5A0BA

Crystal structure of human neutrophil elastase in complex with a dihydropyrimidone inhibitor
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
218
structure length
215
Chain Sequence
IVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEUTROPHIL ELASTASE
publication title Freezing the Bioactive Conformation to Boost Potency: The Identification of BAY 85-8501, a Selective and Potent Inhibitor of Human Neutrophil Elastase for Pulmonary Diseases.
pubmed doi rcsb
molecule tags Hydrolase
total genus 43
structure length 215
sequence length 218
ec nomenclature ec 3.4.21.37: Leukocyte elastase.
pdb deposition date 2015-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5a0bA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5a0bA02
4MPUA 1V2PT 4UONA 1KLJH 4ZMAH 5GXPA 1WBGB 5LPRA 4ZHLU 4NIXA 1PPEE 1NPMA 4OGXA 1BBRH 1G2MA 2FOCA 3UOPA 5AF9H 1WU1A 1IOEA 3T28A 1TBQH 1E37B 3UWJH 1O2MA 3UUZA 2WPHS 5JBBS 6GCHG 1FAKH 2FM2A 2PKSC 1BRBE 4BTIB 5I25A 4IMZA 2H2ZA 2C8WB 3BN9A 1AE5A 1VITF 1QTFA 4NA9H 3UNSA 4FVBA 1QL8A 1PPGE 1GHAG 4DCDA 4OS1A 4IN2A 2J94A 5HYOA 1QJ7B 1LVOA 3MU0A 4IW4E 1D4PB 2Q6FA 4CHAB 3P95A 1SGCA 3QDZB 3LIWA 5TCCA 2AGGX 1PQ7A 2PKAB 4FU8A 4AFZA 3BG4B 1ZJKA 2P8OB 1QBOA 1BTUA 1YC0A 3GY6A 2G5NA 3HK3B 1AWFH 5C1YA 3V13A 1Z8GA 3E1XB 2KAIB 1UVPA 1C1MA 2A4GA 2Z9IA 1O3OA 1QRWA 3NXPA 4FUJA 3A89A 3RXUA 1C5WB 1A0JA 5E2OA 3TGKE 1F92A 2PHBA 3C27B 3EA9A 1FQ3A 1O3JA 1OX1A 1V2VT 1YPEH 4CRBA 1Q3XA 2SGEE 2UWPA 3QN7A 1DUEA 3ZZCA 2B0FA 1AVWA 2NU1E 1SGIB 2XXLA 3IITA 2H5DA 1EASA 3B23B 2GMTB 2Z9KA 3NCLA 1LVBA 5EW1H 1VGCC 4UD9H 1C2KA 1HRTH 3TLOA 1J9CH 1P2OA 1A5HA 5EODA 2IPHA 1SGEE 3T25A 3RXTA 1KLTA 2FS9A 2BOKA 2ZHDA 4I8LA 1C2HA 5FBIA 1CHGA 3PLPA 1LQEA 3A7VA 1QA7A 4AGJA 1NT1A 3GY3A 4BAOB 1W8BH 3P92A 1BRAA 1FN8A 2VWLA 1O3BA 1C1QA 4GSOA 3IWMA 1SGFA 1SPJA 3RXQA 4CR9A 2ZDNA 1P05A 4K1SA 3GCOA 1L4DA 4X1QU 2UUJB 1FN6A 2FDAA 4XOJA 3U8OH 4TWWA 5GPIB 3TH3H 3MO9A 3BEUA 2QXHA 3H7TA 3LH3A 1FY3A 1H1BA 3PMHB 1P12E 3AAVA 4ZH8A 3VB7A 3PTNA 4UEHH 2UWLA 3ZVAA 5HGGA 3TK6A 4FUIA 1D3PB 3MH5A 3SNDA 3RP2A 2W3IA 1C5NH 4KELA 1V2RT 2Z9GA 5E0HA 2F9BH 3SV8A 3STJA 2ZKSA 1P2MA 2XC4A 3RXOA 8LPRA 2AMDA 1GVZA 3MWIU 1OWIA 1OP2A 4ZKOU 1AU8A 5FBEA 1GBTA 5HMAA 8GCHG 4UE7H 5L6NH 1NTPA 1GCDA 2BQWB 1N8OC 3FAOA 1TGBA 1NC6A 1SVPA 3H7OA 1HPGA 4KKDA 1ZSLA 3SHAH 1O3MA 3RXBA 1B0EA 1GL1A 3QUMP 1OWEA 4JZIA 1AZZA 3P70B 3PROA 2PSYA 4WF8A 2ILNA 4X8TH 3SUGA 1QIXB 1IHSH 2OTVA 3OSYA 1GL0E 4FUHA 3IG6B 3FANA 6LPRA 4F49A 3M7UA 1CT0E 1Z6EA 2WYGA 1VITG 1OYTH 1O38A 2AYWA 2BOHB 5DPAA 3TJUA 4GAWA 4CHAC 1SGYE 1YPLH 1BTYA 1DVAH 1QY6A 1C2LA 1ELDE 2P8OC 3LONA 4OS5A 3RXKA 4LK4A 1Y8TA 2BZAA 2VIOA 3B9FH 1TOMH 2ASUB 5FAHA 4JMYA 4E05H 3A83A 2VVCA 1QBNA 1P01A 1MD7A 4DJZB 1LCYA 2CF8H 1SGNE 2JETC 2QY0B 2I6QA 3ZZDA 4BTTB 1QNJA 3BTFE 2P95A 4A1XA 4MPXA 1CT2E 1L2EA 1MD8A 2H1UA 3CS7A 4I31A 2F9NA 4Q7XA 1F5RA 4NSVA 2OQUA 1S83A 1ZPZA 5CHAB 4KP0A 1ARCA 4Y8XA 2FXRA 1Z1JA 2JH0D 1RIWB 3HK6B 2F9OA 2B7DH 1GBMA 3VFEA 1F7ZA 1OOKB 2UUKB 1G37A 3BTDE 4YLQH 3SV2H 4ZKSU 2ANWA 1CE5A 3V7TA 3T5FH 2BZ6H 4QT8C 2XRCA 3VB6A 1AKSB 3KN2A 2GT7A 1D6RA 1GHYH 2FESH 2ZGBH 4ASHA 5FPTA 4YOIA 3SU2A 1Y5BT 4YO9A 3O8DA 3ZV9A 1EKBB 1TA2A 3GY2A 1EPTC 3EAJA 4XSKU 1AZ8A 4TY7A 3VB4A 1ANBA 3A86A 1HUTH 1KDQB 1TBRH 1W13U 4AN7A 2BX4A 6CHAB 1PQ5A 3PV4A 4YESB 1O32A 3RM0H 3E0NB 3M36A 3AVZA 2HALA 4YT7H 3S9CA 4NZQA 2FMJA 4ISIH 1K1PA 3MH4A 3SU1A 2C8ZB 1UMAH 3MU1A 2BD7A 1DS2E 2VIPA 1RTFB 9LPRA 3E90B 4ZROA 1SC8U 1T8LA 4CBOA 2TGAA 1IQMA 1GJCB 5FX5A 4GLYA 3U1IB 4CRGA 4ABDA 5JDUB 2WPIS 1KTSB 3URCA 2WUBA 3SU5A 2ZFFH 3RXLA 3LC5A 1PPBH 1T31A 2FI4E 1MCTA 1Y5AT 5EXMA 1NRNH 1EB2A 4K2YA 1SSXA 3GY4A 1C5SA 3QGNB 3N7OA 1O2XA 6ESTA 1BITA 1C4V2 1ZHPA 3KCGH 2OD3B 2G4UA 2ZDKA 3NWUA 5F8ZA 1V2ST 1CHOF 1UTNA 3UQVA 5F6MA 3TGIE 1EATA 2AIQA 3M3SA 1GJ9B 3L3TA 1UTKA 1IAUA 1JXPA 1ESTA 1BMNH 1B7XB 1P2QA 5A8XA 1C5ZB 3PLBA 1QQUA 2R3UA 2ZF0H 1ZR0A 5GCHG 1N1LA 1O2TA 1NFYA 4IMQA 1C2FA 1GHVH 3HPTB 4DT7B 1V2LT 2EA3A 3KGPA 3GISB 1SI5H 3RXPA 2HVXA 3ELAH 1SGTA 1SHHB 4Y8ZA 1GPZA 4SGAE 5T3HA 1NS3A 2XC0A 5F8TA 1O2RA 4Y10E 2FX6A 5A2MH 1QCPA 3LOXA 2FWWA 2WV4A 4AFUA 1LHEH 1KDQA 1YCPH 1XXDA 2BVXH 1ARBA 4IN1A 4GPGA 1YGCH 3S9AA 1HAOH 2G4TA 4MTBA 4B75A 1WTGH 2BDAA 1K22H 1MAXA 2NU2E 1TNJA 1CT4E 2SFAA 1ELVA 4JYVH 3S7HB 1UHBB 1XUGA 3A87A 3KHVA 1P2KA 1ORFA 2H9TH 8KME2 2GV6A 3RXCA 4ISOA 1TA6A 4A7IB 3E91A 1IQEA 3VGCB 1MQ5A 4B76A 4NSYA 4BAQB 3B8JA 