1CO7E

R117h mutant rat anionic trypsin complexed with bovine pancreatic trypsin inhibitor (bpti)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNAHVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN II
total genus 60
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1co7E01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1co7E02
1EJAA 1GHYH 2ZU5A 3T28A 4Y71A 5FBIA 3AVZA 2Q6FA 1C2JA 2QXJA 1GJ5H 1H9HE 1UJ1A 2NU4E 5A8ZA 3V0XA 3GY3A 3SI4H 1THSH 3TK9A 2GDEH 4BTTB 3SHCH 3UR6A 1TOMH 2C90B 2XBWA 4TY7A 3RXIA 2FOMB 1L4ZA 3HK3B 1NRSH 1UVUH 3MH7A 1EX3A 1S83A 1N6XA 3QWCH 2OTVA 4X1RU 3ZYDA 5A2MH 1C5XB 3BIVH 1HBTH 2ZTZA 2GDDA 3LH3A 2SNWA 2F9PA 5T3HA 1SGIB 5AFYH 3S0NA 3DFLA 5T6DA 2ODQA 2CF8H 1C5RA 1GHAF 4X2VA 1UCYE 2PGQB 1YLCA 4D8NA 1JRTA 3VEQB 1UTKA 3M3SA 3MU4A 4X8UH 4ZHAA 2FI5E 1PPZA 1PYTC 3IITA 1TNHA 1GJCB 2Z9IA 4Y11E 1ESAA 1AE8H 1E0FD 2O8LA 3RXPA 2JKHA 4HFPB 2FYQA 5AF9H 3TVJB 5F03A 2F9UA 3PLKA 1O3CA 1FY3A 4Y0ZE 1UVPA 4MPUA 4E06H 1PQ7A 1GVKB 4AZ2B 3SNDA 1CT4E 1S82A 2C4FH 1Y3YA 3MYWA 2G00A 1S85A 3SJOA 9ESTA 4YLUA 2GCTC 1GJ7B 1P8VC 1ELTA 5FAHA 1DUEA 3SU0A 4DCDA 3A86A 2GT7A 3PYHA 3F1SB 1SOZA 5ESTE 1HB0B 1IOEA 4AYYB 3M7TA 1C5PA 4FUCA 1O37A 4K3JA 3BG4B 2A0QB 2QXHA 1T8LA 4MTBA 1ELFA 2OUAA 2ZWLH 2CF9H 1IHSH 1AKSB 1MUEB 2UWLA 4CRGA 2TGTA 4WWYA 2B8OH 3VB7A 4BAHB 4AB8A 4F4OC 2OC8A 2ZTXA 1AUTC 2PV9B 4DVAU 2R9PA 3L6PA 2VU8E 2Z6BD 1HAYB 3SN8A 3MWIU 1ZJKA 3QTVH 1GMDG 3GCOA 1IQEA 1KXBA 3A87A 1VCWA 3PMBB 1SGQE 4IGDA 3DFJA 3HPTB 1Z8GA 4MPWA 1GHXH 1C2HA 1LMWB 3TNTA 1T8NA 4X1SU 3ZZBA 4LZ4B 3STJA 2ODYB 2AGEX 5K7RA 3UNRA 4Q80A 1TX7A 5ESBA 2NU3E 3TGIE 2BD4A 1O3OA 2A4RA 1GBCA 2DE9A 3NXPA 2WPIS 1VZQH 2FIRH 3D65E 1C2KA 5FXLA 1ZPZA 7KMEH 5F8TA 1LVOA 4MLFB 8LPRA 1J9CH 2GCHG 1YKTA 1BMLA 4Q7ZA 1BOQA 4UDWH 4CBOA 2ZPSA 5C1YA 3VXEH 1FJSA 6LPRA 1GI9B 8GCHF 5A0BA 2OLGA 1SSXA 2AYWA 4K5ZA 1G2MA 2BY5X 1A4WH 5DO4H 1LVBA 1V2OT 3KNXA 1OWDA 1FIZA 1P01A 2A7HA 5AVDA 3HGNA 3RMMH 4CR9A 2GZ7A 3BF6H 4X6MA 2ZDNA 2SGAA 3O8BA 3A7WA 3EA8A 1MAXA 1J8AA 1QB1A 4FUDA 3BTQE 3ZV8A 4YESB 1F7ZA 1ID5H 1AO5A 1ANBA 4YM9A 2A31A 3EGKH 3QK1A 3GY5A 1GI5A 4Q2KA 1VITH 3UQOA 2A5IA 5C2ZA 1ZMNA 4X0WU 1B7XB 4YTAA 2ALVA 1H9LB 2ZU3A 3H7TA 1PPFE 4MNYA 3E91A 3ZVDA 1JWTA 1G37A 1E36B 1RFNA 1AUJA 1O5CB 6ESTA 3KF2A 3Q00A 1TIOA 1B5GH 3QN7A 3M5OA 4YLQH 4XFQA 3PMAB 1GCTB 1BA8B 2NU0E 1S0QA 1Q31A 1O3BA 1S6FA 3SV9A 3ELAH 1LKBA 2VIWA 1OOKB 1E37B 1KXAA 4JYVH 1EZSC 3TGJE 4R8TB 4WXVA 5JBTA 2HPQH 2EA3A 1GBJA 4WMEA 3RC4A 5IDKA 1DANH 1YPMH 5C5OA 1MTNC 1W14U 1DWBH 2I6SA 4Y6DA 1A5IA 1F2SE 4U2WA 1HPGA 4UONA 2O8WA 2PSXA 1YYY1 1T8OA 2ZZUH 1EB1H 2TRMA 1BIOA 5GPIB 1ZHMA 1TNGA 1O3NA 1V2TT 3RXEA 1KDQA 3PLBA 1OWJA 3ZZ7A 1P9SA 1HGTH 3TJUA 2AMQA 1O32A 1E35B 3K6ZA 1GBFA 1Q3XA 2AMPA 1HLTH 2OQ5A 1DUAA 1TPAE 4OS7A 2HNTC 3L3TA 1GDUA 3LU9B 3MHWU 1O0DH 2HLCA 1O2PA 3MMGA 2ZPRA 4UE7H 1DOJA 4ABBA 1C1QA 1SGFA 2P8OC 1PPGE 1QY6A 1VJ9U 1AFQB 4LXBH 2R2MB 2BD9A 1ETSH 2P94A 2QF0A 4AG1A 1C5NH 2HNTE 4AG2A 4FU8A 2O8MA 2Y5FA 3KN2A 4ABIA 5C1XA 1BTXA 2ZDVH 1Z7KA 3SNBA 1O2QA 1O5AB 3GY6A 2K1QA 3R0FA 1BB0B 1B0FA 1ETTH 3ZZAA 1GBTA 1ELEE 1V2KT 2VB0A 1ZTLA 2Z9JA 1SBWA 1AVGH 4DURA 2R2WU 1TX8A 2GKVE 3ATWA 3GCTG 1W12U 1KXFA 3SU6A 1P10A 1DSUA 1GGDC 1GVLA 2BY9X 2Z9LA 3P8OA 1V2UT 3TLOA 1SGPE 4CHAB 1YM0A 3VXFH 4ZUHA 3U8RH 4IBLH 4OS5A 2CJIA 6CHAB 4CH2B 4B2BA 2VWMA 2ZFRH 1OP8A 5HM9A 2PSYA 4CRFA 1P2OA 1LCYA 3BEFB 3KQEA 3DD2H 1C1VH 3T5FH 2GX4A 1TMUH 4Y8XA 2HPPH 2QN5T 1PPBH 1EXFA 1DITH 3PO1C 2IN2A 2VGCC 1VR1H 4AB9A 3SQHE 1Z8IB 1GI6A 1GBBA 1QRXA 4CRDA 1UTPA 2SFAA 1AB9C 4RKOB 1TBRH 4A7IB 1S84A 6GCHG 4YT7H 2J9NA 1EAXA 4WH8A 2BD2A 1GL1A 1K1MA 3SUDA 1UTLM 5T6GA 1KXCA 1F0TA 2GMTB 1SGEE 2QXGA 1JRSA 3UTUH 4CREA 2SNVA 4NFEA 1UHBB 5GWZA 3C1KA 4FUHA 4HGCA 2BTCE 1QL8A 1RJXB 1EPTB 1P04A 1GJAB 5GXPA 4BXWA 1GHWH 1QTFA 1G32B 3S69A 3ZVCA 2GD4B 3MU5A 3MTYA 3RLWH 2XXLA 3ZVBA 3UOUA 4D76A 2D26C 4X8SH 1CA0C 3RM2H 1HJ8A 2CHAC 3BN9A 2BD5A 1JXPA 1TX6A 3MU8A 1AIXH 1XUGA 3UIRA 3AASA 2BQWB 4JYUH 3UFAA 2BLVA 3TPIZ 2VH6A 4FXGH 5DJ7A 3UWIA 1FY4A 1GMHF 1O36A 2BLOA 1H1BA 1VGCC 4D9RA 2VNTA 4VGCB 3UWJH 2BX4A 1W13U 1WQVH 2PUXB 1V2JT 1D6RA 2OC7A 1OSSA 5FCKA 4NGAH 2BQ6B 2ZI2H 4FU7A 1RRKA 3ATKA 2O8TA 3A82A 1PQAA 5HMAA 2CV3A 1O2NA 1C5ZB 1BTUA 3PMHB 5A0CA 1HAOH 1WTGH 4AOQA 2ZC9H 1HFDA 4DIHH 3STIA 5JB9S 1SLVB 3MH5A 2JH0D 3M3TA 2B5TB 2G5VA 3BTWE 1C1UH 1DLKB 3VPKA 1P02A 3PLPA 1LHDH 1LHCH 3F9FA 2TGPZ 2UUFB 4NA9H 1IQJA 1IQGA 2GZ8A 1F0UA 4OS2A 2EI6A 2WPLS 1ZHRA 4MDSA 1G3CA 5TCCA 1F5RA 3UNSA 5BPEA 3BSQA 4KP0A 3RLYH 3VB3A 1P03A 2BY7X 2THFB 1TNLA 3SU5A 1TGTA 1GWAA 1BHXF 2GV6A 1DLEA 1EP6A 1N8OC 1PJPA 2FOGA 2UWPA 3RMNH 2GV7A 4OS6A 1A2CH 1KTTB 3UUZA 3E0PB 2BY8X 1O3AA 4K8YA 3A89A 1C4V2 5FBEA 2IOTA 1BTYA 2P59A 4Y76A 3BTME 3K65B 1EAWA 1VITG 3B23B 1VJAU 5DP4A 1TRMA 4FUEA 1BT7A 3TK6A 3GYLB 4NIYA 1YPEH 1DWDH 4Y79A 4KELA 1LPZB 1DICA 5L6NH 1PPCE 2FLRH 3TU7H 4INLA 4DT7B 4SGBE 4WVPE 2HVXA 2XRCA 1BBRH 5DP6A 1UTJA 3TJOA 2SGEE 1KLIH 1O2YA 1OX1A 3LIWA 2WYJA 1HIAA 2IPHA 3C27B 4XBDA 1MBQA 1N1LA 4X8VH 1TGBA 3GOVB 3ATLA 4BAQB 