2A5AA

Crystal structure of unbound sars coronavirus main peptidase in the space group c2
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
306
structure length
306
Chain Sequence
b'SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like peptidase
publication title Crystal Structures of the Main Peptidase from the SARS Coronavirus Inhibited by a Substrate-like Aza-peptide Epoxide
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 86
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2a5aA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2a5aA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2a5aA02
4IW4E 3S69A 3UTUH 3CS0A 1IQNA 1ZTKA 1AD8H 1TQ7B 1UTMA 1LHEH 3MNXA 2OCVB 1O3NA 1DLEA 2OBOA 4IMZA 4BAOB 1TPSA 2OINA 1TGSZ 2HALA 4NFFA 1ARBA 1P11E 3L6PA 3NWUA 1KLJH 1UK3A 1MCVA 4YO9A 1LTOA 1IQLA 2F3CE 3TJUA 2VIDA 3ZYEA 3RXOA 1O2KA 1JOUB 3GY2A 1AI8H 1O39A 2LPRA 1GJ9B 3GISB 5T6DA 5PTPA 1QA0A 6GCHF 1CO7E 1O3OA 3Q3YA 2Y7ZA 4CH2B 1FAKH 4K1TA 1TRNA 1TRYA 1UO6A 1S82A 1L4ZA 1EZQA 1ZMNA 2XBWA 3LPRA 2WPIS 2P3FH 1L1GA 3MMGA 1ETTH 2A7JA 2ZGHA 8KME2 1GMCG 1DICA 2BDAA 2Y81A 4ABFA 4XSKU 1DITH 3A8DA 2WPLS 4J1YA 3QGNB 2VIOA 1MKXK 2I6QA 1G3CA 1RIWC 2ODPA 1G32B 3SV8A 1ZPCA 1O3EA 1TPOA 3GCTF 1S83A 1GHBF 1K1IA 2WPJS 3GYLB 1EX3A 4MQAA 1XXFA 1S6FA 1TBRH 3VXEH 3MHWU 4Y71A 5JBBS 5A0AE 1UTJA 1UVTH 1QA7A 1HXFH 4XFQA 2CN0H 4I33A 2HVXA 4H4FA 1QB9A 2R2WU 2J95A 2BQ6B 2ALPA 1O5EH 2UUKB 1EASA 1AFEH 3KQBA 4AGKA 1OS8A 3ZVCA 1Y3WA 1P8VC 1TGTA 2GD4B 2PHBA 2DE9A 2WUCA 3SZNA 1DX5M 4RN6A 2TGDA 2PKSC 3SJIA 1QL8A 1GJBB 3GOVB 2AS9A 1D4PB 1GI0A 1O2WA 1V2LT 2FESH 1RTFB 1G9IE 1UHBB 2GCHF 2WPMS 3ZZCA 1E34B 1MAYA 2C90B 3FP7E 2G4TA 2GMTB 2UWPA 1UTPA 1MZAA 2BDCA 1ELAA 2C93B 5E2PA 3A82A 1LHGH 5C1UA 3ELAH 1O2IA 3SW2B 1A4WH 3SV2H 1UVOA 1ORFA 5SGAE 1MTVA 1HRTH 2VGCB 2JETB 4GUXA 3TH4H 1ZTLA 3TITA 3D65E 4ZAEA 8GCHG 2KAIB 2XWBI 1LVOA 2VIQA 1ZPZA 4Y76A 3ZZ5A 1SVPA 3P8FA 2JH0D 1BUIA 1GMDF 1ANDA 4F49A 1GG6B 1HFDA 1LVYA 4YM9A 5DP6A 1W8BH 4H42U 1VITF 1A0LA 1AO5A 1OP8A 3E8LA 1B5GH 4A1VA 3T29A 1UTQA 1O33A 5FPYA 1NN6A 1KXDA 1O2RA 1GBMA 2FMJA 2AMQA 1WOFA 2CXVA 1SFIA 2FOGA 1C5TA 1QY6A 2LNCA 1TA6A 4NWLA 3URCA 1CHOG 6GCHG 4I8JA 1DS2E 1H9IE 7GCHG 4Y0ZE 3FP6E 1XMNB 1WTGH 3A84A 1C5XB 3T25A 3B8JA 5CHAC 2VU8E 3A89A 1QRXA 1FQ3A 1BCUH 2BVXH 4ZHMU 2F9UA 4NIWA 1GI2A 2BMGB 2ESTE 2Z3DA 2PKAB 3RXIA 1PJPA 1ZOMA 2ZFRH 3GCHB 2QV1A 1UCYE 3QWCH 2Y80A 3A81A 1WYKA 1GHBG 3ATLA 2GCTB 2VH6A 4NA7A 4UD9H 3KF2A 1SMFE 1YGCH 2A4RA 5J4SA 2W26A 1GBKA 9LPRA 1O2LA 1LHCH 4FUEA 2FOCA 4KKDA 4OGYA 3DD2H 2ZU1A 4XE4A 1BMLA 2OTVA 4JYTA 2ZFPH 1QL7A 2SGFE 4ISHH 1C5LH 1MUEB 5DPAA 1SGQE 3RU4T 2W3KA 4BXSA 3VPKA 3RXCA 2JKHA 3A83A 4JK6A 3NK8A 1GHZA 1HLTH 1Z8RA 1BHXB 3BV9B 2D2DA 1TAWA 2F9OA 1H4WA 1LQDB 2ZHWH 4VGCC 4WMFA 1WQVH 1UTOA 2PFEA 1BZXE 1HJ9A 1U6QA 3DFJA 2FWWA 4Y11E 1OP0A 3MOCA 3KQDA 4CRDA 1EAWA 1VITH 2B9LA 1JMOH 2GMTC 1MBMA 3SU1A 4WVPE 5EW2H 3WY8A 4AB9A 4O97A 2YOLA 2BD3A 1OWDA 3HK3B 2BLWA 3D23A 1F7ZA 4Y10E 1D3DB 3QZQA 1FNIA 4AORA 1LHDH 3G01A 2JETC 2O9QA 1Q3XA 2YNBA 1CA0B 4I7YH 1FN8A 4ESTE 1FN6A 2VVCA 2BD2A 1BB0B 4Z0KA 1GMHF 3F9GA 4GCHG 5JPMH 1A3EH 3NPSA 4U30A 2PSXA 2GP9B 1HJ8A 1C1RA 2H1UA 4DGJA 2GDEH 1PQ7A 1BJVA 4ABDA 4X6OA 3BG4C 2OQ5A 2BDIA 1O2PA 1UCYH 2EA3A 1BIOA 2IJOB 3TNTA 3QK1A 4CBNA 1A0JA 1QL9A 8ESTE 2HNTE 5JYIA 3SOSA 1KDQB 2ZHQH 1G3BA 4NSYA 4NZQA 1YYY1 1O0DH 4WWYA 1GVZA 2XWAA 1EJAA 4K2YA 2GTBA 1K2I1 2BOKA 2C8YB 1UHBA 4DURA 1PPZA 1DUAA 2ZCLP 3Q76A 1C1UH 1XUGA 2ZDVH 3U1JB 4JZDH 5EXMA 1NPMA 1T8LA 1EP6A 1GDNA 4CRAA 3PMBB 2TPIZ 3QGJA 3SV6A 1MTNC 4DOQA 3EBNA 2G51A 1O2JA 4B75A 3GY4A 3SI4H 1MKWH 2GCTC 1K9OE 1ELCA 3A87A 1GHWH 4HTCH 5TCCA 1JRTA 3SJOA 1AN1E 1AIXH 3ATIA 1EB2A 2Z9LA 1VCPA 2KAIA 1RXPA 1GI8B 3GCNA 4JCNA 2HPPH 1MTWA 1S81A 2W7SA 3TJVA 1IQMA 1ESTA 4I8GA 3T62A 2HRVA 3K9XB 1A0HB 3H5CB 4FU8A 3M3SA 1J14A 1UCYK 3KIDU 4X0WU 4ASHA 4X8VH 2A4OA 2ZIQH 5TJXA 4AZ2B 5FX5A 5HMAA 2PWXA 1GDQA 3MTYA 2CHAB 3RXBA 2YNAA 3LH1A 1IQJA 4B73A 1T4UH 1P0SH 2A4QA 1O5DH 4INHA 1VR1H 1EZUC 1TNHA 2OC7A 1BJUA 2R9PA 3GY3A 3CENA 4TYDA 2IN2A 3KN2A 1H9HE 1UK4A 1AB9B 1WSSH 2CMYA 4U2WA 1SLXB 2BTCE 1BTWA 4IN1A 1C5UA 3KQCA 3RC5A 3Q3XA 2A2QH 1SC8U 2EI8A 1AE8H 1P10A 2BVSH 1AWFH 1O32A 1SOTA 1SLUB 3PTBA 4NSVA 1MKWK 5EPYA 1NFUA 3U69H 2BQ7B 1C1VH 4K8YA 1W7XH 1AQ7A 2PKAA 3A7XA 4X6MA 1G3EA 1OP2A 3RMLH 3MWIU 3LGYA 1ZZZA 3OTJE 5IDKA 1ZRKA 2AIPA 2FOEA 1P9UA 1O2TA 1TGNA 1GMHG 2FS8A 3AW1A 4ZHLU 1AZZA 4Y79A 5H4IB 3LU9B 2AYWA 3S9BA 3RXEA 2FIRH 1P3EA 1ZGVA 3A80A 2PGBB 1NRSH 1XVMA 2ZQ2A 1CHGA 1P3CA 2BDBA 3ITIA 1Z1JA 3SNDA 1D6WA 4WF8A 1ZJKA 2JH6D 1OYTH 3OU0A 5DKMA 4BAMB 1BMAA 1O30A 1C2GA 3EE0B 2J38A 1P2JA 1O3AA 5JDUB 2BY5X 1ZSLA 1BTPA 5FPSA 1TOCB 3MYWA 3MU4A 3K6ZA 4ABEA 2FOMB 3O8DA 1SHHB 4D7FA 1THSH 4KTUA 4AG2A 1RS0A 4B71A 3FZDA 2QXIA 4X1RU 4BAKB 1C5MD 1QR3E 2R3YA 3UWJH 2WYJA 1F0TA 3BTGE 2UUFB 1QFKH 4FUBA 5IYTA 4TWYA 1ARCA 1GMCF 3ODFA 3RXQA 3SGBE 3ESTA 2HOBA 3M7UA 1ZMJA 2ZQ1A 2W7UA 1F92A 3TLOA 3F1SB 4CH8B 5FAHA 3TGJE 4ZKRU 1CT0E 2QXJA 2BD5A 3DHKH 4ABAA 1GL1A 5ESTE 3F9FA 3N7OA 3KNXA 2HGTH 