2W7SA 4CBNA 4JZFH 2BLOA 2ZEBA 2HLCA 3ZZ4A 3ZVEA 2WUCA 1P03A 1JIRA 3ZZ9A 3HATH 1OKXA 2J4IA 1CA0C 3KNXA 1GMCF 5EXLA 1K21H 2BDCA 4MNXA 2ZGXH 3A7ZA 3RMMH 1DWCH 1C1PA 2O9QA 1O3KA 1ELAA 1LVYA 2VJ1A 3GDVA 3ATWA 1FONA 1TMBH 2OC8A 2B8OH 3GCNA 4ZHAA 2Z94A 3S0NA 2QC2A 5GIBA 1HB0B 1INCA 2V3OH 3F9FA 4NA7A 3A7YA 9ESTA 3M35A 1ZSKA 3ATMA 4IC6A 2ZA5A 3TVJB 1K1NA 3PB1E 4J2YB 1J15A 5T6DA 1Q2WA 1HYLA 4GVUA 3E6PH 4K5ZA 1C1WH 2VH6A 1SFQB 1QRXA 2ANKH 1LPKB 1ELEE 3RXSA 2ODYB 3SV6A 4HTCH 4K69A 1ZYOA 1BZXE 3OY5U 2G52A 4FUCA 1C5YB 4INKA 5EPYA 1ELTA 5LPFA 2C93B 5F03A 3LT3A 3SJOA 4Z6AH 4LZ1H 1AFQC 1FY8E 1A4WH 2J38A 4WMFA 5J4SA 2ZGHA 1IQNA 1DWBH 1SGRE 2ZCHP 1H9LB 1C5VA 3SI4H 2QGRA 3SV7A 4AG2A 3U98H 2C90B 2BLWA 5JBAS 1GWAA 5DP4A 1HAIH 4X8UH 2B9LA 3UNQA 3SJIA 1S6HA 4XDEA 2VH0A 5ABWA 3FP7E 3AASA 3S7KB 1QQ4A 3MYWA 3UWIA 3RXEA 1GDQA 2BM2A 1HIAB 4JZEH 1KIGH 1SBWA 1A5IA 1HNEE 2Z3DA 1CHOG 2OC1A 1MQ6A 1O2NA 5H4IB 1XX9A 1VGCB 2A4RA 4X1RU 4Q7YA 4D7GA 4ZHMU 4WWYA 4U30A 1LPGB 3PLKA 3MH7A 4TYDA 5FPYA 1EZSC 5SGAE 3KQDA 1O3FA 4CRDA 3BSQA 1RJXB 1P57B 1UCYK 2A0QB 2A5IA 4UFDH 3MO3A 2TBSA 1AQ7A 4I8KA 2VIWA 3TJOA 1S6FA 1SMFE 2ZDVH 1O3AA 2ZHWH 1F5LA 4AOQA 3OYPA 1A61H 1GJ7B 1IQKA 4A1VA 3RU4T 1AUJA 4FUFA 4M7GA 2CMYA 1E0FD 1PJPA 2P94A 1KY9A 3SNBA 4WXIA 4MPVA 5C3NA 1ACBE 3EYDA 1GMHF 1OWDA 4DVAU 2LNCA 4X2VA 4IGDA 2GZ8A 2O8TA 1KXDA 1ANCA 1SFIA 2F9PA 2ZU1A 3VB3A 4JK5A 3RXAA 3O8RA 2TGPZ 1C2GA 2ZNKH 2BXUH 3BTTE 4ZKRU 4ABFA 2F83A 3VPKA 1ZZZA 1BHXF 5FX6A 3SZNA 1UTQA 2BLVA 2SGQE 4DW2U 2ZFQH 1CBWC 1TGCA 2SGPE 5E8EH 3GY8A 1KSNA 4OS2A 1WQVH 2M5TA 1ZOMA 1GHZA 2BDBA 1WAYB 2XWAA 1IQIA 1N8OB 1GHXH 2PGQB 3ZZ5A 1GMCG 3DFJA 1RTKA 3HKJB 1LHFH 4BAKB 2FOAA 1ELFA 1GHBF 1O2OA 1SLVB 2ZTYA 3P8GA 1BBRK 4Z0KA 2CN0H 1SLWB 2V3HH 3RM2H 4TY6A 3GCTF 4KTUA 1UVUH 1VJ9U 4WY3A 1D6WA 5GDSH 1VCWA 1TYNA 1GBJA 4K8YA 4CH8B 2ZTXA 5BRRE 5IDKA 3A88A 1JWTA 1GI5A 1O3EA 3D49H 2BB4A 3HGPA 4NFFA 2DE8A 4JZDH 1H9IE 1O5GH 3F68H 1P9UA 4KGAA 1WYKA 1XVMA 2ZGJA 1O2KA 1UK4A 1KXFA 2GV7A 4FUEA 3SQHE 3UREA 2VINA 1H9HE 2JETB 1XXFA 1PYTD 1S5SA 3ZV8A 2VWNA 1C5PA 4ZXYH 1GDUA 2FI3E 3M5NA 1K1JA 1MTNC 1FY4A 4BXSA 5EQRA 4I8JA 2G81E 5F8XA 4ZKNU 4A6LA 1B0FA 1Z71A 3BIVH 4VGCC 1P04A 3BTQE 2VVUA 1MTVA 1EAIA 1TB6H 1TRNA 2ZU2A 2FIRH 1C2IA 1EZQA 5ETXA 1SGFG 1ESBA 1GBKA 1FIZA 1SQOA 1G9IE 2ZCLP 2TRMA 4NG9H 1RGQA 4H6TA 2ZDAH 5I46H 1V2UT 3QTOH 1MTWA 2GZ7A 1W10U 1GI7B 2A31A 2A7CA 1QRZA 2FTMA 1IQLA 1MUEB 3Q00A 1PQAA 1ZRBA 1FAXA 5EQSA 2P3TB 1V2NT 2JH5D 5K7RA 2HNTF 1DUAA 1AIXH 4K8BA 2ZPRA 1EPTB 1O2PA 3ATKA 3EA8A 3F9EA 5EU8A 4D8NA 1M9UA 4CH2B 1C1OA 4X2XA 2D2DA 1TGNA 2Y82A 2CF9H 3R0FA 3U1JB 5T6FA 2ZO3H 5EG4A 2ZFSA 1K9OE 5TCAA 4IBLH 1CGIE 1NY22 3Q77A 4YM9A 1EJNA 1YPHC 1NU7B 4YLUA 4Y7BA 3LH1A 2ZPQA 3EE0B 2A32A 4X1NU 4ZAEA 1V2OT 1MBQA 2OP9A 2GP9B 1Z8JB 3BTEE 1EAXA 1IHTH 2Q6GA 1DY9A 2HGTH 2PKAA 3TNTA 3RXFA 4GHTA 2QN5T 2GX4A 1EXFA 2F9UA 1TQ7B 1ID5H 4AYYB 1HAGE 2ODPA 2HOBA 1QGFA 1GVKB 2KAIA 1T8MA 2PUQH 4K1TA 1LDTT 1UTOA 3PO1C 2RDLA 4AFSA 1MTSA 2G51A 1O2GH 3GY5A 5AHGH 2G8TA 2TPIZ 2FTLE 1S81A 3K9XB 4X6MA 1SQTA 2GKVE 1ANDA 1ETRH 1XUKA 3ESTA 1WQSA 1AHTH 2TGDA 3RXHA 2ZQ2A 4AGKA 1GBAA 3OTJE 2Y5FA 1CGHA 1BDAA 4FUBA 4ISHH 3R3GB 5JBCS 1Z8IB 5DO4H 1XUJA 1KYNA 3W94A 2PV9B 1GBLA 1HLTH 5C1UA 1NU9A 1UTLM 1XUFA 2ZGCA 2PFEA 4B71A 1Y59T 1GHBG 2D1JA 1O2HA 7GCHF 3SUEA 1GHWH 5DGJA 1CVWH 5EW2H 2Q1JA 4B1TA 1NRPH 1TAWA 2BQ6B 1FDPA 1MKWH 1T8OA 2VVVA 1TX7A 3A7TA 3VXEH 1LQDB 2EI6A 2ZDLA 1HAXB 1XKAC 5JB9S 2AEIH 4ZXXH 1GJ6A 2WPKS 2A4QA 2YOLA 3RXJA 1A3EH 2GDDA 2ZDMA 1V2QT 4O03A 3RXDA 5C67A 1GGDC 1K1OA 1J14A 1G3DA 4YT6H 2ZFTA 2XNIA 2J95A 2WPMS 3VEQB 2XBYA 1P09A 1TNKA 2ULLA 4E7NA 4LOYH 1L4ZA 5DP9A 1SGPE 3A81A 3DFLA 1XUHA 1HAVB 1DITH 1NROH 2IJOB 2J9NA 2O8MA 2RA0A 2FOHA 2QAAA 1LTOA 5G4BA 4NIWA 5BPEA 1AN1E 2ZG0H 1O2UA 1PQ8A 2IOTA 1AY6H 3O8BA 3MU4A 1O34A 1NFWA 1K1MA 1YYY1 2OC0A 1C9TA 4HGCA 3SGBE 2Y5GA 3TGJE 2HNTE 5DKMA 1AB9C 3FVFB 2V6NA 2EI7A 4UFGH 1RRKA 1HXEH 5FXLA 1CA0B 4JYTA 3BTWE 2GZ9A 1BT7A 4CRCA 1ZSJA 4Y7AA 2NU4E 2ALPA 4X6PA 3RU4E 2THFB 1QHRB 3FFGA 3ZZBA 1AO5A 1HXFH 1F0UA 3RXIA 2G55A 1G2LA 3MOCA 4YOJA 4NZLA 4FUDA 2LPRA 2BLQA 1O2WA 2Z6BD 2BMGB 4GCHF 4MDSA 3STIA 1BMMH 2QXGA 5GWZA 1CQQA 4MNWA 2GT8A 1L1NA 1GJDB 3TPIZ 1G3EA 3SI3H 3SUFA 3GYLB 4X8VH 2FYQA 2FPZA 5A0BA 1GBIA 3LPRA 4AX9H 4XBDA 1BMAA 4R8TB 3MNSA 2BY6X 3PMJA 1YM0A 3H5CB 4I32A 2OCVB 2ZHEH 2CHAC 4D7FA 1EQ9A 2EI8A 2BY9X 1AFQB 1ZHMA 1UVTH 1S0QA 3TNSA 1O30A 1NFUA 4NWKA 