1CO7E

R117h mutant rat anionic trypsin complexed with bovine pancreatic trypsin inhibitor (bpti)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNAHVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN II
total genus 60
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1co7E01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1co7E02
1ANBA 3LPRA 3A7VA 2PGQB 4FU9A 4INLA 3GCHB 1TMTH 1SG8B 3EDXB 4Y71A 2PW8H 1MQ6A 3MU4A 1OWKA 1AZZA 1G3EA 5ETXA 3RXHA 2VU8E 1EPTA 4DG4A 1LVMA 1TMUH 3KNXA 4ABAA 2BXTH 6GCHF 1YPKH 4E7RG 1TRMA 4XBCA 3SUEA 5LGOA 3LGTA 3TH2H 4X8VH 2FZZA 3A88A 3M5LA 4ZKOU 3RXBA 1AVWA 2G81E 1HXFH 1DT2A 2ZNKH 1YM0A 1V2KT 2BZ6H 1QRZA 1ANCA 3RC6A 2VWLA 1YCPK 2GT7A 4UFGH 9ESTA 4MNVA 2ZP0H 1UK4A 5DP5A 4ISHH 3A82A 3U69H 1GJ9B 1WV7H 2Z9IA 2P8OC 1J15A 1TBZH 2O8UA 7GCHG 2QCYA 3GCTF 1O30A 2A32A 3T62A 4A7IB 2ZDMA 1V2TT 3PM3A 1S81A 3TLOA 5J4QA 1GL0E 3GYMA 2FI5E 3C1KA 3VGCC 2ZKSA 1NRRH 5EW2H 4GCHG 3RMNH 4ISOA 2GV6A 4XBDA 4KELA 1YP9A 1GHXH 3A8CA 4ABEA 1GI2A 3SUFA 3IITA 2FOBA 1SLUB 1GMDF 4TWYA 5A2MH 4FVDA 3HKJB 4H4FA 1SLWB 3TJVA 5EGMA 1QB9A 1S83A 3MOCA 5GWZA 1NZQH 4OS7A 1ANEA 4CRFA 1GGDB 4K8YA 5ABWA 1NRSH 3P6ZB 1O5CB 1UK2A 4ESTE 2G52A 2OCVB 1T8OA 5A8XA 1QL9A 2VINA 2BVSH 2WV4A 4MDSA 1AHTH 1V2OT 2HLCA 3MNSA 1D3PB 1MH0A 2GCHG 3SV9A 1FAXA 2ANYA 1TGBA 1OWDA 4FUEA 3QGJA 1HGTH 1P11E 2OP9A 1MZDA 2VGCB 2R3YA 3K2UA 2TIOA 4Y8ZA 2ODYB 7LPRA 1QY6A 1CGIE 2JETC 2OXSA 4WH6A 1WU1A 1O3OA 1SGFA 2B0FA 4FU7A 1TNHA 3M35A 4I31A 4UD9H 1VITG 4AFSA 1K28D 1AGJA 3PLPA 2ZGCA 2FS9A 2Q6DA 2GT8A 4I33A 3MU1A 5E2OA 2CF9H 1NO9H 2VIWA 1O2YA 2W7SA 2SGDE 5DKMA 1FNIA 2ZI2H 4TPYA 1ZGVA 1FV9A 2EEKA 2BLWA 2ZTXA 4Z0KA 1GI4A 5GCHF 5GIBA 2EC9H 1HXEH 2ZFQH 1DITH 1EOLA 1G32B 1V2VT 1HFDA 3SNDA 3KHVA 3RU4D 1PYTD 1L4ZA 3LGWA 1DY9A 3K6YA 1O5BB 2G55A 4OS5A 4AN7A 4OGXA 5ESBA 4LK4A 2A4OA 3UNSA 5F8XA 1BRUP 1OP2A 2AGGX 1P04A 3LC5A 4O97A 1T8MA 1E37B 3JZ1B 1GMHF 8GCHG 1P01A 4JYVH 2W3KA 1TGTA 1SVPA 4X1QU 3W95A 3U8TH 4WWYA 1L1JA 3SJ8A 1FJSA 3UQVA 1NFYA 4INKA 4AX9H 1AFEH 5GJ4B 4NZQA 4B73A 4B2AA 1DS2E 2Q1JA 4D76A 5EOKA 1O2WA 4X8TH 3NPSA 1FN6A 3KQDA 3STIA 2CHAB 5SGAE 2IOTA 1EP5A 2BTCE 5AVDA 2ZDVH 1GJCB 3M5NA 4YLQH 1PQ7A 5BRRE 3NK8A 3P8FA 3S9BA 4YZUA 3UWIA 3VXFH 3KF2A 3LONA 3RXLA 1EZUC 2BB4A 3A8BA 3RLWH 2V3OH 1O3PB 1QJ6B 4SGAE 1ZHMA 2ZCHP 2ZQ2A 4HTCH 4BAOB 1K1NA 2BXUH 3DUXH 5IYTA 3SI3H 1RTKA 3ZV9A 5C20A 1TGCA 1O2KA 3F9EA 3E3TA 3ZVCA 5BPEA 4X6MA 1GJDB 4FUDA 4MNWA 3TK6A 2FX4A 2QN5T 3HGPA 1Y3WA 1ABIH 1O5AB 1O3AA 1T31A 3ATWA 3P92A 5I25A 2BQWB 4K2YA 4ZROA 5T6FA 1AY6H 5LPEA 1YGCH 4DIHH 1O2MA 2ZPQA 3TH3H 1HUTH 1F0UA 1C5YB 1BUIA 1E34B 3BTFE 4GPGA 4Y10E 2AH4X 3FP8E 2G51A 1NRPH 1KTTB 4AOQA 1O2VA 3AASA 1Y59T 3S7KB 2J95A 2A45B 2FIRH 2V6NA 1GI3A 2VWOA 3SW2B 1J17T 4ZXXH 1BT7A 1CU1A 1THSH 1UVOA 2BDBA 1B0FA 3NCLA 2F9PA 3BTGE 2PKSC 2OINA 3M7UA 3UR6A 2VH0A 4CHAC 3RDZA 1TE0A 2QGRA 1GJ4H 3F9FA 2ZU2A 3OYPA 3SI4H 5HGGA 4CRDA 2F9NA 1P9UA 2Y5GA 1D6RA 3P8NA 4U32A 1W14U 1PPZA 2XC5A 3MH7A 5FPSA 2Z9GA 1GI1A 1TRYA 3BSQA 4UFEH 1O5DH 3RM2H 2ULLA 5AFZH 1O2IA 3ZZDA 1EPTC 1KIGH 3FAOA 4RKOB 3A7XA 2HNTC 1O3KA 2GCHF 2B5TB 3L3TA 1ZPCA 4IC5A 1TQ7B 3SHCH 1A7SA 1Y8TA 5EXLA 1P2QA 1SFQB 4Y7BA 2Z7FE 2D26C 4IS5A 1ZZZA 3QUMP 1SC8U 2BDHA 3P70B 1WAYB 3TU7H 3F1SB 1MTWA 1O5FH 2A2QH 1NFXA 5JBBS 1P3EA 2GZ9A 3DFJA 1TOMH 2ZDLA 3PMAB 3MWIU 2P3UB 2QYIA 4AZ2B 4B2BA 3MO3A 4X0WU 5H4IB 1NC6A 3SN8A 1EUFA 2D2DA 1O2ZA 3T29A 1TX7A 5G4BA 3T25A 4Y8XA 2BLOA 2ZFPH 2OQ5A 1YKTA 1J8AA 1X7AC 4OGYA 1H9HE 1P0SH 2ZDKA 2SGQE 4ABGA 3GCOA 1TAWA 3SQEE 4CR5A 1IQMA 1Y3YA 1OKXA 1B5GH 3LC3A 1QHRB 1W12U 4R0IA 3RU4E 4D7GA 1F7ZA 1KY9A 1OWEA 1G37A 1C9PA 1CSOE 4NCYA 2Y5FA 4PROA 4FUBA 2QV1A 3GY2A 3MNBA 1EB2A 5C2ZA 1MCTA 2VVVA 1HAGE 4TY7A 4TWWA 2XC0A 4A6LA 3LJOA 2H9HA 1FN8A 1W2KH 1K1PA 4AB9A 1MU8B 3ITIA 2ZIQH 4B2CA 1DUEA 4A1VA 1F0TA 1SHHB 1PPFE 1Z1JA 1N1LA 3RMMH 1BMAA 2ZFRH 1C2IA 2D1JA 3ZYDA 3NZIA 1JBUH 1LKBA 2PUQH 2A0QB 2VJ1A 2WPHS 1WUNH 1O31A 1SI5H 4YESB 3SORA 3ZZ4A 3UNRA 1PJPA 5TJXA 1O2OA 3M5OA 1UVUH 3SU2A 3ZZAA 1O33A 2VWMA 2UWPA 4CREA 1C5UA 1P9SA 4A1TA 2KAIA 1DUAA 1YCPM 1O35A 1DICA 1V2NT 3KQEA 4H42U 5CHAB 4ZH8A 1B7XB 3E16B 2Z94A 4FUIA 4A92A 3BTQE 3GDSA 1YPLH 3QO6A 2GTBA 3M36A 1O5GH 3HKIB 2ANKH 3MNXA 5FPYA 2XW9A 3SJ9A 2WV5A 3LU9B 1C1OA 1SLXB 2NU1E 4Q7YA 1HAVB 1CO7E 1YCPH 2QF3A 1CBWB 3GY3A 1GI6A 2FLBH 3I77A 5F8TA 3ENSB 4B1TA 1SGQE 5DPAA 2CJIA 2A2XH 2NWNA 1ETSH 5HXFA 1K9OE 4ZHLU 3M7QA 2C8XB 1EP6A 2VIQA 5F8ZA 4WXIA 1QR3E 2AIPA 1QBNA 1Y3XA 1LQDB 1TWXB 1RTFB 1RFNA 1GJ8B 2TGAA 3M3TA 2C3SA 1AE5A 1FY4A 1IQHA 1OX1A 3I29A 3KCGH 4Y7AA 1RIWB 1G36A 2VIOA 5TCCA 3URCA 2ZECA 2H1UA 4CRAA 1BB0B 4ZHMU 1BQYA 1WTGH 4GUXA 3SZNA 1ZJKA 3UUZA 2BDAA 3EE0B 5FXLA 2QIQA 1JOUB 4I8HA 4B74A 3KGPA 2ZFTA 8LPRA 3RXUA 3SU3A 1LQEA 4NIXA 3U1JB 2AERH 2J92A 3TPIZ 2HALA 2BD4A 3PTNA 1T4VH 3SJKA 4J2YB 2NU4E 3RC5A 2AFQB 3VPKA 3F9GA 1LPGB 1HAIH 4ZKRU 1ESTA 1MTUA 2W26A 1PQ8A 4JZDH 2G5NA 4AG2A 3ZZ6A 1P2IA 2QAAA 1FZZA 2BY7X 1XUHA 2XNIA 5GDSH 1GVLA 1DWEH 1W7XH 7GCHF 2UUYA 2ZHDA 1GI5A 3MNCA 3SUGA 3RXRA 4I8KA 1EB1H 