1Y59T

Dianhydrosugar-based benzamidine, factor xa specific inhibitor in complex with bovine trypsin mutant
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Trypsin, cationic
publication title Understanding binding selectivity toward trypsin and factor Xa: the role of aromatic interactions
pubmed doi rcsb
source organism Bos taurus
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2004-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1y59T01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1y59T02
1SGQE 2NU2E 1GJAB 1HAGE 1C2KA 1AE5A 3RXHA 1D3TB 5JBTA 4ABBA 5EXNA 1O3DA 2QF3A 1UVTH 2EA3A 3PWCA 4DT7B 1ZPCA 2A2QH 4I33A 1HLTH 1SLVB 3UQOA 3NZIA 4UFGH 1OS8A 4I8GA 1O0DH 4XBDA 4ASHA 1NU9A 1NTPA 4ABHA 1FY8E 3F9HA 4RN6A 1EKBB 1DVAH 1IQEA 2FTMA 4MLFB 2A4GA 2AH4X 4DW2U 1GVZA 2FI3E 1UTNA 1C5MD 1MQ6A 1SPJA 5C1XA 4FUCA 2SGEE 1MUEB 3RXGA 1ESAA 1N8OC 5LGOA 3TVJB 1O38A 1TQ7B 3ATKA 2Q6GA 2FX4A 2CHAB 1Y3UA 2TPIZ 1IQMA 1TPSA 4ABGA 5F8TA 1W13U 1TALA 4Z6AH 1ARBA 3ZVGA 1YF4A 1FQ3A 1GMHF 3RXCA 2GD4B 1C5LH 1YPLH 4Y8ZA 3A7YA 1NROH 3HGNA 1EQ9A 2YOLA 2GMTC 3KQDA 1VJ9U 1CA8B 3RU4D 1V2PT 3E0PB 3LGYA 3BTKE 1OPHB 2J38A 1SGFG 2TIOA 1HV7A 5LPRA 1GBDA 4I7YH 1E35B 3LGUA 3SJ8A 2J4IA 2FIRH 1LPKB 4JZDH 1PFXC 4MNYA 4TPYA 1THPB 1SBWA 1GJ4H 1YLDA 3UY9A 1YM0A 3PM3A 4K8YA 1LDTT 3SI4H 1DPOA 5DG6A 1ELEE 1PYTD 2ZDVH 3A87A 2ZHDA 1SG8B 1DICA 1MCVA 2ZI2H 2RA3A 4E05H 2DE8A 3A7WA 3HK3B 1XUKA 1TYNA 2UWOA 5DP8A 1O2JA 1NU7B 2AMDA 1YLCA 4OS6A 2GCHG 4DCDA 2O8MA 1RTKA 1TRMA 2B0FA 1W2KH 2WUCA 1P2JA 1D9IA 1ID5H 1CQQA 1ZMNA 2A32A 6GCHG 2A5AA 2XC0A 2G51A 3PWBA 2A1DB 3PV4A 4NWKA 4YT7H 1FY4A 1BTXA 1AKSA 2FXRA 3RXRA 4TY7A 5EW1H 2XTTB 1ORFA 3LT3A 1T8LA 1THSH 3LONA 1QRXA 3MH4A 4RSPA 1GMDF 1SGNE 2YNAA 3S0NA 1L4ZA 2STAE 2UUFB 2WPIS 4IN2A 5HM9A 2PFEA 1EAXA 1TABE 2FS9A 4X2XA 4DG4A 3OY5U 3S9CA 1QNJA 4Y79A 3EQ0H 3P95A 1O3PB 1FN8A 2O9QA 4ISIH 1TGSZ 4BAQB 2BZ6H 2B9LA 1TGBA 4CRAA 1KLIH 3ZV8A 1E37B 1O2LA 3GCHB 1BHXB 1GG6B 3K9XB 1BA8B 1JOUB 1SGYE 1UTMA 4H6SB 1YBWA 1BRBE 4XFQA 7KMEH 1Y5AT 3T26A 3GDUA 1UHBB 3UNRA 4FXGH 1U6QA 3ZYEA 3A86A 3TK6A 1AIXH 2UWLA 2IJOB 8GCHF 4GLYA 3T25A 3QLPH 4JYUH 2WYJA 3PMAB 5A09A 1IQNA 2GX4A 4X6PA 1V2NT 3GCTF 1NM6A 3PO1C 1BTYA 1G2MA 2J95A 1GBIA 4WXVA 3ZZ3A 1ELFA 2D8WA 1XUHA 5C67A 1TNHA 1A7SA 6ESTA 2AIPA 1QL7A 1AWHB 2FOAA 5DP4A 1PYTC 3MNSA 5HXFA 2W7SA 1ELDE 1C5NH 2BVRH 5L2ZH 1B5GH 2QN5T 1A3EH 5B6OA 2BDGA 1OXGA 1YPEH 1O2OA 1HUTH 3H7OA 2BY9X 1BTHH 2YNBA 3ATWA 3SV7A 5DK1A 1HGTH 1LHGH 1T31A 2V35A 2Q6DA 2ZGBH 4CBOA 1G9IE 1Z1JA 3A81A 1ELTA 3AASA 1O3AA 1SGTA 1YPGH 2B5TB 4GPGA 4Q7YA 4OS4A 3LJJA 3DD2H 3SU1A 1ZHMA 1RIWC 2ZU5A 1L2EA 5A0BA 5DP6A 2QXJA 1TE0A 3BIUH 4NIXA 1JMOH 3M5OA 1C5TA 2HNTC 2ANMH 2R9PA 1BJUA 1F5RA 3I77A 1JBUH 1CU1A 2GV7A 2G55A 2F91A 1K1IA 2GKVE 2BXTH 1MAYA 1A46H 2ZFRH 2BLOA 4Q80A 4AZ2B 2FWWA 2ZDLA 2Y81A 1ZLRA 1JWTA 3H7TA 4BAOB 2A5IA 4BOHA 1CO7E 4X2WA 3RU4E 1V2KT 1SSXA 3FZDA 1O2KA 1GBEA 2RDLA 5F8XA 4GHTA 3KF2A 2JKHA 1KIGH 1Z8JB 5EQSA 1C5VA 1MBQA 2WV4A 4XBBA 1P12E 4ZXYH 2STBE 2ZU3A 3FVFB 4TWWA 1P03A 3GY7A 2Y7XA 3M3TA 1GCTB 3AW0A 1KYNA 1W3CA 3D62A 2AFQB 3SGQE 5FPYA 3LH1A 1BMLA 5F6MA 4MPUA 1SHHB 4WXIA 1LHDH 1AD8H 2XRCA 5TCAA 3A7TA 5TCCA 1FMGA 4I31A 1J15A 2G81E 4X1SU 1TNKA 2C93B 1ZZZA 2G5NA 1LPGB 3RXJA 3F9EA 1LMWB 4YLQH 2P3TB 1INCA 2A5KA 1EPTA 5C5OA 1JIMA 3AAUA 4Q7XA 1BJVA 3QDZB 2TGTA 3M5NA 1GDQA 2ZFPH 3PLKA 1W11U 2XBYA 2VINA 1XM1A 1C1WH 1H9LB 5BRRE 2HRVA 1Q2WA 1BMAA 3UOPA 4JYVH 2A4QA 4FUJA 3LH3A 2GZ8A 1ZRKA 2ODQA 4D7FA 2UUYA 2ZHFH 2GDEH 1IHSH 3CENA 5ABWA 2F9NA 5DKMA 1N6YA 1Z7KA 1DXPA 1O39A 1IAUA 1LO6A 2ODYB 4A6LA 3GICB 1B0EA 3TNSA 3QK1A 4FU9A 1UTPA 2ZGJA 1IQIA 4VGCB 2PUXB 5FPSA 1QBNA 2HWLB 1EATA 3S7KB 1GGDB 1DLEA 3DT0H 1Y59T 3SGAE 4ZH8A 1GWAA 1P2IA 5TJXA 2I6QA 2FOHA 3LC3A 2EEKA 1P0SH 4NWLA 1TNGA 1AFQC 1H9IE 3BG4C 5T3HA 2KAIA 1CBWC 1C5WB 2BTCE 5GCHG 2Y5HA 3ZVEA 4XSKU 2XC4A 1A4WH 2ZQ2A 1ZHRA 1C1OA 1SFQB 4NZQA 3ZZAA 1CHOG 4O3UA 1MBMA 2BD4A 1PPBH 1EJNA 4X1PU 4FUBA 3PTBA 2Z3CA 4UONA 3SU4A 3SNBA 4DVAU 4WF8A 2C8WB 1BCUH 4CBNA 1ACBE 3M35A 1C4U2 4INLA 3MO3A 3Q3YA 3O8CA 3KN2A 1H1BA 1HFDA 1XKAC 3PO1B 1LTOA 1OX1A 2VWNA 3NWUA 1NC6A 1P3CA 2F83A 2RA0A 1HAXB 3DFLA 2AMPA 4HZHA 1C5PA 4ZHMU 4IBLH 3O8RA 1O2VA 1S84A 1XKBC 3QN7A 4OS7A 5FX6A 3TK5A 2H5DA 4YM9A 5AFZH 5E0HA 2JH0D 1W10U 3FFGA 1OYQA 5EXMA 2GCTB 3P17H 3QTOH 1TMBH 3HKIB 3MU4A 1SB1H 1NS3A 4ZROA 1YPJH 3TGKE 3B23B 1HAZB 2Z7FE 2FOGA 4HFPB 4UFDH 2OD3B 2Z9JA 1A0LA 1LKBA 1DS2E 3V3MA 1MD8A 4RKOB 2H2ZA 1MMJN 3RXFA 1HJAB 4IS5A 1GHVH 1NRNH 5K0HA 1Y3VA 5C20A 5BPEA 5DO4H 1K1JA 1GI7B 1G3BA 7GCHG 3RXOA 4NA7A 2WPHS 3S9AA 4IMQA 3NCLA 1ESTA 3HK6B 1EJAA 2F9VA 3GISB 1YYY1 4IW4E 1MZAA 1V6DA 4H6TA 1D3DB 4Q7ZA 1QL9A 2BMGB 4K1TA 1MKXK 4CHAC 4X1QU 2GVFA 4DOQA 3S9BA 3STIA 4ZKSU 2Y6TA 1BRAA 1XUJA 4AORA 2VH6A 4YOJA 1TLDA 4AFSA 1Z8GA 4AFQA 1HAVB 1K1MA 2FLBH 2GGVB 1SGIB 2ZHQH 1B7XB 2ZNKH 5EPNA 4A92A 1TBQH 1ZRBA 2HLCA 3A7XA 4AOQA 1UTQA 1S6HA 1NRPH 3V0XA 4MDSA 1K1NA 4XE4A 1YCPM 3K6YA 3RXKA 1O5EH 1ZGIA 2WPKS 5J4QA 5HGGA 1ZMJA 3RXBA 3VXFH 1AFEH 1O3BA 4MVNA 1JRSA 