2A5AA

Crystal structure of unbound sars coronavirus main peptidase in the space group c2
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like peptidase
publication title Crystal Structures of the Main Peptidase from the SARS Coronavirus Inhibited by a Substrate-like Aza-peptide Epoxide
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 86
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2a5aA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2a5aA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2a5aA02
1P09A 2BDHA 3TGJE 1C5ZB 4I8JA 4X8TH 5DGJA 4X1RU 1RIWB 1MD8A 1IQIA 2OXSA 3E91A 1YGCH 3SQHE 1O2RA 1MTVA 1ZJKA 4GPGA 2GDDA 4CR5A 1ZHPA 3ZZCA 3LPRA 2TIOA 4UDWH 5FHTA 1FN8A 4WH6A 1D3DB 2C8YB 4WWYA 1OYTH 2VNTA 4F49A 1Z71A 2VWOA 2PKSC 4GAWA 4ABIA 3DUXH 1DWDH 2FESH 3GDVA 2HOBA 1C1UH 1TFXA 2ZFTA 1QJ1B 3I29A 3RXTA 3M3TA 1E0FD 2OP9A 4B73A 4X1QU 1JIRA 4XBCA 4IC5A 5E2PA 5HM9A 2AMDA 4A92A 2ODQA 1HXEH 1DDJA 1MQ6A 3ZZ3A 4NFEA 8LPRA 1P2KA 1VGCC 5LGOA 4DIHH 5EU8A 4CRCA 2ZEBA 1P06A 2HALA 4OS2A 1SFQB 4FUDA 1MAXA 1Y5BT 1DSUA 4DY7B 2V35A 4ZXYH 3UTUH 3E0PB 1BTHH 2BDYA 1HAVB 1V2TT 2VVUA 2B8OH 5C1UA 4XOJA 1O33A 1KXAA 4CH2B 3ZYEA 2PUQH 3AAVA 1DITH 1WTHD 2ZWLH 1C9PA 1KSNA 2THFB 2A7CA 2H9TH 3SHCH 4AG2A 3R3GB 1XUKA 2BQ7B 3RXIA 1ZGVA 3RXSA 1AIXH 1C2HA 2Z7FE 2QC2A 4IGDA 4TYDA 2CN0H 3A7XA 1BZXE 4A5TS 3SV2H 1GHBG 3TU7H 2VGCB 2A45B 3SV7A 5HYOA 4AORA 2PW8H 5PTPA 1ELBA 4XSKU 1O2PA 3SN8A 1HJ9A 1GJ8B 4B75A 1TRMA 1WUNH 1BIOA 3OSYA 4NIVA 1SPJA 2FI4E 1SSXA 3DA9B 2AH4X 1F5LA 1QJ6B 2W3KA 1C2KA 2EI7A 2XBVA 1C1RA 2IPHA 4K5ZA 1GBHA 5A8ZA 3VB7A 5DP9A 1GVZA 2BM2A 1C5LH 1GCTC 2BVXH 1LHDH 2F9PA 2ZF0H 4ESTE 4MQAA 1CVWH 3F9HA 2BX4A 1G3EA 1UVUH 3MH7A 1SGQE 3RXDA 1NRNH 3QDZB 2G8TA 1VITH 1SBWA 2FS9A 4I7YH 1WV7H 3M7UA 3PTNA 3GOVB 3F68H 1BUIA 2PKSB 1GJ9B 1PQ7A 2PKAB 1EZUC 1CU1A 2ESTE 2SGDE 3SJ9A 2JH0D 1NFXA 3UOUA 3A88A 1B0EA 5JBCS 3FZZA 2A5KA 2ANWA 5T6FA 1MBMA 1A1RA 4I8LA 1GMDF 3PLKA 3SJIA 1AGJA 1EP6A 1S85A 1E38B 1V2LT 2HGTH 1D9IA 1RTLA 1VGCB 1ZSKA 2BY9X 2D26C 3SNAA 1J16A 4K3JA 2VINA 3D23A 3E3TA 5B6OA 1C1WH 1O3LA 4K2YA 4X8SH 1KTSB 5T6GA 3ZVAA 4AFSA 1UK3A 3HATH 1F92A 1GBAA 1NFWA 3ATWA 1AFEH 1GHAF 2SNWA 4JZIA 1ELCA 5TCAA 3RXQA 3KNXA 3TH3H 3SNEA 1O2ZA 1QGFA 1Z8RA 1F2SE 1PPBH 5F8ZA 4FUJA 1C2DA 4OS1A 5CMXH 1AVWA 1PPHE 2TGDA 4UFGH 3EA9A 3Q3YA 1ZHMA 4GUXA 1DANH 2FLBH 3S9BA 4MVNA 3PO1C 4NWKA 8ESTE 2H2ZA 2V3OH 2ZDNA 1XM1A 1P2JA 2GTBA 1V2MT 5E0GA 4WMFA 4CH8B 2TPIZ 2Q6GA 1KXFA 3NK8A 3NZIA 5FPSA 2QCYA 1KXCA 1QRWA 1UHBB 3K6YA 1ETRH 2W3IA 1B0FA 2VWNA 2GZ9A 4DJZB 3PLBA 2BQ6B 4J1YA 2FYRA 5EPNA 4O03A 1MKWH 2O8MA 3RLYH 4ISNA 3T2NA 1DWEH 3A8BA 3FP6E 2XCFA 4YESB 4CRFA 1O2LA 5C5OA 3OY6U 2V0BA 4F4OC 4YM9A 3ATKA 3BTDE 3GY8A 1ELVA 2H9HA 3LONA 4CHAC 1E36B 1CGHA 4NWLA 3MU0A 1QRXA 5DP8A 2F9VA 1AB9C 1O2JA 2ZZUH 1A5IA 1C1NA 4IS5A 1HB0B 1ZSJA 3GY6A 3SU0A 1NRPH 3KQBA 3M5NA 4I8HA 1K1MA 3RXKA 3TGIE 1T4UH 2R2WU 3M7TA 3M61U 4JZEH 2Z6BD 1MZDA 1KIGH 3OY5U 4UEHH 2BDIA 3ZZAA 1DFPA 2ZI2H 3PMBB 3F1SB 2UWPA 2FDAA 3SGQE 4UFFH 2FYQA 2ZG0H 4ZKSU 1TPPA 2GD4B 3ODDA 3RU4E 2GVFA 1P2IA 1BTPA 2WYJA 3MH4A 4H42U 3T28A 1EAXA 1AWFH 1QJ7B 3TLOA 3MI4A 4IBLH 4X1NU 3T25A 1YCPM 1JWTA 4YO9A 5LPFA 1ARCA 1O3NA 1CGJE 3P8OA 5DPAA 4ABFA 3RU4T 2NU2E 1AY6H 3SOSA 4A6LA 1JIMA 3ZZ5A 1D4PB 3N7OA 1EPTC 1P2NA 4CRAA 2I6QA 5DP7A 4B2AA 4B2CA 1FV9A 2C8ZB 1ZR0A 4ZKRU 1HAVA 2BY6X 4E05H 5JBTA 1O35A 4YOGA 1PQAA 3RXHA 3A7VA 1P3EA 4E06H 3AVZA 4YT6H 4AYVB 3MO3A 1O3MA 2BTCE 3H7TA 1SGFG 1AMHA 2OINA 1MBQA 2R2MB 2XTTB 1KY9A 3SNDA 3A81A 1O5FH 1O5DH 5T3HA 1K1OA 1GMCG 1PQ8A 1IQEA 3RDZA 5C1XA 1BRUP 4K1TA 3OTJE 1CQQA 4AFQA 1D6WA 1RRKA 2ZGBH 1O37A 1C4U2 1XMNB 1EUFA 4IW4E 3AAUA 1ARBA 3TK9A 4X1SU 3BTGE 1TA6A 1JRTA 3SGAE 1F5KU 4O9VA 1QIXB 1GI6A 3SBKA 1C5XB 3S9CA 3UIRA 1F7ZA 2A1DB 2O8WA 1EP5A 1O2MA 1EJAA 3I78A 1T7CA 4JCNA 2BD8A 2BDCA 4WXIA 3TK5A 1UTLM 2HNTC 3QO6A 2JETC 3NCLA 4FUIA 1O2GH 2PKAA 1HBTH 1A0JA 1PPZA 4ABHA 3FP7E 6GCHF 4X2XA 1G2MA 3M5LA 4K69A 1K1LA 3ZZ8A 1ELEE 1V2PT 1HFDA 4MLFB 2C3SA 2BVSH 3KHVA 2ZTXA 1L1JA 1ZOMA 2H1UA 3GISB 1O39A 4DG4A 2Q6FA 1K1JA 5EGMA 3MNSA 2ZA5A 1IQGA 3UNQA 2ZGJA 1EPTB 1MZAA 3GY3A 3UNSA 1O2HA 1SLUB 1D3TB 2PFEA 2QIQA 1HXFH 4JK6A 2PR3A 1V2VT 1SC8U 2GCTC 1J8AA 3PTBA 9LPRA 2BXUH 1V2KT 4CRGA 1OP0A 1GDUA 4WH8A 2B7DH 2BLOA 1IQMA 1GI7B 2Y81A 2PUXB 7GCHF 4Y8ZA 2GP9B 1FY8E 2QF0A 3MTYA 4WY3A 2QY0B 3SUEA 2QGRA 3QTVH 2BZ6H 2D2DA 1O3DA 2VWMA 3VXFH 1SGEE 3VB4A 1XKAC 1BRBE 1OPHB 1BMLA 1LQEA 2B9LA 4Q7XA 2RG3A 1L0ZA 1V2JT 5CHAC 1T8MA 4WMEA 1QQUA 3RMNH 3ZVDA 2A0QB 3BTEE 3B9FH 2HNTE 2FS8A 4ZH8A 1LCYA 1AZ8A 1H9IE 3A86A 1O2SA 2OQUA 2QYIA 1TRYA 4MPWA 1QR3E 1IHTH 4K8BA 3V13A 3U1IB 3BV9B 1UVPA 2ZGXH 1ZMLA 3UPEA 4ABBA 4LZ4B 5JDUB 2CMYA 1NC6A 3VB5A 5HGGA 2GGVB 4D9QA 2PHBA 2PTCE 4RKOB 4I8KA 1XXDA 3NXPA 3STIA 2TRMA 3U8RH 1FJSA 3ATLA 1O3AA 1GI4A 2HVXA 2YOLA 1VITG 4UFEH 4ZHLU 2FP7B 4BAHB 1K22H 4XDEA 4FUBA 1W11U 2Y7XA 4AX9H 2JETB 1EOJA 2H6MA 2UUYA 3SJKA 1P01A 1TMBH 1W0ZU 3DHKH 5A8YA 3P92A 2CV3A 5AFYH 1CGIE 2P8OC 5EQRA 4Y8YA 1HJ8A 3SGBE 1QB1A 4ZUHA 1P03A 3GCNA 2RA0A 1G3CA 