1F92A 1LVBA 3SNBA 2G00A 1IHSH 3UTUH 2F9UA 2C8ZB 1EX3A 4NWKA 4XSKU 2BDCA 1GDNA 1P09A 1LPZB 2GP9B 1NFUA 4KGAA 4AGKA 2FI4E 1HAVA 3MH4A 4BAMB 1F5KU 2FLRH 1HAPH 3SU1A 2ZF0H 1C1TA 3MMGA 1BMNH 1ETTH 2PKSB 4X6OA 2Z6BD 1EQ9A 3RXKA 1YLCA 1ZPZA 2JH6D 3D65E 1O2UA 3LOXA 3D23A 1ZSKA 1UTOA 1TA6A 1XUFA 1GHBF 4DCDA 2WYGA 1EJMA 1SQAA 4NFFA 3TITA 4AFQA 2OC1A 1UMAH 1CA0C 2ZEBA 4WMEA 1J9CH 3QLPH 3O8CA 2AGEX 4K1EA 2FOHA 1A61H 1XUJA 4WMFA 4IGDA 2ZU3A 3SNCA 1P10A 3RM0H 3A89A 3RMOH 1GVKB 1O2QA 3PO1C 1QA7A 1C2JA 2VWNA 1SPJA 3A8AA 1TNGA 2SNVA 2ANWA 1C5TA 2FOMB 2QF0A 2OQUA 1ZHPA 3TGIE 3GY6A 4JZIA 1O2PA 5JBCS 3RXSA 3KQBA 3EQ0H 1SQTA 1HBTH 1AUJA 1DFPA 3ZVAA 4WXVA 1BDAA 2FX6A 1PPEE 1UCYE 1W11U 4YOIA 5TCAA 3TNSA 2WINI 3Q76A 2ALPA 3BTEE 2LNCA 1A1RA 1PPGE 2R2MB 5A09A 5DP6A 1YLDA 1S0RA 4J1YA 2ZPRA 4IN1A 2OD3B 4UONA 2BQ6B 1U6QA 1N6XA 4BTUB 2P16A 1MBQA 3MFJA 2XTTB 1JRTA 3AAVA 1C1RA 1BITA 3VB6A 1FUJA 4THNH 2WUCA 2FTLE 1GBCA 1ELCA 4K3JA 3K65B 5T3HA 3UOUA 3KN2A 1L4DA 1TX8A 1SGDE 3MTYA 1DANH 2CN0H 4JCNA 4TY6A 5CHAC 1EAUA 3V12A 1ABJH 1MAXA 2BY9X 4ZHAA 2AMDA 4BAQB 3T27A 4FU8A 5HM9A 1OSSA 3BV9B 5E0HA 3HGNA 3RXCA 1CE5A 1GHAF 3C27B 1H8IH 3E6PH 2CXVA 1XM1A 3MH5A 1DLEA 2I6QA 2UUJB 3QGNB 2JH0D 4DGJA 1BOQA 1UTMA 1PYTC 3O8RA 1A0HB 3E8LA 3HATH 3HK6B 1AKSB 1LMWB 1T8NA 2FS8A 3E90B 3QK1A 3L6PA 1ZMLA 1HV7A 4OS4A 3SHAH 1JIRA 2Y5HA 4I32A 3EGKH 1LKAA 1AQ7A 2OC0A 1NY22 1A0LA 3T5FH 1C9TA 3HPTB 3N7OA 1GJ6A 1KLIH 3FP7E 1RRKA 1WSSH 3NWUA 5LPFA 1XUGA 6CHAC 1GG6C 1MUEB 5EU8A 1A5HA 2GDDA 2ODQA 2ZDAH 1O2RA 3OY6U 1JMOH 1VITH 2ZU4A 2ZG0H 1C1QA 1C2EA 2FDAA 1C5LH 1XKAC 4O03A 4X1NU 2IPHA 3RXJA 1Z8IB 3GOVB 4X2YA 1OP0A 2EI8A 1BTHH 3P8OA 1ELVA 1Z6JH 2BOKA 2GMTB 1K1OA 4Y6DA 1VCPA 3NKKA 2ALVA 1P05A 3SV8A 1GVZA 1SGIB 1NFWA 2C93B 1RIWC 2R0KA 1S0QA 2TGPZ 1RJXB 1AE8H 2PHBA 1Y5AT 1BRAA 2XCFA 1FIZA 3ATKA 3FFGA 1CHGA 1BMMH 2R9PA 1MKWK 2R0LA 4MPWA 1GBFA 3DHKH 4MNYA 1OWHA 1ELTA 2OUAA 4ZMAH 5FCKA 2ZGJA 1E36B 1Q2WA 1QIXB 3QN7A 4YM9A 1ZJDA 2BMGB 2WPMS 2BD5A 3TGKE 2ZZUH 1O2TA 2UUKB 2CF8H 2XWBI 1N8OC 4HFPB 1NU7B 4B71A 1ELGA 2FOEA 2PLXA 1LPKB 1WTHD 1MBMA 1NESE 3TNTA 1GGDC 1V3XA 2GV7A 5FX5A 4DIIH 1Z8JB 1TOCB 1VJAU 1V2PT 2A4QA 3RXFA 1KTSB 5GPIB 3VB4A 1C2DA 1LHFH 3A7YA 5C3NA 1TMBH 1WOFA 3RLYH 1P2OA 1UTQA 2UWLA 3DD2H 1HCGA 2P3TB 1QRWA 5J4SA 2SGAA 1LHGH 1MZAA 2PR3A 3CS0A 7ESTE 3UQOA 5EQRA 1GBLA 4I7YH 2FOGA 2C8YB 2Y7XA 4TYDA 2J2UA 1O2SA 4O9VA 5DP4A 1NRNH 2TBSA 9LPRA 3V3MA 1HAZB 1VJ9U 4XFQA 3RUOA 1WBGB 4UFFH 1UTJA 4X1PU 5DP8A 2Z3CA 1YC0A 2B9LA 1GWAA 1HJ9A 3MYWA 2G8TA 1GHBG 4OS6A 3IG6B 3O8BA 3ZV8A 1EOJA 3MI4A 3OSYA 1O34A 4CRGA 2O8MA 1S6FA 2NU0E 6CHAB 1TNIA 1W0YH 1A4WH 1UTNA 3MHWU 2R3UA 3KIDU 1YPHC 1SQOA 1SR5C 2GX4A 3U9AH 1A46H 1UO6A 1C1NA 4BTTB 1PQAA 1CT0E 1HJAB 2F91A 1M9UA 3KQCA 1NU9A 1FY1A 3QWCH 2QXHA 5L2ZH 3LGIA 1G9IE 3NXPA 3ZVBA 3ZZ9A 1EPTB 4CRBA 1NTPA 1CQQA 1C1VH 5A8YA 2LPRA 2NU3E 2SGEE 3MH6A 4JZFH 3DA9B 3U8RH 1ELBA 2DUCA 3S69A 1C5MD 1Q31A 2WPIS 3KL6A 1XUIA 2PTNA 3RMLH 4I8LA 4NFEA 3OY5U 1C2HA 1V2WT 4LZ1H 1TLDA 1G3BA 2FESH 1Z7KA 2VIVA 4K1TA 3SU5A 3UR9A 3W94A 1BA8B 4Z6AH 1KLTA 1P3CA 3FVFB 1IHTH 1FY8E 1XXDA 3S9AA 3ODDA 5E0JA 1ZSJA 2A7CA 3VB5A 5LPRA 1QCPA 3BN9A 2Y6TA 3T26A 3A84A 3BTKE 5T6GA 1YBWA 3PMBB 1H9LB 1DSTA 2BOHB 1O2GH 1OWIA 5C1YA 3LGUA 1FY5A 1FONA 1TX6A 1ZMNA 1O36A 1GJ5H 1QQ4A 1W7GH 3G01A 3PMJA 2BD8A 4YT6H 1MCVA 1FPCH 4A1XA 1ZTLA 1C2FA 3UOPA 2ZHFH 3PV4A 4AFZA 2SFAA 1W3CA 2FPZA 3KEEA 3AAUA 5EQQA 3ZZ7A 4IN2A 3RXVA 2A31A 2AYWA 1BHXB 1GI0A 1S85A 4BNRA 1RXPA 3AW1A 3D49H 1SMFE 1DWBH 3M3VA 1FY3A 1G3DA 2BLQA 2UWOA 4GSOA 3ZVDA 1BHXF 1TPPA 3BIVH 2ZCKP 1V2JT 5DO4H 2BY8X 5HM2A 1F5RA 4UDWH 3I78A 1HIAB 4GCHF 1SGRE 3MU5A 2AMQA 2PGBB 2PSYA 1EKBB 4X8SH 4ZXYH 2YNAA 1FAKH 4CRCA 2ZTYA 3A83A 1ARCA 1GI7B 1GMCF 3SV7A 3BF6H 1NT1A 3TJUA 1O3NA 1Y3VA 2C8WB 1Q3XA 1QJ7B 2Y7ZA 1GHWH 2OTVA 3OX7U 2XWAA 3STJA 4WH8A 1TNKA 2H5DA 1IQEA 1VZQH 4Y0YE 4XE4A 8KME2 1TFXA 1FIWA 1N6YA 4BANB 4YTAA 3PWBA 3T28A 1AVGH 2QXIA 1ELDE 2BY6X 2BQ7B 2B8OH 4NA9H 1HLTH 4K8BA 4U01A 1G3CA 2TGDA 1F0SA 4CBNA 4ZUHA 5JPMH 3VXEH 3GY4A 1INCA 1GJ7B 3U8OH 1DWCH 1ZHRA 1O3LA 1ELFA 1P2NA 2D8WA 2FYQA 3BG4C 2F3CE 4X1SU 2BDYA 1QRXA 3QDZB 3UNQA 3IWMA 3SOSA 4CR9A 1UTLM 1CT4E 1O3EA 3UREA 2UUFB 1CBWC 5EPNA 1OXGA 1TBRH 1Z1IA 1IQJA 2VIPA 4KTSA 1XXFA 2PSXA 2AS9A 4Q80A 1P8VC 3E0PB 4KTCA 3EA7A 3TIUA 2HGTH 2ZHQH 2ZWLH 3HK3B 5A0CA 1THRH 4U30A 1ELAA 3PO1B 4YOGA 3PB1E 1MTSA 3QZRA 1ZLRA 3QTVH 3K9XB 3L33A 2W7UA 5DJ7A 1TALA 3SGBE 2ZHWH 4OS2A 2PV9B 1EZQA 4AG1A 1JXPA 3DFLA 2GCTB 5JYIA 4MPXA 4NSYA 4FUCA 4K60A 5FCRA 1F2SE 2TRMA 3V13A 4BTIB 1RS0A 2V35A 2THFB 1D9IA 2BZAA 5AF9H 2J94A 5F6MA 2RG3A 1NRQH 1C4V2 1GBDA 1TGNA 3FZZA 4RSPA 2FODA 1PPCE 5L30H 2W5EA 1AZ8A 3RU4T 4BAKB 2ASUB 5ESTE 6GCHG 3B9FH 4FUFA 2XYAA 1ZTJA 2BX3A 1GBKA 2ZQ1A 2YNBA 3BTHE 1A0JA 1WCZA 1BZXE 4ABDA 1A3BH 1C4U2 3ZZ5A 4FVBA 1VITF 4AYVB 4X1RU 5GXPA 1IQLA 4AORA 1K1MA 4FUGA 2AEIH 1IOEA 1GI9B 4YT7H 1W8BH 2A4GA 1VR1H 1C5SA 1EAXA 2FOAA 1NS3A 1C5OH 4NG9H 3Q3XA 4NA7A 8ESTE 3GCNA 1EJNA 2ZA5A 1CVWH 4GVUA 1Z71A 5E8EH 1ZGIA 2PKAA 3MO9A 2VGCC 