCHG 3A8AA 3AAUA 1LHFH 4CHAB 1TWXB 3ESTA 3TK5A 3UIRA 3IG6B 2Z7FE 4KELA 1LHDH 3RMMH 5C1YA 1BMMH 3ATKA 4IW4E 1D3DB 1MCTA 2Y5FA 4GUXA 1OP2A 3BG8A 4Q80A 4D7FA 1A2CH 5DP8A 1VITG 2FWWA 4K1EA 4NA9H 3MU4A 2B5TB 2VIQA 2Q6GA 5HXFA 2KAIA 5L30H 1MD7A 1UJ1A 3DD2H 1YPMH 2A5AA 3PV5A 1IQNA 5HGGA 1TNIA 3W94A 3RDZA 1UCYH 2ZCLP 4SGBE 1N8OC 4TT3D 1C1RA 1ESAA 1O3EA 4Z6AH 3D62A 1P01A 3KNXA 2QAAA 1TA6A 2BD7A 2BDIA 2HLDD 4SGAE 5DG6A 1O2OA 2HPPH 3Q76A 2V3MA 2AEIH 1UHBB 3DSPA 1O5FH 2EY4C 4WJG2 1TMBH 5EQQA 3WW7A 2R3YA 1YLCA 2JJ1D 4HFPB 1MKXK 2HNTF 4KKDA 4ZHMU 1C5WB 4DCDA 1SGQE 3EA7A 3K6YA 1SLUB 4ZXXH 1FV9A 3TNTA 3QK1A 4X1PU 1VJAU 2KCPA 1FX0B 3BTDE 2HRVA 2QF0A 2TGTA 2KCYA 1BDAA 2FLRH 1MABB 1WCZA 2CHAC 4BTTB 1OXGA 2BMGB 3AAVA 1CSOE 1GBAA 3RXIA 1O31A 2NU4E 2AMQA 5FHTA 1SOTA 3BTWE 2FZZA 2O8UA 3SHAH 1O5AB 2F4LA 5CE1A 4ISHH 1C1UH 1FJSA 1T32A 3MFJA 1ARBA 2GX4A 1Y3UA 1UO6A 2QE7D 4FU7A 1MU6B 3U1JB 3VB5A 1GHYH 1ZTKA 3MH6A 5J4SA 1NU7B 1XUKA 3D49H 1HIAB 1IQLA 1ZSLA 1G37A 2VWOA 1O2KA 1IQKA 4WF8A 2Z9JA 4CRBA 1GMHG 2ZZUH 1MTUA 3ODFA 1V2PT 2XOKD 3ZZDA 2J92A 2ZHFH 2O8WA 2SGAA 1AY6H 1O3JA 2RDLA 5T6GA 1WQVH 1GJ5H 3F0PA 4AGJA 3STJA 3RXHA 2H1UA 5EG4A 3VXEH 5L6NH 1D4PB 5LPEA 2WYGA 1DANH 2QC2A 3FZZA 2ZFQH 2ZPSA 1SB1H 3CP7A 5A0BA 3DA9B 1UK3A 1ELGA 3P8FA 3N7EA 1P2NA 3L3TA 2FDAA 4AB8A 2WPHS 2GT8A 1W7GH 1FPCH 1MQ6A 1O34A 1ABIH 2C8WB 3BN9A 4FUHA 4AN7A 2BDCA 1QBNA 4RKOB 2Z3CA 1C5ZB 4H6SB 1Z8RA 4B6EA 3M35A 1A0HB 1YBWA 3EYDA 2NU0E 1YLDA 1TB6H 4Y8XA 2G55A 5LGOA 1ZMNA 4O9VA 5LPRA 1O39A 1YCPH 4CRAA 1GBEA 1IQHA 1ZPZA 2LELA 3ZZ4A 3ZZCA 1BJUA 1C1OA 2G4TA 3KYFA 3ELAH 2FLBH 3M5OA 1AIXH 2O8MA 1EAWA 1DWCH 3QDZB 3VGCC 1CU1A 4BNRA 1NZQH 1L1NA 4NFFA 4B6FA 4LOYH 3ZZBA 2GCTB 1P03A 3LGVA 4MPXA 3F6UH 1AKSB 2OUAA 4AB9A 1P57B 3UREA 3MNXA 2ZDVH 3U28C 7KMEH 1AZ8A 3SV8A 2ZHQH 1GJ9B 2BVXH 1GJ7B 1ACBE 1TNJA 2AERH 1E34B 1J16A 4ABIA 1OWEA 5E0JA 5HM9A 2EI7A 2ULLA 2Y80A 1ELAA 2AFQB 1HCGA 5JBBS 3E0PB 1O37A 5E2PA 1J17T 4JMYA 4R8TB 1HUTH 1IAUA 3NWUA 3PLKA 5C67A 3U8TH 4YZUA 1V3XA 4AX9H 3SNDA 9LPRA 1VKYA 1S6FA 1GDUA 2RFKC 1Z1IA 2F9BH 3MO3A 3A88A 3MWIU 2FTMA 2Z3EA 3UOUA 1WXRA 1TAWA 2CMYA 4XFQA 2VWMA 2R3UA 4IBLH 3RP2A 1CGIE 5C2ZA 1QB1A 1A5IA 3GISB 5GNDA 1QGFA 3KF2A 2NWNA 3JZ1B 2BY9X 3G01A 2TRMA 3MNBA 3UAIC 3L33A 4WXIA 3T27A 1E35B 3FVFB 4LK4A 4MNWA 2GZ7A 3T28A 2EI8A 4FXGH 5FPSA 1V6DA 1C2KA 2BTCE 2FODA 1B5GH 3A8DA 3RC6A 5SGAE 2J95A 1H9IE 2ZFRH 1O3MA 3TGIE 3SJKA 1AE8H 3GOVB 4K60A 3P17H 1UCYE 3FANA 2K8IA 1MCVA 4KP0A 1SI5H 1KLJH 4UONA 3MU5A 2BYAX 1FAXA 3BIUH 4UFEH 1EJMA 5EU8A 3ZV8A 1O2NA 1GI3A 1UVPA 1BTYA 5JPMH 1C2DA 1MMJN 2OC8A 1ANDA 1SGFA 3LC3A 2PGBB 4BAOB 1T8OA 3DFLA 2ANMH 1P3CA 1TBZH 3DHKH 4GCHG 4NIVA 4WY3A 1O3FA 2QF4A 3MOCA 2WPDD 1FPHH 2R2MB 1PPCE 2WUCA 1VZQH 2GCHG 5TJXA 2Q1JA 3E6PH 