1PFXC 3S7KB 4HI3A 2XW9A 4ZKOU 1JBUH 1YLCA 1O2WA 4BTIB 4JYVH 2JH6D 2IN2A 2A2XH 1W12U 2O8LA 4X6MA 1O2YA 1GI1A 2Z9LA 3A7TA 2ANYA 1WQSA 2GCTB 2OC8A 1EXFA 1OS8A 3MMGA 1GI8B 2BXTH 1YLDA 3PMJA 3LC5A 1UCYK 2QXHA 2ZU5A 2UUFB 2BD4A 1QCPA 1PYTD 2HPPH 2WUCA 4BAKB 1ELTA 9ESTA 2QAAA 2RDLA 3M3SA 4UE7H 1S84A 1GMDG 2PV9B 4GCHG 1ELAA 4AFUA 3ATIA 4GHTA 4AFZA 1O3HA 4BANB 2SGAA 2BOHB 3UWJH 4Y6DA 1IHSH 1T4VH 4QT8C 8GCHF 1L1GA 3BG4C 3DFJA 4R0IA 2Q1JA 4TWYA 4ZMAH 2RA3A 2ZGCA 2PSXA 5GJ4B 2O8UA 3NKKA 2ZHEH 1SHHB 1WTGH 5CHAB 3CENA 1G30B 1C2FA 3FP8E 4HFPB 2GZ8A 3VB6A 1GI3A 2OQ5A 3U9AH 2Z3EA 5EXLA 3L6PA 3BEFB 3EE0B 2XRCA 1YM0A 1ANCA 2ZTZA 1ZPBA 1TONA 2CHAC 1GHZA 5F8XA 5EQQA 5DK1A 3VPKA 2V6NA 2VIQA 1O3IA 3ZVEA 2AYWA 3KF2A 1HRTH 3RXJA 1TLDA 1BTZA 1TQ7B 1A5GH 3PROA 5CE1A 2YNAA 5LPEA 2WPLS 1OP8A 1NRSH 1OWDA 1YPGH 1DM4B 4BXSA 5FPTA 3ZZBA 3KQEA 1C2LA 1UTNA 1G36A 2VH0A 1ESAA 3GCOA 1GDNA 5DJ7A 2NWNA 1PJPA 4DW2U 1FPHH 1OWKA 4TPIZ 1D3PB 4Y11E 4B2BA 1C5SA 2P8OB 4ABEA 4JMYA 1XXFA 3RC4A 3ZVCA 5GPIB 1BMNH 1THRH 3PMAB 1DICA 3EAJA 2EI6A 1UTPA 3K65B 3K9XB 1NO9H 3RXAA 3URCA 2ZCLP 1ZTLA 2LIZA 1UTOA 1GBDA 1BBRK 4CBNA 2H5DA 1SGRE 2R3YA 1CHOF 1INCA 1O5BB 1OP2A 3L3TA 3TK6A 3LGWA 3BEIB 4ZROA 1W13U 3SUGA 1AUJA 4DIIH 3GY4A 4NIXA 3Q00A 2CXVA 4SGBE 1DY8A 1MKXH 3RC6A 1C1TA 1N6YA 1MU6B 3MNBA 1C5RA 1ZLRA 1EPTA 1ID5H 1XVMA 5F8TA 2J38A 1SB1H 2HRVA 2C90B 3S7HB 4FXGH 2G4UA 1WU1A 1TMUH 1MUEB 1HGTH 3EGKH 2G81E 4ZHMU 2WPIS 3Q76A 2ZHFH 3M5OA 3DFLA 3SORA 3BG4B 1Y3YA 3ZVBA 5A0CA 1O3PB 2OD3B 4NA9H 1O38A 2EC9H 1P05A 3M36A 4GVUA 4X6PA 3RMMH 1YC0A 3T62A 1AQ7A 4X6NA 4CRDA 3UR6A 5TCCA 1WBGB 1NESE 1BRCE 1EASA 2Z9IA 4HGCA 1K21H 2IOTA 1S0QA 3SU3A 1GMHF 4ASHA 4MNWA 2XBYA 1SGFA 1GBKA 2A7JA 3A7ZA 1TGBA 1MU8B 2QF3A 2G5NA 3MO6A 5BPEA 2CHAB 1SGNE 1CSOE 4MNVA 2VIOA 2NU4E 2ZQ1A 1GHYH 3AASA 1XUFA 2SFAA 1SL3A 3V3MA 4ABDA 3MH5A 2FX6A 2BD5A 1TAWA 1L4DA 2G00A 1V3XA 1YYY1 1EQ9A 2WV5A 1TALA 1K28D 2TGTA 1FQ3A 1DX5M 1MTWA 5J4QA 3SJOA 1UK4A 1O5AB 1ZHRA 1WOFA 5ABWA 3UFAA 1WAYB 2ZFQH 1TNIA 3TJOA 3GICB 4A1XA 1FLEE 1KDQB 3OX7U 2I6SA 2R9PA 2J9NA 1QQ4A 2BDGA 3KCGH 2VB0A 3UOPA 1DXPA 1EZXC 4BTUB 3GCHC 1MQ5A 4IN1A 2BHGA 4YTAA 5C2ZA 1A2CH 3RMLH 1KYNA 3KN2A 2ANMH 2QXIA 4I31A 1W7XH 2OCVB 1LO6A 2ZFSA 1LVMA 2AGIX 2ASUB 4Q2KA 4UD9H 1BTUA 1N1LA 2AS9A 1LPKB 1ELFA 3S69A 1AWHB 2VU8E 1PPCE 3ZV8A 1TNHA 1FONA 4FUGA 3SV9A 1NRRH 1FY3A 3H7OA 1ESTA 3SU1A 2XNIA 1HAHH 3SUDA 1F0SA 1BHXF 1UCYH 1C5WB 1CBWC 1DUAA 3LU9B 5JYIA 1UMAH 1YPHC 4U32A 4U2WA 2LPRA 1AU8A 2WPKS 3SZNA 3MU1A 3VFEA 1FXYA 5LPRA 2VIDA 3MU4A 4NZLA 1JMOH 1FIWA 1EB1H 1KXBA 1LKAA 3LOXA 3BTHE 3V0XA 1SMFE 3SO3A 3LKWA 2O8TA 1C5NH 2Z9GA 1V6DA 3L33A 3UUZA 1SQOA 4Y10E 5A0BA 2HLCA 1AHTH 1Z8JB 2ZHQH 1A7SA 1HAZB 1Y3WA 2VIVA 3QX5H 3MO9A 3U69H 3RU4D 3UWIA 3KL6A 4CREA 3FZDA 2WYGA 3RXFA 4HTCH 2FM2A 3T5FH 2BD3A 1SVPA 3HPTB 2BVRH 3MYWA 2BLWA 1HDTH 1N8OC 4AOQA 2FTLE 3P95A 1GBLA 1UTJA 3UY9A 1MH0A 1O3OA 4ABGA 1HAOH 4ISHH 1O3FA 1TB6H 2NU1E 4NSYA 1H8DH 4IMZA 5EW1H 1Z1JA 1FN6A 5FCRA 2P95A 3P70B 3UREA 5A2MH 3U8TH 4OS5A 3PM3A 2F9UA 3MNXA 5GCHG 4Z6AH 1UVTH 1UTMA 4PROA 4UFDH 1E37B 1FY5A 4DT7B 1S5SA 2VIWA 3O8BA 1IAUA 5K0HA 3TVJB 2A32A 2GCHG 3NPSA 4ABAA 3GCHB 4D76A 4BXWA 4ZXXH 5A09A 1P10A 2YNBA 1O34A 1GHBF 1P2OA 1MMJN 1QBVH 3ZZ9A 3RXBA 2BX3A 4YOIA 2FOMB 2GV6A 1V2OT 4H6TA 4Y71A 1TGTA 4WVPE 1C1QA 1BBRH 1GI2A 1YPHE 1TPAE 4E7RG 4X0WU 4MPUA 4BNRA 5BRRE 4LK4A 1THPB 2BD7A 1O2TA 1B7XB 1GL0E 4Y8XA 3QWCH 2KAIB 3BN9A 3G01A 1FAKH 2GV7A 1W2KH 4KTCA 1QRZA 1VR1H 3LC3A 3QTOH 1L2EA 2A5AA 1E34B 1GG6C 1NFYA 1GVLA 1GVKB 1XKBC 7ESTE 3BTWE 3HGNA 4OS4A 1UVOA 4M7GA 1CBWB 1P2QA 1P8VC 2TGAA 4E7NA 3ZZ6A 3RXRA 2G51A 2Z9JA 1LTOA 2P93A 3SUFA 3T27A 1GI0A 3RXOA 7KMEH 4AB9A 1X7AC 2OC7A 2SNVA 5L6NH 3GDUA 4XBDA 1UTQA 3P17H 1EX3A 3LGYA 2ZU4A 4DURA 1DE7H 3K2UA 2FI5E 2EEKA 3O8CA 1J17T 1TGSZ 2P3TB 4GSOA 5JB9S 3EA7A 1P02A 2J4IA 3NWUA 3QK1A 1AD8H 1V2UT 2ZFRH 3LGVA 1U6QA 1N8OB 3FVFB 1C1PA 3K6ZA 3A82A 2ZDMA 2ULLA 6LPRA 1G2LA 4JYTA 1QHRB 1JOUB 1D3QB 1DOJA 4H6SB 1LPGB 1RJXB 4AN7A 1MCVA 3TITA 1O3KA 4BOHA 1V2WT 3RXMA 2STAE 2GMTB 3GCTG 4FUEA 3EA8A 2DUCA 1ZTKA 2ZDAH 2XYAA 2WV4A 1F0RA 3M7QA 2EI8A 1MKXK 1ZPCA 2RCEA 2Z9KA 1MCTA 3LGTA 1RTKA 2VVVA 1GBFA 1KXDA 3A8CA 3H5CB 4XE4A 1KDQA 1BTYA 1C5PA 4AGJA 3UQOA 2WINI 4NIYA 5EXNA 3A8AA 1ABJH 1ANEA 1QB9A 2Q6DA 1H4WA 1IQNA 2PGBB 1RS0A 3M5MA 3QN7A 5IYTA 5JB8S 1W7GH 3A7YA 1KLJH 1HIAB 1ABIH 1VJAU 1CT4E 2ZDKA 5FXLA 4D7GA 1HV7A 3ELAH 4OGYA 4FVBA 1ZJDA 4Y0YE 2GT8A 1TNLA 2ZC9H 3HK3B 4FUCA 4NCYA 2ILNA 3VB3A 2AGGX 1YPMH 4X8UH 2W7SA 1GG6B 4KGAA 2NU3E 4BTTB 1RXPA 2VH6A 5C20A 1GI5A 1K1NA 1OWJA 3MU5A 4H4FA 5JPMH 3BF6H 1NM6A 2Y82A 4X1PU 1V2ST 1Y8TA 5A8XA 2FOGA 4FVDA 1WCZA 5H4IB 1XUHA 3V7TA 1W0YH 1ANBA 1C2IA 4XBBA 5K7RA 4X6OA 1YKTA 2ZU1A 2H5CA 5DP6A 1T8NA 5DG6A 1TNJA 5AFZH 1C5YB 4MNXA 3Q3XA 1DS2E 2P94A 1BQYA 1C5OH 1AVXA 1GBMA 2OLGA 1PPEE 4AGKA 4B74A 1GDQA 1G9IE 1GJ5H 5DP4A 3O8DA 1G3DA 1NTPA 1BITA 1YBWA 2ZCKP 1ETSH 4JZDH 2C93B 3A89A 1NROH 1C2MA 2K7XA 1J9CH 5C5NA 1IOEA 1SQTA 3DD2H 1YPLH 1EZSC 3MHWU 3OU0A 4I33A 1YF4A 2QA9E 5F03A 3F9GA 3IG6B 1XUJA 