3UQOA 1NTPA 1O5GH 1D3QB 1G3DA 3QUMP 2H5CA 1KLTA 4OS1A 2I6SA 4AFQA 3I78A 2O8TA 4D76A 1FXYA 3BF6H 3DA9B 4A1TA 5F6MA 1VZQH 1DWDH 4I8KA 4Y8ZA 3TJOA 1EUFA 2NU0E 3P8OA 1O2OA 1TOMH 4NA9H 4GHQA 3VGCC 3PROA 2BQWB 1K28D 1N8OB 1Z1IA 2CF9H 2NU2E 3RXJA 3RMNH 2ZTZA 1LPZB 1DM4B 1SQAA 4CR5A 3TK5A 1FPCH 2A7CA 4FUIA 2W3IA 1HGTH 1EXFA 3ATMA 1KDQA 2OLGA 1AE5A 2SFAA 1B7XB 3FANA 3PO1B 4DW2U 4K5ZA 1V2WT 3GDUA 4KTCA 1OWEA 1WU1A 1KIGH 3RU4E 1E38B 1C1NA 4FVBA 3RXMA 1TE0A 5FCRA 1GI1A 1YC0A 4D7GA 3RXAA 6LPRA 5L2YH 3V12A 4DT7B 3E0PB 2WV4A 3A7YA 3RXKA 1Z8GA 1KXEA 3MFJA 3QO6A 1HAHH 3RU4D 4R8TB 5C1YA 4NWKA 2F91A 2BLVA 1Y3XA 3BTHE 3UOPA 1V2UT 1NU9A 1XM1A 1CA8B 1BTUA 3MH5A 3OSYA 3F9HA 4ABJA 4GAWA 3E6PH 5DO4H 4R0IA 1QNJA 4MNYA 1MTUA 1WBGB 2VH0A 8GCHF 1GDUA 5A0BA 1C4Y2 1SSXA 3RXSA 1QCPA 3KCGH 3EYDA 1V2QT 2AGGX 1TB6H 2LIZA 1QRWA 3P95A 2P8OC 1P2NA 3ZVBA 4ZKOU 1WQSA 3TJNA 1A7SA 2ZA5A 3W94A 3EA9A 2A2XH 4Y7AA 3V7TA 1TNLA 1ZGIA 3LGWA 2GDDA 2PSYA 1O35A 1VGCB 4A5TS 1CHOF 3NZIA 3SGQE 7GCHF 1C1TA 4FUCA 2A31A 4I8HA 4DG4A 2BDYA 3MO9A 2PR3A 3A7WA 1GJ6A 3ZVGA 5HM9A 1GBDA 3F9EA 3NUMA 1CSOE 5L6NH 1TONA 1F5KU 3SUDA 1GJAB 3Q00A 4B76A 1GBAA 1GJ5H 3V0XA 2SNWA 3SBKA 5AF9H 1CGJE 1H1BA 5LH8A 1A5IA 2TGAA 2K1QA 2GGVB 2O8WA 2STBE 3T27A 3LOXA 4RSPA 1O3BA 4XOJA 3RLWH 4AYYB 1FAXA 2J4IA 1QGFA 5FPTA 1NS3A 4NGAH 2CF8H 1HXEH 4B2CA 5EU8A 1D3PB 3IG6B 1SGYE 5K0HA 2BDHA 2ZEBA 3RXGA 3SU3A 5DP9A 2ZO3H 2P94A 1TRMA 1O2YA 1XUFA 4CHAB 1YPHC 3LH3A 5L30H 2GV6A 1O2UA 5C5NA 3EDXB 3ENSB 5EQSA 3RXTA 1GI3A 2F83A 4Q2KA 1YPJH 5A8YA 1BRCE 3GDSA 3SJ8A 4ABGA 4X8SH 1HBTH 3E91A 2O8LA 2UWOA 3PO1C 1GPZA 2G81E 3SU2A 1F2SE 4IGDA 4ZXYH 5JBCS 1CGIE 4JYVH 3M5NA 1QBVH 4MVNA 1UTKA 2XCFA 3EQ0H 4AFZA 1AFQB 2ZTXA 5DJ7A 1DWCH 4M7GA 2OD3B 1ABIH 3AAUA 2H9EH 4OGXA 3M5LA 1C5OH 2PV9B 2XBVA 1VCQA 2VWOA 1C1WH 3VB3A 1ESAA 1NRQH 4K1SA 3BEIB 2H9HA 3K6YA 3SU5A 1HAZB 4CR9A 1O5BB 1AZ8A 4H6TA 5GPIB 4Y6DA 1GBTA 1YKTA 1G2LA 2BY6X 1DWEH 2P3UB 3I29A 2H2ZA 1HNEE 1SGRE 1LVBA 3D62A 2OQUA 2SGEE 5EXLA 1C2EA 2NU3E 1FONA 1LPGB 1O2MA 1V2ST 1V6DA 3ZVAA 3E16B 1NFWA 1T4VH 2VVUA 2ZI2H 4GCHF 3RC4A 1S0RA 1XUIA 1FY8E 1HDTH 1P12E 2B0FA 2ZDLA 1BMNH 5C1XA 5EGMA 4IC6A 1K1PA 1ZMLA 3E90B 2BVRH 1PFXC 3Q77A 4FU9A 2XTTB 3R3GB 4GSOA 1CT2E 4UFDH 4BNRA 3UQVA 1PYTD 4TY6A 2W5EA 3LONA 3M5OA 1L0ZA 3JZ2B 2P16A 5FHTA 1TMTH 5DP3A 1CT4E 1JBUH 1P05A 1TNIA 2G5NA 3QZRA 5E0JA 3T2NA 1RGQA 1HAVB 1S0QA 1GBEA 4NG9H 5DK1A 2UWLA 1ZSJA 5EPNA 3M37A 1S6HA 4TPYA 2Z3CA 4IBLH 4WMEA 1PPHE 4JZ1A 1V3XA 4ZKSU 2AGIX 1O38A 1BA8B 1SGEE 3E0NB 1SFQB 5HXFA 4CBOA 4NCYA 2EC9H 3EA8A 2SGPE 1P04A 2P3TB 3LT3A 4IN2A 3TU7H 4WY3A 3A86A 1GBCA 1HJAB 1TNGA 1KXFA 2PW8H 1W0ZU 1XUHA 2ZHDA 3TH3H 1NU7B 5EW1H 4NIXA 3RC6A 2XYAA 1DLKB 1OWJA 4CHAC 1T31A 2WPKS 3ZZBA 4RKJB 1MCTA 4F4OC 1QURH 3MI4A 1NRRH 1FPHH 3FVFB 2D26C 5EODA 2QC2A 1FUJA 5I46H 3UNRA 1BITA 1TALA 2EI6A 1EJMA 4Y8YA 1THPB 2B8OH 3QDZB 4WXVA 1PPFE 2OC8A 1GI7B 2ZC9H 5E0GA 1GJ4H 2NU4E 2BLQA 1IQFA 1DOJA 3T5FH 1DDJA 1GVLA 2FI5E 1J16A 1ZTJA 1WCZA 1AFQC 4YT6H 1QQ4A 4JZIA 2RA0A 3LGIA 2PTCE 3LJJA 4QT8C 3SUGA 3ZYDA 1Y8TA 2J9NA 1IQEA 2SGQE 1ZHMA 1V2OT 1OOKB 4UDWH 2AFQB 4THNH 1Y3YA 2ZGXH 3TNSA 2XBYA 5E8EH 4ZKNU 3BTKE 1AVGH 1AVXA 1QJ7B 1A5GH 4X6NA 1FLEE 3BIUH 1BTHH 3SN8A 2GZ9A 4X8UH 2ZPRA 2VGCC 2STAE 1O2QA 1TNKA 1P06A 1JIMA 4NZLA 1IAUA 1D6RA 2WPHS 5ETXA 1GG6C 1G2MA 1GCTB 5DP8A 1GGDB 3ZVFA 1KXCA 2Q6DA 3FAOA 9ESTA 4FUFA 1LMWB 1Z8JB 1P2QA 1FJSA 1EAXA 5EQQA 3SU0A 2FM2A 4ABIA 2OP9A 4ZH8A 1FY5A 3EGKH 4SGAE 2A4GA 3NCLA 2C3SA 3S7HB 2HNTF 3IWMA 1P2OA 1P01A 1QTFA 1KLIH 2VIVA 3MH7A 3SNBA 5C67A 1BDAA 1UJ1A 3EAJA 3NKKA 2ZU4A 4XBBA 2ANKH 1V2TT 2BY8X 1EAIA 2VNTA 1EJNA 1MU8B 1AGJA 1P9SA 2AH4X 1ZJDA 3Q3KA 1MD7A 2Z9IA 2BHGA 2D1JA 3K65B 4YZUA 3OY6U 5GXPA 5A8XA 1DE7H 1GJCB 1A3BH 1C2JA 1C2MA 1O2SA 3GCHC 3P6ZB 3RP2A 3RXPA 4BAHB 1HAGE 1RRKA 1Y3UA 1HJAC 2BM2A 5GJ4B 3ODDA 3BTWE 3S0NA 4UE7H 3MNCA 5A2MH 2Y5FA 1SGPE 1GHYH 4DJZB 1QRZA 3O8RA 1J15A 3SUEA 1ELEE 3UY9A 5A09A 1B0FA 1QB6A 1YPEH 1J9CH 1KSNA 4AYVB 1TLDA 1GHVH 4YTAA 3UNSA 1O3JA 5T6FA 2FO9A 3SI3H 2ZFTA 1PQ5A 2ZU3A 3LIWA 4OS4A 4YLQH 4WH8A 1SQTA 4X1SU 1TA2A 2J94A 2NU1E 4Z6AH 1C5WB 2PUQH 3UR6A 5FCKA 1NZQH 1PQ8A 2TIOA 4GLYA 3RMMH 5GDSH 2XC5A 2XCNA 1V2KT 4JK5A 1O5FH 5AFYH 1AKSB 2FPZA 1SGNE 1YBWA 2BZAA 1ZHPA 2A5KA 4FU7A 1HAVA 1HAXB 1NESE 1HB0B 2FLRH 4IMQA 7LPRA 1W12U 1BQYA 1HUTH 1UK2A 4ZHAA 4DIIH 4YOGA 1KTTB 2D8WA 3M35A 3PMAB 1Q2WA 1SQOA 2ODQA 2A5IA 4PROA 1YCPH 2ODYB 6CHAB 2ZPSA 2VB0A 1YCPM 1OYQA 3RXHA 2P59A 1C5VA 2WUBA 3A7TA 1NRPH 2Y5HA 1CA0C 1O2HA 5GWZA 2R0LA 2ZFSA 5AFZH 5DP7A 2ZU2A 1JIRA 2BX4A 1TYNA 2Q1JA 4LZ1H 2C8ZB 1VCWA 5F8ZA 2VIWA 7ESTE 1P2IA 1AY6H 3A8AA 4GVUA 4AN7A 2R2MB 3ZZ7A 1C1PA 1PQAA 2BD8A 3GDVA 1EKBB 2THFB 4FUDA 4JZEH 3U8TH 4MDSA 5EG4A 1XXDA 3VB5A 3FFGA 1YF4A 4K60A 3GYMA 2R3UA 3ZZ3A 2BX3A 3U8RH 3BTDE 1GJ8B 1UTNA 3L33A 4UFEH 1OX1A 1XX9A 1ZLRA 4WJG2 5GIBA 1JWTA 2HLCA 2AEIH 1YCPK 1C1QA 5T6GA 1HCGA 1O2XA 4LZ4B 1QBOA 1SR5C 1C2DA 1YPLH 1C9TA 1P02A 1DXWA 3BTTE 3HGPA 1INCA 2TRMA 2UUYA 1T8OA 4LK4A 4U01A 4X6PA 2VWMA 2A5AA 4KGAA 5F03A 2VJ1A 2G52A 2Z9KA 3ZZ9A 1TWXB 2FTLE 3LC3A 