3TGIE 3F6UH 2JETC 1VGCB 4BANB 2QAAA 3Q77A 1GHAF 2CN0H 2VU8E 2DE9A 1SOTA 1H8DH 1EPTC 1C2FA 1S81A 1AWFH 4THNH 1S5SA 1C4V2 4Z0KA 4JYTA 3UUZA 1AU8A 1BBRH 2O8LA 1BITA 3LGWA 3LJOA 1JIRA 4WMEA 1A61H 3DFJA 2ULLA 3GY8A 3RXVA 1O2GH 5FBEA 3QWCH 1GMCF 2Y5GA 3S69A 2ZCHP 1O3MA 4D9QA 1NRRH 1HXFH 4X8TH 1TNIA 1FV9A 4MNVA 1XUGA 1TBZH 1LVMA 1QIXB 1O3EA 1AUJA 1O3IA 3UPEA 4D9RA 1GI4A 1QA0A 1CVWH 2BY5X 2Y82A 4Y11E 3RXSA 3UNQA 3VXEH 4GSOA 2Z9KA 4ZHLU 1O5GH 2ZGCA 1L1NA 4NGAH 2ZDMA 4H42U 1AB9B 1OWHA 1C2HA 1QBVH 4X6OA 2OC7A 4GHQA 3BTHE 4H4FA 1FAXA 1RTLA 2H1UA 1C2MA 4X1RU 1T4UH 4CRGA 2F9BH 1LKAA 1OWDA 4XBCA 5FXLA 1GHBF 2TRMA 1G3EA 2FP7B 4Y8XA 3MH6A 1AFQB 1DXWA 1E34B 1O33A 1WTHD 1O2XA 1P01A 1AGJA 1O31A 1C5YB 1YPMH 1Q31A 1CGHA 3BTEE 1DUAA 4JK5A 1KLJH 3A8DA 1CA0C 4O9VA 2JH5D 1O3JA 4FUIA 1GBHA 1ELVA 3SV6A 3O8DA 2VNTA 1YPKH 4F49A 3TJUA 2BY8X 1VR1H 1FAKH 1TOCB 1NT1A 1WAYB 2A4OA 2PGQB 2QXGA 3LPRA 2J92A 4JZ1A 1GHYH 1HIAA 4E7NA 1EAWA 3KL6A 2BLVA 1K28D 1A5GH 1OP2A 2BQ6B 2BVSH 2OQUA 3VGCC 4E7RG 3RU4T 1F0SA 3ZZ6A 1F2SE 2ANYA 4K8BA 4CRCA 3NK8A 3SQHE 4JZIA 1OWEA 2R2MB 3T29A 5HYOA 1XXDA 5CHAC 1IQKA 2GDDA 3RM0H 3KQCA 5CE1A 3BTTE 3NKKA 1SGDE 2ALPA 2GZ9A 3KQEA 1G32B 4MG3A 4R8TB 3DUXH 1ABJH 4Y0ZE 4I8LA 1CGJE 1GBLA 3SZNA 1UVUH 1MKWH 1FIZA 3PYHA 3ZZCA 2SGAA 1DLKB 4KP0A 1BTZA 1KTTB 3E3TA 4GVUA 1UK4A 2C8ZB 4JCNA 1IQGA 1S6FA 4CREA 1O3FA 3MMGA 5PTPA 4BNRA 2FDAA 2FOMB 2ZEBA 3RXQA 1OSSA 2SNVA 2OCVB 4B2BA 5A8XA 2ZGXH 3SGBE 1O2ZA 2R0KA 1DX5M 4Q2KA 4R0IA 4X2VA 3SV2H 2H9TH 1MU8B 3ZVFA 2ZHWH 2PTCE 4B1TA 4NIVA 5JBBS 5H4IB 1W8BH 3SNAA 4OS2A 1T32A 2EC9H 3TITA 5L30H 1SHYA 3BEUA 3MU1A 3B8JA 1ZTKA 3RXAA 4GCHF 1G2LA 4U32A 2TGPZ 2TGAA 3T62A 4DGJA 2NWNA 5DP9A 4MNXA 2PSYA 3AW1A 2ZKSA 4INKA 2P8OC 1EZXC 3TLOA 4ABAA 1P11E 1FPCH 8LPRA 1GJ5H 2ZPSA 2SGDE 3UIRA 1T4VH 3U98H 4FUDA 1QGFA 1UTJA 1P3EA 1P2NA 2BQ7B 1AY6H 1C5QA 2VVCA 1O2TA 2ANWA 3GY2A 4JZFH 3T27A 3AAVA 3BTME 2IPHA 2FYQA 2Q6FA 1GHXH 3EA8A 3NPSA 3PMBB 4UEHH 3UWIA 1OOKB 4AYYB 3FZZA 1ZR0A 5C2ZA 4B2AA 5A2MH 1C1SA 1DWBH 3EAJA 1H4WA 2WYGA 1O5DH 2BD3A 1DUEA 1Z8RA 2NU1E 3MU5A 1GMHG 3RUOA 1KSNA 4HGCA 4KKDA 1P05A 1RTFB 1UVSH 1SGEE 3BEIB 5ETXA 2CV3A 8KME2 2SGPE 1VITH 4CH2B 3VPKA 3UNSA 2FX6A 1QHRB 1QTFA 4M7GA 3A85A 2ZA5A 2K1QA 3PLBA 4X0WU 3VB3A 5JYIA 1YKTA 4JZEH 2G00A 3VFEA 1O3CA 2JETB 3D65E 2VH0A 4U2WA 1GI0A 3HATH 1O30A 5EQRA 3SU6A 5E8EH 1W0ZU 1MTNB 3T2NA 1GJ8B 3GCNA 3VB7A 2A31A 1V2UT 1UVPA 1YGCH 2FLRH 4OS1A 2BHGA 3BTGE 4AN7A 1K2I1 5EQQA 1LHCH 2OC8A 2D2DA 2GZ7A 4J2YB 1ETSH 2CF8H 1UCYH 4ABJA 3SQEE 5JDUB 2WPJS 9LPRA 4ABIA 1EXFA 4BAKB 4IN1A 1P2QA 2Y7ZA 5EPYA 3SNDA 1K1OA 3JZ1B 4CRBA 2R0LA 3OX7U 3MH7A 1ELGA 4ZHAA 3K65B 1FY3A 3KIDU 1AZ8A 1DY8A 5DPAA 2H5CA 1TA2A 4IMZA 5LPEA 3R3GB 2ZDKA 1GVKB 1GMDG 3VB6A 2BXUH 1SGPE 2AGEX 2PV9B 4WH8A 1GL0E 3F1SB 3A82A 1UK3A 3M61U 1TX6A 3BTWE 3L33A 4Y10E 1N8OB 1AI8H 1IQJA 3M7QA 1C9PA 3IITA 3SJIA 1KXFA 2J2UA 2XBVA 3URCA 2VGCC 1AE8H 3UREA 1WCZA 1AVWA 1F0RA 1C5XB 4KTUA 5G4BA 6CHAC 1DT2A 5IYTA 3ENSB 1UO6A 4OGXA 1T8MA 1ZHPA 1UHBA 1P06A 3GCOA 4WJG2 5DJ7A 1EZUC 1BMMH 2ZPQA 2OTVA 5A8ZA 3B9FH 3PMHB 1DE7H 1ZOMA 1O2QA 3U8RH 3ZZ7A 4RKJB 2BB4A 2PKAB 2GMTB 3KGPA 1YC0A 4SGAE 4A7IB 1ELBA 2AERH 1QQUA 3ATIA 1G37A 2AIQA 5E2OA 1KXEA 1BBRK 3FP6E 3OU0A 4NFFA 8GCHG 3OYPA 4FUHA 2XW9A 1GDUA 1UTLM 3GCTG 1HDTH 1SFIA 4ABEA 4K1EA 4YLUA 1N1LA 1C1VH 3MU0A 3EYDA 1D4PB 3ZZBA 3GY6A 1NRQH 1J14A 1O5AB 5EGMA 2XBXA 3GOVB 3HKJB 3KCGH 1GI6A 1T8OA 1ZSLA 3H5CB 3RXDA 3SI3H 3ATLA 1CGIE 1SR5C 1V2JT 3ESTA 1O35A 4BAHB 2W5EA 4WMFA 2O8WA 3O8BA 4A5TS 1XVMA 1V2RT 2G5VA 1Y8TA 1EB2A 1VCQA 4WMDA 3M3VA 3MHWU 4J1YA 4A1XA 1W12U 1KLTA 1PPEE 2PTNA 1TAWA 2BY6X 4D7GA 2VIVA 1KXCA 2QA9E 3FAOA 4X6NA 4AB8A 1HJ8A 1BT7A 2A7JA 1P57B 2C3SA 3RXUA 1SGFA 1CT4E 3LOXA 1C5OH 1KXDA 4D76A 2HPPH 1GI3A 1BBRE 1TIOA 2ZO3H 1LHEH 1GJ9B 1F92A 1WTGH 2VJ1A 2VIDA 2OP9A 2ZP0H 1AO5A 1BDAA 1IOEA 3TJNA 1LQEA 4NZLA 4BAMB 1MD7A 2HPQH 4K69A 2BQWB 1THRH 3KEEA 3UQVA 2ZC9H 1C1RA 4DURA 1S0QA 2CHAC 2ZFTA 1TX7A 2ZECA 1N6XA 2V0BA 2FEQH 2OUAA 1ZSKA 1OWIA 2RCEA 1O2PA 4ZMAH 2QIQA 2O8TA 3ODDA 4AGKA 1EB1H 1RRKA 2PKSC 2D1JA 1LVYA 2BY7X 3ATMA 1EAUA 2ZHEH 3UFAA 1BQYA 2ZCKP 2QC2A 1FZZA 1C2LA 1SI5H 5E2PA 4CR5A 1DWEH 2PWXA 2C90B 2LPRA 1MKWK 4FU7A 2BD5A 2G4TA 4YTAA 2AGGX 5GJ4B 1KDQB 1BTPA 4K2YA 1MH0A 3E1XB 2H6MA 1J16A 1GL1A 1K9OE 1OKXA 3A88A 3MYWA 4Y6DA 1VITF 1RS0A 2B8OH 2W7UA 4KTSA 5T6GA 2D26C 1O5CB 2XC5A 1BHXF 2Z9LA 3LDXH 1DFPA 1TQ0B 1EZQA 3E0NB 2GT7A 3ZVCA 1TMTH 3SN8A 1QJ1B 1QL8A 5JB8S 1EAIA 2BD8A 3M7UA 1NRSH 2BLQA 1V2OT 2Y5FA 1QFKH 1NFYA 2BVXH 1O3HA 4I8HA 1QJ6B 1QY6A 2P93A 4NIYA 2HVXA 1HB0B 1HBTH 3KHVA 2A0QB 2NU4E 1FLEE 1RGQA 3P8GA 1HPGA 1O2YA 2BD2A 2FTLE 3QTVH 4B71A 1IQHA 3SU0A 4HI3A 1LPZB 4ISNA 1IQFA 3A80A 1BMNH 3ZZDA 2PUQH 2BD7A 3RXMA 4LZ1H 1LHFH 1RIWB 1J17T 2VWOA 1D3QB 1SOZA 1V2WT 1NFUA 5FX5A 1GBJA 1E36B 1BRCE 2VIQA 3GY3A 1ABIH 1ARCA 3HPTB 1OWKA 1L1GA 1NFWA 2Z9IA 4X2YA 1B0FA 1Y5UT 2V3OH 2PSXA 1O3KA 5AFYH 1SGCA 5I25A 2UWPA 1GJCB 1VZQH 3VEQB 1O34A 1WV7H 2V3HH 5F8ZA 3SU3A 3U8TH 2XXLA 3GCHC 2THFB 1ZGVA 1AZZA 2OINA 3U69H 3TK9A 3LIWA 4DIIH 