1EZXC 1TBZH 2A5AA 5JB8S 2GD4B 2BYAX 1O3CA 1UO6A 2PTCE 4Q2KA 4AB8A 1H8IH 1O2YA 1MZDA 1PPCE 1O5CB 1OXGA 3MNXA 2W3KA 4H6SB 3SQEE 1ZGIA 1O35A 1YPJH 5C5NA 3QTVH 3LC3A 1C2DA 3S9BA 2ODQA 2Z7FE 1YCPM 1UK3A 2BY5X 4DURA 3CP7A 3KEEA 5FHTA 1ZGVA 4ESTE 2BD8A 3LGIA 2ZTZA 1GI0A 5B6OA 4A1TA 4ABAA 2OUAA 3RXRA 1DXWA 2WINI 2FOGA 3PMAB 2BDHA 1YPKH 5DP3A 3ZZ7A 3GOVB 2ZQ1A 4RKJB 3VB5A 4YTAA 1F0TA 4ABEA 4BAHB 1S84A 4O9VA 3UR9A 4PROA 3FZZA 1GCTC 1C4U2 1OP0A 1NZQH 3KF2A 1AKSA 1DOJA 1WOFA 5DP5A 1S82A 4BNRA 2STBE 1THRH 3BG8A 3SNEA 2JKHA 3PWCA 3F6UH 2VU8E 3L6PA 1ANEA 1OSSA 1C5MD 1MMJN 3K65B 1ABIH 1W2KH 3M37A 4OS4A 2NWNA 5A0CA 1J16A 4NIYA 1O2LA 5CMXH 2PWXA 4DG4A 1C2MA 1ZHRA 2HPQH 1BQYA 4Y6DA 1C1RA 2F3CE 3I29A 4MPWA 2Q6DA 2P16A 4X2YA 1L1JA 2AGIX 2HNTC 1BRUP 4UFFH 2BD4A 1YCPK 1D3TB 3V3MA 8ESTE 5JBTA 5JPMH 4KTSA 2Z3CA 2AIPA 2SNVA 2QF3A 2A4OA 1C5QA 1ABJH 1P9SA 1C5UA 1RS0A 2OQ5A 1TMTH 1CBWB 1ZMLA 4ABJA 2ZU5A 1P11E 3TK9A 4TPYA 5AVDA 1K2I1 5IYTA 1O2SA 3OY6U 1F0RA 2H9EH 1D9IA 4U32A 2Y6TA 1A5GH 1A3BH 1S0RA 2SGAA 3SORA 1IQFA 1UTPA 1ZTLA 3SO3A 1TLDA 1DSTA 3FP6E 2O8LA 1BOQA 1TFXA 1IQGA 6GCHF 1VCQA 1DFPA 3BV9B 2R0LA 3DHKH 4CR5A 2WYJA 1OYQA 1TABE 3ZZ3A 2XC5A 2HPPH 4ABIA 4GCHG 1KXEA 3RLYH 3RXVA 3QZQA 3GDSA 4FU9A 1SGQE 1V3XA 1GHAF 4GHQA 3GY7A 3U8RH 3ZVFA 3G01A 1S85A 3A84A 2P59A 3P17H 1OWKA 2TGTA 3W95A 1W3CA 2C4FH 3ZYDA 4DIHH 7ESTE 1TGSZ 1D3QB 3LKWA 1BTHH 1C5OH 1O3GA 5L2YH 3K2UA 2CV3A 1MKXK 1HAYB 3ZVDA 3NUMA 1W7GH 4ISLA 4Y0ZE 1ZJDA 3BEIB 1MTNB 2J2UA 1GBDA 2UWOA 4I8GA 2FZZA 3A85A 4VGCB 4K3JA 1DWEH 2NU3E 4BAMB 1UHBA 4ABGA 3F9HA 4WMEA 1V2TT 3MNBA 1O3PB 3ATLA 1LMWB 2GVFA 2A45B 1O5AB 1BTWA 4E06H 1G3BA 1EP6A 1L0ZA 1IQJA 1DY8A 2FYRA 1TALA 1G32B 4ABBA 2J34A 4D76A 3URDA 2FI5E 1QURH 2FLRH 4IC5A 4LZ4B 3M5MA 2VGCC 4Y79A 1GJAB 2ZFRH 1W14U 2GCTC 1K1LA 1C9PA 4BOHA 1HDTH 2FS8A 1LPZB 2QYIA 3KQEA 2DUCA 1ETSH 1O3DA 3GICB 3NKKA 1TNGA 3SN8A 4WMDA 1BRCE 3TU7H 2ZU3A 2BXTH 4CRFA 5A8YA 1TOCB 1EX3A 1THPB 1GBBA 5AFZH 4ABHA 1TE0A 1NESE 3M61U 2I6SA 3ZVCA 2ZIQH 2C8XB 1AVGH 2GDEH 2W26A 1VJAU 5LPEA 4NWLA 2QXJA 1T8NA 2H6MA 2R9PA 1TX8A 5J4QA 4THNH 2JH6D 3UTUH 2F91A 1V2WT 4HFPB 4Q7ZA 1KLIH 3SJKA 1G3CA 1V2JT 3D23A 4MVNA 3QWCH 3PO1B 3M7TA 4GUXA 3HKIB 4B2BA 1A46H 1O5FH 3ZZAA 3EQ0H 1Z6JH 4NIVA 3U9AH 1TQ0B 2NU0E 1YKTA 3P8OA 4KTCA 1GG6B 1F0SA 1OWHA 1GJBB 2D26C 1WCZA 4X0WU 3UOUA 2WV5A 1HIAA 1P06A 1T7CA 1K1IA 2ZP0H 1GJ5H 1GBHA 1MCVA 1ZPBA 2XBXA 3BIUH 1YBWA 3I77A 4NGAH 4B2CA 3A8DA 2CXVA 1NN6A 4NFEA 2ZFPH 1AGJA 2H5CA 1Y3WA 3D62A 2WPJS 3PMBB 4Y71A 1DANH 2FOBA 1GI3A 5FCKA 1YPGH 1GVLA 3Q3XA 4FU7A 1SOZA 1UTMA 1ZTJA 2XCFA 2UUYA 1TNLA 4A5TS 3RU4D 3FZDA 4I33A 1MTUA 5E0JA 1GMDF 2IN2A 4Y11E 2A5KA 4MLFB 2VIVA 4A92A 1N6YA 2VB0A 2ZECA 2ZWLH 3SU4A 2A1DB 3Q3YA 1C1TA 1QL7A 1GGDB 1P3EA 1W0ZU 1SQAA 7KMEH 3P8FA 2Y81A 5ESTE 4OGYA 1GI1A 3GCHC 1BTZA 1A7SA 1CSOE 1Z7KA 3V12A 1GJ8B 1DPOA 1ZRKA 1O3HA 4ZUHA 2C3SA 1NFXA 1C2EA 1LKBA 1UJ1A 2QF0A 1O3IA 5DK1A 2BDGA 4B74A 4IS5A 3BEFB 3GYMA 1C4Y2 1C5XB 1FPCH 1U6QA 5FPSA 4DOQA 2XTTB 5ESBA 3MMGA 3RXGA 1AB9B 1DM4B 1C5LH 1C1UH 2EC9H 1ESAA 4K60A 2A7HA 1A2CH 1VCPA 1TIOA 1TRMA 2ZU4A 3T2NA 3SJ9A 1CGJE 5C5OA 1B5GH 3QGJA 4U2WA 4CRAA 2FX4A 1TNIA 1AE8H 3QK1A 1BHXB 2J92A 1K28D 1W0YH 3FP8E 4X2WA 4BANB 3NPSA 3KL6A 4X1SU 2VIDA 2SGFE 1XM1A 1C1SA 3BF6H 1VZQH 3E8LA 1BJUA 4X1PU 5HM2A 4CREA 2BX3A 4MG3A 1V6DA 1QBVH 1RTLA 1Q31A 2GCHF 3S69A 3ZVGA 1LO6A 3TJVA 3K6ZA 1TNHA 1DT2A 1P3CA 1O2ZA 4B73A 3UY9A 1GMHG 2AMPA 1XKBC 1O5DH 2CHAB 2XW9A 1DLEA 4J1YA 2OBQA 3E16B 2BVRH 2ZHFH 3LDXH 3LGUA 1C5TA 1LKAA 5JYIA 2FOMB 2ANMH 1P10A 3O8CA 2PSXA 1THSH 4X6NA 5LH8A 3BTGE 1FMGA 3A7XA 1EP5A 2OBOA 4E7RG 3SBKA 4FUGA 1TRYA 1HJAC 3WY8A 1G30B 1SLUB 2AMQA 1EB1H 3QO6A 1GG6C 3LJJA 3NK8A 3A8AA 1HGTH 1KXAA 1XVOA 5C20A 1QR3E 2Y7ZA 3M3TA 4JZ1A 1HFDA 2BDYA 2FOEA 3AW0A 3E0PB 1WSSH 3TH4H 1ZMNA 2GGVB 2Z9JA 5DG6A 2AH4X 2BD9A 1MZAA 3M7QA 1KXCA 2EEKA 3GCTG 3UFAA 1TGTA 5EGMA 1IQHA 1GCTB 5GCHF 1EJMA 1GJ4H 5DP7A 3RLWH 5A09A 4MQAA 3RC6A 5DJ7A 1OS8A 3LGWA 1WV7H 4H4FA 2O8WA 3U69H 1T32A 1FJSA 1EPTA 1A0LA 1WUNH 1T4VH 2HWLB 5FCRA 5T6GA 1GMDG 2SGDE 1XMNB 1MKWK 2F9VA 1J17T 2FP7B 2XYAA 1JMOH 1GDNA 4AYVB 1NO9H 3BG4C 4JYUH 7LPRA 3ITIA 1J8AA 1GI2A 1PPFE 3TIUA 5PTPA 3SHCH 4NA8A 1QJ1B 2K1QA 3SJ8A 2Y5HA 3U8TH 1AI8H 1QFKH 2R2MB 1BTPA 3SW2B 2AFQB 1FLEE 1QL9A 3F1SB 3ZZ8A 1DDJA 1AMHA 4OS7A 2BDIA 1ELBA 3GDUA 1P2JA 1HJ9A 2B5TB 1ELGA 2RA3A 1P0SH 2BVSH 4D9QA 2QV1A 2ALVA 2XWBI 4FVDA 3K6YA 3SV9A 1OWJA 2GMTC 