1CO7E

R117h mutant rat anionic trypsin complexed with bovine pancreatic trypsin inhibitor (bpti)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNAHVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN II
molecule tags Hydrolase/hydrolase inhibitor
total genus 60
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1co7E01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1co7E02
1HBTH 1GL0E 1EB2A 1GI5A 1P2MA 2NWNA 3RXQA 4A6LA 3I78A 1O2KA 1SQTA 3M7UA 5EXMA 4MG3A 4BTIB 3GY3A 4LOYH 4SGAE 1OP8A 1E37B 4AFUA 2A1DB 3ATWA 1Y3WA 2ZGXH 4KKDA 1IQNA 1O3HA 1MQ5A 2CF8H 4CRFA 2BVRH 2BDAA 4NWKA 4Y8XA 2Q6GA 2WUBA 3QGJA 1S83A 4E7NA 2O8TA 2ZTZA 3PTBA 4GVUA 2VIVA 2R0KA 3V3MA 4KTCA 3SGAE 4A1VA 5DO4H 4GCHG 1A5IA 4YOGA 9ESTA 5DJ7A 1DE7H 2O8MA 2AGGX 1XXDA 4K60A 1HIAA 3TH2H 1SLWB 2VNTA 5HGGA 1PPBH 1W8BH 1HAOH 1GBAA 1THSH 5LPFA 1CQQA 3A82A 1GJ6A 1AB9B 3PLPA 1OWHA 3A7XA 4X1QU 1GHAG 1ETRH 1YPMH 1L4ZA 2CF9H 2TGPZ 3RXGA 1GJBB 1ANDA 3E6PH 1ZLRA 2VWLA 1GJ7B 1IQMA 1HCGA 1BTPA 1BRBE 3LC3A 3UPEA 3UOUA 4ABAA 5K7RA 1RS0A 5GPIB 1B5GH 1IQIA 1P2NA 1C5ZB 4ABHA 1MU6B 3TPIZ 4TWYA 2BY7X 1OSSA 2PW8H 1RXPA 1KXDA 4Q7ZA 2I6SA 3SJKA 1C2DA 1O5GH 1NFXA 5EPNA 3SU0A 5E2PA 5ESTE 3E91A 3LGVA 2Y5HA 3U98H 1KSNA 1W7XH 2GP9B 1XUKA 3P8OA 4ZXXH 1GI2A 1T4VH 4F49A 2W5EA 1TNJA 1GI1A 1ELVA 1EKBB 5SGAE 2FYRA 5CHAB 1GGDC 1IQHA 4O03A 4IGDA 4A1TA 1HFDA 3F6UH 4ABDA 3OTJE 1X7AC 3M5NA 1W13U 1YM0A 1C2LA 4BXWA 1S82A 1O2MA 3UREA 3MWIU 2JH6D 4YM9A 4LZ1H 4GSOA 1GBMA 1MKXH 1O2SA 1QIXB 2A31A 5FHTA 1YLDA 1XUIA 3A8AA 1FONA 1T8LA 1ZTLA 2QXGA 2TIOA 3ZZ8A 2QXIA 3FZDA 4BAMB 4BAHB 4NCYA 2FWWA 3RXIA 3BEIB 1GDUA 4YT7H 1PPEE 2F9BH 1EOJA 1WOFA 3M37A 4X1SU 3M61U 2AS9A 4MNWA 1BITA 1K22H 1D3DB 1ZGVA 4FUIA 1AFQC 1TYNA 1P12E 5JB8S 3GYLB 1QRZA 3EA9A 1FNIA 2BX4A 2ZECA 4TWWA 5ABWA 4D7FA 1P3EA 3F9EA 3B8JA 2J92A 3TNTA 4NSVA 1LTOA 2ZHQH 2WYGA 3SNBA 4FU7A 3BG4C 3TIUA 2AFQB 3BEUA 4H6SB 3FVFB 1GWAA 1GJCB 1TPOA 3K9XB 2GKVE 1ELEE 1YP9A 1G2MA 2G51A 2ZDNA 1UCYE 3A86A 1NU7B 2EI6A 3LPRA 1BTHH 5DKMA 1V2WT 4K2YA 1O2OA 4U32A 3TITA 3U8OH 1ID5H 5J4SA 4D8NA 1CSOE 2Q6FA 1SGQE 3SV8A 4OS7A 1MTUA 4H6TA 3GCHC 4Q7YA 4D76A 2STAE 3RMOH 1O5AB 3G01A 1BZXE 1T7CA 2WYJA 1OWIA 2QYIA 2UWPA 1GI8B 1GHXH 1RD3B 2A7CA 2OCVB 1GHYH 1Z8GA 4X6PA 5HM2A 1ORFA 1BQYA 4NA8A 3HKIB 1UK3A 3SUFA 1CE5A 3MNSA 1M9UA 1QBVH 1TRNA 1SLVB 1J17T 2FI4E 2DE9A 1S81A 3U69H 2V3OH 1SI5H 2P59A 1TMTH 2VJ1A 3LOXA 1Z1JA 4Y7AA 4MNXA 2H5DA 2PV9B 1YPHC 1ETSH 2PKAA 3L33A 1ZRKA 1CT0E 1VJAU 3UR6A 1FXYA 3ESTA 1MTNC 4OGYA 4D9QA 1Z6JH 1D6WA 2PFEA 1SGRE 3P8FA 3BTFE 1FIWA 3PMHB 4B1TA 1RFNA 1YPLH 3TU7H 1TQ7B 2XRCA 4J1YA 1HJAB 3LGYA 3BV9B 2ANYA 4DOQA 1CVWH 2P8OB 1F0RA 2ZPSA 1KLTA 1Z8JB 8GCHG 1C5MD 2BMGB 3GDVA 1WSSH 1ELAA 3W95A 1O2GH 1PPGE 4A1XA 3E8LA 3SQHE 3MU1A 1ESBA 2TGAA 5E8EH 1QJ6B 2FOCA 3A84A 1A3EH 1N6XA 1P09A 1SLXB 2VVUA 4JYUH 4CHAB 1MKXK 1C4V2 3AAVA 1MD7A 3SJ8A 1GMHG 3Q77A 3OY6U 1PQAA 2XBXA 4ZAEA 1GBHA 3GICB 4NIWA 4MTBA 3M7TA 4AYVB 5T6DA 1TONA 3KQDA 3BG8A 3PTNA 4NGAH 5JBCS 1EP6A 2ZU5A 2NU4E 3ZVAA 8KME2 1O37A 1BT7A 1BHXF 5EPYA 5AF9H 2ZGCA 3Q76A 3SN8A 3BSQA 5GDSH 2GDEH 3CENA 1TA6A 1ZPCA 2XNIA 3MU8A 2BQ7B 1JBUH 1GMDG 2A5KA 2UWLA 3QO6A 1NN6A 1EOLA 1OX1A 1GBIA 4GAWA 1NFUA 4Y0ZE 1TIOA 3CP7A 1KDQB 2XWBI 2R3YA 1O3EA 1SOTA 1VGCC 5JB9S 1ANEA 4XOJA 5L30H 1TAWA 3HATH 2BYAX 2ZPRA 3QZQA 4JZ1A 1NRQH 2OBQA 4U30A 1WQVH 1A0LA 1O2RA 1BBRE 4ZHAA 4MVNA 3AVZA 1P06A 3MO9A 4ABGA 5BRRE 4NA7A 2VINA 3K2UA 2A4GA 1O2TA 4JMYA 2JKHA 2P8OC 2PGBB 1UCYK 1TBQH 4CRCA 4I7YH 1C9PA 1LPGB 4X8UH 1FAKH 4AFQA 2J2UA 4WWYA 1C1PA 3ZVCA 2GV7A 2W7UA 1ZSKA 4ZKSU 1CT4E 3RM2H 1QHRB 2J94A 5TCAA 3PWCA 1K1NA 2BQWB 3SV2H 1ZPBA 1CA0C 1CO7E 3MI4A 2G5VA 5L2YH 1NRNH 3FZZA 5GCHF 1GBJA 1AMHA 3UFAA 2TRMA 1LVYA 4R0IA 2SGDE 1L4DA 5JPMH 2IPHA 3OYPA 3FAOA 3SU6A 1T8MA 2VWNA 1PYTC 2GMTB 6CHAB 2C93B 1ZGIA 3S7HB 2ZDAH 3LGIA 5B6OA 1W3CA 1V2UT 1SGTA 4NWLA 1HV7A 1HJ9A 2AMPA 3Q3YA 4AB8A 5A09A 1QQUA 1GMCF 4FVDA 5GIBA 2Q1JA 3U8TH 1NPMA 3BIUH 1A0JA 1QY6A 2BD7A 4MQAA 1G37A 1EZUC 1OWKA 3A83A 1SR5C 2XWAA 3MNCA 4ZH8A 1OWJA 3OX7U 1FQ3A 3LT3A 1G3DA 4DGJA 4JZDH 1UHBA 1PFXC 1SHHB 1W10U 2GZ8A 5C1YA 1KLJH 2ODPA 3BTME 1FAXA 2B0FA 3KL6A 4KTUA 2CHAB 1W14U 3KHVA 2VGCB 1Z6EA 3SUDA 2FYQA 1O33A 4ESTE 2EC9H 1Z71A 3I77A 1O3NA 1B0EA 3DFJA 1F5LA 3P8NA 3RUOA 1GCTC 1O3AA 4B2BA 3GYMA 1IHSH 3E16B 2V35A 2TGDA 3TGKE 2ANKH 2J95A 1TNKA 3LGUA 2BY9X 3P6ZB 3T2NA 1ZMNA 1BRUP 2ZNKH 4B75A 1F0SA 1MTSA 3SNEA 3VGCB 1MMJN 4BNRA 3A7WA 1C1WH 2ZF0H 4X8SH 1GHBF 1V2NT 1WBGB 5A8YA 1FI8A 2GCHG 2DE8A 1NESE 3SZNA 3L6PA 1Q3XA 2PGQB 3HPTB 1GHWH 3A7TA 3RXAA 1A5HA 4MPUA 4JCNA 3U8RH 4BXSA 1E38B 2GMTC 4O3TA 2ZFSA 1DWBH 6CHAC 1ZHMA 3A8DA 1K2I1 3UWJH 2BD4A 4OS2A 4XSKU 4ZUHA 1ABJH 3NCLA 5DPAA 2HPPH 3SHCH 1UMAH 4Y0YE 1A3BH 2BD8A 4M7GA 5HYOA 2G5NA 4JK5A 1O3IA 4DT7B 4JYVH 1G3CA 1G3BA 1Y3VA 1UTJA 4B2AA 1BBRK 4INKA 1SSXA 3TK5A 5K0HA 2Z3DA 1EZXC 1A5GH 1Y8TA 1WCZA 2FM2A 1AVXA 1LKBA 4YOIA 4FUCA 4X0WU 5GWZA 4CH8B 2UUJB 1N8OB 1NROH 1O5EH 3W94A 3S9BA 1D3PB 2ESTE 4U01A 1YPJH 3JZ2B 4VGCB 2GGVB 7GCHF 2ZHEH 3DT0H 3HKJB 5ETXA 