1VGCC 2PWXA 3PWCA 3ATMA 1H4WA 4WF8A 2FEQH 4H6TA 4YO9A 3LKWA 5L2YH 3Q3KA 1ETRH 3GY5A 4RN6A 3UIRA 1HJ8A 4SGBE 5A0AE 2BD7A 4X6NA 1QL7A 1LHEH 3T2NA 1SOTA 2H5CA 1KXAA 2QY0B 4DW2U 2BM2A 2ZGHA 1GHVH 3ATIA 3BG4B 1GMHG 3QTOH 1TNLA 1ZR0A 1MTVA 3BEFB 2AMPA 3Q3YA 3RXGA 3QX5H 3SJOA 3BEIB 4E05H 3VGCB 1ELEE 1D3DB 8GCHF 1ZSLA 1O2JA 1ZTKA 1LVOA 2QXGA 1MU6B 3Q00A 1AWFH 2WPLS 3RC4A 3GISB 2H6MA 2ZC9H 1NN6A 3UPEA 1C5XB 1LHDH 3OTJE 3ZZBA 1EZSC 3LJJA 4MPVA 1P57B 5EQSA 1T32A 4GHQA 3FANA 1KLJH 2QXJA 4WMDA 1ZMJA 4D7FA 1QB1A 2H9TH 1TPAE 1K22H 3BTDE 3V7TA 1FPHH 2A7JA 1QQUA 2PUXB 4Y8YA 3K6ZA 3BG8A 1EJAA 1LCYA 1S82A 4NIYA 1ID5H 4KKDA 2HOBA 1O2NA 4QT8C 3B23B 1W0ZU 3EAJA 4I8JA 1B0EA 1FLEE 1IQKA 1P2JA 1AI8H 1HPGA 2Z9LA 1SGNE 3E91A 2JETB 1QA0A 1TYNA 4NGAH 3M37A 2CV3A 6ESTA 1HRTH 2H9EH 2BD3A 3UWJH 4ZKNU 1QJ1B 3R0FA 3U98H 4JYUH 3H7OA 2ZFSA 1LTOA 7KMEH 4BXWA 1EZXC 1KXBA 3AVZA 2BD9A 1BRBE 2P3FH 1MKWH 3ODFA 3VB3A 4ABBA 1ESAA 1BTWA 4JZEH 1FQ3A 3TH4H 1C1PA 1O3MA 2ZGXH 2VVUA 4X6PA 1AFQC 2Q6FA 2TGTA 3GY8A 4H6SB 2A4RA 3A8DA 1CGHA 1YF4A 2DE9A 4DVAU 1AN1E 1O3GA 1YPEH 1QBVH 4ISNA 4B75A 1DM4B 1O3BA 3LH3A 1SFIA 4R8TB 2R2WU 4F4OC 4INHA 5JBTA 1C1UH 2FP7B 1MQ5A 5JB8S 2P8OB 3RXTA 2GGVB 1BBRH 2P94A 1A3EH 5I46H 1DSUA 3V0XA 2J38A 1XUKA 1SGFG 1JIMA 2GCTC 1BRCE 4NZLA 1DXWA 2XRCA 1SB1H 1BJUA 1YPHE 4MQAA 2ZPSA 2KAIB 2FXRA 1YYY1 1LDTT 1P02A 1DXPA 5DP9A 5E0GA 1AO5A 1GHAG 2HNTE 1AWHB 2ZFFH 2RDLA 1GMDG 2Z9KA 4Q2KA 3F9HA 1UJ1A 1MKXH 2A5IA 1O38A 5T6DA 4O3TA 1C5WB 2C4FH 1GBEA 1UCYH 1A5IA 3ZZ8A 2HPQH 4MTBA 3LH1A 1AB9C 4D9QA 1BCUH 1O2HA 2O8LA 4WY3A 1DX5M 2FM2A 3PYHA 2BDIA 2V3HH 2CGAA 3BIUH 3MU8A 2ZCLP 1QBOA 4UEHH 3P8GA 3F68H 3U1IB 1ESBA 2ILNA 2RCEA 1SGCA 3ZZ3A 5LH8A 1L1GA 2XBVA 2NU2E 2FOFA 3SGQE 1WQSA 4X2WA 1GDQA 4IC6A 4MPUA 1GI8B 2GDEH 4KTUA 1BMLA 4HGCA 1Y5UT 1K2I1 1GBBA 4IMZA 4WVPE 1MD7A 1VCWA 2EA3A 4ABIA 4BAHB 1DY8A 1BBRE 2O8WA 1BTXA 2FI3E 1AUTC 1DVAH 1K1IA 1L2EA 2RA3A 3A7ZA 2O9QA 1BBRK 5DK1A 1KDQB 1NM6A 5K7RA 1HDTH 3PLBA 2C90B 2J4IA 1UTPA 5EW1H 1GCTC 1LHCH 1BTUA 1C2KA 1O3HA 1TGSZ 2EI7A 2J9NA 3VFEA 5IDKA 4Y0ZE 3H5CB 1TNJA 2BLVA 4JK5A 4IMQA 1MTNC 2VH6A 1TONA 4ZKSU 2HVXA 3ZZCA 5GCHG 2FTMA 4IBLH 1S84A 1RTLA 1GBIA 2BVXH 2VIDA 3A7TA 4NIWA 3M7TA 1C1SA 1QURH 5FX6A 3PLKA 3LGYA 1SGTA 1DPOA 1G2LA 1L0ZA 1NPMA 1JRSA 1V2QT 5EXNA 1L1NA 2SNWA 1KDQA 1AFQB 2OLGA 1HAOH 4CH2B 1GPZA 4KP0A 1CA0B 1SBWA 2Y80A 3GCHC 3ZVEA 1KXEA 1IQGA 1IQFA 3BTWE 1YPGH 2P93A 2BY5X 1FI8A 3E1XB 4MVNA 4NA8A 1GBHA 5DP3A 1GBMA 1SLVB 4B76A 2AIQA 1AKSA 5F03A 1ANDA 4M7GA 1D3TB 4ISLA 5C67A 3GY7A 1RGQA 3TGJE 5B6OA 4K1SA 1F5LA 4FXGH 3SNEA 1O3JA 3F6UH 3SGAE 4DOQA 1P2KA 3S0NA 3QZQA 4O3UA 1OP8A 1K21H 1TPOA 1NROH 1ZOMA 4NIVA 3GDUA 1C5ZB 1HYLA 3UY9A 2P95A 2EI6A 1J16A 4FUHA 1QB6A 1W13U 5PTPA 3M5MA 1C5PA 1UVTH 3LIWA 1LVYA 1BTYA 2ZDNA 4JK6A 2G5VA 5CMXH 2XBXA 5K0HA 2WPKS 1K1LA 1UK3A 3BEUA 5FHTA 3SUDA 4MNXA 3SJIA 1CA8B 3RXIA 1ARBA 1TBQH 5A0BA 3CP7A 1O3CA 4Q7ZA 1BIOA 1ZRKA 3GICB 4DURA 5L6NH 1XMNB 4JZ1A 3M61U 2ODPA 1T7CA 2STBE 1GCTB 4AYYB 1V2MT 2PFEA 3ZYEA 3RXMA 1WQVH 4Y76A 4JMYA 1WYKA 3P17H 2FWWA 1V2ST 4I8GA 1A2CH 2ZU1A 4MG3A 1GBJA 2WYJA 4D9RA 1C4Y2 1V2LT 2ZO3H 1TB6H 2V0BA 1UVSH 1SGPE 1P2MA 1SSXA 2FYRA 1MMJN 4CHAB 1GCDA 3EA8A 4DY7B 1GMCG 3RXQA 3S9CA 4LZ4B 2M5TA 1O3FA 1C5NH 2CMYA 3SU4A 2PTCE 1SL3A 4ABHA 5DP7A 1GBTA 1HNEE 3RXDA 2SGPE 2GKVE 2YOLA 1ZRBA 1GL1A 1HAYB 4YOJA 1EAWA 1A5GH 2GD4B 1C1WH 4K5ZA 3UFAA 1ZYOA 4U2WA 1LO6A 1E38B 4F49A 2HWLB 1EATA 5A8ZA 1GDUA 2TPIZ 1RD3B 1P12E 2I6SA 1FMGA 2QC2A 2XBYA 4D8NA 1AIXH 5C5NA 3RXEA 3ZVFA 1O39A 2G4TA 3A85A 5EPYA 1O3IA 2XC4A 2WUBA 3SBKA 4TPIZ 4X2VA 1O37A 2ESTE 1EASA 2BYAX 2BVRH 4GAWA 1KXDA 2JKHA 1BTZA 2VNTA 2XBWA 1QL8A 4YLUA 2Y82A 1QTFA 4Y11E 1TRNA 4FUJA 5C1UA 3GDVA 4Y79A 3A87A 3PROA 5CE1A 1UCYK 1OWJA 5C1XA 3SU6A 1YPMH 3FP6E 1JWTA 1TABE 5EG4A 3TVJB 2BX4A 1H8DH 1OOKB 3LGVA 1ZPBA 1KSNA 5E2PA 1O2XA 1UHBA 1GJAB 1S6HA 1OS8A 1TA2A 1C5RA 1H9IE 3RP2A 3D62A 4DT7B 4HI3A 2JH5D 2A5AA 3URDA 2CHAC 4K69A 4MLFB 2GMTC 3FZDA 1HAHH 1VCQA 1PQ5A 2ZU5A 1YPJH 1T8LA 1Y5BT 3TJNA 6LPRA 3TK9A 2VB0A 1GHZA 4AFUA 4ABFA 4ISIH 2W3IA 3SO3A 2FO9A 1AU8A 5C5OA 3PTBA 4E7NA 2WPJS 1EXFA 2F9BH 1K1JA 3A7WA 1GBAA 1PPBH 1P06A 4VGCC 4ABJA 1PFXC 1O5EH 4A5TS 1D4PB 5FAHA 3ESTA 1EAIA 4LXBH 4XBBA 3NUMA 1OYQA 1KXFA 3B8JA 3JZ2B 4E06H 4LOYH 1TQ0B 1DLKB 4X2XA 3S7HB 1SGEE 2F9VA 5AHGH 5EODA 3SQHE 2A7HA 1UHBB 3CS7A 4VGCB 5DGJA 1IQIA 1N8OB 5FBEA 4WJG2 1MD8A 1V2UT 1C5VA 1D3QB 5FBIA 1DE7H 1QGFA 1ORFA 1AVXA 1P03A 3WY8A 1FDPA 2Z9JA 1XVOA 4Q7XA 1O2LA 4X8UH 2B7DH 4GLYA 3SV2H 1V2RT 3GCTG 1F0RA 2Q6GA 2Z3DA 3ELAH 2J34A 2XXLA 1DDJA 2A1DB 1THPB 5HMAA 1S5SA 1O0DH 3DT0H 1UVPA 2GZ7A 3MU0A 2DE8A 1T4UH 5JDUB 2OBOA 2IJOB 3CENA 1Z8GA 2IN2A 3E0NB 4XOJA 4ASHA 1MAYA 2ANMH 1VGCB 1HIAA 3RXAA 3BTME 3LDXH 2GVFA 1V6DA 1W10U 3LT3A 1O3DA 1MTNB 1BTPA 3EA9A 4NWLA 1QFKH 1D6WA 4HZHA 3P95A 5FPTA 1IQNA 2OC8A 4JYTA 5HYOA 1C2GA 1CHOG 1IAUA 2G4UA 2PKAB 2ZTZA 1UTKA 1SHYA 1Z8RA 1G2MA 1TPSA 1HAXB 3GYLB 2XCNA 4OS1A 1XX9A 2VVCA 1DWDH 1GHYH 2O8TA 5DG6A 2BDGA 4GHTA 2GZ8A 2OC7A 2QA9E 4RKJB 3VB7A 1E0FD 1C1MA 1SGYE 3ATLA 4NSVA 3TJOA 1PPHE 2STAE 4ZAEA 3A81A 3M3SA 4UE7H 1HJAC 3TK5A 1QNJA 2BHGA 1GG6B 1XKBC 3SU0A 1O32A 4UFDH 2P59A 3RXOA 2A5KA 1KYNA 3A80A 3EYDA 5JBAS 3BTTE 1SOZA 2FMJA 2Y81A 3H7TA 3SV6A 3AW0A 4IW4E 1E35B 1KXCA 4AB8A 1AB9B 1OYTH 2ZHEH 2RA0A 1XVMA 1AMHA 1CHOF 3MO6A 2F83A 3Q77A 1BJVA 2HPPH 4CBOA 1Z6EA 2F9OA 3A86A 2OBQA 1H1BA 1AD8H 5AFYH 2BD2A 4XDEA 3PMHB 1J14A 1FXYA 2HNTF 2AGIX 3O8DA 1C5QA 5JB9S 4DJZB 2K1QA 1C2MA 3ZVGA 3SNAA 5EXMA 1HB0B 3VEQB 1Y3UA 2FOCA 3RXPA 2H2ZA 1C2LA 1TIOA 3R3GB 1MKXK 2HRVA 2SGFE 1GJBB 4BOHA 4AGJA 1DOJA 1ACBE 1CGJE 4CH8B 3OU0A 2ZGBH 1G30B 1CT2E 4BXSA 1OPHB 2Z3EA