4XOJA 4TY6A 1O32A 1RD3B 1EP5A 2P3FH 3RXEA 1MAXA 3N7OA 3P70B 2EI8A 1TMUH 2EI6A 3MNBA 3S7HB 3ELAH 4KELA 1FXYA 3F9FA 4F4OC 1NY22 3EA7A 5FAHA 7LPRA 1AQ7A 1PQ5A 4D8NA 1PQAA 1V3XA 3SW2B 2PHBA 1CT2E 3SHCH 1PJPA 1P9SA 1EZSC 2R3UA 1C2GA 4LZ4B 1WYKA 1TPAE 1F5KU 5AF9H 2BLWA 2QXIA 1QB6A 4O3TA 4JMYA 3A83A 2GCHF 1NO9H 1OP8A 3UWJH 1FJSA 1SQTA 2R3YA 4GAWA 1L1JA 5FHTA 2ZFFH 1O2RA 1C2EA 1FONA 5EOKA 5A0CA 1O2IA 4AG1A 1HAOH 3QUMP 6GCHF 1UJ1A 3LGTA 3Q76A 1C1NA 1UCYK 4IC5A 4NFEA 3GYMA 1WSSH 1A5HA 1KY9A 5A8YA 2ANKH 4I8JA 3U8OH 1SLXB 4X8VH 1Y3YA 1TB6H 1QCPA 1D3PB 1GBCA 3AVZA 3QGNB 4K3JA 3RXLA 1SLWB 1O2WA 4AG2A 3P92A 1F0TA 2ZG0H 1AKSB 1ZMLA 2WV5A 1JXPA 3P8FA 1HXEH 3RMLH 2BDCA 3QGJA 3R0FA 2FO9A 3MNCA 3WY8A 2F9PA 2BD9A 1LCYA 1AUTC 1QRZA 1YPHE 1DWDH 2LNCA 2J34A 2ZIQH 4SGBE 2BM2A 2J94A 3MO9A 1VCWA 3BTQE 1GVLA 2BOHB 3BG4B 1G3CA 3PTNA 1CBWB 1S0RA 4TPIZ 1GPZA 1P9UA 3ZZ9A 2OBQA 4LK4A 1V2TT 3E90B 1UCYE 5LPFA 1SMFE 2PGBB 2VWMA 1PPHE 2ZWLH 1UK2A 2FESH 1TA6A 3QZQA 2BOKA 2NU3E 1FI8A 4ZKOU 3F68H 1WBGB 3EE0B 1PPGE 1TGCA 1GBKA 5K7RA 2TBSA 1HAVA 2BDYA 2OXSA 5C1YA 5EG4A 1GCTC 1ANBA 4CR9A 2P16A 1C1MA 2PKSB 1C9TA 4YZUA 3RMMH 5LH8A 4YOGA 3VB4A 3V12A 1P8VC 1OP0A 4UFEH 1FDPA 3BG8A 1Y5BT 1CT0E 3GDVA 4UDWH 5DP5A 1T8NA 1Q3XA 4FUEA 3TJVA 2WINI 3ZVBA 4ISLA 2OQ5A 3K2UA 1TBRH 3U9AH 5CMXH 1F7ZA 2ZDNA 4AB9A 1A0JA 3D49H 2XWBI 3EA9A 1D6RA 3C27B 1SL3A 4YOIA 1TPPA 4FU8A 1K1PA 1MU6B 1K22H 1XUFA 2ZFQH 1H8IH 3BEFB 3SV9A 4I32A 4DY7B 1GHAG 1OWJA 1KXBA 1EX3A 2BYAX 1EOLA 1YCPH 3TGJE 1F0UA 2FI4E 3SJ9A 1MCTA 5AHGH 3DA9B 2H9HA 1FY1A 2WPMS 2VIOA 1BRUP 4B74A 4BTTB 5HMAA 1CHGA 3JZ2B 2PW8H 1GMCG 4A1TA 1TGNA 5HM2A 1BOQA 2HGTH 5EU8A 1P10A 1GBTA 4MPXA 2A45B 1ZYOA 1Z1IA 5A0AE 1GBMA 3E91A 4VGCC 1WUNH 3NUMA 3SHAH 4Y0YE 1GGDC 1C1UH 2EI7A 4B73A 1AHTH 1SC8U 3T28A 3BF6H 1NESE 4K1SA 1O2HA 3TU7H 3T5FH 2C4FH 4MTBA 2FS8A 1DM4B 1CSOE 1GJ7B 1LVBA 1MTSA 1CE5A 1O3GA 1NFXA 1HAHH 4ZXXH 3UR6A 1GBAA 1NPMA 3RC6A 4CHAB 3RLYH 2FM2A 5GIBA 1DSTA 2FZZA 4NIWA 4LOYH 1P2KA 2TGDA 5E0JA 1GHBG 3SUGA 5EW2H 1BB0B 2ZFSA 3OY6U 1QR3E 2UUKB 3RC5A 2P95A 4X6MA 2H9EH 1ZTLA 3U1JB 3A8BA 1V2VT 1WQVH 3SORA 1D6WA 2ESTE 1G36A 2CF9H 2HALA 3BTDE 3KNXA 1KXAA 3KQBA 2XCNA 1ZPBA 1G30B 1W7GH 2HNTF 1DANH 1GI8B 1MKXH 4Y7BA 4A1VA 2SFAA 3F9GA 3RMOH 5SGAE 1QA7A 1C4Y2 2SGQE 4QT8C 2BX3A 1FPHH 5GWZA 4IGDA 2QXHA 3PMJA 1Y3WA 4KGAA 4B75A 4CH8B 3DHKH 4UE7H 3SU2A 1ZSJA 1TNLA 1MTVA 3UOUA 3MO6A 3URDA 1EASA 2CGAA 1EPTB 3E6PH 5GDSH 3MI4A 1TONA 3MWIU 1HAPH 4WVPE 2XYAA 3BIVH 4JK6A 3I78A 3RDZA 3RLWH 1FUJA 2W3IA 1LVOA 5GPIB 5C5NA 2QCYA 3MOCA 5L2YH 2Z3EA 2QYIA 2GCTC 1AVXA 1TWXB 1DSUA 4FVBA 1O2UA 3M5MA 1HCGA 1UTKA 2VVUA 2GTBA 3EDXB 3IWMA 1Z71A 2ZU2A 2QY0B 3BTFE 1DWCH 2P94A 5ESBA 5AVDA 2VIPA 1EOJA 5T6FA 4YO9A 1SLUB 4IC6A 1XVOA 3GYLB 3SNEA 1HJAC 3QO6A 4O03A 4ABDA 3TJOA 3UR9A 3RP2A 1P2MA 1TGTA 3A8AA 3PLPA 1C1PA 1OYTH 2P3UB 1RXPA 3D23A 1FIWA 4Y71A 2FPZA 2IOTA 1P09A 1TOMH 1SQOA 5GCHF 1TX8A 3ZZ4A 7ESTE 2RG3A 4GCHG 4Y8YA 1A2CH 4MPWA 4CRDA 2KAIB 1CHOF 4U01A 1L0ZA 1UTOA 2FMJA 2P59A 1O2MA 4E06H 1XUIA 1CA0B 4GUXA 3ZVAA 2AMQA 1QJ7B 2O8UA 2W26A 4DJZB 2GT8A 1M9UA 3CP7A 4K5ZA 2IN2A 1SVPA 1ZTJA 1F5LA 1PQ7A 1SQAA 3MU8A 2ZF0H 3VGCB 4YESB 3SV8A 1O3OA 1S85A 4X1NU 4Y7AA 3M36A 3Q3XA 2C8XB 1QB1A 1O5BB 1J9CH 3NXPA 1O2SA 1C5RA 3SNCA 2G8TA 1K21H 5J4SA 5FPTA 5CHAB 4ZAEA 3P8NA 3TH2H 3MNXA 1TRNA 3MFJA 1GDNA 3LGIA 3MTYA 4K60A 3SUFA 1HNEE 3ZV9A 2J9NA 3CS7A 3BV9B 4OGYA 1ELAA 4WH6A 2F9OA 1VGCC 1JRTA 1NZQH 3V13A 1DITH 2M5TA 1GI2A 1X7AC 2GP9B 2ZDAH 2ZCLP 1DOJA 2ODPA 1V2QT 1C5SA 2CXVA 5JB9S 1C2DA 3W94A 3P6ZB 3I29A 1S83A 1IQLA 2FOBA 1O2NA 2QV1A 5I46H 2ZZUH 8ESTE 5F03A 2G52A 2HNTE 1HAIH 2V6NA 4ZUHA 3ZZ5A 4LXBH 1BUIA 1FY5A 2Y80A 3VB5A 1IHTH 3A7ZA 2ZU1A 1C2JA 2A7HA 1BIOA 1XXFA 2FOCA 2Z3DA 2OC1A 4AYVB 7GCHF 2HOBA 5EXLA 1O3LA 4NA9H 3LGVA 3GY5A 2A2XH 2Z94A 1MZDA 4INHA 4TWYA 1MQ5A 4O97A 3M37A 1AN1E 1WQSA 2BDHA 3ODFA 1AB9C 1C1QA 2GV6A 1ANEA 3M5LA 5ESTE 4FUFA 3EGKH 2OBOA 3SOSA 3SU5A 4HTCH 2WUBA 5C3NA 2FI5E 2P8OB 1ANDA 4MPVA 1PQ8A 1AVGH 2FYRA 2ALVA 2BZAA 1GI5A 2VWLA 2I6SA 2BX4A 4AX9H 4BXSA 6LPRA 2PLXA 3Q00A 2XNIA 5FCKA 2XWAA 1HYLA 4X8SH 1BTWA 4Y76A 1GI1A 1Z8IB 3TIUA 2BDIA 1W7XH 2XCFA 1XX9A 1RJXB 1MTWA 3G01A 3TH4H 3Q3KA 1C5UA 1G3DA 1GI9B 2R2WU 1GHWH 3RXPA 3IG6B 1TNJA 9ESTA 4NSYA 1DDJA 1TPOA 1S82A 4NA8A 3K6ZA 1VCPA 4NSVA 1Y3XA 1XMNB 2PKAA 1E0FD 3RXIA 3C1KA 4UFFH 1GHZA 2AS9A 3M3SA 1FNIA 3ITIA 2W3KA 2ILNA 3STJA 2Z9GA 3TNTA 3OSYA 2ZPRA 5E0GA 1E38B 1L4DA 4MNWA 2Q1JA 1V2MT 5L6NH 1Z6EA 1P04A 2XBWA 1FN6A 2ZTXA 3E8LA 3RC4A 1T7CA 4B76A 2DUCA 2ASUB 4I8KA 1GBFA 5C1UA 1YCPK 1GBBA 1AMHA 3RXTA 3FP8E 3L3TA 1ELCA 1QB9A 3ZVDA 2CMYA 4X8UH 1A0HB 2QF0A 3LU9B 3TH3H 3UTUH 1KTSB 2SGFE 1O3NA 3RM2H 1Z6JH 1ZPZA 2AGIX 3MH5A 3SUEA 4BTIB 1A5IA 3P8OA 2VVVA 3A89A 4AFZA 1J8AA 3HGPA 5JBCS 3LKWA 2FOEA 1O37A 1ETRH 5DP7A 1O5FH 1C1TA 1TFXA 5FBIA 1YP9A 4ZKNU 2ZU4A 1HRTH 5FCRA 4YT6H 2VIWA 3SUDA 4BXWA 3SJOA 2WPLS 1RFNA 4U30A 5JPMH 1HAYB 3GDSA 3PROA 1NN6A 2UUJB 1ZJKA 2OLGA 3RMNH 3A7VA 1H9HE 4WY3A 1ZJDA 3LC5A 1V2LT 5IDKA 4PROA 2ZGHA 1W0YH 1O36A 2BDBA 2G4UA 4B2CA 4NCYA 1QURH 3PB1E 2FOFA 1LQDB 2FODA 4FUGA 3OTJE 5EODA 1GG6C 1GJ6A 3QZRA 5JBAS 1BTUA 1V2ST 1ETTH 4AGJA 3QX5H 2VGCB 1K1LA 2F3CE 2Z6BD 6CHAB 1VJAU 2PR3A 3BN9A 2F9UA 4NG9H 2ZQ1A 4OS5A 2AEIH 1YPHC 3A84A 4MQAA 1ANCA 1HIAB 3FANA 4ZKRU 3ZYDA 1DY9A 4ISOA 5DP3A 4DIHH 1GJDB 1C5ZB 2VB0A 1EP6A 3W95A 4WWYA 3SBKA 1UVOA 1GJBB 3CS0A 4TYDA 1BZXE 1UMAH 4KTCA 4ISHH 1QRWA 2ZTYA 1A3BH 2A7CA 2NU0E 1QBOA 4ABFA 1KDQA 2QGRA 1SGRE 3E16B 1GCDA 1HJ9A 3M7TA 1C2IA 2CJIA 1QQ4A 2B7DH 2JH6D 1PPFE 1P02A 3GY4A 1WOFA 1ESBA 3U1IB 2BDAA 3ZZ8A 4AFUA 1EUFA 4ESTE 3SO3A 5DGJA 1MTNC 1W14U 1P2OA 1A1RA 1MTUA 3A8CA 3BSQA 1VITG 3L6PA 4UD9H 2OC0A 1TRYA 5T6DA 2ZTZA 4FVDA 4CRFA 2A4RA 1WU1A 2SNWA 5GXPA 2C8YB 3V7TA 4BTUB 1EJMA 3SJKA 4XDEA 1PPCE 3FP7E 3TPIZ 1PPZA 2AYWA