1GCDA 5C5OA 5C3NA 4OS1A 3TH3H 1O5CB 1XMNB 1J9CH 1MKWH 1T31A 3MNXA 1QBNA 1QBOA 3TGJE 1EJAA 1SHYA 3P70B 1BTXA 2D8WA 1FMGA 2IOTA 1H9HE 1FZZA 1P9SA 2XC5A 3H5CB 1PQ5A 1SMFE 4AYYB 4LK4A 4MLFB 3PLKA 2H9TH 2B7DH 3VFEA 1JXPA 4GHQA 2A4QA 2JH0D 2HNTC 5FX6A 1TGCA 2JETC 1IQEA 1QFKH 4WXVA 1GBEA 2OLGA 3T29A 5C1XA 3ATMA 3RM0H 1J14A 2V3HH 3M5OA 2ALPA 2R0LA 4ZHMU 1TX7A 1O2NA 1V2OT 1FPHH 2FOEA 2HALA 4OS6A 5F8XA 3MU4A 3AASA 3RXUA 1CHOG 1RIWC 1SLUB 2R2WU 3KN2A 2WV4A 1OP0A 1QL7A 1K1IA 1QNJA 4JZEH 2ZU1A 1BJVA 3RU4E 1O2UA 2ZFQH 1NFYA 2AMQA 4GCHF 3RLWH 1UVSH 1K21H 4YT6H 1ZZZA 3V12A 5FAHA 1JIRA 5A0BA 3ODFA 2ZI2H 4O97A 2FS9A 2FLBH 3NWUA 3ELAH 1QRXA 1EB1H 1SGFA 3L3TA 4NIVA 1N6YA 4VGCC 1TGNA 2ALVA 2AYWA 1AVGH 3M36A 4Y8YA 4CBNA 1GHAF 1C5UA 2SNWA 4B74A 3R3GB 4KP0A 1HAVB 2H5CA 4PROA 3RP2A 1Z1IA 1QL8A 4ABEA 1HAIH 2ZHWH 4B73A 1XX9A 3EAJA 5A0AE 1LHFH 3RXEA 3LU9B 1RTKA 1C1UH 1K28D 2GTBA 1A61H 2O8WA 2PHBA 4NA9H 1C2KA 3RXJA 2BD9A 1JWTA 1O2YA 1TE0A 2ANMH 3FP8E 1FY4A 1ELCA 4FVBA 2OQUA 1MTVA 5HMAA 3TJNA 4SGBE 5LGOA 1P2KA 3RXPA 4Y79A 1GJ5H 1TX8A 4CH2B 2OXSA 1C5TA 4TPIZ 4ZHLU 2WINI 1C1SA 4WXIA 1LCYA 3ZZ4A 2ZU3A 2W3KA 2P3TB 3MH4A 3ZZBA 1GVLA 1NO9H 2H2ZA 5PTPA 2EA3A 4X1NU 1EAIA 4IS5A 1UTLM 2J9NA 2BDYA 3PWBA 2ZTYA 5A2MH 1H9LB 3RXDA 3VB6A 4UFGH 4DW2U 4IBLH 4K1TA 3TGIE 1EQ9A 2ZDLA 4XBDA 1GBFA 2Y6TA 1MKWK 2ZTXA 2OQ5A 4KTSA 1XKBC 1AZZA 1O3CA 4X6MA 1AN1E 4UFDH 1SL3A 2C8WB 1SB1H 2ZPQA 1VCQA 3A7VA 3BIVH 2OC0A 1AUJA 1O3LA 5JBTA 1P03A 4AOQA 5AHGH 1IQGA 1GHZA 1WTGH 3E3TA 3PMBB 2F3CE 3DUXH 1DOJA 2VIWA 3FP7E 2BLOA 1NU9A 5TJXA 3D65E 1AB9C 1B0FA 3KCGH 4JK6A 3MO6A 5HXFA 2Z9KA 1H8IH 1LKAA 1MD8A 1O2LA 2Z3EA 2B9LA 1LMWB 1S84A 1INCA 1B7XB 1VITH 1AQ7A 4Y76A 1Z8RA 3M5MA 1XUGA 1MTWA 1TBZH 1TQ0B 2FI5E 2Z9LA 5JBBS 1Y3XA 4ZKRU 4TY7A 1YKTA 2M5TA 4GUXA 2ZP0H 3GY2A 1QB1A 5JDUB 3BTKE 4IC6A 1BOQA 4JYTA 4NSYA 1GBLA 1DANH 2A32A 3ZYEA 3Q3KA 3QGNB 2XTTB 4K3JA 3R0FA 2AGIX 1UTKA 1AWHB 1KLIH 1MH0A 1YF4A 2Y81A 1SFQB 2XCNA 2ZQ2A 4NZLA 3T27A 5C20A 1WU1A 2PUXB 3RC6A 1NRPH 3FANA 2BX3A 3M7QA 1C5XB 1SGPE 1D9IA 1UCYH 2XW9A 1G30B 2GVFA 4K69A 5CHAC 3UY9A 2P94A 3TH4H 1DVAH 3MO3A 3AAUA 1DFPA 4GHTA 2SGFE 1QA7A 6GCHG 3SV6A 1ZSJA 1TPSA 1KDQA 3DHKH 3MU5A 3EDXB 4B76A 3UR9A 5EW2H 1P2OA 3BTGE 3FP6E 5LPRA 2ILNA 1O2VA 1P05A 4ISLA 1EAXA 1J8AA 1GI9B 4Q7XA 5DP6A 1TNHA 3P92A 4UFEH 1QJ7B 1BCUH 1V6DA 1RGQA 2H9HA 1V3XA 2WPHS 4F4OC 1ZYOA 4ZKNU 3ATKA 3UIRA 3EA8A 1OKXA 1VITF 1WYKA 2GZ9A 1K1PA 5CE1A 2XCFA 3RMNH 1AO5A 1LHCH 2FTMA 2P16A 5G4BA 1Q2WA 3M3TA 1XVOA 1TX6A 2LPRA 1ARCA 1AIXH 3QDZB 2QAAA 1DPOA 4H42U 5TCCA 3GY4A 1NZQH 4CREA 3KEEA 5E0HA 1W11U 7KMEH 1V2RT 1JOUB 1GMHF 1VJ9U 1P2QA 1EZQA 3ATLA 3S69A 4KELA 1HNEE 4IMZA 4IN1A 1AE8H 1KIGH 1UO6A 4K8YA 4DURA 3RXHA 1TRYA 1BTYA 1BTUA 1K9OE 1LPKB 1GI4A 1O38A 4XDEA 3RU4D 4X2WA 4CRDA 1DUAA 1FPCH 1CBWB 1P02A 2QY0B 3GDSA 1C2FA 3MH5A 4ABFA 3S9CA 1C5LH 2ZQ1A 4K8BA 1C1VH 1IOEA 1GJ8B 2BZAA 1DWEH 4NIYA 1IHTH 5FBIA 1ZR0A 2EI7A 3E90B 3QLPH 1GBKA 3A87A 2ZFFH 2OC1A 3H7TA 1GBCA 4J2YB 1XKAC 1QQ4A 2ZC9H 1Y59T 1HAGE 3BTWE 3H7OA 1GI0A 1THRH 1YPHE 2PTNA 5DG6A 1HGTH 1ZMLA 1J16A 2ZU4A 2BVSH 2BD3A 3VPKA 1A4WH 1THPB 1BRAA 1BB0B 1A0HB 4WMDA 5DP4A 1FY3A 1E0FD 2OD3B 2K1QA 1ZHRA 1L2EA 1UVTH 1O2ZA 4YTAA 5E0GA 1H8DH 1MCVA 5LPEA 1T8OA 3DA9B 2G4TA 1O2WA 1KXBA 2Y80A 1E34B 1VCWA 3LJJA 1O2IA 2VH6A 1LDTT 1AKSB 5DP9A 1VZQH 3UNSA 3STJA 1HJAC 1RRKA 2FOHA 3PV4A 2SFAA 1QR3E 5L6NH 1MUEB 2FOAA 4KGAA 1OWEA 1EPTB 2NU2E 5DGJA 1BBRH 1WV7H 1O34A 3A81A 1SG8B 4INLA 1BA8B 1JRTA 2ZDMA 4H4FA 1H1BA 1HRTH 3SUEA 5T3HA 2XBWA 1MCTA 4Q80A 5A8ZA 1UTPA 1BTWA 4RSPA 1A2CH 3D62A 3IG6B 4FUHA 4UDWH 3K6YA 1TFXA 3GY7A 1ARBA 4CHAC 4YESB 2ZA5A 1E36B 1BMLA 5DK1A 3SNAA 2BD5A 3MTYA 1DWCH 1GI7B 4ISOA 1ABIH 2C8YB 2DUCA 4X1PU 2GX4A 1C1QA 1ELTA 1HUTH 2ZEBA 5A0CA 1UK2A 3S7KB 2QXJA 1O2PA 5C67A 3MFJA 2F9UA 1UVPA 1O35A 2G00A 1D4PB 2CJIA 4NZQA 4I8GA 1N1LA 1O3KA 2RG3A 4X6NA 3SNCA 3KIDU 3TNSA 2BDCA 1IAUA 3RLYH 4BANB 1PQ8A 2JH5D 2ZDVH 3TJUA 2QF3A 4BTTB 3GOVB 3BTDE 1V2ST 2FPZA 1S5SA 1SGFG 2A0QB 2HLCA 4B2CA 1SBWA 1YLCA 5F8ZA 1XUHA 1C5NH 1IQLA 4AFSA 2UWOA 2R2MB 5CMXH 1O3DA 4YLQH 1BMNH 3ZV9A 1SGEE 1MZDA 1EAWA 1F5KU 3ZVEA 3KGPA 1RTFB 1GL1A 1DLKB 2FIRH 1TBRH 2GT7A 2W7SA 1W7GH 2ZFTA 1NRRH 1O3MA 1PJPA 4YOJA 1ELFA 1O39A 1O3BA 1G3EA 2PKSB 4ISIH 4DVAU 1QA0A 2FOBA 2ZG0H 2ZCKP 5DP5A 2SGEE 2HOBA 1FJSA 1ZJKA 4X8VH 1BMAA 2F9VA 3SI4H 5FXLA 1TOCB 4X2VA 4YZUA 4E06H 2NU3E 1OP2A 3TJOA 1ZJDA 3RXSA 3UTUH 1FUJA 2C3SA 2VIDA 5EXNA 3F1SB 2KAIB 4FXGH 4ABIA 2O9QA 1O5FH 1FN8A 1GJAB 1ANBA 3M5LA 3B23B 5FX5A 2A45B 2SGQE 3OY5U 1QURH 3UWIA 1Y5BT 2FZZA 1TALA 1Z7KA 1NTPA 3AW0A 1SGCA 3SUGA 3BTQE 1O3PB 3NKKA 2Z9JA 3IWMA 2ZFPH 1ETTH 3CS7A 1YPEH 1O3OA 1DSTA 3GCTF 1O36A 1A1RA 3K6ZA 1S6FA 2G4UA 1TGSZ 1JMOH 1O0DH 1UVOA 1FIZA 1XVMA 2BDIA 1AI8H 1HAVA 3PO1B 4MPWA 2H6MA 5EXLA 2BDBA 5FCRA 1JRSA 1O2HA 2GCTB 2FP7B 4YO9A 5FCKA 1EASA 2R9PA 4ISNA 2QV1A 3LKWA 1HB0B 1Y5UT 2CHAC 2RCEA 2WPIS 6ESTA 2VGCC 3M35A 3ZZ7A 2C4FH 3RXVA 4MNYA 1KTTB 3A88A 5FPYA 1DDJA 3ZZCA 1G9IE 2B8OH 1C5SA 2QF0A 2YNBA 3ZZ3A 2VIPA 3AW1A 1C1MA 1Y5AT 2FO9A 1GVZA 