chains in the Genus database with same CATH superfamily
1ANBA 3LPRA 3A7VA 2PGQB 2XNDD 4FU9A 4INLA 3GCHB 1TMTH 1SG8B 3EDXB 4Y71A 2PW8H 1MQ6A 3MU4A 1OWKA 2LP6A 1AZZA 3CNRA 1G3EA 5ETXA 3RXHA 2VU8E 1EPTA 4DG4A 1LVMA 1TMUH 3KNXA 4ABAA 2BXTH 6GCHF 1YPKH 4E7RG 1TRMA 4XBCA 3SUEA 5LGOA 3LGTA 3TH2H 4X8VH 2FZZA 3A88A 3M5LA 4ZKOU 3RXBA 1AVWA 2G81E 1HXFH 1DT2A 2ZNKH 1YM0A 1V2KT 2BZ6H 1QRZA 1ANCA 3RC6A 2VWLA 1YCPK 2GT7A 4UFGH 9ESTA 4MNVA 2ZP0H 1UK4A 5DP5A 4ISHH 3A82A 3U69H 1GJ9B 1WV7H 2Z9IA 2P8OC 1J15A 1TBZH 2J98A 2WZQA 2O8UA 7GCHG 2QCYA 3GCTF 1O30A 2A32A 3T62A 4A7IB 2ZDMA 1V2TT 3PM3A 2KX4A 1S81A 3TLOA 5J4QA 1GL0E 3GYMA 2FI5E 3C1KA 3VGCC 2ZKSA 1NRRH 5EW2H 4GCHG 5FL7D 3RMNH 4ISOA 2GV6A 4XBDA 4KELA 1YP9A 1GHXH 3A8CA 4ABEA 1GI2A 4YXWD 3SUFA 3IITA 5GNDA 2FOBA 1SLUB 1GMDF 4TWYA 5A2MH 4FVDA 3HKJB 4H4FA 1SLWB 3VG8A 3TJVA 5EGMA 1QB9A 1S83A 3MOCA 5GWZA 1NZQH 4OS7A 1ANEA 4CRFA 1GGDB 4K8YA 5ABWA 1NRSH 3P6ZB 1O5CB 1UK2A 4ESTE 2G52A 2OCVB 1T8OA 2J97A 1QL9A 5A8XA 2VINA 2BVSH 2WV4A 4MDSA 1AHTH 1V2OT 2HLCA 3MNSA 1D3PB 1MH0A 2GCHG 3SV9A 1FAXA 2ANYA 1TGBA 1OWDA 4FUEA 3QGJA 1HGTH 1P11E 2OP9A 1MZDA 2VGCB 2R3YA 3K2UA 2TIOA 4Y8ZA 2ODYB 7LPRA 1QY6A 1CGIE 2JETC 2OXSA 4WH6A 1WU1A 1O3OA 1SGFA 2B0FA 4FU7A 1TNHA 3M35A 4I31A 4UD9H 1VITG 4AFSA 3F2GA 1K28D 1AGJA 3PLPA 2ZGCA 2FS9A 2Q6DA 2GT8A 4I33A 3MU1A 5E2OA 2CF9H 1NO9H 2VIWA 1O2YA 2W7SA 2SGDE 5DKMA 1FNIA 2ZI2H 4TPYA 1ZGVA 1FV9A 2EEKA 2BLWA 2ZTXA 4Z0KA 1GI4A 3H09A 5GCHF 5GIBA 2EC9H 1HXEH 2ZFQH 1DITH 1EOLA 1G32B 1V2VT 1HFDA 3SNDA 3KHVA 3RU4D 1PYTD 1L4ZA 3LGWA 1DY9A 3ZIAD 4P02A 3K6YA 1O5BB 2G55A 4OS5A 4AN7A 4OGXA 5ESBA 4LK4A 2A4OA 3UNSA 5F8XA 1BRUP 1OP2A 2AGGX 1P04A 3LC5A 4O97A 1T8MA 1E37B 3JZ1B 1GMHF 8GCHG 1P01A 2KCPA 4JYVH 2W3KA 1TGTA 1SVPA 4X1QU 3W95A 3U8TH 4WWYA 1L1JA 3SJ8A 1FJSA 2WV9A 1NFYA 4INKA 4AX9H 3UQVA 1AFEH 5GJ4B 4NZQA 4B73A 4B2AA 1DS2E 2Q1JA 4D76A 5EOKA 1O2WA 4X8TH 3NPSA 1FN6A 3KQDA 3STIA 2CHAB 5SGAE 2IOTA 1EP5A 2BTCE 2F43B 5AVDA 2ZDVH 1GJCB 3M5NA 4YLQH 1PQ7A 5BRRE 3NK8A 3P8FA 3S9BA 4YZUA 3UWIA 3VXFH 3KF2A 3LONA 3RXLA 1EZUC 2BB4A 3A8BA 3RLWH 5KECA 2V3OH 1O3PB 2IPQX 1QJ6B 4SGAE 1ZHMA 2ZCHP 2ZQ2A 4HTCH 4BAOB 2KCOA 1K1NA 2BXUH 3DUXH 5IYTA 3SI3H 1RTKA 3ZV9A 5C20A 1TGCA 1O2KA 3F9EA 3E3TA 3ZVCA 5BPEA 4X6MA 1GJDB 1NBMD 4FUDA 4MNWA 3TK6A 2FX4A 2QN5T 3HGPA 1Y3WA 1ABIH 1O5AB 1O3AA 1T31A 3ATWA 3P92A 5I25A 2BQWB 4K2YA 4ZROA 5T6FA 1AY6H 3AK5A 5LPEA 1YGCH 4ACAA 4DIHH 1O2MA 2ZPQA 3TH3H 1HUTH 1F0UA 3N99A 1C5YB 1BUIA 1E34B 3BTFE 2KM0A 4GPGA 4Y10E 2AH4X 3FP8E 2G51A 1NRPH 1KTTB 4AOQA 1O2VA 3AASA 1E1QD 1Y59T 3S7KB 2WSSD 2J95A 2A45B 2FIRH 2V6NA 1GI3A 2VWOA 3SW2B 1J17T 2CK3D 4ZXXH 4B6EA 1BT7A 1CU1A 1THSH 1UVOA 2BDBA 1B0FA 3NCLA 2F9PA 3BTGE 2PKSC 2OINA 3M7UA 3UR6A 2VH0A 4CHAC 3RDZA 1TE0A 2QGRA 1GJ4H 3F9FA 2ZU2A 3OYPA 3SI4H 5HGGA 4CRDA 5EJ1A 2F9NA 1P9UA 2Y5GA 1D6RA 3P8NA 4U32A 1W14U 1PPZA 2XC5A 3MH7A 5FPSA 2Z9GA 1GI1A 1TRYA 3BSQA 4UFEH 1O5DH 3RM2H 2ULLA 5AFZH 1O2IA 3ZZDA 1EPTC 1KIGH 3FAOA 4RKOB 3A7XA 2HNTC 1O3KA 2GCHF 2B5TB 3L3TA 1ZPCA 4IC5A 1TQ7B 3SHCH 1A7SA 1Y8TA 5EXLA 1P2QA 1SFQB 4Y7BA 2Z7FE 2D26C 4IS5A 1ZZZA 3QUMP 1SC8U 2BDHA 3P70B 1WAYB 3TU7H 3F1SB 1MTWA 1O5FH 2A2QH 1NFXA 5JBBS 1P3EA 2GZ9A 3DFJA 1TOMH 2ZDLA 3PMAB 3MWIU 2K0QA 2P3UB 2QYIA 4AZ2B 4B2BA 3MO3A 4X0WU 5H4IB 1NC6A 3SN8A 1EUFA 2D2DA 1O2ZA 3T29A 1TX7A 5G4BA 3T25A 4Y8XA 2BLOA 2ZFPH 2OQ5A 1YKTA 1J8AA 1X7AC 4OGYA 1H9HE 1P0SH 2ZDKA 2SGQE 4RI0A 4ABGA 3GCOA 1TAWA 3SQEE 4CR5A 1IQMA 1Y3YA 1OKXA 1B5GH 3LC3A 1QHRB 1W12U 4R0IA 3RU4E 4D7GA 1F7ZA 1KY9A 1OWEA 1G37A 1C9PA 1CSOE 4NCYA 2Y5FA 2EY4C 4PROA 4FUBA 2QV1A 3GY2A 3MNBA 1EB2A 3F3BA 5EJLA 5C2ZA 1MCTA 2VVVA 1HAGE 4TY7A 4TWWA 2XC0A 4A6LA 4FOUC 3LJOA 2H9HA 1FN8A 1W2KH 1K1PA 4AB9A 1MU8B 3ITIA 2ZIQH 4B2CA 1W0KD 1DUEA 4A1VA 1F0TA 1SHHB 1PPFE 1Z1JA 1N1LA 3RMMH 1BMAA 2ZFRH 1C2IA 2D1JA 3ZYDA 3NZIA 1JBUH 1LKBA 2PUQH 2A0QB 2VJ1A 2WPHS 1WUNH 1O31A 1SI5H 4YESB 3SORA 3ZZ4A 3UNRA 1PJPA 5TJXA 1O2OA 3M5OA 1UVUH 3SU2A 3ZZAA 1O33A 2VWMA 2UWPA 4CREA 1C5UA 1P9SA 4A1TA 2KAIA 1DUAA 1YCPM 5C0UA 1O35A 1DICA 1V2NT 3KQEA 4H42U 5CHAB 4ZH8A 1B7XB 3E16B 2Z94A 4FUIA 4A92A 3BTQE 3GDSA 1YPLH 3QO6A 2GTBA 2V3MA 3M36A 1O5GH 3HKIB 2ANKH 3MNXA 5FPYA 2XW9A 3SJ9A 2WV5A 3LU9B 1C1OA 1SLXB 2NU1E 4Q7YA 1HAVB 1CO7E 1YCPH 2QF3A 1CBWB 3GY3A 1GI6A 2FLBH 3I77A 5F8TA 3ENSB 4B1TA 1SGQE 1BMFD 5DPAA 2CJIA 2A2XH 2NWNA 1ETSH 5HXFA 1MABB 1K9OE 4ZHLU 3M7QA 2C8XB 1EP6A 2VIQA 5F8ZA 4WXIA 1QR3E 2AIPA 