4A7IB 3HK3B 1OSSA 3RXMA 1T8MA 4OS6A 3VB3A 1Z1JA 2HVYB 1SMFE 3O8BA 5EPYA 2ZGHA 3CNRA 1C5OH 2J4IA 2C90B 4UFFH 2O8TA 1Z8IB 1GGDB 2IJOB 4K8YA 2Z94A 1GI0A 2GP9B 2HLCA 4AFZA 3M5LA 1DLKB 1YPJH 1FY1A 2ODQA 5DSFA 2FIRH 4VGCC 1KTTB 3EA9A 1QCPA 2A7JA 1O2PA 5A0CA 2A4OA 2YNBA 3EAJA 1XUJA 4OS1A 2J94A 1ELFA 1FI8A 4J1YA 5EXNA 3U8RH 2A32A 2PKAA 1C4V2 1SGFG 2BY6X 1QZ8A 1BRBE 3MQKC 1ELVA 1FUJA 4K1TA 1GDNA 1GBKA 3UFAA 1DY8A 1XVOA 1WV7H 1BITA 2OBQA 3LH3A 1OPHB 3VB4A 1O2WA 1TOMH 4ABDA 3F9GA 1ETSH 1QA0A 1GCTB 1MKWK 4JYTA 5C0TA 3E3TA 1BUIA 3PMHB 3SU4A 1G3CA 4X6MA 1VGCB 5DP5A 4LXBH 1HLTH 4YLQH 1BBRK 1ESBA 3EE7A 4R0IA 1QQUA 3FP7E 1G3BA 4OS5A 4O03A 1LQDB 4ZAEA 4X6PA 4XBCA 1O2IA 2Y6TA 3MO6A 5T3HA 3GCNA 5AVDA 1TMTH 3PROA 3WWFA 2A4GA 1G2MA 2SNWA 2IPHA 3N7OA 2PKSC 4DJZB 3RU4T 3F0OA 2W26A 2BY8X 1V2RT 2QXGA 2H9HA 1AN1E 1DFPA 4AG1A 3A85A 1ZJKA 2OD3B 2OK5A 1WAYB 4A1TA 4CR9A 1TA2A 2TBSA 5GWZA 1SQRA 1UW7A 1C2EA 1QJ6B 3Q77A 3LGWA 3EA8A 3M5MA 1YPEH 5T6DA 5JB8S 1CT2E 1PYTC 1BTXA 1Z7KA 1JWTA 1O3HA 4YLUA 5EODA 2ZCHP 1J8AA 1V2UT 1GBHA 1W8BH 4OGXA 4CRDA 5F8XA 3STIA 2ZFFH 1C1MA 2FOHA 4BXWA 1W2KH 1TNKA 2FX6A 1D6WA 5EQRA 6CHAC 1IQIA 1O2JA 4FVBA 4XD7D 2GDDA 1C5RA 3KEEA 4D7GA 1MTVA 2EA3A 1O5DH 1FN8A 3F9HA 2FM2A 3SYJA 1KIGH 1EB1H 1M9UA 2D26C 3C1KA 2XWBI 3HKJB 5L2YH 1CT0E 5ESTE 3RXOA 1V2MT 3S0NA 2ANYA 1VITF 3GCHC 1QIXB 1SKYE 4FOUC 2GZ8A 2XBXA 5CDFE 2JETC 1FONA 3FZDA 1TQ7B 2V3OH 2HPQH 3LKWA 4AYYB 1FZZA 2YNAA 1UTLM 4UE7H 2BB4A 1LVMA 3RXSA 4MVNA 3UNSA 3PRBA 2WHXA 4ZXYH 2BVRH 3ZZ6A 2H9EH 3KN2A 3SJOA 4Q7ZA 2BVSH 2BD2A 1CBWC 3ITIA 2R9PA 5FAHA 1GBDA 1Y59T 1DY9A 4NIXA 3SNCA 4BAQB 1SQAA 2OP9A 4HZHA 1W14U 2OQ5A 3LC5A 1LKAA 2WYJA 4NA7A 1GBFA 5K0HA 1V2KT 4NWLA 3WWBA 4P00A 1NBME 2PP6A 2P3TB 2G5VA 2JKHA 1P9UA 1T4UH 5DP6A 2ZWLH 1T31A 1UTQA 1A61H 2LNCA 4OS2A 1F0SA 1YPHC 2SGEE 2WPKS 3BTGE 5EPNA 4BAHB 2IN2A 4Y0ZE 1AWHB 2VIDA 4ABJA 2ZIQH 3SW2B 1ZR0A 1SPJA 5DP4A 2J38A 2NU1E 3O8DA 3ZZ9A 1GBBA 3IITA 3QO6A 5HM2A 4TWWA 4Q7YA 1THSH 2ZC9H 4I8KA 1KXAA 2GKVE 3SV6A 3BTME 3ATMA 1YY3A 5T6FA 1Y3WA 2F3CE 1ZMJA 2XYAA 4X8TH 2JH6D 2HNTC 2XCFA 4HGCA 3NRLA 1ELEE 3N7DA 4YT7H 3TU7H 2A45B 2JH5D 4U01A 1F92A 3RLYH 3I78A 1O3GA 4ABFA 4A1XA 1TBQH 1HAXB 2P93A 2THFB 4INKA 4X1SU 1YGCH 5EW1H 2QF3A 1GG6B 2KX4A 3Q3XA 1NESE 1Y5UT 1GMHF 1MBMA 1Y3XA 3RM2H 2V35A 3P6ZB 1HJ9A 2IOTA 3DUXH 2C8XB 3SHCH 3LGTA 3OY5U 2DUCA 1SLVB 3MH4A 5F8ZA 3KCGH 3GY2A 1W0YH 1GVZA 1SL3A 1AQ7A 5BPEA 1PPZA 5FL7D 1YPHE 1HJAB 4Q7XA 2PHBA 3SNAA 3UR9A 3KHVA 1GJ6A 3A86A 1HB0B 4Y8ZA 2Y82A 1PPGE 3T26A 5LPFA 1W0KD 2OXSA 1NFXA 2WPMS 3I29A 1NO9H 2A2QH 1GJDB 2IJD1 9ESTA 2TIOA 2ZHWH 3B23B 1QA7A 2P16A 2V6NA 1TPPA 4XBBA 3IWMA 1ZTLA 1GJ4H 2HNTE 1F5LA 3QUMP 4IN1A 4Y76A 1P10A 1BOQA 4PROA 1QL8A 1MKXH 1O3DA 1WTGH 2J9NA 2B8OH 4XOJA 1DICA 1KXDA 3BV9B 