chains in the Genus database with same CATH superfamily
1SGQE 2NU2E 1GJAB 1HAGE 1C2KA 1AE5A 3RXHA 1D3TB 5JBTA 4ABBA 2L74A 5EXNA 1O3DA 2QF3A 1UVTH 2EA3A 3PWCA 4DT7B 1ZPCA 2A2QH 4I33A 1HLTH 1SLVB 3KQ5A 3NZIA 3UQOA 4UFGH 1OS8A 4I8GA 1O0DH 4XBDA 4ASHA 1NU9A 1NTPA 4ABHA 1FY8E 3F9HA 4RN6A 1EKBB 1DVAH 5C17A 1IQEA 2FTMA 3DSPA 2A4GA 2AH4X 4MLFB 2OK5A 4DW2U 1GVZA 2FI3E 1UTNA 1C5MD 1MQ6A 1SPJA 5C1XA 4FUCA 2SGEE 1MUEB 3RXGA 1ESAA 1N8OC 5LGOA 3TVJB 1O38A 1TQ7B 3ATKA 2Q6GA 1YY3A 2FX4A 2CHAB 1Y3UA 2TPIZ 1IQMA 1TPSA 4ABGA 5F8TA 1W13U 1TALA 4Z6AH 1ARBA 3ZVGA 1YF4A 1FQ3A 1GMHF 3RXCA 2GD4B 1C5LH 1YPLH 4Y8ZA 3A7YA 1NROH 3HGNA 1EQ9A 2YOLA 2GMTC 3KQDA 1VJ9U 1CA8B 3RU4D 1V2PT 3E0PB 3LGYA 3BTKE 1OPHB 2J38A 1SGFG 2TIOA 1HV7A 5LPRA 1GBDA 4I7YH 1E35B 3LGUA 3SJ8A 2J4IA 2FIRH 1LPKB 4JZDH 1PFXC 4MNYA 4TPYA 1THPB 1SBWA 1GJ4H 1YLDA 3UY9A 1YM0A 3PM3A 4K8YA 1LDTT 3SI4H 1DPOA 5DG6A 1ELEE 1PYTD 2ZDVH 3A87A 2ZHDA 1SG8B 1DICA 1K0HA 1MCVA 2ZI2H 2RA3A 4E05H 2DE8A 3A7WA 3HK3B 1H8ED 1XUKA 1TYNA 2UWOA 5DP8A 1O2JA 1NU7B 2AMDA 1YLCA 4OS6A 2GCHG 4DCDA 2O8MA 1RTKA 1TRMA 2B0FA 1W2KH 2WUCA 1P2JA 1D9IA 1ID5H 1CQQA 1ZMNA 2A32A 6GCHG 2A5AA 2XC0A 2G51A 3PWBA 2A1DB 3PV4A 4NWKA 4YT7H 1FY4A 1BTXA 1AKSA 2FXRA 3OEED 3RXRA 2HVYB 4TY7A 5GNDA 2XTTB 1ORFA 5EW1H 2YMSB 3FOAA 3LT3A 1T8LA 1THSH 3LONA 1QRXA 3MH4A 4RSPA 1GMDF 1SGNE 3FKSD 2YNAA 3S0NA 1L4ZA 2STAE 2UUFB 2WPIS 4IN2A 5HM9A 2PFEA 1EAXA 1TABE 2FS9A 4X2XA 4DG4A 3OY5U 3S9CA 1QNJA 4Y79A 3EQ0H 3P95A 1O3PB 1FN8A 2O9QA 3DSOA 4ISIH 1TGSZ 4BAQB 2BZ6H 2B9LA 1TGBA 4CRAA 1KLIH 3ZV8A 1E37B 1O2LA 3GCHB 1BHXB 1GG6B 3K9XB 1BA8B 1JOUB 1SGYE 1UTMA 4H6SB 1YBWA 1BRBE 5EJ1A 4XFQA 7KMEH 1Y5AT 3T26A 3GDUA 1UHBB 3UNRA 4FXGH 1U6QA 3ZYEA 3A86A 3TK6A 1AIXH 1E1QD 2UWLA 2IJOB 2KFWA 8GCHF 4GLYA 3T25A 3QLPH 4JYUH 2WYJA 3PMAB 5A09A 1IQNA 2GX4A 4X6PA 5F53A 1V2NT 3GCTF 1NM6A 3PO1C 1BTYA 1G2MA 2J95A 1GBIA 4WXVA 3ZZ3A 1ELFA 2D8WA 1XUHA 5C67A 1TNHA 1A7SA 6ESTA 2AIPA 4ACBA 1QL7A 1AWHB 2FOAA 5DP4A 4I86A 1PYTC 3MNSA 5HXFA 2W7SA 1ELDE 1C5NH 2BVRH 5L2ZH 1B5GH 2QN5T 1A3EH 5B6OA 2BDGA 1OXGA 1YPEH 1O2OA 1HUTH 3H7OA 2BY9X 1BTHH 2YNBA 3ATWA 2LELA 3SV7A 5DK1A 1HGTH 1LHGH 1T31A 2V35A 2Q6DA 2ZGBH 4CBOA 1G9IE 4F55A 1Z1JA 3A81A 1ELTA 3AASA 1O3AA 1SGTA 1YPGH 2B5TB 4GPGA 4Q7YA 4OS4A 3LJJA 3DD2H 3SU1A 1ZHMA 1RIWC 2ZU5A 1L2EA 5A0BA 5DP6A 2QXJA 1TE0A 3BIUH 1VKYA 4NIXA 1JMOH 3M5OA 1C5TA 2HNTC 2ANMH 2R9PA 1BJUA 1F5RA 3I77A 1JBUH 2KCAA 1CU1A 2GV7A 1WDIA 2G55A 2F91A 1K1IA 2GKVE 2BXTH 1MAYA 1A46H 2ZFRH 2BLOA 4Q80A 4AZ2B 2FWWA 2ZDLA 2Y81A 1ZLRA 1JWTA 3H7TA 4BAOB 2A5IA 4BOHA 1CO7E 4X2WA 3RU4E 1V2KT 1SSXA 3FZDA 1O2KA 1GBEA 2RDLA 5F8XA 4GHTA 3KF2A 2JKHA 1KIGH 1Z8JB 5EQSA 1C5VA 1MBQA 2WV4A 4XBBA 1P12E 4ZXYH 2STBE 2ZU3A 3FVFB 4RT1A 4TWWA 1P03A 2JDID 2JJ1D 3GY7A 2Y7XA 3M3TA 1GCTB 3AW0A 1KYNA 1W3CA 2LP6A 3D62A 5EIYA 2AFQB 3SGQE 5FPYA 3LH1A 1BMLA 5F6MA 4MPUA 1SHHB 4WXIA 1LHDH 1AD8H 2XRCA 4ACAA 5TCAA 3A7TA 3DCLA 5TCCA 1FMGA 4I31A 1J15A 2L6OA 2G81E 4X1SU 1TNKA 2C93B 1ZZZA 2G5NA 1LPGB 3RXJA 3F9EA 1LMWB 4YLQH 2P3TB 1INCA 2A5KA 1EPTA 5C5OA 1JIMA 5C0UA 3AAUA 4Q7XA 1BJVA 3QDZB 2TGTA 3M5NA 1GDQA 2ZFPH 3PLKA 1W11U 2XBYA 2KM0A 2VINA 1XM1A 1C1WH 1H9LB 5BRRE 2HRVA 4DT4A 1Q2WA 1BMAA 3UOPA 4JYVH 2A4QA 4FUJA 3LH3A 2GZ8A 1ZRKA 2ODQA 4D7FA 2UUYA 2ZHFH 2GDEH 1IHSH 3CENA 5ABWA 2F9NA 5DKMA 1N6YA 1Z7KA 1DXPA 1O39A 1IAUA 1LO6A 2ODYB 4A6LA 3GICB 1B0EA 3TNSA 3QK1A 2WV9A 4FU9A 1UTPA 2ZGJA 1IQIA 4VGCB 2PUXB 5FPSA 1QBNA 2HWLB 1EATA 3S7KB 1GGDB 1DLEA 3DT0H 1Y59T 3SGAE 4ZH8A 1GWAA 1P2IA 5TJXA 2I6QA 2FOHA 3LC3A 2EEKA 1P0SH 4NWLA 1TNGA 1AFQC 1H9IE 3BG4C 5T3HA 2KAIA 1CBWC 1C5WB 2BTCE 5GCHG 2Y5HA 3ZVEA 4XSKU 2WPDD 2XC4A 1A4WH 2ZQ2A 1ZHRA 1C1OA 1SFQB 4NZQA 3ZZAA 1CHOG 4O3UA 1MBMA 2BD4A 1PPBH 1EJNA 4X1PU 4FUBA 3PTBA 2Z3CA 4UONA 3SU4A 3SNBA 4DVAU 4WF8A 2C8WB 1BCUH 4CBNA 1ACBE 3M35A 1C4U2 4INLA 3MO3A 3Q3YA 3O8CA 3KN2A 1H1BA 1HFDA 5HKKD 1XKAC 3PO1B 1LTOA 1OX1A 2VWNA 3NWUA 1NC6A 1P3CA 2F83A 2RA0A 1HAXB 3DFLA 2AMPA 4HZHA 1C5PA 4ZHMU 4IBLH 3O8RA 1O2VA 1S84A 4M9FA 1XKBC 1W0JD 3N7EA 3QN7A 4OS7A 5FX6A 3TK5A 2H5DA 4YM9A 1NBMD 5AFZH 5E0HA 2JH0D 1W10U 3FFGA 1OYQA 5EXMA 2GCTB 3P17H 3QTOH 1TMBH 3HKIB 3MU4A 1SB1H 1NS3A 4ZROA 1YPJH 3TGKE 3B23B 1HAZB 2Z7FE 2FOGA 4HFPB 4UFDH 2OD3B 2Z9JA 1A0LA 1LKBA 1DS2E 3V3MA 1MD8A 4RKOB 2H2ZA 1MMJN 3RXFA 1HJAB 4IS5A 