3GCTF 2FO9A 4LOYH 1C5TA 1DT2A 1BBRK 1AZ8A 2O9QA 4B2AA 1TYNA 1YC0A 1FY8E 4LZ1H 3B8JA 4NCYA 3OY5U 1ARBA 4NZQA 1DDJA 4AORA 2V0BA 3K6YA 3GDVA 1AN1E 3URDA 2P3TB 1OYTH 1TMTH 4H6SB 3FZDA 3MNSA 1QA7A 1A1RA 2Y6TA 3I78A 2Z94A 1DXPA 2G4TA 5C20A 3LJJA 3IG6B 2FZZA 1DFPA 2P95A 3UREA 1SLXB 5LGOA 2Y80A 1RS0A 1QCPA 3OY6U 3RXCA 2GCTB 3U1JB 2FMJA 1O31A 4K1EA 3WY8A 1TRYA 2V35A 1CHOF 1UMAH 1FDPA 6GCHF 3FP8E 4KGAA 3MO3A 1BCUH 1MD8A 4K69A 4MVNA 2Z3EA 3LGYA 2C3SA 1C1NA 1O2TA 4AFZA 5A0AE 4NG9H 4NWKA 1KXDA 1IQNA 1GI0A 3VB6A 2BYAX 5EODA 3PTNA 2XBVA 3OTJE 5LPRA 3I29A 3TITA 4ABGA 4FUIA 1GBLA 5E0HA 1Y5UT 3QX5H 5EQSA 1RTLA 1ELAA 1P12E 1HXEH 2WV4A 1YPLH 4WY3A 3SNAA 1D6WA 1ZJDA 1WV7H 4U32A 3ZZ8A 1UTOA 3NPSA 1GI3A 4K60A 1QURH 1K1OA 3A7VA 1Z6EA 2H1UA 5FX5A 2P3UB 2VINA 2A1DB 2FS8A 3PM3A 1GI2A 3ZVEA 1KXEA 1GJDB 1YCPM 1LHEH 3BG8A 1L4DA 4PROA 4F49A 1C4Y2 2ALPA 3NK8A 1MQ6A 1NFXA 2XBXA 4B74A 1ABJH 1O2WA 2Z7FE 1K1NA 4GPGA 4AFQA 3RXAA 2A7CA 4X2YA 3EE0B 3A8BA 4H4FA 3QGJA 2G5NA 5FPYA 1LHGH 3VGCB 3RXJA 2CXVA 3FVFB 1GI7B 2XC4A 4BOHA 1EZXC 1V2NT 1FONA 1Y5BT 2A2XH 4INHA 1TQ7B 3BV9B 3QGNB 4BAMB 2J34A 2BB4A 1QBNA 2ZG0H 4Y7AA 2V3HH 4KTCA 5JYIA 4IC5A 3OYPA 3ITIA 1O3DA 4YT6H 2BOKA 2D2DA 2ANWA 3MU1A 1G3DA 4DGJA 3V13A 3TH3H 4IW4E 3LPRA 1XVMA 2BVRH 1G2LA 4Y7BA 1T31A 2BDAA 3A8DA 2R3YA 4B76A 1KTSB 3MFJA 3AW1A 1TFXA 1BQYA 3SBKA 1SLUB 1VCQA 4FU9A 1IQLA 2NU2E 4TPYA 1UK2A 4ZH8A 3SOSA 3ZVGA 1NESE 2PTNA 3DA9B 3SV2H 1C2DA 2F91A 2QF3A 2WV5A 4A1VA 2VIDA 1OYQA 7GCHG 2Z3DA 2A4OA 1ANDA 1HIAB 1Y59T 2BDHA 2QGRA 2BD7A 1YPKH 1O5GH 1MMJN 2Z3CA 1V2WT 3P70B 1OWHA 1DVAH 2B7DH 1GMCF 3HK6B 2R0KA 3F6UH 2C8YB 3TK5A 4ISOA 4X1QU 2OINA 2ZFFH 5EQRA 2ZCHP 1JBUH 2XTTB 1L1GA 1GDNA 3LGTA 1GI8B 1ELCA 4X6PA 2W5EA 4KTUA 1X7AC 3BTEE 3PB1E 2ZIQH 4A1TA 1NFWA 1T4UH 1C5MD 1H8IH 1ACBE 3RXTA 1G9IE 1O3EA 1D9IA 1LQEA 4INKA 4WMFA 2BLWA 1NRNH 1GHBF 1O3FA 4JZ1A 4I31A 3VFEA 1CQQA 1ORFA 1LPGB 1AU8A 2OP9A 4OS1A 3FAOA 4K2YA 4LK4A 1XM1A 1ESBA 3FZZA 3SJKA 1B0EA 1GDQA 2P3FH 3F9GA 5I46H 4UEHH 4X2WA 1EOLA 2ZU4A 4A6LA 4KKDA 4GAWA 1O3HA 1Y8TA 1TALA 5TJXA 1SG8B 1GG6B 3MO9A 2ZGCA 4NIVA 1HV7A 1ZRKA 5A09A 1C1WH 2BVXH 1MCTA 3M61U 2H6MA 1TAWA 4I8LA 1T32A 3F68H 1Y3UA 1T4VH 1FPCH 4J1YA 3A85A 1TPSA 1W8BH 1FN8A 5DP9A 1XUIA 5FPSA 1SOTA 3A8CA 4NA8A 1DPOA 1P2MA 5DP5A 1QQ4A 1ELDE 1NTPA 1YF4A 4FVDA 3T29A 1H9IE 1XXDA 1HJAB 1UK4A 2TBSA 3LGWA 2G55A 2ZDMA 4CRAA 1BTPA 1GBMA 2DUCA 3M3VA 3T26A 1SGNE 1MQ5A 2V6NA 2JETB 2ZU1A 3KL6A 4MQAA 3UY9A 2FDAA 3S7KB 2ANKH 2GVFA 4OGYA 1RXPA 3FP6E 3GY7A 4K1TA 2Q6GA 1BRAA 3V7TA 2ZFQH 1HAHH 1HRTH 2ANMH 4X1NU 3ENSB 2ZHQH 2WPHS 1AVWA 3ATIA 1LHFH 1GGDB 2PFEA 1TGCA 3OX7U 3RM0H 3OSYA 3FFGA 1NO9H 1NFUA 3RMOH 4I33A 5FX6A 2AIQA 5J4SA 1ZSLA 1V2LT 2ZHDA 1XKAC 1BZXE 1CBWB 1XX9A 3A83A 2IJOB 4JZIA 4UD9H 3LH1A 1GL0E 1YCPH 3P6ZB 4FUJA 2OQUA 1UVTH 2YNAA 1BHXB 2BD8A 3BTDE 1EB2A 3ZV9A 2H9TH 5DP8A 1NY22 2A5KA 4FVBA 1XUKA 4D7FA 3QO6A 4RKJB 1GCTC 2J94A 4MNXA 1P57B 1YCPK 3M5LA 4MPVA 3P17H 5GCHG 3SUEA 2OBQA 1OWEA 2RCEA 2FEQH 1FLEE 2STAE 4Q7YA 4DIIH 2P16A 1LKAA 2ZF0H 2D8WA 4Y10E 2H9EH 2CMYA 3QZRA 1ZR0A 2Y5GA 1THPB 3ATMA 1Z71A 3ZZ3A 1HDTH 2G8TA 4ZAEA 3RU4D 1O2KA 1SB1H 2ZGXH 1YLDA 1GI1A 1C1SA 3W95A 3RXOA 3K2UA 1D3PB 1QBOA 1V2VT 1MKWH 3SO3A 1MTWA 3LOXA 1C1RA 1A61H 1O3GA 1SHYA 4TWWA 5E8EH 3A7XA 1UTQA 2FPZA 3QLPH 1JMOH 1NRQH 3NKKA 3QUMP 1XUJA 4A92A 2Y82A 2FOFA 4O9VA 1MKWK 1GMDF 2FOCA 4CRBA 2F9VA 1Q2WA 1H4WA 1G30B 4UFGH 4ZHLU 1O2LA 2F3CE 3H5CB 4E7RG 4H6TA 2QIQA 1DS2E 1K1IA 3P8GA 5LH8A 1P3EA 4IS5A 1ARCA 4AX9H 3AAVA 2VVUA 2ZFTA 1ZSKA 1QBVH 1OPHB 1T8MA 1GCDA 2ZECA 3M35A 2XWAA 2RDLA 4XE4A 3UQVA 2ZDLA 1MAYA 2J95A 1A0LA 3SGAE 1FPHH 4THNH 1BITA 2GCHF 2BOHB 5JB8S 2PR3A 2WUBA 3H7OA 5DP7A 1L1NA 4GUXA 1AI8H 5DGJA 1AMHA 2XBYA 1TPOA 2CN0H 1OWIA 1P05A 2TIOA 1V2MT 2GZ9A 4E05H 1DE7H 1J14A 2F83A 5EU8A 4GSOA 2FESH 1TNJA 2FOEA 2XNIA 2F9BH 1MD7A 2ZHWH 1BBRE 4ZXYH 3DT0H 2FM2A 3K9XB 3QZQA 2ZDKA 2UUKB 3V3MA 1A3EH 4OS4A 1K1LA 3L33A 5DK1A 2AFQB 1GHAG 1G3EA 4ISNA 1K28D 1KDQB 3GDSA 2PHBA 4BTIB 4ZKSU 1SGTA 4A5TS 1PPEE 4CHAC 5TCAA 2C93B 1V3XA 3PTBA 5JBAS 2HNTF 1WUNH 3G01A 2G4UA 4JZDH 3RXLA 6CHAC 4O3UA 4ZKOU 1TB6H 3SU4A 2Y5HA 1HAPH 3ZZ5A 3LGVA 4XBBA 3EA9A 4YOGA 3SNCA 1BRCE 3SQEE 1WQSA 1O2RA 3F9HA 3A7TA 1O5FH 3PV4A 5F6MA 3QDZB 1WTHD 2PGBB 2AEIH 1SMFE 1RD3B 3DUXH 1ESTA 1BMMH 3UR9A 2KAIA 3RXMA 3P8NA 1QNJA 3SJ8A 1L0ZA 1D3TB 3PROA 2TGAA 1C5VA 4Y8ZA 1ZGIA 1QA0A 2FXRA 1HAZB 2BMGB 1RIWB 2PKSB 1HYLA 1O3JA 3I77A 1ZSJA 3SGQE 3SI3H 3AW0A 1K2I1 2PTCE 1O2GH 4WMDA 1QJ1B 3SV8A 3T25A 1WU1A 4ABDA 3JZ1B 1AFEH 5J4QA 1EP5A 2GMTC 4HTCH 5F8XA 1FI8A 3SUGA 3KCGH 4ASHA 2J92A 1GJ6A 3BEUA 4NFFA 1DWEH 1C4U2 5K0HA 1SC8U 4TY6A 3U1IB 1O2ZA 4AGKA 2W3IA 1BUIA 2BD3A 1GJBB 1EPTC 2HRVA 1FMGA 2AMDA 4AYVB 1QB9A 2FLBH 1FN6A 4UFEH 3SJIA 4Z6AH 2BX3A 1BJUA 5GIBA 4X1PU 3SNEA 5GJ4B 3BTGE 3Q3XA 1PYTD 2ILNA 1ZPCA 2QC2A 4RN6A 1O2JA 1SGRE 1A0HB 4ZKRU 5CHAB 2QAAA 1Z6JH 4VGCC 2PUQH 3TIUA 4ZKNU 1GJ4H 5EXLA 3GCHB 3S9CA 2BXTH 5DKMA 1G36A 2FTMA 1BJVA 1MTVA 4B71A 1O2UA 1C2IA 4XDEA 1EQ9A 1CA8B 3M36A 1NC6A 1THRH 1O5EH 1NU9A 1ZTKA 