2A5AA

Crystal structure of unbound sars coronavirus main peptidase in the space group c2
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3C-like peptidase
publication title Crystal Structures of the Main Peptidase from the SARS Coronavirus Inhibited by a Substrate-like Aza-peptide Epoxide
pubmed doi rcsb
source organism Sars coronavirus
total genus 86
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2a5aA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2a5aA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2a5aA02
1ZTKA 1P3EA 1BTXA 1E34B 2FMJA 1XUJA 2BD7A 1UVUH 4DCDA 3E90B 1QQ4A 1GCTC 2A4RA 3NWUA 4FU8A 3L33A 2VVCA 4NFEA 2UWOA 1EAWA 1D3QB 1JWTA 2HLCA 2OUAA 1C2LA 1ARBA 1G37A 1Z8GA 2A7HA 1TABE 2ZPQA 3GOVB 3QZRA 1TQ7B 1PQ7A 1MBQA 5E2PA 1MBMA 4NIXA 3KEEA 2CJIA 3A83A 1TYNA 3RDZA 1GBMA 4Y7AA 1Y5AT 1GDQA 2IJOB 1IOEA 4CHAB 1YLCA 2ZF0H 4HFPB 4I33A 4ASHA 3SN8A 1YPJH 2F9OA 1AE8H 3D65E 3PTBA 1PJPA 1E37B 1V2RT 2G5VA 1C1VH 1O31A 4OS7A 1C2EA 2ZP0H 3BTEE 1LKAA 1O3KA 1P9SA 3UR9A 1AFQB 1ABIH 4XBCA 2ESTE 4YOJA 3SU5A 1HYLA 4BAMB 3VGCC 2P93A 2HGTH 3ZZ7A 1O30A 3P95A 3RXQA 2HPPH 2J9NA 1C5RA 1PFXC 3F1SB 4ZHMU 5J4QA 1V2PT 1O2HA 4IW4E 4A7IB 2QXIA 4A92A 3DA9B 4XOJA 1FUJA 4QT8C 5EXNA 2PKAB 2G52A 3UNSA 1GBCA 2OBQA 2TGAA 1TE0A 4ZROA 3T62A 5GCHF 5E8EH 4K60A 2TIOA 3GY3A 1O3FA 2G4TA 2ZFPH 3BN9A 1O2SA 2VIQA 4TPIZ 3RC4A 2Z9JA 1A1RA 1ZMJA 3KCGH 4Y0YE 2OLGA 1DLKB 2CHAB 1ANEA 3RXPA 2AFQB 1YPHC 1O34A 1ZOMA 3ZZDA 1HAHH 2HNTE 1ZGIA 1W2KH 2PLXA 4FUFA 3RXUA 4BXWA 2Y7XA 2UUJB 4BAOB 1GG6C 6ESTA 1T4UH 3D62A 3SJKA 1B7XB 1GI0A 1VITF 1OXGA 3PLBA 3TH4H 1SGYE 4J1YA 1MKXH 4WY3A 1QTFA 2BD3A 1O5BB 1T31A 4Y11E 5GCHG 1C5QA 2ZHFH 4X8UH 3U98H 2Y81A 1ZYOA 5EOKA 1DVAH 1G3EA 1CBWC 1H9IE 1RIWC 1CA0B 3SNDA 5A0CA 1FY8E 4X1QU 1TWXB 2CN0H 1QL8A 3LJOA 3DUXH 2PUQH 3BTWE 1GWAA 4UEHH 1AY6H 3W95A 2XC0A 4UONA 3ZVDA 2HWLB 1SHYA 3EA9A 3MI4A 4D76A 5F6MA 2ULLA 1YPKH 3E91A 1DSTA 1MU8B 4A1TA 5FX6A 5BPEA 5HMAA 1L0ZA 1INCA 1O2TA 1JIMA 1VZQH 1DITH 2BX4A 2AMQA 1GMCF 5A8ZA 1UCYH 1FZZA 1C1UH 1MMJN 1P2NA 1NTPA 1VITG 2Z6BD 3RC5A 1ELVA 1XX9A 2VGCB 5JB9S 1O5CB 1PQ5A 3ZVGA 3UNRA 3E0NB 4B73A 3SJ8A 1LVOA 4IBLH 1C5WB 1NC6A 3S9BA 1EZQA 1GDNA 2AIQA 2B5TB 1HIAB 2F9NA 1CT2E 1TX7A 2TBSA 3ATMA 2JETC 2FWWA 5C1YA 1WAYB 1OPHB 4X6NA 3OYPA 3Q77A 2UWPA 4X8SH 4IC5A 3FZZA 1CU1A 1EPTA 1WBGB 1MTWA 3ATIA 1X7AC 2GZ8A 1MTNB 1SGPE 1FPHH 4F49A 1BT7A 3BG8A 1OWDA 2HVXA 2ZGXH 4JYVH 3ZVFA 1P06A 5I25A 2STBE 4YTAA 2CF8H 3S9AA 1QFKH 1KTSB 1W7GH 1PPEE 2ZIQH 3SNAA 5J4SA 4BTTB 1UTQA 3RXAA 1IHSH 1YC0A 4WMDA 2BZ6H 1ABJH 4AG2A 1HAOH 2VVUA 3JZ1B 4OGXA 2R2WU 2WINI 3EGKH 2BXTH 2YNAA 2WV4A 2FO9A 1TAWA 1DUEA 1DANH 4NIVA 3ZZ4A 2J95A 4SGAE 3VXFH 3UIRA 3SO3A 1N6YA 2ZFSA 4I8JA 1G30B 2I6QA 1D6WA 1C1NA 4BTUB 1N8OC 4GCHF 1Y8TA 1MAYA 1OYQA 4F4OC 1BMNH 1EUFA 1XXDA 2G51A 1K1NA 1SLWB 3OY6U 1A5HA 1N6XA 4Y10E 3NKKA 4BXSA 1GBAA 1VGCC 1JOUB 1UCYE 4K1EA 1BBRK 4B74A 1BQYA 3RXDA 1AIXH 3OU0A 1RFNA 1THPB 1O2WA 1ZTLA 3TK9A 2BY9X 1C2GA 2XCFA 4JZIA 2Q6GA 1GBDA 1TPPA 5EQSA 3PTNA 3ENSB 1PPHE 4LZ4B 3KQEA 1YPGH 2BXUH 2ODPA 1JRSA 1T32A 3GYMA 2SGDE 1GI9B 3U8TH 4MPVA 1KXBA 4O03A 4I32A 1NROH 3KF2A 2FESH 3LU9B 2P8OC 5AFYH 5CMXH 1NRPH 3S69A 3P8OA 1G3CA 1LMWB 1S82A 2BLVA 4DOQA 2GT7A 2QF3A 3CS0A 1DT2A 2ZGCA 4GCHG 1LHGH 1ZPBA 3STJA 1O2ZA 1YM0A 1GGDC 5B6OA 4M7GA 2VU8E 1AWHB 4NZLA 1W13U 2C4FH 3H7OA 1YLDA 1QBNA 1F0SA 1NN6A 4GHQA 3SW2B 3U9AH 1O2KA 1KXAA 1P02A 3PLPA 4YLQH 3SI3H 2J34A 7ESTE 1EQ9A 2SGQE 5A09A 3E16B 1FLEE 1LKBA 2OCVB 1TFXA 1VJAU 4TWWA 1P03A 1WQVH 1JBUH 1HAVB 2QA9E 4ZHAA 1Z6JH 3GY7A 1OWEA 2AIPA 2PWXA 1HAVA 1P01A 3ELAH 1TGSZ 3QWCH 1P8VC 4YOGA 1LQDB 1F0UA 1RTLA 4UE7H 1O33A 3MH5A 5DG6A 1C1WH 2PSXA 5JBBS 3KQDA 4TWYA 2ZDAH 1YF4A 3RXKA 1HRTH 3GCHB 3Q3YA 4KTUA 1C1MA 2QIQA 3M5MA 1DPOA 3IWMA 5E0HA 4B2BA 2ZFRH 1NFXA 1TNKA 3A8CA 4YESB 1AFEH 3GCOA 2CHAC 4DVAU 2FOHA 3M7UA 1AD8H 1CSOE 5T6FA 1NU9A 1TALA 3CP7A 1AKSB 1MQ5A 1MAXA 1PPGE 1AKSA 2O8UA 1XUHA 3RXJA 2BVSH 1MKWK 1ARCA 3RMNH 1NY22 5F03A 4OGYA 2BLWA 3TITA 2H9EH 3QX5H 4I8GA 1BB0B 5DP4A 1XUKA 3SBKA 3SI4H 4ISLA 3BIVH 1L1NA 2XCNA 3A82A 2A2QH 1QJ6B 1BDAA 1ELCA 5AVDA 4NIWA 2ZU4A 1A7SA 1EXFA 1IQJA 1OX1A 1GI2A 3FP6E 3UQOA 1C2IA 1Y59T 1C5MD 3FAOA 3ZZAA 1BMAA 4MLFB 2VWLA 1ETSH 4Y71A 3SHAH 2NU3E 2R2MB 2GTBA 3BG4C 2A0QB 4AORA 1Y3UA 2FIRH 4MPUA 2BB4A 3F6UH 1XXFA 4TY7A 5DP8A 1T8MA 5JDUB 3KIDU 2WPIS 1ANCA 1DWDH 2OP9A 1KDQA 4AYVB 2A31A 3RXLA 2A32A 1V2UT 4X0WU 1LHEH 2OC1A 2HRVA 1O2VA 1GJ9B 4Q2KA 1F5RA 1PQ8A 5JBAS 3P8NA 1OWIA 2G8TA 1TIOA 1HJ9A 1O3IA 2QCYA 1BHXF 2BDIA 1L2EA 1K22H 1XUGA 1H1BA 1AVXA 1C4Y2 1EJAA 1KXCA 3O8CA 3U8RH 1HAXB 4Y79A 4MPXA 1O3NA 1P11E 2AS9A 3MU5A 3ATWA 5AFZH 2VIDA 3U1IB 3UFAA 3M3VA 1EPTC 2SNWA 1B5GH 1ESTA 1GBEA 1JMOH 1J17T 3MU1A 5DP9A 5C20A 3URCA 4CRAA 1K1IA 4LZ1H 1DOJA 2ZTZA 1TONA 1FIZA 3NZIA 3SV8A 2FS8A 4DG4A 3T29A 3A85A 1P04A 4GPGA 2XWBI 1ETTH 1ZTJA 4ABHA 1EJMA 4WVPE 1ZZZA 3KN2A 3RXRA 4E05H 2ZDLA 1HAPH 1SLUB 1HNEE 3STIA 2ZCHP 5A8YA 1CHGA 1TLDA 3MU4A 1TB6H 1AUTC 3EBNA 3E1XB 4DURA 4ZKSU 1SBWA 1G36A 3ESTA 1YP9A 4B1TA 3A7VA 1G2LA 