1GHVH 1NRNH 1WXRA 5K0HA 1Y3VA 5C20A 5BPEA 5DO4H 1K1JA 1GI7B 1G3BA 5DSFA 7GCHG 3RXOA 4NA7A 2WPHS 3S9AA 4IMQA 3NCLA 1ESTA 3HK6B 1EJAA 2F9VA 3GISB 1YYY1 4IW4E 1MZAA 1V6DA 4H6TA 1D3DB 4Q7ZA 1QL9A 2BMGB 4K1TA 1MKXK 4CHAC 4X1QU 2GVFA 4DOQA 3S9BA 3STIA 4ZKSU 2Y6TA 1BRAA 1XUJA 4AORA 2VH6A 4YOJA 1TLDA 4AFSA 1Z8GA 4AFQA 1HAVB 1K1MA 2FLBH 2GGVB 1SGIB 2ZHQH 1B7XB 2ZNKH 5EPNA 4A92A 1TBQH 1ZRBA 2HLCA 3A7XA 4AOQA 1UTQA 1S6HA 1NRPH 3V0XA 4MDSA 1K1NA 4XE4A 1YCPM 3K6YA 3RXKA 4P02A 1O5EH 1ZGIA 2WPKS 5J4QA 5HGGA 1ZMJA 3RXBA 3VXFH 1AFEH 1O3BA 4MVNA 1JRSA 3TGIE 3F6UH 2JETC 1VGCB 4BANB 2QAAA 3Q77A 1GHAF 2CN0H 2VU8E 2DE9A 1SOTA 1H8DH 1EPTC 1C2FA 1S81A 1AWFH 4THNH 1S5SA 1C4V2 4Z0KA 4JYTA 3UUZA 1AU8A 1BBRH 2O8LA 1BITA 3LGWA 3PRDA 3LJOA 1JIRA 4WMEA 1A61H 3DFJA 2ULLA 3GY8A 3RXVA 3F3BA 1O2GH 5FBEA 3QWCH 1GMCF 2Y5GA 3S69A 2ZCHP 4FETA 1O3MA 2QF5A 4D9QA 1NRRH 1HXFH 4X8TH 1TNIA 1FV9A 4MNVA 1XUGA 1TBZH 1LVMA 1QIXB 1O3EA 1AUJA 1O3IA 3UPEA 4D9RA 1GI4A 1QA0A 3OEHD 1CVWH 2BY5X 2Y82A 4Y11E 3RXSA 3UNQA 3VXEH 4GSOA 2Z9KA 4ZHLU 1O5GH 2ZGCA 1L1NA 4NGAH 2ZDMA 4H42U 1AB9B 1OWHA 1EFRD 1C2HA 1QBVH 4X6OA 2OC7A 4GHQA 3BTHE 4H4FA 1FAXA 1RTLA 2H1UA 1C2MA 4X1RU 1T4UH 4CRGA 2F9BH 1LKAA 1OWDA 4XBCA 2KZ4A 5FXLA 1GHBF 3F2HA 2TRMA 1G3EA 2FP7B 4Y8XA 2VBCA 5HIYA 3MH6A 1AFQB 1DXWA 1E34B 1O33A 1WTHD 1O2XA 1P01A 1AGJA 1O31A 1C5YB 1YPMH 1Q31A 1CGHA 3BTEE 1DUAA 4JK5A 3H09A 1KLJH 1YWUA 3A8DA 1E1RD 1CA0C 4O9VA 2JH5D 1O3JA 4FUIA 1GBHA 1ELVA 3SV6A 3O8DA 2VNTA 1YPKH 4F49A 3TJUA 2BY8X 1VR1H 1FAKH 1TOCB 1NT1A 1WAYB 2A4OA 2PGQB 2QXGA 3LPRA 2J92A 4JZ1A 1GHYH 1HIAA 4E7NA 1EAWA 3KL6A 2BLVA 1K28D 1A5GH 1OP2A 2BQ6B 2BVSH 2OQUA 3VGCC 4E7RG 3RU4T 1NBME 1F0SA 3ZZ6A 1F2SE 2ANYA 4K8BA 4CRCA 3NK8A 3SQHE 4JZIA 3AK5A 1OWEA 2R2MB 3T29A 5HYOA 1XXDA 5CHAC 2QE7D 1IQKA 2GDDA 3RM0H 3KQCA 1OHHD 5CE1A 3BTTE 3NKKA 1SGDE 2ALPA 2GZ9A 3KQEA 2JIZD 1G32B 4MG3A 4R8TB 2JJ2D 3DUXH 1ABJH 3WWFA 4Y0ZE 2XOKD 4I8LA 1CGJE 1GBLA 3SZNA 1KMHB 1UVUH 1MKWH 1FIZA 5C0TA 4FOUC 3PYHA 3ZZCA 2SGAA 1DLKB 4KP0A 1BTZA 1KTTB 3E3TA 4GVUA 1UK4A 2C8ZB 4JCNA 1IQGA 1S6FA 4CREA 1O3FA 3MMGA 5PTPA 4BNRA 2FDAA 2FOMB 2ZEBA 3GS9A 3RXQA 1OSSA 2SNVA 2OCVB 4B2BA 5A8XA 2ZGXH 3SGBE 1O2ZA 2R0KA 1DX5M 4Q2KA 4R0IA 4X2VA 3SV2H 2K0QA 2H9TH 2PP6A 1MU8B 3ZVFA 2ZHWH 2PTCE 4B1TA 4NIVA 5JBBS 1YLNA 5H4IB 1W8BH 3SNAA 4OS2A 1T32A 2EC9H 3TITA 5L30H 1SHYA 3BEUA 3MU1A 3B8JA 1ZTKA 3RXAA 4GCHF 1G2LA 4U32A 2TGPZ 2TGAA 3T62A 4DGJA 2NWNA 5DP9A 4MNXA 2PSYA 4OM9A 3AW1A 2ZKSA 4INKA 2P8OC 1EZXC 3TLOA 3ZIAD 4ABAA 1P11E 1FPCH 8LPRA 1GJ5H 2ZPSA 2SGDE 3UIRA 5CDFE 1T4VH 3U98H 4FUDA 1QGFA 1UTJA 1P3EA 1P2NA 2BQ7B 1AY6H 1SKYE 1C5QA 2VVCA 1O2TA 2ANWA 3GY2A 4JZFH 5DN6D 4B6FA 3T27A 3AAVA 3BTME 2IPHA 2FYQA 2Q6FA 1GHXH 3EA8A 3NPSA 3PMBB 4UEHH 3UWIA 1OOKB 4AYYB 3FZZA 1ZR0A 5C2ZA 4B2AA 5A2MH 1C1SA 1DWBH 3EAJA 1H4WA 2WYGA 1O5DH 2BD3A 1DUEA 1Z8RA 2NU1E 3MU5A 1GMHG 3RUOA 1KSNA 4HGCA 4KKDA 1P05A 1RTFB 1UVSH 1SGEE 3BEIB 5ETXA 2CV3A 8KME2 2SGPE 1VITH 4CH2B 3VPKA 3UNSA 2FX6A 1QHRB 1QTFA 4M7GA 3A85A 2ZA5A 2K1QA 3PLBA 4X0WU 3VB3A 5JYIA 1YKTA 4JZEH 2G00A 3VFEA 1O3CA 5EJLA 2V3MA 2JETB 3D65E 2VH0A 4U2WA 1GI0A 3HATH 1O30A 5EQRA 3SU6A 5E8EH 2W6JD 1W0ZU 1MTNB 3T2NA 1FX0B 1GJ8B 3GCNA 3VB7A 2A31A 1V2UT 1UVPA 1YGCH 2FLRH 4OS1A 2BHGA 3BTGE 4AN7A 1K2I1 5EQQA 1LHCH 2OC8A 2D2DA 2GZ7A 4J2YB 1ETSH 2CF8H 1UCYH 4ABJA 3SQEE 5JDUB 2WPJS 9LPRA 4ABIA 1EXFA 4BAKB 4IN1A 1P2QA 2Y7ZA 5EPYA 3SNDA 1K1OA 3JZ1B 4CRBA 2R0LA 2IJD1 3OX7U 3MH7A 1ELGA 4ZHAA 3K65B 1FY3A 3CNRA 3KIDU 1AZ8A 1DY8A 5DPAA 2H5CA 1QZ8A 2K8IA 1TA2A 4IMZA 5LPEA 3R3GB 3F0OA 2ZDKA 1GVKB 1GMDG 3VB6A 2BXUH 1SGPE 2AGEX 2PV9B 4WH8A 1GL0E 3F1SB 3A82A 1UK3A 3M61U 1TX6A 3BTWE 3L33A 4Y10E 1N8OB 1AI8H 1IQJA 3M7QA 1C9PA 3IITA 3SJIA 1KXFA 2J2UA 2XBVA 3URCA 2VGCC 1AE8H 3UREA 1WCZA 1AVWA 1F0RA 1C5XB 4KTUA 5G4BA 6CHAC 1DT2A 5IYTA 3ENSB 1UO6A 4OGXA 1T8MA 1ZHPA 1UHBA 1P06A 3GCOA 4WJG2 5DJ7A 1EZUC 1BMMH 2ZPQA 2OTVA 5A8ZA 3B9FH 3PMHB 1DE7H 1ZOMA 1H8HD 1O2QA 3U8RH 3ZZ7A 4RKJB 3UAIC 2BB4A 2PKAB 2GMTB 3KGPA 1YC0A 2RDEA 4SGAE 4A7IB 1ELBA 2QF4A 2AERH 1QQUA 3ATIA 1G37A 2AIQA 5E2OA 1KXEA 1BBRK 3FP6E 3OU0A 4NFFA 8GCHG 3OYPA 4FUHA 2XW9A 2IPQX 1GDUA 1UTLM 3GCTG 1HDTH 1SFIA 4ABEA 4K1EA 4YLUA 1N1LA 1C1VH 3MU0A 3EYDA 3U28C 1D4PB 3ZZBA 3GY6A 1NRQH 1J14A 1O5AB 5EGMA 2XBXA 3GOVB 3HKJB 3KCGH 1GI6A 3WW7A 1T8OA 1ZSLA 3H5CB 3RXDA 3SI3H 3ATLA 1CGIE 1SR5C 1V2JT 3ESTA 1O35A 5T1VA 4BAHB 2W5EA 4WMFA 2O8WA 3O8BA 4A5TS 1XVMA 1V2RT 2G5VA 1Y8TA 1EB2A 1VCQA 4WMDA 3M3VA 3MHWU 4J1YA 4A1XA 1W12U 1KLTA 1PPEE 2PTNA 3W1EA 1TAWA 2BY6X 4D7GA 2VIVA 1KXCA 2QA9E 3FAOA 4X6NA 4AB8A 1HJ8A 1BT7A 2A7JA 1P57B 2C3SA 3RXUA 1SGFA 1CT4E 3LOXA 2J98B 1C5OH 2YMSD 1KXDA 4D76A 2HPPH 1GI3A 1BBRE 2W6ID 1TIOA 2ZO3H 1LHEH 1GJ9B 1F92A 1WTGH 2VJ1A 2VIDA 2OP9A 2ZP0H 1AO5A 1BDAA 1IOEA 3TJNA 1LQEA 4NZLA 4BAMB 1MD7A 2HPQH 4K69A 2BQWB 1W0KD 1THRH 4B6EA 4ASUD 3KEEA 3UQVA 2ZC9H 1C1RA 4DURA 1S0QA 2CHAC 2ZFTA 5EJZA 1TX7A 2ZECA 1N6XA 2V0BA 2FEQH 2OUAA 1ZSKA 1OWIA 2RCEA 1O2PA 4ZMAH 2QIQA 2O8TA 3ODDA 4AGKA 1EB1H 3KYFA 1RRKA 2PKSC 2D1JA 1LVYA 2BY7X 3ATMA 1EAUA 2ZHEH 