3LGUA 4D9QA 8GCHG 1ZMJA 5PTPA 2WUCA 1F0SA 1KSNA 2BDIA 3TGKE 3D23A 1MZDA 1WOFA 3E6PH 2FI3E 4ABHA 2C8ZB 5HM2A 1ZOMA 1YPJH 1G3BA 1HCGA 2G52A 1O3LA 3Q77A 3F9EA 1KIGH 1YP9A 1LVYA 3RU4T 3SW2B 2FOAA 1TA2A 2OD3B 1K22H 2BZAA 1HAVA 2OC1A 5C67A 3T27A 1CU1A 3E90B 4NSYA 4CRCA 2QXIA 3PWBA 1UVSH 4XBCA 1FAKH 1IHTH 1O2XA 2A32A 1MU6B 4WH6A 1NRRH 3UOPA 4MG3A 1SQAA 3MOCA 2YOLA 3M7UA 5F8ZA 1O3IA 2D1JA 1O30A 3A88A 4Q7XA 4XSKU 1SPJA 1GJ8B 3A7YA 1ETRH 3TH4H 3PMJA 1J16A 1C1OA 2BM2A 4ABAA 3RC5A 2CGAA 3KEEA 2VJ1A 5HYOA 4UFFH 1W7GH 1S6HA 1Z8JB 4BNRA 2AGIX 3B9FH 3ZZ6A 4BXSA 4AGJA 1D4PB 3BTFE 4O03A 4X6OA 1BMAA 1QQUA 3DHKH 1TWXB 3NZIA 4TPIZ 1O2HA 1QJ7B 2A7JA 1TRNA 2GTBA 1C9PA 5EGMA 1P2JA 1TABE 1A46H 2ZP0H 1AGJA 2XCFA 3SU2A 2KAIB 4JZEH 2AIPA 1BTWA 4NWLA 3ODDA 1QR3E 4MPXA 3P92A 2ZGHA 4HZHA 3E16B 1ZRBA 3NWUA 5DG6A 4FUBA 3VB5A 4UFDH 2V3OH 2BVSH 3SORA 4K1SA 4RSPA 1F5LA 4X2XA 2WINI 4ISLA 3AAUA 1P2KA 4U01A 4AN7A 2FX6A 4E7NA 2TPIZ 1PPHE 3P95A 3TJNA 2QY0B 1GBEA 4DW2U 5FCRA 1EATA 2BDBA 1NZQH 3LONA 1AWFH 1LQDB 1SFIA 1TPPA 1JIMA 3M7QA 2VWNA 1O3PB 2UUYA 1BRUP 1AZZA 3CS0A 3D49H 4CH8B 2Z9KA 1DY8A 3A8AA 1GVZA 2QYIA 3KIDU 1MH0A 4YOIA 3U8TH 1SGCA 2ZEBA 1GPZA 8ESTE 2R0LA 3RXQA 3GCNA 1C5LH 1OWKA 2ESTE 1C5UA 1OXGA 2LPRA 1P2NA 1AD8H 1HXFH 3GYMA 1C2LA 3RMLH 1N6YA 1CGHA 2BHGA 4OGXA 3A7ZA 1IAUA 3RXDA 3A80A 3MO6A 1TGNA 1BRBE 2OCVB 1FZZA 1OP0A 4H42U 5EXMA 3N7OA 3BEIB 3O8RA 1SQTA 2FS9A 3RXKA 2PW8H 1QRZA 4HI3A 1QIXB 1ABIH 4DY7B 1SLWB 1QJ6B 1E38B 2FODA 2QV1A 2WPMS 4ISHH 1CGJE 1ZZZA 4A1XA 1W11U 1HAVB 2OC0A 2G81E 2AERH 1BTZA 1HUTH 3EQ0H 3HKIB 3RUOA 1TOCB 3Q3KA 2ASUB 1D3DB 1INCA 4KTSA 3E0NB 3U69H 3KGPA 1DY9A 3LKWA 3RC6A 1TA6A 4CR5A 1DM4B 3U8OH 3RP2A 2VH0A 2ZGBH 1VITF 1F0RA 2B0FA 1FQ3A 3VGCC 1LVMA 3BG4C 1MTNB 1Z8RA 1ANEA 5C1UA 2RG3A 2GT8A 1TONA 3LJOA 4WF8A 4JCNA 4I7YH 4AFUA 4ISIH 4NIXA 2SGFE 1ZGVA 2STBE 3E8LA 2VWOA 3MNBA 1L2EA 2W3KA 1IQHA 1QB6A 1C2EA 3NCLA 1P2IA 1YPGH 3ZVAA 2ZQ2A 3S9BA 2FI4E 2JH5D 1UK3A 7LPRA 3FP7E 3T62A 2ZHFH 1WCZA 3Q3YA 1AVXA 1XXFA 1HJ9A 4ZXXH 1EZQA 3KQCA 5JBCS 2H9HA 1UCYH 2ZTYA 2VIVA 3GICB 1CSOE 1A5HA 4IN1A 2VIQA 1MKXH 5HGGA 1EUFA 1CHGA 4R0IA 1MTSA 1O5DH 2NWNA 1UO6A 1GMHG 3P8FA 3ZZDA 5EG4A 5CMXH 2WYGA 1O38A 4NIWA 4AFSA 1CE5A 1UCYK 1SQOA 4IN2A 1EASA 1AY6H 2P8OB 2SGPE 4B2CA 3W94A 1SR5C 1MKXK 4ZMAH 1C2FA 1O35A 2XCNA 2M5TA 4CBNA 1C1MA 2ZA5A 5G4BA 2HOBA 1TLDA 2F9NA 2HWLB 3QTOH 1ZPBA 2AGGX 3S9AA 3TJVA 3GY2A 3M37A 4IMZA 3LDXH 3BTKE 2NU1E 1KLTA 1QL7A 2J2UA 3SUFA 3KQDA 1GHZA 4MNWA 1CO7E 2W7SA 2OBOA 4B1TA 1J15A 4WXIA 4TWYA 5A8XA 2ZCKP 1UHBA 1YPHC 5HXFA 1QL9A 1EPTA 2RA0A 1O3MA 3V12A 2F9OA 3TNSA 3RXFA 2H5CA 2LNCA 2XWBI 1ZMLA 4X8TH 2ZDAH 1ELBA 4DOQA 1A5GH 2EC9H 5EPNA 4BAOB 4FUFA 1C5WB 3MNCA 1W0YH 1YPHE 1DSTA 1GG6C 1C5QA 1CGIE 1Y3VA 3RXVA 3A84A 1BMNH 1E34B 2P93A 1DWCH 1K1PA 2Y7XA 1AQ7A 2FOHA 1FY5A 1IQMA 4Y0YE 1A0JA 1O2IA 2HGTH 1NM6A 2OXSA 2QA9E 9LPRA 1LPKB 1W0ZU 3ZZ4A 4ABJA 2Z9GA 2VVVA 3RXGA 1O33A 4J2YB 1F92A 3SV6A 1S81A 2VIPA 3E3TA 3PO1B 1QFKH 2VGCB 3SV7A 1QGFA 1ANCA 1C2GA 5AFZH 3JZ2B 1XVOA 2QCYA 1NPMA 1CT0E 1AB9B 4ESTE 1HJAC 1O2SA 4O97A 1W10U 1ZTJA 2DE8A 1HAGE 3GISB 3MH4A 2FTLE 3LGIA 2JETC 1Y5AT 1U6QA 3BTTE 5LPFA 2FP7B 1ZHPA 1BDAA 1PQ8A 3GDUA 1CT2E 1JOUB 2Q6DA 4JYTA 3LC3A 4X6NA 3LC5A 3LT3A 4GCHG 1AE5A 1OP2A 4B73A 1P11E 2XW9A 3EDXB 2FWWA 3OU0A 1MU8B 5ETXA 2VVCA 2SGDE 1GI4A 4Y8YA 1OKXA 2ZQ1A 2B9LA 2PKAA 1FIWA 1SGDE 1MBMA 1CA0B 1P0SH 3O8CA 1FV9A 1NU7B 2CHAB 5H4IB 1XMNB 1XUHA 2RA3A 1FXYA 1TE0A 3HKJB 1GBIA 5E0JA 2VWLA 5DP3A 1NN6A 3RXBA 7GCHF 2C8WB 4FUGA 4U30A 5GDSH 1AWHB 3ZVFA 1GBDA 1NROH 1VGCB 1CBWC 2PLXA 1O2MA 7ESTE 2GGVB 3ESTA 2ODPA 1CVWH 2BZ6H 2R3UA 1FAXA 2A45B 2J4IA 1O3KA 4K8BA 1MCVA 1AFQC 3MH6A 1W2KH 1QHRB 2ANYA 2Y81A 3S7HB 4YOJA 1TMBH 4MNVA 2UWOA 5C3NA 4YO9A 3SHAH 3VB4A 3SU3A 1CHOG 5A8YA 1EOJA 1RGQA 5LPEA 2O8UA 1M9UA 1P06A 3MU0A 1YGCH 1P3CA 1IQIA 2EI8A 3O8DA 2ZKSA 2UUJB 3UPEA 1TQ0B 1D3QB 1PFXC 1WBGB 1C2MA 1FUJA 4XOJA 2BY6X 5EQQA 1GBHA 3ZZ9A 1P09A 1LDTT 1MTUA 4JK6A 1SVPA 2H5DA 1Y3XA 1LO6A 2BLQA 2I6QA 2HALA 1K1JA 1TNKA 3RXSA 3SJ9A 1SL3A 3MNXA 5IYTA 3KHVA 4I8KA 1SHHB 2BDCA 4NZLA 1L1JA 5L2YH 4B75A 2FX4A 5CE1A 2A4GA 4DG4A 1Z1IA 3RDZA 1A7SA 1S5SA 3MI4A 2XC0A 2H2ZA 3HATH 1FY1A 1SGYE 1N8OB 1O34A 1P2QA 4I8JA 2ULLA 2FOBA 1TBQH 2Y7ZA 1SGFG 2GP9B 5L30H 1ELVA 1C9TA 1WSSH 3ZZCA 5I25A 3UNQA 3RXRA 3U9AH 1V2ST 3R3GB 2ZPQA 3GY8A 4BANB 1NS3A 1BTHH 1K9OE 2ZGJA 3HGPA 2G51A 4QT8C 3GY4A 1RTKA 1ELGA 5B6OA 1GJ9B 1C5SA 4GVUA 1K21H 3PWCA 1YBWA 4JZFH 2Q1JA 1SFQB 1GBAA 1C1TA 2PWXA 2ZFPH 2W7UA 3ZYEA 4ABEA 1C5YB 1WAYB 2ZO3H 5E0GA 2ZCLP 3SGBE 2YNBA 3TH2H 5EW1H 1XKBC 4NA7A 4I8HA 4M7GA 1VCPA 3EA7A 1V6DA 3SZNA 1MZAA 2BQ7B 2C8XB 2XC5A 1J17T 4D7GA 1SI5H 1KLJH 1QRWA 1DX5M 8KME2 3T2NA 3RU4E 3CS7A 1W3CA 4GHQA 1EKBB 3BTHE 1IQKA 4GLYA 3E1XB 2J38A 3M5NA 3U98H 2PKAB 3M5MA 3RXUA 1EAIA 3D62A 1S0RA 5EPYA 4JK5A 3SU1A 1GMCG 1PQ5A 1GHVH 2EI7A 1TNIA 2AS9A 1FNIA 3IWMA 5JDUB 5JPMH 5EW2H 2XYAA 5DPAA 1W7XH 3Q76A 1LTOA 2A2QH 3KQBA 4ZHMU 1A3BH 2VIOA 1EZUC 1KYNA 4Z0KA 1O5BB 5E2PA 2A5AA 5JBBS 2ZHEH 1DXWA 5GCHF 5ABWA 1AKSA 3RXHA 2AH4X 4I8GA 1T7CA 1XUFA 4WJG2 1NFYA 1ZYOA 1RIWC 2PKSC 2WPKS 5BRRE 2FYRA 3FANA 1GHBG 2JH6D 1F5KU 1V2PT 1HAIH 1O2VA 2ZFSA 4O3TA 3BIUH 4DJZB 3A81A 1P9UA 5L2ZH 4BAKB 2BXUH 1NRPH 5FHTA 3URCA 1Z1JA 5C5NA 1HAXB 1C5OH 3NUMA 4SGAE 5FPTA 1V2RT 4TYDA 1GBKA 2WPJS 4BTUB 1H8DH 4GCHF 1V2QT 4JMYA 3EYDA 4ABFA 1KY9A 1Y3WA 3EAJA 1HNEE 1NT1A 1C1PA 3CP7A 1IQFA 4IC6A 5EOKA 1O2OA 1TGSZ 1TBZH 1UTMA 1UVOA 4ZROA 2TGDA 1RTFB 2EEKA 2A4QA 2SGQE 4NSVA 2BDGA 2ZNKH 1EJMA 2W26A 5AHGH 1AHTH 4GHTA 1WYKA 4IMQA 1OS8A 1UTNA 5T6FA 4I32A 1EAUA 1EJNA 1ZLRA 5CHAC 1JIRA 3ODFA 2ZU2A 3CENA 2BDYA 5E2OA 4YZUA 3GCHC 5EXNA 5SGAE 1O39A