2RA0A 1GBBA 1GJ4H 1T4UH 1HAYB 3NZIA 4WMFA 1LHGH 4BTUB 5EW1H 4CBOA 1UTQA 2Q6DA 2F91A 3VGCC 3S9AA 3RXFA 4E05H 2A7JA 4HGCA 3T62A 1DXWA 3RMMH 1CHOF 2HVXA 1C1OA 2CXVA 3T25A 3TK6A 2ZFRH 1C4Y2 2QC2A 4WY3A 3ZZ9A 2J38A 4ZMAH 2F9NA 3MOCA 1C5WB 5EGMA 1E35B 4FUBA 1WAYB 1C2JA 1P3CA 4X2YA 3KF2A 1C2HA 2ODYB 3T26A 1OPHB 1K1MA 2C90B 1CA8B 2VWOA 3GY8A 1V2PT 1C5QA 2FEQH 4Y6DA 1ZMJA 1SQAA 4FUEA 1AWFH 1KXAA 3GY6A 1FN6A 1YPKH 1PQ7A 1SVPA 2VVVA 3SQEE 1HJ8A 1G2LA 4X8TH 2P3UB 2BOKA 1P01A 1QB6A 2FS8A 3A85A 3GCNA 3MH7A 1EXFA 1O2QA 3QX5H 1N8OC 1WQSA 1C1RA 1GHVH 2NU0E 3UQVA 4IW4E 3VEQB 4Y7BA 4TPYA 5AFZH 2BM2A 1D6RA 1D3TB 3PYHA 2BDHA 2PSXA 2CV3A 4BOHA 1QTFA 1GGDB 3RC4A 2FX4A 1O30A 1KXCA 1S0RA 2HNTE 4LXBH 2H9EH 4MPXA 2R3UA 3SO3A 1KXFA 1TNGA 2XBVA 4DIHH 3PROA 2FESH 3Q3XA 3O8DA 3U9AH 4K1EA 3EGKH 3OSYA 1DUEA 1ZTKA 4UEHH 4CRBA 3RMLH 1BIOA 5EG4A 1BHXB 3M3VA 1ZOMA 3V7TA 1HAXB 5DP8A 3LONA 2ZO3H 3RXKA 2WPLS 3MYWA 5EU8A 2ZU2A 3BTEE 1SGYE 2Z3CA 1TLDA 3NPSA 1AFQB 1OWDA 2WV5A 3D49H 1TWXB 2ZGHA 5F03A 1YC0A 1C5OH 4QT8C 1GBDA 5A8XA 2AMDA 1AY6H 2PUQH 1EX3A 1MU8B 4O3UA 1XUFA 3IITA 1W0ZU 2YNAA 3A80A 3ZZDA 3BG4B 1YGCH 1CGIE 2ULLA 2P93A 1W2KH 1ZHPA 1MZAA 1QGFA 3SORA 1UTOA 1AFEH 1TGBA 4I32A 3C1KA 1C2EA 2A4OA 1P8VC 3LGWA 4MPVA 4AB9A 1Y3YA 3UUZA 5C5NA 1LVMA 2V6NA 3D23A 2AERH 1LO6A 3SV9A 1XXFA 2TBSA 1QL9A 4DCDA 1A7SA 3GCHB 2FMJA 5E0JA 2XBYA 2NU1E 5EODA 1SPJA 3SJOA 2HNTF 5GJ4B 3KQBA 2D26C 4AORA 3E0PB 1PYTD 1QB9A 1GJDB 1V2LT 1CHGA 4YLUA 5T6FA 2STBE 1NC6A 1LHDH 1L1JA 4X1RU 1BRCE 1CT2E 1PPZA 1Y3UA 3F9HA 1FY8E 4GLYA 2WPKS 1GPZA 4OS5A 4AN7A 2QN5T 2F9PA 3SU5A 2Z9GA 5JYIA 1MAXA 1TA2A 4NG9H 3UQOA 4XFQA 5FPSA 1TMBH 3DFLA 5JBAS 2GZ7A 2VWMA 1S6HA 2BB4A 2Y5FA 1EATA 2Z7FE 3U1JB 4NIXA 2ZWLH 1P2IA 1S85A 1UVUH 2Y5GA 1MTNB 1P0SH 2ZHFH 6GCHF 1DY9A 2OC8A 4THNH 2I6QA 2C8ZB 1T32A 2ZIQH 3M3SA 2AGEX 2HWLB 1C1TA 2Y7XA 3C27B 1HIAB 3BN9A 7ESTE 2LNCA 2EI8A 4ASHA 3QUMP 1HAZB 2RA3A 2ZZUH 2W3IA 3TK9A 2B5TB 3KNXA 3JZ1B 4ABJA 1XM1A 4FU9A 1CGJE 4FUFA 3URCA 2A2XH 2QCYA 4TY6A 3TLOA 4DJZB 2GV6A 4RKOB 3MNBA 1NS3A 3TJVA 1O5DH 1OOKB 2ZHDA 3NXPA 3VB7A 1DXPA 5J4QA 3QWCH 4IC5A 1LQDB 3SI3H 1NRSH 1O3JA 2FX6A 1WTHD 1OYQA 2QGRA 1AKSA 1BDAA 2VB0A 3SU4A 4K5ZA 1P9UA 4K1SA 5IDKA 1AU8A 1TPAE 1AE5A 2V0BA 3ZZAA 7LPRA 1EPTA 3SGQE 4AG1A 3A8BA 4XE4A 3SJ9A 3KQEA 1K1OA 1AGJA 8GCHF 1TGTA 1ACBE 4WVPE 1SGDE 2H1UA 1GDQA 4MNVA 1HPGA 3V0XA 4IN2A 4A7IB 4HTCH 3ATIA 1EUFA 2G81E 3MU0A 1F92A 4B71A 2VH0A 2SNVA 1O2JA 2CMYA 2GT8A 4GPGA 4Y8ZA 5BPEA 5T6GA 2A2QH 3ZVFA 1C5RA 1G32B 1SFIA 4A92A 2FOMB 1VGCB 2G52A 3QTOH 1RTLA 3DD2H 4NFEA 3LH3A 4AX9H 1GG6B 3RXCA 1TNLA 1TMUH 4XBCA 4I8HA 4HI3A 2PSYA 1GVKB 2SGPE 1D3QB 2OTVA 1PPCE 2AH4X 5FBEA 2BY8X 1BTZA 1Z8IB 3VB4A 2F83A 2OUAA 3QK1A 2PTCE 1SOZA 4UE7H 2BY6X 1VITG 4Q2KA 3MMGA 3ZZ5A 1F7ZA 4Y10E 3MH6A 1IQKA 1L1NA 3HK3B 1J15A 1AVWA 4UFFH 1GMDF 1OYTH 3S0NA 2FXRA 1YCPM 3LDXH 4I8KA 1L0ZA 3CS0A 5L2ZH 1C5YB 2Z94A 4CR9A 3SBKA 1DITH 1HAPH 1V2JT 1S0QA 2BY5X 2BHGA 2O8LA 3P95A 3BTTE 3T5FH 1LPZB 3SOSA 3SW2B 1K1JA 4WH6A 1CA0B 1SGIB 4OS4A 1OXGA 4Z6AH 2G55A 2ZDKA 3QZRA 3TVJB 1DWDH 5FPTA 1NT1A 4CRAA 3ZVDA 2ASUB 2FODA 2FDAA 5H4IB 5AVDA 1IQFA 1NFWA 3PMAB 1XUJA 3LC5A 4MDSA 3PM3A 1HLTH 2UUKB 3O8CA 2A5IA 2IN2A 1O32A 4NFFA 1DM4B 2XC4A 3Q00A 1A46H 2OINA 4I8LA 5DP3A 5I46H 2WPJS 1GDNA 3GY5A 3B9FH 4E7RG 1BMMH 5E2OA 4WJG2 5GXPA 2ANWA 2FOFA 2QA9E 5IYTA 3VXEH 3RXMA 4ZKOU 1FY5A 2ZGBH 4AG2A 1HYLA 1C1NA 1GG6C 3O8BA 2BOHB 3OU0A 2ZKSA 4D7GA 2KAIA 3NK8A 4A5TS 3HGNA 3F9FA 1C9TA 2TPIZ 3HK6B 4DY7B 1AHTH 3SU1A 2Z9IA 3UNRA 2ODQA 3ODDA 1EAUA 1YPGH 3VB5A 1CBWC 2VU8E 1YCPH 5C1UA 1F0UA 2BZ6H 1IQJA 4HZHA 3SJIA 1PPFE 2AIQA 3EYDA 3RXOA 4WMEA 1JIMA 3RU4T 1U6QA 2PKAB 1DT2A 1H9IE 1F0TA 3BTHE 2PWXA 1TNIA 3RXLA 3SU3A 1ELGA 1KYNA 2IJOB 2WUCA 1GCTB 4FU8A 1ESAA 2P3FH 2GD4B 1ESTA 2BXTH 2FLRH 2UUFB 3ZV8A 3RDZA 2BLWA 5EQQA 3GCOA 3LIWA 3A89A 1W12U 3LH1A 2BQ6B 4TYDA 1DICA 1EZSC 1C5VA 4Y71A 1GI6A 4ABBA 2W26A 1TPPA 4HFPB 3P8GA 1DSUA 3ENSB 4IMQA 3SNDA 3U1IB 1V2KT 5I25A 1QJ1B 4UD9H 4CRGA 3STIA 1T8NA 4AGJA 4FUDA 2HGTH 4Y11E 1UTNA 4RN6A 4BAOB 2ZCHP 3A7YA 1DLEA 3LGTA 1LVBA 4WF8A 1CU1A 2Z6BD 3EE0B 2AEIH 5GCHG 1C4U2 3GDUA 4FUJA 1TABE 1ZRBA 1QRWA 3PMJA 3VXFH 3P17H 2BDGA 1CGHA 1SQOA 1EPTC 1ZPZA 4U2WA 1P10A 1AD8H 1TRMA 2RDLA 3A8CA 1L1GA 4I31A 4UONA 1QCPA 2OBOA 2C8XB 1SC8U 2CGAA 2GCHF 3ITIA 3BEFB 3SV7A 4XBBA 1K1LA 1O2XA 2XXLA 1W0YH 1RJXB 2XYAA 3BF6H 4RKJB 1KY9A 4AZ2B 4INHA 1KTSB 1P2JA 1P57B 5LH8A 3K65B 1GMCG 5EQRA 2D2DA 4CR5A 1TB6H 8ESTE 2BLVA 1YYY1 2FI3E 1G36A 2A5AA 1HXFH 1FV9A 4AGKA 2CN0H 1DX5M 2WPMS 2TGTA 3E1XB 3URDA 1C2IA 2OC7A 1GJ9B 3T28A 1DS2E 1GI3A 1O3FA 4X6OA 3SHAH 1HXEH 1UJ1A 2BVXH 2QXHA 1F2SE 2A4RA 4ISHH 2HRVA 2VVCA 2A7HA 1C2MA 1EJMA 2G8TA 8LPRA 2XC0A 5F6MA 3LJOA 3MHWU 2YOLA 4I33A 2FOGA 3ZYDA 1O5BB 1MBMA 2JETB 1AUTC 2Y7ZA 1V2TT 3VB3A 4BAKB 1ANCA 2QIQA 3FFGA 3EA7A 3NUMA 5EOKA 2BTCE 2P95A 3UNQA 9LPRA 1V2QT 1KXEA 2Y82A 1PPHE 1C5PA 1GHBG 4X2XA 1UK4A 1ZTJA 1GBTA 1RIWB 6LPRA 4ZXYH 4AFZA 3A7ZA 1ELBA 2FTLE 5ESBA 1YCPK 1WUNH 1O31A 5F8TA 3KQCA 3QTVH 1HAHH 4DIIH 1FDPA 3ZZ6A 3O8RA 1YBWA 2PKSC 2BLQA 1BUIA 3PLBA 4BAQB 1AZ8A 2O8UA 3ZVGA 2BD2A 3RXTA 1V2VT 1DY8A 1TOMH 3F9GA 3GCTG 4OGXA 1P04A 1MBQA 1LQEA 4LZ4B 3RXBA 2J34A 1OS8A 1NY22 1EJNA 2EEKA 3HGPA 2ZCLP 1SGNE 2HPQH 1EP5A 2PLXA 1BJUA 1MQ6A 2UUYA 3RXRA 5C2ZA 3SGBE 1FLEE 2GDDA 1UHBB 4R8TB 1VR1H 1LVOA 1H4WA 4Z0KA 5DP7A 4O9VA 3E0NB 3V13A 4D9RA 7GCHG 4ZROA 1VCPA 3SU2A 2D1JA 5EQSA 3QN7A 1C2GA 1F5RA 4I8JA 3RC5A 2THFB 4JZIA 4FUGA 4JZFH 3ZVBA 1P11E 2AIPA 1HDTH 2ZGJA 5AFYH 1ZSLA 2VIQA 3N7OA 1V2MT 3I29A 3PO1C 1UTMA 1FY1A 3F68H 1ELDE 3PB1E 1O3GA 2OP9A 1NM6A 1MAYA 4DG4A 1Q31A 2GCTC 3WY8A 1LHEH 2F9OA 3EQ0H 2BXUH 3GISB 4WH8A 3UOPA 2PR3A 2J4IA 2VIOA 2SGAA 5HM9A