3NXPA 1E79D 1CA0B 1LTOA 5DKMA 1MBQA 1FNIA 2ZDNA 2RCEA 3T29A 3R0FA 1AB9C 1RTKA 3MNSA 1H9LB 4NIWA 4Q2KA 1AFQC 1GBTA 2FI4E 4K8BA 1S0QA 3DSGA 1QHRB 1UTNA 3PLBA 1JIRA 4IS5A 1QBOA 1EAUA 3O8RA 2QF5A 1V2OT 1NY22 4CREA 1OKXA 2BQWB 3V12A 1N8OB 4WH8A 5FX5A 2SGFE 4JYVH 3BEUA 5C0UA 2GD4B 4JK6A 1UTJA 5JYIA 1GI8B 3LJOA 5CMXH 1BMLA 4A92A 1TQ0B 3Q3YA 1ETTH 4WVPE 3GY6A 4YOIA 4AG2A 3KYGA 1EX3A 1BTUA 1FAKH 1V2ST 1ZGVA 3QZRA 2H5CA 2PLXA 5L2ZH 2WPJS 2UWOA 4NGAH 1XXFA 3I77A 1FQ3A 1NPMA 1TGSZ 2GV7A 2HOBA 3OSYA 4Z0KA 5F6MA 4K5ZA 4E7RG 1H8DH 3TITA 1T7CA 3V13A 2ZU5A 1LHEH 2PTCE 1JOUB 1WTHD 2A1DB 2WPLS 3MMGA 4ABBA 2GTBA 1C2GA 1K22H 2L6OA 4KGAA 1H8HD 1JXPA 4I7YH 2O8LA 1SOZA 1ZSJA 2W5EA 4BOHA 1GBMA 2OC0A 1A5HA 3HPTB 2CHAB 1L4DA 4IN2A 3AASA 4A1VA 1SLXB 2XBYA 3ZYEA 1MTWA 1PFXC 4MG3A 1XVMA 1TNGA 4A6LA 4D8NA 2V7QD 5AFYH 4ZCNA 1O3IA 2ZFTA 1QJ7B 4D76A 1C5VA 1BQYA 1DPOA 1MD8A 1GI4A 4JZEH 1FY8E 3LGUA 1H8ED 2BLVA 1N1LA 1OS8A 1P3EA 2VJ1A 2VIOA 1O2VA 2VBCA 4F49A 1NU9A 1PPFE 4O3UA 3D23A 2C4FH 2WZQA 4F4OC 2F43B 1EOJA 2PKAB 3RUOA 3DT0H 1UVOA 4FUDA 3RXRA 2ZU3A 3DFJA 1F5RA 2J98B 1QBVH 2GDEH 2XTTB 1W3CA 3E16B 1MAXA 4LZ1H 3MU1A 4ABAA 4GLYA 2ZTYA 3P8OA 2UWLA 2BDBA 2ZA5A 2WV5A 1OYTH 2KR7A 4U30A 4AFSA 8GCHF 2ZFSA 3CS7A 3M36A 4DT7B 1K1JA 3ZZ3A 2XWAA 2OINA 3GY5A 1WYKA 4GCHF 4KTSA 2BZ6H 2ODPA 3FOAA 1SGNE 2TGPZ 1GHBF 1DUAA 1DXPA 4INLA 1LPKB 1DWDH 1NT1A 1ZJDA 2A31A 2GCHF 4ACBA 1CA8B 2ALVA 4Y79A 6GCHG 2UUFB 1GVLA 1FIZA 4NCYA 1CE5A 1YCPM 2VINA 2CN0H 3ENSB 1Z8GA 3VEQB 5EW2H 4IGDA 2HWLB 2VIWA 1IQGA 5DP7A 2WUBA 3T2NA 1TPSA 1WOFA 4AGKA 3OFND 1O2TA 1ELDE 3F9EA 2KCOA 3LT3A 1TYNA 1GI2A 1O3LA 1VITH 5HIZA 3A7ZA 2PWXA 5H4IB 1E36B 1QB6A 3F2GA 3CENA 1S85A 2UUYA 1UTPA 3VGCB 2G4UA 1O3KA 2XRCA 2YMSC 1OWHA 4FUCA 3S7HB 4B71A 3QTVH 1H8IH 3PMAB 1L2EA 1UTKA 3E1XB 4YOGA 5PTPA 1BB0B 4IC6A 4Y71A 2BD3A 3A7YA 1AI8H 1QL9A 1TLDA 3UQVA 2PR3A 3KQBA 3SGQE 1SGDE 3PO1C 4D9RA 1MZDA 1ZZZA 3BIVH 3PM3A 2XBWA 1EATA 3QZQA 2WSSD 2EQNA 1K1MA 5ESBA 1C4Y2 1XUHA 2JDID 1F0TA 1K1OA 5A8XA 2HVXA 1E38B 1EPTC 1NFWA 4AORA 1LVYA 1FY3A 1AHTH 2EEKA 4HTCH 1EJNA 3B9FH 1NRQH 5B6LA 1DWBH 4GSOA 4X2WA 5E2OA 4X2VA 3SORA 1YCPK 2ZDLA 4OM9A 3M3TA 4JZDH 3RXVA 4I8LA 1KLIH 1Z6JH 2QV1A 4ISIH 1KLTA 2AYWA 2G52A 3MH5A 1GMCF 2ODYB 1BTZA 2SNVA 5DJ7A 4GAWA 1OP0A 1HRTH 2I6QA 2QYIA 1XM1A 3GY7A 5E8EH 4X6OA 2XC5A 1FXYA 3E90B 3E91A 1XMNB 1TGNA 2ZECA 5EIYA 3UB0A 1FMGA 2ZGBH 2STBE 2V3HH 5AHGH 1AE5A 1SGTA 5GDSH 3UTUH 2BLOA 1SGEE 2ZP0H 2A2XH 1TX7A 3ZZ8A 1UVSH 2TGDA 5C94A 1Y8TA 3RM0H 2FOEA 3V3MA 1SGRE 1KDQA 1O2MA 4ZKRU 1BIOA 5HYOA 1EKBB 3VPKA 4B75A 1ETRH 1YYY1 1W0JD 1CGJE 1EZSC 8LPRA 1S5SA 1OX1A 1C1TA 3SQHE 8GCHG 1O35A 1LMWB 2ILNA 1HDTH 1KXBA 4B1TA 2BX4A 1ANBA 1DX5M 4BXSA 2ASUB 4JCNA 1A46H 4LZ4B 5A8YA 1UTOA 1GHBG 2BZAA 3HATH 2Y7XA 