1DWCH 1KLTA 3EYDA 3RXGA 1CE5A 2CF8H 2ZGHA 3HKIB 1BTWA 5EXMA 2H9EH 4NFFA 1F0TA 1WSSH 1TIOA 1BJUA 3BTQE 3CS7A 4B1TA 1P0SH 5E0HA 3V12A 5I46H 4AB8A 1N6XA 3LGUA 2BLQA 3W95A 2PGQB 5FPYA 1GGDB 2XCNA 1GBBA 3GY5A 1GBTA 1CHGA 3WY8A 2ZFFH 1HJAB 1AI8H 1S6FA 1SLWB 1ZTJA 1MTNC 2FLRH 3U98H 1NN6A 3ITIA 1O2NA 2DE9A 2VIPA 1TE0A 1LDTT 1Z8IB 1BTXA 2FI3E 4DOQA 3SI4H 1QL9A 3EQ0H 4JZFH 2ZDVH 3ZZ7A 1A0LA 1ZMNA 1O2OA 3BG8A 3VGCC 1XX9A 1IQFA 1P12E 3KQCA 1TOMH 2C8WB 5EODA 2FOAA 3C27B 1SOTA 3RLWH 1O2XA 5AHGH 5EG4A 2J95A 3A84A 3UQVA 3RXUA 1TOCB 2FX4A 1AZZA 2BQWB 2G52A 3LH3A 2KAIA 3A85A 2HNTF 5DP3A 3BTME 2QN5T 1O32A 2BDAA 3TJUA 2FODA 1DSTA 2VWLA 3IWMA 3D49H 3JZ1B 1ZGIA 2A4QA 2FZZA 3A83A 2UUKB 1TPSA 1NS3A 2B5TB 1H9HE 1GHAG 4FUFA 2ZO3H 1HUTH 3LJJA 1T8OA 3SQEE 1C5UA 1THSH 2QXJA 1HNEE 5ESTE 1C1OA 1ZRKA 4Y79A 4X2WA 1TQ0B 1O3EA 4KTSA 1EOLA 2G55A 1NFUA 2XBWA 4FUHA 1BCUH 1GCDA 2ZP0H 2Y5HA 1Y5AT 4YZUA 3MH6A 1QBNA 2TBSA 1W10U 1LHGH 1UVSH 3ZVFA 4Z0KA 1NU9A 1VCPA 4TPYA 3M35A 4SGAE 2BLVA 3S0NA 1SG8B 5E0JA 4ZHAA 2BDBA 2D1JA 4I8GA 1C4Y2 1QA7A 1QURH 2FPZA 4NGAH 1VJ9U 2SGFE 4K1EA 1C2EA 1HLTH 3FANA 1Z6JH 1UJ1A 3B23B 3A80A 2WPJS 2C4FH 4Y0ZE 5IDKA 2STBE 4ISOA 1M9UA 3MWIU 1MTNB 1ANDA 1CA0C 3VEQB 2Z3DA 1LHFH 3ZYDA 5SGAE 1YPKH 1OKXA 4ABJA 2BZAA 1PPGE 3QUMP 3ZV9A 4THNH 1NY22 1LKBA 2BMGB 3VGCB 1FY1A 1KLIH 1MTUA 3TIUA 2OBOA 3PMHB 4Y7AA 4BAMB 1C9TA 1HIAA 1FMGA 1AO5A 1RGQA 4CRBA 4VGCC 1P2MA 2ZHWH 2AEIH 1UCYE 1EAUA 1TX7A 1MD7A 3S9AA 5GDSH 1GWAA 4WXVA 1VCWA 2AIPA 1LVBA 1Q3XA 4JYUH 1AE5A 1SGTA 2SGEE 3MFJA 1SGIB 1P04A 4LOYH 1YCPK 1T31A 3E1XB 1VITF 1O2VA 2JH5D 1GJDB 1BMAA 3ENSB 3ESTA 3PYHA 1DLKB 3I77A 4YT7H 5EPYA 5HMAA 4BAQB 4O3UA 1H1BA 2F9OA 1FI8A 2QXGA 1FIZA 1K9OE 3E90B 1GJ7B 2J34A 1K1PA 1Y59T 2OBQA 5J4SA 1A5HA 1GHVH 3M37A 3M3VA 1SHYA 1PPFE 1EJNA 1O31A 2Y5FA 1PQ5A 2AIQA 2ALPA 4X2VA 3TH2H 1C1MA 2BY8X 2FOCA 4AZ2B 2AERH 2W26A 1Z7KA 2CF9H 4K1SA 5HXFA 2P16A 1TGNA 1G32B 2P3FH 2CJIA 2FEQH 1GBIA 2BYAX 3BIVH 4U30A 2Y5GA 1GL1A 2FO9A 1TPOA 1BHXB 1RFNA 2DE8A 2WPHS 4K60A 2BY7X 4I32A 4WJG2 1MAYA 2GKVE 1EAWA 2VVCA 1O3GA 1HAYB 1OSSA 2IJOB 1BB0B 1XUGA 1WQVH 1SGDE 4GCHF 1CA0B 1CT2E 3SU2A 2ZU2A 1A46H 4FU7A 2QV1A 3ZZDA 1GPZA 1BRAA 4K8YA 1BJVA 4NG9H 4BAOB 4MNYA 1UO6A 3RC5A 4GLYA 1C5QA 1QA0A 1AKSB 1BBRE 3RXLA 1OOKB 1HAPH 2XWAA 2XC5A 2P3UB 4AYYB 2A2QH 4ISLA 5C67A 1DLEA 2Y6TA 2FTMA 1O5EH 3SU6A 3UNRA 5AVDA 1AFQC 4VGCB 3PLPA 6GCHG 3RP2A 4D7FA 5EQSA 5G4BA 3D62A 1B5GH 3EBNA 1YPJH 1P9UA 3ATMA 1OXGA 3RM0H 2SGQE 4IC6A 1J14A 4OS6A 1GBCA 2ZCHP 4MG3A 1H9LB 3CP7A 3Q3KA 3ZVGA 1MTSA 3SU5A 4B76A 1ESBA 1KTTB 1TBRH 1TA2A 5DP5A 2Y7ZA 1FAXA 1SQAA 4NA8A 3A7WA 5A0AE 2ZHDA 4J2YB 3GYMA 2AGEX 1JXPA 3MU8A 4Q80A 2HWLB 3QGJA 1K2I1 3SNCA 1O3JA 1QY6A 3P6ZB 2SGPE 3RUOA 2ODPA 5GWZA 4A1VA 4DGJA 2B0FA 3QZQA 1A4WH 2J92A 5EOKA 2PTNA 4ZAEA 4WMDA 2ODYB 3IITA 3SU4A 2VJ1A 1O36A 2ZNKH 1GCTB 2XXLA 1SOZA 4YLUA 1ZZZA 3SHAH 1ORFA 7GCHG 2F83A 3LT3A 4U01A 1V2QT 1AVGH 1O2QA 2A4RA 3RXCA 3LIWA 3BTTE 1EB2A 1ZSLA 1QNJA 1XUIA 1ETTH 4Q7ZA 1OWEA 3TJNA 1IQJA 2OUAA 4NA7A 1BDAA 4DCDA 1S83A 1J15A 4NZQA 3PWCA 2GMTC 2P59A 1C2GA 2F9BH 3FFGA 1IQHA 1TX6A 3DT0H 2XC4A 3KQDA 5FAHA 1F0UA 4Y76A 1LPZB 1G37A 5L2ZH 3PB1E 1ZYOA 1NZQH 2G4TA 5E8EH 2OC1A 4A7IB 1CA8B 2CGAA 3U1JB 2UWLA 1C1VH 1QL8A 3HKJB 1HAXB 4O97A 2UUJB 1DT2A 3STJA 2A7HA 3BTKE 1RD3B 3GY2A 2GX4A 3F9EA 3RXVA 3EDXB 1Z1IA 3P8GA 1HCGA 2AMPA 5C3NA 1P3CA 1LVYA 2A31A 2FOHA 1TYNA 1S0RA 4ZKNU 2TGPZ 1QFKH 1EAIA 4Q7YA 2R0LA 2XWBI 1AFQB 1TNGA 4D8NA 2W7UA 3UR9A 6ESTA 3MNCA 1T32A 4UONA 1Y3XA 5GIBA 4NIWA 1TGCA 3P8FA 4NSVA 3O8RA 1LHEH 1ELGA 5L30H 4X2YA 4TWWA 3PO1B 2ZFPH 3A87A 4INLA 5LH8A 2M5TA 1O3BA 5ETXA 4GHQA 1DPOA 3JZ2B 5ESBA 4DVAU 4MTBA 5L2YH 1TWXB 2BB4A 3HGPA 1HAIH 1SGCA 3SV8A 4KELA 1EJMA 5F6MA 3TJVA 5FCKA 1TRNA 3ODFA 3Q77A 4FU9A 1DUEA 3RMOH 3D65E 4JK5A 1CO7E 1F5RA 1GJ4H 1LHCH 1YCPH 3SV6A 1O5CB 2HPQH 2AFQB 3BEUA 5TJXA 5C1YA 2C8XB 4CHAB 3KGPA 4Y7BA 5HM2A 2AMQA 3C1KA 2A5IA 1FDPA 1H8IH 2PSYA 8GCHG 1AB9B 5FX5A 4INHA 1SR5C 3E6PH 3TPIZ 1OYQA 4IMQA 1IQLA 2FIRH 5FX6A 3R0FA 2R0KA 1QL7A 2UWOA 2FMJA 1E35B 1ZPZA 1C5VA 2V3HH 3PWBA 2GT7A 1W8BH 4RN6A 2ZPQA 3RXEA 4TY7A 4FU8A 2BD2A 4LZ1H 1YPEH 1C5TA 1W14U 2K1QA 1SGPE 1GGDC 5I25A 2ZKSA 1BOQA 1TX8A 1GJ6A 1AE8H 1GBEA 1V2NT 1DWBH 3LGIA 2R3UA 1OWHA 1SGYE 3LJOA 1HJAC 2OTVA 4KKDA 4X8VH 3VXEH 3GYLB 1TMTH 4TY6A 1AUTC 1YP9A 1EATA 7LPRA 1GI9B 1SFIA 1G3BA 1C5MD 2ZPRA 3F6UH 2ZTYA 1IQKA 1O2UA 2BY5X 4CBOA 4MDSA 2FOBA 3CS0A 4HZHA 2ZPSA 2A4GA 2NU0E 2JKHA 4XFQA 1A3BH 1AKSA 3NUMA 6CHAC 1P9SA 3LDXH 4MPXA 4WF8A 1BMMH 4LXBH 3TH4H 1A3EH 1VCQA 1SLVB 1GHWH 2PWXA 4RSPA 1S81A 1QTFA 1Q2WA 3URDA 1LVOA 3FAOA 2ZDLA 1NRQH 1NPMA 1JRSA 2FOFA 1ZMJA 4KTUA 3TGKE 3U8OH 1CHOG 3TNTA 5FBIA 1C1SA 1OX1A 2ANKH 3QGNB 3B8JA 2W5EA 4OS7A 3ZZ4A 1V2RT 3AW0A 3HK6B 2G5VA 1A0HB 3A8DA 4A1TA 1HYLA 1DXWA 1HAGE 1S82A 1TNKA 2OC0A 3AW1A 1XVOA 4JZ1A 4YLQH 2O9QA 2Z3CA 5GCHF 2XBXA 1L1NA 1W3CA 5JBAS 1K1IA 1UHBA 4KP0A 4OGXA 3BSQA 1EZQA 2ALVA 8KME2 2GCHF 1Y5UT 1RIWC 1O30A 1FUJA 3SJ8A 1GHXH 1QBOA 1ELDE 3T29A 1O5GH 5AF9H 3KEEA 1O3CA 5DKMA 1Z6EA 1GJAB 2ZIQH 2FOEA 