4IMQA 3BTQE 1W7XH 2EI8A 2GMTB 1SGIB 2BY7X 2GCTB 1P05A 1C4V2 4X6MA 5FAHA 4NWLA 3GISB 1F0RA 4CR5A 1ELAA 1QRWA 1W12U 1P10A 5EXMA 3RU4T 3ZVEA 1UTOA 2XNIA 1LVBA 3QTOH 2H2ZA 3PO1B 2OC7A 3QGJA 5IYTA 3ZZ3A 2J38A 1Z1IA 4Q80A 4ZXXH 4OS4A 4ISIH 1QHRB 2VWOA 1KYNA 4GUXA 4MNYA 1E35B 4AB9A 2FZZA 3MNBA 1J14A 3VB4A 3BTFE 1K1PA 4FUBA 4JZDH 3K2UA 1A5GH 1C4U2 1RGQA 3P6ZB 1GBHA 1ZHRA 1YCPH 1NESE 1TGBA 2Z9GA 1Q2WA 1Y3YA 5HGGA 1NT1A 1UVOA 2FTLE 2M5TA 4BOHA 4DT7B 1PQAA 3LGTA 2PR3A 5E2OA 4YT6H 2K7XA 1C1QA 3TJNA 1ZHPA 1SVPA 5DP6A 2IN2A 4CR9A 1XMNB 4ZXYH 1LPGB 4AFSA 3ZZ9A 1GMDG 3H7TA 1WU1A 2H6MA 2ZU1A 2Z3CA 1O2YA 1W14U 4BAKB 4ZMAH 5ETXA 1O5GH 1K21H 4THNH 1OKXA 1A3BH 4H4FA 2FODA 2XBXA 5L2YH 1AZZA 3GDVA 4KP0A 2VH0A 4U30A 1KY9A 4XSKU 1ELEE 1GHWH 1TGCA 4WJG2 2ODYB 1HXEH 4BAQB 1C9TA 1B0EA 4X8TH 1FI8A 1KLIH 1GJDB 3UWIA 5LPEA 1OYTH 1RTFB 1O2XA 1UMAH 1BJVA 2SGAA 3ZZ6A 3MMGA 1VITH 3C27B 4LOYH 4ABBA 3ZZ5A 1PPCE 4RSPA 5TCCA 3V12A 3FZDA 1QIXB 1S83A 9ESTA 1D9IA 3TJUA 2QY0B 1F5LA 5FHTA 2BDBA 5DGJA 3QUMP 2ZHQH 1JXPA 1YBWA 3R3GB 3S9CA 3B23B 1MTVA 2F3CE 2GDDA 2FI5E 1Z8RA 2BTCE 3KL6A 5A0BA 3ZZ8A 1BRAA 4OS1A 1Z7KA 1J15A 2ZG0H 1GBJA 3C1KA 3DT0H 1EP6A 3RXSA 4AFQA 1UVPA 3K6YA 1AWFH 4I8HA 3UQVA 2EI6A 2PKAA 1NRSH 1HJAC 5DK1A 4I7YH 2C8YB 1SGQE 1GHYH 2XBWA 2TRMA 1BTYA 1HAZB 3EYDA 4YLUA 2WUBA 3M36A 1AB9B 2FDAA 4UDWH 5FBEA 2A45B 4K1SA 5TCAA 2PHBA 5CE1A 1GBKA 1C2KA 1SQTA 1BMMH 1W11U 1A0HB 4GLYA 5L6NH 1ELTA 1UO6A 2D1JA 2AGGX 4CBNA 3GY5A 5LH8A 1LHCH 4MNWA 3HGNA 1QA0A 5CHAB 3UUZA 1FY3A 1GVLA 2F9UA 3P8GA 3E6PH 1EKBB 2SGPE 4CBOA 1O36A 2GV6A 3MU0A 2H9HA 3M5NA 1KTTB 1LHFH 1TMBH 2PGBB 2ZHEH 1O2QA 1SGEE 1SOTA 5EQRA 1ZSJA 1IQNA 1WSSH 5F8XA 2PW8H 3ZVBA 3PYHA 1FV9A 3HATH 3L6PA 3T26A 3CENA 3GCTG 1IQIA 1NFWA 4RN6A 3GDSA 5HM9A 3HK3B 3A81A 2Y5FA 2W5EA 3SV9A 1N1LA 1SI5H 4IC6A 2G4UA 4X2YA 1DXPA 8LPRA 4Z0KA 1BRCE 3SQHE 4AX9H 1GJCB 1S81A 4ABAA 1GJ5H 4I8KA 2ZGHA 1C5PA 7KMEH 2BY5X 5A8XA 4HGCA 1O3EA 2VB0A 2D2DA 5T6GA 3A89A 1TOMH 1DUAA 1S6FA 4WH6A 3QK1A 4NWKA 1RS0A 2QXJA 3BTTE 3BTHE 1ZPZA 3MOCA 5FBIA 2YNBA 1T8NA 4LXBH 1EZUC 1VJ9U 3UY9A 2W26A 2WPMS 2H5CA 1HUTH 2ZFQH 3SNBA 3ODDA 4TYDA 2W7SA 3RMOH 4CH2B 1K1JA 2A4QA 1O2UA 1OSSA 4ABIA 1BTUA 4FUGA 2R9PA 4NSVA 5EQQA 1CT0E 3RU4D 1O3HA 1Z71A 1HIAA 2ZTXA 1PYTD 1J8AA 1L4DA 5JBCS 1O2JA 1VCWA 3M7TA 2XC5A 1O3DA 2Z3EA 4RKJB 1NM6A 3U8OH 3A7YA 3FP8E 1SGDE 1YKTA 3SGBE 1V2OT 2FX4A 2ZNKH 4FU9A 5SGAE 5GPIB 4B71A 1HFDA 2ZI2H 2G00A 3TNSA 3ZVCA 1E36B 1TMUH 2A7JA 1V2TT 3BTGE 4K5ZA 3DHKH 4JZEH 1EZSC 1JIRA 2QF0A 1BJUA 1UCYK 2ZU3A 2XXLA 3BTDE 4ZAEA 1D3DB 3SGQE 2ZPSA 1TX6A 1QL7A 3T28A 2WUCA 2ANYA 5JB8S 2W3IA 2GGVB 1YCPM 2JH6D 1DSUA 3QN7A 1FJSA 1NPMA 1F5KU 2C3SA 2CV3A 3LGVA 2PKSC 4NGAH 3A88A 2V3HH 1Y5BT 1K9OE 1ACBE 1AVGH 2BX3A 1GI4A 2XWAA 4AGKA 1HJ8A 3TK5A 2UUYA 3TVJB 1BRUP 4UFEH 2ZFFH 4MPWA 1UTKA 2AMDA 1J16A 5DP5A 1ZHMA 1UJ1A 2O8MA 4X8VH 1DWBH 2Z3DA 1C5SA 3M5OA 8GCHF 1QB1A 4UFDH 3TGKE 3SU2A 1UVTH 3EAJA 1HDTH 1M9UA 2TGDA 5GIBA 1SGRE 4K3JA 4ZHLU 3MU8A 1O39A 3B8JA 3A8BA 2C8ZB 3MFJA 3SV2H 1A0LA 2CGAA 3A8DA 3I77A 4JK5A 4WWYA 4X1RU 4ISNA 2BQWB 2PTCE 3M3TA 4A6LA 1MD8A 1DY8A 3PV4A 4UFGH 1XUIA 3MO6A 4XBBA 4X1PU 1V2ST 1NZQH 4WXIA 3E0PB 2V6NA 1VR1H 4SGBE 4X6PA 1QBVH 4CHAC 1V2LT 3D23A 2GVFA 2ZU2A 2SNVA 1IHTH 2AGEX 2LPRA 3RUOA 2AERH 3F68H 2FS9A 1LHDH 1Z8IB 4NSYA 3ATKA 1C1OA 4Y8YA 1C1TA 1DM4B 1YPEH 1O3OA 2QAAA 3PMHB 8GCHG 2A4OA 4D9RA 2OXSA 3RLWH 3HKJB 1P57B 1C2DA 1CE5A 1GDUA 1AFQC 4NA8A 4VGCB 3D49H 2LIZA 1ESAA 2P16A 1GI8B 1L1GA 1LTOA 2EI7A 4WH8A 2ZZUH 5FCKA 1FONA 1G32B 4PROA 5C1XA 2SGEE 3AAUA 1EAIA 2ZGJA 1Z1JA 2FOCA 1Y3WA 1XUFA 3MH7A 1P2IA 1O3BA 3LH3A 2W7UA 2B8OH 1AN1E 1Y5UT 4U2WA 4Y8XA 1GJBB 2BDAA 3LPRA 1GCTB 3I78A 2FM2A 1ORFA 5EG4A 2GD4B 5A2MH 4WMFA 2GX4A 1LVYA 5H4IB 1HGTH 4ESTE 1HCGA 3S7KB 3T5FH 2TGPZ 8ESTE 3TPIZ 4XE4A 1ANDA 1XKBC 1S84A 2IPHA 2ALPA 2BM2A 3V7TA 4GHTA 5LGOA 3AW0A 1O5EH 2P95A 3RXTA 2ZTYA 2Y82A 1F2SE 3VXEH 4KGAA 5I46H 4MG3A 3G01A 3SJOA 1TA2A 1THRH 1K2I1 3M37A 1L4ZA 4INLA 1H8IH 2VIPA 3PLKA 3RXEA 1ESBA 1DICA 4JYUH 5DP7A 1NU7B 2FPZA 3QZQA 3SU3A 4O3UA 1FDPA 1YPHE 3VGCB 1O5AB 1SGFA 5IDKA 2PGQB 3VEQB 4YOIA 3SV6A 1IQKA 1V3XA 2ZWLH 2ZQ1A 3UTUH 5JPMH 2TGTA 1MD7A 1CA0C 3H5CB 1TBQH 2WV5A 2QC2A 4MVNA 1V2NT 2FI4E 2HNTC 1PPFE 3SORA 1UTPA 2FI3E 1ZGVA 1C1SA 4AB8A 1BTPA 1P2QA 3A7ZA 1BTZA 4AOQA 1TNLA 3SUEA 2BDCA 2Z9KA 2BQ7B 4IMZA 1O2LA 3KNXA 3RM0H 2O8TA 3DFLA 3GY6A 1H8DH 3Q76A 3KGPA 4KTSA 3F9HA 2BVXH 4X1SU 1O3CA 4K69A 2NU2E 3PMAB 2UUFB 2GCHF 4AG1A 3HKIB 4UD9H 2VGCC 1A61H 2I6SA 3OSYA 1TPSA 5FX5A 3T2NA 5JBTA 2R0LA 3VPKA 2ZHWH 1UHBB 3P70B 3ZVAA 5DP3A 3QGNB 7LPRA 5GDSH 1VCQA 4IGDA 4KELA 5BRRE 4CRFA 3O8RA 2XRCA 3PM3A 1EOJA 1QJ1B 4KKDA 2HOBA 1P2JA 1ZJKA 1AUJA 1SFQB 1OS8A 1IQEA 3ZYEA 1BA8B 5AF9H 2ALVA 3S0NA 4DIIH 1WTGH 2Y6TA 4AFUA 2FLRH 2JKHA 1C5OH 2ZDNA 2XW9A 4JMYA 4XBDA 3PMJA 2C8XB 2PV9B 1QL9A 1DWEH 1ZSKA 3LGUA 4FXGH 1CBWB 2BZAA 1RIWB 2ASUB 1MTNC 3RMMH 1B0FA 1GVZA 3LH1A 1D4PB 1GJ6A 1FY5A 3SU1A 2VINA 2ZHDA 3QO6A 4O97A 4GSOA 1SQOA 2Z9LA 4A1VA 3K6ZA 2RDLA 3M5LA 1HAYB 2GCHG 4K8BA 1FPCH 2NU0E 1O37A 1BCUH 1RXPA 1SSXA 