1E1RD 4UFGH 1TOCB 2CF9H 1HNEE 1DS2E 1QB9A 1JRSA 4X1QU 2M5TA 5FPTA 5JBAS 5DK1A 4B76A 3RC4A 3QLPH 4BANB 2B9LA 3RXCA 4JK5A 3SU2A 4ZKNU 1YPKH 1NC6A 3M61U 5EGMA 2P8OC 4CRGA 3F2HA 4NSVA 1BBRH 3VB6A 3TIUA 2FOBA 1O2SA 1NRSH 1H9HE 1HFDA 4VGCB 5GJ4B 4I8JA 2B7DH 1QL7A 3A7XA 1ZTJA 1DXWA 2FTLE 1U6QA 4INHA 3HK6B 3RXUA 1FN6A 1AVWA 2J98A 3M3SA 3FAOA 2R0LA 2BD5A 2ZDAH 3F3BA 2XC4A 3EE0B 3M7QA 1TBRH 1OWIA 1WUNH 2BDHA 1UMAH 2QN5T 2VGCC 4Q4LA 1TPAE 1MTNC 1O0DH 1S6LA 2F9OA 1BCUH 4UFDH 2FOMB 2UUKB 1ELBA 1SGPE 2OCVB 4JZFH 1O3CA 3RLWH 2VH0A 1KMHB 4IMQA 4RT1A 5A2MH 4MLFB 1GHZA 2XNIA 2G51A 1HJ8A 1CO7E 1YLNA 1ID5H 1HAOH 2AGEX 2FOGA 1KXFA 2FS9A 4Q63A 1C5LH 3BTTE 2OC1A 3ZVAA 1V2TT 1O2HA 1AU8A 2ZDMA 1C2IA 4FUJA 5HIYA 1CHGA 1GHAF 2XXLA 1O5GH 3MYWA 1GMCG 1ESTA 3GS9A 2W7SA 3TJUA 3RU4E 1HAIH 3JZ2B 1IQEA 1GHVH 2QA9E 4RKJB 4IMZA 3SU3A 1XKAC 1EAXA 2D1JA 1O3BA 1YF4A 3AW0A 3A83A 1TGTA 2PKSB 2ZGXH 2PUQH 3UR6A 1AUTC 2QIQA 4NIYA 1C4U2 1DUEA 4Y0YE 3QGNB 2A4RA 2ZFPH 4BTUB 4ZMAH 1C9PA 1LO6A 1V2QT 2G5NA 3KQEA 1OHHD 1ZOMA 1W7XH 1DT2A 3OU0A 2V0BA 3N99A 3SV7A 4E7NA 1T4VH 3GDSA 3SGAE 2XCNA 1BA8B 1P0SH 4X0WU 3BTKE 5BRRE 1HXFH 1S84A 1KTSB 1C5QA 2KM0A 3TVJB 2FP7B 1AWFH 1NTPA 5DP9A 1K1NA 4B2CA 1E37B 5C5OA 1BHXB 1ZHRA 4DOQA 2F9PA 5LH8A 2R2WU 1QQ4A 2ZF0H 3GDVA 1Z71A 1EJAA 2TPIZ 3HGPA 5CHAC 4B74A 6CHAB 3SI4H 2ZDKA 1A0JA 4BTIB 1G2LA 5JBTA 5F53A 2FOAA 1TFXA 2ZGJA 3ZV9A 5IK2D 1PJPA 2C8ZB 4K3JA 3ZZ5A 1NM6A 3BG4C 1LHCH 1DITH 4X2XA 3RC5A 5I25A 2RA0A 3SJIA 1PYTD 2BLQA 5TCAA 3PYHA 1ZHPA 2RG3A 4DGJA 4FUGA 4CH2B 2O9QA 3A8BA 1H4WA 3GCHB 3A7WA 3O8CA 1J15A 2W3KA 1C1QA 1O38A 3VXFH 2JETB 1BTPA 1V2VT 1QRWA 2PGQB 3HKIB 4TSFD 3A81A 1G30B 1CQQA 1NBMD 1A4WH 4TY6A 5EJZA 4IC5A 3LONA 1OWDA 4H6TA 5DO4H 4MNVA 2FPZA 2C3SA 3OY6U 2BXTH 3MU8A 5JB9S 3SGBE 4E06H 2AH4X 2TGAA 3NPSA 1DE7H 4GHQA 1XXDA 1RIWC 1PPEE 1CBWB 2IPQX 3ZVCA 1NFYA 1BMFD 1UVUH 1GJCB 1C2JA 1K21H 1AFEH 2VU8E 3V7TA 2VVCA 1WDIA 2Z9LA 3S9BA 3UPEA 1C5UA 2ZNKH 1O32A 1WSSH 1W0ZU 1ELTA 1OYQA 3Q3KA 3GYMA 1GL0E 2VIPA 1IQFA 3URDA 3PTBA 1SFIA 1ANCA 3UUZA 3T62A 3V0XA 3HGNA 1SHYA 3WY8A 3OAAD 1O2RA 1C5XB 1ZRKA 1HXEH 1YC0A 5E0GA 1BTWA 5GCHG 1NFUA 1GHAG 1INCA 1Y3YA 3LGIA 1VJ9U 1LHGH 4FUBA 1EFRD 3EQ0H 5KEDA 1WU1A 3OE7D 4AFUA 3SJ8A 1P2IA 2CXVA 1LVBA 2PSXA 1LPGB 4ASHA 1N6XA 1IHTH 4ZKOU 3C27B 1DM4B 4H4FA 1Y3VA 1PQ5A 3SN8A 1MU8B 1IOEA 3PWCA 4I33A 1OP8A 1A5GH 2FESH 4DT4A 1NROH 1MTSA 1DSUA 1BBRE 2BQ6B 1P06A 2GGVB 2PSYA 1DWEH 4X8SH 3UY9A 5ABWA 4HI3A 1NN6A 1VCPA 2OBOA 1TALA 2CGAA 2FI5E 2Y81A 3TLOA 3OEHD 5G4BA 2CK3D 1MQ5A 3GICB 1ZPBA 1BZXE 1GMDG 1CHOF 5GIBA 2ZU4A 2QXIA 2GV6A 2GMTB 5C1XA 4I8HA 1RFNA 2OTVA 2ZGCA 2J5UA 3M5NA 4ISOA 1GJ8B 2VVVA 3ATLA 4M9FA 4ZHAA 4ABGA 5EOKA 3GYLB 3LU9B 2P95A 4GPGA 4BAMB 1OWJA 3M3VA 2OLGA 2CV3A 6GCHF 1HAPH 1YKTA 