1GCDA 4KP0A 2RDLA 1O3CA 2QN5T 3E3TA 3KQEA 1A5HA 4Q7XA 1WUNH 3HPTB 1MTSA 1S85A 1NFYA 5CMXH 3R0FA 2A0QB 1L2EA 1Q31A 1YPMH 3RXUA 2CHAC 1ELFA 3U8OH 1BTXA 1O3GA 4JZFH 4DCDA 1L4DA 5C3NA 3LC5A 1BBRE 3HKIB 1SGTA 3SNAA 1DPOA 1FV9A 1RIWB 1AB9C 4Q80A 1T8NA 3UR9A 1ID5H 3TH2H 1KYNA 1F5RA 2F9PA 2Z9GA 1SHYA 5F8TA 2J34A 1MMJN 3AAVA 1T32A 1IQIA 1BMMH 1O2VA 1GBJA 2ZFFH 3SORA 1SLVB 2XC0A 4HFPB 3D49H 2QA9E 3CP7A 1TGBA 1V2JT 4INLA 1T7CA 1WTHD 1ZYOA 3RDZA 2ZG0H 2FOBA 4BXWA 1DSTA 1DT2A 3HATH 2GV7A 1J8AA 5ABWA 1HAPH 3RXDA 4CRCA 2BXTH 1XKAC 1EP5A 4K69A 3LDXH 1OWIA 4DY7B 1LO6A 4ABBA 1GVKB 3U9AH 1DVAH 1V2MT 1OWKA 1Y5UT 2SGAA 3HGNA 1K1LA 1VJAU 3L3TA 2Y7XA 1O3KA 4ISIH 1ANEA 4AFUA 2ALVA 5T3HA 1C4V2 3UOUA 4KELA 3GY7A 1V2VT 3DT0H 2WYGA 2QY0B 2O8UA 1AUJA 1C5YB 2QYIA 3SHAH 2ZDKA 1ELDE 4OS6A 4TWWA 1BRUP 3MU1A 1EOJA 2XNIA 5EXNA 4MPWA 4FXGH 1JRSA 2M5TA 3SU4A 1UMAH 1YM0A 1VJ9U 2BDGA 2A32A 1C5QA 1DUEA 1O3MA 1W0YH 2G00A 1EPTA 1AKSA 3W95A 5CE1A 1EAUA 1F0UA 1GI5A 3IITA 4IC5A 1TMBH 1SBWA 1C2FA 4FUHA 1J17T 2ZFQH 4ZMAH 3CS7A 1THRH 4A92A 3M7QA 3GCOA 3PMHB 2G55A 4MTBA 2GZ8A 1T8MA 1FY1A 3MH4A 3STIA 1QB1A 3RXVA 8LPRA 3JZ1B 3SQEE 1BBRH 2OUAA 3SJ9A 1G30B 2FEQH 4WMDA 1DANH 2BLOA 1UTLM 1D9IA 2ZTYA 2QF3A 1SGIB 1Y5AT 1E37B 1CVWH 3PWBA 3TK9A 1O3DA 2GT7A 4O3TA 4MNVA 1TQ0B 1K1MA 3TGIE 5LPEA 4E06H 2AGEX 2VIPA 1AHTH 3TPIZ 3A85A 1EB1H 5CHAB 4Q7YA 1N6XA 2ZCKP 2AMDA 4UONA 1PPEE 3GY5A 1TFXA 3OYPA 5LPFA 3M36A 1EATA 1HYLA 4MPVA 1N8OC 1F0RA 2GX4A 1AMHA 1K1OA 3URDA 2OC0A 1UVPA 1S84A 2ZPQA 3UUZA 2V3OH 2EI7A 1GBLA 2ZGBH 4NIYA 4CRGA 1C9PA 3P92A 3S9AA 4AOQA 1UVSH 2C8XB 1GBHA 3PV4A 1SOZA 1SG8B 1DFPA 5A0CA 2OC1A 2QF0A 2Z3EA 1K1JA 1BBRK 1X7AC 5LGOA 3SQHE 3SUFA 5A8ZA 4O3UA 3P70B 5HYOA 7KMEH 1YP9A 4O9VA 4LXBH 2XRCA 1DWBH 3K2UA 1IOEA 1WV7H 3S7KB 5E0HA 1MZDA 3BEUA 1GHXH 1C5PA 1XVOA 1TMUH 5FBIA 2Z94A 2FX4A 2H5DA 1W14U 3C27B 4X2YA 4BTIB 4WXIA 4VGCB 1C5NH 4AFSA 3I77A 2VVVA 1ANBA 4Y7BA 2BOHB 1AU8A 2FOAA 4KTSA 3ZZ8A 3PWCA 4HI3A 1HV7A 1QJ6B 4X2WA 1CU1A 1HIAB 2Q6GA 1SGFG 2RCEA 1A61H 2Y82A 3AASA 3RUOA 1FY4A 4BTUB 2F9NA 4AGJA 4JMYA 1ESBA 5K7RA 2ZDMA 3HK6B 1MQ6A 2QXGA 4YOIA 3ZV8A 3S9CA 2ZZUH 1C1SA 4YESB 4A7IB 2FTMA 2GZ7A 1IQHA 2ZHEH 1VGCC 1NM6A 2ZNKH 2ZHFH 1CBWB 3RM2H 3QTOH 1LDTT 3SU6A 4YLUA 1FDPA 4BAQB 2PLXA 3DUXH 1L1NA 2HNTC 1O2ZA 1RFNA 2BD9A 4TPIZ 4E7RG 1DY8A 1ETSH 3ZVDA 2AERH 3DFLA 1B0EA 5FX6A 1C2LA 1P2KA 1CGHA 4X8TH 4E05H 1O5CB 2GKVE 2TGPZ 2CV3A 1AWHB 3BG4B 5J4QA 3M3VA 5F8XA 3UIRA 1IHTH 3PLPA 3VB4A 1LKAA 4FUGA 4I8LA 3PTNA 5JBTA 1EOLA 4X1QU 1W2KH 2G4UA 3B9FH 3BSQA 3T26A 2AMPA 1YPKH 1HAOH 2VINA 3QX5H 3ZVEA 5DG6A 4ZUHA 2QIQA 1IQGA 1AVWA 1FY3A 4D9QA 5DP4A 3RXFA 1TX6A 1XUJA 4K8BA 1TPAE 3F6UH 3ATKA 1ELGA 3BTME 3GCTG 1MTNB 2BYAX 4X1PU 2GT8A 2ZF0H 4NA8A 2V35A 4OS7A 4AG1A 2F9BH 1BOQA 2FP7B 2V6NA 2EEKA 1DXPA 4XBDA 3SO3A 4ABHA 3RM0H 4YOJA 4BOHA 4AX9H 2FLBH 1V2RT 1OSSA 1S5SA 4HZHA 2FDAA 2FXRA 3V3MA 2P95A 3FZZA 5L2ZH 1ANCA 4B2AA 2B5TB 1YPHE 2J2UA 1XKBC 4ISOA 5C2ZA 2BD4A 4CRFA 5B6OA 4I31A 2FODA 1E36B 2BY7X 1IQKA 4MG3A 1C5ZB 4ZXXH 1GWAA 4DVAU 3P8NA 1KY9A 1TGCA 1Z7KA 1Y5BT 1M9UA 4Y8XA 2TBSA 2Z6BD 1RJXB 3OX7U 4B74A 3M7TA 1P57B 4H6SB 1E35B 2GCHG 5HM2A 3HKJB 3O8BA 1O37A 1FIWA 2OBQA 2SNVA 1QIXB 2BB4A 3QTVH 1Z6JH 1WAYB 1FI8A 3PMJA 1NRNH 2XC4A 1MBQA 4NIVA 1N1LA 5GCHF 3KHVA 3TIUA 4MNXA 3MO3A 4YT7H 2K7XA 2BXUH 3QLPH 1N6YA 1XUKA 2GVFA 1QQUA 1TPPA 1FIZA 3MU8A 3BTQE 1CBWC 4TY7A 3SGAE 1LHFH 3M3TA 1TNJA 1NFXA 3LGUA 1LQEA 1ETRH 3KL6A 5C5OA 1GMDG 5EOKA 1Z8IB 4Y0YE 3A88A 4A1XA 2A1DB 1VITG 1QBNA 1CE5A 5JB9S 4MPXA 1IHSH 4O03A 5FXLA 1P03A 1P2MA 1D3TB 3A8BA 3ZZAA 1GI6A 1MD8A 1C1OA 2XBXA 2QXHA 1QJ1B 2ZGJA 1QHRB 4FUJA 3P17H 3M5MA 3VEQB 3UFAA 1O3PB 3BIVH 1BT7A 2V0BA 5DGJA 2ZU5A 1BRAA 1TBZH 3M61U 5C20A 2WV5A 2G8TA 3MO6A 2P93A 2J92A 3BG8A 1HIAA 2H9TH 1C5SA 4XDEA 4A6LA 1GBIA 3NXPA 1O3LA 4AB8A 3TGKE 3U98H 1LKBA 1ABJH 2Q6FA 4MPUA 1TX7A 2G5VA 3AVZA 4XBCA 5ESBA 1L1JA 1JXPA 3MU5A 4DIHH 1C2KA 1W10U 1Z71A 2PGQB 4CRBA 2XXLA 3ZZDA 1PPCE 1EPTB 1HPGA 3GY6A 1H8DH 2FOFA 5AVDA 1GHAF 2RA3A 2DUCA 2FS9A 4J2YB 5EQRA 2A7HA 3U1IB 1RD3B 1ELTA 2FOHA 2SGDE 1E0FD 1BTYA 3A7ZA 4MNWA 3AW0A 2UUJB 3VGCB 3MU0A 1HAYB 1ZHRA 2H6MA 4UFFH 1O3IA 1KTSB 2ZP0H 3SV9A 5JBAS 3GY8A 3SHCH 2QGRA 3PM3A 3SJKA 2RG3A 2BD7A 2DE8A 5I25A 3RXLA 3UREA 4WH6A 5HGGA 4E7NA 3BN9A 1C5RA 2ASUB 1GCTC 1O2NA 1V2PT 3RMOH 2ZECA 1GGDC 3BTFE 1W11U 3PYHA 1SGDE 4BTTB 5GCHG 2ZDAH 4JYUH 4D8NA 1O5AB 1GBFA 3BTEE 1DY9A 1O34A 1FZZA 1ZR0A 2ANMH 1TX8A 3E1XB 5TCAA 3GICB 3T28A 1OPHB 2O8MA 2ULLA 2ZGCA 2XW9A 2B7DH 5DP5A 1SLWB 3KEEA 2NWNA 4K1EA 1TBQH 4B2BA 3STJA 1MAXA 2F9VA 3TK6A 3O8CA 2IOTA 2JH5D 1AUTC 1UVUH 1RTKA 1GI9B 1H9LB 1OWHA 1RTLA 4INKA 4SGBE 1LCYA 2ILNA 5JB8S 2QAAA 1NT1A 1F5LA 1C4U2 1PPGE 1GL0E 4GPGA 1ZPBA 4I32A 3BEFB 1A46H 2ANWA 1EZSC 2FI4E 2P8OB 2PUXB 3UNQA 4X1NU 2VWLA 3VB6A 1ACBE 2BY9X 2CJIA 4X2VA 3B23B 2Y5GA 3RXRA 4FVDA 2FYRA 5E2OA 3ATWA 3A7VA 4UEHH 3VB7A 4X2XA 4ZROA 1YPGH 2ZCHP 3VXFH 1O3FA 2V3HH 4UFGH 3EA7A 1NC6A 1SI5H 1LPKB 1W3CA 1GBBA 4GHTA 4RKOB 3V13A 2HWLB 2TGTA 5AHGH 1MH0A 1A1RA 1BRBE 1OKXA 1P09A 4IS5A 1C2HA 1GI4A 1ZRBA 2ZDNA 