1QBNA 1Y3XA 1LQDB 1TWXB 1RTFB 1RFNA 4F48B 1GJ8B 2TGAA 3M3TA 2C3SA 1AE5A 1FY4A 1IQHA 1OX1A 3I29A 3KCGH 4Y7AA 1RIWB 1G36A 2VIOA 5TCCA 3U28C 3URCA 2ZECA 2H1UA 4CRAA 1BB0B 4ZHMU 1BQYA 2J5UA 1WTGH 4GUXA 3SZNA 1ZJKA 3UUZA 2BDAA 3DSOA 3EE0B 5FXLA 2QIQA 1JOUB 4I8HA 4B74A 3KGPA 2ZFTA 8LPRA 3RXUA 3SU3A 1LQEA 4NIXA 3U1JB 3DSPA 2AERH 2J92A 3TPIZ 2HALA 2BD4A 3PTNA 1T4VH 3SJKA 4J2YB 2NU4E 3RC5A 2AFQB 2KCYA 3VPKA 3F9GA 1LPGB 1HAIH 4ZKRU 1ESTA 1MTUA 2W26A 1PQ8A 4JZDH 2G5NA 4AG2A 3ZZ6A 1P2IA 2QAAA 4P00A 1FZZA 2BY7X 1XUHA 2XNIA 5GDSH 1GVLA 1DWEH 1W7XH 7GCHF 2UUYA 2ZHDA 1GI5A 3MNCA 3SUGA 3RXRA 4I8KA 5KEDA 3NRLA 1EB1H 1F92A 1LVBA 3SNBA 2G00A 1IHSH 3UTUH 2F9UA 2C8ZB 1EX3A 2F4LA 4NWKA 4XSKU 2BDCA 1GDNA 1P09A 1LPZB 2GP9B 1NFUA 4KGAA 4AGKA 2FI4E 1HAVA 3MH4A 4BAMB 1F5KU 2FLRH 1HAPH 3UB0A 3SU1A 2ZF0H 1C1TA 3MMGA 1BMNH 1ETTH 2PKSB 4X6OA 2Z6BD 1EQ9A 3RXKA 1YLNA 5B6LA 1YLCA 1ZPZA 2JH6D 3D65E 1O2UA 3LOXA 3D23A 1ZSKA 1UTOA 1TA6A 1XUFA 3WW7A 1GHBF 4DCDA 2WYGA 1EJMA 1SQAA 4NFFA 3TITA 4AFQA 2OC1A 5HIZA 1UMAH 1CA0C 2ZEBA 4WMEA 1J9CH 3QLPH 3O8CA 3OFND 5HIYA 2AGEX 4K1EA 2FOHA 1A61H 1XUJA 4WMFA 4IGDA 2ZU3A 3SNCA 1P10A 3RM0H 3A89A 3RMOH 1GVKB 1O2QA 3PO1C 1QA7A 1C2JA 2VWNA 1SPJA 3A8AA 1TNGA 2SNVA 2ANWA 1C5TA 2FOMB 2QF0A 2OQUA 5EJZA 1ZHPA 3TGIE 3GY6A 4JZIA 1O2PA 5JBCS 3RXSA 3KQBA 3EQ0H 1SQTA 1HBTH 1AUJA 5HKKD 1DFPA 3ZVAA 2W6ID 4WXVA 1BDAA 2FX6A 1PPEE 1UCYE 1W11U 4YOIA 2J98B 5TCAA 3TNSA 2WINI 3Q76A 5EIYA 2ALPA 3BTEE 2LNCA 1A1RA 1PPGE 2R2MB 5A09A 5DP6A 1YLDA 1S0RA 4J1YA 2ZPRA 4IN1A 2OD3B 4UONA 2BQ6B 1U6QA 1N6XA 4BTUB 2P16A 1MBQA 3MFJA 2XTTB 1JRTA 3AAVA 1C1RA 1BITA 3VB6A 1FUJA 4THNH 2WUCA 2FTLE 1GBCA 1ELCA 4K3JA 3K65B 5T3HA 2IJD1 3UOUA 4Z1MD 3KN2A 4FETA 1K0HA 1L4DA 1TX8A 1SGDE 3MTYA 1DANH 2CN0H 4JCNA 4TY6A 5CHAC 1EAUA 3V12A 1ABJH 1MAXA 3WWFA 2BY9X 2M2AA 4ZHAA 2AMDA 4BAQB 3T27A 4FU8A 5HM9A 1OSSA 3BV9B 5E0HA 3HGNA 3RXCA 1CE5A 1GHAF 3C27B 1H8IH 2YMSD 3E6PH 2CXVA 1XM1A 3MH5A 1DLEA 2I6QA 2UUJB 3QGNB 2JH0D 4DGJA 1BOQA 3WWBA 1UTMA 1PYTC 3O8RA 1A0HB 3E8LA 3HATH 5CDFE 3HK6B 1AKSB 1LMWB 1T8NA 2FS8A 3E90B 3QK1A 3L6PA 1ZMLA 1HV7A 2K8IA 4OS4A 3SHAH 1JIRA 2Y5HA 4I32A 3EGKH 1LKAA 1AQ7A 2OC0A 1NY22 1A0LA 3F0PA 3T5FH 1C9TA 3HPTB 3N7OA 1GJ6A 1KLIH 3FP7E 1RRKA 1WSSH 3NWUA 5LPFA 1XUGA 6CHAC 1GG6C 1MUEB 5EU8A 1A5HA 1EFRD 2GDDA 2ODQA 2ZDAH 1O2RA 3OY6U 1JMOH 1VITH 2ZU4A 2ZG0H 1C1QA 1C2EA 2FDAA 1C5LH 1XKAC 4O03A 4X1NU 2IPHA 3RXJA 1Z8IB 3GOVB 4X2YA 1OP0A 2EI8A 1BTHH 3P8OA 1ELVA 1Z6JH 2BOKA 2GMTB 1K1OA 4Y6DA 1VCPA 3NKKA 2ALVA 1P05A 5DSFA 3SV8A 1GVZA 1SGIB 1NFWA 2C93B 1RIWC 2R0KA 1S0QA 2TGPZ 1RJXB 1AE8H 2PHBA 1Y5AT 1BRAA 2XCFA 1FIZA 3ATKA 3FFGA 1CHGA 1BMMH 2R9PA 1MKWK 2R0LA 4MPWA 1GBFA 3DHKH 4MNYA 1OWHA 1ELTA 2OUAA 4ZMAH 5FCKA 2ZGJA 1E36B 1Q2WA 1QIXB 3QN7A 4YM9A 1ZJDA 2BMGB 2WPMS 2BD5A 3TGKE 2ZZUH 1O2TA 2UUKB 2CF8H 2XWBI 1N8OC 4HFPB 1NU7B 4B71A 1ELGA 2FOEA 2PLXA 1LPKB 1WTHD 1COWD 1MBMA 1NESE 3TNTA 1GGDC 1V3XA 2GV7A 2GJGA 5FX5A 4DIIH 1Z8JB 1TOCB 1VJAU 1V2PT 2A4QA 3RXFA 1KTSB 3OTPA 5GPIB 3VB4A 1C2DA 1LHFH 3A7YA 5C3NA 1TMBH 1WOFA 3RLYH 1P2OA 1UTQA 2UWLA 3DD2H 1HCGA 2P3TB 1QRWA 5J4SA 2SGAA 1LHGH 1MZAA 2PR3A 3CS0A 7ESTE 3UQOA 5EQRA 1GBLA 4I7YH 2FOGA 2C8YB 2Y7XA 4TYDA 2J2UA 1O2SA 4O9VA 5DP4A 1NRNH 2TBSA 9LPRA 3V3MA 3W1EA 1HAZB 1VJ9U 2QF4A 4XFQA 3RUOA 1WBGB 4UFFH 1UTJA 4X1PU 5DP8A 2Z3CA 1YC0A 2B9LA 1GWAA 1HJ9A 3MYWA 2OK5A 2G8TA 1GHBG 4OS6A 3IG6B 3O8BA 3ZV8A 1EOJA 3MI4A 3OSYA 1O34A 4CRGA 2O8MA 3PV5A 1S6FA 2NU0E 6CHAB 1TNIA 1W0YH 1A4WH 1UTNA 3MHWU 2R3UA 3KIDU 1YPHC 1SQOA 1SR5C 2GX4A 3U9AH 1A46H 1UO6A 1C1NA 4BTTB 1PQAA 1CT0E 1HJAB 2F91A 1M9UA 3KQCA 1NU9A 1FY1A 3QWCH 2QXHA 1H8HD 5L2ZH 3LGIA 5CHBA 1G9IE 3NXPA 3ZVBA 3ZZ9A 1EPTB 4CRBA 1NTPA 1CQQA 1C1VH 5A8YA 2LPRA 2NU3E 2SGEE 3MH6A 4JZFH 3DA9B 3U8RH 1ELBA 2DUCA 3S69A 1C5MD 1Q31A 2WPIS 3KL6A 1XUIA 2PTNA 3RMLH 4I8LA 4NFEA 1W0JD 3OY5U 1C2HA 1V2WT 4LZ1H 1TLDA 1G3BA 2FESH 1Z7KA 2VIVA 4K1TA 3SU5A 3UR9A 3W94A 3EE7A 4I86A 1BA8B 4Z6AH 1KLTA 1P3CA 3FVFB 1E79D 1IHTH 1FY8E 1XXDA 3S9AA 3ODDA 5E0JA 1ZSJA 2A7CA 3VB5A 5LPRA 1QCPA 3BN9A 2Y6TA 3T26A 3A84A 3BTKE 5T6GA 1YBWA 3PMBB 1H9LB 1DSTA 2BOHB 1O2GH 1OWIA 5C1YA 3LGUA 1FY5A 1FONA 1TX6A 1ZMNA 1O36A 1GJ5H 1QQ4A 1W7GH 3G01A 3PMJA 2BD8A 4YT6H 1MCVA 1FPCH 1VKYA 4A1XA 1ZTLA 1C2FA 3UOPA 2ZHFH 3PV4A 4AFZA 2SFAA 1W3CA 2FPZA 3KEEA 4HG6A 3AAUA 5EQQA 3ZZ7A 4IN2A 5KGOA 3RXVA 2A31A 2AYWA 1BHXB 1GI0A 2KCAA 1S85A 4BNRA 1RXPA 3AW1A 3D49H 1SMFE 1DWBH 3M3VA 1FY3A 1G3DA 2BLQA 2UWOA 4GSOA 4F55A 3ZVDA 1BHXF 1TPPA 3BIVH 2ZCKP 1V2JT 4Q4LA 2BY8X 5DO4H 5HM2A 1F5RA 4UDWH 3I78A 1HIAB 4GCHF 1SGRE 3MU5A 5T1VA 2AMQA 2PGBB 2PSYA 1EKBB 4X8SH 4ZXYH 2YNAA 1FAKH 4CRCA 2ZTYA 3A83A 1ARCA 3OEED 1GI7B 1GMCF 3SV7A 3BF6H 1NT1A 3TJUA 1O3NA 1Y3VA 2C8WB 1Q3XA 1QJ7B 2Y7ZA 1GHWH 2OTVA 3OX7U 2XWAA 3STJA 4WH8A 1TNKA 2H5DA 1IQEA 1VZQH 4Y0YE 4XE4A 8KME2 1TFXA 1FIWA 1N6YA 4BANB 4YTAA 3PWBA 3T28A 1AVGH 2QXIA 1ELDE 2BY6X 2BQ7B 2B8OH 3OE7D 4NA9H 1HLTH 4K8BA 4U01A 1G3CA 2TGDA 5C17A 1F0SA 4CBNA 4ZUHA 5JPMH 3VXEH 3GY4A 1INCA 1GJ7B 3U8OH 1DWCH 1ZHRA 1O3LA 1ELFA 1P2NA 