4X2YA 5C17A 1XUIA 1K1LA 3K9XB 2AMPA 4FUIA 3PLPA 2XC0A 4FU8A 3URCA 2BLWA 1TE0A 2A0QB 2ZTXA 1HV7A 4CHAC 1Z6EA 4YO9A 4ACAA 3KQ5A 1O30A 3BTQE 1QR3E 4NWKA 1G3EA 1BMNH 3NZIA 1D6RA 3P92A 4CRCA 1AB9B 3LGYA 3SV2H 3KGPA 1AD8H 1CA0C 1GJAB 1AFQB 3TGKE 4MTBA 3K6ZA 2PV9B 5JBCS 1JRTA 1CVWH 1N6YA 1P04A 2AHME 4UEHH 1C1WH 2Z6BD 1ARCA 3S7KB 2Z9GA 4DY7B 3QTOH 1OOKB 1CT4E 1O2XA 1YPLH 3FP8E 2FYRA 4CH8B 2K1QA 2DE8A 2QXJA 1KDQB 4ESTE 4WMFA 3AK5A 1FY5A 3ZIAD 3LH1A 3ZZAA 1GBLA 2H6MA 1G32B 4FVDA 3P8NA 4OS4A 2ZHEH 4ABHA 3T5FH 2PFEA 1GVKB 4ISLA 5T1VA 2BDGA 3LJJA 4TYDA 2JJ2D 2HGTH 1UK4A 4JZIA 1T8LA 3F9FA 4Y10E 7LPRA 2C93B 8ESTE 1DVAH 2ZQ2A 3L6PA 1C2LA 3A82A 1HPGA 4I32A 1AVGH 2YOLA 2WINI 4XRNA 1C5TA 1ZHMA 2P3FH 3RXLA 4H42U 2ZQ1A 1ZSKA 3A87A 1H1BA 4D9QA 1A0LA 2AMDA 4Y6DA 1ORFA 1TPOA 3TK9A 3GY8A 1O3NA 2AGIX 1J14A 4Y11E 1JBUH 1UCYK 1P2QA 1QRZA 2ZEBA 3RXKA 1QURH 3BTEE 3H7OA 5CHBA 2KFWA 4FUEA 1GI1A 2FEQH 3QGJA 1S6HA 3A8CA 1O2GH 2D8WA 3SU5A 1TX6A 3RXJA 3B8JA 3A84A 1SQTA 1DDJA 3SBKA 6LPRA 5FCKA 1IQMA 4FUFA 2XBVA 4XDEA 4B2BA 3P70B 1B7XB 1F7ZA 2VVUA 2G00A 2UWPA 5IDKA 3MTYA 3OYPA 2Z3DA 1YP9A 1DLEA 1WBGB 2KZ4A 1FIWA 3F2FA 3ZVDA 4ISNA 4YT6H 1AMHA 1PQ8A 2SGQE 4KTCA 1E1QD 1CHOG 2FO9A 4HG6A 2J34A 1MAYA 4WH6A 3NCLA 5F8TA 2GZ9A 1FY4A 2OQUA 1RTFB 1GI6A 1Z8JB 1IHSH 3U1IB 1EAIA 3TJVA 1VCWA 4MPUA 1SGIB 2SGPE 3TGJE 3S9AA 4NSYA 5FX6A 4MDSA 1SFQB 1C1VH 1DSTA 1SVPA 3RMOH 1D9IA 4DW2U 1K2I1 1YWUA 2QCYA 3BEFB 2QY0B 1TIOA 3PMBB 5I46H 4X6NA 1V2WT 4O3TA 2DE9A 1C1PA 3SUFA 1L4ZA 1PPHE 4CBOA 1LCYA 1O33A 2JH0D 1J9CH 1TMUH 1KXEA 4B73A 4KTUA 2ZO3H 1LPZB 1C9TA 1P8VC 1TGBA 5KGOA 3MO9A 4Y7AA 1KYNA 1EASA 4TWYA 1ZMLA 2YMSB 3TJNA 3D65E 4ZROA 1L1JA 3BTFE 2A7HA 4DG4A 2PW8H 4WWYA 3DSOA 1F0UA 1GCDA 1W13U 2AIPA 1MUEB 2GCTC 1LQEA 4NA8A 4Y8YA 1KXCA 1O3PB 1UVTH 2FX4A 5KECA 1KSNA 1PPBH 2ZTZA 4X8VH 3BEIB 3FN8A 1P12E 1RXPA 1YPGH 3PO1B 1A3EH 1JIMA 1HYLA 2P3UB 2XW9A 3OTJE 1RJXB 3ZZ7A 2YMSD 3PB1E 3ODDA 3RXTA 1B0EA 1UTMA 2BD9A 4M7GA 3SV9A 1EQ9A 2BOKA 3K65B 4CBNA 1EPTB 2G81E 1C5PA 1GHWH 1HAYB 2W7UA 1MH0A 3W95A 3PMJA 1B0FA 1EZQA 1Y5BT 1ELCA 3TH4H 4X1RU 4I31A 1AZZA 2VB0A 2QGRA 1HGTH 4B2AA 2K0QA 5FBIA 1TGCA 1XX9A 3RXAA 1YM0A 2ZPQA 3DCLA 3AW1A 3TNSA 3SU0A 3BTHE 4GHTA 2VWNA 3RXDA 2FI3E 2BHGA 3FO8D 2VNTA 4JZ1A 4O97A 2Y5GA 1GI9B 1VR1H 1D3QB 1D3PB 2CJIA 3A80A 2F83A 1ZYOA 1GDQA 3SU6A 3PWBA 2NU2E 3SJ9A 2GVFA 4WXVA 4K69A 3U69H 3W1EA 1O3AA 2D2DA 1EUFA 2CF8H 2ZCKP 4XE4A 5K7RA 4WMEA 1C2HA 4I8GA 3U8OH 2HALA 1V2LT 2P94A 1C5SA 2VWLA 1SR5C 3GY4A 1HAGE 4J2YB 4P02A 1QJ1B 1EP5A 3RXFA 3UOPA 3LIWA 5EXLA 1RGQA 3E8LA 1AVXA 1X7AC 1WQSA 1BRAA 1ABJH 4F55A 3KIDU 1UHBA 4RN6A 3ATWA 1UK2A 1PQAA 1SBWA 5FCRA 3F1SB 3LPRA 2ESTE 1HBTH 1S0RA 1TRNA 4AC9A 2VH6A 2PTNA 1THRH 3MH7A 5FBEA 3OX7U 3EDXB 2H2ZA 3ZVEA 4K2YA 1EP6A 4NG9H 2ZHDA 4YXWD 2BDAA 4UDWH 2A7CA 8KME2 1ZRBA 1O2LA 4THNH 5AF9H 1ZLRA 1COWD 3H7TA 2ALPA 2BD4A 3M7UA 5HMAA 3UWIA 2WPIS 1NS3A 1HAVB 3UNQA 3FP6E 1MKWH 3SOSA 5TCCA 1THPB 2ZPRA 2KCAA 1HAZB 1AUJA 1TX8A 1O5EH 1P9SA 4X8UH 3NUMA 4E05H 3CS0A 2P8OB 3ZVBA 2FOCA 1GGDC 4ZUHA 4MNXA 2RDEA 3Q00A 4BAKB 3M7TA 3ZVGA 3ZYDA 1SLWB