chains in the Genus database with same CATH superfamily
1HBTH 1GL0E 1EB2A 1GI5A 1P2MA 2NWNA 3RXQA 4A6LA 3I78A 1O2KA 1SQTA 3M7UA 5EXMA 4MG3A 4BTIB 3GY3A 4LOYH 4SGAE 1OP8A 1E37B 4AFUA 2A1DB 3ATWA 1Y3WA 2ZGXH 4KKDA 1IQNA 1O3HA 1MQ5A 2CF8H 4CRFA 2BVRH 2BDAA 4NWKA 1UW7A 4Y8XA 2Q6GA 2WUBA 3QGJA 1S83A 4E7NA 2O8TA 2ZTZA 3PTBA 4GVUA 2VIVA 2R0KA 3V3MA 4KTCA 3SGAE 4A1VA 5DO4H 4GCHG 1A5IA 4YOGA 9ESTA 5DJ7A 1DE7H 2O8MA 2V3MA 2AGGX 1XXDA 4K60A 1HIAA 3TH2H 1SLWB 2VNTA 5HKKD 5HGGA 1PPBH 1W8BH 1HAOH 1GBAA 1THSH 5LPFA 5HIZA 1CQQA 2KCPA 3A82A 1GJ6A 1AB9B 3PLPA 1OWHA 3N99A 3A7XA 4X1QU 1GHAG 1ETRH 1YPMH 2J97A 2K8IA 1L4ZA 2CF9H 2TGPZ 3RXGA 1GJBB 1ANDA 3E6PH 1ZLRA 2VWLA 1GJ7B 1IQMA 1HCGA 5DN6D 1BTPA 1BRBE 3LC3A 3UPEA 3UOUA 4ABAA 5K7RA 1RS0A 5GPIB 1B5GH 1IQIA 1KMHB 1P2NA 1C5ZB 4P00A 4ABHA 1MU6B 3TPIZ 4TWYA 3SYJA 2BY7X 1OSSA 2PW8H 1RXPA 1KXDA 4Q7ZA 2I6SA 3SJKA 1C2DA 1O5GH 1NFXA 5EPNA 3SU0A 5E2PA 5ESTE 3E91A 3LGVA 2Y5HA 3U98H 1KSNA 1W7XH 2GP9B 1XUKA 3P8OA 4ZXXH 1GI2A 1T4VH 4F49A 2W5EA 1TNJA 1GI1A 1ELVA 1EKBB 5SGAE 2FYRA 5CHAB 1GGDC 1IQHA 4O03A 4F48B 4IGDA 4A1TA 1HFDA 3F6UH 4ASUD 4ABDA 3OTJE 1X7AC 3M5NA 1W13U 1YM0A 1C2LA 3F3BA 4Q63A 4BXWA 1S82A 1O2MA 3UREA 3MWIU 2JH6D 4YM9A 4LZ1H 4GSOA 1GBMA 1MKXH 1O2SA 1QIXB 2A31A 5FHTA 1YLDA 1XUIA 3A8AA 1FONA 1T8LA 1ZTLA 2QXGA 2TIOA 3ZZ8A 2QXIA 3FZDA 4BAMB 4BAHB 3OFND 4NCYA 5CHBA 2FWWA 3RXIA 3BEIB 1GDUA 3UB0A 4YT7H 1PPEE 2F9BH 1EOJA 1WOFA 3M37A 4X1SU 3M61U 2AS9A 4MNWA 1BITA 1K22H 1D3DB 1ZGVA 4FUIA 1AFQC 1TYNA 1P12E 5JB8S 3GYLB 1QRZA 3EA9A 1FNIA 2BX4A 2ZECA 4TWWA 5ABWA 4D7FA 1P3EA 3F9EA 3B8JA 2J92A 3TNTA 4NSVA 1LTOA 3W1EA 2ZHQH 2WYGA 3SNBA 4FU7A 3BG4C 3TIUA 3OAAD 2AFQB 3BEUA 4H6SB 3FVFB 1GWAA 1GJCB 1TPOA 3K9XB 2GKVE 1ELEE 1YP9A 1G2MA 2G51A 2ZDNA 1UCYE 3A86A 1NU7B 2EI6A 3LPRA 1BTHH 5DKMA 1V2WT 4K2YA 4Z1MD 1O2OA 4U32A 3TITA 2CK3D 3U8OH 1ID5H 5J4SA 4D8NA 1CSOE 2Q6FA 1SGQE 3SV8A 4OS7A 1MTUA 1E79D 4H6TA 3GCHC 4Q7YA 3OTPA 4D76A 2STAE 3RMOH 1O5AB 3G01A 1BZXE 1T7CA 2J98B 1OWIA 2WYJA 2QYIA 2UWPA 1GI8B 1GHXH 1RD3B 1S6LA 2A7CA 2OCVB 1GHYH 1Z8GA 4X6PA 5HM2A 1ORFA 1BQYA 3F0OA 4NA8A 3HKIB 1UK3A 3SUFA 2HLDD 1CE5A 3F2HA 3MNSA 1M9UA 1QBVH 1TRNA 1SLVB 1J17T 2FI4E 1MABB 2DE9A 1S81A 3U69H 2V3OH 1SI5H 2P59A 2XOKD 1TMTH 2VJ1A 3LOXA 1Z1JA 4XRNA 4Y7AA 4MNXA 2H5DA 2PV9B 1YPHC 1ETSH 2PKAA 3L33A 1ZRKA 1CT0E 1VJAU 3UR6A 1FXYA 3ESTA 1MTNC 4OGYA 4D9QA 1Z6JH 1D6WA 2PFEA 1SGRE 3P8FA 3BTFE 1FIWA 3PMHB 4B1TA 1RFNA 4RT1A 1YPLH 3TU7H 1TQ7B 2XRCA 2WZQA 4J1YA 1HJAB 3LGYA 3BV9B 2ANYA 5C17A 4DOQA 1CVWH 1VKYA 2QF4A 2P8OB 1F0RA 3PRBA 2ZPSA 1KLTA 1Z8JB 8GCHG 1C5MD 2BMGB 3GDVA 1WSSH 1ELAA 3W95A 1O2GH 1PPGE 4A1XA 3E8LA 3SQHE 3MU1A 1ESBA 2TGAA 5E8EH 1QJ6B 2FOCA 3A84A 2K0QA 1A3EH 1N6XA 1P09A 1SLXB 2VVUA 4JYUH 4CHAB 1MKXK 1C4V2 3AAVA 1MD7A 3SJ8A 1GMHG 3Q77A 2L6OA 1PQAA 2XBXA 3OY6U 4ZAEA 1GBHA 3GICB 4NIWA 4MTBA 3M7TA 4AYVB 5T6DA 1TONA 3KQDA 3BG8A 3PTNA 4NGAH 5JBCS 1EP6A 2ZU5A 2NU4E 3ZVAA 8KME2 1O37A 1BT7A 1BHXF 5EPYA 3FKSD 5AF9H 2ZGCA 3Q76A 3SN8A 3BSQA 5GDSH 2GDEH 3CENA 1TA6A 1ZPCA 2XNIA 3MU8A 2BQ7B 1JBUH 1GMDG 2A5KA 2UWLA 3QO6A 1NN6A 1EOLA 1OX1A 1GBIA 4GAWA 1NFUA 4Y0ZE 1TIOA 3CP7A 1KDQB 2XWBI 2R3YA 1O3EA 1SOTA 1VGCC 5JB9S 1ANEA 4XOJA 5L30H 1TAWA 2KR7A 3HATH 2BYAX 2ZPRA 3QZQA 4JZ1A 1NRQH 2OBQA 4U30A 1WQVH 1A0LA 1O2RA 1BBRE 4ZHAA 4MVNA 3AVZA 1P06A 3MO9A 4ABGA 5BRRE 4NA7A 2VINA 3K2UA 2KM0A 2A4GA 1O2TA 4JMYA 2JKHA 2P8OC 2PGBB 1UCYK 1TBQH 4CRCA 4I7YH 1C9PA 1LPGB 4X8UH 1FAKH 4AFQA 2J2UA 4WWYA 1C1PA 2OK5A 2GV7A 3ZVCA 2W7UA 5KEDA 1ZSKA 4ZKSU 1CT4E 3RM2H 1QHRB 2J94A 5TCAA 3PWCA 1K1NA 2BQWB 3SV2H 1ZPBA 1CA0C 1CO7E 3MI4A 2G5VA 5L2YH 1NRNH 3FZZA 5C0UA 2WV9A 5GCHF 1GBJA 1AMHA 3UFAA 2TRMA 1LVYA 4R0IA 2SGDE 1L4DA 5JPMH 2IPHA 3OYPA 3FAOA 2KX4A 3SU6A 1T8MA 2VWNA 1PYTC 2GMTB 1E1QD 6CHAB 2C93B 1ZGIA 3S7HB 2ZDAH 3LGIA 2JIZD 5B6OA 1W3CA 1V2UT 1SGTA 4NWLA 1HV7A 1HJ9A 2AMPA 3Q3YA 4AB8A 5A09A 3DCLA 1QQUA 1GMCF 4FVDA 5GIBA 5EJLA 2Q1JA 3U8TH 1NPMA 3BIUH 1A0JA 1QY6A 2BD7A 4MQAA 1G37A 1EZUC 1OWKA 3A83A 1SR5C 2XWAA 3MNCA 4ZH8A 1OWJA 3OX7U 1FQ3A 3LT3A 1G3DA 4DGJA 4JZDH 1UHBA 1PFXC 1SHHB 1W10U 2GZ8A 5C1YA 1KLJH 2ODPA 3BTME 1FAXA 2B0FA 3KL6A 4KTUA 2CHAB 1W14U 3KHVA 2VGCB 1Z6EA 3SUDA 2FYQA 1O33A 5DSFA 4ESTE 2EC9H 1Z71A 3I77A 1O3NA 1B0EA 3DFJA 1F5LA 3P8NA 3RUOA 1GCTC 1O3AA 4B2BA 3GYMA 3KYGA 2M2AA 1IHSH 3E16B 2V35A 2TGDA 3TGKE 2ANKH 2J95A 1TNKA 3LGUA 2BY9X 3P6ZB 3T2NA 1ZMNA 3OEHD 1W0KD 