3PROA 3RXVA 1BHXB 4ZH8A 2ZC9H 1PYTC 4NZQA 2FTMA 4GVUA 1C5LH 4FVBA 1V2JT 2AMPA 1BUIA 2K1QA 2WPHS 5E0JA 1GHAF 2XTTB 4U32A 1QY6A 3A84A 1P12E 1F7ZA 2FXRA 2RG3A 3MHWU 4R0IA 2AYWA 3PMBB 1BOQA 1TNJA 2Y7ZA 3U1JB 6CHAB 1THSH 1GMDF 2Q6FA 4Y8ZA 1CA8B 1TMTH 4MNXA 1G2MA 5FXLA 2BQ6B 2JETB 1G3DA 1HBTH 1CGIE 1SL3A 1VCPA 1SGCA 3A7WA 1QJ7B 1DLEA 2F9PA 3EDXB 1O2PA 2JH0D 3E3TA 1ELGA 1TBZH 1CVWH 3RXOA 5DKMA 2GZ9A 2BDYA 1SQAA 3TLOA 1OOKB 2H9TH 9LPRA 4DGJA 4I31A 3SGAE 1Q31A 2A2XH 1O3PB 1MQ6A 2ZDVH 1GHAG 4Z6AH 3ODFA 1EASA 1TQ0B 3AAVA 2HALA 4ZKOU 1SLVB 2GP9B 2ZKSA 1WCZA 2R3UA 5FPTA 1K28D 3BV9B 1GVKB 1AI8H 1FIWA 3OTJE 3UPEA 1EX3A 3P17H 2WYJA 2Y5GA 3MNSA 4E06H 3VB3A 3F9EA 1GJAB 1SFIA 2BMGB 7GCHG 4WF8A 1YPMH 4B2AA 4ABFA 4VGCC 5DJ7A 1P2OA 1P0SH 4B2CA 1N8OB 1DE7H 1HV7A 2NU4E 1EZXC 2AH4X 1RRKA 4ABEA 1FNIA 1CGHA 1O0DH 2RA3A 4D7GA 3TGIE 3UNQA 3QTVH 1XM1A 1VGCB 2BOKA 2QXHA 2JH5D 4MNVA 1NS3A 4DW2U 2Y5HA 4ZKNU 3N7OA 2XYAA 2OC8A 4X2VA 1YCPK 1C5XB 1WQSA 2ZCKP 3BSQA 5EPNA 2GKVE 1GHVH 1D3PB 4JYTA 1KLJH 3NXPA 5FCRA 1FQ3A 1O2GH 2VH6A 3A80A 1SOZA 2PTNA 2OTVA 3GCHC 2A5KA 4Y0ZE 2UUKB 3Q00A 2TPIZ 2Y80A 3V0XA 3SU4A 4YT7H 5C5NA 2P8OB 1QR3E 3LGWA 1P2MA 4H42U 4TPYA 3OX7U 5LPFA 1GHBG 1MTUA 3P8FA 3VB6A 5C3NA 4NA9H 4BANB 2ZFTA 4FVDA 3MYWA 2ZGBH 1RTKA 1GGDB 5LPRA 1GL1A 1UTMA 1UTLM 3RXCA 3ZZBA 4OS6A 2A4GA 2GZ7A 2R3YA 2NWNA 2F9BH 2ZECA 3Q3KA 2PFEA 1W3CA 2B7DH 3KQCA 2J2UA 2Z7FE 1QB6A 5T3HA 5DPAA 1SC8U 2CF9H 3B9FH 3V3MA 2CXVA 3GCTF 3Q3XA 1GPZA 1HAGE 2P3UB 4D8NA 4FU7A 4CREA 1TRYA 4ABGA 2O8WA 1EATA 3FFGA 1HLTH 1CT4E 1ELDE 3FP7E 4FUEA 2BD9A 3RMLH 1S6HA 3K9XB 4ISOA 1AMHA 1HAIH 3F9GA 4NFFA 2SFAA 1BITA 1KXFA 2HNTF 5F8ZA 2QXGA 3NK8A 5C2ZA 3SU0A 5K7RA 4AGJA 4I8LA 4DIHH 2ZO3H 2H1UA 1SR5C 1GI7B 1SB1H 1P9UA 3HK6B 2C93B 1DS2E 1TPOA 2VWNA 5L2ZH 4U01A 3NPSA 3NCLA 3TJVA 1O2RA 1CQQA 1O3MA 3OY5U 4UFFH 3MH6A 1NRQH 3L3TA 1YGCH 2P94A 1O2IA 3MTYA 3TIUA 1MCTA 2FLBH 4BAHB 1AGJA 2FYRA 4JZ1A 4XDEA 1GL0E 3ZV8A 1QURH 4A5TS 5PTPA 1FN8A 3GDUA 4H6TA 4OS5A 3RLYH 1GMHF 1QB9A 2Z94A 3W94A 3BG4B 2J92A 3HPTB 8KME2 2J4IA 3SV7A 3EA8A 1K1LA 2DE8A 2C8WB 3LKWA 2YOLA 3TNTA 3A7TA 1QRXA 2FOBA 1GHZA 2ZEBA 1YYY1 4RKOB 1ID5H 2BD4A 1ZPCA 2FX6A 2G5NA 3TH2H 3BTME 2C90B 1MKXK 5EW1H 4R8TB 4NCYA 1OP0A 2GMTC 3SNEA 2GCTC 1LPKB 2FOEA 3TJOA 2FP7B 3FVFB 1O2OA 1A5IA 3SU6A 4HI3A 1T8LA 2FYQA 2XBVA 1NRNH 3BTKE 3SJIA 1FMGA 3RU4E 3RC6A 2STAE 1KXEA 3PWCA 5K0HA 6CHAC 2R0KA 5A0AE 3TGJE 1TNIA 1GMHG 4E7RG 1MZAA 3PO1C 1U6QA 3JZ2B 1SLXB 4Y7BA 1E38B 2P3TB 2WPLS 2EC9H 1C5TA 1O2MA 4TY6A 1EPTB 1W0ZU 3T25A 3PB1E 1UVSH 1P09A 3SHCH 3UWJH 3RXHA 1K1OA 1BBRH 4BTIB 1AVWA 1ZLRA 3O8DA 3RXIA 1BZXE 1ELBA 3LC5A 2F83A 2WYGA 3TK6A 5G4BA 5AHGH 4AYYB 1GMCG 3AVZA 1BTWA 3BEIB 1S0RA 1TOCB 1ELFA 3WY8A 5C1UA 5FPSA 3GCNA 1W10U 1LPZB 2A1DB 2FEQH 4HTCH 2F9VA 1A3EH 3SUFA 1WTHD 3SUDA 4YO9A 2GDEH 3LGIA 4CRDA 3ZYDA 1QRZA 2XC4A 5L30H 3BEUA 1FXYA 4CRCA 4JCNA 2EEKA 2RCEA 1LDTT 2Z9IA 1CHOF 1Y3VA 1Z8JB 2BOHB 1CGJE 1SHHB 2HPQH 2BD8A 4IN2A 5ESBA 2ZA5A 1GCDA 1SG8B 4D9QA 2ANMH 2D8WA 1O3LA 4Y76A 4Q7XA 1GJ7B 1QNJA 1C2JA 1O3JA 2AGIX 3U69H 1BRBE 4X2WA 4OS2A 4WMEA 1V2KT 1A4WH 1MH0A 3M3SA 1C2HA 2ZDMA 3S7HB 1RD3B 4MTBA 4AN7A 1ANBA 1KXDA 1H9LB 4X6OA 1KLTA 3MO9A 4ABJA 2V35A 2KAIB 1O3GA 2ANWA 1WUNH 1GI1A 1O3AA 1TRMA 2KAIA 1EAUA 4Y6DA 1TGNA 3FANA 2J94A 3V13A 1DX5M 2Q1JA 2QV1A 3ZZCA 1LQEA 3UR6A 4ABDA 4YZUA 1IQHA 1CHOG 1WOFA 1FY1A 1UK4A 1S5SA 1IAUA 3IITA 4AFZA 1MZDA 4ISHH 1C5YB 4B76A 3BF6H 2G81E 1GI5A 2BHGA 3RXGA 3RXMA 1BBRE 1JRTA 4AZ2B 3MNXA 3VFEA 1G3BA 1DXWA 4INKA 1SMFE 1C5UA 5C5OA 4NIYA 3T27A 4Q7YA 4E7NA 3GY2A 1XVOA 1NFYA 5GWZA 1MKWH 3BEFB 4NG9H 2BD2A 3SUGA 1SGNE 3IG6B 1OP8A 1OP2A 1A0JA 1UTJA 2ZQ2A 6GCHF 2QGRA 1DFPA 2EA3A 4DJZB 1E0FD 1ZMNA 3I29A 1AB9C 3KHVA 3EA7A 1HPGA 2FOMB 5EW2H 3EE0B 1GHXH 1OWJA 1QQUA 4X2XA 1LCYA 1AO5A 4ZUHA 1YPLH 1KSNA 1IQMA 2VIOA 2VNTA 2PUXB 1C2MA 4MQAA 1W8BH 2ZPRA 5CHAC 1F0TA 1MU6B 4YM9A 3LDXH 1LVMA 3SZNA 2BY8X 1AHTH 1ZRBA 1TX8A 1T8OA 4A1XA 4X1NU 1T7CA 5EGMA 2ANKH 3RP2A 3A8AA 4GAWA 2DE9A 3BIUH 2O8LA 4J2YB 6LPRA 1O38A 5TJXA 3M35A 3GY4A 3K65B 6GCHG 1P2KA 2V3OH 2G55A 1PPBH 1BIOA 3LONA 1EAXA 1QGFA 1SGFG 4CRGA 4FUHA 1PPZA 1ZSLA 2D26C 1A2CH 5JYIA 3SNCA 1V2VT 1O35A 3A87A 3EQ0H 4XFQA 2THFB 1HJAB 3NUMA 4MDSA 1AU8A 3E8LA 2O9QA 4ZKRU 4K8YA 2BY6X 1W0YH 4Q7ZA 4WXVA 1V2QT 1IQFA 2FOGA 2OINA 1DWCH 2ZDKA 4FUIA 4KTCA 1K1MA 1O32A 1D3TB 2ZCLP 1GBBA 1QA7A 1RJXB 1IQGA 2BDGA 3LIWA 3RXBA 3ZV9A 4NA7A 3RM2H 1FAXA 1C2FA 1C1RA 4K1TA 3UREA 2BLOA 1ZR0A 3LT3A 3MO3A 5EPYA 1Z6EA 3UOUA 3URDA 1TGTA 1KDQB 1UTNA 2UWLA 4HZHA 3QLPH 1QCPA 1GG6B 1UHBA 1AZ8A 3SJ9A 1C5ZB 3TU7H 2VWMA 4H6SB 3R0FA 1H9HE 2V0BA 1Q3XA 2P59A 2DUCA 3DFJA 2OBOA 1T4VH 1BMLA 5HM2A 2QN5T 4BNRA 4CH8B 1CO7E 5FPYA 1SGTA 1WYKA 1OWKA 5E0GA 3F9FA 1TPAE 1C1PA 5EXLA 1GJ8B 3A7XA 3LGYA 2QYIA 2A5IA 1TBRH 4B75A 2VIWA 1EB1H 2FOFA 3LJJA 1NRRH 2A5AA 1GJ4H 5HYOA 1FY4A 1GI6A 1XKAC 4CRBA 3RXFA 4D7FA 2BD5A 2VVVA 1AE5A 2GV7A 2IOTA 3VB5A 2WPKS 2FOAA 4O9VA 2ILNA 2PSYA 3GICB 2F91A 2CMYA 3CS7A 2W3KA 3A86A 1EOLA 1NFUA 1TRNA 1ZJDA 3PWBA 5GJ4B 5ABWA 1D6RA 3ATLA 3MH4A 5F8TA 5HXFA 