chains in the Genus database with same CATH topology
2SFAA 2FMJA 1GI7B 1C5NH 1LVOA 3KQCA 3R3GB 5DP3A 4GVUA 3GCTF 3SUEA 1HIAA 1GBJA 1QTFA 1SHHB 3ZVFA 1V2NT 2B0FA 2VIVA 4AFQA 1GJBB 1O5CB 1P2OA 3RXGA 4DIHH 3VB7A 1K9OE 4OS7A 1GI5A 3PTNA 2VGCB 3RU4D 1BRUP 1MTNB 2BY5X 2Q6FA 4ABEA 1F0RA 3RXEA 3QX5H 2C8YB 3PV4A 4TY7A 3F68H 3T25A 2ZKSA 1SGYE 3BF6H 3A7TA 1A3BH 2F9NA 2BX3A 2ANKH 4MPVA 4Y7BA 3KL6A 1RS0A 3S69A 3RXBA 2QXHA 1GCTC 1K28D 2H9TH 2STAE 2EI6A 2A5IA 5GCHF 1VGCC 1TRMA 3SU1A 1Q31A 1TNLA 4DIIH 5EQSA 1F5KU 1FDPA 4YTAA 5JDUB 1GHXH 2AS9A 3EGKH 3MNCA 1NRNH 5GXPA 3NK8A 4AOQA 2F9VA 1C1SA 3GDUA 1QY6A 2F91A 1EOLA 3LOXA 1EXFA 2SGDE 1GPZA 4OGYA 1SC8U 5C5NA 1XKBC 5J4QA 1BJVA 1TABE 4QT8C 3UWJH 1W11U 2LPRA 4JYUH 2P59A 4U2WA 4MQAA 1IQJA 3SUDA 5A8ZA 2KAIB 3U98H 5B6OA 4DVAU 1A1RA 4XSKU 1SQOA 3A7VA 4YESB 5A09A 4XBDA 5C1UA 3FFGA 1G3DA 2OC7A 1AKSA 4NFEA 1G36A 1GMDF 3TH3H 1FLEE 3QN7A 4ZKSU 5FPYA 3LDXH 1L0ZA 2WV4A 1EPTA 1XUFA 2W3IA 1K1IA 1S82A 5CHAB 1QFKH 1P02A 4CR5A 1E0FD 1C2FA 3ATIA 5ETXA 1QNJA 3TH2H 1C1NA 1O36A 3RXQA 1O3OA 1Y5AT 2ZG0H 1F2SE 5EXMA 3RXPA 3BG4B 1P05A 4UD9H 2BDYA 2BY7X 3P95A 1O2ZA 7GCHF 2FOFA 1EB2A 1LKBA 1OWKA 1P2JA 2I6SA 5DPAA 3QWCH 3RMLH 3UNRA 4WMDA 1BTHH 1DOJA 2AIQA 1O5BB 1GWAA 2ZI2H 1P11E 1W10U 2F9UA 2G8TA 2EC9H 4TPYA 3SUGA 4MNYA 2RA3A 1GL1A 1ZPCA 2A5KA 2Z9KA 3GY3A 3AVZA 1BRCE 1K1PA 2Y7ZA 4RSPA 2R0KA 1C2MA 3SNEA 4YM9A 1L1GA 2ZU1A 1MZAA 1CGHA 3SI3H 3SZNA 5IYTA 3GCOA 3H5CB 1O2QA 1BT7A 4MPWA 1KY9A 2PUXB 3GCTG 2BOHB 1RIWB 2AGGX 2FYQA 1C5YB 2J2UA 3SQEE 1G9IE 1TONA 2GT7A 1GBIA 1S81A 5FXLA 1PQ7A 4A5TS 1NRRH 2A4QA 3M37A 4AZ2B 1QRXA 3E0NB 3TPIZ 1C5MD 1D3TB 1SGCA 1AO5A 1Q3XA 2Y5HA 4X1NU 5GPIB 4NZLA 1RTLA 1P09A 2BXUH 4K1SA 1HAVA 1TRYA 3MI4A 1SG8B 3VFEA 1S83A 1T8NA 1O2YA 1V2JT 5C20A 1GBCA 1SSXA 5E0HA 4U32A 2BQ7B 2NU3E 4ZHLU 1ANEA 2BD8A 1O2UA 2BM2A 3A89A 4CRFA 5DGJA 1HAHH 2FXRA 1EZUC 1ZGIA 1BHXF 1W12U 2H5DA 3RMNH 3MHWU 1GG6C 3TK6A 3BSQA 3P8GA 5C3NA 4NZQA 1P2KA 2ANWA 4ZH8A 3MU0A 5A0AE 6ESTA 1NRPH 1JMOH 5AFZH 1EZXC 2FS8A 3SNBA 2Q6DA 5F03A 3TJOA 2Z9IA 4DURA 3SO3A 1RRKA 1RD3B 1HJAC 3KQDA 3K2UA 3U9AH 1Q2WA 3NKKA 4YOJA 2UUJB 1BMAA 3UQOA 7ESTE 1A7SA 1P2MA 2GMTC 1XUGA 1VCQA 1TNHA 2ZU2A 1LDTT 4FU9A 3S9CA 1AGJA 4TPIZ 4AYVB 7GCHG 3A8AA 3AAUA 1LHFH 4CHAB 1TWXB 3ESTA 3TK5A 3UIRA 3IG6B 2Z7FE 4KELA 1LHDH 3RMMH 5C1YA 1BMMH 3ATKA 4IW4E 1D3DB 1MCTA 2Y5FA 4GUXA 1OP2A 3BG8A 4Q80A 4D7FA 1A2CH 5DP8A 1VITG 2FWWA 4K1EA 4NA9H 3MU4A 