1NRRH 1EUFA 4WVPE 3LGYA 1FI8A 1FY5A 4AORA 2V35A 3BTME 3SNAA 2QXIA 4INLA 3UPEA 1UTJA 1GI4A 3KQBA 3MO6A 1A1RA 2YNBA 1PPHE 3MFJA 4XBCA 3TITA 1Y5UT 4B2AA 1V2MT 2YNAA 1A0HB 1MBMA 2OINA 4O3UA 1NM6A 1BJVA 1NRQH 2A2QH 1GI9B 3A7WA 4I8HA 3RMNH 1V2KT 4MNVA 5A0AE 2GCHG 4BTUB 2HRVA 4WJG2 1C5RA 5DP6A 5L30H 1NRSH 4WH8A 4DGJA 2PR3A 4Q80A 3AW1A 1LHDH 3PWBA 3UQOA 5C2ZA 1TPOA 3MTYA 1FUJA 3D65E 1VITH 2RG3A 4Y0YE 1EZUC 2AGEX 3A8BA 1EOLA 3RC5A 3TK5A 4F4OC 3A82A 1HAVA 1O5BB 1QJ6B 1W7XH 2OC7A 4OS6A 3T62A 4TPIZ 1O33A 2VWMA 3BTKE 4YOGA 2BQ7B 1ZTKA 1HAZB 1Y3VA 1O36A 1O3NA 1RFNA 1RXPA 1TPSA 1VR1H 5AFYH 4D9RA 2W5EA 3DD2H 1P2IA 1Y3UA 1EOJA 3DT0H 4Y8YA 1MAYA 3SNCA 2XBVA 1AD8H 2W7UA 1UVSH 3I78A 4AB9A 1O31A 1BTXA 1EJAA 2PLXA 2BTCE 3ENSB 1DX5M 1P02A 4INHA 5EQQA 3SUDA 4XE4A 1JIMA 4DIIH 7GCHG 1QB6A 1FZZA 3RUOA 3V0XA 3RMOH 1KTTB 1CA8B 2PUXB 2VGCB 1TWXB 3RC4A 3LU9B 1O2JA 1TMUH 2CJIA 3KIDU 1BA8B 2GCTB 2XCNA 1N6XA 1AVXA 1Z1IA 3M5OA 1E34B 1X7AC 2P3FH 4AFQA 1BUIA 2P3UB 1H8DH 1UCYE 1BB0B 3F9GA 3NZIA 2VNTA 3Q3KA 1SHYA 2TIOA 4RN6A 4O3TA 1JOUB 2QIQA 4NCYA 1GI6A 1DSUA 3C1KA 1QA0A 3LGTA 3EDXB 2SNWA 1LHCH 2PTNA 1SR5C 2STAE 5GJ4B 3OU0A 3PTBA 3LGVA 3QZRA 3ODDA 1QB9A 2FEQH 3RMLH 2QA9E 1JRTA 3JZ1B 3MI4A 3SOSA 1E36B 1E35B 2BHGA 4X8SH 2BD5A 1O2VA 3DUXH 4K1EA 3SU0A 1L1GA 1O0DH 2R0KA 4TWYA 2G00A 2Z3EA 4JK6A 5HXFA 4RSPA 3UNRA 3Q76A 1W12U 1MU8B 1W11U 2BY8X 4WH6A 3TJNA 2FODA 5CHAC 3UIRA 2ESTE 2O8UA 3A80A 2A2XH 2PGBB 1ELCA 1Z8RA 1GBEA 1RIWC 3TH2H 4X6OA 1GBCA 3QLPH 1Y3YA 4XBBA 1HJ8A 2R2WU 1HAPH 3AAUA 1BMLA 2ZPSA 1LHGH 1P8VC 3HGNA 1FPHH 3T27A 1H4WA 2Y80A 1DE7H 1FY1A 4SGBE 2Y7XA 2BY7X 1O39A 1HCGA 2OXSA 4H42U 3P8NA 4AZ2B 4Y76A 3SGQE 1KXBA 3MH6A 2G5VA 1RD3B 2GTBA 1TPAE 1E38B 5A8ZA 1PYTC 1JBUH 2WPLS 3M3VA 2PKSB 1CU1A 2Z9LA 1EAUA 3A8CA 4ISNA 1BBRE 1MU6B 1QB1A 2V0BA 3CENA 1ETTH 6CHAC 2ZHQH 1C1NA 1PPZA 4WXVA 1O37A 3KQCA 3ZVBA 3PM3A 2H9HA 3ZYEA 3EGKH 2C8YB 3BTHE 3ODFA 5L2ZH 3L33A 1TPPA 4FXGH 1O3LA 1FXYA 3MU8A 1MKXH 3UR6A 3CS0A 1HBTH 1AWHB 3GCHB 2QCYA 5EXNA 3T29A 2ZI2H 2ZZUH 4UFEH 1TX6A 4R0IA 4UDWH 2VIQA 2BD2A 1AFEH 5K0HA 1WTHD 4AG1A 1SG8B 5C1XA 2ZC9H 4HZHA 3JZ2B 1AUTC 2DE9A 1XUIA 3SGAE 3LJOA 4I7YH 1GI8B 5E2PA 1T4UH 1CO7E 3T26A 1EAWA 4YZUA 2CGAA 1JRSA 4HI3A 3MU5A 3M5LA 4JCNA 4RKOB 1O2IA 1HAHH 3MHWU 3MNCA 3RDZA 1UVOA 4O97A 3E3TA 1P2NA 4LXBH 2ANYA 1ZMJA 2AERH 1UCYH 1YP9A 1MH0A 1BIOA 2FLBH 1DWDH 2AS9A 1C1VH 5CE1A 1C2JA 1PFXC 3P6ZB 2VWOA 4MNYA 5HM9A 2FO9A 2BD3A 3EA7A 1Y3XA 3RXMA 5E0GA 3QX5H 1OP8A 1LVMA 1SOTA 1GBFA 3VXFH 1YLDA 1YPMH 5TJXA 2R3YA 3ZZ6A 2P93A 1BCUH 1DLKB 4U01A 5DP8A 5EPNA 1OPHB 2XBWA 1FV9A 2FOFA 1F5KU 1G36A 1ZLRA 4XFQA 1SL3A 1UK2A 1D3DB 1SB1H 5EOKA 1SLXB 3SU6A 2ZCKP 1O5EH 2OLGA 1YLCA 1SGDE 1DICA 1FIWA 1YF4A 1DXPA 3ATIA 2PW8H 2RCEA 3DA9B 4BXWA 2UUFB 1HV7A 1TONA 1YPHE 4DY7B 1ZPCA 3VGCC 1FNIA 1HJAB 3SU3A 2D8WA 3OX7U 1F2SE 3PYHA 1O2QA 8GCHF 5LGOA 2A7JA
chains in the Genus database with same CATH superfamily
4MPUA 1V2PT 4UONA 1KLJH 4ZMAH 5GXPA 1WBGB 5LPRA 4ZHLU 4NIXA 1PPEE 1NPMA 2K8IA 4OGXA 1BBRH 1G2MA 2FOCA 3UOPA 5AF9H 1WU1A 1IOEA 3T28A 3F0PA 1TBQH 1E37B 3UWJH 1O2MA 3UUZA 2WPHS 5JBBS 6GCHG 1FAKH 2FM2A 3OFND 2W6JD 5HIYA 2PKSC 1BRBE 4BTIB 5I25A 4IMZA 2H2ZA 2C8WB 3BN9A 1AE5A 1VITF 1QTFA 4NA9H 3UNSA 4FVBA 1QL8A 1PPGE 1GHAG 4DCDA 4OS1A 4IN2A 2J94A 5HYOA 1QJ7B 1LVOA 3MU0A 4IW4E 1D4PB 4B6FA 3NRLA 5HIZA 2Q6FA 4CHAB 3P95A 1SGCA 3QDZB 3LIWA 5TCCA 4ACBA 2AGGX 1PQ7A 2PKAB 4FU8A 4AFZA 3BG4B 1ZJKA 2P8OB 1QBOA 1BTUA 1YC0A 3GY6A 2G5NA 3HK3B 1AWFH 5C1YA 3U28C 3V13A 1Z8GA 3F3BA 3E1XB 2KAIB 1UVPA 1C1MA 2A4GA 2Z9IA 1WXRA 1O3OA 1QRWA 3NXPA 4FUJA 3A89A 3RXUA 1C5WB 1A0JA 5E2OA 3TGKE 1F92A 2PHBA 3C27B 3EA9A 1FQ3A 1O3JA 1OX1A 1V2VT 1YPEH 4CRBA 1Q3XA 2SGEE 2UWPA 3QN7A 1DUEA 3ZZCA 2B0FA 3SZEA 1AVWA 2NU1E 1SGIB 2XXLA 3IITA 2H5DA 1EASA 3B23B 2GMTB 2QF4A 2Z9KA 3NCLA 1LVBA 5EW1H 1VGCC 4UD9H 1C2KA 1HRTH 3TLOA 1J9CH 1P2OA 1A5HA 5EODA 2IPHA 1SGEE 2L6OA 3T25A 3RXTA 1KLTA 2FS9A 2BOKA 2ZHDA 4I8LA 1C2HA 5FBIA 1WDIA 1CHGA 3PLPA 1LQEA 3A7VA 1QA7A 4AGJA 1NT1A 3GY3A 4BAOB 1W8BH 3P92A 1BRAA 1FN8A 2VWLA 1O3BA 1C1QA 4GSOA 3IWMA 1SGFA 1W0JD 1SPJA 3RXQA 4CR9A 2ZDNA 1P05A 4K1SA 3GCOA 1L4DA 4X1QU 2UUJB 1FN6A 2FDAA 4XOJA 3U8OH 4TWWA 2VBCA 5GPIB 3TH3H 3MO9A 3BEUA 2QXHA 3H7TA 3LH3A 1K0HA 1FY3A 1H1BA 3PMHB 1P12E 1W0KD 3AAVA 4ZH8A 3VB7A 3PTNA 4UEHH 2UWLA 3ZVAA 5HGGA 3TK6A 4FUIA 3FO8D 1D3PB 3MH5A 3SNDA 1E1QD 3RP2A 5KEDA 2W3IA 1C5NH 4KELA 1V2RT 2Z9GA 5E0HA 2F9BH 