1DY9A 1BTHH 1EJNA 2XBYA 3LOXA 4INHA 4IS5A 5DO4H 1EB2A 2VIVA 3P92A 3O8BA 3LC3A 3M61U 1G9IE 2BLQA 1C5VA 1HXFH 1WV7H 3KQBA 1ZMLA 4O3TA 7GCHF 2AEIH 1GBIA 1GI3A 1LO6A 1O5DH 3MWIU 1P3CA 1GBLA 1TA6A 1HB0B 1KIGH 1V6DA 3SOSA 4FUJA 4JZFH 2B9LA 1MTSA 1Y3XA 2ZU5A 1EP5A 1O2NA 5C67A 1V2WT 1ETRH 5GXPA 1GBTA 2Q6DA 4FUDA 3VB7A 1DDJA 1SPJA 3HGPA 4DY7B 1AQ7A 2RA0A 3GY8A 1J9CH 1S85A 2NU1E 3QDZB 5EU8A 1TNHA 3AASA 5EODA 1ZRKA 2BDHA 2OQ5A 1F92A 2P3FH 3AW1A 2OQUA 4K2YA 3DD2H 1OWHA 2OC0A 3TH3H 2BVRH 2LNCA 3MNCA 1IQLA 2PKSB 2H5DA 4FUCA 1UK2A 1C5NH 1NO9H 1TNGA 3M7QA 2B0FA 1GHBF 1MUEB 2WPJS 4LK4A 1QBOA 2GT8A 1C9PA 1H4WA 1MCVA 4IN1A 1FN6A 3UOPA 2SGFE 1O5FH 1L1JA 1A46H 2VJ1A 1XVMA 1GBFA 1V2MT 1UK3A 2ODQA 4JK6A 5ESTE 5T6DA 3SQEE 1FAKH 3ITIA 3GYLB 2BYAX 1S0QA 2OD3B 2A7CA
chains in the Genus database with same CATH superfamily
1ZTKA 1P3EA 1BTXA 1K0HA 1E34B 1KMHB 2FMJA 1XUJA 2BD7A 1UVUH 4DCDA 3E90B 1QQ4A 1GCTC 2A4RA 3NWUA 4FU8A 3L33A 2VVCA 4NFEA 2UWOA 1EAWA 1D3QB 1JWTA 2HLCA 2OUAA 1C2LA 1ARBA 1G37A 1Z8GA 2A7HA 1TABE 2ZPQA 3GOVB 3QZRA 1TQ7B 1PQ7A 1MBQA 5E2PA 1MBMA 4NIXA 3KEEA 2CJIA 3A83A 1TYNA 3RDZA 1GBMA 4Y7AA 1Y5AT 1GDQA 2IJOB 1IOEA 4CHAB 1YLCA 2ZF0H 4HFPB 4I33A 4ASHA 3SN8A 1YPJH 2F9OA 4B6EA 1AE8H 3D65E 3PTBA 4I86A 1PJPA 1E37B 1V2RT 2G5VA 1C1VH 1O31A 4OS7A 1C2EA 2ZP0H 3BTEE 1LKAA 1O3KA 1P9SA 3UR9A 1AFQB 1ABIH 2YMSC 4XBCA 2ESTE 4YOJA 3SU5A 1HYLA 4BAMB 3VGCC 2P93A 2HGTH 3ZZ7A 1O30A 5KGOA 3P95A 3RXQA 2HPPH 2J9NA 2RDEA 1C5RA 1PFXC 3F1SB 4ZHMU 5J4QA 1V2PT 5DN6D 1O2HA 4IW4E 4A7IB 2QXIA 4A92A 3DA9B 4XOJA 1FUJA 4QT8C 5EXNA 2PKAB 2G52A 3UNSA 1GBCA 1WDIA 2OBQA 2TGAA 1TE0A 4ZROA 3T62A 5GCHF 5E8EH 4K60A 2TIOA 3GY3A 1O3FA 2G4TA 2ZFPH 3BN9A 1O2SA 2VIQA 4TPIZ 3RC4A 2Z9JA 1E1QD 1A1RA 1ZMJA 3KCGH 4Y0YE 2OLGA 1DLKB 2CHAB 1ANEA 3RXPA 2AFQB 1YPHC 1O34A 1ZOMA 3ZZDA 1HAHH 2HNTE 1ZGIA 1W2KH 1BMFD 2J98B 2PLXA 4FUFA 3RXUA 3U28C 4BXWA 2Y7XA 2UUJB 4BAOB 1GG6C 6ESTA 1T4UH 3D62A 3SJKA 1B7XB 1GI0A 1VITF 3UB0A 1OXGA 3PLBA 3TH4H 1SGYE 4J1YA 1MKXH 4WY3A 1QTFA 2BD3A 1O5BB 1T31A 4Y11E 5GCHG 1C5QA 2ZHFH 4X8UH 3U98H 2Y81A 1ZYOA 5EOKA 1DVAH 1G3EA 1CBWC 1H9IE 1RIWC 1CA0B 3SNDA 3F3BA 5A0CA 1FY8E 4X1QU 1TWXB 2CN0H 1QL8A 3LJOA 3DUXH 2PUQH 3BTWE 1GWAA 4UEHH 1AY6H 3W95A 2XC0A 4RT0A 4UONA 3ZVDA 2HWLB 1SHYA 3EA9A 3MI4A 4D76A 5F6MA 2ULLA 1YPKH 3E91A 1DSTA 1QZ8A 1MU8B 4A1TA 5FX6A 5BPEA 5HMAA 1L0ZA 1INCA 1O2TA 1JIMA 1VZQH 1DITH 2BX4A 2AMQA 1GMCF 5A8ZA 1UCYH 1FZZA 2WSSD 1C1UH 1MMJN 1P2NA 1NTPA 1VITG 2Z6BD 3RC5A 1ELVA 1XX9A 2VGCB 5JB9S 2JJ2D 1O5CB 1PQ5A 3ZVGA 3UNRA 3E0NB 4B73A 3SJ8A 1LVOA 3KYGA 4IBLH 1C5WB 1NC6A 3S9BA 1EZQA 1GDNA 2AIQA 2B5TB 1HIAB 2F9NA 5GNDA 1CT2E 1TX7A 2TBSA 3ATMA 2JETC 2FWWA 5C1YA 1WAYB 1OPHB 4X6NA 3OYPA 3Q77A 2UWPA 4X8SH 4IC5A 3FZZA 1CU1A 1EPTA 1WBGB 1MTWA 3ATIA 1X7AC 2GZ8A 1MTNB 1SGPE 1FPHH 4F49A 1BT7A 4FOUC 5DSFA 3BG8A 1OWDA 2HVXA 2ZGXH 4JYVH 3ZVFA 1P06A 5I25A 2STBE 4YTAA 2CF8H 3S9AA 1QFKH 1KTSB 1W7GH 1PPEE 2ZIQH 3SNAA 5J4SA 4BTTB 1UTQA 3RXAA 1IHSH 1YC0A 4WMDA 2BZ6H 1ABJH 4AG2A 1HAOH 2VVUA 3JZ1B 4OGXA 2R2WU 2WINI 3EGKH 2BXTH 2YNAA 2WV4A 2FO9A 1TAWA 1DUEA 1DANH 4NIVA 3ZZ4A 2J95A 4SGAE 3VXFH 3UIRA 2LELA 3SO3A 1N6YA 2ZFSA 4I8JA 1G30B 2I6QA 1D6WA 1C1NA 4BTUB 1N8OC 4GCHF 1Y8TA 1MAYA 1OYQA 4F4OC 1BMNH 1EUFA 1XXDA 2G51A 1K1NA 1SLWB 3OY6U 1A5HA 1N6XA 4Y10E 3NKKA 4BXSA 1GBAA 1VGCC 2QE7D 1JOUB 1UCYE 4K1EA 1BBRK 4B74A 1BQYA 3RXDA 1AIXH 3OU0A 1RFNA 1THPB 1O2WA 1ZTLA 3TK9A 2BY9X 3FKSD 1C2GA 2XCFA 4JZIA 2Q6GA 1GBDA 1TPPA 5EQSA 3PTNA 3ENSB 1PPHE 4LZ4B 3KQEA 1YPGH 2BXUH 2ODPA 1JRSA 4ACAA 1T32A 3OEED 3GYMA 2XNDD 2SGDE 1GI9B 3U8TH 4MPVA 1KXBA 4O03A 1VKYA 4I32A 1NROH 3KF2A 2FESH 3LU9B 2P8OC 5AFYH 5CMXH 1NRPH 3S69A 3P8OA 1G3CA 1LMWB 1S82A 2BLVA 5KEDA 4DOQA 2GT7A 2QF3A 3CS0A 1DT2A 2ZGCA 4GCHG 1LHGH 1ZPBA 3STJA 1O2ZA 1YM0A 1GGDC 5B6OA 4M7GA 2VU8E 1AWHB 4NZLA 1W13U 2C4FH 3H7OA 1YLDA 1QBNA 4YXWD 1F0SA 1NN6A 4GHQA 3SW2B 3U9AH 2YMSD 1O2KA 1KXAA 1P02A 3PLPA 4YLQH 3SI3H 2J34A 7ESTE 1EQ9A 2SGQE 5A09A 3E16B 1FLEE 1LKBA 2OCVB 1TFXA 1VJAU 4TWWA 1P03A 1WQVH 1JBUH 1HAVB 2QA9E 4ZHAA 1Z6JH 3GY7A 1OWEA 2AIPA 2PWXA 1HAVA 1P01A 3ELAH 1TGSZ 3QWCH 1P8VC 4YOGA 1LQDB 1F0UA 1RTLA 4UE7H 1O33A 3MH5A 5DG6A 1C1WH 2PSXA 5JBBS 3KQDA 4TWYA 2ZDAH 1YF4A 3RXKA 1HRTH 3GCHB 3Q3YA 4KTUA 4Z1MD 1C1MA 2QIQA 3M5MA 1DPOA 3IWMA 5E0HA 4B2BA 2ZFRH 1NFXA 1TNKA 3A8CA 4YESB 1AFEH 3GCOA 2CHAC 4DVAU 2FOHA 3M7UA 1AD8H 1CSOE 5T6FA 1NU9A 1TALA 3CP7A 1AKSB 1MQ5A 1MAXA 1PPGE 1AKSA 2O8UA 1XUHA 3N7DA 3RXJA 2BVSH 1MKWK 1ARCA 3RMNH 1NY22 5F03A 4OGYA 4OM9A 2BLWA 3TITA 2H9EH 3QX5H 4I8GA 1BB0B 5DP4A 1XUKA 3SBKA 3SI4H 4ISLA 3BIVH 1L1NA 2XCNA 3A82A 2A2QH 1QJ6B 1BDAA 1ELCA 5AVDA 4NIWA 2ZU4A 2KFWA 1A7SA 1EXFA 1IQJA 1OX1A 1GI2A 3FP6E 3UQOA 1C2IA 1Y59T 1C5MD 3FAOA 3ZZAA 1BMAA 4MLFB 2VWLA 1ETSH 4Y71A 3SHAH 2NU3E 2R2MB 2GTBA 3BG4C 2A0QB 4AORA 1Y3UA 2FIRH 4MPUA 2BB4A 3F6UH 1XXFA 4TY7A 5DP8A 1T8MA 5JDUB 1SQRA 3KIDU 2WPIS 1ANCA 1DWDH 2OP9A 1KDQA 4AYVB 2W6JD 2A31A 2KM0A 3RXLA 2A32A 1V2UT 4X0WU 1LHEH 2OC1A 2HRVA 1O2VA 1GJ9B 4Q2KA 1F5RA 1PQ8A 5JBAS 3P8NA 1OWIA 2G8TA 1TIOA 1HJ9A 1O3IA 