2B5TB 2VIQA 2Q6GA 5HXFA 2KAIA 5L30H 1MD7A 1UJ1A 3DD2H 1YPMH 2A5AA 1IQNA 5HGGA 1TNIA 3W94A 3RDZA 1UCYH 2ZCLP 4SGBE 1N8OC 1C1RA 1ESAA 1O3EA 4Z6AH 3D62A 1P01A 3KNXA 2QAAA 1TA6A 2BD7A 2BDIA 4SGAE 5DG6A 1O2OA 2HPPH 3Q76A 2AEIH 1UHBB 1O5FH 4WJG2 1TMBH 5EQQA 2R3YA 1YLCA 4HFPB 1MKXK 2HNTF 4KKDA 4ZHMU 1C5WB 4DCDA 1SGQE 3EA7A 3K6YA 1SLUB 4ZXXH 1FV9A 3TNTA 3QK1A 4X1PU 1VJAU 3BTDE 2HRVA 2QF0A 2TGTA 1BDAA 2FLRH 1WCZA 2CHAC 4BTTB 1OXGA 2BMGB 3AAVA 1CSOE 1GBAA 3RXIA 1O31A 2NU4E 2AMQA 5FHTA 1SOTA 3BTWE 2FZZA 2O8UA 3SHAH 1O5AB 5CE1A 4ISHH 1C1UH 1FJSA 1T32A 3MFJA 1ARBA 2GX4A 1Y3UA 1UO6A 4FU7A 3U1JB 1MU6B 3VB5A 1GHYH 1ZTKA 3MH6A 5J4SA 1NU7B 1XUKA 3D49H 1HIAB 1IQLA 1ZSLA 1G37A 2VWOA 1O2KA 1IQKA 4WF8A 2Z9JA 4CRBA 1GMHG 2ZZUH 1MTUA 3ODFA 1V2PT 3ZZDA 2J92A 2ZHFH 2O8WA 2SGAA 1AY6H 1O3JA 2RDLA 5T6GA 1WQVH 1GJ5H 4AGJA 3STJA 3RXHA 2H1UA 5EG4A 3VXEH 5L6NH 1D4PB 5LPEA 2WYGA 1DANH 2QC2A 3FZZA 2ZFQH 2ZPSA 1SB1H 3CP7A 5A0BA 3DA9B 1UK3A 1ELGA 3P8FA 1P2NA 3L3TA 2FDAA 4AB8A 2WPHS 2GT8A 1W7GH 1FPCH 1MQ6A 1O34A 1ABIH 2C8WB 3BN9A 4FUHA 4AN7A 2BDCA 1QBNA 4RKOB 2Z3CA 1C5ZB 4H6SB 1Z8RA 3M35A 1A0HB 1YBWA 3EYDA 2NU0E 1YLDA 1TB6H 4Y8XA 2G55A 5LGOA 1ZMNA 4O9VA 5LPRA 1O39A 1YCPH 4CRAA 1GBEA 1IQHA 1ZPZA 3ZZ4A 3ZZCA 1BJUA 1C1OA 2G4TA 3ELAH 2FLBH 3M5OA 1AIXH 2O8MA 1EAWA 1DWCH 3QDZB 3VGCC 1CU1A 4BNRA 1NZQH 1L1NA 4NFFA 4LOYH 3ZZBA 2GCTB 1P03A 3LGVA 4MPXA 3F6UH 1AKSB 2OUAA 4AB9A 1P57B 3UREA 3MNXA 2ZDVH 7KMEH 1AZ8A 3SV8A 2ZHQH 1GJ9B 2BVXH 1GJ7B 1ACBE 1TNJA 2AERH 1E34B 1J16A 4ABIA 1OWEA 5E0JA 5HM9A 2EI7A 2ULLA 2Y80A 1ELAA 2AFQB 1HCGA 5JBBS 3E0PB 1O37A 5E2PA 1J17T 4JMYA 4R8TB 1HUTH 1IAUA 3NWUA 3PLKA 5C67A 3U8TH 4YZUA 1V3XA 4AX9H 3SNDA 9LPRA 1S6FA 1GDUA 1Z1IA 2F9BH 3MO3A 3A88A 3MWIU 2FTMA 2Z3EA 3UOUA 1TAWA 2CMYA 4XFQA 2VWMA 2R3UA 4IBLH 3RP2A 1CGIE 5C2ZA 1QB1A 1A5IA 3GISB 1QGFA 3KF2A 2NWNA 3JZ1B 2BY9X 3G01A 2TRMA 3MNBA 3L33A 4WXIA 3T27A 1E35B 3FVFB 4LK4A 4MNWA 2GZ7A 3T28A 2EI8A 4FXGH 5FPSA 1V6DA 1C2KA 2BTCE 2FODA 1B5GH 3A8DA 3RC6A 5SGAE 2J95A 1H9IE 2ZFRH 1O3MA 3TGIE 3SJKA 1AE8H 3GOVB 4K60A 3P17H 1UCYE 3FANA 1MCVA 4KP0A 1SI5H 1KLJH 4UONA 3MU5A 2BYAX 1FAXA 3BIUH 4UFEH 1EJMA 5EU8A 3ZV8A 1O2NA 1GI3A 1UVPA 1BTYA 5JPMH 1C2DA 1MMJN 2OC8A 1ANDA 1SGFA 3LC3A 2PGBB 4BAOB 1T8OA 3DFLA 2ANMH 1P3CA 1TBZH 3DHKH 4GCHG 4NIVA 4WY3A 1O3FA 3MOCA 1FPHH 2R2MB 1PPCE 2WUCA 1VZQH 2GCHG 5TJXA 2Q1JA 3E6PH 4A7IB 3HK3B 1OSSA 3RXMA 1T8MA 4OS6A 3VB3A 1Z1JA 1SMFE 3O8BA 5EPYA 2ZGHA 1C5OH 2J4IA 2C90B 4UFFH 2O8TA 1Z8IB 1GGDB 2IJOB 4K8YA 2Z94A 1GI0A 2GP9B 2HLCA 4AFZA 3M5LA 1DLKB 1YPJH 1FY1A 2ODQA 2FIRH 4VGCC 1KTTB 3EA9A 1QCPA 2A7JA 1O2PA 5A0CA 2A4OA 2YNBA 3EAJA 1XUJA 4OS1A 2J94A 1ELFA 1FI8A 4J1YA 5EXNA 3U8RH 2A32A 2PKAA 1C4V2 1SGFG 2BY6X 1BRBE 1ELVA 1FUJA 4K1TA 1GDNA 1GBKA 3UFAA 1DY8A 1XVOA 