2D8WA 2FYQA 3BG4C 2F3CE 4X1SU 2BDYA 1QRXA 3QDZB 3UNQA 3IWMA 2VBCA 3SOSA 4CR9A 1UTLM 1CT4E 1O3EA 3UREA 2UUFB 1CBWC 5EPNA 1OXGA 1TBRH 1Z1IA 1IQJA 2VIPA 4KTSA 1XXFA 2PSXA 2AS9A 4Q80A 1YWUA 1P8VC 3E0PB 4KTCA 3EA7A 3TIUA 5DN6D 2HGTH 2ZHQH 2ZWLH 3HK3B 5A0CA 2QE7D 1THRH 4U30A 1ELAA 3PO1B 4YOGA 3GS9A 3PB1E 1MTSA 3QZRA 1ZLRA 3QTVH 3K9XB 3L33A 2W7UA 5DJ7A 1TALA 3SGBE 2ZHWH 4OS2A 5C94A 2PV9B 1EZQA 4AG1A 1JXPA 3DFLA 2GCTB 5JYIA 4MPXA 4NSYA 2RFKC 4FUCA 4K60A 3SZEA 5FCRA 1F2SE 2TRMA 3V13A 4BTIB 1RS0A 2V35A 2THFB 3PV2A 1D9IA 2BZAA 5AF9H 2J94A 5F6MA 2RG3A 1NRQH 1C4V2 1GBDA 1TGNA 3FZZA 4RSPA 2FODA 1PPCE 5L30H 2W5EA 1AZ8A 3RU4T 4BAKB 2ASUB 5ESTE 6GCHG 3B9FH 4FUFA 2AHME 2XYAA 1ZTJA 4ACBA 2BX3A 1GBKA 2ZQ1A 5F53A 2YNBA 3BTHE 1A0JA 1WCZA 1BZXE 4ABDA 1A3BH 1C4U2 3ZZ5A 4FVBA 1VITF 4AYVB 4X1RU 5GXPA 1IQLA 4AORA 1K1MA 4FUGA 2AEIH 1IOEA 1GI9B 4YT7H 1W8BH 2A4GA 1VR1H 1C5SA 1EAXA 2FOAA 3F2HA 1NS3A 1C5OH 4NG9H 3Q3XA 4NA7A 8ESTE 3GCNA 1EJNA 2ZA5A 1CVWH 2HLDD 4GVUA 2JDID 1Z71A 5E8EH 1ZGIA 2PKAA 3MO9A 3F2FA 2VGCC 1VGCC 2PWXA 3PWCA 3ATMA 1H4WA 4WF8A 2FEQH 4H6TA 4YO9A 3LKWA 5L2YH 3Q3KA 1SKYE 1ETRH 3GY5A 4RN6A 3UIRA 1HJ8A 4SGBE 5A0AE 2BD7A 4X6NA 1QL7A 1LHEH 3T2NA 1SOTA 2H5CA 1KXAA 2QY0B 4DW2U 2BM2A 2ZGHA 1GHVH 3ATIA 3BG4B 1GMHG 3QTOH 1TNLA 1ZR0A 1MTVA 2XOKD 3BEFB 2AMPA 3Q3YA 3RXGA 3QX5H 3SJOA 3BEIB 4E05H 3VGCB 1ELEE 1D3DB 8GCHF 1ZSLA 1O2JA 1ZTKA 1LVOA 2QXGA 1MU6B 3Q00A 1AWFH 2WPLS 3RC4A 3GISB 2H6MA 2ZC9H 1NN6A 3UPEA 1C5XB 1LHDH 3OTJE 3ZZBA 1EZSC 3LJJA 4MPVA 1P57B 3FOAA 5EQSA 1T32A 4GHQA 3FANA 2QXJA 1KLJH 4WMDA 1ZMJA 4D7FA 1QB1A 2H9TH 1TPAE 1K22H 3BTDE 2WPDD 3V7TA 1FPHH 2A7JA 1QQUA 2PUXB 4Y8YA 3K6ZA 3BG8A 1EJAA 1LCYA 1S82A 3KYGA 4NIYA 1ID5H 4KKDA 2HOBA 1O2NA 4QT8C 3B23B 1W0ZU 3EAJA 2KR7A 1B0EA 4I8JA 1FLEE 1IQKA 4RT0A 1P2JA 1AI8H 1HPGA 2Z9LA 1SGNE 3E91A 2JETB 1QA0A 1TYNA 4NGAH 3M37A 2CV3A 6ESTA 1HRTH 2H9EH 2BD3A 3UWJH 4ZKNU 3KQ5A 1QJ1B 3R0FA 3U98H 4JYUH 3H7OA 2ZFSA 1LTOA 7KMEH 4XRNA 4BXWA 1EZXC 1KXBA 1NBME 2L6OA 3AVZA 2BD9A 1BRBE 2P3FH 4M9FA 1MKWH 3ODFA 3VB3A 4ABBA 1ESAA 1BTWA 2JJ1D 4JZEH 1FQ3A 3TH4H 1C1PA 1O3MA 2ZGXH 2V7QD 2VVUA 4X6PA 1AFQC 2Q6FA 2TGTA 3GY8A 4H6SB 2A4RA 3A8DA 1CGHA 1YF4A 2DE9A 4DVAU 1AN1E 1O3GA 1YPEH 1QBVH 4ISNA 4B75A 1DM4B 1O3BA 3LH3A 1SFIA 4R8TB 3SYJA 2R2WU 4F4OC 4INHA 5JBTA 1C1UH 2FP7B 1MQ5A 3PRBA 5JB8S 2P8OB 4TSFD 1WDIA 3RXTA 2GGVB 1BBRH 2P94A 2PP6A 1A3EH 5I46H 1DSUA 3V0XA 2J38A 1XUKA 1SGFG 1JIMA 2GCTC 2LELA 1BRCE 4NZLA 1DXWA 1SB1H 1BJUA 1YPHE 2XRCA 4MQAA 2ZPSA 2KAIB 2FXRA 1YYY1 1LDTT 1P02A 1DXPA 5DP9A 5E0GA 1AO5A 1GHAG 2HNTE 1E1RD 1AWHB 2ZFFH 2RDLA 1GMDG 2Z9KA 4Q2KA 3F9HA 1UJ1A 1MKXH 2A5IA 1O38A 5T6DA 4O3TA 1C5WB 2C4FH 5IK2D 1GBEA 1UCYH 1A5IA 2KFWA 3ZZ8A 2HPQH 4MTBA 3LH1A 1AB9C 4D9QA 1BCUH 1O2HA 4TT3D 2O8LA 1OHHD 1DX5M 4WY3A 2FM2A 3PYHA 2BDIA 2V3HH 2CGAA 3BIUH 3MU8A 2ZCLP 1QBOA 4UEHH 3P8GA 3F68H 3U1IB 1ESBA 2ILNA 2RCEA 1SGCA 3ZZ3A 5LH8A 1L1GA 2XBVA 2NU2E 2FOFA 3MQKC 3SGQE 1WQSA 4X2WA 1GDQA 4IC6A 4MPUA 1GI8B 2GDEH 4KTUA 1BMLA 4HGCA 1Y5UT 1K2I1 1GBBA 4IMZA 4WVPE 1MD7A 1VCWA 2EA3A 4ABIA 4BAHB 1DY8A 1BBRE 2O8WA 1BTXA 2FI3E 1AUTC 1DVAH 1K1IA 1L2EA 2RA3A 3A7ZA 2O9QA 1BBRK 5DK1A 1KDQB 1NM6A 1FX0B 5K7RA 1HDTH 3PLBA 4OM9A 2C90B 3OEHD 2J4IA 1UTPA 5EW1H 1GCTC 1LHCH 1BTUA 1C2KA 1O3HA 1TGSZ 2EI7A 2J9NA 3VFEA 5IDKA 4Y0ZE 3H5CB 1TNJA 2BLVA 4JK5A 4IMQA 1MTNC 2EQNA 2VH6A 1TONA 4ZKSU 2HVXA 3ZZCA 5GCHG 2FTMA 4IBLH 1S84A 1RTLA 1GBIA 2BVXH 2VIDA 3A7TA 4NIWA 3M7TA 4AC9A 1C1SA 1QURH 5FX6A 3PLKA 3LGYA 1SGTA 1DPOA 1G2LA 1L0ZA 1NPMA 2KZ4A 1JRSA 1V2QT 3F0OA 5EXNA 1L1NA 2SNWA 1KDQA 1AFQB 2OLGA 1HAOH 4CH2B 1GPZA 4KP0A 1CA0B 1SBWA 2Y80A 3GCHC 3ZVEA 1KXEA 1IQGA 1IQFA 3BTWE 1YPGH 2P93A 2BY5X 1FI8A 1WXRA 3E1XB 4MVNA 4NA8A 1GBHA 5DP3A 1GBMA 1SLVB 4B76A 2AIQA 1AKSA 5F03A 1ANDA 4M7GA 1D3TB 4ISLA 5C67A 3GY7A 1RGQA 3TGJE 5B6OA 4K1SA 1F5LA 4FXGH 3SNEA 1YY3A 1O3JA 3F6UH 3SGAE 4DOQA 1P2KA 3S0NA 3QZQA 4O3UA 1OP8A 1K21H 1TPOA 1NROH 1ZOMA 4NIVA 3GDUA 1C5ZB 1HYLA 3UY9A 2P95A 2JIZD 2EI6A 1J16A 3N7DA 4FUHA 1QB6A 1W13U 5PTPA 3M5MA 1C5PA 1UVTH 3LIWA 1LVYA 1BTYA 2ZDNA 4JK6A 2G5VA 4RT1A 5CMXH 2XBXA 5K0HA 2WPKS 1K1LA 1UK3A 3BEUA 5FHTA 3SUDA 4MNXA 3SJIA 1CA8B 3RXIA 1ARBA 1TBQH 5A0BA 3CP7A 1O3CA 4Q7ZA 1BIOA 1ZRKA 3GICB 2W6JD 4DURA 5L6NH 1XMNB 4JZ1A 4ZCNA 3M61U 2ODPA 1T7CA 2STBE 1GCTB 4AYYB 1V2MT 2PFEA 3ZYEA 3RXMA 1WQVH 4Y76A 4JMYA 1WYKA 3P17H 2FWWA 1V2ST 4I8GA 1A2CH 2ZU1A 4MG3A 1GBJA 4B6FA 2WYJA 4D9RA 1C4Y2 1V2LT 2ZO3H 1TB6H 2V0BA 1UVSH 1SGPE 1P2MA 1SSXA 2FYRA 1MMJN 4CHAB 1GCDA 3EA8A 4DY7B 1GMCG 3RXQA 3S9CA 4LZ4B 2M5TA 1O3FA 1C5NH 2CMYA 3SU4A 2PTCE 1SL3A 4ABHA 5DP7A 1GBTA 1HNEE 3RXDA 2SGPE 2GKVE 2YOLA 1ZRBA 1GL1A 1HAYB 4YOJA 1EAWA 1A5GH 2GD4B 3DCLA 1C1WH 4K5ZA 3UFAA 1ZYOA 4U2WA 1LO6A 1E38B 4F49A 2HWLB 1EATA 3PRDA 5A8ZA 1GDUA 2TPIZ 3FO8D 1RD3B 1P12E 2I6SA 1FMGA 2QC2A 2XBYA 3OAAD 1AIXH 4D8NA 5C5NA 3RXEA 3ZVFA 1O39A 2G4TA 3A85A 5EPYA 1O3IA 2XC4A 2WUBA 3SBKA 4TPIZ 4X2VA 1O37A 2ESTE 1EASA 2BYAX 2BVRH 4GAWA 1KXDA 2JKHA 1BTZA 1UW7A 2VNTA 2XBWA 1QL8A 4YLUA 2Y82A 1QTFA 4Y11E 1TRNA 4FUJA 5C1UA 