2QCYA 1BHXF 2BDIA 1L2EA 1K22H 1XUGA 1H1BA 1AVXA 1C4Y2 1EJAA 1KXCA 3O8CA 3U8RH 1HAXB 4Y79A 4MPXA 1O3NA 1P11E 2AS9A 3MU5A 3ATWA 5AFZH 2VIDA 3U1IB 3UFAA 3M3VA 1EPTC 2SNWA 1B5GH 1ESTA 1GBEA 1JMOH 1J17T 3MU1A 5DP9A 5C20A 3URCA 4CRAA 1K1IA 4LZ1H 1DOJA 2ZTZA 1TONA 1FIZA 3NZIA 2W6ID 3SV8A 2FS8A 4DG4A 3T29A 3A85A 1P04A 4GPGA 2XWBI 1ETTH 1ZTJA 4ABHA 1EJMA 4WVPE 1ZZZA 3KN2A 3RXRA 4E05H 2ZDLA 1HAPH 1SLUB 1HNEE 2K0QA 3STIA 2ZCHP 5A8YA 1CHGA 1TLDA 3MU4A 1TB6H 1AUTC 3EBNA 2JIZD 3E1XB 4DURA 4ZKSU 1SBWA 1G36A 3ESTA 1YP9A 4B1TA 3A7VA 1G2LA 4IMQA 3BTQE 3GS9A 1W7XH 2EI8A 2GMTB 2HLDD 1SGIB 2BY7X 2GCTB 1P05A 1C4V2 4X6MA 3UAIC 5FAHA 4NWLA 3GISB 1F0RA 4CR5A 1ELAA 1QRWA 1W12U 1P10A 5EXMA 3RU4T 3ZVEA 1UTOA 2XNIA 1LVBA 3QTOH 2H2ZA 4TSFD 3PO1B 2OC7A 3QGJA 2QF4A 5IYTA 3ZZ3A 2J38A 1Z1IA 4Q80A 4ZXXH 4OS4A 1MABB 4ISIH 1QHRB 2VWOA 1KYNA 4GUXA 4MNYA 1E35B 4AB9A 2FZZA 3MNBA 1J14A 3VB4A 3BTFE 1K1PA 4FUBA 4JZDH 3K2UA 1A5GH 1C4U2 1RGQA 3P6ZB 1GBHA 3PV2A 1ZHRA 1YCPH 3SYJA 1NESE 1TGBA 2Z9GA 1Q2WA 1Y3YA 1W0JD 5HGGA 1NT1A 1UVOA 2FTLE 2M5TA 4BOHA 4DT7B 1PQAA 3LGTA 2PR3A 5E2OA 4YT6H 2K7XA 1C1QA 3TJNA 1ZHPA 1SVPA 5DP6A 2IN2A 4CR9A 1XMNB 4ZXYH 1LPGB 4AFSA 2HVYB 3W1EA 3ZZ9A 1GMDG 2CK3D 3H7TA 1WU1A 2H6MA 2ZU1A 4DT4A 2Z3CA 3ZIAD 1O2YA 1W14U 1E79D 1FX0B 2LP6A 4BAKB 4ZMAH 5ETXA 1O5GH 1K21H 4THNH 1OKXA 1A3BH 4H4FA 4P02A 2FODA 2XBXA 5L2YH 3F0OA 1AZZA 3GDVA 4KP0A 2VH0A 4U30A 1KY9A 4XSKU 1E1RD 1ELEE 1GHWH 1TGCA 4WJG2 2ODYB 1HXEH 4BAQB 1C9TA 2AHME 1B0EA 4X8TH 1FI8A 1KLIH 1GJDB 3UWIA 5LPEA 1OYTH 1RTFB 1O2XA 1UMAH 1BJVA 2SGAA 3ZZ6A 3MMGA 1VITH 3C27B 4LOYH 4ABBA 3H09A 3ZZ5A 1PPCE 4RSPA 5TCCA 3DSOA 3V12A 3FZDA 1QIXB 1S83A 9ESTA 1D9IA 3TJUA 2QY0B 1F5LA 4ZCNA 5FHTA 2BDBA 5DGJA 3QUMP 2ZHQH 1JXPA 1YBWA 3R3GB 3S9CA 3B23B 1MTVA 2F3CE 2GDDA 2FI5E 1Z8RA 5EJZA 2BTCE 3KL6A 5A0BA 2K8IA 1BRAA 3ZZ8A 4OS1A 2WZQA 1Z7KA 1J15A 2ZG0H 1GBJA 3C1KA 3DT0H 1EP6A 3RXSA 4AFQA 1UVPA 3K6YA 1AWFH 4I8HA 3UQVA 2EI6A 2PKAA 4XRNA 1NRSH 1HJAC 5DK1A 4I7YH 2C8YB 1SGQE 1GHYH 2XBWA 2TRMA 1BTYA 1HAZB 3EYDA 4YLUA 2WUBA 3M36A 1AB9B 2FDAA 4UDWH 5FBEA 2A45B 3FO8D 4K1SA 2PHBA 5TCAA 1GBKA 5CE1A 4ACBA 1C2KA 1SQTA 1BMMH 1W11U 1A0HB 4GLYA 5L6NH 1ELTA 1UO6A 2D1JA 2AGGX 4CBNA 3GY5A 5LH8A 1LHCH 4MNWA 3HGNA 3KYFA 1QA0A 5CHAB 3UUZA 2J98A 1FY3A 1GVLA 2F9UA 3P8GA 3E6PH 1EKBB 2GJGA 2SGPE 4CBOA 3DSPA 1O36A 2GV6A 3MU0A 2H9HA 3M5NA 2KZ4A 1KTTB 1LHFH 1TMBH 3SZEA 2PGBB 2ZHEH 1O2QA 1SGEE 1SOTA 5EQRA 1ZSJA 1IQNA 1WSSH 5F8XA 2PW8H 3ZVBA 3PYHA 1FV9A 3HATH 3L6PA 3T26A 3CENA 3GCTG 1IQIA 1NFWA 4RN6A 3GDSA 5HM9A 3HK3B 3A81A 3N99A 2Y5FA 2W5EA 3SV9A 1N1LA 1SI5H 4IC6A 2G4UA 4X2YA 1DXPA 8LPRA 4Z0KA 1BRCE 3SQHE 4AX9H 5C17A 1GJCB 1S81A 4ABAA 4B6FA 1GJ5H 4I8KA 2ZGHA 1C5PA 7KMEH 2BY5X 1NBME 5A8XA 4HGCA 1O3EA 2WV9A 2VB0A 2D2DA 5T6GA 3A89A 1TOMH 1DUAA 1S6FA 4WH6A 3QK1A 4NWKA 1RS0A 2QXJA 3BTTE 3BTHE 1ZPZA 3MOCA 5FBIA 2V7QD 2YNBA 1T8NA 4LXBH 1EZUC 1VJ9U 3UY9A 2W26A 2WPMS 2H5CA 2XOKD 1HUTH 2ZFQH 3SNBA 3ODDA 4TYDA 2W7SA 3RMOH 4CH2B 1K1JA 2A4QA 1O2UA 1OSSA 4ABIA 1BTUA 1YLNA 4FUGA 2R9PA 4NSVA 5EQQA 1CT0E 3RU4D 1O3HA 1Z71A 1HIAA 2ZTXA 1PYTD 1J8AA 1L4DA 5JBCS 1O2JA 1VCWA 3M7TA 2XC5A 1O3DA 2Z3EA 4RKJB 1NM6A 3U8OH 3A7YA 3FP8E 1SGDE 1YKTA 2WPDD 1V2OT 2FX4A 2ZNKH 3SGBE 4FU9A 5SGAE 5GPIB 4B71A 5EJ1A 1HFDA 2ZI2H 3OEHD 2WHXA 2G00A 3TNSA 3ZVCA 1E36B 1TMUH 2A7JA 1V2TT 3BTGE 4K5ZA 3DHKH 4JZEH 1EZSC 1JIRA 2QF0A 1BJUA 1UCYK 2ZU3A 2XXLA 3BTDE 4ZAEA 1D3DB 3SGQE 2ZPSA 1TX6A 1QL7A 3T28A 2WUCA 2ANYA 5JB8S 2W3IA 2GGVB 1YCPM 2JH6D 1DSUA 3QN7A 1FJSA 1NPMA 1S6LA 1F5KU 2C3SA 2CV3A 3LGVA 2PKSC 4NGAH 3A88A 2V3HH 1Y5BT 1K9OE 1ACBE 1AVGH 2BX3A 1GI4A 2XWAA 4AGKA 1HJ8A 3TK5A 2UUYA 3TVJB 1BRUP 4UFEH 2ZFFH 4MPWA 1UTKA 2AMDA 1J16A 5DP5A 1ZHMA 1UJ1A 2O8MA 4X8VH 1DWBH 2Z3DA 1C5SA 3M5OA 8GCHF 1QB1A 4UFDH 5HIYA 3TGKE 3SU2A 1UVTH 3EAJA 1HDTH 1M9UA 2TGDA 5GIBA 5KECA 1SGRE 4K3JA 4ZHLU 3KQ5A 3MU8A 1O39A 3B8JA 3A8BA 2C8ZB 3MFJA 3SV2H 1A0LA 2CGAA 3A8DA 3I77A 4JK5A 4WWYA 2L74A 4X1RU 4ISNA 2BQWB 2PTCE 3M3TA 4A6LA 1MD8A 1DY8A 3PV4A 4UFGH 1XUIA 3MO6A 4XBBA 4X1PU 3F2FA 1V2ST 1NZQH 3EE7A 4WXIA 3E0PB 2V6NA 1VR1H 4SGBE 4X6PA 1QBVH 4CHAC 1V2LT 3D23A 2GVFA 2ZU2A 4RI0A 2SNVA 1IHTH 2AGEX 2LPRA 3RUOA 2AERH 3F68H 2FS9A 1LHDH 1Z8IB 4NSYA 3ATKA 1C1OA 4Y8YA 1C1TA 1DM4B 1YPEH 1O3OA 2QAAA 3PMHB 8GCHG 2A4OA 4D9RA 2OXSA 3RLWH 3HKJB 1P57B 1C2DA 1CE5A 1GDUA 1AFQC 4NA8A 4VGCB 3D49H 2LIZA 1ESAA 2P16A 1GI8B 1L1GA 1LTOA 2EI7A 4WH8A 2ZZUH 5FCKA 1FONA 1G32B 4PROA 5C1XA 2SGEE 3AAUA 1EAIA 2ZGJA 1Z1JA 2FOCA 1Y3WA 1XUFA 3MH7A 3F2HA 1P2IA 1O3BA 3LH3A 2W7UA 2B8OH 1AN1E 1Y5UT 4U2WA 4Y8XA 1GJBB 2BDAA 3LPRA 1GCTB 3I78A 2FM2A 1ORFA 5EG4A 2GD4B 5A2MH 4WMFA 2GX4A 3OE7D 1LVYA 4RT1A 5H4IB 1HGTH 4ESTE 1HCGA 3S7KB 3T5FH 2TGPZ 8ESTE 3TPIZ 4XE4A 1ANDA 1XKBC 1S84A 2IPHA 2ALPA 2BM2A 3V7TA 4GHTA 5LGOA 3AW0A 1O5EH 2P95A 3RXTA 2ZTYA 2Y82A 1F2SE 3VXEH 4KGAA 5I46H 4MG3A 3G01A 3SJOA 1TA2A 1THRH 1K2I1 3M37A 1L4ZA 4INLA 1H8IH 2VIPA 3PLKA 3RXEA 1ESBA 1WXRA 2YMSB 1DICA 4JYUH 5DP7A 1NU7B 2FPZA 3QZQA 3SU3A 4O3UA 1FDPA 1YPHE 3VGCB 1O5AB 1SGFA 2JDID 1EFRD 5IDKA 2PGQB 3VEQB 4YOIA 