chains in the Genus database with same CATH superfamily
1EJAA 1GHYH 2ZU5A 3T28A 4Y71A 5FBIA 3AVZA 5EJ1A 2Q6FA 1C2JA 2QXJA 1YLNA 1GJ5H 1COWD 1H9HE 1UJ1A 4RT0A 2NU4E 5A8ZA 3V0XA 3GY3A 3SI4H 1THSH 3TK9A 2GDEH 4BTTB 4HG6A 3SHCH 3UR6A 1TOMH 2C90B 2XBWA 4TY7A 3RXIA 5EIYA 2FOMB 1L4ZA 3HK3B 1NRSH 1UVUH 3MH7A 1EX3A 1S83A 1N6XA 3QWCH 2OTVA 4X1RU 3ZYDA 5A2MH 1C5XB 3BIVH 1HBTH 2ZTZA 2GDDA 3LH3A 4Q63A 2SNWA 2F9PA 5T3HA 1SGIB 5AFYH 3S0NA 3DFLA 5T6DA 2CK3D 2ODQA 2CF8H 1C5RA 1GHAF 3SYJA 4X2VA 1UCYE 2PGQB 1YLCA 4D8NA 1JRTA 3VEQB 1UTKA 3M3SA 3MU4A 4X8UH 4ZHAA 2FI5E 1PPZA 1PYTC 3IITA 4RI0A 1TNHA 1GJCB 2Z9IA 4Y11E 1ESAA 1AE8H 1E0FD 2O8LA 3RXPA 1H8HD 2JKHA 4HFPB 2FYQA 1W0KD 5AF9H 3TVJB 5F03A 2F9UA 3PLKA 1O3CA 1FY3A 4Y0ZE 1UVPA 4MPUA 4ZCNA 4E06H 5EJZA 1PQ7A 1GVKB 4AZ2B 3SNDA 1CT4E 1S82A 2C4FH 1Y3YA 3MYWA 2G00A 1S85A 3SJOA 9ESTA 4YLUA 2GCTC 1GJ7B 1P8VC 1ELTA 5FAHA 1DUEA 3SU0A 4DCDA 3A86A 2GT7A 3PYHA 3F1SB 1SOZA 5ESTE 1HB0B 1IOEA 4AYYB 3F2FA 3M7TA 1C5PA 4FUCA 1O37A 4K3JA 3BG4B 2A0QB 2QXHA 1T8LA 4MTBA 1ELFA 2OUAA 2ZWLH 2CF9H 1IHSH 1AKSB 1MUEB 2UWLA 4CRGA 2TGTA 4WWYA 2B8OH 3VB7A 4BAHB 4AB8A 4F4OC 2OC8A 2ZTXA 1AUTC 1H8ED 2PV9B 4DVAU 2R9PA 1WDIA 3L6PA 2VU8E 2Z6BD 1HAYB 3SN8A 2WPDD 3MWIU 3FOAA 1ZJKA 3QTVH 1GMDG 3GCOA 1IQEA 1KXBA 3A87A 1VCWA 3PMBB 1SGQE 4IGDA 3DFJA 3HPTB 1Z8GA 4MPWA 1GHXH 1C2HA 1LMWB 3TNTA 1T8NA 4X1SU 3ZZBA 4LZ4B 3STJA 2ODYB 2AGEX 2QF5A 5K7RA 3UNRA 4Q80A 1TX7A 5ESBA 2NU3E 3TGIE 2BD4A 1O3OA 2A4RA 1GBCA 3NRLA 2DE9A 3NXPA 2WPIS 1VZQH 2FIRH 3D65E 1C2KA 5FXLA 1ZPZA 7KMEH 5F8TA 1LVOA 4MLFB 8LPRA 1J9CH 2GCHG 1YKTA 1BMLA 4Q7ZA 1SQRA 1BOQA 4UDWH 4CBOA 2ZPSA 5C1YA 3VXEH 1FJSA 6LPRA 1GI9B 8GCHF 5A0BA 2OLGA 1SSXA 2AYWA 4K5ZA 1G2MA 2BY5X 1E1QD 1A4WH 5DO4H 1LVBA 1V2OT 3KNXA 1OWDA 1FIZA 1P01A 2A7HA 5AVDA 3HGNA 3RMMH 4CR9A 2GZ7A 3BF6H 4X6MA 2ZDNA 2LP6A 2SGAA 3O8BA 3A7WA 3EA8A 1MAXA 1J8AA 1QB1A 4FUDA 3BTQE 2LELA 3ZV8A 4YESB 1F7ZA 1ID5H 1AO5A 1ANBA 4YM9A 2A31A 3EGKH 3QK1A 3GY5A 1GI5A 4Q2KA 1VITH 3UQOA 2A5IA 2JDID 5C2ZA 1ZMNA 4X0WU 1B7XB 4YTAA 2ALVA 1H9LB 2ZU3A 3H7TA 1PPFE 4MNYA 2F43B 3E91A 3ZVDA 1JWTA 1G37A 1E36B 1RFNA 1AUJA 1O5CB 6ESTA 3KF2A 3Q00A 2KCYA 5IK2D 1TIOA 1B5GH 3QN7A 3M5OA 4YLQH 4XFQA 3PMAB 1GCTB 1BA8B 2NU0E 1S0QA 1Q31A 1O3BA 1S6FA 3SV9A 3ELAH 1LKBA 2V3MA 2VIWA 1OOKB 1E37B 1KXAA 4JYVH 1EZSC 3TGJE 4R8TB 4WXVA 5JBTA 2HPQH 2EA3A 1GBJA 4WMEA 3RC4A 5IDKA 1DANH 1YPMH 5C5OA 1MTNC 1W14U 1DWBH 2I6SA 4Y6DA 1A5IA 1F2SE 4U2WA 1HPGA 4UONA 2O8WA 2PSXA 1YYY1 1T8OA 2ZZUH 1EB1H 2TRMA 1BIOA 5GPIB 1ZHMA 1TNGA 1O3NA 1V2TT 3RXEA 1KDQA 3PLBA 1OWJA 3WWFA 3ZZ7A 1P9SA 1HGTH 3TJUA 2AMQA 1O32A 1E35B 3K6ZA 1GBFA 1Q3XA 2AMPA 1HLTH 1DUAA 2OQ5A 1TPAE 4OS7A 2HNTC 3L3TA 1GDUA 3LU9B 3MHWU 1O0DH 2HLCA 1O2PA 3MMGA 2ZPRA 4UE7H 1DOJA 4ABBA 1C1QA 1SGFA 2P8OC 3KYFA 1PPGE 2JIZD 1QY6A 1VJ9U 1AFQB 4LXBH 2R2MB 5DSFA 2BD9A 1ETSH 2P94A 2QF0A 4AG1A 1C5NH 2HNTE 2L6OA 3UB0A 4FU8A 2O8MA 4AG2A 2Y5FA 3KN2A 4ABIA 5C1XA 1BTXA 2ZDVH 1Z7KA 3SNBA 2IPQX 1O2QA 1O5AB 3GY6A 2K1QA 3R0FA 1FX0B 1BB0B 1B0FA 1ETTH 2GJGA 3ZZAA 1GBTA 1SKYE 1ELEE 1V2KT 2VB0A 1ZTLA 2Z9JA 1SBWA 1AVGH 4DURA 2R2WU 1TX8A 2GKVE 3ATWA 3GCTG 1W12U 1KXFA 3SU6A 1P10A 1DSUA 1GGDC 1GVLA 2BY9X 2Z9LA 3P8OA 1V2UT 3TLOA 1SGPE 4CHAB 2KCPA 1YM0A 3VXFH 4ZUHA 3U8RH 4IBLH 4OS5A 2CJIA 6CHAB 4CH2B 4B2BA 2VWMA 2ZFRH 1OP8A 5HM9A 2PSYA 4CRFA 1P2OA 1LCYA 3BEFB 3KQEA 3DD2H 1C1VH 5KECA 3T5FH 2GX4A 1TMUH 4Y8XA 2HPPH 2QN5T 1PPBH 1EXFA 1DITH 3PO1C 2IN2A 2VGCC 1VR1H 4AB9A 3SQHE 1Z8IB 1GI6A 1GBBA 1QRXA 3PRDA 4CRDA 1UTPA 2SFAA 2WZQA 1AB9C 4RKOB 1TBRH 4A7IB 1S84A 6GCHG 4YT7H 2J9NA 1EAXA 4WH8A 2BD2A 1GL1A 2EQNA 1K1MA 3SUDA 1UTLM 5T6GA 1KXCA 3AK5A 1F0TA 2GMTB 1SGEE 2QXGA 1JRSA 3UTUH 4CREA 2SNVA 4NFEA 1UHBB 5GWZA 3C1KA 4FUHA 4HGCA 2BTCE 1MABB 5C0TA 1QL8A 1RJXB 1EPTB 1P04A 1GJAB 5GXPA 4BXWA 1GHWH 1QTFA 1G32B 3S69A 3ZVCA 2GD4B 3MU5A 3MTYA 3RLWH 2XXLA 3ZVBA 1E1RD 3UOUA 4D76A 2D26C 4X8SH 1CA0C 3RM2H 1HJ8A 2CHAC 3BN9A 2BD5A 1JXPA 3KYGA 1TX6A 3MU8A 3OE7D 1AIXH 1XUGA 3UIRA 3AASA 2BQWB 4JYUH 3UFAA 2BLVA 3TPIZ 2VH6A 4FXGH 5DJ7A 3UWIA 1FY4A 1GMHF 1O36A 2BLOA 1H1BA 1VGCC 4D9RA 2VNTA 4VGCB 3UWJH 2BX4A 1W13U 1WQVH 2PUXB 1V2JT 3PV5A 3F2HA 1D6RA 2OC7A 1OSSA 5FCKA 4NGAH 2BQ6B 2ZI2H 4FU7A 1RRKA 3ATKA 2O8TA 3A82A 1PQAA 5HMAA 2CV3A 1O2NA 1C5ZB 1BTUA 3PMHB 5A0CA 1HAOH 1WTGH 4AOQA 2ZC9H 1HFDA 4DIHH 3STIA 5JB9S 1SLVB 3MH5A 2JH0D 4DT4A 3M3TA 2B5TB 2G5VA 3BTWE 1C1UH 1DLKB 3VPKA 1P02A 3PLPA 1LHDH 1LHCH 