1O31A 2BZ6H 4CREA 4U32A 1DSUA 1SGFA 1SPJA 1EZXC 1CQQA 1EPTC 1SB1H 3SV7A 2PTNA 1FMGA 1G36A 3C1KA 2R0KA 1O3HA 1GJ7B 1KXBA 2C8WB 1G37A 1C1MA 3PLBA 2QCYA 1SL3A 4K3JA 2FZZA 5FBEA 1GHAG 3LGTA 1H8IH 1C2IA 3LKWA 5LPRA 1O2GH 1EQ9A 2OXSA 3PB1E 6CHAC 1BHXF 1Y3VA 1W13U 4LOYH 1GJDB 1ZSKA 1YLCA 2CGAA 3SNEA 3VFEA 4Q7ZA 3UPEA 3QN7A 3FP8E 1W7GH 2VWNA 3P8GA 2A45B 4HGCA 2Z9JA 2Y6TA 2FX6A 1KXAA 1TIOA 4B1TA 3MNBA 1TABE 2ANYA 2FI3E 1ELBA 1MQ5A 3KGPA 4NFEA 3PLKA 1O36A 2PKSB 2FYQA 6ESTA 3H7TA 3A8CA 1PPBH 3ZZ4A 1HAIH 3MNSA 1MU6B 1OXGA 1V2NT 2C4FH 1NROH 3RLYH 5BRRE 3SNCA 1PYTC 4OS5A 3ZV9A 1F0SA 1LVMA 2HPQH 2ZWLH 3LJOA 1YLDA 3MH6A 1NO9H 4MLFB 4D9RA 1BTZA 1K21H 1A2CH 5G4BA 2WINI 2ZKSA 1ELVA 4ISLA 4OS2A 2IPHA 3F68H 3ZZ6A 4BANB 3OY5U 1Z6EA 3H7OA 1MKXH 1NY22 3LGVA 4ISNA 1SGCA 2AIQA 1K22H 3UWIA 2Z7FE 5BPEA 3TVJB 1Y59T 1K1NA
chains in the Genus database with same CATH superfamily
4IW4E 3S69A 3UTUH 3CS0A 1IQNA 1ZTKA 1AD8H 1TQ7B 1UTMA 1LHEH 3MNXA 2OCVB 1O3NA 1DLEA 2OBOA 4IMZA 4BAOB 2HLDD 1TPSA 2M2AA 1TGSZ 2HALA 2OINA 4NFFA 1ARBA 1P11E 3L6PA 3NWUA 2IPQX 1KLJH 1UK3A 1MCVA 4YO9A 1LTOA 1IQLA 2F3CE 3TJUA 2VIDA 3ZYEA 3RXOA 1O2KA 1JOUB 3GY2A 1AI8H 1O39A 2LPRA 1GJ9B 4P00A 3GISB 5T6DA 5PTPA 1QA0A 6GCHF 1CO7E 1O3OA 3Q3YA 2Y7ZA 4CH2B 1FAKH 4K1TA 1TRNA 1TRYA 1UO6A 1S82A 1L4ZA 1EZQA 1ZMNA 2EQNA 2XBWA 3LPRA 2WPIS 2P3FH 1L1GA 3MMGA 1ETTH 2A7JA 2ZGHA 8KME2 1GMCG 1DICA 2BDAA 2Y81A 4ABFA 4XSKU 1DITH 3A8DA 2WPLS 4J1YA 3QGNB 2VIOA 1MKXK 2I6QA 1G3CA 1RIWC 5DSFA 2ODPA 1G32B 3SV8A 1ZPCA 1O3EA 1TPOA 3GCTF 1S83A 1GHBF 1K1IA 2WPJS 3GYLB 1EX3A 4MQAA 2KCAA 1XXFA 1S6FA 1TBRH 3VXEH 3MHWU 4Y71A 5JBBS 5A0AE 1UTJA 1UVTH 1QA7A 1HXFH 4XFQA 2CN0H 4I33A 2HVXA 4H4FA 1QB9A 2R2WU 2J95A 2BQ6B 2ALPA 3OEED 1O5EH 2UUKB 1EASA 1AFEH 3KQBA 4AGKA 1OS8A 3ZVCA 1Y3WA 1P8VC 1TGTA 2GD4B 2IJD1 2PHBA 2DE9A 1QZ8A 2WUCA 3SZNA 1DX5M 4RN6A 2TGDA 2PKSC 3SJIA 1QL8A 1GJBB 3GOVB 2AS9A 1D4PB 1GI0A 1VKYA 1O2WA 1V2LT 2FESH 1RTFB 1G9IE 1UHBB 2GCHF 2WPMS 3ZZCA 1E34B 1MAYA 2C90B 3FP7E 2G4TA 2GMTB 2UWPA 1UTPA 1MZAA 2BDCA 1ELAA 2C93B 2LELA 5E2PA 3A82A 1LHGH 5C1UA 3ELAH 1O2IA 3SW2B 4TSFD 1A4WH 3SV2H 1UVOA 1ORFA 5SGAE 2QF4A 1MTVA 1HRTH 2VGCB 2JETB 4GUXA 3TH4H 1ZTLA 3TITA 5KEDA 3D65E 4ZAEA 8GCHG 2KAIB 2XWBI 1LVOA 2VIQA 1ZPZA 4Y76A 3ZZ5A 1SVPA 3P8FA 2JH0D 1BUIA 1GMDF 1ANDA 4F49A 1GG6B 1HFDA 1LVYA 5EJ1A 4YM9A 5DP6A 1W8BH 4H42U 1VITF 2AHME 1A0LA 1AO5A 1OP8A 3E8LA 1B5GH 4A1VA 3T29A 1UTQA 1O33A 5FPYA 1NN6A 1KXDA 1O2RA 1GBMA 2FMJA 2AMQA 1WOFA 2CXVA 1SFIA 2FOGA 1C5TA 1QY6A 2JJ1D 2LNCA 1TA6A 4NWLA 3URCA 1CHOG 6GCHG 4I8JA 1DS2E 1H9IE 7GCHG 4Y0ZE 3FP6E 1XMNB 1WTGH 3A84A 1C5XB 3T25A 3B8JA 5CHAC 2VU8E 3A89A 1QRXA 1FQ3A 1BCUH 2BVXH 4ZHMU 2F9UA 4NIWA 2KM0A 3F2HA 1GI2A 2BMGB 2ESTE 2Z3DA 3OFND 2PKAB 3RXIA 1PJPA 1ZOMA 2ZFRH 3GCHB 2QV1A 1UCYE 3QWCH 2Y80A 3A81A 1WYKA 1GHBG 3ATLA 2GCTB 2VH6A 4NA7A 4UD9H 3KF2A 1SMFE 1YGCH 2A4RA 5J4SA 2W26A 1GBKA 9LPRA 1O2LA 1LHCH 4FUEA 2FOCA 4KKDA 4OGYA 3DD2H 2ZU1A 4XE4A 3F3BA 1BMLA 2OTVA 4JYTA 2ZFPH 1QL7A 2SGFE 4ISHH 1C5LH 1MUEB 5DPAA 1SGQE 3RU4T 2W3KA 4BXSA 1W0KD 3VPKA 3RXCA 2JKHA 3A83A 4JK6A 3NK8A 1GHZA 1HLTH 1Z8RA 1BHXB 3BV9B 2D2DA 1TAWA 2F9OA 1H4WA 1LQDB 2ZHWH 4VGCC 4WMFA 1WQVH 1UTOA 4RT1A 2PFEA 1BZXE 1HJ9A 1U6QA 3DFJA 2FWWA 4Y11E 1OP0A 3MOCA 3KQDA 4CRDA 1EAWA 1VITH 2B9LA 4M9FA 1JMOH 1NBME 2GMTC 1MBMA 3SU1A 4WVPE 5EW2H 3WY8A 4AB9A 4O97A 2YOLA 2BD3A 1OWDA 1H8ED 3HK3B 2BLWA 3D23A 1F7ZA 4Y10E 1D3DB 2J98B 3QZQA 1FNIA 4AORA 4B6FA 1LHDH 3G01A 2JETC 2O9QA 1Q3XA 2YNBA 1CA0B 4I7YH 1FN8A 4ESTE 1FN6A 2VVCA 2BD2A 1BB0B 2HVYB 4Z0KA 1GMHF 3F9GA 3DSOA 4GCHG 5JPMH 1A3EH 3NPSA 4U30A 2PSXA 2GP9B 1HJ8A 1C1RA 2H1UA 4DGJA 2GDEH 1PQ7A 1BJVA 4ABDA 4X6OA 3BG4C 2OQ5A 2BDIA 1O2PA 1UCYH 2EA3A 2RDEA 4HG6A 1BIOA 2IJOB 3TNTA 3QK1A 4CBNA 1A0JA 1QL9A 8ESTE 2HNTE 5JYIA 3SOSA 1KDQB 2ZHQH 1G3BA 4NSYA 4NZQA 1YYY1 3MQKC 1O0DH 4WWYA 1GVZA 2XWAA 1EJAA 4K2YA 2GTBA 1K2I1 2BOKA 2C8YB 1UHBA 4DURA 1PPZA 1DUAA 2ZCLP 3Q76A 1C1UH 1XUGA 2ZDVH 3U1JB 4JZDH 5EXMA 1NPMA 1T8LA 1EP6A 1GDNA 4XD7D 4CRAA 3PMBB 2TPIZ 3QGJA 4ZCNA 3SV6A 1MTNC 4DOQA 3EBNA 2G51A 1O2JA 4B75A 3GY4A 3SI4H 1MKWH 2GCTC 1K9OE 1ELCA 3A87A 1GHWH 4HTCH 2WPDD 5TCCA 1JRTA 3SJOA 1AN1E 1AIXH 3ATIA 1EB2A 2Z9LA 1VCPA 2KAIA 1RXPA 5GNDA 1GI8B 2WV9A 3GCNA 4JCNA 2HPPH 1MTWA 1S81A 2W7SA 3TJVA 1IQMA 1ESTA 4I8GA 3T62A 2HRVA 3K9XB 1A0HB 3H5CB 4FU8A 3M3SA 1J14A 1UCYK 3KIDU 1MABB 4X0WU 4ASHA 4X8VH 2A4OA 2ZIQH 5TJXA 4AZ2B 5FX5A 5HMAA 2PWXA 1GDQA 3MTYA 2CHAB 3RXBA 2YNAA 3LH1A 1IQJA 4B73A 1T4UH 1P0SH 2A4QA 1O5DH 4INHA 1VR1H 1EZUC 1TNHA 2OC7A 1BJUA 2R9PA 3GY3A 3CENA 4TYDA 2IN2A 3KN2A 1H9HE 1UK4A 1AB9B 1WSSH 2CMYA 3N7DA 4U2WA 1SLXB 2BTCE 3DSPA 1BTWA 4IN1A 1C5UA 3KQCA 3RC5A 3Q3XA 2A2QH 1SC8U 2KZ4A 1K0HA 2EI8A 1AE8H 1P10A 2BVSH 1AWFH 1O32A 1SOTA 1SLUB 3PTBA 4NSVA 1MKWK 5EPYA 1NFUA 3U69H 2BQ7B 1C1VH 4K8YA 1W7XH 1AQ7A 2PKAA 3A7XA 4X6MA 1G3EA 1OP2A 5EJLA 3RMLH 3MWIU 3LGYA 1ZZZA 2JDID 3OTJE 5IDKA 1ZRKA 2AIPA 2FOEA 3OAAD 1P9UA 1O2TA 1TGNA 1GMHG 2FS8A 3N7EA 3AW1A 4ZHLU 1AZZA 4Y79A 5H4IB 3LU9B 2AYWA 3S9BA 3RXEA 2FIRH 1P3EA 1ZGVA 3A80A 2PGBB 1NRSH 