3SV8A 3STJA 2ZKSA 1P2MA 2XC4A 3RXOA 8LPRA 2AMDA 1GVZA 3MWIU 1OWIA 1OP2A 4ZKOU 1AU8A 5FBEA 1GBTA 2QE7D 5HMAA 4UE7H 8GCHG 1NTPA 5L6NH 1GCDA 2BQWB 1N8OC 3FAOA 1TGBA 1NC6A 1SVPA 3H7OA 1HPGA 4KKDA 1ZSLA 3SHAH 1O3MA 3RXBA 1B0EA 1GL1A 3QUMP 1OWEA 4JZIA 1AZZA 3P70B 3PROA 2PSYA 4WF8A 2ILNA 4X8TH 3SUGA 1QIXB 1IHSH 2OTVA 3OSYA 1GL0E 4FUHA 3IG6B 3FANA 6LPRA 4F49A 2OK5A 3M7UA 1CT0E 1Z6EA 2WYGA 1VITG 1OYTH 1O38A 2AYWA 2BOHB 5DPAA 3KQ5A 3TJUA 1NBME 4GAWA 4CHAC 1SGYE 1YPLH 1BTYA 1DVAH 1QY6A 1C2LA 1ELDE 2P8OC 3LONA 4OS5A 3RXKA 4F55A 4LK4A 1Y8TA 2BZAA 2VIOA 3B9FH 1TOMH 2ASUB 5FAHA 4JMYA 4E05H 3A83A 2VVCA 4DT4A 1QBNA 1P01A 1MD7A 4DJZB 1LCYA 2CF8H 1SGNE 2JETC 2QY0B 2I6QA 3ZZDA 4BTTB 1QNJA 3BTFE 2P95A 4A1XA 4MPXA 1CT2E 1L2EA 1MD8A 2H1UA 3CS7A 4I31A 2F9NA 4Q7XA 1F5RA 4NSVA 2OQUA 5HKKD 1S83A 1ZPZA 5CHAB 4KP0A 1ARCA 3PRBA 4Y8XA 2FXRA 2WSSD 1Z1JA 2JH0D 3MQKC 1RIWB 3HK6B 2F9OA 2B7DH 1GBMA 3VFEA 1F7ZA 1OOKB 2UUKB 1G37A 3BTDE 4YLQH 3SV2H 4ZKSU 2ANWA 1CE5A 3V7TA 3T5FH 2BZ6H 4QT8C 2XRCA 3VB6A 1AKSB 3KN2A 2GT7A 1D6RA 1GHYH 2FESH 2ZGBH 4ASHA 3F0OA 4YOIA 5FPTA 3SU2A 1Y5BT 4YO9A 3O8DA 3ZV9A 1EKBB 1TA2A 3GY2A 1EPTC 3EAJA 4XSKU 1AZ8A 4TY7A 3VB4A 1ANBA 3A86A 1HUTH 1KDQB 1TBRH 1W13U 4AN7A 2BX4A 6CHAB 1PQ5A 3PV4A 4YESB 1O32A 3RM0H 3E0NB 3M36A 3AVZA 2HALA 4YT7H 3S9CA 4NZQA 2FMJA 3F2HA 4ISIH 1K1PA 3MH4A 3SU1A 1SKYE 2C8ZB 1UMAH 3MU1A 2BD7A 1DS2E 2VIPA 1RTFB 9LPRA 3E90B 4ZROA 1SC8U 1T8LA 4CBOA 2TGAA 1IQMA 1GJCB 5FX5A 4GLYA 3U1IB 4CRGA 4ABDA 5JDUB 2WPIS 1KTSB 3URCA 2WUBA 3SU5A 2ZFFH 3RXLA 3LC5A 1PPBH 1T31A 2FI4E 1MCTA 1Y5AT 5EXMA 1NRNH 1EB2A 4K2YA 1SSXA 3GY4A 1C5SA 3QGNB 3N7OA 1O2XA 6ESTA 1BITA 1C4V2 1ZHPA 3KCGH 2OD3B 2G4UA 2ZDKA 3NWUA 5F8ZA 1V2ST 1CHOF 1UTNA 3UQVA 5F6MA 3TGIE 1EATA 2AIQA 3M3SA 1GJ9B 3L3TA 1UTKA 1IAUA 1JXPA 1ESTA 1BMNH 1B7XB 1P2QA 5A8XA 5T1VA 1C5ZB 3PLBA 1QQUA 2R3UA 2ZF0H 1ZR0A 5GCHG 1N1LA 1O2TA 1NFYA 4IMQA 1C2FA 2CK3D 1GHVH 3HPTB 4DT7B 1V2LT 2EA3A 3KGPA 3GISB 1SI5H 3RXPA 2WHXA 2HVXA 3ELAH 1SGTA 2YMSB 1SHHB 4Y8ZA 2JJ1D 1GPZA 2KCYA 4SGAE 5T3HA 1NS3A 5EJLA 2XC0A 5F8TA 1O2RA 4Y10E 2FX6A 5A2MH 1QCPA 3LOXA 2FWWA 2WV4A 4AFUA 1LHEH 1KDQA 3DSPA 1YCPH 5EIYA 1XXDA 2BVXH 1ARBA 4IN1A 4GPGA 1YGCH 3S9AA 1HAOH 2G4TA 4MTBA 4B75A 1WTGH 2BDAA 1K22H 1MAXA 2NU2E 1TNJA 1CT4E 2SFAA 1ELVA 4JYVH 3S7HB 1UHBB 1XUGA 3A87A 3KHVA 1P2KA 1ORFA 2H9TH 8KME2 2GV6A 3RXCA 4ISOA 1TA6A 4A7IB 3E91A 1IQEA 4ASUD 3VGCB 1MQ5A 4B76A 4NSYA 4BAQB 3B8JA 2W7SA 4CBNA 4JZFH 2BLOA 2ZEBA 2HLCA 3ZZ4A 4RI0A 3ZVEA 2WUCA 1P03A 1JIRA 3ZZ9A 3HATH 1OKXA 2J4IA 1CA0C 3KNXA 1GMCF 5EXLA 1K21H 2BDCA 4MNXA 2ZGXH 3A7ZA 3RMMH 1DWCH 1C1PA 2O9QA 1O3KA 1ELAA 1LVYA 2VJ1A 4I86A 3GDVA 3ATWA 1FONA 1TMBH 2OC8A 2B8OH 3GCNA 4ZHAA 2Z94A 3S0NA 2QC2A 5GIBA 1HB0B 1INCA 2V3OH 3F9FA 4NA7A 2KFWA 3A7YA 9ESTA 3M35A 1ZSKA 1YY3A 3ATMA 4IC6A 2ZA5A 3TVJB 1K1NA 3PB1E 4J2YB 1J15A 4P02A 5T6DA 1Q2WA 1HYLA 4GVUA 3E6PH 4K5ZA 1C1WH 2VH6A 1SFQB 1QRXA 2ANKH 4YXWD 1LPKB 1ELEE 3RXSA 2ODYB 3SV6A 4OM9A 4HTCH 4K69A 1ZYOA 1BZXE 3OY5U 2G52A 4FUCA 1C5YB 4INKA 5EPYA 1ELTA 5LPFA 2C93B 5F03A 3LT3A 3SJOA 4Z6AH 4LZ1H 1AFQC 1FY8E 1A4WH 2J38A 4WMFA 5J4SA 2ZGHA 1IQNA 1DWBH 1SGRE 2ZCHP 1H9LB 1C5VA 3SI4H 2QGRA 3SV7A 4AG2A 3U98H 2C90B 2BLWA 2IPQX 5JBAS 1GWAA 5DP4A 1HAIH 4X8UH 2B9LA 3UNQA 3SJIA 1S6HA 4XDEA 2VH0A 5ABWA 3FP7E 3AASA 3S7KB 1QQ4A 3MYWA 3UWIA 3RXEA 1GDQA 2BM2A 1HIAB 4JZEH 1KIGH 4B6EA 1SBWA 1A5IA 1HNEE 2Z3DA 1CHOG 2OC1A 1MQ6A 1O2NA 5H4IB 1XX9A 1VGCB 2A4RA 4X1RU 4Q7YA 4D7GA 4ZHMU 3N7EA 1FX0B 5DN6D 4WWYA 4U30A 1LPGB 3PLKA 3MH7A 4TYDA 5FPYA 1EZSC 5FL7D 5SGAE 3KQDA 1O3FA 4CRDA 3BSQA 1RJXB 1P57B 1UCYK 2A0QB 2A5IA 2YMSC 4UFDH 4F48B 3MO3A 2TBSA 1AQ7A 4I8KA 2J98B 2VIWA 5DSFA 3TJOA 1S6FA 1SMFE 2ZDVH 1O3AA 2ZHWH 1F5LA 4AOQA 3OYPA 1A61H 1GJ7B 1IQKA 4A1VA 3RU4T 1AUJA 4FUFA 4M7GA 2CMYA 1E0FD 1PJPA 2P94A 1KY9A 3SNBA 2F4LA 4WXIA 4MPVA 5C3NA 1ACBE 3EYDA 1GMHF 1OWDA 4DVAU 2LNCA 4X2VA 4IGDA 2GZ8A 2O8TA 1KXDA 1ANCA 1SFIA 2F9PA 2ZU1A 3VB3A 4JK5A 3RXAA 3O8RA 2TGPZ 1C2GA 2ZNKH 2BXUH 3BTTE 4ZKRU 4ABFA 2F83A 2V3MA 3UB0A 3VPKA 1ZZZA 1BHXF 2HVYB 5FX6A 3SZNA 1UTQA 2BLVA 2SGQE 4DW2U 2ZFQH 1CBWC 1TGCA 3DSGA 2SGPE 5E8EH 3GY8A 1KSNA 4OS2A 1WQVH 2M5TA 1ZOMA 1GHZA 2BDBA 1WAYB 2XWAA 1IQIA 1N8OB 1GHXH 2PGQB 3ZZ5A 1GMCG 3DFJA 1RTKA 3HKJB 1LHFH 4BAKB 2FOAA 1ELFA 1GHBF 1O2OA 4Z1MD 2QF5A 1SLVB 2ZTYA 3P8GA 1BBRK 4Z0KA 2CN0H 1SLWB 2V3HH 3RM2H 4TY6A 3GCTF 4KTUA 1UVUH 1VJ9U 4WY3A 1D6WA 5GDSH 1VCWA 1TYNA 1GBJA 4K8YA 4CH8B 