3UFAA 1BQYA 2ZCKP 2QC2A 1FZZA 1C2LA 1S6LA 1SI5H 2F43B 5E2PA 4CR5A 1DWEH 2PWXA 2C90B 2LPRA 1MKWK 4FU7A 2BD5A 2G4TA 4YTAA 3WWBA 4Q63A 3N7DA 2AGGX 5GJ4B 2WHXA 1KDQB 1BTPA 4K2YA 1MH0A 3E1XB 2H6MA 1J16A 1GL1A 1K9OE 1OKXA 3A88A 3MYWA 4Y6DA 1VITF 1RS0A 2B8OH 2W7UA 4KTSA 5T6GA 2D26C 1O5CB 2XC5A 1BHXF 2Z9LA 3LDXH 1DFPA 1TQ0B 1EZQA 3E0NB 2GT7A 3ZVCA 1TMTH 3SN8A 1QJ1B 1QL8A 5JB8S 1EAIA 2BD8A 3M7UA 1NRSH 2BLQA 1V2OT 2Y5FA 1QFKH 1NFYA 5IK2D 2BVXH 1O3HA 4I8HA 1QJ6B 1QY6A 2P93A 4NIYA 2HVXA 1HB0B 1HBTH 3KHVA 4TSFD 2A0QB 2NU4E 1FLEE 1RGQA 3P8GA 1HPGA 1O2YA 2BD2A 2FTLE 3QTVH 4B71A 1IQHA 3SU0A 4HI3A 1LPZB 4ISNA 1IQFA 3A80A 1BMNH 3ZZDA 2PUQH 2BD7A 3RXMA 4LZ1H 1LHFH 1RIWB 1J17T 2VWOA 1D3QB 1SOZA 1V2WT 1NFUA 5FX5A 1GBJA 2YMSC 1E36B 1BRCE 2VIQA 3GY3A 1ABIH 1ARCA 3HPTB 1OWKA 1L1GA 1NFWA 2Z9IA 4X2YA 1B0FA 1Y5UT 2V3OH 2PSXA 4TT3D 1O3KA 5AFYH 1SGCA 5I25A 2UWPA 1GJCB 1VZQH 3VEQB 1O34A 1WV7H 2V3HH 5F8ZA 3SU3A 3U8TH 2XXLA 3GCHC 2THFB 1ZGVA 1AZZA 2OINA 3U69H 3TK9A 3LIWA 4DIIH 4XOJA 4TY6A 1O32A 1RD3B 1EP5A 2P3FH 3RXEA 1MAXA 3N7OA 3P70B 2EI8A 1TMUH 2EI6A 3MNBA 3S7HB 3ELAH 4KELA 1FXYA 2KX4A 3F9FA 4F4OC 1NY22 3EA7A 5FAHA 7LPRA 1AQ7A 1PQ5A 4D8NA 1PQAA 1V3XA 3SW2B 2PHBA 1CT2E 1E79D 3SHCH 1PJPA 1P9SA 1EZSC 2R3UA 2XNDD 1C2GA 4LZ4B 1WYKA 1TPAE 1F5KU 5AF9H 2BLWA 2QXIA 1QB6A 4O3TA 4JMYA 3A83A 2GCHF 1NO9H 1OP8A 3UWJH 1FJSA 1SQTA 2R3YA 4GAWA 1L1JA 5FHTA 5B6LA 2ZFFH 1O2RA 1C2EA 1FONA 5EOKA 5A0CA 1O2IA 4AG1A 1HAOH 3QUMP 6GCHF 1UJ1A 3LGTA 3Q76A 1C1NA 1UCYK 4IC5A 4NFEA 3PV5A 3GYMA 1WSSH 1A5HA 1KY9A 5A8YA 2ANKH 4I8JA 3U8OH 1SLXB 2CK3D 4X8VH 2F4LA 1Y3YA 1TB6H 1QCPA 1D3PB 1GBCA 3AVZA 3QGNB 4K3JA 3RXLA 1SLWB 1O2WA 4AG2A 3P92A 1F0TA 2GJGA 2ZG0H 1AKSB 1ZMLA 2WV5A 1JXPA 3P8FA 1HXEH 3RMLH 2BDCA 3QGJA 3R0FA 2FO9A 3MNCA 3WY8A 2F9PA 2BD9A 2V7QD 1LCYA 1AUTC 1QRZA 1YPHE 1DWDH 2LNCA 2J34A 2ZIQH 4SGBE 2BM2A 2J94A 3MO9A 1VCWA 3BTQE 1GVLA 2BOHB 3BG4B 1G3CA 3KYGA 3PTNA 1CBWB 1S0RA 4TPIZ 1GPZA 1P9UA 3ZZ9A 2OBQA 4LK4A 1V2TT 3E90B 1UCYE 5LPFA 1SMFE 2PGBB 2VWMA 1PPHE 2ZWLH 1UK2A 2FESH 1TA6A 3QZQA 4RT0A 2BOKA 2NU3E 1FI8A 4ZKOU 3F68H 1WBGB 3EE0B 5FL7D 1PPGE 1TGCA 1GBKA 3DSGA 5K7RA 2TBSA 1HAVA 2BDYA 2OXSA 5C1YA 5EG4A 1GCTC 1ANBA 4CR9A 2P16A 1C1MA 2PKSB 1C9TA 4YZUA 3RMMH 5LH8A 4YOGA 3VB4A 3V12A 1P8VC 1OP0A 4UFEH 1FDPA 3BG8A 1Y5BT 1CT0E 3GDVA 4UDWH 5DP5A 1SQRA 1T8NA 1Q3XA 4FUEA 3TJVA 2WINI 3ZVBA 4ISLA 2OQ5A 3K2UA 1TBRH 3U9AH 5CMXH 1F7ZA 2ZDNA 4AB9A 1A0JA 3D49H 2XWBI 3EA9A 1D6RA 3C27B 2KCPA 1SL3A 4YOIA 1TPPA 4FU8A 1K1PA 1MU6B 1K22H 1XUFA 2ZFQH 1H8IH 1COWD 3BEFB 3SV9A 4I32A 4DY7B 1GHAG 1OWJA 4ZCNA 1KXBA 1EX3A 2BYAX 1EOLA 1YCPH 3TGJE 1F0UA 2FI4E 3SJ9A 1MCTA 5AHGH 3DA9B 2H9HA 2EY4C 1FY1A 2WPMS 2VIOA 1BRUP 4B74A 4BTTB 5HMAA 1CHGA 3JZ2B 2PW8H 1GMCG 4A1TA 1TGNA 5HM2A 1BOQA 2HGTH 5EU8A 1P10A 1GBTA 4MPXA 2A45B 1MABB 1ZYOA 1Z1IA 5A0AE 1GBMA 3E91A 4VGCC 1WUNH 3NUMA 3SHAH 4Y0YE 1GGDC 1C1UH 2EI7A 4B73A 1AHTH 1SC8U 3T28A 3BF6H 1NESE 4K1SA 1O2HA 3TU7H 3T5FH 2C4FH 4MTBA 2FS8A 1DM4B 1CSOE 1GJ7B 1LVBA 1MTSA 1CE5A 1O3GA 1NFXA 1HAHH 4ZXXH 3UR6A 3FN8A 4F48B 1GBAA 1NPMA 3RC6A 4CHAB 3RLYH 2FM2A 3N99A 5GIBA 1DSTA 2FZZA 4NIWA 4LOYH 1P2KA 2TGDA 5E0JA 1GHBG 3SUGA 5EW2H 1BB0B 2ZFSA 3OY6U 4Z1MD 3PV2A 5KGOA 1QR3E 2UUKB 3RC5A 2P95A 4X6MA 2H9EH 1ZTLA 3U1JB 3A8BA 1V2VT 1WQVH 3SORA 1D6WA 2ESTE 1G36A 2CF9H 2HALA 3BTDE 3KNXA 1KXAA 3KQBA 2XCNA 1ZPBA 1G30B 1W7GH 2HNTF 1DANH 1GI8B 1MKXH 4Y7BA 4A1VA 2SFAA 3F9GA 3RMOH 5SGAE 1QA7A 4YXWD 1C4Y2 2SGQE 4QT8C 2BX3A 1FPHH 5GWZA 4IGDA 2QXHA 3PMJA 1Y3WA 4KGAA 4B75A 4CH8B 3DHKH 4UE7H 3SU2A 1ZSJA 1TNLA 1MTVA 3SYJA 3UOUA 3MO6A 3URDA 1EASA 2CGAA 1EPTB 3E6PH 4XD7D 5GDSH 3MI4A 1TONA 3MWIU 1HAPH 4WVPE 2XYAA 3BIVH 4JK6A 3UB0A 3I78A 3RDZA 3RLWH 1FUJA 2W3IA 1LVOA 2EQNA 5GPIB 5C5NA 2QCYA 3F2FA 3MOCA 5L2YH 2Z3EA 2QYIA 2GCTC 1AVXA 1TWXB 1DSUA 4FVBA 2KCYA 1O2UA 3M5MA 1HCGA 1UTKA 2VVUA 2GTBA 3EDXB 3IWMA 1Z71A 3EE7A 2ZU2A 2QY0B 3BTFE 1DWCH 2P94A 5ESBA 5AVDA 2VIPA 1EOJA 5T6FA 4YO9A 1SLUB 4IC6A 1XVOA 3GYLB 3SNEA 1HJAC 3QO6A 4O03A 4ABDA 3TJOA 3UR9A 3RP2A 1P2MA 1TGTA 3A8AA 4RI0A 3PLPA 1C1PA 1OYTH 2P3UB 1RXPA 3D23A 1FIWA 4Y71A 2FPZA 2IOTA 1P09A 1TOMH 1SQOA 5GCHF 1TX8A 3ZZ4A 7ESTE 2RG3A 4GCHG 4P00A 4Y8YA 1A2CH 4MPWA 4CRDA 2KAIB 1CHOF 2J97A 4U01A 5KECA 1L0ZA 1UTOA 2FMJA 2P59A 1O2MA 4E06H 4HG6A 1XUIA 1CA0B 4GUXA 3ZVAA 2AMQA 1QJ7B 2O8UA 2W26A 4DJZB 2GT8A 1M9UA 3CP7A 1UW7A 4K5ZA 2IN2A 1SVPA 2HLDD 1ZTJA 1F5LA 1PQ7A 1SQAA 3MU8A 2ZF0H 3VGCB 4YESB 3SV8A 1O3OA 3SZEA 1S85A 4X1NU 4Y7AA 3M36A 3Q3XA 2C8XB 1QB1A 1O5BB 1J9CH 3NXPA 1O2SA 1C5RA 3SNCA 2G8TA 1K21H 5J4SA 5FPTA 5CHAB 4ZAEA 3P8NA 3TH2H 3MNXA 1TRNA 2AHME 3MFJA 1GDNA 3LGIA 3MTYA 4K60A 3SUFA 1HNEE 3ZV9A 2J9NA 3CS7A 3BV9B 4OGYA 1ELAA 4WH6A 2F9OA 1VGCC 1JRTA 1NZQH 3V13A 1DITH 2M5TA 1GI2A 1X7AC 2GP9B 2ZDAH 2ZCLP 1DOJA 2ODPA 2RFKC 1V2QT 1C5SA 2CXVA 2KR7A 5JB9S 1C2DA 3W94A 3P6ZB 3I29A 1S83A 1IQLA 2FOBA 1O2NA 2QV1A 5I46H 2ZZUH 8ESTE 5F03A 2G52A 2HNTE 1HAIH 2V6NA 4ZUHA 3ZZ5A 4LXBH 1BUIA 1FY5A 2Y80A 3VB5A 1IHTH 5HIZA 3A7ZA 2ZU1A 1C2JA 2A7HA 3F0PA 1BIOA 1XXFA 2FOCA 2Z3DA 2OC1A 4AYVB 3PRBA 