1XVMA 2ZQ2A 1CHGA 1P3CA 2BDBA 3ITIA 1Z1JA 3SNDA 1D6WA 4WF8A 2PP6A 1ZJKA 2JH6D 1OYTH 3OU0A 5DKMA 2KCYA 4BAMB 1BMAA 1O30A 1C2GA 3EE0B 3KYGA 2J38A 1P2JA 1O3AA 5JDUB 2BY5X 1ZSLA 1BTPA 5FPSA 1TOCB 3MYWA 3MU4A 2K0QA 3K6ZA 4ABEA 2FOMB 3O8DA 1WXRA 1SHHB 4D7FA 1THSH 4KTUA 4AG2A 1RS0A 4B71A 3FZDA 2QXIA 4X1RU 4BAKB 1C5MD 1QR3E 2R3YA 3UWJH 2WYJA 1F0TA 3BTGE 2UUFB 1QFKH 3WW7A 4FUBA 5IYTA 4TWYA 1ARCA 1GMCF 3ODFA 3RXQA 3SGBE 3ESTA 2HOBA 3M7UA 1ZMJA 2ZQ1A 2W7UA 1F92A 2J98A 3TLOA 3F1SB 4CH8B 5FAHA 3TGJE 4ZKRU 1CT0E 2QXJA 2BD5A 3DHKH 4ABAA 1GL1A 5ESTE 3F9FA 3N7OA 3KNXA 2HGTH 3UQOA 1NTPA 1O5GH 1D3QB 1G3DA 3NRLA 3QUMP 2H5CA 1KLTA 4OS1A 2I6SA 4AFQA 3I78A 2O8TA 4D76A 1FXYA 3BF6H 3DA9B 4A1TA 5F6MA 1VZQH 1DWDH 4I8KA 4Y8ZA 3TJOA 5C0TA 1EUFA 2NU0E 3P8OA 1O2OA 1TOMH 4NA9H 4GHQA 3VGCC 3PROA 2BQWB 1K28D 1N8OB 1Z1IA 2CF9H 2NU2E 3RXJA 3RMNH 2ZTZA 2WSSD 1LPZB 1DM4B 1SQAA 4CR5A 3TK5A 1FPCH 2A7CA 4FUIA 2W6JD 2W3IA 1HGTH 1EXFA 3ATMA 1KDQA 2OLGA 1AE5A 2SFAA 1B7XB 3FANA 3PO1B 4DW2U 4K5ZA 1V2WT 3GDUA 4KTCA 1OWEA 1WU1A 1KIGH 3RU4E 1E38B 1C1NA 4FVBA 3RXMA 1TE0A 5FCRA 1GI1A 1YC0A 4D7GA 3RXAA 6LPRA 5L2YH 2VBCA 3V12A 4DT7B 3E0PB 2WV4A 3A7YA 3RXKA 1Z8GA 1KXEA 3MFJA 3QO6A 1HAHH 3RU4D 4R8TB 5C1YA 4NWKA 2F91A 2BLVA 1Y3XA 3BTHE 3UOPA 1V2UT 1NU9A 1XM1A 1CA8B 1BTUA 3MH5A 3OSYA 3F9HA 4ABJA 4GAWA 3E6PH 5DO4H 4R0IA 1QNJA 4MNYA 1MTUA 1WBGB 2VH0A 5HIYA 8GCHF 1GDUA 5A0BA 1C4Y2 1SSXA 3RXSA 3FO8D 1QCPA 3KCGH 3EYDA 1V2QT 2AGGX 1TB6H 2LIZA 1QRWA 4DT4A 3P95A 2P8OC 1P2NA 3ZVBA 4ZKOU 1WQSA 3TJNA 1A7SA 2ZA5A 2KCPA 4RT0A 3W94A 3EA9A 2A2XH 4Y7AA 3V7TA 1TNLA 1ZGIA 1YY3A 3LGWA 2GDDA 2PSYA 1O35A 1VGCB 4A5TS 1CHOF 3NZIA 3SGQE 7GCHF 1C1TA 4FUCA 3OE7D 2A31A 4FOUC 4I8HA 4DG4A 2BDYA 3MO9A 2PR3A 1BMFD 3A7WA 1GJ6A 3ZVGA 5HM9A 1GBDA 3F9EA 3NUMA 1CSOE 5L6NH 1TONA 1F5KU 3SUDA 1GJAB 3Q00A 4B76A 3FOAA 1GBAA 1GJ5H 3V0XA 2SNWA 3SBKA 5AF9H 1CGJE 1H1BA 5LH8A 1A5IA 2TGAA 2K1QA 2GGVB 2O8WA 2STBE 3T27A 3LOXA 4RSPA 1O3BA 4XOJA 3RLWH 4AYYB 1FAXA 2J4IA 1QGFA 5FPTA 1NS3A 4NGAH 2CF8H 1HXEH 4B2CA 5EU8A 1D3PB 3IG6B 1SGYE 5K0HA 2BDHA 2ZEBA 3RXGA 2YMSC 3SU3A 5DP9A 2ZO3H 2P94A 1TRMA 1O2YA 1XUFA 4CHAB 1YPHC 3LH3A 5L30H 2GV6A 1O2UA 5C5NA 3EDXB 3ENSB 5EQSA 3RXTA 1GI3A 2F83A 4Q2KA 1YPJH 5A8YA 1BRCE 3GDSA 3SJ8A 1E1QD 4ABGA 4X8SH 1HBTH 3E91A 2O8LA 2UWOA 3PO1C 1GPZA 2G81E 3SU2A 1YLNA 1F2SE 4IGDA 4ZXYH 5JBCS 1CGIE 2L74A 4JYVH 3M5NA 1QBVH 4MVNA 1UTKA 2XCFA 3EQ0H 4AFZA 1AFQB 2ZTXA 5DJ7A 1DWCH 4M7GA 2OD3B 1ABIH 3AAUA 2H9EH 4OGXA 3M5LA 1C5OH 2PV9B 2XBVA 1VCQA 2VWOA 1C1WH 3VB3A 1ESAA 1NRQH 4K1SA 3BEIB 2H9HA 3K6YA 3SU5A 1HAZB 4CR9A 1O5BB 1AZ8A 4H6TA 5GPIB 4Y6DA 1GBTA 1YKTA 1G2LA 2BY6X 1DWEH 1YWUA 2P3UB 3I29A 2H2ZA 1HNEE 1SGRE 1LVBA 3D62A 2OQUA 2SGEE 5EXLA 2J5UA 3OEHD 1C2EA 2NU3E 1FONA 1LPGB 1O2MA 1V2ST 1V6DA 3ZVAA 3E16B 1NFWA 1T4VH 2VVUA 2ZI2H 4GCHF 2KR7A 3RC4A 1S0RA 1XUIA 1FY8E 1HDTH 1P12E 2B0FA 2ZDLA 1BMNH 5C1XA 5EGMA 4IC6A 1K1PA 1ZMLA 3E90B 2BVRH 1PFXC 3Q77A 4FU9A 2XTTB 3R3GB 4GSOA 1CT2E 4UFDH 4BNRA 3UQVA 1PYTD 4TY6A 2XOKD 2W5EA 3LONA 3M5OA 1L0ZA 3JZ2B 2P16A 5FHTA 2V7QD 3FN8A 1TMTH 5DP3A 1CT4E 1JBUH 1P05A 1TNIA 2G5NA 3QZRA 5E0JA 3T2NA 1RGQA 1HAVB 1S0QA 1GBEA 4NG9H 5DK1A 2QE7D 2UWLA 1ZSJA 5EPNA 3M37A 1S6HA 4TPYA 2Z3CA 4IBLH 4WMEA 1PPHE 3FKSD 4JZ1A 1V3XA 4ZKSU 2AGIX 1O38A 1BA8B 1H8HD 1SGEE 3E0NB 1SFQB 5HXFA 4CBOA 4NCYA 2EC9H 3EA8A 2SGPE 1P04A 2P3TB 3LT3A 3EE7A 4IN2A 3TU7H 4WY3A 3A86A 1GBCA 1HJAB 1TNGA 1KXFA 2PW8H 1W0ZU 1XUHA 2ZHDA 3TH3H 1NU7B 5EW1H 4NIXA 3RC6A 2XYAA 1DLKB 1OWJA 4CHAC 1T31A 2WPKS 3ZZBA 4RKJB 1MCTA 4F4OC 1QURH 3MI4A 1NRRH 1FPHH 3FVFB 2D26C 5EODA 2QC2A 1FUJA 5I46H 3UNRA 1BITA 1TALA 2EI6A 1EJMA 4Y8YA 1THPB 2B8OH 3QDZB 4WXVA 2OK5A 1PPFE 2OC8A 1GI7B 2ZC9H 5E0GA 1GJ4H 2NU4E 2BLQA 1IQFA 1DOJA 3T5FH 1DDJA 1GVLA 2FI5E 1J16A 1ZTJA 1WCZA 1AFQC 4YT6H 1QQ4A 4JZIA 2RA0A 3LGIA 2PTCE 3LJJA 4QT8C 3SUGA 3ZYDA 1Y8TA 2J9NA 1IQEA 2SGQE 1ZHMA 1V2OT 1OOKB 4UDWH 2AFQB 4THNH 1Y3YA 2ZGXH 3TNSA 2XBYA 5E8EH 4ZKNU 3BTKE 1AVGH 1AVXA 1QJ7B 1A5GH 4X6NA 5FL7D 1FLEE 3BIUH 1BTHH 3SN8A 2GZ9A 4X8UH 2ZPRA 2VGCC 2STAE 1O2QA 1TNKA 1P06A 1JIMA 4NZLA 1IAUA 1D6RA 2WPHS 5ETXA 1GG6C 1G2MA 1GCTB 2EY4C 5DP8A 1GGDB 3ZVFA 1KXCA 3N99A 2Q6DA 3FAOA 9ESTA 4FUFA 1LMWB 1Z8JB 1P2QA 2LP6A 1FJSA 1EAXA 5EQQA 3OTPA 3SU0A 2FM2A 4ABIA 2OP9A 4ZH8A 1FY5A 3EGKH 2WHXA 4SGAE 2A4GA 3NCLA 2C3SA 3S7HB 2HNTF 3IWMA 1P2OA 1P01A 1QTFA 1KLIH 2VIVA 3MH7A 3SNBA 5C67A 1BDAA 4B6EA 1UJ1A 3EAJA 3NKKA 2ZU4A 4XBBA 2ANKH 1V2TT 2BY8X 1EAIA 2VNTA 1EJNA 1MU8B 1AGJA 1P9SA 2AH4X 1ZJDA 3Q3KA 1MD7A 2Z9IA 2BHGA 2D1JA 3K65B 4YZUA 3OY6U 5GXPA 5A8XA 1DE7H 1GJCB 1A3BH 1C2JA 1C2MA 1O2SA 3GCHC 3P6ZB 3RP2A 3RXPA 4BAHB 1HAGE 1RRKA 1Y3UA 1HJAC 2BM2A 5GJ4B 3ODDA 3BTWE 2J97A 3S0NA 4UE7H 3W1EA 3MNCA 5A2MH 2Y5FA 1SGPE 1GHYH 4DJZB 1QRZA 3O8RA 1J15A 3SUEA 1ELEE 3UY9A 5A09A 1B0FA 1QB6A 1YPEH 1J9CH 1KSNA 1UW7A 4AYVB 1TLDA 1GHVH 4YTAA 3UNSA 1O3JA 5T6FA 2FO9A 2W6ID 3SI3H 2ZFTA 1PQ5A 2ZU3A 3LIWA 4OS4A 4YLQH 2KX4A 4WH8A 1SQTA 5EIYA 4X1SU 1TA2A 2J94A 2NU1E 4Z6AH 1C5WB 2PUQH 3UR6A 5FCKA 1NZQH 1PQ8A 2TIOA 4GLYA 3RMMH 5GDSH 2XC5A 2XCNA 1V2KT 4JK5A 1O5FH 