3SV6A 1IQKA 1V3XA 2ZWLH 2ZQ1A 3UTUH 5JPMH 2TGTA 1MD7A 1CA0C 3H5CB 1TBQH 2WV5A 2QC2A 4MVNA 1V2NT 2FI4E 2HNTC 1PPFE 3SORA 1UTPA 3DSGA 2FI3E 1ZGVA 1C1SA 4AB8A 1BTPA 1P2QA 3A7ZA 1BTZA 4AOQA 1TNLA 3SUEA 2BDCA 3PV5A 2Z9KA 5B6LA 2BQ7B 4IMZA 1O2LA 3KNXA 3RM0H 2O8TA 3DFLA 3GY6A 1H8DH 3Q76A 3KGPA 4KTSA 3F9HA 2BVXH 2L6OA 4X1SU 1O3CA 1H8ED 4K69A 2NU2E 3PMAB 2UUFB 2GCHF 4AG1A 3HKIB 4UD9H 2VGCC 1A61H 2I6SA 3OSYA 1TPSA 5FX5A 3T2NA 5JBTA 2R0LA 3VPKA 2ZHWH 1UHBB 3P70B 2KCPA 5DP3A 3ZVAA 3QGNB 7LPRA 5GDSH 1VCQA 4IGDA 4KELA 5BRRE 4CRFA 3O8RA 2XRCA 3PM3A 3AK5A 1EOJA 1QJ1B 4KKDA 2HOBA 1P2JA 1ZJKA 1AUJA 1SFQB 1OS8A 1IQEA 3ZYEA 1BA8B 5AF9H 2ALVA 3S0NA 4DIIH 1WTGH 2Y6TA 4AFUA 2FLRH 2JKHA 1C5OH 2ZDNA 2XW9A 4JMYA 4XBDA 3PMJA 2C8XB 2PV9B 1QL9A 1DWEH 1ZSKA 3LGUA 4FXGH 1CBWB 2BZAA 1RIWB 5CDFE 2ASUB 1MTNC 3RMMH 1B0FA 1GVZA 3LH1A 1D4PB 1GJ6A 1FY5A 3SU1A 2VINA 2ZHDA 3QO6A 4O97A 4GSOA 1SQOA 2Z9LA 4A1VA 2KX4A 3K6ZA 2RDLA 3VG8A 3M5LA 1HAYB 2GCHG 4K8BA 1FPCH 2NU0E 1O37A 3OAAD 1BCUH 1RXPA 1SSXA 3PROA 3RXVA 1BHXB 4ZH8A 2ZC9H 1PYTC 4NZQA 2FTMA 4GVUA 1C5LH 4FVBA 1V2JT 2AMPA 1BUIA 2K1QA 2WPHS 5E0JA 1GHAF 2XTTB 4U32A 1QY6A 2V3MA 3A84A 1P12E 1F7ZA 2FXRA 2RG3A 3MHWU 4R0IA 2AYWA 3PMBB 1BOQA 1TNJA 2Y7ZA 3U1JB 2QF5A 4XD7D 6CHAB 1THSH 1GMDF 2Q6FA 4Y8ZA 1CA8B 1TMTH 4MNXA 1G2MA 5FXLA 2BQ6B 2JETB 2KCOA 1G3DA 1HBTH 1CGIE 1SL3A 1VCPA 1SGCA 3A7WA 1COWD 1QJ7B 1DLEA 2F9PA 3EDXB 1O2PA 2JH0D 3E3TA 1ELGA 1TBZH 1YY3A 1CVWH 3RXOA 5DKMA 2GZ9A 2BDYA 1SQAA 3TLOA 1OOKB 2H9TH 9LPRA 4DGJA 4I31A 3SGAE 4M9FA 1Q31A 2A2XH 1O3PB 1MQ6A 2ZDVH 1GHAG 4Z6AH 3ODFA 1EASA 1TQ0B 3AAVA 2HALA 4ZKOU 1SLVB 2GP9B 2ZKSA 1WCZA 2R3UA 5F53A 1K28D 3BV9B 5FPTA 1GVKB 1AI8H 1FIWA 3OTJE 3UPEA 1EX3A 3P17H 2WYJA 2Y5GA 3MNSA 4E06H 3VB3A 3FN8A 3F9EA 1GJAB 1SFIA 2BMGB 7GCHG 4WF8A 1YPMH 4B2AA 4ABFA 4VGCC 5DJ7A 1P2OA 1P0SH 4B2CA 1N8OB 1DE7H 1HV7A 2NU4E 1EZXC 2AH4X 1RRKA 2J97A 4ABEA 5HKKD 1FNIA 1CGHA 1O0DH 2RA3A 4D7GA 3TGIE 3UNQA 3QTVH 1XM1A 1VGCB 2BOKA 2QXHA 2JH5D 4MNVA 1NS3A 4DW2U 3F0PA 2Y5HA 4ZKNU 3F2GA 3N7OA 2XYAA 4AC9A 5C94A 2OC8A 4X2VA 1YCPK 1C5XB 1WQSA 2ZCKP 3BSQA 5EPNA 2GKVE 1GHVH 1D3PB 2EY4C 4JYTA 1KLJH 3NXPA 5FCRA 3PRBA 1FQ3A 1O2GH 2VH6A 3A80A 1SOZA 2PTNA 2OTVA 3GCHC 2A5KA 4Y0ZE 2UUKB 3Q00A 2TPIZ 2Y80A 3V0XA 3SU4A 4YT7H 5C5NA 2P8OB 5IK2D 1QR3E 3LGWA 1P2MA 4H42U 4TPYA 3OX7U 3MQKC 5LPFA 1GHBG 1MTUA 3P8FA 3VB6A 5C3NA 4NA9H 4BANB 2ZFTA 4P00A 4FVDA 3MYWA 2ZGBH 1RTKA 1GGDB 5LPRA 1GL1A 1UTMA 1UTLM 3RXCA 3ZZBA 4OS6A 2A4GA 2GZ7A 2R3YA 2NWNA 2F9BH 2ZECA 3Q3KA 2PFEA 1W3CA 2B7DH 3KQCA 2J2UA 2Z7FE 1QB6A 5T3HA 5DPAA 1SC8U 2CF9H 3B9FH 3WWFA 3V3MA 5CHBA 2CXVA 3GCTF 3Q3XA 1GPZA 1HAGE 4Q63A 2P3UB 4D8NA 4FU7A 4CREA 1TRYA 4ABGA 2O8WA 1EATA 3FFGA 1HLTH 1CT4E 1ELDE 3FP7E 4FUEA 2BD9A 3RMLH 1S6HA 3K9XB 4ISOA 1AMHA 1HAIH 3F9GA 4NFFA 2SFAA 1BITA 1KXFA 2HNTF 5F8ZA 2QXGA 3NK8A 5C2ZA 3SU0A 5K7RA 4AGJA 4I8LA 2PP6A 2KCYA 4DIHH 2ZO3H 2H1UA 1SR5C 1GI7B 1SB1H 3FOAA 1P9UA 3HK6B 2C93B 1DS2E 1TPOA 2VWNA 5L2ZH 4U01A 3NPSA 3NCLA 3TJVA 1O2RA 1CQQA 1O3MA 3OY5U 4UFFH 3MH6A 1NRQH 3L3TA 1YGCH 2P94A 1O2IA 3MTYA 3TIUA 1MCTA 2FLBH 2KCAA 1AGJA 4BAHB 2FYRA 4JZ1A 4XDEA 1GL0E 3ZV8A 1QURH 4A5TS 5PTPA 1FN8A 3GDUA 4H6TA 4OS5A 3RLYH 1GMHF 1QB9A 2Z94A 3W94A 3BG4B 1NBMD 2J92A 3HPTB 8KME2 2J4IA 3SV7A 3EA8A 1K1LA 2DE8A 2C8WB 3LKWA 2YOLA 3TNTA 3A7TA 1QRXA 2FOBA 1GHZA 2ZEBA 1YYY1 4RKOB 1ID5H 2BD4A 1ZPCA 2FX6A 2G5NA 3TH2H 3BTME 2C90B 1MKXK 5FL7D 5EW1H 4R8TB 4NCYA 1OP0A 2GMTC 3SNEA 2GCTC 1LPKB 2FOEA 3TJOA 2FP7B 3FVFB 1O2OA 1A5IA 3SU6A 4HI3A 4F48B 1T8LA 2FYQA 2XBVA 1NRNH 3BTKE 3SJIA 1FMGA 3RU4E 3RC6A 2STAE 1KXEA 3PWCA 5K0HA 6CHAC 2R0KA 5A0AE 3TGJE 1TNIA 1GMHG 4E7RG 1MZAA 3PO1C 1OHHD 1U6QA 3JZ2B 1SLXB 4Y7BA 1E38B 2P3TB 2WPLS 2EC9H 1C5TA 1O2MA 4TY6A 2F43B 1EPTB 1W0ZU 3T25A 3PB1E 5C0UA 3OFND 1UVSH 1P09A 3SHCH 3UWJH 3RXHA 1K1OA 1BBRH 4BTIB 1AVWA 1ZLRA 3O8DA 3RXIA 1BZXE 1ELBA 3LC5A 2F83A 2WYGA 3TK6A 5G4BA 5AHGH 3N7EA 4AYYB 1GMCG 3AVZA 1BTWA 3BEIB 2JJ1D 3WW7A 1S0RA 1TOCB 1ELFA 3WY8A 5C1UA 5FPSA 3GCNA 1W10U 3PRDA 1LPZB 2J5UA 2A1DB 4TT3D 2FEQH 4HTCH 2F9VA 1A3EH 3SUFA 1WTHD 3SUDA 4YO9A 2GDEH 3LGIA 4CRDA 3ZYDA 1QRZA 2XC4A 5L30H 3BEUA 1FXYA 4CRCA 4JCNA 2EEKA 2RCEA 1LDTT 2Z9IA 1CHOF 1Y3VA 1Z8JB 2BOHB 1CGJE 1SHHB 2HPQH 2BD8A 4IN2A 5ESBA 2ZA5A 1GCDA 1SG8B 4D9QA 2ANMH 2D8WA 1O3LA 4Y76A 4Q7XA 1GJ7B 1QNJA 1C2JA 1O3JA 2AGIX 3U69H 3WWBA 1BRBE 4X2WA 4OS2A 4WMEA 1V2KT 1A4WH 1MH0A 3M3SA 1C2HA 2ZDMA 3S7HB 1RD3B 4MTBA 4AN7A 1ANBA 1KXDA 1H9LB 4X6OA 1KLTA 3MO9A 4ABJA 5HIZA 2V35A 2KAIB 1O3GA 2ANWA 1WUNH 1GI1A 1O3AA 1TRMA 2KAIA 1EAUA 5T1VA 4Y6DA 1TGNA 3FANA 2J94A 3V13A 1DX5M 2Q1JA 2QV1A 3ZZCA 1LQEA 3UR6A 4ABDA 4YZUA 1IQHA 1CHOG 1WOFA 1FY1A 1UK4A 1S5SA 1IAUA 3IITA 4AFZA 1MZDA 4ISHH 1C5YB 4B76A 3BF6H 2G81E 1GI5A 3CNRA 2BHGA 3RXGA 3RXMA 1BBRE 1JRTA 4AZ2B 3MNXA 3VFEA 1G3BA 1DXWA 4INKA 1SMFE 1C5UA 5C5OA 4NIYA 3T27A 4Q7YA 4E7NA 3GY2A 1XVOA 1NFYA 5GWZA 1MKWH 3BEFB 4NG9H 2BD2A 3SUGA 1SGNE 3IG6B 1OP8A 1OP2A 1A0JA 1UTJA 2ZQ2A 6GCHF 2QGRA 1DFPA 2EA3A 4DJZB 1E0FD 1ZMNA 3I29A 1AB9C 2M2AA 3KHVA 3EA7A 1HPGA 2FOMB 5EW2H 3EE0B 1GHXH 