2ZTXA 5BRRE 5IDKA 3A88A 1JWTA 1GI5A 1O3EA 3D49H 2BB4A 3HGPA 4NFFA 2DE8A 4JZDH 1H9IE 1O5GH 3F68H 1P9UA 4KGAA 1WYKA 1XVMA 2ZGJA 1O2KA 1UK4A 1KXFA 2GV7A 4FUEA 3SQHE 3UREA 2VINA 1H9HE 2JETB 1XXFA 1PYTD 1S5SA 3ZV8A 2VWNA 1C5PA 4ZXYH 1GDUA 2FI3E 3M5NA 1K1JA 1MTNC 1FY4A 2KCAA 5EQRA 4BXSA 2KR7A 4I8JA 2G81E 5F8XA 4ZKNU 4A6LA 1B0FA 1Z71A 3BIVH 4VGCC 1P04A 3BTQE 2VVUA 1MTVA 1EAIA 1TB6H 1TRNA 2ZU2A 1EFRD 2FIRH 1C2IA 1EZQA 5ETXA 3KYGA 1SGFG 1ESBA 1GBKA 1FIZA 1SQOA 1G9IE 2JIZD 2ZCLP 2TRMA 4NG9H 1RGQA 4H6TA 2ZDAH 5I46H 1V2UT 3QTOH 1MTWA 2GZ7A 1W10U 1GI7B 2A31A 2A7CA 1QRZA 3H09A 2FTMA 1IQLA 1MUEB 3Q00A 1PQAA 1ZRBA 1FAXA 3W1EA 5EQSA 2P3TB 1V2NT 2JH5D 5K7RA 2HNTF 1DUAA 1AIXH 4K8BA 2ZPRA 1EPTB 1O2PA 3ATKA 3EA8A 3F9EA 5EU8A 4D8NA 1M9UA 4CH2B 1C1OA 4X2XA 2D2DA 1TGNA 2Y82A 2CF9H 3R0FA 3U1JB 5T6FA 2ZO3H 5EG4A 2ZFSA 1K9OE 5TCAA 4IBLH 1CGIE 1NY22 2L74A 3Q77A 4YM9A 1EJNA 1YPHC 1NU7B 4YLUA 4Y7BA 3LH1A 2ZPQA 3EE0B 2A32A 4X1NU 4ZAEA 1V2OT 1MBQA 2OP9A 2GP9B 1Z8JB 3EE7A 3BTEE 1EAXA 1IHTH 2Q6GA 1DY9A 2HGTH 2PKAA 3TNTA 2RFKC 3RXFA 4GHTA 2QN5T 2GX4A 1EXFA 2F9UA 5C94A 1TQ7B 1ID5H 4AYYB 1HAGE 2ODPA 2HOBA 1QGFA 2YMSD 1GVKB 2KAIA 1T8MA 2PUQH 4K1TA 1LDTT 1UTOA 3PO1C 2RDLA 4AFSA 1MTSA 2G51A 1O2GH 3GY5A 5AHGH 2WZQA 2G8TA 2TPIZ 2FTLE 1S81A 3K9XB 4X6MA 5CDFE 4XRNA 3OEED 1SQTA 2GKVE 1ANDA 1E1RD 2LELA 1ETRH 1XUKA 3ESTA 1WQSA 1AHTH 2TGDA 3RXHA 2ZQ2A 4AGKA 1GBAA 3OTJE 2Y5FA 1CGHA 1BDAA 4FUBA 4ISHH 3R3GB 5JBCS 1Z8IB 1SQRA 5DO4H 1XUJA 1KYNA 3W94A 2PV9B 1GBLA 1HLTH 5C1UA 1NU9A 1UTLM 1XUFA 2ZGCA 2PFEA 2K0QA 4B71A 1Y59T 1GHBG 2D1JA 1O2HA 3OE7D 7GCHF 3SUEA 1GHWH 5DGJA 1CVWH 5EW2H 2Q1JA 4B1TA 1NRPH 1TAWA 2BQ6B 3PV5A 1FDPA 1MKWH 1T8OA 2VVVA 1TX7A 3A7TA 3VXEH 1LQDB 2EI6A 2ZDLA 1HAXB 1XKAC 5JB9S 2AEIH 4ZXXH 1YLNA 1GJ6A 2WPKS 2A4QA 2YOLA 3RXJA 1A3EH 2GDDA 2ZDMA 1V2QT 4O03A 3RXDA 5C67A 1GGDC 1K1OA 1J14A 1G3DA 4YT6H 2ZFTA 2XNIA 2J95A 2WPMS 3VEQB 2XBYA 1P09A 1TNKA 2ULLA 4E7NA 4LOYH 1L4ZA 5DP9A 1SGPE 3A81A 3DFLA 1XUHA 1HAVB 1DITH 1NROH 2IJOB 2J9NA 1COWD 2O8MA 2RA0A 2FOHA 2QAAA 1LTOA 5G4BA 4NIWA 5BPEA 1AN1E 2ZG0H 1O2UA 1PQ8A 2IOTA 1AY6H 3O8BA 3MU4A 1O34A 1NFWA 1K1MA 1YYY1 5IK2D 2OC0A 1C9TA 4HGCA 3SGBE 2Y5GA 3TGJE 2HNTE 5DKMA 1AB9C 3FVFB 2V6NA 2EI7A 1KMHB 4UFGH 1RRKA 1HXEH 5FXLA 4XD7D 1CA0B 4JYTA 3BTWE 2GZ9A 1BT7A 4CRCA 1ZSJA 4Y7AA 2NU4E 2ALPA 4X6PA 3RU4E 2THFB 1QHRB 3FFGA 3ZZBA 1AO5A 1HXFH 1F0UA 3RXIA 2G55A 1G2LA 3MOCA 5CHBA 4YOJA 4NZLA 4FUDA 2LPRA 2BLQA 1O2WA 2Z6BD 2BMGB 4GCHF 4MDSA 3STIA 1BMMH 2QXGA 5GWZA 1CQQA 4MNWA 2GT8A 1L1NA 3AK5A 1GJDB 3TPIZ 1G3EA 3SI3H 3SUFA 3GYLB 4X8VH 2FYQA 2WV9A 2FPZA 5A0BA 2AHME 1GBIA 3LPRA 4AX9H 4XBDA 1BMAA 4R8TB 3MNSA 2BY6X 3PMJA 1YM0A 3H5CB 4I32A 2OCVB 2ZHEH 2CHAC 4D7FA 1EQ9A 2EI8A 2BY9X 1AFQB 1ZHMA 1UVTH 1S0QA 3TNSA 1O30A 1NFUA 4NWKA 1EZXC 1TBZH 2A5AA 5JB8S 2GD4B 2BYAX 1O3CA 1UO6A 2PTCE 4Q2KA 4AB8A 1H8IH 1O2YA 1MZDA 1PPCE 1O5CB 1OXGA 3MNXA 2W3KA 4H6SB 3SQEE 1ZGIA 1O35A 1YPJH 5C5NA 3QTVH 3KYFA 3LC3A 1C2DA 3S9BA 2ODQA 2Z7FE 1YCPM 1UK3A 2BY5X 4DURA 3CP7A 3KEEA 5FHTA 1ZGVA 4ESTE 2BD8A 3LGIA 2ZTZA 1GI0A 5B6OA 4A1TA 4ABAA 1E79D 2OUAA 3RXRA 2KZ4A 2WINI 1DXWA 2FOGA 3PMAB 2BDHA 1YPKH 5DP3A 3ZZ7A 3GOVB 2ZQ1A 4RKJB 3VB5A 4YTAA 1F0TA 4ABEA 4BAHB 1S84A 4O9VA 3UR9A 4PROA 3FZZA 1GCTC 3OEHD 1C4U2 1OP0A 1NZQH 3KF2A 1AKSA 1DOJA 1WOFA 5DP5A 1S82A 4BNRA 2STBE 1THRH 3BG8A 3SNEA 2JKHA 3PWCA 3F6UH 2VU8E 3L6PA 1ANEA 1OSSA 3SYJA 1C5MD 1MMJN 3K65B 1ABIH 1W2KH 1QZ8A 3M37A 4OS4A 2NWNA 5A0CA 1J16A 4NIYA 1O2LA 5CMXH 2PWXA 4DG4A 1C2MA 4P00A 1ZHRA 2HPQH 1BQYA 4Y6DA 1C1RA 2F3CE 3I29A 4MPWA 2Q6DA 2P16A 4X2YA 3WW7A 1L1JA 2AGIX 4Q4LA 2HNTC 1BRUP 4UFFH 1UW7A 2GJGA 2BD4A 1YCPK 1D3TB 2M2AA 3V3MA 8ESTE 5JBTA 5JPMH 4KTSA 2Z3CA 2AIPA 2SNVA 2QF3A 2A4OA 1C5QA 1ABJH 1P9SA 1C5UA 1RS0A 2OQ5A 1TMTH 1CBWB 1ZMLA 4ABJA 2ZU5A 1P11E 3TK9A 4TPYA 5AVDA 1K2I1 5IYTA 1O2SA 3OY6U 1F0RA 2H9EH 1D9IA 4U32A 2Y6TA 1A5GH 1A3BH 5F53A 1S0RA 2SGAA 3SORA 1IQFA 1UTPA 1ZTLA 3SO3A 1TLDA 1DSTA 3FP6E 2O8LA 1BOQA 1TFXA 1IQGA 6GCHF 1VCQA 1DFPA 3BV9B 2R0LA 2XNDD 3DHKH 4CR5A 2WYJA 1OYQA 1TABE 3ZZ3A 2XC5A 2HPPH 4ABIA 4GCHG 1KXEA 3RLYH 3RXVA 3QZQA 3GDSA 4FU9A 1SGQE 1V3XA 1GHAF 4GHQA 3GY7A 3U8RH 3ZVFA 3F2FA 3G01A 1S85A 3A84A 2P59A 3P17H 1OWKA 2TGTA 3W95A 1W3CA 2C4FH 3ZYDA 4DIHH 7ESTE 1TGSZ 1D3QB 3LKWA 1BTHH 1C5OH 1O3GA 5L2YH 3K2UA 2CV3A 1MKXK 1HAYB 3ZVDA 3NUMA 1W7GH 4ISLA 4Y0ZE 1ZJDA 3BEIB 1MTNB 2J2UA 1GBDA 2UWOA 4I8GA 2FZZA 3A85A 4VGCB 4K3JA 1DWEH 3PRDA 