5AFYH 1AKSB 2FPZA 1SGNE 1YBWA 2BZAA 1ZHPA 2A5KA 4FU7A 3UAIC 1HAVA 1HAXB 1NESE 1HB0B 2FLRH 4IMQA 7LPRA 1W12U 1BQYA 1HUTH 1UK2A 2F4LA 4ZHAA 4DIIH 4YOGA 1KTTB 2D8WA 3M35A 3PMAB 1Q2WA 1SQOA 2ODQA 2A5IA 4PROA 1YCPH 2ODYB 6CHAB 2ZPSA 2VB0A 1YCPM 1OYQA 3RXHA 2P59A 1C5VA 2WUBA 3A7TA 1NRPH 2Y5HA 1CA0C 1O2HA 5GWZA 2R0LA 2ZFSA 5AFZH 5DP7A 2ZU2A 1JIRA 2BX4A 1TYNA 2Q1JA 4LZ1H 2C8ZB 1VCWA 5F8ZA 2VIWA 7ESTE 1P2IA 1AY6H 3A8AA 4GVUA 3DSGA 4AN7A 2R2MB 3ZZ7A 1C1PA 1PQAA 2BD8A 3GDVA 1EKBB 2THFB 4FUDA 4JZEH 3U8TH 4MDSA 5EG4A 1XXDA 3VB5A 3FFGA 5HIZA 1YF4A 4K60A 3GYMA 2R3UA 3ZZ3A 2BX3A 3U8RH 3BTDE 1GJ8B 1UTNA 3L33A 4UFEH 1OX1A 1XX9A 1ZLRA 4WJG2 5GIBA 1JWTA 2HLCA 2AEIH 1YCPK 1C1QA 5T6GA 1HCGA 1O2XA 4LZ4B 1QBOA 1SR5C 2CK3D 3U28C 1C2DA 3ZIAD 3H09A 4F55A 1YPLH 1C9TA 1P02A 1DXWA 3BTTE 3HGPA 1INCA 2V3MA 2TRMA 2UUYA 1T8OA 4LK4A 4U01A 4X6PA 2VWMA 2A5AA 4KGAA 5F03A 2VJ1A 2G52A 2Z9KA 3ZZ9A 1TWXB 2FTLE 3LC3A 1GCDA 4KP0A 2RDLA 1O3CA 2QN5T 3E3TA 3KQEA 1A5HA 4Q7XA 2KFWA 1WUNH 3HPTB 1MTSA 1S85A 3WWFA 1NFYA 5CMXH 3R0FA 2A0QB 1L2EA 1Q31A 1YPMH 3RXUA 4P02A 2CHAC 1ELFA 3U8OH 1BTXA 1O3GA 4JZFH 4ACAA 4DCDA 1L4DA 5C3NA 3LC5A 1BBRE 3HKIB 1SGTA 3SNAA 1DPOA 1FV9A 1RIWB 1AB9C 4Q80A 1T8NA 3UR9A 1ID5H 3TH2H 1KYNA 1F5RA 2F9PA 2Z9GA 1SHYA 5F8TA 2J34A 1MMJN 3AAVA 1T32A 1IQIA 1BMMH 1O2VA 1GBJA 4OM9A 2ZFFH 2F43B 3SORA 1SLVB 2XC0A 4HFPB 4ASUD 3D49H 2QA9E 3CP7A 1TGBA 1V2JT 4INLA 1T7CA 1WTHD 1COWD 1ZYOA 4XRNA 1E1RD 3RDZA 5DN6D 2ZG0H 2FOBA 4BXWA 1DSTA 1DT2A 3HATH 2GV7A 1J8AA 5ABWA 1HAPH 3RXDA 4CRCA 2BXTH 1XKAC 1EP5A 4K69A 3LDXH 3UB0A 1OWIA 4DY7B 1LO6A 4ABBA 2WZQA 1GVKB 5EJZA 3U9AH 1DVAH 1V2MT 1OWKA 1Y5UT 2SGAA 3HGNA 1K1LA 1VJAU 3L3TA 2Y7XA 3F2FA 1O3KA 3F0OA 4ISIH 1ANEA 4AFUA 2ALVA 5T3HA 1C4V2 3UOUA 4KELA 3GY7A 5IK2D 1V2VT 3DT0H 2WYGA 2QY0B 2O8UA 1AUJA 1C5YB 2QYIA 3SHAH 2ZDKA 1ELDE 4OS6A 1SQRA 4TWWA 1BRUP 3MU1A 1EOJA 2XNIA 5EXNA 3F0PA 4MPWA 4FXGH 4AC9A 1JRSA 2M5TA 3SU4A 1UMAH 1YM0A 1VJ9U 2BDGA 2A32A 1C5QA 1DUEA 1O3MA 1W0YH 2G00A 1EPTA 1AKSA 3W95A 5CE1A 1EAUA 1F0UA 1GI5A 3IITA 4IC5A 1TMBH 1SBWA 1C2FA 4FUHA 1J17T 2ZFQH 4ZMAH 3CS7A 1THRH 4A92A 3M7QA 3GCOA 3PMHB 2G55A 4MTBA 2GZ8A 1T8MA 1FY1A 3MH4A 3STIA 1QB1A 3RXVA 8LPRA 3JZ1B 3SQEE 1BBRH 2OUAA 1OHHD 3SJ9A 1G30B 2FEQH 4WMDA 1DANH 2BLOA 1UTLM 1D9IA 2ZTYA 2QF3A 1SGIB 1Y5AT 1E37B 1CVWH 3PWBA 3TK9A 1O3DA 5F53A 2GT7A 4O3TA 4MNVA 1TQ0B 1K1MA 3TGIE 5LPEA 4E06H 2AGEX 2VIPA 1AHTH 3TPIZ 3A85A 1EB1H 5CHAB 4Q7YA 1N6XA 2ZCKP 2AMDA 4UONA 1PPEE 3GY5A 1TFXA 3OYPA 5LPFA 3M36A 1EATA 1HYLA 4MPVA 1N8OC 1F0RA 2GX4A 1AMHA 1K1OA 3URDA 2OC0A 1UVPA 1S84A 2ZPQA 3UUZA 5HKKD 2V3OH 2EI7A 1GBLA 2ZGBH 4NIYA 4CRGA 1C9PA 3P92A 3S9AA 5CHBA 4AOQA 1UVSH 2C8XB 1GBHA 3PV4A 1SOZA 1SG8B 1DFPA 5A0CA 2OC1A 2QF0A 2Z3EA 1K1JA 1BBRK 1X7AC 5LGOA 3SQHE 3SUFA 5A8ZA 4FETA 4O3UA 3P70B 5HYOA 7KMEH 1YP9A 4O9VA 4LXBH 2XRCA 1DWBH 3K2UA 1IOEA 4TT3D 2XNDD 1WV7H 3PRBA 4Q4LA 3S7KB 5E0HA 1MZDA 3BEUA 1GHXH 1C5PA 1XVOA 1TMUH 5FBIA 2Z94A 1SKYE 2FX4A 2H5DA 1W14U 3C27B 4X2YA 4BTIB 4WXIA 4ACBA 4VGCB 1C5NH 4AFSA 1EFRD 3I77A 2VVVA 1ANBA 4Y7BA 2BOHB 1AU8A 2FOAA 4KTSA 3ZZ8A 1FX0B 3PWCA 4HI3A 1HV7A 1QJ6B 4X2WA 1CU1A 1HIAB 2Q6GA 1SGFG 4F48B 2RCEA 1A61H 1E79D 2Y82A 3AASA 3RUOA 1FY4A 4BTUB 2F9NA 4AGJA 4JMYA 2JIZD 1ESBA 5K7RA 2ZDMA 3HK6B 1MQ6A 2QXGA 4YOIA 3ZV8A 3S9CA 2ZZUH 1C1SA 4YESB 4A7IB 2FTMA 2GZ7A 1IQHA 2ZHEH 1VGCC 1NM6A 2ZNKH 2ZHFH 1CBWB 3RM2H 3QTOH 1LDTT 3SU6A 4YLUA 2QF5A 1FDPA 4BAQB 2PLXA 3DUXH 1L1NA 2HNTC 1O2ZA 1RFNA 2BD9A 4TPIZ 4E7RG 1DY8A 1ETSH 3ZVDA 2AERH 3DFLA 1B0EA 5FX6A 1C2LA 1P2KA 1CGHA 4X8TH 4E05H 1O5CB 2GKVE 2TGPZ 2CV3A 1AWHB 3BG4B 5J4QA 3M3VA 5F8XA 3AK5A 3UIRA 1IHTH 3PLPA 1KMHB 3VB4A 1LKAA 4FUGA 4I8LA 3PTNA 5JBTA 1EOLA 4X1QU 1W2KH 2G4UA 3B9FH 3BSQA 3T26A 2AMPA 1YPKH 1HAOH 2KCOA 2VINA 3QX5H 3ZVEA 5DG6A 4ZUHA 2QIQA 1IQGA 1AVWA 1FY3A 4D9QA 5DP4A 3RXFA 1TX6A 1XUJA 4K8BA 1TPAE 3F6UH 3ATKA 1ELGA 3BTME 3GCTG 1MTNB 2BYAX 4X1PU 2GT8A 2ZF0H 4NA8A 2V35A 4OS7A 4AG1A 2F9BH 1BOQA 2FP7B 5C94A 2V6NA 2EEKA 3PRDA 1DXPA 4XBDA 3SO3A 4ABHA 3RM0H 4YOJA 4BOHA 4AX9H 2FLBH 1V2RT 1OSSA 1S5SA 4HZHA 2FDAA 2FXRA 3V3MA 2P95A 3FZZA 5L2ZH 2JJ2D 1ANCA 4B2AA 2B5TB 1YPHE 2J2UA 1XKBC 4ISOA 5C2ZA 2BD4A 4CRFA 5B6OA 4I31A 2FODA 2YMSD 1E36B 2BY7X 1IQKA 3PV5A 4MG3A 1C5ZB 4ZXXH 1GWAA 4DVAU 3P8NA 1KY9A 1TGCA 1Z7KA 1Y5BT 1M9UA 4Y8XA 2TBSA 2Z6BD 1RJXB 3OX7U 4B74A 3M7TA 5KGOA 1P57B 4H6SB 1E35B 2GCHG 5HM2A 3HKJB 3O8BA 1O37A 1FIWA 2OBQA 2SNVA 1QIXB 2BB4A 5B6LA 3QTVH 1Z6JH 1WAYB 1FI8A 2K8IA 3PMJA 1NRNH 2XC4A 1MBQA 4NIVA 1N1LA 5GCHF 3KHVA 3TIUA 4MNXA 3MO3A 4YT7H 2K7XA 2BXUH 3QLPH 1N6YA 1XUKA 2GVFA 1QQUA 1TPPA 1FIZA 3MU8A 1NBMD 3BTQE 1CBWC 4TY7A 4I86A 3SGAE 1LHFH 3M3TA 1TNJA 1NFXA 3LGUA 1LQEA 1ETRH 3KL6A 5C5OA 1GMDG 5EOKA 1Z8IB 4Y0YE 3A88A 4A1XA 2A1DB 1VITG 1QBNA 1CE5A 5JB9S 4MPXA 1IHSH 4O03A 3DCLA 5FXLA 3SYJA 1P03A 1P2MA 1D3TB 3A8BA 3ZZAA 1GI6A 1MD8A 1C1OA 2XBXA 2QXHA 1QJ1B 2ZGJA 1QHRB 4FUJA 3P17H 3M5MA 3VEQB 3UFAA 1O3PB 3BIVH 1BT7A 2V0BA 5DGJA 2ZU5A 1BRAA 1TBZH 3M61U 5C20A 2WV5A 2G8TA 3MO6A 2P93A 2J92A 3BG8A 1HIAA 2H9TH 1C5SA 4XDEA 4A6LA 1GBIA 3NXPA 1O3LA 