5C94A 7GCHF 2HOBA 5EXLA 1O3LA 4NA9H 3LGVA 3GY5A 2A2XH 2Z94A 2WZQA 1MZDA 4INHA 3NRLA 4TWYA 1MQ5A 4O97A 3M37A 1AN1E 1WQSA 2BDHA 3ODFA 1AB9C 5KEDA 1C1QA 2GV6A 1ANEA 3M5LA 5ESTE 4FUFA 3EGKH 3OTPA 2OBOA 3SOSA 3SU5A 4HTCH 2WUBA 5C3NA 2FI5E 2P8OB 1ANDA 4MPVA 1PQ8A 1AVGH 2FYRA 2ALVA 2BZAA 1GI5A 2VWLA 2I6SA 2BX4A 4AX9H 4BXSA 6LPRA 2PLXA 3Q00A 2XNIA 5FCKA 2XWAA 1HYLA 4X8SH 1BTWA 4Y76A 1GI1A 1Z8IB 3TIUA 2BDIA 1W7XH 2XCFA 1XX9A 1RJXB 1MTWA 3G01A 3TH4H 3Q3KA 2WSSD 1C5UA 1G3DA 1GI9B 2R2WU 1GHWH 4AC9A 3RXPA 3IG6B 1TNJA 9ESTA 4NSYA 1DDJA 1TPOA 1S82A 4NA8A 3K6ZA 1VCPA 4NSVA 1Y3XA 1XMNB 2PKAA 1E0FD 3RXIA 3C1KA 4UFFH 1GHZA 2AS9A 3M3SA 1FNIA 3ITIA 2W3KA 2ILNA 3STJA 2Z9GA 2M2AA 3OSYA 3TNTA 2ZPRA 5E0GA 1E38B 1L4DA 4MNWA 2Q1JA 1V2MT 5L6NH 1Z6EA 1P04A 2XBWA 1FN6A 2ZTXA 3E8LA 3RC4A 1T7CA 4B76A 2DUCA 2ASUB 4I8KA 3VG8A 1GBFA 5C1UA 1YCPK 1GBBA 1AMHA 3RXTA 3FP8E 3L3TA 1ELCA 1QB9A 3ZVDA 2CMYA 4X8UH 1A0HB 2QF0A 3LU9B 3TH3H 3UTUH 1KTSB 2SGFE 1O3NA 3RM2H 1Z6JH 1ZPZA 2AGIX 3MH5A 3SUEA 4BTIB 1A5IA 3P8OA 4Q4LA 2VVVA 3A89A 4AFZA 1J8AA 3HGPA 5JBCS 3LKWA 2FOEA 1O37A 1ETRH 5DP7A 1O5FH 1C1TA 1TFXA 5FBIA 1YP9A 4ZKNU 1BMFD 2ZU4A 1HRTH 5FCRA 4YT6H 2VIWA 3SUDA 4BXWA 3SJOA 2WPLS 1RFNA 4U30A 5JPMH 1HAYB 3GDSA 3PROA 1NN6A 2UUJB 1ZJKA 2OLGA 3RMNH 3A7VA 1H9HE 2J98A 4WY3A 1ZJDA 3LC5A 1V2LT 5IDKA 4PROA 2ZGHA 3MQKC 1W0YH 1O36A 2BDBA 2G4UA 4B2CA 4NCYA 3FO8D 1QURH 3PB1E 2FOFA 1LQDB 2FODA 4FUGA 3OTJE 5EODA 1GG6C 1GJ6A 3OFND 3QZRA 5JBAS 1BTUA 1V2ST 1ETTH 4AGJA 3QX5H 2VGCB 1K1LA 2F3CE 2Z6BD 6CHAB 1VJAU 2PR3A 3BN9A 2F9UA 4NG9H 2ZQ1A 4OS5A 2AEIH 1YPHC 3A84A 4MQAA 1ANCA 3OE7D 1HIAB 4XRNA 3FANA 4ZKRU 3ZYDA 1DY9A 3OAAD 4ISOA 5DP3A 4DIHH 1GJDB 1C5ZB 2VB0A 1EP6A 3W95A 4WWYA 3SBKA 1UVOA 1GJBB 3CS0A 4TYDA 1BZXE 1UMAH 2KCOA 4KTCA 4ISHH 1QRWA 2ZTYA 1A3BH 2A7CA 2NU0E 1QBOA 4ABFA 1KDQA 2QGRA 1SGRE 3E16B 1GCDA 1HJ9A 5CHBA 3M7TA 1C2IA 2J5UA 2CJIA 1QQ4A 2B7DH 2JH6D 1PPFE 1P02A 3GY4A 1WOFA 1ESBA 3U1IB 2BDAA 3ZZ8A 4AFUA 1EUFA 4ESTE 3SO3A 5DGJA 3F2GA 1MTNC 1W14U 1P2OA 1A1RA 1MTUA 3A8CA 3BSQA 1VITG 3L6PA 4UD9H 2OC0A 1TRYA 5T6DA 2ZTZA 4FVDA 4CRFA 2A4RA 1WU1A 2SNWA 5GXPA 2C8YB 3V7TA 4BTUB 1EJMA 3SJKA 4XDEA 1PPCE 3FP7E 3TPIZ 1PPZA 2AYWA
chains in the Genus database with same CATH topology
1SGQE 2NU2E 1GJAB 1HAGE 1C2KA 1AE5A 3RXHA 1D3TB 5JBTA 4ABBA 5EXNA 1O3DA 2QF3A 1UVTH 2EA3A 3PWCA 4DT7B 1ZPCA 2A2QH 4I33A 1HLTH 1SLVB 3UQOA 3NZIA 4UFGH 1OS8A 4I8GA 1O0DH 4XBDA 4ASHA 1NU9A 1NTPA 4ABHA 1FY8E 3F9HA 4RN6A 1EKBB 1DVAH 1IQEA 2FTMA 4MLFB 2A4GA 2AH4X 4DW2U 1GVZA 2FI3E 1UTNA 1C5MD 1MQ6A 1SPJA 5C1XA 4FUCA 2SGEE 1MUEB 3RXGA 1ESAA 1N8OC 5LGOA 3TVJB 1O38A 1TQ7B 3ATKA 2Q6GA 2FX4A 2CHAB 1Y3UA 2TPIZ 1IQMA 1TPSA 4ABGA 5F8TA 1W13U 1TALA 4Z6AH 1ARBA 3ZVGA 1YF4A 1FQ3A 1GMHF 3RXCA 2GD4B 1C5LH 1YPLH 4Y8ZA 3A7YA 1NROH 3HGNA 1EQ9A 2YOLA 2GMTC 3KQDA 1VJ9U 1CA8B 3RU4D 1V2PT 3E0PB 3LGYA 3BTKE 1OPHB 2J38A 1SGFG 2TIOA 1HV7A 5LPRA 1GBDA 4I7YH 1E35B 3LGUA 3SJ8A 2J4IA 2FIRH 1LPKB 4JZDH 1PFXC 4MNYA 4TPYA 1THPB 1SBWA 1GJ4H 1YLDA 3UY9A 1YM0A 3PM3A 4K8YA 1LDTT 3SI4H 1DPOA 5DG6A 1ELEE 1PYTD 2ZDVH 3A87A 2ZHDA 1SG8B 1DICA 1MCVA 2ZI2H 2RA3A 4E05H 2DE8A 3A7WA 3HK3B 1XUKA 1TYNA 2UWOA 5DP8A 1O2JA 1NU7B 2AMDA 1YLCA 4OS6A 2GCHG 4DCDA 2O8MA 1RTKA 1TRMA 2B0FA 1W2KH 2WUCA 1P2JA 1D9IA 1ID5H 1CQQA 1ZMNA 2A32A 6GCHG 2A5AA 2XC0A 2G51A 3PWBA 2A1DB 3PV4A 4NWKA 4YT7H 1FY4A 1BTXA 1AKSA 2FXRA 3RXRA 4TY7A 5EW1H 2XTTB 1ORFA 3LT3A 1T8LA 1THSH 3LONA 1QRXA 3MH4A 4RSPA 1GMDF 1SGNE 2YNAA 3S0NA 1L4ZA 2STAE 2UUFB 2WPIS 4IN2A 5HM9A 2PFEA 1EAXA 1TABE 2FS9A 4X2XA 4DG4A 3OY5U 3S9CA 1QNJA 4Y79A 3EQ0H 3P95A 1O3PB 1FN8A 2O9QA 4ISIH 1TGSZ 4BAQB 2BZ6H 2B9LA 1TGBA 4CRAA 1KLIH 3ZV8A 1E37B 1O2LA 3GCHB 1BHXB 1GG6B 3K9XB 1BA8B 1JOUB 1SGYE 1UTMA 4H6SB 1YBWA 1BRBE 4XFQA 7KMEH 1Y5AT 3T26A 3GDUA 1UHBB 3UNRA 4FXGH 1U6QA 3ZYEA 3A86A 3TK6A 1AIXH 2UWLA 2IJOB 8GCHF 4GLYA 3T25A 3QLPH 4JYUH 2WYJA 3PMAB 5A09A 1IQNA 2GX4A 4X6PA 1V2NT 3GCTF 1NM6A 3PO1C 1BTYA 1G2MA 2J95A 1GBIA 4WXVA 3ZZ3A 1ELFA 2D8WA 1XUHA 5C67A 1TNHA 1A7SA 6ESTA 2AIPA 1QL7A 1AWHB 2FOAA 5DP4A 1PYTC 3MNSA 5HXFA 2W7SA 1ELDE 1C5NH 2BVRH 5L2ZH 1B5GH 2QN5T 1A3EH 5B6OA 2BDGA 1OXGA 1YPEH 1O2OA 1HUTH 3H7OA 2BY9X 1BTHH 2YNBA 3ATWA 3SV7A 5DK1A 1HGTH 1LHGH 1T31A 2V35A 2Q6DA 2ZGBH 4CBOA 1G9IE 1Z1JA 3A81A 1ELTA 3AASA 1O3AA 1SGTA 1YPGH 2B5TB 4GPGA 4Q7YA 4OS4A 3LJJA 3DD2H 3SU1A 1ZHMA 1RIWC 2ZU5A 1L2EA 5A0BA 5DP6A 2QXJA 1TE0A 3BIUH 4NIXA 1JMOH 3M5OA 1C5TA 2HNTC 2ANMH 2R9PA 1BJUA 1F5RA 3I77A 1JBUH 1CU1A 2GV7A 2G55A 2F91A 1K1IA 2GKVE 2BXTH 1MAYA 1A46H 2ZFRH 2BLOA 4Q80A 4AZ2B 2FWWA 2ZDLA 2Y81A 1ZLRA 1JWTA 3H7TA 4BAOB 2A5IA 4BOHA 1CO7E 4X2WA 3RU4E 1V2KT 1SSXA 3FZDA 1O2KA 1GBEA 2RDLA 5F8XA 4GHTA 3KF2A 2JKHA 1KIGH 1Z8JB 5EQSA 1C5VA 1MBQA 2WV4A 4XBBA 1P12E 4ZXYH 2STBE 2ZU3A 3FVFB 4TWWA 1P03A 3GY7A 2Y7XA 3M3TA 1GCTB 3AW0A 1KYNA 1W3CA 3D62A 2AFQB 3SGQE 5FPYA 3LH1A 1BMLA 5F6MA 4MPUA 1SHHB 4WXIA 1LHDH 1AD8H 2XRCA 5TCAA 3A7TA 5TCCA 1FMGA 4I31A 1J15A 2G81E 4X1SU 1TNKA 2C93B 1ZZZA 2G5NA 1LPGB 3RXJA 3F9EA 1LMWB 4YLQH 2P3TB 1INCA 2A5KA 1EPTA 5C5OA 1JIMA 3AAUA 4Q7XA 