1Y3VA 1O2IA 5T6DA 4RKJB 1PYTC 1TBQH 2F91A 3QZRA 4IN2A 1AN1E 1C2JA 2BOKA 4O3TA 1GMHG 1OWIA 1GJBB 3F9FA 1Q31A 1C4V2 1BA8B 3KIDU 4INKA 2WUBA 3QLPH 1NU7B 1Z8GA 1KXEA 1EKBB 1WYKA 3BTFE 2F9NA 5E2OA 1O2KA 3MOCA 1HPGA 5JBBS 1T8LA 1GMCF 1L4ZA 2D8WA 5DO4H 3LH1A 2EA3A 2WPMS 2Z94A 2ZQ2A 3RM2H 2A4OA 1P11E 1SI5H 1S6HA 1FZZA 1VZQH 2J2UA 6CHAB 2FXRA 1RTFB 4MPVA 1FPCH 2J94A 1D6RA 1ACBE 2ZECA 1SLXB 1QB6A 3GDSA 1O0DH 5FBEA 1TABE 3SI3H 2BD9A 2GZ7A 4CR9A 1LMWB 4R8TB 3T26A 1DVAH 5EW2H 2FWWA 2Y80A 3PV4A 3E0NB 1ZRBA 2ZU3A 3P8NA 1MKWK 1CT0E 2F3CE 2PLXA 1A61H 5GXPA 1DY9A 1Y3UA 2VGCC 3E8LA 1UTKA 1GBJA 1GJCB 2LNCA 2XC0A 4B71A 1P57B 1NT1A 3SW2B 1FNIA 4D9RA 4ISIH 3TNSA 1UK2A 1TBZH 3SNBA 4YOJA 2GDEH 3GCTF 3GY7A 4AG1A 3BIUH 1BT7A 1FY4A 3RXPA 1LQDB 3OYPA 3W94A 3E16B
chains in the Genus database with same CATH superfamily
1P09A 2BDHA 3TGJE 1C5ZB 4I8JA 4X8TH 5DGJA 5B6LA 4X1RU 1RIWB 1MD8A 1IQIA 2OXSA 3E91A 1YGCH 3SQHE 1O2RA 1MTVA 1ZJKA 4GPGA 2GDDA 4CR5A 1ZHPA 3ZZCA 3LPRA 2TIOA 4UDWH 5FHTA 1FN8A 4WH6A 2KFWA 1D3DB 2C8YB 2YMSD 4WWYA 1OYTH 2VNTA 4F49A 1Z71A 2VWOA 2PKSC 4GAWA 4ABIA 3DUXH 3AK5A 1DWDH 2FESH 3GDVA 2HOBA 1C1UH 1TFXA 2ZFTA 1QJ1B 3I29A 3RXTA 3M3TA 1E0FD 2OP9A 5KECA 4B73A 4X1QU 1JIRA 4XBCA 4IC5A 5E2PA 5EIYA 5HM9A 2AMDA 4A92A 2ODQA 1HXEH 1DDJA 1MQ6A 3ZZ3A 4NFEA 8LPRA 1P2KA 1VGCC 5LGOA 4DIHH 5EU8A 4CRCA 2ZEBA 1P06A 2HALA 4OS2A 1SFQB 4FUDA 1MAXA 1Y5BT 1DSUA 4DY7B 2V35A 4ZXYH 3UTUH 3E0PB 1BTHH 2BDYA 1HAVB 1V2TT 2VVUA 2B8OH 5C1UA 1YWUA 4XOJA 1O33A 1KXAA 4CH2B 3ZYEA 2PUQH 3AAVA 1DITH 1WTHD 2ZWLH 1C9PA 1KSNA 2THFB 2A7CA 2H9TH 3SHCH 4AG2A 3R3GB 1XUKA 2BQ7B 3RXIA 1ZGVA 3RXSA 1AIXH 1C2HA 2Z7FE 2QC2A 4IGDA 4TYDA 2CN0H 3A7XA 1BZXE 4A5TS 3SV2H 1GHBG 3TU7H 2VGCB 2A45B 3SV7A 5HYOA 4AORA 2PW8H 5PTPA 1ELBA 4XSKU 1O2PA 3SN8A 4RI0A 1HJ9A 1GJ8B 4B75A 1TRMA 1WUNH 1BIOA 3OSYA 4NIVA 1SPJA 2FI4E 1SSXA 3DA9B 2AH4X 1F5LA 1QJ6B 2W3KA 1C2KA 2EI7A 2XBVA 1C1RA 2IPHA 4K5ZA 1GBHA 5A8ZA 3VB7A 5DP9A 1GVZA 2BM2A 1C5LH 1GCTC 2BVXH 1LHDH 2F9PA 2ZF0H 4ESTE 4MQAA 1CVWH 3F9HA 2BX4A 1G3EA 1UVUH 3MH7A 2QF4A 1SGQE 3RXDA 1NRNH 3QDZB 2G8TA 3DSOA 1VITH 1SBWA 2FS9A 4I7YH 1WV7H 3M7UA 3PTNA 3GOVB 3F68H 1BUIA 2PKSB 1GJ9B 1PQ7A 1W0KD 2PKAB 1EZUC 2IPQX 1CU1A 2ESTE 2SGDE 3SJ9A 2JH0D 1NFXA 3UOUA 3A88A 1B0EA 5JBCS 3FZZA 2A5KA 2ANWA 4I86A 5T6FA 1MBMA 1A1RA 4I8LA 1GMDF 3PLKA 3SJIA 1AGJA 1EP6A 1S85A 1E38B 1V2LT 2HGTH 1D9IA 1RTLA 1VGCB 1ZSKA 2BY9X 2D26C 3SNAA 1J16A 4K3JA 2VINA 3D23A 3E3TA 5B6OA 1C1WH 1O3LA 2WHXA 4K2YA 1KTSB 4X8SH 5T6GA 3ZVAA 4AFSA 1UK3A 3HATH 1F92A 1GBAA 1NFWA 3ATWA 1AFEH 1K0HA 1GHAF 2SNWA 4JZIA 1ELCA 5TCAA 3RXQA 3W1EA 3KNXA 3TH3H 3SNEA 1O2ZA 1QGFA 1Z8RA 1F2SE 1PPBH 5F8ZA 4FUJA 1C2DA 4OS1A 5CMXH 1AVWA 1PPHE 2TGDA 4UFGH 3EA9A 3Q3YA 1ZHMA 4GUXA 1DANH 2FLBH 3S9BA 4MVNA 3PO1C 4NWKA 8ESTE 2H2ZA 2V3OH 2ZDNA 3FOAA 1XM1A 1P2JA 2GTBA 1V2MT 5E0GA 4WMFA 4CH8B 2TPIZ 2Q6GA 1KXFA 3NK8A 3NZIA 5FPSA 2QCYA 1KXCA 1QRWA 5CHBA 1UHBB 3K6YA 1ETRH 2W3IA 1B0FA 2VWNA 2GZ9A 4DJZB 3PLBA 2BQ6B 4J1YA 3OAAD 2FYRA 5EPNA 4O03A 1MKWH 2O8MA 3RLYH 4ISNA 3T2NA 1DWEH 3A8BA 3FP6E 2XCFA 4YESB 4CRFA 1O2LA 2XNDD 5C5OA 3OY6U 2V0BA 4F4OC 4YM9A 3ATKA 3BTDE 3GY8A 1ELVA 2H9HA 3LONA 4CHAC 1E36B 1CGHA 4NWLA 3MU0A 1QRXA 5DP8A 2F9VA 1AB9C 1O2JA 2ZZUH 1A5IA 1C1NA 4IS5A 1HB0B 1ZSJA 3GY6A 3SU0A 1NRPH 3KQBA 3M5NA 5EJLA 4I8HA 1K1MA 3RXKA 3TGIE 1T4UH 2R2WU 3M7TA 3M61U 4JZEH 2Z6BD 1MZDA 1KIGH 3OEED 3OY5U 3MQKC 4UEHH 2BDIA 3ZZAA 1DFPA 2ZI2H 3PMBB 3F1SB 2UWPA 2F4LA 2FDAA 3SGQE 3OE7D 4UFFH 2FYQA 2ZG0H 4ZKSU 1TPPA 2GD4B 3ODDA 3RU4E 2GVFA 1P2IA 1BTPA 2WYJA 3MH4A 4H42U 3T28A 1EAXA 1AWFH 1QJ7B 3TLOA 3MI4A 4IBLH 4X1NU 3T25A 1YCPM 1JWTA 4YO9A 5LPFA 1ARCA 1O3NA 1CGJE 3P8OA 5DPAA 5DSFA 4ABFA 3RU4T 2NU2E 1AY6H 3SOSA 4A6LA 1JIMA 3ZZ5A 1D4PB 3N7OA 1EPTC 2F43B 1P2NA 4CRAA 2I6QA 5DP7A 4B2AA 4B2CA 1FV9A 2C8ZB 1ZR0A 4P02A 4ZKRU 1HAVA 2BY6X 5GNDA 4E05H 5JBTA 1O35A 4YOGA 1PQAA 3RXHA 3A7VA 1P3EA 4E06H 3AVZA 4YT6H 4AYVB 2CK3D 3MO3A 1O3MA 1E1QD 2BTCE 3H7TA 1SGFG 1AMHA 2OINA 1MBQA 2R2MB 2XTTB 1KY9A 3SNDA 3A81A 1O5FH 1O5DH 5T3HA 1K1OA 1GMCG 1PQ8A 1IQEA 3RDZA 5C1XA 1BRUP 4K1TA 3OTJE 1CQQA 4AFQA 1D6WA 1RRKA 2ZGBH 1O37A 1C4U2 1XMNB 1EUFA 4IW4E 3AAUA 1ARBA 3TK9A 4X1SU 3BTGE 1TA6A 1JRTA 3SGAE 1F5KU 4O9VA 1QIXB 1GI6A 3SBKA 1C5XB 3S9CA 3UIRA 1F7ZA 2A1DB 2J97A 2O8WA 1EP5A 1O2MA 1EJAA 2KX4A 3I78A 1T7CA 4JCNA 2BD8A 2BDCA 4WXIA 3TK5A 1UTLM 2HNTC 1BMFD 3QO6A 2JETC 3NCLA 4FUIA 1O2GH 2PKAA 1HBTH 1A0JA 1PPZA 4ABHA 3FP7E 6GCHF 4X2XA 1G2MA 3M5LA 4K69A 1K1LA 3ZZ8A 1ELEE 1V2PT 5F53A 1HFDA 4MLFB 2C3SA 2BVSH 3F2HA 3KHVA 2ZTXA 1L1JA 1ZOMA 2H1UA 3GISB 3DSGA 4XD7D 1O39A 4DG4A 4ASUD 2Q6FA 1K1JA 5EGMA 3WWBA 3MNSA 2EY4C 2ZA5A 1IQGA 3UNQA 2ZGJA 1EPTB 1MZAA 3GY3A 3UNSA 1O2HA 1SLUB 1D3TB 2PFEA 2QIQA 1HXFH 4JK6A 2PR3A 1V2VT 1SC8U 2GCTC 1J8AA 3PTBA 9LPRA 2BXUH 1V2KT 4CRGA 1OP0A 1GDUA 4WH8A 2B7DH 2BLOA 1IQMA 1GI7B 2Y81A 2PUXB 7GCHF 4Y8ZA 2GP9B 1FY8E 2QF0A 3MTYA 4WY3A 2QY0B 3SUEA 2QGRA 3F2GA 3QTVH 2BZ6H 2D2DA 1O3DA 2VWMA 3VXFH 1SGEE 3VB4A 1XKAC 1BRBE 1OPHB 1BMLA 1LQEA 2B9LA 4Q7XA 2J98B 2RG3A 1L0ZA 1V2JT 1H8ED 4TT3D 