4AB8A 3TGKE 3U98H 1LKBA 1ABJH 2Q6FA 4MPUA 1TX7A 2G5VA 3AVZA 4XBCA 5ESBA 1L1JA 1JXPA 3MU5A 4DIHH 1C2KA 1W10U 1Z71A 2PGQB 4CRBA 2XXLA 3ZZDA 1PPCE 3VG8A 1EPTB 1HPGA 3GY6A 1H8DH 2FOFA 5AVDA 1GHAF 2RA3A 2DUCA 2FS9A 4J2YB 5EQRA 2A7HA 3U1IB 1RD3B 1ELTA 2FOHA 2SGDE 1E0FD 1BTYA 3A7ZA 4MNWA 3AW0A 2UUJB 3CNRA 3MU0A 3VGCB 1HAYB 1ZHRA 2H6MA 4UFFH 1O3IA 1KTSB 2ZP0H 3SV9A 5JBAS 3GY8A 3SHCH 2QGRA 3PM3A 3SJKA 2RG3A 2BD7A 2DE8A 5I25A 3RXLA 3UREA 4WH6A 5HGGA 4E7NA 3BN9A 1C5RA 2ASUB 1GCTC 1O2NA 1V2PT 3RMOH 2ZECA 1GGDC 3BTFE 1W11U 1W0JD 3PV2A 3PYHA 1SGDE 4BTTB 5GCHG 2ZDAH 4JYUH 4D8NA 1O5AB 1GBFA 4Z1MD 3BTEE 1DY9A 1O34A 1FZZA 1ZR0A 2ANMH 1TX8A 3E1XB 5TCAA 3GICB 3T28A 1OPHB 2O8MA 2ULLA 2ZGCA 2XW9A 2B7DH 5DP5A 1SLWB 3KEEA 2NWNA 4K1EA 1TBQH 4B2BA 3STJA 1MAXA 2F9VA 3TK6A 3O8CA 2IOTA 2JH5D 1AUTC 1UVUH 1RTKA 1GI9B 1H9LB 1OWHA 1RTLA 4INKA 4SGBE 1LCYA 2ILNA 5JB8S 2QAAA 1NT1A 1F5LA 1C4U2 1PPGE 1GL0E 4GPGA 1ZPBA 4I32A 3SZEA 3BEFB 1A46H 3KQ5A 2ANWA 1EZSC 2FI4E 2P8OB 5T1VA 3WWBA 2PUXB 3UNQA 3KYFA 4X1NU 2VWLA 3VB6A 1ACBE 2BY9X 2CJIA 4X2VA 3B23B 2Y5GA 3RXRA 4FVDA 2FYRA 5E2OA 3ATWA 3A7VA 4UEHH 3VB7A 4X2XA 4ZROA 1YPGH 2ZCHP 3VXFH 1O3FA 2V3HH 4UFGH 3EA7A 1NC6A 1SI5H 1LPKB 1W3CA 1GBBA 4GHTA 4RKOB 3V13A 2HWLB 2TGTA 5AHGH 1MH0A 1A1RA 1BRBE 1OKXA 1P09A 4IS5A 1C2HA 1GI4A 2L6OA 1ZRBA 2ZDNA 1O31A 2BZ6H 4CREA 4U32A 1DSUA 1SGFA 1SPJA 1EZXC 1CQQA 1EPTC 1SB1H 3SV7A 2PTNA 1FMGA 1G36A 3C1KA 4YXWD 2R0KA 3GS9A 1O3HA 1GJ7B 1KXBA 2C8WB 1G37A 1C1MA 3PLBA 2QCYA 1SL3A 4K3JA 2FZZA 5FBEA 1GHAG 3LGTA 1H8IH 1C2IA 2YMSB 3LKWA 5LPRA 1O2GH 1EQ9A 2OXSA 3PB1E 6CHAC 1BHXF 1Y3VA 1W13U 4LOYH 1GJDB 1ZSKA 1YLCA 2CGAA 3SNEA 3VFEA 4Q7ZA 5C17A 3UPEA 3QN7A 3FP8E 1W7GH 2VWNA 3P8GA 2A45B 4HGCA 2Z9JA 2Y6TA 2FX6A 1KXAA 1TIOA 5CDFE 4B1TA 3MNBA 1TABE 2ANYA 2FI3E 1ELBA 1MQ5A 3KGPA 4NFEA 3PLKA 1O36A 2RFKC 2PKSB 2FYQA 6ESTA 3H7TA 3A8CA 1PPBH 3ZZ4A 1HAIH 4RI0A 3MNSA 1MU6B 1OXGA 1V2NT 2C4FH 1NROH 3RLYH 5BRRE 3SNCA 1PYTC 4OS5A 3ZV9A 5KECA 1F0SA 1LVMA 2HPQH 2ZWLH 3LJOA 1YLDA 3MH6A 1NO9H 4MLFB 4D9RA 1BTZA 1K21H 5C0UA 3F2GA 1A2CH 5G4BA 2WINI 2ZKSA 1ELVA 1WDIA 4ISLA 4OS2A 2IPHA 3F68H 3ZZ6A 4BANB 3OY5U 1S6LA 1Z6EA 3H7OA 4Q63A 1MKXH 1NY22 3LGVA 4ISNA 1SGCA 2AIQA 1K22H 2GJGA 3UWIA 2Z7FE 5BPEA 3TVJB 1Y59T 1K1NA
chains in the Genus database with same CATH topology
4IW4E 3S69A 3UTUH 3CS0A 1IQNA 1ZTKA 1AD8H 1TQ7B 1UTMA 1LHEH 3MNXA 2OCVB 1O3NA 1DLEA 2OBOA 4IMZA 4BAOB 1TPSA 2OINA 1TGSZ 2HALA 4NFFA 1ARBA 1P11E 3L6PA 3NWUA 1KLJH 1UK3A 1MCVA 4YO9A 1LTOA 1IQLA 2F3CE 3TJUA 2VIDA 3ZYEA 3RXOA 1O2KA 1JOUB 3GY2A 1AI8H 1O39A 2LPRA 1GJ9B 3GISB 5T6DA 5PTPA 1QA0A 6GCHF 1CO7E 1O3OA 3Q3YA 2Y7ZA 4CH2B 1FAKH 4K1TA 1TRNA 1TRYA 1UO6A 1S82A 1L4ZA 1EZQA 1ZMNA 2XBWA 3LPRA 2WPIS 2P3FH 1L1GA 3MMGA 1ETTH 2A7JA 2ZGHA 8KME2 1GMCG 1DICA 2BDAA 2Y81A 4ABFA 4XSKU 1DITH 3A8DA 2WPLS 4J1YA 3QGNB 2VIOA 1MKXK 2I6QA 1G3CA 1RIWC 2ODPA 1G32B 3SV8A 1ZPCA 1O3EA 1TPOA 3GCTF 1S83A 1GHBF 1K1IA 2WPJS 3GYLB 1EX3A 4MQAA 1XXFA 1S6FA 1TBRH 3VXEH 3MHWU 4Y71A 5JBBS 5A0AE 1UTJA 1UVTH 1QA7A 1HXFH 4XFQA 2CN0H 4I33A 2HVXA 4H4FA 1QB9A 2R2WU 2J95A 2BQ6B 2ALPA 1O5EH 2UUKB 1EASA 1AFEH 3KQBA 4AGKA 1OS8A 3ZVCA 1Y3WA 1P8VC 1TGTA 2GD4B 2PHBA 2DE9A 2WUCA 3SZNA 1DX5M 4RN6A 2TGDA 2PKSC 3SJIA 1QL8A 1GJBB 3GOVB 2AS9A 1D4PB 1GI0A 1O2WA 1V2LT 2FESH 1RTFB 1G9IE 1UHBB 2GCHF 2WPMS 3ZZCA 1E34B 1MAYA 2C90B 3FP7E 2G4TA 2GMTB 2UWPA 1UTPA 1MZAA 2BDCA 1ELAA 2C93B 5E2PA 3A82A 1LHGH 5C1UA 3ELAH 1O2IA 3SW2B 1A4WH 3SV2H 1UVOA 1ORFA 5SGAE 1MTVA 1HRTH 2VGCB 2JETB 4GUXA 3TH4H 1ZTLA 3TITA 3D65E 4ZAEA 8GCHG 2KAIB 2XWBI 1LVOA 2VIQA 1ZPZA 4Y76A 3ZZ5A 1SVPA 3P8FA 2JH0D 1BUIA 1GMDF 1ANDA 4F49A 1GG6B 1HFDA 1LVYA 4YM9A 5DP6A 1W8BH 4H42U 1VITF 1A0LA 1AO5A 1OP8A 3E8LA 1B5GH 4A1VA 3T29A 1UTQA 1O33A 5FPYA 1NN6A 1KXDA 1O2RA 1GBMA 2FMJA 2AMQA 1WOFA 2CXVA 1SFIA 2FOGA 1C5TA 1QY6A 2LNCA 1TA6A 4NWLA 3URCA 1CHOG 6GCHG 4I8JA 1DS2E 1H9IE 7GCHG 4Y0ZE 3FP6E 1XMNB 1WTGH 3A84A 1C5XB 3T25A 3B8JA 5CHAC 2VU8E 3A89A 1QRXA 1FQ3A 1BCUH 2BVXH 4ZHMU 2F9UA 4NIWA 1GI2A 2BMGB 2ESTE 2Z3DA 2PKAB 3RXIA 1PJPA 1ZOMA 2ZFRH 3GCHB 2QV1A 1UCYE 3QWCH 2Y80A 3A81A 1WYKA 1GHBG 3ATLA 2GCTB 2VH6A 4NA7A 4UD9H 3KF2A 1SMFE 1YGCH 2A4RA 5J4SA 2W26A 1GBKA 9LPRA 1O2LA 1LHCH 4FUEA 2FOCA 4KKDA 4OGYA 3DD2H 2ZU1A 4XE4A 1BMLA 2OTVA 4JYTA 2ZFPH 1QL7A 2SGFE 4ISHH 1C5LH 1MUEB 5DPAA 1SGQE 3RU4T 2W3KA 4BXSA 3VPKA 3RXCA 2JKHA 3A83A 4JK6A 3NK8A 1GHZA 1HLTH 1Z8RA 1BHXB 3BV9B 2D2DA 1TAWA 2F9OA 1H4WA 1LQDB 2ZHWH 4VGCC 4WMFA 1WQVH 1UTOA 2PFEA 1BZXE 1HJ9A 1U6QA 3DFJA 2FWWA 4Y11E 1OP0A 3MOCA 3KQDA 4CRDA 1EAWA 1VITH 2B9LA 1JMOH 2GMTC 1MBMA 3SU1A 4WVPE 5EW2H 3WY8A 4AB9A 4O97A 2YOLA 2BD3A 1OWDA 3HK3B 2BLWA 3D23A 1F7ZA 4Y10E 1D3DB 3QZQA 1FNIA 4AORA 1LHDH 3G01A 2JETC 2O9QA 1Q3XA 2YNBA 1CA0B 4I7YH 1FN8A 4ESTE 1FN6A 2VVCA 2BD2A 1BB0B 4Z0KA 1GMHF 3F9GA 4GCHG 5JPMH 1A3EH 3NPSA 4U30A 2PSXA 2GP9B 1HJ8A 1C1RA 2H1UA 4DGJA 2GDEH 1PQ7A 1BJVA 4ABDA 4X6OA 3BG4C 2OQ5A 2BDIA 1O2PA 1UCYH 2EA3A 1BIOA 2IJOB 3TNTA 3QK1A 4CBNA 1A0JA 1QL9A 8ESTE 2HNTE 5JYIA 3SOSA 1KDQB 2ZHQH 1G3BA 4NSYA 4NZQA 1YYY1 1O0DH 4WWYA 1GVZA 2XWAA 