4ACBA 3F9FA 2TGPZ 2UUFB 4NA9H 1IQJA 1IQGA 2GZ8A 1F0UA 4OS2A 2EI6A 2WPLS 1ZHRA 4MDSA 1UW7A 4Z1MD 1G3CA 5TCCA 1F5RA 3UNSA 5BPEA 3BSQA 4KP0A 4P00A 3RLYH 3VB3A 1P03A 2BY7X 2THFB 1TNLA 3SU5A 1TGTA 1GWAA 1BHXF 2GV6A 1DLEA 1EP6A 1N8OC 1PJPA 2FOGA 2UWPA 3RMNH 2GV7A 4OS6A 1A2CH 3MQKC 1KTTB 3UUZA 3E0PB 2BY8X 1O3AA 2KX4A 4K8YA 3A89A 1C4V2 5FBEA 2IOTA 1BTYA 4F55A 2P59A 4Y76A 3BTME 3K65B 1EAWA 1VITG 3B23B 1VJAU 5DP4A 1TRMA 4FUEA 1BT7A 3TK6A 3GYLB 4NIYA 1YPEH 1DWDH 4Y79A 4KELA 1LPZB 1DICA 5L6NH 1PPCE 2FLRH 2HVYB 3TU7H 4INLA 4DT7B 4SGBE 4WVPE 2HVXA 2XRCA 1BBRH 5DP6A 1UTJA 3TJOA 2SGEE 1KLIH 1O2YA 1OX1A 3LIWA 2WYJA 1HIAA 2IPHA 3C27B 4XBDA 1MBQA 1N1LA 4X8VH 1TGBA 3GOVB 3ATLA 4BAQB 3GCTF 2FO9A 4LOYH 1C5TA 1DT2A 1BBRK 2K0QA 1AZ8A 2O9QA 4B2AA 1TYNA 1YC0A 1FY8E 3OEED 4LZ1H 3B8JA 4NCYA 3OY5U 1ARBA 2IJD1 4NZQA 1DDJA 4AORA 2V0BA 3K6YA 3GDVA 1AN1E 3URDA 2P3TB 1OYTH 1TMTH 4H6SB 3FZDA 3MNSA 1QA7A 1A1RA 2Y6TA 3I78A 2Z94A 2WSSD 1DXPA 2G4TA 5C20A 3LJJA 2KM0A 3IG6B 2FZZA 1DFPA 2P95A 3UREA 1SLXB 5LGOA 2Y80A 1RS0A 1QCPA 3OY6U 3RXCA 2GCTB 3U1JB 2FMJA 1O31A 4K1EA 3WY8A 1TRYA 2V35A 1CHOF 1UMAH 1YWUA 1FDPA 6GCHF 3FP8E 4KGAA 2F4LA 3MO3A 1VKYA 1BCUH 1MD8A 4K69A 4MVNA 2Z3EA 3LGYA 2C3SA 1C1NA 1O2TA 4AFZA 5A0AE 4NG9H 4NWKA 1KXDA 3WWBA 1IQNA 1GI0A 3VB6A 2OK5A 2BYAX 5EODA 3PTNA 2XBVA 3OTJE 5LPRA 3I29A 3TITA 4ABGA 5B6LA 4FUIA 1GBLA 5E0HA 1Y5UT 3QX5H 2V7QD 5EQSA 1RTLA 1ELAA 1P12E 1HXEH 2WV4A 1YPLH 4WY3A 3SNAA 1D6WA 1ZJDA 1WV7H 4U32A 3ZZ8A 1UTOA 3NPSA 1GI3A 4K60A 1QURH 1K1OA 3A7VA 2J98A 1Z6EA 2H1UA 5FX5A 2P3UB 2VINA 2A1DB 2FS8A 3PM3A 1GI2A 3ZVEA 1KXEA 1GJDB 1YCPM 1LHEH 1K0HA 3BG8A 1L4DA 4PROA 4F49A 1C4Y2 2ALPA 3NK8A 1MQ6A 1NFXA 2XBXA 4B74A 1ABJH 1O2WA 2KZ4A 1K1NA 2Z7FE 4GPGA 4AFQA 3RXAA 2A7CA 4X2YA 3EE0B 3A8BA 4H4FA 3QGJA 2G5NA 5FPYA 1LHGH 3VGCB 3RXJA 2CXVA 3FVFB 1GI7B 2XC4A 4BOHA 1EZXC 1V2NT 1FONA 1Y5BT 2A2XH 4INHA 1TQ7B 3BV9B 3F0OA 3QGNB 4BAMB 2J34A 2BB4A 1QBNA 2ZG0H 4Y7AA 2V3HH 4KTCA 5JYIA 4IC5A 3OYPA 3ITIA 1O3DA 4YT6H 2BOKA 2D2DA 2ANWA 3MU1A 1G3DA 4DGJA 3V13A 3TH3H 4IW4E 3LPRA 1XVMA 2BVRH 1G2LA 4Y7BA 1T31A 2BDAA 3A8DA 2R3YA 4B76A 1KTSB 3EE7A 3MFJA 3AW1A 1TFXA 1BQYA 3SBKA 1SLUB 1VCQA 4FU9A 1IQLA 2NU2E 4TPYA 1UK2A 4ZH8A 3SOSA 3ZVGA 1NESE 2PTNA 3DA9B 3SV2H 1C2DA 2F91A 2QF3A 2WV5A 4A1VA 2VIDA 1OYQA 7GCHG 2Z3DA 2A4OA 1ANDA 1HIAB 1Y59T 2BDHA 2QGRA 2BD7A 1YPKH 1O5GH 1MMJN 2Z3CA 1V2WT 3P70B 1OWHA 1DVAH 2B7DH 1GMCF 3HK6B 2R0KA 3F6UH 2C8YB 3TK5A 4ISOA 4X1QU 2OINA 2ZFFH 5EQRA 2ZCHP 1JBUH 2XTTB 1L1GA 1GDNA 3LGTA 1GI8B 1ELCA 4X6PA 2W5EA 4KTUA 1X7AC 3BTEE 3PB1E 2ZIQH 4A1TA 1NFWA 1T4UH 1C5MD 1WXRA 1H8IH 1ACBE 3RXTA 1G9IE 1O3EA 1D9IA 1LQEA 4INKA 4WMFA 2BLWA 1NRNH 1GHBF 1O3FA 4FETA 4JZ1A 4I31A 3VFEA 1CQQA 1ORFA 1LPGB 1AU8A 2OP9A 4OS1A 3FAOA 4K2YA 4LK4A 1XM1A 1ESBA 3FZZA 3SJKA 2L74A 1B0EA 1GDQA 2P3FH 3F9GA 5I46H 4UEHH 2QE7D 4X2WA 1EOLA 2YMSD 2ZU4A 4A6LA 4KKDA 4GAWA 2HLDD 1O3HA 1Y8TA 1TALA 5TJXA 1SG8B 1GG6B 3MO9A 2ZGCA 4NIVA 1HV7A 1ZRKA 5A09A 1C1WH 2BVXH 1MCTA 3M61U 2H6MA 5F53A 1TAWA 4I8LA 1T32A 3F68H 1Y3UA 1T4VH 3DSOA 3N7EA 1FPCH 4J1YA 3A85A 1TPSA 1W8BH 1FN8A 5DP9A 1XUIA 5FPSA 1SOTA 3A8CA 4NA8A 1DPOA 1P2MA 5DP5A 1QQ4A 1ELDE 1NTPA 1YF4A 2J98B 4FVDA 3T29A 1H9IE 1XXDA 1HJAB 1UK4A 2TBSA 3LGWA 2G55A 2ZDMA 4CRAA 1BTPA 1GBMA 2DUCA 3M3VA 3T26A 1SGNE 1MQ5A 2V6NA 2JETB 2ZU1A 4F48B 3KL6A 5C17A 4MQAA 3UY9A 2FDAA 3S7KB 2ANKH 2GVFA 4OGYA 1RXPA 3FP6E 3GY7A 2KCOA 4K1TA 2Q6GA 1BRAA 2YMSB 3V7TA 2ZFQH 1HAHH 1HRTH 2ANMH 4X1NU 3ENSB 2ZHQH 2WPHS 1AVWA 3ATIA 1LHFH 1GGDB 2PFEA 1TGCA 3OX7U 3RM0H 3OSYA 2EY4C 3F0PA 3FFGA 1NO9H 1NFUA 3RMOH 4I33A 5FX6A 2AIQA 5J4SA 1ZSLA 1V2LT 2ZHDA 1XKAC 1BZXE 1CBWB 1XX9A 3A83A 2IJOB 4JZIA 4UD9H 3LH1A 1GL0E 1YCPH 3P6ZB 4FUJA 2OQUA 1UVTH 2YNAA 1BHXB 2BD8A 3BTDE 1EB2A 3ZV9A 2H9TH 5DP8A 1NY22 2A5KA 4FVBA 1XUKA 4D7FA 3QO6A 4RKJB 1GCTC 2J94A 4MNXA 1P57B 1YCPK 3M5LA 4MPVA 3P17H 5GCHG 3SUEA 3FO8D 2OBQA 1OWEA 2RCEA 2FEQH 1FLEE 2STAE 4Q7YA 4DIIH 2P16A 1LKAA 2ZF0H 2D8WA 4Y10E 2H9EH 2CMYA 3QZRA 1ZR0A 2Y5GA 1THPB 3ATMA 1Z71A 3ZZ3A 1HDTH 2G8TA 4ZAEA 3RU4D 1O2KA 1SB1H 2ZGXH 1YLDA 1GI1A 1C1SA 3OFND 3W95A 3RXOA 3K2UA 1D3PB 1QBOA 1V2VT 1MKWH 3SO3A 1MTWA 3LOXA 1C1RA 1A61H 1O3GA 1SHYA 4TWWA 5E8EH 3A7XA 1UTQA 2FPZA 3QLPH 1BMFD 1JMOH 1NRQH 3NKKA 3QUMP 3W1EA 1XUJA 4A92A 2Y82A 2FOFA 4O9VA 1MKWK 1GMDF 2FOCA 4CRBA 2F9VA 2WV9A 1Q2WA 1H4WA 1G30B 4UFGH 4ZHLU 1O2LA 2F3CE 3H5CB 4E7RG 2VBCA 2QIQA 4H6TA 1DS2E 1K1IA 3P8GA 5LH8A 1P3EA 4IS5A 2JJ1D 1ARCA 4AX9H 3AAVA 2VVUA 2ZFTA 1ZSKA 1QBVH 1OPHB 1T8MA 1GCDA 2ZECA 3M35A 2XWAA 2RDLA 4XE4A 3UQVA 2ZDLA 1MAYA 2J95A 1A0LA 3SGAE 1FPHH 3PRBA 4THNH 1BITA 2GCHF 2BOHB 5JB8S 2PR3A 2WUBA 3H7OA 5DP7A 1L1NA 4GUXA 1AI8H 5DGJA 1AMHA 2XBYA 1TPOA 2CN0H 1OWIA 1P05A 2TIOA 1V2MT 2GZ9A 4E05H 1DE7H 1J14A 2F83A 5EU8A 4GSOA 2FESH 1TNJA 2FOEA 2XNIA 5HKKD 2F9BH 1MD7A 2ZHWH 1BBRE 4ZXYH 3DT0H 2FM2A 3K9XB 3QZQA 2ZDKA 2UUKB 3V3MA 1A3EH 4OS4A 1K1LA 3L33A 5DK1A 2AFQB 1GHAG 1G3EA 4ISNA 1K28D 1KDQB 3GDSA 2PHBA 4BTIB 4ZKSU 1SGTA 4A5TS 1PPEE 4CHAC 5TCAA 2C93B 1V3XA 2KCAA 3PTBA 5JBAS 2HNTF 