5CHAC 1T8MA 4M9FA 4WMEA 1QQUA 3RMNH 3ZVDA 2A0QB 3BTEE 3B9FH 2HNTE 2FS8A 4ZH8A 1LCYA 1AZ8A 1H9IE 3A86A 1O2SA 2OQUA 2QYIA 1TRYA 4MPWA 1QR3E 1IHTH 4K8BA 3V13A 3U1IB 3BV9B 1UVPA 2ZGXH 1ZMLA 3UPEA 4ABBA 4LZ4B 5JDUB 2CMYA 1NC6A 3VB5A 5HGGA 2GGVB 4D9QA 2PHBA 2PTCE 4RKOB 4I8KA 1XXDA 3NXPA 3STIA 2TRMA 3U8RH 1FJSA 3ATLA 3UAIC 1O3AA 1GI4A 2HVXA 2YOLA 1VITG 4UFEH 4ZHLU 2FP7B 4BAHB 1K22H 4XDEA 4FUBA 1W11U 2Y7XA 4AX9H 2JETB 1EOJA 2H6MA 2UUYA 3SJKA 1P01A 1TMBH 1W0ZU 3DHKH 5A8YA 3P92A 2CV3A 5AFYH 1CGIE 2P8OC 5EQRA 4Y8YA 3VG8A 1HJ8A 3SGBE 1QB1A 4ZUHA 1P03A 3GCNA 2RA0A 1G3CA 1PFXC 3S7KB 4HI3A 2XW9A 4ZKOU 1JBUH 1YLCA 1O2WA 4BTIB 4JYVH 2JH6D 2IN2A 2A2XH 1W12U 2O8LA 4X6MA 1O2YA 2KM0A 2L74A 1GI1A 2WV9A 2Z9LA 3A7TA 2ANYA 1WQSA 2GCTB 2RFKC 2OC8A 1EXFA 1OS8A 3MMGA 1GI8B 2BXTH 1YLDA 3PMJA 3LC5A 1UCYK 2QXHA 2ZU5A 2UUFB 2BD4A 1QCPA 1PYTD 2HPPH 2WUCA 4BAKB 1ELTA 9ESTA 2QAAA 2RDLA 3M3SA 4UE7H 1S84A 1GMDG 2PV9B 4GCHG 1ELAA 4AFUA 3ATIA 4GHTA 4AFZA 2KCAA 1O3HA 4BANB 2SGAA 2BOHB 3UWJH 4Y6DA 1IHSH 1T4VH 4QT8C 8GCHF 1L1GA 3BG4C 3DFJA 4R0IA 2Q1JA 4TWYA 4ZMAH 2RA3A 2ZGCA 2PSXA 5GJ4B 2O8UA 3NKKA 2ZHEH 1SHHB 1WTGH 5CHAB 3CENA 1G30B 1C2FA 2JDID 3FP8E 4HFPB 2GZ8A 3VB6A 1GI3A 2OQ5A 4AC9A 3U9AH 2Z3EA 5EXLA 3L6PA 3BEFB 3EE0B 2XRCA 1YM0A 1ANCA 2WSSD 2ZTZA 1ZPBA 1TONA 2CHAC 1GHZA 5F8XA 5EQQA 5DK1A 3VPKA 2V6NA 2VIQA 1O3IA 3ZVEA 2AYWA 3KF2A 1HRTH 3RXJA 1TLDA 1BTZA 1TQ7B 1A5GH 3PROA 5CE1A 2YNAA 5LPEA 2WPLS 1OP8A 1NRSH 1OWDA 1YPGH 1DM4B 2HLDD 4BXSA 5FPTA 3ZZBA 3KQEA 1C2LA 1UTNA 1G36A 2VH0A 1ESAA 3GCOA 1GDNA 5DJ7A 2NWNA 5FL7D 1PJPA 4DW2U 1FPHH 1OWKA 4TPIZ 1QZ8A 1D3PB 4Y11E 4B2BA 1C5SA 2P8OB 4Q4LA 4ABEA 4JMYA 1XXFA 3F3BA 3RC4A 3ZVCA 5GPIB 1BMNH 1THRH 3PMAB 1DICA 3EAJA 5DN6D 2EI6A 1UTPA 3K65B 3K9XB 1NO9H 3RXAA 3URCA 2ZCLP 1ZTLA 2LIZA 3OFND 1UTOA 1GBDA 1BBRK 4CBNA 2H5DA 2WPDD 1SGRE 4F55A 2R3YA 1CHOF 1INCA 1O5BB 1OP2A 3L3TA 3TK6A 3LGWA 3BEIB 4ZROA 1W13U 3SUGA 3GS9A 1AUJA 4DIIH 5IK2D 3GY4A 4NIXA 3Q00A 2CXVA 4SGBE 1DY8A 1MKXH 3RC6A 1C1TA 1N6YA 1MU6B 3MNBA 1C5RA 1ZLRA 1EPTA 1ID5H 1XVMA 5F8TA 2J38A 1SB1H 2HRVA 2C90B 3S7HB 4FXGH 2G4UA 4RT0A 5EJ1A 3N99A 1WU1A 1TMUH 1MUEB 1HGTH 3EGKH 2G81E 4ZHMU 2WPIS 3Q76A 2ZHFH 3M5OA 3DFLA 3SORA 3BG4B 1Y3YA 3ZVBA 5A0CA 1O3PB 2OD3B 4NA9H 1O38A 3F0OA 3KYGA 2EC9H 3NRLA 1P05A 3M36A 4GVUA 4X6PA 3RMMH 1YC0A 3T62A 1AQ7A 4X6NA 4CRDA 3UR6A 5TCCA 1WBGB 1NESE 1BRCE 1EASA 2Z9IA 4HGCA 1K21H 2IOTA 1S0QA 5KGOA 1GMHF 2W6JD 3SU3A 4MNWA 2XBYA 4ASHA 1SGFA 1GBKA 2A7JA 3A7ZA 1TGBA 1MU8B 2QF3A 2G5NA 3MO6A 2J98A 5BPEA 2CHAB 1SGNE 1CSOE 4MNVA 2VIOA 2NU4E 2ZQ1A 1GHYH 3AASA 1XUFA 2SFAA 1SL3A 3H09A 3V3MA 4ABDA 3MH5A 2FX6A 2BD5A 1TAWA 1L4DA 2G00A 1V3XA 1YYY1 1EQ9A 2WV5A 1TALA 1K28D 2TGTA 1FQ3A 1DX5M 1MTWA 5J4QA 3SJOA 1UK4A 1O5AB 1ZHRA 1WOFA 5ABWA 3UFAA 1WAYB 2ZFQH 1TNIA 3TJOA 3GICB 4A1XA 1FLEE 1KDQB 3OX7U 1E79D 2I6SA 2R9PA 2J9NA 1QQ4A 2BDGA 2GJGA 3KCGH 2VB0A 3UOPA 1DXPA 1EZXC 3KQ5A 4BTUB 3GCHC 1MQ5A 4IN1A 2BHGA 4YTAA 5C2ZA 1A2CH 3RMLH 1KYNA 3KN2A 2ANMH 2QXIA 4I31A 1W7XH 2WZQA 2OCVB 1LO6A 3FN8A 2ZFSA 1LVMA 2AGIX 2ASUB 4Q2KA 4UD9H 1BTUA 1N1LA 2AS9A 1LPKB 1ELFA 3S69A 1AWHB 2VU8E 1PPCE 3ZV8A 1TNHA 1FONA 4FUGA 2J5UA 3SV9A 1NRRH 1FY3A 3H7OA 3KYFA 1ESTA 3SU1A 2XNIA 1HAHH 3SUDA 1F0SA 1BHXF 1UCYH 2M2AA 1C5WB 1CBWC 1DUAA 3LU9B 5JYIA 1UMAH 1YPHC 4U32A 4U2WA 2LPRA 1AU8A 2WPKS 3SZNA 3MU1A 3VFEA 1FXYA 5LPRA 2VIDA 3MU4A 4NZLA 1JMOH 1FIWA 1EB1H 1KXBA 1LKAA 3LOXA 3BTHE 3V0XA 1SMFE 3SO3A 3LKWA 2O8TA 1C5NH 2Z9GA 1V6DA 3L33A 3UUZA 1EFRD 1SQOA 2V3MA 4Y10E 2HLCA 5A0BA 1AHTH 1Z8JB 2ZHQH 1A7SA 1HAZB 1Y3WA 2VIVA 3QX5H 5HKKD 3MO9A 3U69H 3RU4D 3UWIA 3KL6A 2XOKD 4CREA 3FZDA 2WYGA 3RXFA 4HTCH 2FM2A 3T5FH 2BD3A 1SVPA 3HPTB 2BVRH 3MYWA 2BLWA 1HDTH 1N8OC 4AOQA 2FTLE 3P95A 1GBLA 1UTJA 3UY9A 1MH0A 1O3OA 4ABGA 1HAOH 4ISHH 1O3FA 1TB6H 2V7QD 2NU1E 4NSYA 1H8DH 4IMZA 5EW1H 1Z1JA 1FN6A 5FCRA 2P95A 3P70B 3UREA 5A2MH 3U8TH 4OS5A 3PM3A 2F9UA 3MNXA 5GCHG 4Z6AH 1UVTH 1UTMA 4PROA 4UFDH 1E37B 1FY5A 4DT7B 1S5SA 2VIWA 3O8BA 1IAUA 5K0HA 3TVJB 2A32A 2GCHG 3NPSA 1H8HD 4ABAA 3GCHB 4D76A 4BXWA 4ZXXH 5A09A 1P10A 2YNBA 4B6EA 1O34A 1S6LA 1GHBF 1P2OA 1MMJN 1QBVH 2QF5A 3ZZ9A 3RXBA 2BX3A 4YOIA 2FOMB 2GV6A 1V2OT 4H6TA 4Y71A 1TGTA 4WVPE 1C1QA 1BBRH 1GI2A 1YPHE 1TPAE 4E7RG 4X0WU 4MPUA 4BNRA 5BRRE 4LK4A 1THPB 2BD7A 1O2TA 1B7XB 2LELA 1GL0E 4Y8XA 3QWCH 2KAIB 3BN9A 3G01A 1FAKH 2GV7A 1MABB 1W2KH 4KTCA 1QRZA 1VR1H 3LC3A 3U28C 3QTOH 1L2EA 2A5AA 1E34B 1GG6C 1NFYA 1GVLA 4FETA 1GVKB 1XKBC 7ESTE 3BTWE 3HGNA 4OS4A 1UVOA 4M7GA 1CBWB 1P2QA 1P8VC 2TGAA 4E7NA 3ZZ6A 3RXRA 2G51A 2Z9JA 1LTOA 4HG6A 2P93A 3SUFA 3T27A 1GI0A 3RXOA 7KMEH 4AB9A 1X7AC 2OC7A 2SNVA 5L6NH 3GDUA 4XBDA 1UTQA 3P17H 1EX3A 3LGYA 2ZU4A 4DURA 4Z1MD 1DE7H 3K2UA 2FI5E 2EEKA 3O8CA 1J17T 1TGSZ 2P3TB 4GSOA 5JB9S 3EA7A 1P02A 2J4IA 3NWUA 3QK1A 1AD8H 1V2UT 2ZFRH 3LGVA 1U6QA 1N8OB 3FVFB 1C1PA 3K6ZA 3A82A 2ZDMA 2ULLA 6LPRA 1G2LA 4JYTA 1VKYA 1QHRB 1JOUB 1D3QB 1DOJA 4H6SB 1LPGB 1RJXB 4AN7A 1MCVA 3TITA 1O3KA 4BOHA 1V2WT 1NBMD 2RDEA 3RXMA 2STAE 3UB0A 2GMTB 3GCTG 4FUEA 3EA8A 2DUCA 1ZTKA 2ZDAH 2XYAA 2WV4A 1F0RA 3M7QA 