1EJAA 4K2YA 2GTBA 1K2I1 2BOKA 2C8YB 1UHBA 4DURA 1PPZA 1DUAA 2ZCLP 3Q76A 1C1UH 1XUGA 2ZDVH 3U1JB 4JZDH 5EXMA 1NPMA 1T8LA 1EP6A 1GDNA 4CRAA 3PMBB 2TPIZ 3QGJA 3SV6A 1MTNC 4DOQA 3EBNA 2G51A 1O2JA 4B75A 3GY4A 3SI4H 1MKWH 2GCTC 1K9OE 1ELCA 3A87A 1GHWH 4HTCH 5TCCA 1JRTA 3SJOA 1AN1E 1AIXH 3ATIA 1EB2A 2Z9LA 1VCPA 2KAIA 1RXPA 1GI8B 3GCNA 4JCNA 2HPPH 1MTWA 1S81A 2W7SA 3TJVA 1IQMA 1ESTA 4I8GA 3T62A 2HRVA 3K9XB 1A0HB 3H5CB 4FU8A 3M3SA 1J14A 1UCYK 3KIDU 4X0WU 4ASHA 4X8VH 2A4OA 2ZIQH 5TJXA 4AZ2B 5FX5A 5HMAA 2PWXA 1GDQA 3MTYA 2CHAB 3RXBA 2YNAA 3LH1A 1IQJA 4B73A 1T4UH 1P0SH 2A4QA 1O5DH 4INHA 1VR1H 1EZUC 1TNHA 2OC7A 1BJUA 2R9PA 3GY3A 3CENA 4TYDA 2IN2A 3KN2A 1H9HE 1UK4A 1AB9B 1WSSH 2CMYA 4U2WA 1SLXB 2BTCE 1BTWA 4IN1A 1C5UA 3KQCA 3RC5A 3Q3XA 2A2QH 1SC8U 2EI8A 1AE8H 1P10A 2BVSH 1AWFH 1O32A 1SOTA 1SLUB 3PTBA 4NSVA 1MKWK 5EPYA 1NFUA 3U69H 2BQ7B 1C1VH 4K8YA 1W7XH 1AQ7A 2PKAA 3A7XA 4X6MA 1G3EA 1OP2A 3RMLH 3MWIU 3LGYA 1ZZZA 3OTJE 5IDKA 1ZRKA 2AIPA 2FOEA 1P9UA 1O2TA 1TGNA 1GMHG 2FS8A 3AW1A 4ZHLU 1AZZA 4Y79A 5H4IB 3LU9B 2AYWA 3S9BA 3RXEA 2FIRH 1P3EA 1ZGVA 3A80A 2PGBB 1NRSH 1XVMA 2ZQ2A 1CHGA 1P3CA 2BDBA 3ITIA 1Z1JA 3SNDA 1D6WA 4WF8A 1ZJKA 2JH6D 1OYTH 3OU0A 5DKMA 4BAMB 1BMAA 1O30A 1C2GA 3EE0B 2J38A 1P2JA 1O3AA 5JDUB 2BY5X 1ZSLA 1BTPA 5FPSA 1TOCB 3MYWA 3MU4A 3K6ZA 4ABEA 2FOMB 3O8DA 1SHHB 4D7FA 1THSH 4KTUA 4AG2A 1RS0A 4B71A 3FZDA 2QXIA 4X1RU 4BAKB 1C5MD 1QR3E 2R3YA 3UWJH 2WYJA 1F0TA 3BTGE 2UUFB 1QFKH 4FUBA 5IYTA 4TWYA 1ARCA 1GMCF 3ODFA 3RXQA 3SGBE 3ESTA 2HOBA 3M7UA 1ZMJA 2ZQ1A 2W7UA 1F92A 3TLOA 3F1SB 4CH8B 5FAHA 3TGJE 4ZKRU 1CT0E 2QXJA 2BD5A 3DHKH 4ABAA 1GL1A 5ESTE 3F9FA 3N7OA 3KNXA 2HGTH 3UQOA 1NTPA 1O5GH 1D3QB 1G3DA 3QUMP 2H5CA 1KLTA 4OS1A 2I6SA 4AFQA 3I78A 2O8TA 4D76A 1FXYA 3BF6H 3DA9B 4A1TA 5F6MA 1VZQH 1DWDH 4I8KA 4Y8ZA 3TJOA 1EUFA 2NU0E 3P8OA 1O2OA 1TOMH 4NA9H 4GHQA 3VGCC 3PROA 2BQWB 1K28D 1N8OB 1Z1IA 2CF9H 2NU2E 3RXJA 3RMNH 2ZTZA 1LPZB 1DM4B 1SQAA 4CR5A 3TK5A 1FPCH 2A7CA 4FUIA 2W3IA 1HGTH 1EXFA 3ATMA 1KDQA 2OLGA 1AE5A 2SFAA 1B7XB 3FANA 3PO1B 4DW2U 4K5ZA 1V2WT 3GDUA 4KTCA 1OWEA 1WU1A 1KIGH 3RU4E 1E38B 1C1NA 4FVBA 3RXMA 1TE0A 5FCRA 1GI1A 1YC0A 4D7GA 3RXAA 6LPRA 5L2YH 3V12A 4DT7B 3E0PB 2WV4A 3A7YA 3RXKA 1Z8GA 1KXEA 3MFJA 3QO6A 1HAHH 3RU4D 4R8TB 5C1YA 4NWKA 2F91A 2BLVA 1Y3XA 3BTHE 3UOPA 1V2UT 1NU9A 1XM1A 1CA8B 1BTUA 3MH5A 3OSYA 3F9HA 4ABJA 4GAWA 3E6PH 5DO4H 4R0IA 1QNJA 4MNYA 1MTUA 1WBGB 2VH0A 8GCHF 1GDUA 5A0BA 1C4Y2 1SSXA 3RXSA 1QCPA 3KCGH 3EYDA 1V2QT 2AGGX 1TB6H 2LIZA 1QRWA 3P95A 2P8OC 1P2NA 3ZVBA 4ZKOU 1WQSA 3TJNA 1A7SA 2ZA5A 3W94A 3EA9A 2A2XH 4Y7AA 3V7TA 1TNLA 1ZGIA 3LGWA 2GDDA 2PSYA 1O35A 1VGCB 4A5TS 1CHOF 3NZIA 3SGQE 7GCHF 1C1TA 4FUCA 2A31A 4I8HA 4DG4A 2BDYA 3MO9A 2PR3A 3A7WA 1GJ6A 3ZVGA 5HM9A 1GBDA 3F9EA 3NUMA 1CSOE 5L6NH 1TONA 1F5KU 3SUDA 1GJAB 3Q00A 4B76A 1GBAA 1GJ5H 3V0XA 2SNWA 3SBKA 5AF9H 1CGJE 1H1BA 5LH8A 1A5IA 2TGAA 2K1QA 2GGVB 2O8WA 2STBE 3T27A 3LOXA 4RSPA 1O3BA 4XOJA 3RLWH 4AYYB 1FAXA 2J4IA 1QGFA 5FPTA 1NS3A 4NGAH 2CF8H 1HXEH 4B2CA 5EU8A 1D3PB 3IG6B 1SGYE 5K0HA 2BDHA 2ZEBA 3RXGA 3SU3A 5DP9A 2ZO3H 2P94A 1TRMA 1O2YA 1XUFA 4CHAB 1YPHC 3LH3A 5L30H 2GV6A 1O2UA 5C5NA 3EDXB 3ENSB 5EQSA 3RXTA 1GI3A 2F83A 4Q2KA 1YPJH 5A8YA 1BRCE 3GDSA 3SJ8A 4ABGA 4X8SH 1HBTH 3E91A 2O8LA 2UWOA 3PO1C 1GPZA 2G81E 3SU2A 1F2SE 4IGDA 4ZXYH 5JBCS 1CGIE 4JYVH 3M5NA 1QBVH 4MVNA 1UTKA 2XCFA 3EQ0H 4AFZA 1AFQB 2ZTXA 5DJ7A 1DWCH 4M7GA 2OD3B 1ABIH 3AAUA 2H9EH 4OGXA 3M5LA 1C5OH 2PV9B 2XBVA 1VCQA 2VWOA 1C1WH 3VB3A 1ESAA 1NRQH 4K1SA 3BEIB 2H9HA 3K6YA 3SU5A 1HAZB 4CR9A 1O5BB 1AZ8A 4H6TA 5GPIB 4Y6DA 1GBTA 1YKTA 1G2LA 2BY6X 1DWEH 2P3UB 3I29A 2H2ZA 1HNEE 1SGRE 1LVBA 3D62A 2OQUA 2SGEE 5EXLA 1C2EA 2NU3E 1FONA 1LPGB 1O2MA 1V2ST 1V6DA 3ZVAA 3E16B 1NFWA 1T4VH 2VVUA 2ZI2H 4GCHF 3RC4A 1S0RA 1XUIA 1FY8E 1HDTH 1P12E 2B0FA 2ZDLA 1BMNH 5C1XA 5EGMA 4IC6A 1K1PA 1ZMLA 3E90B 2BVRH 1PFXC 3Q77A 4FU9A 2XTTB 3R3GB 4GSOA 1CT2E 4UFDH 4BNRA 3UQVA 1PYTD 4TY6A 2W5EA 3LONA 3M5OA 1L0ZA 3JZ2B 2P16A 5FHTA 1TMTH 5DP3A 1CT4E 1JBUH 1P05A 1TNIA 2G5NA 3QZRA 5E0JA 3T2NA 1RGQA 1HAVB 1S0QA 1GBEA 4NG9H 5DK1A 2UWLA 1ZSJA 5EPNA 3M37A 1S6HA 4TPYA 2Z3CA 4IBLH 4WMEA 1PPHE 4JZ1A 1V3XA 4ZKSU 2AGIX 1O38A 1BA8B 1SGEE 3E0NB 1SFQB 5HXFA 4CBOA 4NCYA 2EC9H 3EA8A 2SGPE 1P04A 2P3TB 3LT3A 4IN2A 3TU7H 4WY3A 3A86A 1GBCA 1HJAB 1TNGA 1KXFA 2PW8H 1W0ZU 1XUHA 2ZHDA 3TH3H 1NU7B 5EW1H 4NIXA 3RC6A 2XYAA 1DLKB 1OWJA 4CHAC 1T31A 2WPKS 3ZZBA 4RKJB 1MCTA 4F4OC 1QURH 3MI4A 1NRRH 1FPHH 3FVFB 2D26C 5EODA 2QC2A 1FUJA 5I46H 3UNRA 1BITA 1TALA 2EI6A 1EJMA 4Y8YA 1THPB 2B8OH 3QDZB 4WXVA 1PPFE 2OC8A 1GI7B 2ZC9H 5E0GA 1GJ4H 2NU4E 2BLQA 1IQFA 1DOJA 3T5FH 1DDJA 1GVLA 2FI5E 1J16A 1ZTJA 1WCZA 1AFQC 4YT6H 1QQ4A 4JZIA 2RA0A 3LGIA 2PTCE 3LJJA 4QT8C 3SUGA 3ZYDA 1Y8TA 2J9NA 1IQEA 2SGQE 1ZHMA 1V2OT 1OOKB 4UDWH 2AFQB 4THNH 1Y3YA 2ZGXH 3TNSA 2XBYA 5E8EH 4ZKNU 3BTKE 1AVGH 1AVXA 1QJ7B 1A5GH 4X6NA 1FLEE 3BIUH 1BTHH 3SN8A 2GZ9A 4X8UH 2ZPRA 2VGCC 2STAE 1O2QA 1TNKA 1P06A 1JIMA 4NZLA 1IAUA 1D6RA 2WPHS 5ETXA 1GG6C 1G2MA 1GCTB 5DP8A 1GGDB 3ZVFA 1KXCA 2Q6DA 3FAOA 9ESTA 4FUFA 1LMWB 1Z8JB 1P2QA 1FJSA 1EAXA