1WUNH 3G01A 2G4UA 4JZDH 3RXLA 6CHAC 4O3UA 4ZKOU 1TB6H 3SU4A 2Y5HA 1HAPH 3ZZ5A 3LGVA 4XBBA 3EA9A 4YOGA 3SNCA 1BRCE 3SQEE 1WQSA 1O2RA 3F9HA 1S6LA 1O5FH 3A7TA 3PV4A 5F6MA 3QDZB 1WTHD 2PGBB 2AEIH 1SMFE 1RD3B 3DUXH 1ESTA 1BMMH 3UR9A 2KAIA 3RXMA 3P8NA 1QNJA 3SJ8A 1L0ZA 1D3TB 3PROA 2TGAA 1C5VA 4Y8ZA 1ZGIA 1QA0A 2FXRA 1HAZB 2BMGB 1RIWB 2PKSB 1HYLA 1O3JA 3I77A 1ZSJA 3SGQE 3SI3H 3AW0A 1K2I1 2PTCE 1OHHD 1O2GH 4WMDA 1QJ1B 3DSGA 3SV8A 3T25A 1WU1A 4ABDA 3JZ1B 1AFEH 5J4QA 1EP5A 2GMTC 4HTCH 5F8XA 1FI8A 3SUGA 3KCGH 4ASHA 2J92A 1GJ6A 3BEUA 4NFFA 1DWEH 1C4U2 5K0HA 1SC8U 4TY6A 3U1IB 1O2ZA 4AGKA 2W3IA 1BUIA 2BD3A 1GJBB 1EPTC 2HRVA 1FMGA 2AMDA 4AYVB 1QB9A 2FLBH 1FN6A 4UFEH 3SJIA 4Z6AH 2W6JD 2BX3A 1BJUA 5GIBA 4X1PU 3SNEA 5GJ4B 3BTGE 3Q3XA 1PYTD 2ILNA 1ZPCA 2QC2A 4RN6A 4AC9A 1O2JA 1SGRE 1A0HB 4ZKRU 5CHAB 2QAAA 1Z6JH 4VGCC 1QZ8A 2PUQH 3TIUA 4ZKNU 1GJ4H 5EXLA 3GCHB 2J97A 3S9CA 2BXTH 5DKMA 1G36A 2FTMA 1BJVA 1EFRD 1MTVA 1O2UA 1C2IA 4XDEA 4B71A 1EQ9A 1CA8B 3M36A 1NC6A 4XRNA 1THRH 1O5EH 1NU9A 1ZTKA 3LGUA 4D9QA 8GCHG 1ZMJA 5PTPA 2WUCA 1F0SA 1KSNA 2BDIA 4B6EA 3TGKE 1E79D 3D23A 1MZDA 1WOFA 3E6PH 2FI3E 4ABHA 2C8ZB 5HM2A 1ZOMA 1YPJH 1G3BA 1HCGA 2G52A 1O3LA 3Q77A 3F9EA 1KIGH 1YP9A 1LVYA 4RT1A 3RU4T 3SW2B 2FOAA 3CNRA 1TA2A 2OD3B 1K22H 2BZAA 3KQ5A 1HAVA 2OC1A 5C67A 3T27A 1CU1A 3E90B 4NSYA 4CRCA 2QXIA 3PWBA 1UVSH 4XBCA 1FAKH 1IHTH 1O2XA 2A32A 1MU6B 4WH6A 2RDEA 1NRRH 3UOPA 4MG3A 1SQAA 3MOCA 2YOLA 3M7UA 5F8ZA 1O3IA 2D1JA 1O30A 3A88A 4Q7XA 4XSKU 1SPJA 1GJ8B 3A7YA 2W6ID 1ETRH 3TH4H 3PMJA 1J16A 1C1OA 2BM2A 4ABAA 3RC5A 2CGAA 3KEEA 2VJ1A 5HYOA 4UFFH 1W7GH 1S6HA 3H09A 1Z8JB 4BNRA 2AGIX 3B9FH 3U28C 3ZZ6A 4BXSA 4AGJA 1D4PB 3BTFE 4O03A 4X6OA 1BMAA 1QQUA 3DHKH 1TWXB 3NZIA 4TPIZ 1O2HA 1QJ7B 2A7JA 4XD7D 2QF4A 1TRNA 2GTBA 1C9PA 5EGMA 1P2JA 1TABE 1A46H 2ZP0H 1AGJA 2XCFA 3GS9A 3SU2A 2KAIB 4JZEH 2AIPA 1BTWA 4NWLA 3ODDA 1QR3E 4MPXA 3P92A 2ZGHA 4HZHA 3E16B 1ZRBA 3NWUA 5DG6A 4FUBA 2WHXA 3VB5A 4UFDH 2V3OH 2BVSH 3SORA 4K1SA 4RSPA 1F5LA 4X2XA 2WINI 4ISLA 3AAUA 1P2KA 3FN8A 4U01A 4AN7A 2FX6A 4E7NA 2TPIZ 1PPHE 3P95A 3TJNA 2QY0B 1GBEA 4DW2U 5FCRA 1EATA 2BDBA 1NZQH 3LONA 1AWFH 1LQDB 1SFIA 1TPPA 1JIMA 1W0JD 2VWNA 3M7QA 1O3PB 2UUYA 1BRUP 1AZZA 3CS0A 3D49H 4CH8B 2Z9KA 1DY8A 3A8AA 1GVZA 2QYIA 3KIDU 1MH0A 4YOIA 3U8TH 1SGCA 2ZEBA 2XOKD 1GPZA 8ESTE 2R0LA 3RXQA 3GCNA 1C5LH 1OWKA 2ESTE 1C5UA 1OXGA 2LPRA 1P2NA 1AD8H 1HXFH 3GYMA 1C2LA 3RMLH 1N6YA 1CGHA 5C94A 2BHGA 4OGXA 3A7ZA 1IAUA 3RXDA 3A80A 3MO6A 1TGNA 1BRBE 2OCVB 1FZZA 1OP0A 4H42U 5EXMA 3N7OA 3BEIB 3O8RA 1SQTA 2FS9A 3RXKA 2PW8H 1QRZA 4HI3A 1QIXB 1ABIH 4DY7B 1SLWB 1QJ6B 1KMHB 1E38B 2FODA 2QV1A 2WPMS 3FKSD 1CGJE 4ISHH 1ZZZA 4Q4LA 4A1XA 1W11U 1HAVB 3OTPA 4ACAA 2OC0A 2G81E 2AERH 1BTZA 1HUTH 3EQ0H 3HKIB 3RUOA 1TOCB 3Q3KA 2KFWA 2ASUB 1D3DB 1INCA 4KTSA 3E0NB 3U69H 3KGPA 1DY9A 3LKWA 3RC6A 1TA6A 4CR5A 1DM4B 3U8OH 3RP2A 2VH0A 2ZGBH 1VITF 1F0RA 2B0FA 1FQ3A 3VGCC 3WW7A 4ASUD 1LVMA 5EJLA 3BG4C 1MTNB 1Z8RA 1ANEA 5C1UA 2RG3A 2GT8A 1TONA 3LJOA 4WF8A 4JCNA 4I7YH 4AFUA 4ISIH 4NIXA 2SGFE 1ZGVA 2STBE 3E8LA 2VWOA 3MNBA 1L2EA 2W3KA 1IQHA 1QB6A 1C2EA 3NCLA 1P2IA 1YPGH 3ZVAA 2ZQ2A 3S9BA 2FI4E 2JH5D 1UK3A 7LPRA 3FP7E 3T62A 2ZHFH 1WCZA 3Q3YA 1AVXA 1XXFA 1HJ9A 4ZXXH 1EZQA 3KQCA 5JBCS 2H9HA 1UCYH 2ZTYA 2VIVA 3GICB 1CSOE 1A5HA 4IN1A 2VIQA 1MKXH 5HGGA 1EUFA 1CHGA 4R0IA 1MTSA 1O5DH 2NWNA 1UO6A 1GMHG 3P8FA 3ZZDA 5EG4A 5CMXH 2WYGA 1O38A 4NIWA 4AFSA 1CE5A 1UCYK 1SQOA 4IN2A 1EASA 1AY6H 2P8OB 2SGPE 4B2CA 3W94A 1SR5C 1MKXK 4ZMAH 1C2FA 1O35A 2XCNA 2M5TA 4CBNA 1C1MA 2ZA5A 5G4BA 2HOBA 1TLDA 2F9NA 2HWLB 3QTOH 1ZPBA 2AGGX 3S9AA 3TJVA 3GY2A 3M37A 4IMZA 3LDXH 3BTKE 2NU1E 1KLTA 1QL7A 2J2UA 3SUFA 2J5UA 3KQDA 1GHZA 4MNWA 1CO7E 2W7SA 2OBOA 3F2GA 4B1TA 1J15A 3PV2A 4WXIA 4TWYA 5A8XA 2ZCKP 1UHBA 1YPHC 4M9FA 5HXFA 1QL9A 4OM9A 1EPTA 2RA0A 1O3MA 3V12A 5C0UA 2F9OA 3TNSA 3RXFA 2H5CA 2LNCA 2XWBI 1ZMLA 4X8TH 2ZDAH 1ELBA 4DOQA 1A5GH 2EC9H 5EPNA 4BAOB 4FUFA 1C5WB 3MNCA 1W0YH 1YPHE 1DSTA 1GG6C 1C5QA 1CGIE 5GNDA 1Y3VA 3RXVA 3A84A 1BMNH 1E34B 2P93A 1DWCH 1K1PA 2Y7XA 1AQ7A 2FOHA 1FY5A 1IQMA 4Y0YE 1A0JA 1O2IA 2HGTH 1NM6A 2OXSA 5T1VA 2QA9E 9LPRA 1LPKB 1W0ZU 3ZZ4A 4ABJA 2Z9GA 2VVVA 3RXGA 1O33A 4J2YB 1F92A 3SV6A 1S81A 2VIPA 1NBMD 3E3TA 3PO1B 1QFKH 2VGCB 3SV7A 1QGFA 1ANCA 1C2GA 5AFZH 3JZ2B 1XVOA 2QCYA 1NPMA 1CT0E 1AB9B 3F3BA 4ESTE 1HJAC 1O2SA 4O97A 1W10U 1ZTJA 2DE8A 1HAGE 3GISB 3MH4A 3N99A 2FTLE 3LGIA 2JETC 1Y5AT 1U6QA 3BTTE 5LPFA 2FP7B 1ZHPA 1BDAA 1PQ8A 3GDUA 1CT2E 1JOUB 2Q6DA 4JYTA 3LC3A 4X6NA 3LC5A 3LT3A 4GCHG 1AE5A 1OP2A 4B73A 1P11E 2XW9A 3EDXB 2FWWA 3OU0A 1MU8B 5ETXA 2YMSC 2VVCA 2SGDE 1GI4A 4Y8YA 1OKXA 2ZQ1A 2B9LA 4P02A 2PKAA 5FL7D 1FIWA 1SGDE 1MBMA 1CA0B 1P0SH 3O8CA 1FV9A 1NU7B 2CHAB 5H4IB 1XMNB 1XUHA 2RA3A 1FXYA 1TE0A 3HKJB 5CDFE 1GBIA 5E0JA 2VWLA 5DP3A 1NN6A 3RXBA 7GCHF 2C8WB 2PP6A 4FUGA 4U30A 5GDSH 1AWHB 3ZVFA 1GBDA 1NROH 1VGCB 1CBWC 2PLXA 1O2MA 7ESTE 2GGVB 3ESTA 2ODPA 1CVWH 2BZ6H 2R3UA 1FAXA 2A45B 2J4IA 1O3KA 4K8BA 5KGOA 1MCVA 1AFQC 3MH6A 1W2KH 1QHRB 2ANYA 2Y81A 3S7HB 4YOJA 1TMBH 4MNVA 2UWOA 5C3NA 