1BRUP 2ZNKH 4B75A 1F0SA 1MTSA 3SNEA 3VGCB 1MMJN 4BNRA 3A7WA 1C1WH 2HVYB 2ZF0H 2J5UA 4X8SH 1GHBF 1V2NT 1WBGB 5A8YA 1FI8A 2GCHG 2DE8A 1NESE 3SZNA 3L6PA 1Q3XA 2PGQB 3HPTB 1GHWH 3A7TA 3RXAA 1A5HA 4MPUA 4JCNA 3U8RH 4BXSA 1E38B 2GMTC 1W0JD 4O3TA 2ZFSA 1DWBH 6CHAC 1ZHMA 3A8DA 1K2I1 3UWJH 2BD4A 4OS2A 4XSKU 4ZUHA 1ABJH 3NCLA 5DPAA 2HPPH 3SHCH 1UMAH 4Y0YE 1A3BH 2BD8A 4M7GA 5HYOA 3N7DA 2G5NA 4JK5A 1O3IA 4DT7B 4JYVH 1G3CA 1G3BA 1Y3VA 1UTJA 4B2AA 1BBRK 4INKA 5KGOA 1SSXA 3TK5A 5K0HA 2Z3DA 1EZXC 1A5GH 1Y8TA 1WCZA 2FM2A 1AVXA 1LKBA 4YOIA 4FUCA 4FOUC 4X0WU 4CH8B 5GWZA 2UUJB 1N8OB 1NROH 1O5EH 3W94A 3S9BA 1D3PB 2ESTE 4U01A 1YPJH 3JZ2B 4VGCB 2GGVB 7GCHF 2ZHEH 3DT0H 3WWBA 3HKJB 5ETXA 1GCDA 5C5OA 5C3NA 2JJ2D 4OS1A 3TH3H 1O5CB 1XMNB 1J9CH 1MKWH 1T31A 3MNXA 1QBNA 1QBOA 3TGJE 1EJAA 1SHYA 3P70B 1BTXA 2D8WA 1FMGA 2IOTA 1H9HE 1FZZA 1P9SA 2KCOA 2XC5A 3H5CB 2V7QD 1PQ5A 1SMFE 4AYYB 4LK4A 4MLFB 3PLKA 2H9TH 2B7DH 3VFEA 1JXPA 4GHQA 2QF5A 2A4QA 2JH0D 2HNTC 5FX6A 1WDIA 1TGCA 2JETC 1IQEA 1QFKH 4WXVA 1GBEA 2OLGA 3T29A 5C1XA 3ATMA 3RM0H 1J14A 2V3HH 3M5OA 2ALPA 2R0LA 4ZHMU 1TX7A 1O2NA 1V2OT 1FPHH 2FOEA 2HALA 4OS6A 5F8XA 3MU4A 3AASA 3RXUA 1CHOG 1RIWC 1SLUB 2R2WU 3EE7A 3KN2A 2WV4A 1OP0A 1QL7A 1K1IA 1QNJA 4JZEH 2ZU1A 1BJVA 3RU4E 1O2UA 2ZFQH 1NFYA 2AMQA 4GCHF 3RLWH 1UVSH 1K21H 4YT6H 1ZZZA 3V12A 5FAHA 1JIRA 5A0BA 3ODFA 2ZI2H 4O97A 2FS9A 2FLBH 3NWUA 3ELAH 1QRXA 1EB1H 1SGFA 3L3TA 4NIVA 1N6YA 4VGCC 1TGNA 2ALVA 2AYWA 1AVGH 3M36A 4Y8YA 4CBNA 1GHAF 1C5UA 2SNWA 4B74A 3R3GB 4KP0A 1HAVB 2H5CA 4PROA 3RP2A 3U28C 2LELA 1Z1IA 1QL8A 4ABEA 1HAIH 2ZHWH 4B73A 5CDFE 1XX9A 3EAJA 5A0AE 1LHFH 3RXEA 3LU9B 1RTKA 5EJZA 1C1UH 1K28D 2GTBA 1A61H 2O8WA 2PHBA 4NA9H 1C2KA 3FN8A 3RXJA 2BD9A 1JWTA 1O2YA 1TE0A 2ANMH 3FP8E 1FY4A 1ELCA 4FVBA 2OQUA 1MTVA 5HMAA 3TJNA 4SGBE 5LGOA 1P2KA 3DSPA 4Y79A 2JDID 3RXPA 1GJ5H 4DT4A 1TX8A 4CH2B 2OXSA 1C5TA 4TPIZ 4ZHLU 2WINI 1C1SA 4WXIA 1LCYA 3ZZ4A 2ZU3A 2W3KA 2P3TB 3MH4A 3ZZBA 2IPQX 1GVLA 1NO9H 2H2ZA 5PTPA 2J98A 2EA3A 4X1NU 1EAIA 4IS5A 1UTLM 2J9NA 2BDYA 3PWBA 2ZTYA 5A2MH 1H9LB 3RXDA 3VB6A 4UFGH 4DW2U 4IBLH 4K1TA 3TGIE 1EQ9A 2ZDLA 4XBDA 1GBFA 2Y6TA 1MKWK 1COWD 2ZTXA 2OQ5A 4KTSA 1XKBC 1AZZA 1O3CA 4X6MA 1AN1E 4UFDH 1SL3A 2C8WB 1SB1H 2ZPQA 1VCQA 3A7VA 3BIVH 2OC0A 1AUJA 1O3LA 5JBTA 1P03A 4AOQA 5AHGH 1IQGA 3F0PA 1GHZA 1WTGH 3E3TA 3PMBB 2F3CE 3DUXH 1DOJA 2VIWA 3FP7E 2BLOA 1NU9A 2PP6A 5TJXA 3D65E 1AB9C 1B0FA 3KCGH 4JK6A 3MO6A 5HXFA 2Z9KA 1NBME 1H8IH 1LKAA 1MD8A 1O2LA 2Z3EA 2B9LA 1LMWB 1S84A 1INCA 1B7XB 1VITH 1AQ7A 4Y76A 1Z8RA 3M5MA 1XUGA 1MTWA 1TBZH 1TQ0B 2FI5E 2Z9LA 5JBBS 1Y3XA 4ZKRU 2EQNA 4TY7A 1YKTA 2M5TA 4GUXA 3GS9A 2ZP0H 3GY2A 1QB1A 5JDUB 3BTKE 4IC6A 1BOQA 4JYTA 4NSYA 1GBLA 4TSFD 3F2FA 1DANH 2A32A 3ZYEA 3Q3KA 3QGNB 2XTTB 4K3JA 3R0FA 2AGIX 1UTKA 1AWHB 3WWFA 1KLIH 1MH0A 1YF4A 2Y81A 1SFQB 2XCNA 2ZQ2A 4NZLA 3T27A 5C20A 1WU1A 2PUXB 3RC6A 1NRPH 3FANA 2BX3A 3M7QA 1C5XB 1SGPE 1D9IA 1UCYH 2XW9A 1G30B 2GVFA 4K69A 5CHAC 3UY9A 2P94A 3TH4H 1DVAH 3MO3A 3AAUA 1DFPA 4GHTA 3DSOA 2SGFE 1QA7A 6GCHG 3SV6A 1ZSJA 1TPSA 1KDQA 3DHKH 3MU5A 2F43B 3EDXB 4B76A 3UR9A 5EW2H 1P2OA 3BTGE 3FP6E 5LPRA 2ILNA 1O2VA 1P05A 4ISLA 1EAXA 1J8AA 1GI9B 4Q7XA 5DP6A 1TNHA 3P92A 4UFEH 1QJ7B 1BCUH 1V6DA 1RGQA 2H9HA 1V3XA 2WPHS 4F4OC 1ZYOA 4ZKNU 3ATKA 3UIRA 3EA8A 1OKXA 1VITF 1WYKA 2GZ9A 1K1PA 5CE1A 2XCFA 3RMNH 1AO5A 1LHCH 2FTMA 5EIYA 2P16A 5G4BA 1Q2WA 3M3TA 2JJ1D 1XVOA 1TX6A 2LPRA 1ARCA 1AIXH 3QDZB 2QAAA 1DPOA 4H42U 5TCCA 3GY4A 1NZQH 4CREA 3KEEA 5E0HA 1W11U 7KMEH 1V2RT 1JOUB 1GMHF 4F55A 1VJ9U 1P2QA 1EZQA 3ATLA 3S69A 4KELA 1HNEE 4IMZA 4IN1A 1AE8H 1KIGH 1UO6A 4K8YA 4DURA 3RXHA 1TRYA 1BTYA 1BTUA 1K9OE 1LPKB 1GI4A 1O38A 4XDEA 3RU4D 4X2WA 4CRDA 1DUAA 1K0HA 1FPCH 2YMSD 1CBWB 1P02A 2QY0B 3GDSA 1C2FA 3MH5A 4ABFA 3S9CA 1C5LH 2ZQ1A 4K8BA 1C1VH 1IOEA 1GJ8B 2BZAA 1DWEH 4NIYA 1IHTH 5FBIA 1ZR0A 2EI7A 3E90B 3QLPH 1GBKA 3A87A 2ZFFH 2OC1A 3H7TA 1GBCA 4J2YB 1XKAC 1QQ4A 2ZC9H 1Y59T 1HAGE 3BTWE 3H7OA 1GI0A 1THRH 1YPHE 2PTNA 5DG6A 1HGTH 1ZMLA 1J16A 4HG6A 2ZU4A 2BVSH 2BD3A 3KQ5A 3VPKA 1A4WH 1THPB 1BRAA 1YWUA 1BB0B 1A0HB 4WMDA 5DP4A 1FY3A 1E0FD 2OD3B 2K1QA 1ZHRA 1L2EA 1UVTH 1O2ZA 4YTAA 5E0GA 1H8DH 1MCVA 5LPEA 1T8OA 3DA9B 2G4TA 1O2WA 1KXBA 2Y80A 1E34B 1VCWA 2WPDD 1O2IA 2VH6A 3LJJA 1LDTT 1AKSB 5DP9A 1VZQH 3UNSA 5F53A 3STJA 1HJAC 1RRKA 2FOHA 3PV4A 2SFAA 1QR3E 5L6NH 1MUEB 2FOAA 4KGAA 1OWEA 1EPTB 2NU2E 5DGJA 1BBRH 1WV7H 1O34A 3A81A 1SG8B 4INLA 1BA8B 1JRTA 2ZDMA 4H4FA 1H1BA 1HRTH 3SUEA 5T3HA 2XBWA 1MCTA 4Q80A 5A8ZA 1UTPA 1BTWA 4RSPA 1A2CH 3D62A 3IG6B 2KCYA 4FUHA 4UDWH 3K6YA 1TFXA 3GY7A 1ARBA 4I86A 4YESB 4CHAC 2ZA5A 1E36B 1BMLA 5DK1A 3SNAA 2BD5A 3MTYA 1DWCH 1GI7B 4ISOA 3VG8A 1ABIH 2KCAA 2C8YB 2DUCA 4X1PU 2GX4A 4TT3D 1C1QA 1ELTA 1HUTH 2ZEBA 5A0CA 1UK2A 5FL7D 3S7KB 2QXJA 1O2PA 5C67A 3MFJA 2F9UA 1UVPA 1O35A 2G00A 1D4PB 2CJIA 4NZQA 4I8GA 1N1LA 1O3KA 2RG3A 4X6NA 3SNCA 3KIDU 3TNSA 2BDCA 1IAUA 1YY3A 3FOAA 3RLYH 4BANB 1PQ8A 2JH5D 2ZDVH 3TJUA 2QF3A 4BTTB 3GOVB 3BTDE 1NBMD 1V2ST 2FPZA 1S5SA 1SGFG 2A0QB 2HLCA 4B2CA 1SBWA 1YLCA 5F8ZA 1XUHA 1C5NH 1IQLA 4AFSA 