2NU3E 4BAMB 1UHBA 4ABGA 3F9HA 4WMEA 1V2TT 3MNBA 1O3PB 3ATLA 4M9FA 1LMWB 2GVFA 2A45B 1O5AB 1BTWA 4E06H 1G3BA 4TT3D 1EP6A 4FETA 1L0ZA 1IQJA 1DY8A 2FYRA 3UAIC 1TALA 1G32B 4ABBA 2J34A 4D76A 3URDA 2FI5E 1QURH 2FLRH 3DSOA 4IC5A 4LZ4B 3M5MA 2VGCC 4Y79A 1GJAB 2ZFRH 1W14U 2GCTC 1K1LA 1C9PA 4BOHA 1HDTH 2FS8A 1LPZB 2QYIA 3KQEA 2DUCA 1ETSH 1O3DA 3GICB 3NKKA 1TNGA 3SN8A 4WMDA 1BRCE 3TU7H 2ZU3A 2BXTH 4CRFA 5A8YA 1TOCB 1NBMD 1EX3A 1THPB 1GBBA 5AFZH 5EJ1A 3ZIAD 2J5UA 4ABHA 1TE0A 1NESE 3M61U 2I6SA 3ZVCA 2ZIQH 2C8XB 1AVGH 2GDEH 2W26A 1VJAU 5LPEA 4NWLA 2QXJA 1T8NA 2H6MA 2R9PA 1TX8A 5J4QA 1H8HD 4THNH 2JH6D 3UTUH 2F91A 1V2WT 1OHHD 4HFPB 4Q7ZA 1KLIH 3SJKA 1G3CA 1V2JT 3D23A 4MVNA 3QWCH 3PO1B 3M7TA 4GUXA 3HKIB 4B2BA 1A46H 1O5FH 3ZZAA 3EQ0H 1Z6JH 4NIVA 3U9AH 1TQ0B 2NU0E 1YKTA 2J97A 3P8OA 4KTCA 1GG6B 1F0SA 1OWHA 1GJBB 2D26C 1WCZA 4X0WU 3UOUA 2WV5A 1HIAA 1P06A 1T7CA 1K1IA 2ZP0H 1GJ5H 1GBHA 1MCVA 1ZPBA 2XBXA 3BIUH 1YBWA 3I77A 3GS9A 4NGAH 4B2CA 3A8DA 2CXVA 1NN6A 4NFEA 2ZFPH 1AGJA 2H5CA 1Y3WA 3D62A 2WPJS 3PMBB 4Y71A 1DANH 2FOBA 1GI3A 5FCKA 1YPGH 1GVLA 3Q3XA 4FU7A 1SOZA 3VG8A 1UTMA 1ZTJA 2XCFA 2UUYA 1TNLA 4A5TS 3RU4D 3FZDA 4I33A 1MTUA 5E0JA 1GMDF 3N99A 2J98A 2IN2A 4Y11E 2A5KA 4MLFB 2VIVA 4A92A 1N6YA 2VB0A 2ZECA 2ZWLH 3SU4A 2A1DB 3Q3YA 1VKYA 1C1TA 1QL7A 1GGDB 1P3EA 1W0ZU 1SQAA 2W6ID 7KMEH 3P8FA 2Y81A 5ESTE 4OGYA 1GI1A 3GCHC 1BTZA 3FKSD 1A7SA 1CSOE 1Z7KA 3V12A 1GJ8B 1DPOA 1ZRKA 1O3HA 4ZUHA 2C3SA 1NFXA 1C2EA 1LKBA 1UJ1A 2QF0A 1O3IA 5DK1A 2BDGA 4B74A 4IS5A 3BEFB 3GYMA 1C4Y2 1C5XB 1FPCH 1U6QA 5FPSA 4DOQA 2XTTB 5ESBA 3MMGA 3RXGA 1AB9B 1DM4B 1C5LH 1C1UH 2EC9H 1ESAA 4K60A 2A7HA 1A2CH 1VCPA 1TIOA 1TRMA 2ZU4A 3T2NA 3SJ9A 1CGJE 5C5OA 1B5GH 3QGJA 4U2WA 3WWFA 4CRAA 2FX4A 1TNIA 1AE8H 3QK1A 1BHXB 2J92A 1K28D 1W0YH 3FP8E 4X2WA 4ZCNA 4BANB 3NPSA 2JJ2D 3KL6A 4X1SU 2VIDA 4TSFD 2SGFE 1XM1A 1C1SA 3BF6H 1VZQH 3E8LA 1BJUA 4X1PU 5HM2A 4CREA 2BX3A 4MG3A 1V6DA 1QBVH 1RTLA 1Q31A 2GCHF 3S69A 3ZVGA 1LO6A 3TJVA 3K6ZA 1TNHA 1DT2A 1P3CA 1O2ZA 4B73A 3UY9A 1GMHG 2AMPA 1XKBC 1O5DH 2CHAB 5EJZA 2XW9A 1DLEA 4J1YA 1BMFD 2OBQA 3E16B 2BVRH 2ZHFH 3LDXH 3LGUA 1C5TA 1LKAA 5JYIA 2FOMB 2ANMH 1P10A 3O8CA 2PSXA 1THSH 4X6NA 5LH8A 3BTGE 1FMGA 3A7XA 1EP5A 2OBOA 4E7RG 3SBKA 4FUGA 1TRYA 1HJAC 3WY8A 1G30B 1SLUB 2AMQA 1EB1H 3QO6A 1GG6C 3LJJA 3NK8A 2LP6A 3A8AA 1HGTH 1KXAA 1XVOA 5C20A 1QR3E 2Y7ZA 3M3TA 4JZ1A 1HFDA 2BDYA 2FOEA 3AW0A 3E0PB 1WSSH 3TH4H 1ZMNA 2GGVB 2Z9JA 5DG6A 2AH4X 2BD9A 1MZAA 3M7QA 1KXCA 2EEKA 3GCTG 3UFAA 1TGTA 5EGMA 1IQHA 1GCTB 5GCHF 3OAAD 1EJMA 1GJ4H 5DP7A 3RLWH 5A09A 4MQAA 3RC6A 5DJ7A 1OS8A 3LGWA 1WV7H 4H4FA 2O8WA 3U69H 3PV2A 1T32A 1FJSA 1EPTA 1A0LA 1WUNH 1T4VH 2HWLB 5FCRA 5T6GA 1GMDG 2SGDE 1XMNB 1MKWK 2F9VA 1J17T 2FP7B 2XYAA 1JMOH 1GDNA 4AYVB 1NO9H 3BG4C 4JYUH 7LPRA 3ITIA 1J8AA 1GI2A 1PPFE 3TIUA 5PTPA 3SHCH 4NA8A 1QJ1B 2K1QA 3SJ8A 2Y5HA 3U8TH 1AI8H 1QFKH 2R2MB 1BTPA 3SW2B 2AFQB 1FLEE 1QL9A 3F1SB 3ZZ8A 1DDJA 1AMHA 4OS7A 2BDIA 1ELBA 3GDUA 1P2JA 1HJ9A 2B5TB 1ELGA 2JDID 2RA3A 2PP6A 1P0SH 2BVSH 4D9QA 2QV1A 2ALVA 2XWBI 4FVDA 3K6YA 3SV9A 1OWJA 2GMTC 1NRRH 1EUFA 4WVPE 3LGYA 1FI8A 1FY5A 2KM0A 4AORA 2V35A 3BTME 3SNAA 2QXIA 4INLA 3UPEA 1UTJA 1GI4A 3KQBA 1H8ED 3MO6A 1A1RA 3F2GA 2YNBA 1PPHE 3MFJA 4XBCA 3TITA 1Y5UT 4B2AA 1V2MT 2YNAA 1A0HB 1MBMA 2OINA 4O3UA 1NM6A 2RDEA 1BJVA 1NRQH 2A2QH 1GI9B 3A7WA 4I8HA 3RMNH 1V2KT 4MNVA 5A0AE 2GCHG 4HG6A 4BTUB 2HRVA 4WJG2 1C5RA 5DP6A 5L30H 1NRSH 4WH8A 4DGJA 2PR3A 4Q80A 3AW1A 1LHDH 3PWBA 3UQOA 5C2ZA 1TPOA 3MTYA 1FUJA 3FN8A 3D65E 1VITH 2RG3A 4Y0YE 1EZUC 2AGEX 3A8BA 1EOLA 3RC5A 3TK5A 4F4OC 3A82A 1HAVA 1O5BB 2WPDD 1QJ6B 1W7XH 2OC7A 4OS6A 3T62A 4TPIZ 1O33A 2VWMA 3BTKE 4YOGA 2BQ7B 1ZTKA 1HAZB 1Y3VA 1O36A 1O3NA 1RFNA 1RXPA 1TPSA 1VR1H 5AFYH 4D9RA 2W5EA 3DD2H 1P2IA 1Y3UA 1EOJA 3DT0H 4Y8YA 1MAYA 3SNCA 2XBVA 1AD8H 2W7UA 1UVSH 3FOAA 3I78A 4AB9A 3N7DA 1O31A 5GNDA 1BTXA 1EJAA 2PLXA 2BTCE 3ENSB 1DX5M 1P02A 4INHA 5EQQA 3SUDA 4XE4A 1JIMA 4DIIH 7GCHG 1QB6A 1FZZA 3RUOA 3V0XA 3RMOH 1KTTB 1CA8B 2PUXB 2VGCB 5C17A 1TWXB 3RC4A 3LU9B 1O2JA 1TMUH 2CJIA 3KIDU 1BA8B 2GCTB 2XCNA 1N6XA 1AVXA 1Z1IA 3M5OA 1E34B 1X7AC 2P3FH 4AFQA 1BUIA 2P3UB 4ACAA 1H8DH 1UCYE 1BB0B 3F9GA 3NZIA 2VNTA 3Q3KA 1SHYA 2TIOA 4RN6A 4O3TA 1JOUB 2QIQA 4NCYA 1GI6A 1DSUA 3C1KA 1QA0A 3LGTA 3EDXB 2SNWA 1MABB 1LHCH 2PTNA 1SR5C 2STAE 2V7QD 4FOUC 5GJ4B 3OU0A 3PTBA 2EQNA 3LGVA 3QZRA 3ODDA 1QB9A 2FEQH 3RMLH 2QA9E 1JRTA 3JZ1B 3MI4A 3SOSA 1E36B 1E35B 2BHGA 4X8SH 