2EI8A 1MKXK 1ZPCA 2RCEA 2Z9KA 1MCTA 3LGTA 1RTKA 2VVVA 1GBFA 1KXDA 3A8CA 3EE7A 3H5CB 4XE4A 1KDQA 1BTYA 1C5PA 4AGJA 3UQOA 2WINI 4NIYA 5EXNA 3A8AA 1ABJH 1ANEA 1QB9A 2Q6DA 1H4WA 1IQNA 2PGBB 1RS0A 3M5MA 3PRBA 3QN7A 5IYTA 5JB8S 1W7GH 3A7YA 1KLJH 1HIAB 1ABIH 1VJAU 1CT4E 2ZDKA 5FXLA 4D7GA 1HV7A 3ELAH 4OGYA 4FVBA 1ZJDA 4Y0YE 2GT8A 1TNLA 2ZC9H 3HK3B 4FUCA 4NCYA 5KEDA 3N7DA 2ILNA 3VB3A 2AGGX 1YPMH 4X8UH 2W7SA 1GG6B 4KGAA 2NU3E 4BTTB 1RXPA 2VH6A 5C20A 1GI5A 1K1NA 1OWJA 3MU5A 4H4FA 3WW7A 5JPMH 3BF6H 4ACBA 1NM6A 2Y82A 2JIZD 4X1PU 1V2ST 1Y8TA 5A8XA 2FOGA 4FVDA 1WCZA 5H4IB 1XUHA 3V7TA 1W0YH 1ANBA 1C2IA 4XBBA 5K7RA 4X6OA 1YKTA 2ZU1A 2H5CA 5DP6A 2W6ID 1T8NA 5DG6A 1TNJA 5AFZH 1C5YB 4MNXA 3Q3XA 1DS2E 2LP6A 2P94A 1BQYA 1C5OH 1AVXA 1GBMA 2OLGA 1PPEE 3F2FA 4AGKA 1GDQA 4B74A 2KCPA 1G9IE 1GJ5H 5DP4A 3O8DA 1G3DA 1NTPA 1BITA 1YBWA 2ZCKP 1ETSH 4JZDH 2C93B 3A89A 1NROH 1C2MA 2K7XA 1J9CH 5C5NA 1IOEA 1SQTA 3DD2H 1YPLH 1EZSC 3MHWU 3OU0A 4I33A 1YF4A 2QA9E 5F03A 3F9GA 3IG6B 1XUJA 1DWCH 1KLTA 3EYDA 3RXGA 1CE5A 2CF8H 2ZGHA 3HKIB 1BTWA 5EXMA 2H9EH 4NFFA 1F0TA 1WSSH 1TIOA 1BJUA 3BTQE 3CS7A 4B1TA 1P0SH 5E0HA 3V12A 5I46H 4AB8A 1N6XA 3LGUA 2BLQA 3W95A 2PGQB 5C0UA 5FPYA 1GGDB 2XCNA 1GBBA 3GY5A 1GBTA 1UW7A 1CHGA 3WY8A 2ZFFH 1HJAB 1AI8H 1S6FA 1SLWB 1ZTJA 1MTNC 2FLRH 3U98H 1NN6A 3ITIA 1O2NA 2DE9A 2VIPA 1TE0A 1LDTT 1Z8IB 1BTXA 2FI3E 4DOQA 1YLNA 3SI4H 1QL9A 3EQ0H 4JZFH 2ZDVH 3ZZ7A 1A0LA 1ZMNA 1O2OA 3BG8A 3VGCC 1XX9A 1IQFA 1P12E 3KQCA 2PP6A 1TOMH 2C8WB 5EODA 2FOAA 3C27B 1SOTA 3RLWH 4OM9A 3FO8D 1O2XA 3SYJA 5AHGH 5EG4A 2J95A 3A84A 3UQVA 3RXUA 5C0TA 1TOCB 2FX4A 2YMSC 1AZZA 2BQWB 2G52A 3LH3A 2KAIA 3A85A 2HNTF 5DP3A 3BTME 2QN5T 1O32A 2BDAA 3TJUA 2FODA 1DSTA 2VWLA 3IWMA 3D49H 3JZ1B 1ZGIA 2A4QA 2FZZA 3A83A 2UUKB 1TPSA 1NS3A 2B5TB 1H9HE 1GHAG 4FUFA 2ZO3H 1HUTH 3LJJA 1T8OA 3SQEE 1C5UA 1THSH 2QXJA 1HNEE 5ESTE 1ZRKA 1C1OA 4Y79A 4X2WA 1TQ0B 1O3EA 4KTSA 1EOLA 2G55A 1NFUA 2XBWA 4FUHA 5CDFE 1BCUH 1GCDA 2ZP0H 2Y5HA 1Y5AT 4YZUA 3MH6A 1QBNA 3DCLA 2TBSA 1W10U 1LHGH 1UVSH 3ZVFA 4Z0KA 2K8IA 1NU9A 2OK5A 1VCPA 4TPYA 3SZEA 3N7EA 3M35A 4SGAE 2BLVA 3S0NA 1SG8B 5E0JA 4ZHAA 2BDBA 2D1JA 4I8GA 1C4Y2 1QA7A 1QURH 2FPZA 4NGAH 1VJ9U 2SGFE 4K1EA 1C2EA 1HLTH 3FANA 1Z6JH 1UJ1A 3B23B 3A80A 2WPJS 2C4FH 4Y0ZE 5IDKA 2STBE 4ISOA 1M9UA 3MWIU 4F48B 1MTNB 1ANDA 1CA0C 3VEQB 2Z3DA 1FX0B 1LHFH 3ZYDA 5SGAE 1YPKH 1OKXA 4ABJA 2BZAA 1PPGE 3QUMP 3ZV9A 4THNH 1NY22 1LKBA 2BMGB 3VGCB 3WWFA 1FY1A 1KLIH 4P00A 1MTUA 3TIUA 2OBOA 3PMHB 4RT1A 4Y7AA 4BAMB 1C9TA 5C94A 1HIAA 1FMGA 1AO5A 1RGQA 4CRBA 4VGCC 1P2MA 2IJD1 2ZHWH 2YMSB 2AEIH 2QE7D 2KCYA 5C17A 1UCYE 3OEHD 1EAUA 1TX7A 1MD7A 3S9AA 5GDSH 1GWAA 4WXVA 1VCWA 2AIPA 1LVBA 1Q3XA 4JYUH 1AE5A 1SGTA 2SGEE 3MFJA 1SGIB 1P04A 4LOYH 1YCPK 1T31A 3E1XB 1VITF 1O2VA 3OTPA 2JH5D 1GJDB 1BMAA 3ENSB 1YY3A 3ESTA 3PYHA 2VBCA 1DLKB 3I77A 4YT7H 5EPYA 5HMAA 4BAQB 4O3UA 4DT4A 1H1BA 2F9OA 1FI8A 2QXGA 1FIZA 1K9OE 3E90B 1GJ7B 2J34A 1K1PA 1Y59T 2OBQA 5J4SA 1A5HA 1GHVH 3M37A 3M3VA 1SHYA 1PPFE 1EJNA 1O31A 2Y5FA 1PQ5A 2AIQA 2ALPA 4X2VA 3TH2H 1C1MA 2BY8X 2FOCA 4AZ2B 2AERH 2W26A 1Z7KA 2CF9H 4K1SA 5HXFA 2P16A 1TGNA 1G32B 2P3FH 2CJIA 2FEQH 1GBIA 2BYAX 3BIVH 4U30A 2Y5GA 1GL1A 2FO9A 1TPOA 1BHXB 1RFNA 1WDIA 2DE8A 2WPHS 3F0PA 2BY7X 4I32A 4K60A 4WJG2 1MAYA 2GKVE 1EAWA 2VVCA 1O3GA 3DSPA 2KCOA 1HAYB 1OSSA 2IJOB 1BB0B 1XUGA 1WQVH 1SGDE 4GCHF 1CA0B 1CT2E 3SU2A 2ZU2A 1A46H 4FU7A 2QV1A 3ZZDA 1GPZA 1BRAA 4K8YA 1BJVA 4NG9H 1SKYE 4BAOB 4MNYA 1UO6A 3RC5A 1WXRA 4GLYA 1C5QA 1QA0A 1AKSB 1BBRE 3RXLA 1OOKB 1HAPH 2XWAA 2XC5A 2P3UB 4AYYB 2A2QH 4ISLA 5C67A 1DLEA 2Y6TA 2FTMA 1O5EH 3SU6A 3UNRA 5AVDA 1AFQC 4VGCB 3PLPA 6GCHG 3RP2A 4D7FA 5EQSA 5G4BA 3D62A 1B5GH 4FOUC 3EBNA 1YPJH 1P9UA 3ATMA 1OXGA 3RM0H 2SGQE 4IC6A 1J14A 4OS6A 1GBCA 2ZCHP 4MG3A 1H9LB 3CP7A 3Q3KA 3ZVGA 1MTSA 3SU5A 4B76A 1ESBA 1KTTB 1TBRH 1TA2A 5DP5A 2Y7ZA 1FAXA 1SQAA 4NA8A 3A7WA 5A0AE 2ZHDA 4J2YB 3GYMA 2AGEX 1JXPA 3MU8A 4Q80A 2HWLB 3QGJA 5HIZA 1K2I1 3SNCA 1O3JA 1QY6A 3P6ZB 2SGPE 2KR7A 3RUOA 1W0JD 2AHME 5GWZA 2ODPA 4A1VA 2B0FA 3QZQA 1A4WH 2J92A 4DGJA 5EOKA 2PTNA 4ZAEA 4WMDA 2ODYB 3IITA 4B6FA 3SU4A 2VJ1A 1O36A 2ZNKH 1GCTB 2XXLA 1SOZA 4YLUA 1ZZZA 3SHAH 1ORFA 7GCHG 2F83A 3LT3A 4U01A 1V2QT 1AVGH 1O2QA 2A4RA 3RXCA 3LIWA 3BTTE 1EB2A 1ZSLA 1QNJA 1XUIA 4TSFD 1ETTH 4Q7ZA 1OWEA 3TJNA 1IQJA 2OUAA 4NA7A 1BDAA 4DCDA 1S83A 1J15A 4NZQA 3PWCA 2GMTC 2P59A 1C2GA 1E1RD 2F9BH 3FFGA 1IQHA 1TX6A 3DT0H 2XC4A 3KQDA 5FAHA 1F0UA 4Y76A 1LPZB 1G37A 5L2ZH 3PB1E 1ZYOA 1NZQH 2G4TA 5E8EH 2OC1A 4A7IB 1CA8B 2CGAA 3U1JB 2UWLA 1C1VH 1QL8A 3HKJB 2JJ2D 1HAXB 4O97A 2UUJB 1DT2A 3STJA 2A7HA 3BTKE 1RD3B 3GY2A 2GX4A 3F9EA 3RXVA 3EDXB 1Z1IA 3P8GA 1HCGA 2AMPA 5C3NA 1P3CA 1LVYA 2A31A 2FOHA 1TYNA 1S0RA 4ZKNU 2TGPZ 1QFKH 1EAIA 4Q7YA 2R0LA 2XWBI 1AFQB 1TNGA 4D8NA 2W7UA 3UR9A 6ESTA 3MNCA 1T32A 4UONA 3ZIAD 1Y3XA 5GIBA 4NIWA 1TGCA 3P8FA 4NSVA 3O8RA 1LHEH 1ELGA 4ZCNA 5L30H 4X2YA 4TWWA 3PO1B 2ZFPH 3A87A 4INLA 5LH8A 2M5TA 1O3BA 5ETXA 4GHQA 1DPOA 3JZ2B 1OHHD 5ESBA 4DVAU 4MTBA 5L2YH 1TWXB 2BB4A 3HGPA 1HAIH 1SGCA 3SV8A 4KELA 1EJMA 5F6MA 3TJVA 