2UWOA 2R2MB 5CMXH 1O3DA 4YLQH 1BMNH 3ZV9A 1SGEE 1MZDA 1EAWA 1F5KU 3ZVEA 3KGPA 1RTFB 1GL1A 1DLKB 2FIRH 1TBRH 2GT7A 2W7SA 5C94A 1W7GH 2ZFTA 1NRRH 1O3MA 1PJPA 4YOJA 1ELFA 1O39A 1O3BA 1G3EA 2PKSB 4ISIH 4DVAU 1QA0A 2FOBA 2ZG0H 2ZCKP 5DP5A 2SGEE 2HOBA 1FJSA 1ZJKA 4X8VH 1BMAA 2F9VA 3SI4H 5FXLA 1TOCB 4X2VA 5T1VA 4YZUA 1SQRA 4E06H 2W6ID 2YMSB 2NU3E 1OP2A 3TJOA 1ZJDA 3RXSA 3UTUH 1FUJA 2C3SA 2VIDA 5EXNA 3F1SB 2KAIB 4FXGH 4ABIA 2O9QA 1O5FH 1FN8A 1GJAB 1ANBA 3M5LA 3B23B 5FX5A 2A45B 2SGQE 3OY5U 1QURH 3UWIA 1Y5BT 2FZZA 1TALA 1Z7KA 1NTPA 3AW0A 1SGCA 3SUGA 3BTQE 1O3PB 3NKKA 2Z9JA 3IWMA 2ZFPH 1ETTH 3CS7A 1YPEH 1O3OA 1DSTA 3GCTF 1O36A 1A1RA 3K6ZA 1S6FA 2G4UA 1TGSZ 4RT0A 1JMOH 1O0DH 1UVOA 1FIZA 1XVMA 2BDIA 1AI8H 1HAVA 3PO1B 4MPWA 2H6MA 5EXLA 2BDBA 2LP6A 5FCRA 3DSGA 1JRSA 1O2HA 2GCTB 3AK5A 2FP7B 4YO9A 5FCKA 3PV5A 1EASA 2R9PA 4ISNA 2QV1A 3LKWA 1HB0B 1Y5UT 2CHAC 2RCEA 2WPIS 6ESTA 2VGCC 3M35A 2EY4C 3ZZ7A 2C4FH 3RXVA 4MNYA 1KTTB 3A88A 5FPYA 1DDJA 3NRLA 3ZZCA 1G9IE 2B8OH 1C5SA 2QF0A 2YNBA 3ZZ3A 2VIPA 3AW1A 1C1MA 1Y5AT 2FO9A 1GVZA 2RA0A 1GBBA 1GJ4H 1T4UH 1HAYB 3NZIA 4WMFA 1LHGH 4BTUB 5EW1H 4CBOA 1UTQA 2Q6DA 2F91A 3VGCC 2KZ4A 3S9AA 3RXFA 4E05H 2A7JA 4HGCA 3T62A 1DXWA 3RMMH 1CHOF 2HVXA 1C1OA 2CXVA 3T25A 3TK6A 2ZFRH 1C4Y2 2QC2A 3H09A 4WY3A 3ZZ9A 2J38A 4ZMAH 2F9NA 3MOCA 1C5WB 5EGMA 1E35B 4FUBA 1WAYB 1C2JA 1P3CA 4X2YA 1BMFD 3KF2A 1C2HA 2ODYB 3T26A 1OPHB 1K1MA 2C90B 1CA8B 2VWOA 3GY8A 1V2PT 1C5QA 2FEQH 4Y6DA 1ZMJA 1SQAA 4FUEA 2WHXA 1AWFH 1KXAA 3GY6A 1FN6A 3MQKC 1YPKH 1SKYE 1PQ7A 4YXWD 5IK2D 1SVPA 2VVVA 3SQEE 1HJ8A 1G2LA 4X8TH 2P3UB 3KYFA 2BOKA 1P01A 1QB6A 2FS8A 3A85A 3GCNA 3MH7A 4ACAA 1EXFA 1O2QA 3QX5H 1N8OC 1WQSA 1C1RA 1GHVH 2NU0E 3UQVA 4ACBA 4IW4E 3VEQB 4Y7BA 4TPYA 5AFZH 2BM2A 1D6RA 1D3TB 3OE7D 3PYHA 2BDHA 2PSXA 2CV3A 4BOHA 1QTFA 1GGDB 3RC4A 2FX4A 1O30A 1KXCA 1S0RA 2HNTE 4LXBH 2H9EH 4MPXA 2R3UA 3SO3A 1KXFA 1TNGA 2XBVA 4DIHH 2WSSD 3PROA 2FESH 4B6EA 3Q3XA 3O8DA 3U9AH 4K1EA 3EGKH 3OSYA 1DUEA 1ZTKA 4UEHH 4CRBA 3RMLH 1BIOA 5EG4A 1BHXB 3M3VA 1ZOMA 3V7TA 1HAXB 5DP8A 3LONA 2ZO3H 3RXKA 2WPLS 3MYWA 5EU8A 2ZU2A 3BTEE 1SGYE 1OHHD 2Z3CA 4FETA 1TLDA 3NPSA 1AFQB 1OWDA 2WV5A 3D49H 1TWXB 2ZGHA 5F03A 1YC0A 1C5OH 4QT8C 1GBDA 5A8XA 2AMDA 2QE7D 1AY6H 2PUQH 1EX3A 1MU8B 4O3UA 1XUFA 3IITA 1W0ZU 2YNAA 3A80A 3ZZDA 3BG4B 1YGCH 1CGIE 2ULLA 2P93A 1W2KH 1ZHPA 1MZAA 1QGFA 3SORA 2XNDD 1UTOA 1AFEH 1TGBA 4I32A 3C1KA 1C2EA 2A4OA 1P8VC 3LGWA 4MPVA 4AB9A 1Y3YA 3UUZA 5C5NA 1LVMA 2V6NA 3D23A 2AERH 1LO6A 3SV9A 1XXFA 2TBSA 1QL9A 4DCDA 1A7SA 3FO8D 4OM9A 3GCHB 2FMJA 5E0JA 1E1RD 2XBYA 2NU1E 5EODA 1SPJA 3SJOA 2HNTF 5GJ4B 3KQBA 2D26C 4AORA 3E0PB 1PYTD 1QB9A 1GJDB 1V2LT 1CHGA 4YLUA 5T6FA 2STBE 1NC6A 1LHDH 1L1JA 4X1RU 1BRCE 1CT2E 1PPZA 1Y3UA 3F9HA 1FY8E 4GLYA 2WPKS 1GPZA 4OS5A 4AN7A 2QN5T 2F9PA 3SU5A 2Z9GA 5JYIA 1MAXA 1TA2A 4NG9H 3UQOA 4XD7D 4XFQA 5FPSA 1TMBH 3DFLA 5JBAS 2GZ7A 2VWMA 1S6HA 2BB4A 2Y5FA 1EATA 2Z7FE 3U1JB 4NIXA 2ZWLH 1P2IA 1S85A 3F2GA 3PV2A 1UVUH 2Y5GA 1MTNB 1P0SH 1YLNA 2ZHFH 1DY9A 2OC8A 6GCHF 4THNH 2I6QA 2C8ZB 1T32A 2ZIQH 3M3SA 2AGEX 2HWLB 1C1TA 2Y7XA 3C27B 1HIAB 3BN9A 7ESTE 2LNCA 2EI8A 4ASHA 4P02A 3QUMP 1HAZB 2RA3A 2ZZUH 2W3IA 3TK9A 2B5TB 3KNXA 3JZ1B 4ABJA 1XM1A 4FU9A 1CGJE 4FUFA 3URCA 2A2XH 2QCYA 4TY6A 3TLOA 4DJZB 2GV6A 4RKOB 3MNBA 1NS3A 3TJVA 1O5DH 1OOKB 2ZHDA 3NXPA 3VB7A 1DXPA 5J4QA 1WXRA 3QWCH 4IC5A 1LQDB 3SI3H 1NRSH 1O3JA 1FX0B 2FX6A 1WTHD 1OYQA 2QGRA 1AKSA 1BDAA 4B6FA 2VB0A 3SU4A 4K5ZA 1P9UA 4K1SA 5IDKA 1AU8A 1TPAE 1AE5A 2V0BA 3ZZAA 2L74A 4RI0A 7LPRA 1EPTA 3SGQE 4AG1A 3A8BA 4XE4A 3SJ9A 3KQEA 1K1OA 1AGJA 8GCHF 1TGTA 1ACBE 4WVPE 1SGDE 2H1UA 3PRDA 1GDQA 4MNVA 1HPGA 3V0XA 4IN2A 4A7IB 4HTCH 3ATIA 1EUFA 2G81E 3MU0A 1F92A 4B71A 4Q4LA 2VH0A 2SNVA 1O2JA 2CMYA 2GT8A 4GPGA 4Y8ZA 5BPEA 5T6GA 2A2QH 3ZVFA 1C5RA 1G32B 1SFIA 4A92A 2FOMB 1VGCB 2G52A 3QTOH 1RTLA 3DD2H 4NFEA 3LH3A 4AX9H 1GG6B 3RXCA 1TNLA 1TMUH 4XBCA 4I8HA 4HI3A 2PSYA 1GVKB 2SGPE 5KECA 1D3QB 2OTVA 1PPCE 2AH4X 5FBEA 2BY8X 1BTZA 1Z8IB 1QZ8A 3VB4A 2F83A 2OUAA 3QK1A 2PTCE 1SOZA 4UE7H 2BY6X 1VITG 4Q2KA 3MMGA 3ZZ5A 1F7ZA 4Y10E 3MH6A 1IQKA 1L1NA 3HK3B 1J15A 1AVWA 4UFFH 1GMDF 1OYTH 3S0NA 2FXRA 1YCPM 3LDXH 4I8KA 1L0ZA 3CS0A 5L2ZH 1C5YB 2Z94A 4CR9A 3SBKA 5B6LA 1DITH 1HAPH 1V2JT 1S0QA 2IJD1 2BY5X 2BHGA 2O8LA 3P95A 3BTTE 3T5FH 1LPZB 3SOSA 3SW2B 1K1JA 4WH6A 1CA0B 1SGIB 4OS4A 1OXGA 5EJ1A 4Z6AH 2G55A 2ZDKA 3QZRA 2RDEA 3TVJB 1DWDH 5FPTA 1NT1A 4CRAA 3ZVDA 2ASUB 2FODA 2FDAA 5H4IB 5AVDA 1IQFA 1NFWA 3PMAB 1XUJA 3LC5A 4MDSA 3PM3A 1HLTH 2UUKB 3O8CA 2A5IA 2IN2A 1O32A 4NFFA 1DM4B 2XC4A 3Q00A 1A46H 2OINA 4I8LA 5DP3A 5I46H 2WPJS 1GDNA 3GY5A 3B9FH 4E7RG 1BMMH 5E2OA 4WJG2 5GXPA 2ANWA 2FOFA 2QA9E 5IYTA 3VXEH 3RXMA 4ZKOU 1FY5A 2ZGBH 4AG2A 1HYLA 1C1NA 1GG6C 3O8BA 2BOHB 3OU0A 2ZKSA 4D7GA 2KAIA 3NK8A 4M9FA 4A5TS 3HGNA 3F9FA 1C9TA 2TPIZ 3HK6B 4DY7B 1AHTH 3SU1A 2Z9IA 3UNRA 2ODQA 3ODDA 1EAUA 1YPGH 3VB5A 1CBWC 2VU8E 1YCPH 5C1UA 1F0UA 2BZ6H 1IQJA 4HZHA 3SJIA 1PPFE 2AIQA 3EYDA 3RXOA 4WMEA 1JIMA 3RU4T 1U6QA 2PKAB 1DT2A 1H9IE 1F0TA 3BTHE 2PWXA 1TNIA 3RXLA 3SU3A 1ELGA 