1WV7H 1BITA 2OBQA 3LH3A 1OPHB 3VB4A 1O2WA 1TOMH 4ABDA 3F9GA 1ETSH 1QA0A 1GCTB 1MKWK 4JYTA 3E3TA 1BUIA 3PMHB 3SU4A 1G3CA 4X6MA 1VGCB 5DP5A 4LXBH 1HLTH 4YLQH 1BBRK 1ESBA 4R0IA 1QQUA 3FP7E 1G3BA 4OS5A 4O03A 1LQDB 4ZAEA 4X6PA 4XBCA 1O2IA 2Y6TA 3MO6A 5T3HA 3GCNA 5AVDA 1TMTH 3PROA 2A4GA 1G2MA 2SNWA 2IPHA 3N7OA 2PKSC 4DJZB 3RU4T 2W26A 2BY8X 1V2RT 2QXGA 2H9HA 1AN1E 1DFPA 4AG1A 3A85A 1ZJKA 2OD3B 1WAYB 4A1TA 4CR9A 1TA2A 2TBSA 5GWZA 1C2EA 1QJ6B 3Q77A 3LGWA 3EA8A 3M5MA 1YPEH 5T6DA 5JB8S 1CT2E 1PYTC 1BTXA 1Z7KA 1JWTA 1O3HA 4YLUA 5EODA 2ZCHP 1J8AA 1V2UT 1GBHA 1W8BH 4OGXA 4CRDA 5F8XA 3STIA 2ZFFH 1C1MA 2FOHA 4BXWA 1W2KH 1TNKA 2FX6A 1D6WA 5EQRA 6CHAC 1IQIA 1O2JA 4FVBA 4D7GA 2GDDA 1C5RA 3KEEA 1MTVA 2EA3A 1O5DH 1FN8A 3F9HA 2FM2A 1KIGH 1EB1H 1M9UA 2D26C 3C1KA 2XWBI 3HKJB 5L2YH 1CT0E 5ESTE 3RXOA 1V2MT 3S0NA 2ANYA 1VITF 3GCHC 1QIXB 2GZ8A 2XBXA 2JETC 1FONA 3FZDA 1TQ7B 2V3OH 2HPQH 3LKWA 4AYYB 1FZZA 2YNAA 1UTLM 4UE7H 2BB4A 1LVMA 3RXSA 4MVNA 3UNSA 4ZXYH 2BVRH 3ZZ6A 2H9EH 3KN2A 3SJOA 4Q7ZA 2BVSH 2BD2A 1CBWC 3ITIA 2R9PA 5FAHA 1GBDA 1Y59T 1DY9A 4NIXA 3SNCA 4BAQB 1SQAA 2OP9A 4HZHA 1W14U 2OQ5A 3LC5A 1LKAA 2WYJA 4NA7A 1GBFA 5K0HA 1V2KT 4NWLA 2P3TB 2G5VA 2JKHA 1P9UA 1T4UH 5DP6A 2ZWLH 1T31A 1UTQA 1A61H 2LNCA 4OS2A 1F0SA 1YPHC 2SGEE 2WPKS 3BTGE 5EPNA 4BAHB 2IN2A 4Y0ZE 1AWHB 2VIDA 4ABJA 2ZIQH 3SW2B 1ZR0A 1SPJA 5DP4A 2J38A 2NU1E 3O8DA 3ZZ9A 1GBBA 3IITA 3QO6A 5HM2A 4TWWA 4Q7YA 1THSH 2ZC9H 4I8KA 1KXAA 2GKVE 3SV6A 3BTME 3ATMA 5T6FA 1Y3WA 2F3CE 1ZMJA 2XYAA 4X8TH 2JH6D 2HNTC 2XCFA 4HGCA 1ELEE 4YT7H 3TU7H 2A45B 2JH5D 4U01A 1F92A 3RLYH 3I78A 1O3GA 4ABFA 4A1XA 1TBQH 1HAXB 2P93A 2THFB 4INKA 4X1SU 1YGCH 5EW1H 2QF3A 1GG6B 3Q3XA 1NESE 1Y5UT 1GMHF 1MBMA 1Y3XA 3RM2H 2V35A 3P6ZB 1HJ9A 2IOTA 3DUXH 2C8XB 3SHCH 3LGTA 3OY5U 2DUCA 1SLVB 3MH4A 5F8ZA 3KCGH 3GY2A 1W0YH 1GVZA 1SL3A 1AQ7A 5BPEA 1PPZA 1YPHE 1HJAB 4Q7XA 2PHBA 3SNAA 3UR9A 3KHVA 1GJ6A 3A86A 1HB0B 4Y8ZA 2Y82A 1PPGE 3T26A 5LPFA 2OXSA 1NFXA 2WPMS 3I29A 1NO9H 2A2QH 1GJDB 9ESTA 2TIOA 2ZHWH 3B23B 1QA7A 2P16A 2V6NA 1TPPA 4XBBA 3IWMA 1ZTLA 1GJ4H 2HNTE 1F5LA 3QUMP 4IN1A 4Y76A 1P10A 1BOQA 4PROA 1QL8A 1MKXH 1O3DA 1WTGH 2J9NA 2B8OH 4XOJA 1DICA 1KXDA 3BV9B 3NXPA 1CA0B 1LTOA 5DKMA 1MBQA 1FNIA 2ZDNA 2RCEA 3T29A 3R0FA 1AB9C 1RTKA 3MNSA 1H9LB 4NIWA 4Q2KA 1AFQC 1GBTA 2FI4E 4K8BA 1S0QA 1QHRB 1UTNA 3PLBA 1JIRA 4IS5A 1QBOA 1EAUA 3O8RA 1V2OT 1NY22 4CREA 1OKXA 2BQWB 3V12A 1N8OB 4WH8A 5FX5A 2SGFE 4JYVH 3BEUA 2GD4B 4JK6A 1UTJA 5JYIA 1GI8B 3LJOA 5CMXH 1BMLA 4A92A 1TQ0B 3Q3YA 1ETTH 4WVPE 3GY6A 4YOIA 4AG2A 1EX3A 1BTUA 1FAKH 1V2ST 1ZGVA 3QZRA 2H5CA 2PLXA 5L2ZH 2WPJS 2UWOA 4NGAH 1XXFA 3I77A 1FQ3A 1NPMA 1TGSZ 2GV7A 2HOBA 3OSYA 4Z0KA 5F6MA 4K5ZA 4E7RG 1H8DH 3TITA 1T7CA 3V13A 2ZU5A 1LHEH 2PTCE 1JOUB 1WTHD 2A1DB 2WPLS 3MMGA