1OWJA 5EIYA 1QQUA 4X2XA 1LCYA 1AO5A 5C0TA 4ZUHA 1YPLH 2IJD1 1KSNA 1IQMA 2VIOA 2VNTA 2PUXB 1C2MA 4MQAA 1W8BH 2ZPRA 5CHAC 1F0TA 1MU6B 4YM9A 3LDXH 1LVMA 3SZNA 2BY8X 1AHTH 1ZRBA 1TX8A 1T8OA 4A1XA 4X1NU 1T7CA 5EGMA 2ANKH 3RP2A 3DCLA 3A8AA 4GAWA 2DE9A 3BIUH 2O8LA 4J2YB 6LPRA 1O38A 5TJXA 3M35A 3GY4A 3K65B 2F4LA 6GCHG 1P2KA 2V3OH 2G55A 1PPBH 1BIOA 3LONA 1EAXA 1QGFA 1SGFG 4CRGA 4FUHA 1PPZA 1ZSLA 2D26C 1A2CH 2OK5A 5JYIA 3SNCA 1V2VT 1O35A 3A87A 3EQ0H 4XFQA 2THFB 1HJAB 3NUMA 4MDSA 1AU8A 3E8LA 2O9QA 4ZKRU 4K8YA 2BY6X 1W0YH 4Q7ZA 4WXVA 1V2QT 1IQFA 2FOGA 2OINA 1DWCH 2ZDKA 4FUIA 4KTCA 1K1MA 1O32A 1D3TB 2ZCLP 1GBBA 1QA7A 1RJXB 1IQGA 2BDGA 3LIWA 2RFKC 3RXBA 3ZV9A 4NA7A 3RM2H 1FAXA 2IPQX 1C2FA 1C1RA 4K1TA 3UREA 2BLOA 1ZR0A 3LT3A 3MO3A 5EPYA 1Z6EA 3UOUA 3URDA 1TGTA 1KDQB 1UTNA 2UWLA 4HZHA 1SKYE 3QLPH 1QCPA 1GG6B 1UHBA 1AZ8A 2VBCA 3SJ9A 1C5ZB 3TU7H 2VWMA 4H6SB 3R0FA 1H9HE 2V0BA 1Q3XA 2P59A 2DUCA 3DFJA 2OBOA 1T4VH 1BMLA 1UW7A 5HM2A 2QN5T 4BNRA 4CH8B 1CO7E 5FPYA 1SGTA 1WYKA 1OWKA 5E0GA 1W0KD 3F9FA 1TPAE 1C1PA 5EXLA 1GJ8B 3A7XA 3LGYA 2QYIA 2A5IA 1TBRH 4B75A 2VIWA 1EB1H 2FOFA 3LJJA 1NRRH 2A5AA 1GJ4H 2KR7A 5HYOA 1FY4A 1GI6A 1XKAC 4CRBA 3RXFA 4D7FA 2BD5A 2VVVA 1AE5A 2GV7A 2IOTA 3NRLA 3VB5A 2WPKS 2FOAA 4O9VA 2ILNA 2PSYA 3GICB 1H8HD 2F91A 2CMYA 3CS7A 2W3KA 3A86A 1EOLA 1NFUA 1TRNA 1ZJDA 3PWBA 5GJ4B 5ABWA 1D6RA 3ATLA 3MH4A 5F8TA 5HXFA 1DY9A 1BTHH 1EJNA 2XBYA 3LOXA 4INHA 4Q4LA 4ASUD 4IS5A 5DO4H 1EB2A 2VIVA 3P92A 3O8BA 3LC3A 3M61U 1G9IE 2BLQA 1C5VA 1HXFH 1WV7H 4HG6A 3OTPA 3KQBA 1ZMLA 4O3TA 7GCHF 2AEIH 1GBIA 1GI3A 1LO6A 1O5DH 3MWIU 1P3CA 4FETA 1GBLA 1TA6A 1HB0B 1KIGH 1V6DA 3SOSA 4FUJA 4JZFH 2B9LA 1MTSA 1Y3XA 2ZU5A 1EP5A 1O2NA 5C67A 1V2WT 1ETRH 5GXPA 1GBTA 2Q6DA 4FUDA 3VB7A 1DDJA 1SPJA 3HGPA 5EJLA 4DY7B 1AQ7A 2RA0A 3GY8A 1J9CH 1S85A 2NU1E 3QDZB 2EQNA 5EU8A 1TNHA 3AASA 5EODA 1ZRKA 2BDHA 2OQ5A 4F55A 1YWUA 1F92A 2P3FH 3AW1A 2OQUA 4K2YA 3DD2H 1OWHA 2OC0A 3TH3H 2BVRH 2LNCA 3MNCA 1IQLA 2PKSB 2H5DA 4FUCA 1UK2A 1C5NH 1NO9H 1TNGA 3M7QA 2B0FA 1GHBF 1MUEB 2WPJS 4LK4A 1QBOA 2GT8A 1C9PA 1H4WA 1MCVA 4IN1A 1FN6A 3UOPA 2SGFE 1O5FH 1L1JA 1A46H 2VJ1A 1XVMA 1GBFA 1V2MT 1UK3A 2ODQA 4JK6A 5ESTE 5T6DA 3SQEE 1FAKH 3ITIA 3GYLB 2BYAX 1S0QA 2OD3B 2A7CA
chains in the Genus database with same CATH topology
1ZTKA 1P3EA 1BTXA 1E34B 2FMJA 1XUJA 2BD7A 1UVUH 4DCDA 3E90B 1QQ4A 1GCTC 2A4RA 3NWUA 4FU8A 3L33A 2VVCA 4NFEA 2UWOA 1EAWA 1D3QB 1JWTA 2HLCA 2OUAA 1C2LA 1ARBA 1G37A 1Z8GA 2A7HA 1TABE 2ZPQA 3GOVB 3QZRA 1TQ7B 1PQ7A 1MBQA 5E2PA 1MBMA 4NIXA 3KEEA 2CJIA 3A83A 1TYNA 3RDZA 1GBMA 4Y7AA 1Y5AT 1GDQA 2IJOB 1IOEA 4CHAB 1YLCA 2ZF0H 4HFPB 4I33A 4ASHA 3SN8A 1YPJH 2F9OA 1AE8H 3D65E 3PTBA 1PJPA 1E37B 1V2RT 2G5VA 1C1VH 1O31A 4OS7A 1C2EA 2ZP0H 3BTEE 1LKAA 1O3KA 1P9SA 3UR9A 1AFQB 1ABIH 4XBCA 2ESTE 4YOJA 3SU5A 1HYLA 4BAMB 3VGCC 2P93A 2HGTH 3ZZ7A 1O30A 3P95A 3RXQA 2HPPH 2J9NA 1C5RA 1PFXC 3F1SB 4ZHMU 5J4QA 1V2PT 1O2HA 4IW4E 4A7IB 2QXIA 4A92A 3DA9B 4XOJA 1FUJA 4QT8C 5EXNA 2PKAB 2G52A 3UNSA 1GBCA 2OBQA 2TGAA 1TE0A 4ZROA 3T62A 5GCHF 5E8EH 4K60A 2TIOA 3GY3A 1O3FA 2G4TA 2ZFPH 3BN9A 1O2SA 2VIQA 4TPIZ 3RC4A 2Z9JA 1A1RA 1ZMJA 3KCGH 4Y0YE 2OLGA 1DLKB 2CHAB 1ANEA 3RXPA 2AFQB 1YPHC 1O34A 1ZOMA 3ZZDA 1HAHH 2HNTE 1ZGIA 1W2KH 2PLXA 4FUFA 3RXUA 4BXWA 2Y7XA 2UUJB 4BAOB 1GG6C 6ESTA 1T4UH 3D62A 3SJKA 1B7XB 1GI0A 1VITF 1OXGA 3PLBA 3TH4H 1SGYE 4J1YA 1MKXH 4WY3A 1QTFA 2BD3A 1O5BB 1T31A 4Y11E 5GCHG 1C5QA 2ZHFH 4X8UH 3U98H 2Y81A 1ZYOA 5EOKA 1DVAH 1G3EA 1CBWC 1H9IE 1RIWC 1CA0B 3SNDA 5A0CA 1FY8E 4X1QU 1TWXB 2CN0H 1QL8A 3LJOA 3DUXH 2PUQH 3BTWE 1GWAA 4UEHH 1AY6H 3W95A 2XC0A 4UONA 3ZVDA 2HWLB 1SHYA 3EA9A 3MI4A 4D76A 5F6MA 2ULLA 1YPKH 3E91A 1DSTA 1MU8B 4A1TA 5FX6A 5BPEA 5HMAA 1L0ZA 1INCA 1O2TA 1JIMA 1VZQH 1DITH 2BX4A 2AMQA 1GMCF 5A8ZA 1UCYH 1FZZA 1C1UH 1MMJN 1P2NA 1NTPA 1VITG 2Z6BD 3RC5A 1ELVA 1XX9A 2VGCB 5JB9S 1O5CB 1PQ5A 3ZVGA 3UNRA 3E0NB 4B73A 3SJ8A 1LVOA 4IBLH 1C5WB 1NC6A 3S9BA 1EZQA 1GDNA 2AIQA 2B5TB 1HIAB 2F9NA 1CT2E 1TX7A 2TBSA 3ATMA 2JETC 2FWWA 5C1YA 1WAYB 1OPHB 4X6NA 3OYPA 3Q77A 2UWPA 4X8SH 4IC5A 3FZZA 1CU1A 1EPTA 1WBGB 1MTWA 3ATIA 1X7AC 2GZ8A 1MTNB 1SGPE 1FPHH 4F49A 1BT7A 3BG8A 1OWDA 2HVXA 2ZGXH 4JYVH 3ZVFA 1P06A 5I25A 2STBE 4YTAA 2CF8H 3S9AA 1QFKH 1KTSB 1W7GH 1PPEE 2ZIQH 3SNAA 5J4SA 4BTTB 1UTQA 3RXAA 1IHSH 1YC0A 4WMDA 2BZ6H 1ABJH 4AG2A 1HAOH 2VVUA 3JZ1B 4OGXA 2R2WU 2WINI 3EGKH 2BXTH 2YNAA 2WV4A 2FO9A 1TAWA 1DUEA 1DANH 4NIVA 3ZZ4A 2J95A 4SGAE 3VXFH 3UIRA 3SO3A 1N6YA 2ZFSA 4I8JA 1G30B 2I6QA 1D6WA 1C1NA 4BTUB 1N8OC 4GCHF 1Y8TA 1MAYA 1OYQA 4F4OC 1BMNH 1EUFA 1XXDA 2G51A 1K1NA 1SLWB 3OY6U 1A5HA 1N6XA 4Y10E 3NKKA 4BXSA 1GBAA 1VGCC 1JOUB 1UCYE 4K1EA 1BBRK 4B74A 1BQYA 3RXDA 1AIXH 3OU0A 1RFNA 1THPB 1O2WA 1ZTLA 3TK9A 2BY9X 1C2GA 2XCFA 4JZIA 2Q6GA 1GBDA 1TPPA 5EQSA 3PTNA 3ENSB 1PPHE 4LZ4B 3KQEA 1YPGH 2BXUH 2ODPA 1JRSA 1T32A 3GYMA 2SGDE 1GI9B 3U8TH 4MPVA 1KXBA 4O03A 4I32A 1NROH 3KF2A 2FESH 3LU9B 2P8OC 5AFYH 5CMXH 1NRPH 3S69A 3P8OA 1G3CA 1LMWB 1S82A 2BLVA 4DOQA 2GT7A 2QF3A 3CS0A 1DT2A 2ZGCA 4GCHG 1LHGH 1ZPBA 3STJA 1O2ZA 1YM0A 1GGDC 5B6OA 4M7GA 