5FCKA 1TRNA 3ODFA 3Q77A 4FU9A 1DUEA 3RMOH 3D65E 4JK5A 1CO7E 1F5RA 1GJ4H 1LHCH 1YCPH 3SV6A 1O5CB 2HPQH 2AFQB 3BEUA 5TJXA 5C1YA 2C8XB 4CHAB 2HVYB 3KGPA 4Y7BA 5HM2A 2AMQA 3C1KA 2A5IA 1FDPA 1H8IH 2PSYA 8GCHG 1AB9B 5FX5A 4INHA 1SR5C 3E6PH 3TPIZ 1OYQA 4IMQA 1IQLA 2FIRH 5FX6A 3R0FA 2R0KA 1QL7A 2UWOA 2FMJA 1E35B 1ZPZA 1C5VA 2V3HH 3PWBA 2GT7A 1W8BH 4RN6A 2ZPQA 3RXEA 4TY7A 4FU8A 2BD2A 4LZ1H 1YPEH 1C5TA 1W14U 2K1QA 1SGPE 1GGDC 3CNRA 5I25A 2ZKSA 1BOQA 1TX8A 5T1VA 1GJ6A 1AE8H 1GBEA 1V2NT 1DWBH 3LGIA 2R3UA 1OWHA 1SGYE 3LJOA 1HJAC 2OTVA 4KKDA 4X8VH 3VXEH 3GYLB 1TMTH 4TY6A 4YXWD 2JJ1D 1AUTC 1YP9A 1EATA 7LPRA 1GI9B 1SFIA 1G3BA 1C5MD 2ZPRA 3FKSD 3F6UH 2ZTYA 1IQKA 1O2UA 2BY5X 4CBOA 4MDSA 2FOBA 3CS0A 4HZHA 2ZPSA 2A4GA 1NBME 2NU0E 2JKHA 4XFQA 1A3BH 1AKSA 3NUMA 6CHAC 1P9SA 2KZ4A 3LDXH 4MPXA 4WF8A 1BMMH 4LXBH 3TH4H 1A3EH 1VCQA 1SLVB 2L6OA 1GHWH 2PWXA 4RSPA 1SQRA 1S81A 1QTFA 1Q2WA 3URDA 1LVOA 3FAOA 2ZDLA 2K0QA 1NRQH 1NPMA 1JRSA 2FOFA 1ZMJA 4KTUA 4Q63A 3TGKE 3PRDA 3U8OH 1CHOG 3TNTA 5FBIA 5EJZA 1C1SA 1OX1A 2ANKH 3PV2A 3QGNB 3B8JA 2W5EA 4OS7A 3ZZ4A 1V2RT 3AW0A 3HK6B 2G5VA 1A0HB 3A8DA 4A1TA 1HYLA 1DXWA 1HAGE 1S82A 1TNKA 2OC0A 3AW1A 1XVOA 4JZ1A 4YLQH 2O9QA 2Z3CA 5GCHF 2XBXA 1L1NA 1W3CA 5JBAS 1K1IA 1UHBA 4KP0A 4OGXA 3BSQA 1EZQA 2ALVA 8KME2 1KMHB 2GCHF 1Y5UT 1COWD 1RIWC 1O30A 1FUJA 3SJ8A 1GHXH 1QBOA 1ELDE 3T29A 1O5GH 5AF9H 3KEEA 1O3CA 5DKMA 1Z6EA 1GJAB 5HIYA 2ZIQH 2FOEA 1Y3VA 1O2IA 5T6DA 4RKJB 1PYTC 1TBQH 2F91A 3QZRA 4IN2A 1AN1E 1C2JA 2BOKA 3PV5A 4O3TA 1GMHG 1OWIA 1GJBB 3F9FA 1Q31A 1C4V2 1BA8B 3KIDU 4INKA 2WUBA 3QLPH 1NU7B 1Z8GA 1KXEA 1EKBB 1WYKA 3BTFE 2F9NA 5E2OA 1O2KA 3MOCA 1HPGA 5JBBS 1T8LA 1GMCF 2EQNA 1L4ZA 2D8WA 5DO4H 3LH1A 2EA3A 2WPMS 2Z94A 4XRNA 2ZQ2A 3RM2H 2A4OA 1P11E 1SI5H 1S6HA 1FZZA 1VZQH 2J2UA 6CHAB 4ACAA 2FXRA 1RTFB 4MPVA 1FPCH 2J94A 1D6RA 1ACBE 2ZECA 1SLXB 1QB6A 3GDSA 1O0DH 5FBEA 1TABE 3SI3H 2BD9A 2GZ7A 4CR9A 1LMWB 4R8TB 3T26A 1DVAH 5EW2H 2FWWA 2Y80A 3PV4A 3E0NB 1ZRBA 2ZU3A 3P8NA 1MKWK 1CT0E 2F3CE 2PLXA 1A61H 5GXPA 1DY9A 1Y3UA 2VGCC 3E8LA 1UTKA 1GBJA 1GJCB 2LNCA 2XC0A 4B71A 1P57B 1NT1A 3SW2B 1FNIA 4D9RA 4ISIH 3TNSA 1UK2A 1TBZH 3SNBA 4YOJA 2GDEH 3GCTF 3GY7A 4AG1A 3BIUH 1BT7A 1FY4A 3RXPA 1LQDB 3OYPA 3W94A 3E16B
chains in the Genus database with same CATH topology
1P09A 2BDHA 3TGJE 1C5ZB 4I8JA 4X8TH 5DGJA 4X1RU 1RIWB 1MD8A 1IQIA 2OXSA 3E91A 1YGCH 3SQHE 1O2RA 1MTVA 1ZJKA 4GPGA 2GDDA 4CR5A 1ZHPA 3ZZCA 3LPRA 2TIOA 4UDWH 5FHTA 1FN8A 4WH6A 1D3DB 2C8YB 4WWYA 1OYTH 2VNTA 4F49A 1Z71A 2VWOA 2PKSC 4GAWA 4ABIA 3DUXH 1DWDH 2FESH 3GDVA 2HOBA 1C1UH 1TFXA 2ZFTA 1QJ1B 3I29A 3RXTA 3M3TA 1E0FD 2OP9A 4B73A 4X1QU 1JIRA 4XBCA 4IC5A 5E2PA 5HM9A 2AMDA 4A92A 2ODQA 1HXEH 1DDJA 1MQ6A 3ZZ3A 4NFEA 8LPRA 1P2KA 1VGCC 5LGOA 4DIHH 5EU8A 4CRCA 2ZEBA 1P06A 2HALA 4OS2A 1SFQB 4FUDA 1MAXA 1Y5BT 1DSUA 4DY7B 2V35A 4ZXYH 3UTUH 3E0PB 1BTHH 2BDYA 1HAVB 1V2TT 2VVUA 2B8OH 5C1UA 4XOJA 1O33A 1KXAA 4CH2B 3ZYEA 2PUQH 3AAVA 1DITH 1WTHD 2ZWLH 1C9PA 1KSNA 2THFB 2A7CA 2H9TH 3SHCH 4AG2A 3R3GB 1XUKA 2BQ7B 3RXIA 1ZGVA 3RXSA 1AIXH 1C2HA 2Z7FE 2QC2A 4IGDA 4TYDA 2CN0H 3A7XA 1BZXE 4A5TS 3SV2H 1GHBG 3TU7H 2VGCB 2A45B 3SV7A 5HYOA 4AORA 2PW8H 5PTPA 1ELBA 4XSKU 1O2PA 3SN8A 1HJ9A 1GJ8B 4B75A 1TRMA 1WUNH 1BIOA 3OSYA 4NIVA 1SPJA 2FI4E 1SSXA 3DA9B 2AH4X 1F5LA 1QJ6B 2W3KA 1C2KA 2EI7A 2XBVA 1C1RA 2IPHA 4K5ZA 1GBHA 5A8ZA 3VB7A 5DP9A 1GVZA 2BM2A 1C5LH 1GCTC 2BVXH 1LHDH 2F9PA 2ZF0H 4ESTE 4MQAA 1CVWH 3F9HA 2BX4A 1G3EA 1UVUH 3MH7A 1SGQE 3RXDA 1NRNH 3QDZB 2G8TA 1VITH 1SBWA 2FS9A 4I7YH 1WV7H 3M7UA 3PTNA 3GOVB 3F68H 1BUIA 2PKSB 1GJ9B 1PQ7A 2PKAB 1EZUC 1CU1A 2ESTE 2SGDE 3SJ9A 2JH0D 1NFXA 3UOUA 3A88A 1B0EA 5JBCS 3FZZA 2A5KA 2ANWA 5T6FA 1MBMA 1A1RA 4I8LA 1GMDF 3PLKA 3SJIA 1AGJA 1EP6A 1S85A 1E38B 1V2LT 2HGTH 1D9IA 1RTLA 1VGCB 1ZSKA 2BY9X 2D26C 3SNAA 1J16A 4K3JA 2VINA 3D23A 3E3TA 5B6OA 1C1WH 1O3LA 4K2YA 4X8SH 1KTSB 5T6GA 3ZVAA 4AFSA 1UK3A 3HATH 1F92A 1GBAA 1NFWA 3ATWA 1AFEH 1GHAF 2SNWA 4JZIA 1ELCA 5TCAA 3RXQA 3KNXA 3TH3H 3SNEA 1O2ZA 1QGFA 1Z8RA 1F2SE 1PPBH 5F8ZA 4FUJA 1C2DA 4OS1A 5CMXH 1AVWA 1PPHE 2TGDA 4UFGH 3EA9A 3Q3YA 1ZHMA 4GUXA 1DANH 2FLBH 3S9BA 4MVNA 3PO1C 4NWKA 8ESTE 2H2ZA 2V3OH 2ZDNA 1XM1A 1P2JA 2GTBA 1V2MT 5E0GA 4WMFA 4CH8B 2TPIZ 2Q6GA 1KXFA 3NK8A 3NZIA 5FPSA 2QCYA 1KXCA 1QRWA 1UHBB 3K6YA 1ETRH 2W3IA 1B0FA 2VWNA 2GZ9A 4DJZB 3PLBA 2BQ6B 4J1YA 2FYRA 5EPNA 4O03A 1MKWH 2O8MA 3RLYH 4ISNA 3T2NA 1DWEH 3A8BA 3FP6E 2XCFA 4YESB 4CRFA 1O2LA 5C5OA 3OY6U 2V0BA 4F4OC 4YM9A 3ATKA 3BTDE 3GY8A 1ELVA 2H9HA 3LONA 4CHAC 1E36B 1CGHA 4NWLA 3MU0A 1QRXA 5DP8A 2F9VA 1AB9C 1O2JA 2ZZUH 1A5IA 1C1NA 4IS5A 1HB0B 1ZSJA 3GY6A 3SU0A 1NRPH 3KQBA 3M5NA 4I8HA 1K1MA 3RXKA 3TGIE 1T4UH 2R2WU 3M7TA 3M61U 4JZEH 2Z6BD 1MZDA 1KIGH 3OY5U 4UEHH 2BDIA 3ZZAA 1DFPA 2ZI2H 3PMBB 3F1SB 2UWPA 2FDAA 3SGQE 4UFFH 2FYQA 2ZG0H 4ZKSU 1TPPA 2GD4B 3ODDA 3RU4E 2GVFA 1P2IA 1BTPA 2WYJA 3MH4A 4H42U 3T28A 1EAXA 1AWFH 1QJ7B 3TLOA 3MI4A 4IBLH 4X1NU 3T25A 1YCPM 1JWTA 4YO9A 5LPFA 1ARCA 1O3NA 1CGJE 3P8OA 5DPAA 4ABFA 3RU4T 2NU2E 1AY6H 3SOSA 4A6LA 1JIMA 3ZZ5A 1D4PB 3N7OA 1EPTC 1P2NA 4CRAA 