1KYNA 2IJOB 2WUCA 1GCTB 3UAIC 4FU8A 1ESAA 2P3FH 2GD4B 1ESTA 2BXTH 2FLRH 2UUFB 3ZV8A 3RDZA 2BLWA 5EQQA 2F4LA 3GCOA 3LIWA 3WW7A 3A89A 1W12U 3LH1A 3N7EA 2BQ6B 4TYDA 1DICA 1EZSC 1C5VA 4Y71A 1GI6A 4ABBA 2W26A 1TPPA 4HFPB 3P8GA 1DSUA 3ENSB 4IMQA 3SNDA 3U1IB 1V2KT 5I25A 2KFWA 1QJ1B 4UD9H 4CRGA 2W6JD 3STIA 1T8NA 4AGJA 3SZEA 4FUDA 2HGTH 4Y11E 1UTNA 4RN6A 4BAOB 2ZCHP 3A7YA 1DLEA 3LGTA 1LVBA 4WF8A 1CU1A 2Z6BD 3EE0B 2AEIH 5GCHG 1C4U2 3GDUA 4FUJA 1TABE 1ZRBA 1QRWA 3PMJA 3VXFH 3P17H 2BDGA 1CGHA 1SQOA 1EPTC 1ZPZA 4U2WA 1P10A 1AD8H 1TRMA 2RDLA 3A8CA 1L1GA 4I31A 2RFKC 4UONA 1QCPA 2OBOA 2C8XB 1SC8U 2CGAA 2GCHF 3ITIA 3BEFB 3SV7A 4XBBA 1K1LA 1O2XA 2XXLA 1W0YH 1RJXB 2XYAA 3BF6H 4RKJB 1KY9A 4AZ2B 4INHA 1KTSB 1P2JA 1P57B 5LH8A 3K65B 1GMCG 5EQRA 2D2DA 4CR5A 1TB6H 8ESTE 2BLVA 1YYY1 2FI3E 1G36A 2A5AA 1HXFH 1FV9A 4AGKA 2CN0H 1DX5M 2WPMS 2TGTA 3E1XB 3URDA 1C2IA 1EFRD 2OC7A 1GJ9B 3T28A 1DS2E 1GI3A 1O3FA 4X6OA 3SHAH 1H8ED 1HXEH 2AHME 1UJ1A 2BVXH 2QXHA 1F2SE 2A4RA 4ISHH 2HRVA 2VVCA 2A7HA 1C2MA 1EJMA 2G8TA 4AC9A 2XC0A 5F6MA 8LPRA 3LJOA 3MHWU 2YOLA 4I33A 2FOGA 3ZYDA 1O5BB 1MBMA 2JETB 1AUTC 2Y7ZA 1V2TT 3VB3A 4BAKB 1ANCA 2QIQA 3FFGA 3EA7A 3NUMA 5EOKA 2BTCE 2P95A 3UNQA 9LPRA 1V2QT 1KXEA 5HIYA 2Y82A 1PPHE 1H8HD 1C5PA 1GHBG 4X2XA 1UK4A 1ZTJA 1GBTA 3OEED 1RIWB 6LPRA 4ZXYH 4AFZA 3A7ZA 1ELBA 2FTLE 5ESBA 1YCPK 1WUNH 1O31A 5F8TA 5C0TA 3KQCA 3QTVH 1HAHH 4DIIH 2GJGA 1FDPA 3ZZ6A 3O8RA 1YBWA 2PKSC 2BLQA 1BUIA 3PLBA 4BAQB 1AZ8A 2O8UA 3ZVGA 2BD2A 3RXTA 1V2VT 1DY8A 1TOMH 3F9GA 3GCTG 4OGXA 1P04A 1MBQA 1LQEA 4LZ4B 3RXBA 2J34A 1OS8A 1NY22 1EJNA 2EEKA 3HGPA 2YMSC 2ZCLP 1SGNE 2HPQH 1EP5A 2PLXA 1BJUA 1MQ6A 2UUYA 3RXRA 5C2ZA 3SGBE 1FLEE 2GDDA 1UHBB 4R8TB 1VR1H 1LVOA 1H4WA 4Z0KA 5DP7A 4O9VA 3E0NB 3V13A 4D9RA 7GCHG 4ZROA 1VCPA 5GNDA 3SU2A 2D1JA 5EQSA 3QN7A 1C2GA 3CNRA 1F5RA 3ZIAD 4I8JA 3RC5A 2THFB 4JZIA 4FUGA 4JZFH 3ZVBA 1P11E 2AIPA 1HDTH 2ZGJA 4ZCNA 5AFYH 1ZSLA 2VIQA 3N7OA 1V2MT 3I29A 3PO1C 1UTMA 1FY1A 3F68H 1ELDE 3PB1E 1O3GA 2OP9A 1NM6A 1MAYA 4DG4A 1Q31A 2GCTC 3WY8A 1LHEH 2F9OA 2VBCA 3EQ0H 2BXUH 3GISB 4WH8A 3UOPA 2PR3A 2J4IA 2VIOA 2SGAA 5HM9A
chains in the Genus database with same CATH topology
1HBTH 1GL0E 1EB2A 1GI5A 1P2MA 2NWNA 3RXQA 4A6LA 3I78A 1O2KA 1SQTA 3M7UA 5EXMA 4MG3A 4BTIB 3GY3A 4LOYH 4SGAE 1OP8A 1E37B 4AFUA 2A1DB 3ATWA 1Y3WA 2ZGXH 4KKDA 1IQNA 1O3HA 1MQ5A 2CF8H 4CRFA 2BVRH 2BDAA 4NWKA 4Y8XA 2Q6GA 2WUBA 3QGJA 1S83A 4E7NA 2O8TA 2ZTZA 3PTBA 4GVUA 2VIVA 2R0KA 3V3MA 4KTCA 3SGAE 4A1VA 5DO4H 4GCHG 1A5IA 4YOGA 9ESTA 5DJ7A 1DE7H 2O8MA 2AGGX 1XXDA 4K60A 1HIAA 3TH2H 1SLWB 2VNTA 5HGGA 1PPBH 1W8BH 1HAOH 1GBAA 1THSH 5LPFA 1CQQA 3A82A 1GJ6A 1AB9B 3PLPA 1OWHA 3A7XA 4X1QU 1GHAG 1ETRH 1YPMH 1L4ZA 2CF9H 2TGPZ 3RXGA 1GJBB 1ANDA 3E6PH 1ZLRA 2VWLA 1GJ7B 1IQMA 1HCGA 1BTPA 1BRBE 3LC3A 3UPEA 3UOUA 4ABAA 5K7RA 1RS0A 5GPIB 1B5GH 1IQIA 1P2NA 1C5ZB 4ABHA 1MU6B 3TPIZ 4TWYA 2BY7X 1OSSA 2PW8H 1RXPA 1KXDA 4Q7ZA 2I6SA 3SJKA 1C2DA 1O5GH 1NFXA 5EPNA 3SU0A 5E2PA 5ESTE 3E91A 3LGVA 2Y5HA 3U98H 1KSNA 1W7XH 2GP9B 1XUKA 3P8OA 4ZXXH 1GI2A 1T4VH 4F49A 2W5EA 1TNJA 1GI1A 1ELVA 1EKBB 5SGAE 2FYRA 5CHAB 1GGDC 1IQHA 4O03A 4IGDA 4A1TA 1HFDA 3F6UH 4ABDA 3OTJE 1X7AC 3M5NA 1W13U 1YM0A 1C2LA 4BXWA 1S82A 1O2MA 3UREA 3MWIU 2JH6D 4YM9A 4LZ1H 4GSOA 1GBMA 1MKXH 1O2SA 1QIXB 2A31A 5FHTA 1YLDA 1XUIA 3A8AA 1FONA 1T8LA 1ZTLA 2QXGA 2TIOA 3ZZ8A 2QXIA 3FZDA 4BAMB 4BAHB 4NCYA 2FWWA 3RXIA 3BEIB 1GDUA 4YT7H 1PPEE 2F9BH 1EOJA 1WOFA 3M37A 4X1SU 3M61U 2AS9A 4MNWA 1BITA 1K22H 1D3DB 1ZGVA 4FUIA 1AFQC 1TYNA 1P12E 5JB8S 3GYLB 1QRZA 3EA9A 1FNIA 2BX4A 2ZECA 4TWWA 5ABWA 4D7FA 1P3EA 3F9EA 3B8JA 2J92A 3TNTA 4NSVA 1LTOA 2ZHQH 2WYGA 3SNBA 4FU7A 3BG4C 3TIUA 2AFQB 3BEUA 4H6SB 3FVFB 1GWAA 1GJCB 1TPOA 3K9XB 2GKVE 1ELEE 1YP9A 1G2MA 2G51A 2ZDNA 1UCYE 3A86A 1NU7B 2EI6A 3LPRA 1BTHH 5DKMA 1V2WT 4K2YA 1O2OA 4U32A 3TITA 3U8OH 1ID5H 5J4SA 4D8NA 1CSOE 2Q6FA 1SGQE 3SV8A 4OS7A 1MTUA 4H6TA 3GCHC 4Q7YA 4D76A 2STAE 3RMOH 1O5AB 3G01A 1BZXE 1T7CA 2WYJA 1OWIA 2QYIA 2UWPA 1GI8B 1GHXH 1RD3B 2A7CA 2OCVB 1GHYH 1Z8GA 4X6PA 5HM2A 1ORFA 1BQYA 4NA8A 3HKIB 1UK3A 3SUFA 1CE5A 3MNSA 1M9UA 1QBVH 1TRNA 1SLVB 1J17T 2FI4E 2DE9A 1S81A 3U69H 2V3OH 1SI5H 2P59A 1TMTH 2VJ1A 3LOXA 1Z1JA 4Y7AA 4MNXA 2H5DA 2PV9B 1YPHC 1ETSH 2PKAA 3L33A 1ZRKA 1CT0E 1VJAU 3UR6A 1FXYA 3ESTA 1MTNC 4OGYA 4D9QA 1Z6JH 1D6WA 2PFEA 1SGRE 3P8FA 3BTFE 1FIWA 3PMHB 4B1TA 1RFNA 1YPLH 3TU7H 1TQ7B 2XRCA 4J1YA 1HJAB 3LGYA 3BV9B 2ANYA 4DOQA 1CVWH 2P8OB 1F0RA 2ZPSA 1KLTA 1Z8JB 8GCHG 1C5MD 2BMGB 3GDVA 1WSSH 1ELAA 3W95A 1O2GH 1PPGE 4A1XA 3E8LA 3SQHE 3MU1A 1ESBA 2TGAA 5E8EH 1QJ6B 2FOCA 3A84A 1A3EH 1N6XA 1P09A 1SLXB 2VVUA 4JYUH 4CHAB 1MKXK 1C4V2 3AAVA 1MD7A 3SJ8A 1GMHG 3Q77A 3OY6U 1PQAA 2XBXA 4ZAEA 1GBHA 3GICB 4NIWA 4MTBA 3M7TA 4AYVB 5T6DA 1TONA 3KQDA 3BG8A 3PTNA 4NGAH 5JBCS 1EP6A 2ZU5A 2NU4E 3ZVAA 8KME2 1O37A 1BT7A 1BHXF 5EPYA 5AF9H 2ZGCA 3Q76A 3SN8A 3BSQA 5GDSH 2GDEH 3CENA 1TA6A 1ZPCA 2XNIA 3MU8A 2BQ7B 1JBUH 1GMDG 2A5KA 2UWLA 3QO6A 1NN6A 1EOLA 1OX1A 1GBIA 4GAWA 1NFUA 4Y0ZE 1TIOA 3CP7A 1KDQB 2XWBI 2R3YA 1O3EA 1SOTA 1VGCC 5JB9S 1ANEA 