2VU8E 1AWHB 4NZLA 1W13U 2C4FH 3H7OA 1YLDA 1QBNA 1F0SA 1NN6A 4GHQA 3SW2B 3U9AH 1O2KA 1KXAA 1P02A 3PLPA 4YLQH 3SI3H 2J34A 7ESTE 1EQ9A 2SGQE 5A09A 3E16B 1FLEE 1LKBA 2OCVB 1TFXA 1VJAU 4TWWA 1P03A 1WQVH 1JBUH 1HAVB 2QA9E 4ZHAA 1Z6JH 3GY7A 1OWEA 2AIPA 2PWXA 1HAVA 1P01A 3ELAH 1TGSZ 3QWCH 1P8VC 4YOGA 1LQDB 1F0UA 1RTLA 4UE7H 1O33A 3MH5A 5DG6A 1C1WH 2PSXA 5JBBS 3KQDA 4TWYA 2ZDAH 1YF4A 3RXKA 1HRTH 3GCHB 3Q3YA 4KTUA 1C1MA 2QIQA 3M5MA 1DPOA 3IWMA 5E0HA 4B2BA 2ZFRH 1NFXA 1TNKA 3A8CA 4YESB 1AFEH 3GCOA 2CHAC 4DVAU 2FOHA 3M7UA 1AD8H 1CSOE 5T6FA 1NU9A 1TALA 3CP7A 1AKSB 1MQ5A 1MAXA 1PPGE 1AKSA 2O8UA 1XUHA 3RXJA 2BVSH 1MKWK 1ARCA 3RMNH 1NY22 5F03A 4OGYA 2BLWA 3TITA 2H9EH 3QX5H 4I8GA 1BB0B 5DP4A 1XUKA 3SBKA 3SI4H 4ISLA 3BIVH 1L1NA 2XCNA 3A82A 2A2QH 1QJ6B 1BDAA 1ELCA 5AVDA 4NIWA 2ZU4A 1A7SA 1EXFA 1IQJA 1OX1A 1GI2A 3FP6E 3UQOA 1C2IA 1Y59T 1C5MD 3FAOA 3ZZAA 1BMAA 4MLFB 2VWLA 1ETSH 4Y71A 3SHAH 2NU3E 2R2MB 2GTBA 3BG4C 2A0QB 4AORA 1Y3UA 2FIRH 4MPUA 2BB4A 3F6UH 1XXFA 4TY7A 5DP8A 1T8MA 5JDUB 3KIDU 2WPIS 1ANCA 1DWDH 2OP9A 1KDQA 4AYVB 2A31A 3RXLA 2A32A 1V2UT 4X0WU 1LHEH 2OC1A 2HRVA 1O2VA 1GJ9B 4Q2KA 1F5RA 1PQ8A 5JBAS 3P8NA 1OWIA 2G8TA 1TIOA 1HJ9A 1O3IA 2QCYA 1BHXF 2BDIA 1L2EA 1K22H 1XUGA 1H1BA 1AVXA 1C4Y2 1EJAA 1KXCA 3O8CA 3U8RH 1HAXB 4Y79A 4MPXA 1O3NA 1P11E 2AS9A 3MU5A 3ATWA 5AFZH 2VIDA 3U1IB 3UFAA 3M3VA 1EPTC 2SNWA 1B5GH 1ESTA 1GBEA 1JMOH 1J17T 3MU1A 5DP9A 5C20A 3URCA 4CRAA 1K1IA 4LZ1H 1DOJA 2ZTZA 1TONA 1FIZA 3NZIA 3SV8A 2FS8A 4DG4A 3T29A 3A85A 1P04A 4GPGA 2XWBI 1ETTH 1ZTJA 4ABHA 1EJMA 4WVPE 1ZZZA 3KN2A 3RXRA 4E05H 2ZDLA 1HAPH 1SLUB 1HNEE 3STIA 2ZCHP 5A8YA 1CHGA 1TLDA 3MU4A 1TB6H 1AUTC 3EBNA 3E1XB 4DURA 4ZKSU 1SBWA 1G36A 3ESTA 1YP9A 4B1TA 3A7VA 1G2LA 4IMQA 3BTQE 1W7XH 2EI8A 2GMTB 1SGIB 2BY7X 2GCTB 1P05A 1C4V2 4X6MA 5FAHA 4NWLA 3GISB 1F0RA 4CR5A 1ELAA 1QRWA 1W12U 1P10A 5EXMA 3RU4T 3ZVEA 1UTOA 2XNIA 1LVBA 3QTOH 2H2ZA 3PO1B 2OC7A 3QGJA 5IYTA 3ZZ3A 2J38A 1Z1IA 4Q80A 4ZXXH 4OS4A 4ISIH 1QHRB 2VWOA 1KYNA 4GUXA 4MNYA 1E35B 4AB9A 2FZZA 3MNBA 1J14A 3VB4A 3BTFE 1K1PA 4FUBA 4JZDH 3K2UA 1A5GH 1C4U2 1RGQA 3P6ZB 1GBHA 1ZHRA 1YCPH 1NESE 1TGBA 2Z9GA 1Q2WA 1Y3YA 5HGGA 1NT1A 1UVOA 2FTLE 2M5TA 4BOHA 4DT7B 1PQAA 3LGTA 2PR3A 5E2OA 4YT6H 2K7XA 1C1QA 3TJNA 1ZHPA 1SVPA 5DP6A 2IN2A 4CR9A 1XMNB 4ZXYH 1LPGB 4AFSA 3ZZ9A 1GMDG 3H7TA 1WU1A 2H6MA 2ZU1A 2Z3CA 1O2YA 1W14U 4BAKB 4ZMAH 5ETXA 1O5GH 1K21H 4THNH 1OKXA 1A3BH 4H4FA 2FODA 2XBXA 5L2YH 1AZZA 3GDVA 4KP0A 2VH0A 4U30A 1KY9A 4XSKU 1ELEE 1GHWH 1TGCA 4WJG2 2ODYB 1HXEH 4BAQB 1C9TA 1B0EA 4X8TH 1FI8A 1KLIH 1GJDB 3UWIA 5LPEA 1OYTH 1RTFB 1O2XA 1UMAH 1BJVA 2SGAA 3ZZ6A 3MMGA 1VITH 3C27B 4LOYH 4ABBA 3ZZ5A 1PPCE 4RSPA 5TCCA 3V12A 3FZDA 1QIXB 1S83A 9ESTA 1D9IA 3TJUA 2QY0B 1F5LA 5FHTA 2BDBA 5DGJA 3QUMP 2ZHQH 1JXPA 1YBWA 3R3GB 3S9CA 3B23B 1MTVA 2F3CE 2GDDA 2FI5E 1Z8RA 2BTCE 3KL6A 5A0BA 3ZZ8A 1BRAA 4OS1A 1Z7KA 1J15A 2ZG0H 1GBJA 3C1KA 3DT0H 1EP6A 3RXSA 4AFQA 1UVPA 3K6YA 1AWFH 4I8HA 3UQVA 2EI6A 2PKAA 1NRSH 1HJAC 5DK1A 4I7YH 2C8YB 1SGQE 1GHYH 2XBWA 2TRMA 1BTYA 1HAZB 3EYDA 4YLUA 2WUBA 3M36A 1AB9B 2FDAA 4UDWH 5FBEA 2A45B 4K1SA 5TCAA 2PHBA 5CE1A 1GBKA 1C2KA 1SQTA 1BMMH 1W11U 1A0HB 4GLYA 5L6NH 1ELTA 1UO6A 2D1JA 2AGGX 4CBNA 3GY5A 5LH8A 1LHCH 4MNWA 3HGNA 1QA0A 5CHAB 3UUZA 1FY3A 1GVLA 2F9UA 3P8GA 3E6PH 1EKBB 2SGPE 4CBOA 1O36A 2GV6A 3MU0A 2H9HA 3M5NA 1KTTB 1LHFH 1TMBH 2PGBB 2ZHEH 1O2QA 1SGEE 1SOTA 5EQRA 1ZSJA 1IQNA 1WSSH 5F8XA 2PW8H 3ZVBA 3PYHA 1FV9A 3HATH 3L6PA 3T26A 3CENA 3GCTG 1IQIA 1NFWA 4RN6A 3GDSA 5HM9A 3HK3B 3A81A 2Y5FA 2W5EA 3SV9A 1N1LA 1SI5H 4IC6A 2G4UA 4X2YA 1DXPA 8LPRA 4Z0KA 1BRCE 3SQHE 4AX9H 1GJCB 1S81A 4ABAA 1GJ5H 4I8KA 2ZGHA 1C5PA 7KMEH 2BY5X 5A8XA 4HGCA 1O3EA 2VB0A 2D2DA 5T6GA 3A89A 1TOMH 1DUAA 1S6FA 4WH6A 3QK1A 4NWKA 1RS0A 2QXJA 3BTTE 3BTHE 1ZPZA 3MOCA 5FBIA 2YNBA 1T8NA 4LXBH 1EZUC 1VJ9U 3UY9A 2W26A 2WPMS 2H5CA 1HUTH 2ZFQH 3SNBA 3ODDA 4TYDA 2W7SA 3RMOH 4CH2B 1K1JA 2A4QA 1O2UA 1OSSA 4ABIA 1BTUA 4FUGA 2R9PA 4NSVA 5EQQA 1CT0E 3RU4D 1O3HA 1Z71A 1HIAA 2ZTXA 1PYTD 1J8AA 1L4DA 5JBCS 1O2JA 1VCWA 3M7TA 2XC5A 1O3DA 2Z3EA 4RKJB 1NM6A 3U8OH 3A7YA 3FP8E 1SGDE 1YKTA 3SGBE 1V2OT 2FX4A 2ZNKH 4FU9A 5SGAE 5GPIB 4B71A 1HFDA 2ZI2H 2G00A 3TNSA 3ZVCA 1E36B 1TMUH 2A7JA 1V2TT 3BTGE 4K5ZA 3DHKH 4JZEH 1EZSC 1JIRA 2QF0A 1BJUA 1UCYK 2ZU3A 2XXLA 3BTDE 4ZAEA 1D3DB 3SGQE 2ZPSA 1TX6A 1QL7A 3T28A 2WUCA 2ANYA 5JB8S 2W3IA 2GGVB 1YCPM 2JH6D 1DSUA 3QN7A 1FJSA 1NPMA 1F5KU 2C3SA 2CV3A 3LGVA 2PKSC 4NGAH 3A88A 2V3HH 1Y5BT 1K9OE 1ACBE 1AVGH 2BX3A 1GI4A 2XWAA 4AGKA 1HJ8A 3TK5A 2UUYA 3TVJB 1BRUP 4UFEH 2ZFFH 4MPWA 1UTKA 2AMDA 1J16A 5DP5A 1ZHMA 1UJ1A 2O8MA 4X8VH 1DWBH 2Z3DA 1C5SA 3M5OA 8GCHF 1QB1A 4UFDH 3TGKE 3SU2A 1UVTH 3EAJA 1HDTH 1M9UA 2TGDA 5GIBA 1SGRE 4K3JA 4ZHLU 3MU8A 1O39A 3B8JA 3A8BA 2C8ZB 3MFJA 3SV2H 1A0LA 2CGAA 3A8DA 3I77A 4JK5A 4WWYA 4X1RU 4ISNA 2BQWB 2PTCE 3M3TA 4A6LA 1MD8A 1DY8A 3PV4A 4UFGH 1XUIA 3MO6A 4XBBA 4X1PU 1V2ST 1NZQH 4WXIA 3E0PB 2V6NA 1VR1H 4SGBE 4X6PA 1QBVH 4CHAC 1V2LT 3D23A 2GVFA 2ZU2A 2SNVA 1IHTH 2AGEX 2LPRA 3RUOA 2AERH 3F68H 2FS9A 1LHDH 1Z8IB 4NSYA 3ATKA 1C1OA 4Y8YA 1C1TA