4YO9A 3SHAH 3VB4A 3SU3A 1CHOG 5A8YA 1EOJA 1RGQA 5LPEA 2O8UA 1M9UA 1P06A 3MU0A 1YGCH 1P3CA 1IQIA 2EI8A 3O8DA 2ZKSA 2UUJB 3UPEA 1TQ0B 1D3QB 1PFXC 1WBGB 1C2MA 1FUJA 3SZEA 4XOJA 2BY6X 5EQQA 1GBHA 3ZZ9A 1P09A 1LDTT 1MTUA 4JK6A 1SVPA 2H5DA 1Y3XA 1LO6A 2BLQA 2I6QA 2HALA 1K1JA 1TNKA 3RXSA 3SJ9A 1SL3A 3MNXA 5IYTA 3KHVA 4I8KA 1SHHB 2BDCA 2XNDD 4NZLA 1L1JA 5L2YH 4B75A 2FX4A 5CE1A 2A4GA 4DG4A 1Z1IA 3RDZA 3N7DA 1A7SA 1S5SA 2RFKC 3MI4A 2XC0A 2H2ZA 4TT3D 3HATH 1FY1A 1SGYE 1N8OB 1O34A 1P2QA 4I8JA 4TSFD 2ULLA 2AHME 2FOBA 1TBQH 2Y7ZA 1SGFG 2GP9B 5L30H 1ELVA 1C9TA 1WSSH 3ZZCA 5I25A 5HIZA 3UNQA 3RXRA 3U9AH 1V2ST 3R3GB 2ZPQA 3GY8A 4B6FA 4BANB 1NS3A 1BTHH 1K9OE 2ZGJA 3HGPA 2G51A 4QT8C 3GY4A 1RTKA 1ELGA 5B6OA 2KR7A 1GJ9B 1C5SA 4GVUA 3UAIC 1K21H 3PWCA 1YBWA 4JZFH 2Q1JA 1SFQB 1GBAA 1C1TA 2PWXA 2ZFPH 2W7UA 2M2AA 3ZYEA 4ABEA 1C5YB 1WAYB 2ZO3H 1NBME 5E0GA 2JJ2D 2ZCLP 3SGBE 2YNBA 3TH2H 5EW1H 1XKBC 4NA7A 4I8HA 4M7GA 1VCPA 3EA7A 1V6DA 3SZNA 1MZAA 2BQ7B 2C8XB 2XC5A 1J17T 4D7GA 1SI5H 1KLJH 1QRWA 1DX5M 8KME2 3T2NA 3RU4E 3CS7A 1W3CA 4GHQA 1EKBB 3BTHE 1IQKA 4GLYA 3E1XB 2J38A 3M5NA 3U98H 2PKAB 3M5MA 3RXUA 1EAIA 3D62A 1S0RA 5EPYA 4JK5A 3SU1A 1GMCG 1PQ5A 1GHVH 2EI7A 1TNIA 2AS9A 1FNIA 3IWMA 5JDUB 5JPMH 5EW2H 2XYAA 5DPAA 1W7XH 3Q76A 1LTOA 2A2QH 3KQBA 3ZIAD 4I86A 4ZHMU 5KEDA 1A3BH 2VIOA 1EZUC 5HIYA 1KYNA 4Z0KA 1O5BB 5E2PA 2A5AA 5JBBS 4FOUC 2ZHEH 1DXWA 5GCHF 5ABWA 1AKSA 3RXHA 2AH4X 4I8GA 1T7CA 1XUFA 4WJG2 1NFYA 1ZYOA 1RIWC 2PKSC 2WPKS 5BRRE 2FYRA 3FANA 1GHBG 2JH6D 1F5KU 1V2PT 1HAIH 1O2VA 2ZFSA 4O3TA 3BIUH 4DJZB 3A81A 1P9UA 5L2ZH 5DN6D 4BAKB 2BXUH 1NRPH 5FHTA 3URCA 1Z1JA 5C5NA 1HAXB 2K8IA 1C5OH 3NUMA 4SGAE 5FPTA 1V2RT 4TYDA 1GBKA 2WPJS 4BTUB 1H8DH 4GCHF 3VG8A 1V2QT 4JMYA 3EYDA 4ABFA 1KY9A 1Y3WA 3EAJA 1HNEE 1NT1A 1C1PA 3CP7A 1IQFA 4IC6A 3DSPA 5EOKA 1O2OA 4YXWD 1TGSZ 3OAAD 1TBZH 3DCLA 3OEHD 1UTMA 1UVOA 4ZROA 2TGDA 1RTFB 2EEKA 2A4QA 2SGQE 4NSVA 2BDGA 2ZNKH 1EJMA 2W26A 5AHGH 1AHTH 4GHTA 1WYKA 4IMQA 5CHBA 1OS8A 1UTNA 5T6FA 4I32A 1EAUA 1EJNA 1ZLRA 5CHAC 1JIRA 3ODFA 2ZU2A 3CENA 2BDYA 5E2OA 4YZUA 3GCHC 5EXNA 5SGAE 1YY3A 1O39A
chains in the Genus database with same CATH topology
1EJAA 1GHYH 2ZU5A 3T28A 4Y71A 5FBIA 3AVZA 2Q6FA 1C2JA 2QXJA 1GJ5H 1H9HE 1UJ1A 2NU4E 5A8ZA 3V0XA 3GY3A 3SI4H 1THSH 3TK9A 2GDEH 4BTTB 3SHCH 3UR6A 1TOMH 2C90B 2XBWA 4TY7A 3RXIA 2FOMB 1L4ZA 3HK3B 1NRSH 1UVUH 3MH7A 1EX3A 1S83A 1N6XA 3QWCH 2OTVA 4X1RU 3ZYDA 5A2MH 1C5XB 3BIVH 1HBTH 2ZTZA 2GDDA 3LH3A 2SNWA 2F9PA 5T3HA 1SGIB 5AFYH 3S0NA 3DFLA 5T6DA 2ODQA 2CF8H 1C5RA 1GHAF 4X2VA 1UCYE 2PGQB 1YLCA 4D8NA 1JRTA 3VEQB 1UTKA 3M3SA 3MU4A 4X8UH 4ZHAA 2FI5E 1PPZA 1PYTC 3IITA 1TNHA 1GJCB 2Z9IA 4Y11E 1ESAA 1AE8H 1E0FD 2O8LA 3RXPA 2JKHA 4HFPB 2FYQA 5AF9H 3TVJB 5F03A 2F9UA 3PLKA 1O3CA 1FY3A 4Y0ZE 1UVPA 4MPUA 4E06H 1PQ7A 1GVKB 4AZ2B 3SNDA 1CT4E 1S82A 2C4FH 1Y3YA 3MYWA 2G00A 1S85A 3SJOA 9ESTA 4YLUA 2GCTC 1GJ7B 1P8VC 1ELTA 5FAHA 1DUEA 3SU0A 4DCDA 3A86A 2GT7A 3PYHA 3F1SB 1SOZA 5ESTE 1HB0B 1IOEA 4AYYB 3M7TA 1C5PA 4FUCA 1O37A 4K3JA 3BG4B 2A0QB 2QXHA 1T8LA 4MTBA 1ELFA 2OUAA 2ZWLH 2CF9H 1IHSH 1AKSB 1MUEB 2UWLA 4CRGA 2TGTA 4WWYA 2B8OH 3VB7A 4BAHB 4AB8A 4F4OC 2OC8A 2ZTXA 1AUTC 2PV9B 4DVAU 2R9PA 3L6PA 2VU8E 2Z6BD 1HAYB 3SN8A 3MWIU 1ZJKA 3QTVH 1GMDG 3GCOA 1IQEA 1KXBA 3A87A 1VCWA 3PMBB 1SGQE 4IGDA 3DFJA 3HPTB 1Z8GA 4MPWA 1GHXH 1C2HA 1LMWB 3TNTA 1T8NA 4X1SU 3ZZBA 4LZ4B 3STJA 2ODYB 2AGEX 5K7RA 3UNRA 4Q80A 1TX7A 5ESBA 2NU3E 3TGIE 2BD4A 1O3OA 2A4RA 1GBCA 2DE9A 3NXPA 2WPIS 1VZQH 2FIRH 3D65E 1C2KA 5FXLA 1ZPZA 7KMEH 5F8TA 1LVOA 4MLFB 8LPRA 1J9CH 2GCHG 1YKTA 1BMLA 4Q7ZA 1BOQA 4UDWH 4CBOA 2ZPSA 5C1YA 3VXEH 1FJSA 6LPRA 1GI9B 8GCHF 5A0BA 2OLGA 1SSXA 2AYWA 4K5ZA 1G2MA 2BY5X 1A4WH 5DO4H 1LVBA 1V2OT 3KNXA 1OWDA 1FIZA 1P01A 2A7HA 5AVDA 3HGNA 3RMMH 4CR9A 2GZ7A 3BF6H 4X6MA 2ZDNA 2SGAA 3O8BA 3A7WA 3EA8A 1MAXA 1J8AA 1QB1A 4FUDA 3BTQE 3ZV8A 4YESB 1F7ZA 1ID5H 1AO5A 1ANBA 4YM9A 2A31A 3EGKH 3QK1A 3GY5A 1GI5A 4Q2KA 1VITH 3UQOA 2A5IA 5C2ZA 1ZMNA 4X0WU 1B7XB 4YTAA 2ALVA 1H9LB 2ZU3A 3H7TA 1PPFE 4MNYA 3E91A 3ZVDA 1JWTA 1G37A 1E36B 1RFNA 1AUJA 1O5CB 6ESTA 3KF2A 3Q00A 1TIOA 1B5GH 3QN7A 3M5OA 4YLQH 4XFQA 3PMAB 1GCTB 1BA8B 2NU0E 1S0QA 1Q31A 1O3BA 1S6FA 3SV9A 3ELAH 1LKBA 2VIWA 1OOKB 1E37B 1KXAA 4JYVH 1EZSC 3TGJE 4R8TB 4WXVA 5JBTA 2HPQH 2EA3A 1GBJA 4WMEA 3RC4A 5IDKA 1DANH 1YPMH 5C5OA 1MTNC 1W14U 1DWBH 2I6SA 4Y6DA 1A5IA 1F2SE 4U2WA 1HPGA 4UONA 2O8WA 2PSXA 1YYY1 1T8OA 2ZZUH 1EB1H 2TRMA 1BIOA 5GPIB 1ZHMA 1TNGA 1O3NA 1V2TT 3RXEA 1KDQA 3PLBA 1OWJA 3ZZ7A 1P9SA 1HGTH 3TJUA 2AMQA 1O32A 1E35B 3K6ZA 1GBFA 1Q3XA 2AMPA 1HLTH 2OQ5A 1DUAA 1TPAE 4OS7A 2HNTC 3L3TA 1GDUA 3LU9B 3MHWU 1O0DH 2HLCA 1O2PA 3MMGA 2ZPRA 4UE7H 1DOJA 4ABBA 1C1QA 1SGFA 2P8OC 1PPGE 1QY6A 1VJ9U 1AFQB 4LXBH 2R2MB 2BD9A 1ETSH 2P94A 2QF0A 4AG1A 1C5NH 2HNTE 4AG2A 4FU8A 2O8MA 2Y5FA 3KN2A 4ABIA 5C1XA 1BTXA 2ZDVH 1Z7KA 3SNBA 1O2QA 1O5AB 3GY6A 2K1QA 3R0FA 1BB0B 1B0FA 1ETTH 3ZZAA 1GBTA 1ELEE 1V2KT 2VB0A 1ZTLA 2Z9JA 1SBWA 1AVGH 4DURA 2R2WU 1TX8A 2GKVE 3ATWA 3GCTG 1W12U 1KXFA 3SU6A 1P10A 1DSUA 1GGDC 1GVLA 2BY9X 2Z9LA 