3GDVA 4Y79A 3A87A 3PROA 5CE1A 1UCYK 3N7EA 1OWJA 5C1XA 3SU6A 1YPMH 3FP6E 1JWTA 1TABE 5EG4A 3TVJB 2BX4A 2QF5A 1H8DH 1OOKB 2YMSB 3LGVA 1ZPBA 4XD7D 1KSNA 5E2PA 1O2XA 1UHBA 1GJAB 1S6HA 1OS8A 1TA2A 1C5RA 1H9IE 2WHXA 3RP2A 3D62A 4DT7B 4HI3A 2JH5D 2A5AA 3URDA 2CHAC 4K69A 4MLFB 2GMTC 3FZDA 1HAHH 1VCQA 1PQ5A 2ZU5A 1YPJH 1T8LA 1Y5BT 3TJNA 6LPRA 3TK9A 2VB0A 1GHZA 4AFUA 4ABFA 4ISIH 2W3IA 3SO3A 2FO9A 1AU8A 5C5OA 3PTBA 4E7NA 2WPJS 1EXFA 2F9BH 1K1JA 3A7WA 1GBAA 1PPBH 1P06A 4VGCC 4ABJA 1PFXC 1O5EH 4A5TS 1D4PB 5FAHA 3ESTA 1SQRA 1EAIA 4LXBH 4XBBA 3NUMA 1OYQA 1KXFA 3B8JA 3JZ2B 4Q63A 4LOYH 1TQ0B 4E06H 1DLKB 4X2XA 3S7HB 1SGEE 2F9VA 5AHGH 5EODA 3SQHE 2A7HA 1UHBB 3CS7A 4VGCB 5DGJA 1IQIA 1N8OB 5FBEA 4WJG2 1MD8A 1V2UT 1C5VA 1D3QB 5FBIA 1H8ED 1DE7H 1QGFA 1ORFA 1AVXA 1P03A 3WY8A 1FDPA 2Z9JA 1XVOA 4Q7XA 1O2LA 4X8UH 2B7DH 2HVYB 4GLYA 3SV2H 1V2RT 3GCTG 1F0RA 2Q6GA 2Z3DA 3ELAH 2J34A 2XXLA 1DDJA 2A1DB 2RDEA 1THPB 5HMAA 1S5SA 1O0DH 3DT0H 1UVPA 2GZ7A 3MU0A 2DE8A 1T4UH 5JDUB 2OBOA 2IJOB 3FN8A 3CENA 1Z8GA 2IN2A 3E0NB 4XOJA 4ASHA 1MAYA 2ANMH 1VGCB 1HIAA 3RXAA 1QZ8A 3BTME 3LDXH 2GVFA 1V6DA 1W10U 3LT3A 1O3DA 1MTNB 1BTPA 3EA9A 4NWLA 3FKSD 1QFKH 1D6WA 4HZHA 3UAIC 3P95A 5FPTA 1IQNA 2OC8A 4JYTA 5HYOA 1C2GA 1CHOG 1IAUA 2G4UA 2PKAB 2ZTZA 1UTKA 4DT4A 1SHYA 1Z8RA 2JJ2D 1G2MA 1TPSA 1HAXB 3GYLB 2XCNA 3DSGA 4OS1A 1XX9A 2VVCA 1DWDH 1GHYH 2O8TA 5DG6A 2BDGA 4GHTA 2GZ8A 2OC7A 2QA9E 4RKJB 3VB7A 1E0FD 1C1MA 1SGYE 3ATLA 4NSVA 3TJOA 1PPHE 2L74A 2STAE 4ZAEA 3A81A 3M3SA 4UE7H 1HJAC 3TK5A 1QNJA 2BHGA 1GG6B 1XKBC 3SU0A 1O32A 4UFDH 2P59A 3RXOA 2A5KA 1KYNA 3A80A 3KYFA 3EYDA 5JBAS 3BTTE 1SOZA 2FMJA 2Y81A 3H7TA 3SV6A 3AW0A 4IW4E 1E35B 1KXCA 4AB8A 1AB9B 1OYTH 2ZHEH 2RA0A 1KMHB 1XVMA 1AMHA 1CHOF 3MO6A 2F83A 2YMSC 3Q77A 1BJVA 2HPPH 4CBOA 1Z6EA 2F9OA 3A86A 2OBQA 1H1BA 1AD8H 5AFYH 2BD2A 4XDEA 3PMHB 1J14A 1FXYA 2HNTF 2AGIX 3O8DA 1C5QA 5JB9S 4DJZB 2K1QA 1C2MA 3ZVGA 3SNAA 5EXMA 1HB0B 3VEQB 1Y3UA 2FOCA 3RXPA 2H2ZA 1C2LA 1TIOA 1S6LA 3R3GB 1MKXK 4ASUD 2HRVA 2SGFE 1GJBB 4BOHA 4AGJA 1DOJA 1ACBE 1CGJE 4CH8B 5C0TA 3OU0A 2ZGBH 1G30B 1CT2E 4BXSA 1OPHB 2Z3EA
chains in the Genus database with same CATH topology
1ANBA 3LPRA 3A7VA 2PGQB 4FU9A 4INLA 3GCHB 1TMTH 1SG8B 3EDXB 4Y71A 2PW8H 1MQ6A 3MU4A 1OWKA 1AZZA 1G3EA 5ETXA 3RXHA 2VU8E 1EPTA 4DG4A 1LVMA 1TMUH 3KNXA 4ABAA 2BXTH 6GCHF 1YPKH 4E7RG 1TRMA 4XBCA 3SUEA 5LGOA 3LGTA 3TH2H 4X8VH 2FZZA 3A88A 3M5LA 4ZKOU 3RXBA 1AVWA 2G81E 1HXFH 1DT2A 2ZNKH 1YM0A 1V2KT 2BZ6H 1QRZA 1ANCA 3RC6A 2VWLA 1YCPK 2GT7A 4UFGH 9ESTA 4MNVA 2ZP0H 1UK4A 5DP5A 4ISHH 3A82A 3U69H 1GJ9B 1WV7H 2Z9IA 2P8OC 1J15A 1TBZH 2O8UA 7GCHG 2QCYA 3GCTF 1O30A 2A32A 3T62A 4A7IB 2ZDMA 1V2TT 3PM3A 1S81A 3TLOA 5J4QA 1GL0E 3GYMA 2FI5E 3C1KA 3VGCC 2ZKSA 1NRRH 5EW2H 4GCHG 3RMNH 4ISOA 2GV6A 4XBDA 4KELA 1YP9A 1GHXH 3A8CA 4ABEA 1GI2A 3SUFA 3IITA 2FOBA 1SLUB 1GMDF 4TWYA 5A2MH 4FVDA 3HKJB 4H4FA 1SLWB 3TJVA 5EGMA 1QB9A 1S83A 3MOCA 5GWZA 1NZQH 4OS7A 1ANEA 4CRFA 1GGDB 4K8YA 5ABWA 1NRSH 3P6ZB 1O5CB 1UK2A 4ESTE 2G52A 2OCVB 1T8OA 5A8XA 1QL9A 2VINA 2BVSH 2WV4A 4MDSA 1AHTH 1V2OT 2HLCA 3MNSA 1D3PB 1MH0A 2GCHG 3SV9A 1FAXA 2ANYA 1TGBA 1OWDA 4FUEA 3QGJA 1HGTH 1P11E 2OP9A 1MZDA 2VGCB 2R3YA 3K2UA 2TIOA 4Y8ZA 2ODYB 7LPRA 1QY6A 1CGIE 2JETC 2OXSA 4WH6A 1WU1A 1O3OA 1SGFA 2B0FA 4FU7A 1TNHA 3M35A 4I31A 4UD9H 1VITG 4AFSA 1K28D 1AGJA 3PLPA 2ZGCA 2FS9A 2Q6DA 2GT8A 4I33A 3MU1A 5E2OA 2CF9H 1NO9H 2VIWA 1O2YA 2W7SA 2SGDE 5DKMA 1FNIA 2ZI2H 4TPYA 1ZGVA 1FV9A 2EEKA 2BLWA 2ZTXA 4Z0KA 1GI4A 5GCHF 5GIBA 2EC9H 1HXEH 2ZFQH 1DITH 1EOLA 1G32B 1V2VT 1HFDA 3SNDA 3KHVA 3RU4D 1PYTD 1L4ZA 3LGWA 1DY9A 3K6YA 1O5BB 2G55A 4OS5A 4AN7A 4OGXA 5ESBA 4LK4A 2A4OA 3UNSA 5F8XA 1BRUP 1OP2A 2AGGX 1P04A 3LC5A 4O97A 1T8MA 1E37B 3JZ1B 1GMHF 8GCHG 1P01A 4JYVH 2W3KA 1TGTA 1SVPA 4X1QU 3W95A 3U8TH 4WWYA 1L1JA 3SJ8A 1FJSA 3UQVA 1NFYA 4INKA 4AX9H 1AFEH 5GJ4B 4NZQA 4B73A 4B2AA 1DS2E 2Q1JA 4D76A 5EOKA 1O2WA 4X8TH 3NPSA 1FN6A 3KQDA 3STIA 2CHAB 5SGAE 2IOTA 1EP5A 2BTCE 5AVDA 2ZDVH 1GJCB 3M5NA 4YLQH 1PQ7A 5BRRE 3NK8A 3P8FA 3S9BA 4YZUA 3UWIA 3VXFH 3KF2A 3LONA 3RXLA 1EZUC 2BB4A 3A8BA 3RLWH 2V3OH 1O3PB 1QJ6B 4SGAE 1ZHMA 2ZCHP 2ZQ2A 4HTCH 4BAOB 1K1NA 2BXUH 3DUXH 5IYTA 3SI3H 1RTKA 3ZV9A 5C20A 1TGCA 1O2KA 3F9EA 3E3TA 3ZVCA 5BPEA 4X6MA 1GJDB 4FUDA 4MNWA 3TK6A 2FX4A 2QN5T 3HGPA 1Y3WA 1ABIH 1O5AB 1O3AA 1T31A 3ATWA 3P92A 5I25A 2BQWB 4K2YA 4ZROA 5T6FA 1AY6H 5LPEA 1YGCH 4DIHH 1O2MA 2ZPQA 3TH3H 1HUTH 1F0UA 1C5YB 1BUIA 1E34B 3BTFE 4GPGA 4Y10E 2AH4X 3FP8E 2G51A 1NRPH 1KTTB 4AOQA 1O2VA 3AASA 1Y59T 3S7KB 2J95A 2A45B 2FIRH 2V6NA 1GI3A 2VWOA 3SW2B 1J17T 4ZXXH 1BT7A 1CU1A 1THSH 1UVOA 2BDBA 1B0FA 3NCLA 2F9PA 3BTGE 2PKSC 2OINA 3M7UA 3UR6A 2VH0A 4CHAC 3RDZA 1TE0A 2QGRA 1GJ4H 3F9FA 2ZU2A 3OYPA 3SI4H 5HGGA 4CRDA 2F9NA 1P9UA 2Y5GA 1D6RA 3P8NA 4U32A 1W14U 1PPZA 2XC5A 3MH7A 5FPSA 2Z9GA 1GI1A 1TRYA 3BSQA 4UFEH 1O5DH 3RM2H 2ULLA 5AFZH 1O2IA 3ZZDA 1EPTC 1KIGH 3FAOA 4RKOB 3A7XA 2HNTC 1O3KA 2GCHF 2B5TB 3L3TA 1ZPCA 4IC5A 1TQ7B 3SHCH 1A7SA 1Y8TA 5EXLA 1P2QA 1SFQB 4Y7BA 2Z7FE 2D26C 4IS5A 1ZZZA 3QUMP 1SC8U 2BDHA 3P70B 