1BJVA 3QDZB 2TGTA 3M5NA 1GDQA 2ZFPH 3PLKA 1W11U 2XBYA 2VINA 1XM1A 1C1WH 1H9LB 5BRRE 2HRVA 1Q2WA 1BMAA 3UOPA 4JYVH 2A4QA 4FUJA 3LH3A 2GZ8A 1ZRKA 2ODQA 4D7FA 2UUYA 2ZHFH 2GDEH 1IHSH 3CENA 5ABWA 2F9NA 5DKMA 1N6YA 1Z7KA 1DXPA 1O39A 1IAUA 1LO6A 2ODYB 4A6LA 3GICB 1B0EA 3TNSA 3QK1A 4FU9A 1UTPA 2ZGJA 1IQIA 4VGCB 2PUXB 5FPSA 1QBNA 2HWLB 1EATA 3S7KB 1GGDB 1DLEA 3DT0H 1Y59T 3SGAE 4ZH8A 1GWAA 1P2IA 5TJXA 2I6QA 2FOHA 3LC3A 2EEKA 1P0SH 4NWLA 1TNGA 1AFQC 1H9IE 3BG4C 5T3HA 2KAIA 1CBWC 1C5WB 2BTCE 5GCHG 2Y5HA 3ZVEA 4XSKU 2XC4A 1A4WH 2ZQ2A 1ZHRA 1C1OA 1SFQB 4NZQA 3ZZAA 1CHOG 4O3UA 1MBMA 2BD4A 1PPBH 1EJNA 4X1PU 4FUBA 3PTBA 2Z3CA 4UONA 3SU4A 3SNBA 4DVAU 4WF8A 2C8WB 1BCUH 4CBNA 1ACBE 3M35A 1C4U2 4INLA 3MO3A 3Q3YA 3O8CA 3KN2A 1H1BA 1HFDA 1XKAC 3PO1B 1LTOA 1OX1A 2VWNA 3NWUA 1NC6A 1P3CA 2F83A 2RA0A 1HAXB 3DFLA 2AMPA 4HZHA 1C5PA 4ZHMU 4IBLH 3O8RA 1O2VA 1S84A 1XKBC 3QN7A 4OS7A 5FX6A 3TK5A 2H5DA 4YM9A 5AFZH 5E0HA 2JH0D 1W10U 3FFGA 1OYQA 5EXMA 2GCTB 3P17H 3QTOH 1TMBH 3HKIB 3MU4A 1SB1H 1NS3A 4ZROA 1YPJH 3TGKE 3B23B 1HAZB 2Z7FE 2FOGA 4HFPB 4UFDH 2OD3B 2Z9JA 1A0LA 1LKBA 1DS2E 3V3MA 1MD8A 4RKOB 2H2ZA 1MMJN 3RXFA 1HJAB 4IS5A 1GHVH 1NRNH 5K0HA 1Y3VA 5C20A 5BPEA 5DO4H 1K1JA 1GI7B 1G3BA 7GCHG 3RXOA 4NA7A 2WPHS 3S9AA 4IMQA 3NCLA 1ESTA 3HK6B 1EJAA 2F9VA 3GISB 1YYY1 4IW4E 1MZAA 1V6DA 4H6TA 1D3DB 4Q7ZA 1QL9A 2BMGB 4K1TA 1MKXK 4CHAC 4X1QU 2GVFA 4DOQA 3S9BA 3STIA 4ZKSU 2Y6TA 1BRAA 1XUJA 4AORA 2VH6A 4YOJA 1TLDA 4AFSA 1Z8GA 4AFQA 1HAVB 1K1MA 2FLBH 2GGVB 1SGIB 2ZHQH 1B7XB 2ZNKH 5EPNA 4A92A 1TBQH 1ZRBA 2HLCA 3A7XA 4AOQA 1UTQA 1S6HA 1NRPH 3V0XA 4MDSA 1K1NA 4XE4A 1YCPM 3K6YA 3RXKA 1O5EH 1ZGIA 2WPKS 5J4QA 5HGGA 1ZMJA 3RXBA 3VXFH 1AFEH 1O3BA 4MVNA 1JRSA 3TGIE 3F6UH 2JETC 1VGCB 4BANB 2QAAA 3Q77A 1GHAF 2CN0H 2VU8E 2DE9A 1SOTA 1H8DH 1EPTC 1C2FA 1S81A 1AWFH 4THNH 1S5SA 1C4V2 4Z0KA 4JYTA 3UUZA 1AU8A 1BBRH 2O8LA 1BITA 3LGWA 3LJOA 1JIRA 4WMEA 1A61H 3DFJA 2ULLA 3GY8A 3RXVA 1O2GH 5FBEA 3QWCH 1GMCF 2Y5GA 3S69A 2ZCHP 1O3MA 4D9QA 1NRRH 1HXFH 4X8TH 1TNIA 1FV9A 4MNVA 1XUGA 1TBZH 1LVMA 1QIXB 1O3EA 1AUJA 1O3IA 3UPEA 4D9RA 1GI4A 1QA0A 1CVWH 2BY5X 2Y82A 4Y11E 3RXSA 3UNQA 3VXEH 4GSOA 2Z9KA 4ZHLU 1O5GH 2ZGCA 1L1NA 4NGAH 2ZDMA 4H42U 1AB9B 1OWHA 1C2HA 1QBVH 4X6OA 2OC7A 4GHQA 3BTHE 4H4FA 1FAXA 1RTLA 2H1UA 1C2MA 4X1RU 1T4UH 4CRGA 2F9BH 1LKAA 1OWDA 4XBCA 5FXLA 1GHBF 2TRMA 1G3EA 2FP7B 4Y8XA 3MH6A 1AFQB 1DXWA 1E34B 1O33A 1WTHD 1O2XA 1P01A 1AGJA 1O31A 1C5YB 1YPMH 1Q31A 1CGHA 3BTEE 1DUAA 4JK5A 1KLJH 3A8DA 1CA0C 4O9VA 2JH5D 1O3JA 4FUIA 1GBHA 1ELVA 3SV6A 3O8DA 2VNTA 1YPKH 4F49A 3TJUA 2BY8X 1VR1H 1FAKH 1TOCB 1NT1A 1WAYB 2A4OA 2PGQB 2QXGA 3LPRA 2J92A 4JZ1A 1GHYH 1HIAA 4E7NA 1EAWA 3KL6A 2BLVA 1K28D 1A5GH 1OP2A 2BQ6B 2BVSH 2OQUA 3VGCC 4E7RG 3RU4T 1F0SA 3ZZ6A 1F2SE 2ANYA 4K8BA 4CRCA 3NK8A 3SQHE 4JZIA 1OWEA 2R2MB 3T29A 5HYOA 1XXDA 5CHAC 1IQKA 2GDDA 3RM0H 3KQCA 5CE1A 3BTTE 3NKKA 1SGDE 2ALPA 2GZ9A 3KQEA 1G32B 4MG3A 4R8TB 3DUXH 1ABJH 4Y0ZE 4I8LA 1CGJE 1GBLA 3SZNA 1UVUH 1MKWH 1FIZA 3PYHA 3ZZCA 2SGAA 1DLKB 4KP0A 1BTZA 1KTTB 3E3TA 4GVUA 1UK4A 2C8ZB 4JCNA 1IQGA 1S6FA 4CREA 1O3FA 3MMGA 5PTPA 4BNRA 2FDAA 2FOMB 2ZEBA 3RXQA 1OSSA 2SNVA 2OCVB 4B2BA 5A8XA 2ZGXH 3SGBE 1O2ZA 2R0KA 1DX5M 4Q2KA 4R0IA 4X2VA 3SV2H 2H9TH 1MU8B 3ZVFA 2ZHWH 2PTCE 4B1TA 4NIVA 5JBBS 5H4IB 1W8BH 3SNAA 4OS2A 1T32A 2EC9H 3TITA 5L30H 1SHYA 3BEUA 3MU1A 3B8JA 1ZTKA 3RXAA 4GCHF 1G2LA 4U32A 2TGPZ 2TGAA 3T62A 4DGJA 2NWNA 5DP9A 4MNXA 2PSYA 3AW1A 2ZKSA 4INKA 2P8OC 1EZXC 3TLOA 4ABAA 1P11E 1FPCH 8LPRA 1GJ5H 2ZPSA 2SGDE 3UIRA 1T4VH 3U98H 4FUDA 1QGFA 1UTJA 1P3EA 1P2NA 2BQ7B 1AY6H 1C5QA 2VVCA 1O2TA 2ANWA 3GY2A 4JZFH 3T27A 3AAVA 3BTME 2IPHA 2FYQA 2Q6FA 1GHXH 3EA8A 3NPSA 3PMBB 4UEHH 3UWIA 1OOKB 4AYYB 3FZZA 1ZR0A 5C2ZA 4B2AA 5A2MH 1C1SA 1DWBH 3EAJA 1H4WA 2WYGA 1O5DH 2BD3A 1DUEA 1Z8RA 2NU1E 3MU5A 1GMHG 3RUOA 1KSNA 4HGCA 4KKDA 1P05A 1RTFB 1UVSH 1SGEE 3BEIB 5ETXA 2CV3A 8KME2 2SGPE 1VITH 4CH2B 3VPKA 3UNSA 2FX6A 1QHRB 1QTFA 4M7GA 3A85A 2ZA5A 2K1QA 3PLBA 4X0WU 3VB3A 5JYIA 1YKTA 4JZEH 2G00A 3VFEA 1O3CA 2JETB 3D65E 2VH0A 4U2WA 1GI0A 3HATH 1O30A 5EQRA 3SU6A 5E8EH 1W0ZU 1MTNB 3T2NA 1GJ8B 3GCNA 3VB7A 2A31A 1V2UT 1UVPA 1YGCH 2FLRH 4OS1A 2BHGA 3BTGE 4AN7A 1K2I1 5EQQA 1LHCH 2OC8A 2D2DA 2GZ7A 4J2YB 1ETSH 2CF8H 1UCYH 4ABJA 3SQEE 5JDUB 2WPJS 9LPRA 4ABIA 1EXFA 4BAKB 4IN1A 1P2QA 2Y7ZA 5EPYA 3SNDA 1K1OA 3JZ1B 4CRBA 2R0LA 3OX7U 3MH7A 1ELGA 4ZHAA 3K65B 1FY3A 3KIDU 1AZ8A 1DY8A 5DPAA 2H5CA 1TA2A 4IMZA 5LPEA 3R3GB 2ZDKA 1GVKB 1GMDG 3VB6A 2BXUH 1SGPE 2AGEX 2PV9B 4WH8A 1GL0E 3F1SB 3A82A 1UK3A 3M61U 1TX6A 3BTWE 3L33A 4Y10E 1N8OB 1AI8H 1IQJA 3M7QA 1C9PA 3IITA 3SJIA 1KXFA 2J2UA 2XBVA 3URCA 2VGCC 1AE8H 3UREA 1WCZA 1AVWA 1F0RA 1C5XB 4KTUA 5G4BA 6CHAC 1DT2A 5IYTA 3ENSB 1UO6A 4OGXA 1T8MA 1ZHPA 1UHBA 1P06A 3GCOA 4WJG2 5DJ7A 1EZUC 1BMMH 2ZPQA 2OTVA 5A8ZA 3B9FH 3PMHB 1DE7H 1ZOMA 1O2QA 3U8RH 3ZZ7A 4RKJB 2BB4A 2PKAB 2GMTB 3KGPA 1YC0A 4SGAE 4A7IB 1ELBA 2AERH 1QQUA 3ATIA 1G37A 2AIQA 5E2OA 1KXEA 1BBRK 3FP6E 3OU0A 4NFFA 8GCHG 3OYPA 4FUHA 2XW9A 1GDUA 1UTLM 3GCTG 1HDTH 1SFIA 4ABEA 4K1EA 4YLUA 1N1LA 1C1VH 3MU0A 3EYDA