3P8OA 1V2UT 3TLOA 1SGPE 4CHAB 1YM0A 3VXFH 4ZUHA 3U8RH 4IBLH 4OS5A 2CJIA 6CHAB 4CH2B 4B2BA 2VWMA 2ZFRH 1OP8A 5HM9A 2PSYA 4CRFA 1P2OA 1LCYA 3BEFB 3KQEA 3DD2H 1C1VH 3T5FH 2GX4A 1TMUH 4Y8XA 2HPPH 2QN5T 1PPBH 1EXFA 1DITH 3PO1C 2IN2A 2VGCC 1VR1H 4AB9A 3SQHE 1Z8IB 1GI6A 1GBBA 1QRXA 4CRDA 1UTPA 2SFAA 1AB9C 4RKOB 1TBRH 4A7IB 1S84A 6GCHG 4YT7H 2J9NA 1EAXA 4WH8A 2BD2A 1GL1A 1K1MA 3SUDA 1UTLM 5T6GA 1KXCA 1F0TA 2GMTB 1SGEE 2QXGA 1JRSA 3UTUH 4CREA 2SNVA 4NFEA 1UHBB 5GWZA 3C1KA 4FUHA 4HGCA 2BTCE 1QL8A 1RJXB 1EPTB 1P04A 1GJAB 5GXPA 4BXWA 1GHWH 1QTFA 1G32B 3S69A 3ZVCA 2GD4B 3MU5A 3MTYA 3RLWH 2XXLA 3ZVBA 3UOUA 4D76A 2D26C 4X8SH 1CA0C 3RM2H 1HJ8A 2CHAC 3BN9A 2BD5A 1JXPA 1TX6A 3MU8A 1AIXH 1XUGA 3UIRA 3AASA 2BQWB 4JYUH 3UFAA 2BLVA 3TPIZ 2VH6A 4FXGH 5DJ7A 3UWIA 1FY4A 1GMHF 1O36A 2BLOA 1H1BA 1VGCC 4D9RA 2VNTA 4VGCB 3UWJH 2BX4A 1W13U 1WQVH 2PUXB 1V2JT 1D6RA 2OC7A 1OSSA 5FCKA 4NGAH 2BQ6B 2ZI2H 4FU7A 1RRKA 3ATKA 2O8TA 3A82A 1PQAA 5HMAA 2CV3A 1O2NA 1C5ZB 1BTUA 3PMHB 5A0CA 1HAOH 1WTGH 4AOQA 2ZC9H 1HFDA 4DIHH 3STIA 5JB9S 1SLVB 3MH5A 2JH0D 3M3TA 2B5TB 2G5VA 3BTWE 1C1UH 1DLKB 3VPKA 1P02A 3PLPA 1LHDH 1LHCH 3F9FA 2TGPZ 2UUFB 4NA9H 1IQJA 1IQGA 2GZ8A 1F0UA 4OS2A 2EI6A 2WPLS 1ZHRA 4MDSA 1G3CA 5TCCA 1F5RA 3UNSA 5BPEA 3BSQA 4KP0A 3RLYH 3VB3A 1P03A 2BY7X 2THFB 1TNLA 3SU5A 1TGTA 1GWAA 1BHXF 2GV6A 1DLEA 1EP6A 1N8OC 1PJPA 2FOGA 2UWPA 3RMNH 2GV7A 4OS6A 1A2CH 1KTTB 3UUZA 3E0PB 2BY8X 1O3AA 4K8YA 3A89A 1C4V2 5FBEA 2IOTA 1BTYA 2P59A 4Y76A 3BTME 3K65B 1EAWA 1VITG 3B23B 1VJAU 5DP4A 1TRMA 4FUEA 1BT7A 3TK6A 3GYLB 4NIYA 1YPEH 1DWDH 4Y79A 4KELA 1LPZB 1DICA 5L6NH 1PPCE 2FLRH 3TU7H 4INLA 4DT7B 4SGBE 4WVPE 2HVXA 2XRCA 1BBRH 5DP6A 1UTJA 3TJOA 2SGEE 1KLIH 1O2YA 1OX1A 3LIWA 2WYJA 1HIAA 2IPHA 3C27B 4XBDA 1MBQA 1N1LA 4X8VH 1TGBA 3GOVB 3ATLA 4BAQB 3GCTF 2FO9A 4LOYH 1C5TA 1DT2A 1BBRK 1AZ8A 2O9QA 4B2AA 1TYNA 1YC0A 1FY8E 4LZ1H 3B8JA 4NCYA 3OY5U 1ARBA 4NZQA 1DDJA 4AORA 2V0BA 3K6YA 3GDVA 1AN1E 3URDA 2P3TB 1OYTH 1TMTH 4H6SB 3FZDA 3MNSA 1QA7A 1A1RA 2Y6TA 3I78A 2Z94A 1DXPA 2G4TA 5C20A 3LJJA 3IG6B 2FZZA 1DFPA 2P95A 3UREA 1SLXB 5LGOA 2Y80A 1RS0A 1QCPA 3OY6U 3RXCA 2GCTB 3U1JB 2FMJA 1O31A 4K1EA 3WY8A 1TRYA 2V35A 1CHOF 1UMAH 1FDPA 6GCHF 3FP8E 4KGAA 3MO3A 1BCUH 1MD8A 4K69A 4MVNA 2Z3EA 3LGYA 2C3SA 1C1NA 1O2TA 4AFZA 5A0AE 4NG9H 4NWKA 1KXDA 1IQNA 1GI0A 3VB6A 2BYAX 5EODA 3PTNA 2XBVA 3OTJE 5LPRA 3I29A 3TITA 4ABGA 4FUIA 1GBLA 5E0HA 1Y5UT 3QX5H 5EQSA 1RTLA 1ELAA 1P12E 1HXEH 2WV4A 1YPLH 4WY3A 3SNAA 1D6WA 1ZJDA 1WV7H 4U32A 3ZZ8A 1UTOA 3NPSA 1GI3A 4K60A 1QURH 1K1OA 3A7VA 1Z6EA 2H1UA 5FX5A 2P3UB 2VINA 2A1DB 2FS8A 3PM3A 1GI2A 3ZVEA 1KXEA 1GJDB 1YCPM 1LHEH 3BG8A 1L4DA 4PROA 4F49A 1C4Y2 2ALPA 3NK8A 1MQ6A 1NFXA 2XBXA 4B74A 1ABJH 1O2WA 2Z7FE 1K1NA 4GPGA 4AFQA 3RXAA 2A7CA 4X2YA 3EE0B 3A8BA 4H4FA 3QGJA 2G5NA 5FPYA 1LHGH 3VGCB 3RXJA 2CXVA 3FVFB 1GI7B 2XC4A 4BOHA 1EZXC 1V2NT 1FONA 1Y5BT 2A2XH 4INHA 1TQ7B 3BV9B 3QGNB 4BAMB 2J34A 2BB4A 1QBNA 2ZG0H 4Y7AA 2V3HH 4KTCA 5JYIA 4IC5A 3OYPA 3ITIA 1O3DA 4YT6H 2BOKA 2D2DA 2ANWA 3MU1A 1G3DA 4DGJA 3V13A 3TH3H 4IW4E 3LPRA 1XVMA 2BVRH 1G2LA 4Y7BA 1T31A 2BDAA 3A8DA 2R3YA 4B76A 1KTSB 3MFJA 3AW1A 1TFXA 1BQYA 3SBKA 1SLUB 1VCQA 4FU9A 1IQLA 2NU2E 4TPYA 1UK2A 4ZH8A 3SOSA 3ZVGA 1NESE 2PTNA 3DA9B 3SV2H 1C2DA 2F91A 2QF3A 2WV5A 4A1VA 2VIDA 1OYQA 7GCHG 2Z3DA 2A4OA 1ANDA 1HIAB 1Y59T 2BDHA 2QGRA 2BD7A 1YPKH 1O5GH 1MMJN 2Z3CA 1V2WT 3P70B 1OWHA 1DVAH 2B7DH 1GMCF 3HK6B 2R0KA 3F6UH 2C8YB 3TK5A 4ISOA 4X1QU 2OINA 2ZFFH 5EQRA 2ZCHP 1JBUH 2XTTB 1L1GA 1GDNA 3LGTA 1GI8B 1ELCA 4X6PA 2W5EA 4KTUA 1X7AC 3BTEE 3PB1E 2ZIQH 4A1TA 1NFWA 1T4UH 1C5MD 1H8IH 1ACBE 3RXTA 1G9IE 1O3EA 1D9IA 1LQEA 4INKA 4WMFA 2BLWA 1NRNH 1GHBF 1O3FA 4JZ1A 4I31A 3VFEA 1CQQA 1ORFA 1LPGB 1AU8A 2OP9A 4OS1A 3FAOA 4K2YA 4LK4A 1XM1A 1ESBA 3FZZA 3SJKA 1B0EA 1GDQA 2P3FH 3F9GA 5I46H 4UEHH 4X2WA 1EOLA 2ZU4A 4A6LA 4KKDA 4GAWA 1O3HA 1Y8TA 1TALA 5TJXA 1SG8B 1GG6B 3MO9A 2ZGCA 4NIVA 1HV7A 1ZRKA 5A09A 1C1WH 2BVXH 1MCTA 3M61U 2H6MA 1TAWA 4I8LA 1T32A 3F68H 1Y3UA 1T4VH 1FPCH 4J1YA 3A85A 1TPSA 1W8BH 1FN8A 5DP9A 1XUIA 5FPSA 1SOTA 3A8CA 4NA8A 1DPOA 1P2MA 5DP5A 1QQ4A 1ELDE 1NTPA 1YF4A 4FVDA 3T29A 1H9IE 1XXDA 1HJAB 1UK4A 2TBSA 3LGWA 2G55A 2ZDMA 4CRAA 1BTPA 1GBMA 2DUCA 3M3VA 3T26A 1SGNE 1MQ5A 2V6NA 2JETB 2ZU1A 3KL6A 4MQAA 3UY9A 2FDAA 3S7KB 2ANKH 2GVFA 4OGYA 1RXPA 3FP6E 3GY7A 4K1TA 2Q6GA 1BRAA 3V7TA 2ZFQH 1HAHH 1HRTH 2ANMH 4X1NU 3ENSB 2ZHQH 2WPHS 1AVWA 3ATIA 1LHFH 1GGDB 2PFEA 1TGCA 3OX7U 3RM0H 3OSYA 3FFGA 1NO9H 1NFUA 3RMOH 4I33A 5FX6A 2AIQA 5J4SA 1ZSLA 1V2LT 2ZHDA 1XKAC 1BZXE 1CBWB 1XX9A 3A83A 2IJOB 4JZIA 4UD9H 3LH1A 1GL0E 1YCPH 3P6ZB 4FUJA 2OQUA 1UVTH 2YNAA 1BHXB 2BD8A 3BTDE 1EB2A 3ZV9A 2H9TH 5DP8A 1NY22 2A5KA 4FVBA 1XUKA 4D7FA 3QO6A 4RKJB 1GCTC 2J94A 4MNXA 1P57B 1YCPK 3M5LA 4MPVA 3P17H 5GCHG 3SUEA 2OBQA 1OWEA 2RCEA 2FEQH 1FLEE 2STAE 4Q7YA 4DIIH 2P16A 1LKAA 2ZF0H 2D8WA 4Y10E 2H9EH 2CMYA 3QZRA 1ZR0A 2Y5GA 1THPB 3ATMA 1Z71A 3ZZ3A 1HDTH 2G8TA 4ZAEA 3RU4D 1O2KA 1SB1H 2ZGXH 1YLDA 1GI1A 1C1SA 3W95A 3RXOA 3K2UA 1D3PB 1QBOA 1V2VT 1MKWH 3SO3A 1MTWA 3LOXA 1C1RA 1A61H