1WAYB 3TU7H 3F1SB 1MTWA 1O5FH 2A2QH 1NFXA 5JBBS 1P3EA 2GZ9A 3DFJA 1TOMH 2ZDLA 3PMAB 3MWIU 2P3UB 2QYIA 4AZ2B 4B2BA 3MO3A 4X0WU 5H4IB 1NC6A 3SN8A 1EUFA 2D2DA 1O2ZA 3T29A 1TX7A 5G4BA 3T25A 4Y8XA 2BLOA 2ZFPH 2OQ5A 1YKTA 1J8AA 1X7AC 4OGYA 1H9HE 1P0SH 2ZDKA 2SGQE 4ABGA 3GCOA 1TAWA 3SQEE 4CR5A 1IQMA 1Y3YA 1OKXA 1B5GH 3LC3A 1QHRB 1W12U 4R0IA 3RU4E 4D7GA 1F7ZA 1KY9A 1OWEA 1G37A 1C9PA 1CSOE 4NCYA 2Y5FA 4PROA 4FUBA 2QV1A 3GY2A 3MNBA 1EB2A 5C2ZA 1MCTA 2VVVA 1HAGE 4TY7A 4TWWA 2XC0A 4A6LA 3LJOA 2H9HA 1FN8A 1W2KH 1K1PA 4AB9A 1MU8B 3ITIA 2ZIQH 4B2CA 1DUEA 4A1VA 1F0TA 1SHHB 1PPFE 1Z1JA 1N1LA 3RMMH 1BMAA 2ZFRH 1C2IA 2D1JA 3ZYDA 3NZIA 1JBUH 1LKBA 2PUQH 2A0QB 2VJ1A 2WPHS 1WUNH 1O31A 1SI5H 4YESB 3SORA 3ZZ4A 3UNRA 1PJPA 5TJXA 1O2OA 3M5OA 1UVUH 3SU2A 3ZZAA 1O33A 2VWMA 2UWPA 4CREA 1C5UA 1P9SA 4A1TA 2KAIA 1DUAA 1YCPM 1O35A 1DICA 1V2NT 3KQEA 4H42U 5CHAB 4ZH8A 1B7XB 3E16B 2Z94A 4FUIA 4A92A 3BTQE 3GDSA 1YPLH 3QO6A 2GTBA 3M36A 1O5GH 3HKIB 2ANKH 3MNXA 5FPYA 2XW9A 3SJ9A 2WV5A 3LU9B 1C1OA 1SLXB 2NU1E 4Q7YA 1HAVB 1CO7E 1YCPH 2QF3A 1CBWB 3GY3A 1GI6A 2FLBH 3I77A 5F8TA 3ENSB 4B1TA 1SGQE 5DPAA 2CJIA 2A2XH 2NWNA 1ETSH 5HXFA 1K9OE 4ZHLU 3M7QA 2C8XB 1EP6A 2VIQA 5F8ZA 4WXIA 1QR3E 2AIPA 1QBNA 1Y3XA 1LQDB 1TWXB 1RTFB 1RFNA 1GJ8B 2TGAA 3M3TA 2C3SA 1AE5A 1FY4A 1IQHA 1OX1A 3I29A 3KCGH 4Y7AA 1RIWB 1G36A 2VIOA 5TCCA 3URCA 2ZECA 2H1UA 4CRAA 1BB0B 4ZHMU 1BQYA 1WTGH 4GUXA 3SZNA 1ZJKA 3UUZA 2BDAA 3EE0B 5FXLA 2QIQA 1JOUB 4I8HA 4B74A 3KGPA 2ZFTA 8LPRA 3RXUA 3SU3A 1LQEA 4NIXA 3U1JB 2AERH 2J92A 3TPIZ 2HALA 2BD4A 3PTNA 1T4VH 3SJKA 4J2YB 2NU4E 3RC5A 2AFQB 3VPKA 3F9GA 1LPGB 1HAIH 4ZKRU 1ESTA 1MTUA 2W26A 1PQ8A 4JZDH 2G5NA 4AG2A 3ZZ6A 1P2IA 2QAAA 1FZZA 2BY7X 1XUHA 2XNIA 5GDSH 1GVLA 1DWEH 1W7XH 7GCHF 2UUYA 2ZHDA 1GI5A 3MNCA 3SUGA 3RXRA 4I8KA 1EB1H 1F92A 1LVBA 3SNBA 2G00A 1IHSH 3UTUH 2F9UA 2C8ZB 1EX3A 4NWKA 4XSKU 2BDCA 1GDNA 1P09A 1LPZB 2GP9B 1NFUA 4KGAA 4AGKA 2FI4E 1HAVA 3MH4A 4BAMB 1F5KU 2FLRH 1HAPH 3SU1A 2ZF0H 1C1TA 3MMGA 1BMNH 1ETTH 2PKSB 4X6OA 2Z6BD 1EQ9A 3RXKA 1YLCA 1ZPZA 2JH6D 3D65E 1O2UA 3LOXA 3D23A 1ZSKA 1UTOA 1TA6A 1XUFA 1GHBF 4DCDA 2WYGA 1EJMA 1SQAA 4NFFA 3TITA 4AFQA 2OC1A 1UMAH 1CA0C 2ZEBA 4WMEA 1J9CH 3QLPH 3O8CA 2AGEX 4K1EA 2FOHA 1A61H 1XUJA 4WMFA 4IGDA 2ZU3A 3SNCA 1P10A 3RM0H 3A89A 3RMOH 1GVKB 1O2QA 3PO1C 1QA7A 1C2JA 2VWNA 1SPJA 3A8AA 1TNGA 2SNVA 2ANWA 1C5TA 2FOMB 2QF0A 2OQUA 1ZHPA 3TGIE 3GY6A 4JZIA 1O2PA 5JBCS 3RXSA 3KQBA 3EQ0H 1SQTA 1HBTH 1AUJA 1DFPA 3ZVAA 4WXVA 1BDAA 2FX6A 1PPEE 1UCYE 1W11U 4YOIA 5TCAA 3TNSA 2WINI 3Q76A 2ALPA 3BTEE 2LNCA 1A1RA 1PPGE 2R2MB 5A09A 5DP6A 1YLDA 1S0RA 4J1YA 2ZPRA 4IN1A 2OD3B 4UONA 2BQ6B 1U6QA 1N6XA 4BTUB 2P16A 1MBQA 3MFJA 2XTTB 1JRTA 3AAVA 1C1RA 1BITA 3VB6A 1FUJA 4THNH 2WUCA 2FTLE 1GBCA 1ELCA 4K3JA 3K65B 5T3HA 3UOUA 3KN2A 1L4DA 1TX8A 1SGDE 3MTYA 1DANH 2CN0H 4JCNA 4TY6A 5CHAC 1EAUA 3V12A 1ABJH 1MAXA 2BY9X 4ZHAA 2AMDA 4BAQB 3T27A 4FU8A 5HM9A 1OSSA 3BV9B 5E0HA 3HGNA 3RXCA 1CE5A 1GHAF 3C27B 1H8IH 3E6PH 2CXVA 1XM1A 3MH5A 1DLEA 2I6QA 2UUJB 3QGNB 2JH0D 4DGJA 1BOQA 1UTMA 1PYTC 3O8RA 1A0HB 3E8LA 3HATH 3HK6B 1AKSB 1LMWB 1T8NA 2FS8A 3E90B 3QK1A 3L6PA 1ZMLA 1HV7A 4OS4A 3SHAH 1JIRA 2Y5HA 4I32A 3EGKH 1LKAA 1AQ7A 2OC0A 1NY22 1A0LA 3T5FH 1C9TA 3HPTB 3N7OA 1GJ6A 1KLIH 3FP7E 1RRKA 1WSSH 3NWUA 5LPFA 1XUGA 6CHAC 1GG6C 1MUEB 5EU8A 1A5HA 2GDDA 2ODQA 2ZDAH 1O2RA 3OY6U 1JMOH 1VITH 2ZU4A 2ZG0H 1C1QA 1C2EA 2FDAA 1C5LH 1XKAC 4O03A 4X1NU 2IPHA 3RXJA 1Z8IB 3GOVB 4X2YA 1OP0A 2EI8A 1BTHH 3P8OA 1ELVA 1Z6JH 2BOKA 2GMTB 1K1OA 4Y6DA 1VCPA 3NKKA 2ALVA 1P05A 3SV8A 1GVZA 1SGIB 1NFWA 2C93B 1RIWC 2R0KA 1S0QA 2TGPZ 1RJXB 1AE8H 2PHBA 1Y5AT 1BRAA 2XCFA 1FIZA 3ATKA 3FFGA 1CHGA 1BMMH 2R9PA 1MKWK 2R0LA 4MPWA 1GBFA 3DHKH 4MNYA 1OWHA 1ELTA 2OUAA 4ZMAH 5FCKA 2ZGJA 1E36B 1Q2WA 1QIXB 3QN7A 4YM9A 1ZJDA 2BMGB 2WPMS 2BD5A 3TGKE 2ZZUH 1O2TA 2UUKB 2CF8H 2XWBI 1N8OC 4HFPB 1NU7B 4B71A 1ELGA 2FOEA 2PLXA 1LPKB 1WTHD 1MBMA 1NESE 3TNTA 1GGDC 1V3XA 2GV7A 5FX5A 4DIIH 1Z8JB 1TOCB 1VJAU 1V2PT 2A4QA 3RXFA 1KTSB 5GPIB 3VB4A 1C2DA 1LHFH 3A7YA 5C3NA 1TMBH 1WOFA 3RLYH 1P2OA 1UTQA 2UWLA 3DD2H 1HCGA 2P3TB 1QRWA 5J4SA 2SGAA 1LHGH 1MZAA 2PR3A 3CS0A 7ESTE 3UQOA 5EQRA 1GBLA 4I7YH 2FOGA 2C8YB 2Y7XA 4TYDA 2J2UA 1O2SA 4O9VA 5DP4A 1NRNH 2TBSA 9LPRA 3V3MA 1HAZB 1VJ9U 4XFQA 3RUOA 1WBGB 4UFFH 1UTJA 4X1PU 5DP8A 2Z3CA 1YC0A 2B9LA 1GWAA 1HJ9A 3MYWA 2G8TA 1GHBG 4OS6A 3IG6B 3O8BA 3ZV8A 1EOJA 3MI4A 3OSYA 1O34A 4CRGA 2O8MA 1S6FA 2NU0E 6CHAB 1TNIA 1W0YH 1A4WH 1UTNA 3MHWU 2R3UA 3KIDU 1YPHC 1SQOA 1SR5C 2GX4A 3U9AH 1A46H 1UO6A 1C1NA 4BTTB 1PQAA 1CT0E 1HJAB 2F91A 1M9UA 3KQCA 1NU9A 1FY1A 3QWCH 2QXHA 5L2ZH 3LGIA 1G9IE 3NXPA 3ZVBA 3ZZ9A 1EPTB 4CRBA 1NTPA 1CQQA 1C1VH 5A8YA 2LPRA 2NU3E 2SGEE 3MH6A 4JZFH 3DA9B 3U8RH 1ELBA 2DUCA 3S69A 1C5MD 1Q31A 2WPIS 3KL6A 1XUIA 2PTNA 3RMLH 4I8LA 4NFEA 3OY5U 1C2HA 1V2WT 4LZ1H 1TLDA 1G3BA 2FESH 1Z7KA 2VIVA 4K1TA 3SU5A 3UR9A 3W94A 1BA8B 4Z6AH 1KLTA 1P3CA 3FVFB 1IHTH 1FY8E 1XXDA 3S9AA 3ODDA 5E0JA 1ZSJA 2A7CA 3VB5A 5LPRA 1QCPA 3BN9A 2Y6TA 3T26A 3A84A 3BTKE 5T6GA 1YBWA 3PMBB 1H9LB 1DSTA 2BOHB 1O2GH 1OWIA