4XOJA 5L30H 1TAWA 3HATH 2BYAX 2ZPRA 3QZQA 4JZ1A 1NRQH 2OBQA 4U30A 1WQVH 1A0LA 1O2RA 1BBRE 4ZHAA 4MVNA 3AVZA 1P06A 3MO9A 4ABGA 5BRRE 4NA7A 2VINA 3K2UA 2A4GA 1O2TA 4JMYA 2JKHA 2P8OC 2PGBB 1UCYK 1TBQH 4CRCA 4I7YH 1C9PA 1LPGB 4X8UH 1FAKH 4AFQA 2J2UA 4WWYA 1C1PA 3ZVCA 2GV7A 2W7UA 1ZSKA 4ZKSU 1CT4E 3RM2H 1QHRB 2J94A 5TCAA 3PWCA 1K1NA 2BQWB 3SV2H 1ZPBA 1CA0C 1CO7E 3MI4A 2G5VA 5L2YH 1NRNH 3FZZA 5GCHF 1GBJA 1AMHA 3UFAA 2TRMA 1LVYA 4R0IA 2SGDE 1L4DA 5JPMH 2IPHA 3OYPA 3FAOA 3SU6A 1T8MA 2VWNA 1PYTC 2GMTB 6CHAB 2C93B 1ZGIA 3S7HB 2ZDAH 3LGIA 5B6OA 1W3CA 1V2UT 1SGTA 4NWLA 1HV7A 1HJ9A 2AMPA 3Q3YA 4AB8A 5A09A 1QQUA 1GMCF 4FVDA 5GIBA 2Q1JA 3U8TH 1NPMA 3BIUH 1A0JA 1QY6A 2BD7A 4MQAA 1G37A 1EZUC 1OWKA 3A83A 1SR5C 2XWAA 3MNCA 4ZH8A 1OWJA 3OX7U 1FQ3A 3LT3A 1G3DA 4DGJA 4JZDH 1UHBA 1PFXC 1SHHB 1W10U 2GZ8A 5C1YA 1KLJH 2ODPA 3BTME 1FAXA 2B0FA 3KL6A 4KTUA 2CHAB 1W14U 3KHVA 2VGCB 1Z6EA 3SUDA 2FYQA 1O33A 4ESTE 2EC9H 1Z71A 3I77A 1O3NA 1B0EA 3DFJA 1F5LA 3P8NA 3RUOA 1GCTC 1O3AA 4B2BA 3GYMA 1IHSH 3E16B 2V35A 2TGDA 3TGKE 2ANKH 2J95A 1TNKA 3LGUA 2BY9X 3P6ZB 3T2NA 1ZMNA 1BRUP 2ZNKH 4B75A 1F0SA 1MTSA 3SNEA 3VGCB 1MMJN 4BNRA 3A7WA 1C1WH 2ZF0H 4X8SH 1GHBF 1V2NT 1WBGB 5A8YA 1FI8A 2GCHG 2DE8A 1NESE 3SZNA 3L6PA 1Q3XA 2PGQB 3HPTB 1GHWH 3A7TA 3RXAA 1A5HA 4MPUA 4JCNA 3U8RH 4BXSA 1E38B 2GMTC 4O3TA 2ZFSA 1DWBH 6CHAC 1ZHMA 3A8DA 1K2I1 3UWJH 2BD4A 4OS2A 4XSKU 4ZUHA 1ABJH 3NCLA 5DPAA 2HPPH 3SHCH 1UMAH 4Y0YE 1A3BH 2BD8A 4M7GA 5HYOA 2G5NA 4JK5A 1O3IA 4DT7B 4JYVH 1G3CA 1G3BA 1Y3VA 1UTJA 4B2AA 1BBRK 4INKA 1SSXA 3TK5A 5K0HA 2Z3DA 1EZXC 1A5GH 1Y8TA 1WCZA 2FM2A 1AVXA 1LKBA 4YOIA 4FUCA 4X0WU 5GWZA 4CH8B 2UUJB 1N8OB 1NROH 1O5EH 3W94A 3S9BA 1D3PB 2ESTE 4U01A 1YPJH 3JZ2B 4VGCB 2GGVB 7GCHF 2ZHEH 3DT0H 3HKJB 5ETXA 1GCDA 5C5OA 5C3NA 4OS1A 3TH3H 1O5CB 1XMNB 1J9CH 1MKWH 1T31A 3MNXA 1QBNA 1QBOA 3TGJE 1EJAA 1SHYA 3P70B 1BTXA 2D8WA 1FMGA 2IOTA 1H9HE 1FZZA 1P9SA 2XC5A 3H5CB 1PQ5A 1SMFE 4AYYB 4LK4A 4MLFB 3PLKA 2H9TH 2B7DH 3VFEA 1JXPA 4GHQA 2A4QA 2JH0D 2HNTC 5FX6A 1TGCA 2JETC 1IQEA 1QFKH 4WXVA 1GBEA 2OLGA 3T29A 5C1XA 3ATMA 3RM0H 1J14A 2V3HH 3M5OA 2ALPA 2R0LA 4ZHMU 1TX7A 1O2NA 1V2OT 1FPHH 2FOEA 2HALA 4OS6A 5F8XA 3MU4A 3AASA 3RXUA 1CHOG 1RIWC 1SLUB 2R2WU 3KN2A 2WV4A 1OP0A 1QL7A 1K1IA 1QNJA 4JZEH 2ZU1A 1BJVA 3RU4E 1O2UA 2ZFQH 1NFYA 2AMQA 4GCHF 3RLWH 1UVSH 1K21H 4YT6H 1ZZZA 3V12A 5FAHA 1JIRA 5A0BA 3ODFA 2ZI2H 4O97A 2FS9A 2FLBH 3NWUA 3ELAH 1QRXA 1EB1H 1SGFA 3L3TA 4NIVA 1N6YA 4VGCC 1TGNA 2ALVA 2AYWA 1AVGH 3M36A 4Y8YA 4CBNA 1GHAF 1C5UA 2SNWA 4B74A 3R3GB 4KP0A 1HAVB 2H5CA 4PROA 3RP2A 1Z1IA 1QL8A 4ABEA 1HAIH 2ZHWH 4B73A 1XX9A 3EAJA 5A0AE 1LHFH 3RXEA 3LU9B 1RTKA 1C1UH 1K28D 2GTBA 1A61H 2O8WA 2PHBA 4NA9H 1C2KA 3RXJA 2BD9A 1JWTA 1O2YA 1TE0A 2ANMH 3FP8E 1FY4A 1ELCA 4FVBA 2OQUA 1MTVA 5HMAA 3TJNA 4SGBE 5LGOA 1P2KA 3RXPA 4Y79A 1GJ5H 1TX8A 4CH2B 2OXSA 1C5TA 4TPIZ 4ZHLU 2WINI 1C1SA 4WXIA 1LCYA 3ZZ4A 2ZU3A 2W3KA 2P3TB 3MH4A 3ZZBA 1GVLA 1NO9H 2H2ZA 5PTPA 2EA3A 4X1NU 1EAIA 4IS5A 1UTLM 2J9NA 2BDYA 3PWBA 2ZTYA 5A2MH 1H9LB 3RXDA 3VB6A 4UFGH 4DW2U 4IBLH 4K1TA 3TGIE 1EQ9A 2ZDLA 4XBDA 1GBFA 2Y6TA 1MKWK 2ZTXA 2OQ5A 4KTSA 1XKBC 1AZZA 1O3CA 4X6MA 1AN1E 4UFDH 1SL3A 2C8WB 1SB1H 2ZPQA 1VCQA 3A7VA 3BIVH 2OC0A 1AUJA 1O3LA 5JBTA 1P03A 4AOQA 5AHGH 1IQGA 1GHZA 1WTGH 3E3TA 3PMBB 2F3CE 3DUXH 1DOJA 2VIWA 3FP7E 2BLOA 1NU9A 5TJXA 3D65E 1AB9C 1B0FA 3KCGH 4JK6A 3MO6A 5HXFA 2Z9KA 1H8IH 1LKAA 1MD8A 1O2LA 2Z3EA 2B9LA 1LMWB 1S84A 1INCA 1B7XB 1VITH 1AQ7A 4Y76A 1Z8RA 3M5MA 1XUGA 1MTWA 1TBZH 1TQ0B 2FI5E 2Z9LA 5JBBS 1Y3XA 4ZKRU 4TY7A 1YKTA 2M5TA 4GUXA 2ZP0H 3GY2A 1QB1A 5JDUB 3BTKE 4IC6A 1BOQA 4JYTA 4NSYA 1GBLA 1DANH 2A32A 3ZYEA 3Q3KA 3QGNB 2XTTB 4K3JA 3R0FA 2AGIX 1UTKA 1AWHB 1KLIH 1MH0A 1YF4A 2Y81A 1SFQB 2XCNA 2ZQ2A 4NZLA 3T27A 5C20A 1WU1A 2PUXB 3RC6A 1NRPH 3FANA 2BX3A 3M7QA 1C5XB 1SGPE 1D9IA 1UCYH 2XW9A 1G30B 2GVFA 4K69A 5CHAC 3UY9A 2P94A 3TH4H 1DVAH 3MO3A 3AAUA 1DFPA 4GHTA 2SGFE 1QA7A 6GCHG 3SV6A 1ZSJA 1TPSA 1KDQA 3DHKH 3MU5A 3EDXB 4B76A 3UR9A 5EW2H 1P2OA 3BTGE 3FP6E 5LPRA 2ILNA 1O2VA 1P05A 4ISLA 1EAXA 1J8AA 1GI9B 4Q7XA 5DP6A 1TNHA 3P92A 4UFEH 1QJ7B 1BCUH 1V6DA 1RGQA 2H9HA 1V3XA 2WPHS 4F4OC 1ZYOA 4ZKNU 3ATKA 3UIRA 3EA8A 1OKXA 1VITF 1WYKA 2GZ9A 1K1PA 5CE1A 2XCFA 3RMNH 1AO5A 1LHCH 2FTMA 2P16A 5G4BA 1Q2WA 3M3TA 1XVOA 1TX6A 2LPRA 1ARCA 1AIXH 3QDZB 2QAAA 1DPOA 4H42U 5TCCA 3GY4A 1NZQH 4CREA 3KEEA 5E0HA 1W11U 7KMEH 1V2RT 1JOUB 1GMHF 1VJ9U 1P2QA 1EZQA 3ATLA 3S69A 4KELA 1HNEE 4IMZA 4IN1A 1AE8H 1KIGH 1UO6A 4K8YA 4DURA 3RXHA 1TRYA 1BTYA 1BTUA 1K9OE 1LPKB 1GI4A 1O38A 4XDEA 3RU4D 4X2WA 4CRDA 1DUAA 1FPCH 1CBWB 1P02A 2QY0B 3GDSA 1C2FA 3MH5A 4ABFA 3S9CA 1C5LH 2ZQ1A 4K8BA 1C1VH 1IOEA 1GJ8B 2BZAA 1DWEH 4NIYA 1IHTH 5FBIA 1ZR0A 2EI7A 3E90B 3QLPH 1GBKA 3A87A 2ZFFH 2OC1A 3H7TA 1GBCA 4J2YB 1XKAC 1QQ4A 2ZC9H 1Y59T 1HAGE 3BTWE 3H7OA 1GI0A 1THRH 1YPHE 2PTNA 5DG6A 1HGTH 1ZMLA 1J16A 2ZU4A 2BVSH 2BD3A 3VPKA 1A4WH 1THPB 1BRAA 1BB0B 1A0HB 4WMDA 5DP4A 1FY3A 1E0FD 2OD3B 2K1QA 1ZHRA 1L2EA 1UVTH 1O2ZA 4YTAA 5E0GA 1H8DH 1MCVA 5LPEA 1T8OA 3DA9B 2G4TA 1O2WA 1KXBA 2Y80A 1E34B 1VCWA