2I6QA 5DP7A 4B2AA 4B2CA 1FV9A 2C8ZB 1ZR0A 4ZKRU 1HAVA 2BY6X 4E05H 5JBTA 1O35A 4YOGA 1PQAA 3RXHA 3A7VA 1P3EA 4E06H 3AVZA 4YT6H 4AYVB 3MO3A 1O3MA 2BTCE 3H7TA 1SGFG 1AMHA 2OINA 1MBQA 2R2MB 2XTTB 1KY9A 3SNDA 3A81A 1O5FH 1O5DH 5T3HA 1K1OA 1GMCG 1PQ8A 1IQEA 3RDZA 5C1XA 1BRUP 4K1TA 3OTJE 1CQQA 4AFQA 1D6WA 1RRKA 2ZGBH 1O37A 1C4U2 1XMNB 1EUFA 4IW4E 3AAUA 1ARBA 3TK9A 4X1SU 3BTGE 1TA6A 1JRTA 3SGAE 1F5KU 4O9VA 1QIXB 1GI6A 3SBKA 1C5XB 3S9CA 3UIRA 1F7ZA 2A1DB 2O8WA 1EP5A 1O2MA 1EJAA 3I78A 1T7CA 4JCNA 2BD8A 2BDCA 4WXIA 3TK5A 1UTLM 2HNTC 3QO6A 2JETC 3NCLA 4FUIA 1O2GH 2PKAA 1HBTH 1A0JA 1PPZA 4ABHA 3FP7E 6GCHF 4X2XA 1G2MA 3M5LA 4K69A 1K1LA 3ZZ8A 1ELEE 1V2PT 1HFDA 4MLFB 2C3SA 2BVSH 3KHVA 2ZTXA 1L1JA 1ZOMA 2H1UA 3GISB 1O39A 4DG4A 2Q6FA 1K1JA 5EGMA 3MNSA 2ZA5A 1IQGA 3UNQA 2ZGJA 1EPTB 1MZAA 3GY3A 3UNSA 1O2HA 1SLUB 1D3TB 2PFEA 2QIQA 1HXFH 4JK6A 2PR3A 1V2VT 1SC8U 2GCTC 1J8AA 3PTBA 9LPRA 2BXUH 1V2KT 4CRGA 1OP0A 1GDUA 4WH8A 2B7DH 2BLOA 1IQMA 1GI7B 2Y81A 2PUXB 7GCHF 4Y8ZA 2GP9B 1FY8E 2QF0A 3MTYA 4WY3A 2QY0B 3SUEA 2QGRA 3QTVH 2BZ6H 2D2DA 1O3DA 2VWMA 3VXFH 1SGEE 3VB4A 1XKAC 1BRBE 1OPHB 1BMLA 1LQEA 2B9LA 4Q7XA 2RG3A 1L0ZA 1V2JT 5CHAC 1T8MA 4WMEA 1QQUA 3RMNH 3ZVDA 2A0QB 3BTEE 3B9FH 2HNTE 2FS8A 4ZH8A 1LCYA 1AZ8A 1H9IE 3A86A 1O2SA 2OQUA 2QYIA 1TRYA 4MPWA 1QR3E 1IHTH 4K8BA 3V13A 3U1IB 3BV9B 1UVPA 2ZGXH 1ZMLA 3UPEA 4ABBA 4LZ4B 5JDUB 2CMYA 1NC6A 3VB5A 5HGGA 2GGVB 4D9QA 2PHBA 2PTCE 4RKOB 4I8KA 1XXDA 3NXPA 3STIA 2TRMA 3U8RH 1FJSA 3ATLA 1O3AA 1GI4A 2HVXA 2YOLA 1VITG 4UFEH 4ZHLU 2FP7B 4BAHB 1K22H 4XDEA 4FUBA 1W11U 2Y7XA 4AX9H 2JETB 1EOJA 2H6MA 2UUYA 3SJKA 1P01A 1TMBH 1W0ZU 3DHKH 5A8YA 3P92A 2CV3A 5AFYH 1CGIE 2P8OC 5EQRA 4Y8YA 1HJ8A 3SGBE 1QB1A 4ZUHA 1P03A 3GCNA 2RA0A 1G3CA 1PFXC 3S7KB 4HI3A 2XW9A 4ZKOU 1JBUH 1YLCA 1O2WA 4BTIB 4JYVH 2JH6D 2IN2A 2A2XH 1W12U 2O8LA 4X6MA 1O2YA 1GI1A 2Z9LA 3A7TA 2ANYA 1WQSA 2GCTB 2OC8A 1EXFA 1OS8A 3MMGA 1GI8B 2BXTH 1YLDA 3PMJA 3LC5A 1UCYK 2QXHA 2ZU5A 2UUFB 2BD4A 1QCPA 1PYTD 2HPPH 2WUCA 4BAKB 1ELTA 9ESTA 2QAAA 2RDLA 3M3SA 4UE7H 1S84A 1GMDG 2PV9B 4GCHG 1ELAA 4AFUA 3ATIA 4GHTA 4AFZA 1O3HA 4BANB 2SGAA 2BOHB 3UWJH 4Y6DA 1IHSH 1T4VH 4QT8C 8GCHF 1L1GA 3BG4C 3DFJA 4R0IA 2Q1JA 4TWYA 4ZMAH 2RA3A 2ZGCA 2PSXA 5GJ4B 2O8UA 3NKKA 2ZHEH 1SHHB 1WTGH 5CHAB 3CENA 1G30B 1C2FA 3FP8E 4HFPB 2GZ8A 3VB6A 1GI3A 2OQ5A 3U9AH 2Z3EA 5EXLA 3L6PA 3BEFB 3EE0B 2XRCA 1YM0A 1ANCA 2ZTZA 1ZPBA 1TONA 2CHAC 1GHZA 5F8XA 5EQQA 5DK1A 3VPKA 2V6NA 2VIQA 1O3IA 3ZVEA 2AYWA 3KF2A 1HRTH 3RXJA 1TLDA 1BTZA 1TQ7B 1A5GH 3PROA 5CE1A 2YNAA 5LPEA 2WPLS 1OP8A 1NRSH 1OWDA 1YPGH 1DM4B 4BXSA 5FPTA 3ZZBA 3KQEA 1C2LA 1UTNA 1G36A 2VH0A 1ESAA 3GCOA 1GDNA 5DJ7A 2NWNA 1PJPA 4DW2U 1FPHH 1OWKA 4TPIZ 1D3PB 4Y11E 4B2BA 1C5SA 2P8OB 4ABEA 4JMYA 1XXFA 3RC4A 3ZVCA 5GPIB 1BMNH 1THRH 3PMAB 1DICA 3EAJA 2EI6A 1UTPA 3K65B 3K9XB 1NO9H 3RXAA 3URCA 2ZCLP 1ZTLA 2LIZA 1UTOA 1GBDA 1BBRK 4CBNA 2H5DA 1SGRE 2R3YA 1CHOF 1INCA 1O5BB 1OP2A 3L3TA 3TK6A 3LGWA 3BEIB 4ZROA 1W13U 3SUGA 1AUJA 4DIIH 3GY4A 4NIXA 3Q00A 2CXVA 4SGBE 1DY8A 1MKXH 3RC6A 1C1TA 1N6YA 1MU6B 3MNBA 1C5RA 1ZLRA 1EPTA 1ID5H 1XVMA 5F8TA 2J38A 1SB1H 2HRVA 2C90B 3S7HB 4FXGH 2G4UA 1WU1A 1TMUH 1MUEB 1HGTH 3EGKH 2G81E 4ZHMU 2WPIS 3Q76A 2ZHFH 3M5OA 3DFLA 3SORA 3BG4B 1Y3YA 3ZVBA 5A0CA 1O3PB 2OD3B 4NA9H 1O38A 2EC9H 1P05A 3M36A 4GVUA 4X6PA 3RMMH 1YC0A 3T62A 1AQ7A 4X6NA 4CRDA 3UR6A 5TCCA 1WBGB 1NESE 1BRCE 1EASA 2Z9IA 4HGCA 1K21H 2IOTA 1S0QA 3SU3A 1GMHF 4ASHA 4MNWA 2XBYA 1SGFA 1GBKA 2A7JA 3A7ZA 1TGBA 1MU8B 2QF3A 2G5NA 3MO6A 5BPEA 2CHAB 1SGNE 1CSOE 4MNVA 2VIOA 2NU4E 2ZQ1A 1GHYH 3AASA 1XUFA 2SFAA 1SL3A 3V3MA 4ABDA 3MH5A 2FX6A 2BD5A 1TAWA 1L4DA 2G00A 1V3XA 1YYY1 1EQ9A 2WV5A 1TALA 1K28D 2TGTA 1FQ3A 1DX5M 1MTWA 5J4QA 3SJOA 1UK4A 1O5AB 1ZHRA 1WOFA 5ABWA 3UFAA 1WAYB 2ZFQH 1TNIA 3TJOA 3GICB 4A1XA 1FLEE 1KDQB 3OX7U 2I6SA 2R9PA 2J9NA 1QQ4A 2BDGA 3KCGH 2VB0A 3UOPA 1DXPA 1EZXC 4BTUB 3GCHC 1MQ5A 4IN1A 2BHGA 4YTAA 5C2ZA 1A2CH 3RMLH 1KYNA 3KN2A 2ANMH 2QXIA 4I31A 1W7XH 2OCVB 1LO6A 2ZFSA 1LVMA 2AGIX 2ASUB 4Q2KA 4UD9H 1BTUA 1N1LA 2AS9A 1LPKB 1ELFA 3S69A 1AWHB 2VU8E 1PPCE 3ZV8A 1TNHA 1FONA 4FUGA 3SV9A 1NRRH 1FY3A 3H7OA 1ESTA 3SU1A 2XNIA 1HAHH 3SUDA 1F0SA 1BHXF 1UCYH 1C5WB 1CBWC 1DUAA 3LU9B 5JYIA 1UMAH 1YPHC 4U32A 4U2WA 2LPRA 1AU8A 2WPKS 3SZNA 3MU1A 3VFEA 1FXYA 5LPRA 2VIDA 3MU4A 4NZLA 1JMOH 1FIWA 1EB1H 1KXBA 1LKAA 3LOXA 3BTHE 3V0XA 1SMFE 3SO3A 3LKWA 2O8TA 1C5NH 2Z9GA 1V6DA 3L33A 3UUZA 1SQOA 4Y10E 5A0BA 2HLCA 1AHTH 1Z8JB 2ZHQH 1A7SA 1HAZB 1Y3WA 2VIVA 3QX5H 3MO9A 3U69H 3RU4D 3UWIA 3KL6A 4CREA 3FZDA 2WYGA 3RXFA 4HTCH 2FM2A 3T5FH 2BD3A 1SVPA 3HPTB 2BVRH 3MYWA 2BLWA 1HDTH 1N8OC 4AOQA 2FTLE 3P95A 1GBLA 1UTJA 3UY9A 1MH0A 1O3OA 4ABGA 1HAOH 4ISHH 1O3FA 1TB6H 2NU1E 4NSYA 1H8DH 4IMZA 5EW1H 1Z1JA 1FN6A 5FCRA 2P95A 3P70B 3UREA 5A2MH 3U8TH 4OS5A 3PM3A 2F9UA 3MNXA 5GCHG 4Z6AH 1UVTH 1UTMA 4PROA 4UFDH 1E37B 1FY5A 4DT7B 1S5SA 2VIWA 3O8BA 1IAUA 5K0HA 3TVJB 2A32A 2GCHG 3NPSA 4ABAA 3GCHB 4D76A 4BXWA 4ZXXH 5A09A 1P10A 2YNBA 1O34A 1GHBF 1P2OA 1MMJN 1QBVH 3ZZ9A 3RXBA 2BX3A 4YOIA 2FOMB 2GV6A 1V2OT 4H6TA 4Y71A 1TGTA 4WVPE 1C1QA