2BD5A 1O2VA 3DUXH 4K1EA 3SU0A 1L1GA 1O0DH 2R0KA 4TWYA 2G00A 2Z3EA 4JK6A 5HXFA 4RSPA 3WWBA 3UNRA 3Q76A 1W12U 1MU8B 1W11U 2BY8X 4WH6A 3TJNA 5C0TA 2FODA 5CHAC 3UIRA 2ESTE 2O8UA 3A80A 2A2XH 2PGBB 1ELCA 1Z8RA 1GBEA 1RIWC 3TH2H 4X6OA 1GBCA 3QLPH 4RT1A 1Y3YA 4XBBA 1HJ8A 2R2WU 1HAPH 2HLDD 3AAUA 1BMLA 2ZPSA 1LHGH 1P8VC 3HGNA 1FPHH 3T27A 1H4WA 2Y80A 1DE7H 1FY1A 4SGBE 2Y7XA 2BY7X 1O39A 1HCGA 2OXSA 4H42U 3P8NA 2KX4A 4AZ2B 4Y76A 3SGQE 1KXBA 3MH6A 2G5VA 1RD3B 2GTBA 1TPAE 1E38B 5A8ZA 1PYTC 1JBUH 2WPLS 3M3VA 2PKSB 1CU1A 2Z9LA 5KECA 1EAUA 3A8CA 4ISNA 1BBRE 1MU6B 1QB1A 2V0BA 3CENA 1ETTH 6CHAC 2ZHQH 1C1NA 1PPZA 4WXVA 1O37A 3KQCA 3ZVBA 3PM3A 2H9HA 3ZYEA 3EGKH 2C8YB 3BTHE 3ODFA 5L2ZH 3L33A 1TPPA 4FXGH 1O3LA 1FXYA 3MU8A 1MKXH 4Q63A 3UR6A 3CS0A 1HBTH 1AWHB 3GCHB 2QCYA 5EXNA 3T29A 2ZI2H 2ZZUH 4UFEH 1TX6A 4R0IA 4UDWH 2VIQA 2BD2A 2KCPA 1AFEH 5K0HA 1WTHD 4AG1A 1SG8B 5C1XA 2ZC9H 4HZHA 3JZ2B 1AUTC 2DE9A 1XUIA 3SGAE 3LJOA 4I7YH 1GI8B 5E2PA 1T4UH 1CO7E 3T26A 1EAWA 4YZUA 2CGAA 1JRSA 4HI3A 3MU5A 5KGOA 3M5LA 4JCNA 4RKOB 5C0UA 2EY4C 1O2IA 1HAHH 3MHWU 3MNCA 3RDZA 4AC9A 1UVOA 3CNRA 4O97A 3E3TA 1P2NA 4LXBH 2ANYA 1ZMJA 2AERH 1UCYH 1YP9A 1MH0A 1BIOA 1S6LA 2FLBH 1DWDH 2AS9A 1C1VH 5CE1A 1YWUA 2IJD1 1C2JA 1PFXC 3P6ZB 2VWOA 4MNYA 5HM9A 2FO9A 2BD3A 3EA7A 1Y3XA 2F43B 3RXMA 5E0GA 3QX5H 1OP8A 1LVMA 1SOTA 1GBFA 3VXFH 3OTPA 1YLDA 1YPMH 5TJXA 5B6LA 2R3YA 3ZZ6A 2KCOA 2P93A 4RT0A 1BCUH 1DLKB 4U01A 5DP8A 5EPNA 1OPHB 2XBWA 1FV9A 2FOFA 1F5KU 1G36A 1ZLRA 4XFQA 1SL3A 3DCLA 1UK2A 1D3DB 1SB1H 5EOKA 1SLXB 3SU6A 2ZCKP 1O5EH 2OLGA 1YLCA 1SGDE 1DICA 1FIWA 1YF4A 1DXPA 3ATIA 2PW8H 2RCEA 3DA9B 4BXWA 2UUFB 1HV7A 1TONA 1YPHE 4DY7B 1ZPCA 3VGCC 1FNIA 1HJAB 3SU3A 2XOKD 2D8WA 3OX7U 1F2SE 3PYHA 1O2QA 8GCHF 5LGOA 2A7JA
chains in the Genus database with same CATH topology
4MPUA 1V2PT 4UONA 1KLJH 4ZMAH 5GXPA 1WBGB 5LPRA 4ZHLU 4NIXA 1PPEE 1NPMA 4OGXA 1BBRH 1G2MA 2FOCA 3UOPA 5AF9H 1WU1A 1IOEA 3T28A 1TBQH 1E37B 3UWJH 1O2MA 3UUZA 2WPHS 5JBBS 6GCHG 1FAKH 2FM2A 2PKSC 1BRBE 4BTIB 5I25A 4IMZA 2H2ZA 2C8WB 3BN9A 1AE5A 1VITF 1QTFA 4NA9H 3UNSA 4FVBA 1QL8A 1PPGE 1GHAG 4DCDA 4OS1A 4IN2A 2J94A 5HYOA 1QJ7B 1LVOA 3MU0A 4IW4E 1D4PB 2Q6FA 4CHAB 3P95A 1SGCA 3QDZB 3LIWA 5TCCA 2AGGX 1PQ7A 2PKAB 4FU8A 4AFZA 3BG4B 1ZJKA 2P8OB 1QBOA 1BTUA 1YC0A 3GY6A 2G5NA 3HK3B 1AWFH 5C1YA 3V13A 1Z8GA 3E1XB 2KAIB 1UVPA 1C1MA 2A4GA 2Z9IA 1O3OA 1QRWA 3NXPA 4FUJA 3A89A 3RXUA 1C5WB 1A0JA 5E2OA 3TGKE 1F92A 2PHBA 3C27B 3EA9A 1FQ3A 1O3JA 1OX1A 1V2VT 1YPEH 4CRBA 1Q3XA 2SGEE 2UWPA 3QN7A 1DUEA 3ZZCA 2B0FA 1AVWA 2NU1E 1SGIB 2XXLA 3IITA 2H5DA 1EASA 3B23B 2GMTB 2Z9KA 3NCLA 1LVBA 5EW1H 1VGCC 4UD9H 1C2KA 1HRTH 3TLOA 1J9CH 1P2OA 1A5HA 5EODA 2IPHA 1SGEE 3T25A 3RXTA 1KLTA 2FS9A 2BOKA 2ZHDA 4I8LA 1C2HA 5FBIA 1CHGA 3PLPA 1LQEA 3A7VA 1QA7A 4AGJA 1NT1A 3GY3A 4BAOB 1W8BH 3P92A 1BRAA 1FN8A 2VWLA 1O3BA 1C1QA 4GSOA 3IWMA 1SGFA 1SPJA 3RXQA 4CR9A 2ZDNA 1P05A 4K1SA 3GCOA 1L4DA 4X1QU 2UUJB 1FN6A 2FDAA 4XOJA 3U8OH 4TWWA 5GPIB 3TH3H 3MO9A 3BEUA 2QXHA 3H7TA 3LH3A 1FY3A 1H1BA 3PMHB 1P12E 3AAVA 4ZH8A 3VB7A 3PTNA 4UEHH 2UWLA 3ZVAA 5HGGA 3TK6A 4FUIA 1D3PB 3MH5A 3SNDA 3RP2A 2W3IA 1C5NH 4KELA 1V2RT 2Z9GA 5E0HA 2F9BH 3SV8A 3STJA 2ZKSA 1P2MA 2XC4A 3RXOA 8LPRA 2AMDA 1GVZA 3MWIU 1OWIA 1OP2A 4ZKOU 1AU8A 5FBEA 1GBTA 5HMAA 8GCHG 4UE7H 5L6NH 1NTPA 1GCDA 2BQWB 1N8OC 3FAOA 1TGBA 1NC6A 1SVPA 3H7OA 1HPGA 4KKDA 1ZSLA 3SHAH 1O3MA 3RXBA 1B0EA 1GL1A 3QUMP 1OWEA 4JZIA 1AZZA 3P70B 3PROA 2PSYA 4WF8A 2ILNA 4X8TH 3SUGA 1QIXB 1IHSH 2OTVA 3OSYA 1GL0E 4FUHA 3IG6B 3FANA 6LPRA 4F49A 3M7UA 1CT0E 1Z6EA 2WYGA 1VITG 1OYTH 1O38A 2AYWA 2BOHB 5DPAA 3TJUA 4GAWA 4CHAC 1SGYE 1YPLH 1BTYA 1DVAH 1QY6A 1C2LA 1ELDE 2P8OC 3LONA 4OS5A 3RXKA 4LK4A 1Y8TA 2BZAA 2VIOA 3B9FH 1TOMH 2ASUB 5FAHA 4JMYA 4E05H 3A83A 2VVCA 1QBNA 1P01A 1MD7A 4DJZB 1LCYA 2CF8H 1SGNE 2JETC 2QY0B 2I6QA 3ZZDA 4BTTB 1QNJA 3BTFE 2P95A 4A1XA 4MPXA 1CT2E 1L2EA 1MD8A 2H1UA 3CS7A 4I31A 2F9NA 4Q7XA 1F5RA 4NSVA 2OQUA 1S83A 1ZPZA 5CHAB 4KP0A 1ARCA 4Y8XA 2FXRA 1Z1JA 2JH0D 1RIWB 3HK6B 2F9OA 2B7DH 1GBMA 3VFEA 1F7ZA 1OOKB 2UUKB 1G37A 3BTDE 4YLQH 3SV2H 4ZKSU 2ANWA 1CE5A 3V7TA 3T5FH 2BZ6H 4QT8C 2XRCA 3VB6A 1AKSB 3KN2A 2GT7A 1D6RA 1GHYH 2FESH 2ZGBH 4ASHA 5FPTA 4YOIA 3SU2A 1Y5BT 4YO9A 3O8DA 3ZV9A 1EKBB 1TA2A 3GY2A 1EPTC 3EAJA 4XSKU 1AZ8A 4TY7A 3VB4A 1ANBA 3A86A 1HUTH 1KDQB 1TBRH 1W13U 4AN7A 2BX4A 6CHAB 1PQ5A 3PV4A 4YESB 1O32A 3RM0H 3E0NB 3M36A 3AVZA 2HALA 4YT7H 3S9CA 4NZQA 2FMJA 4ISIH 1K1PA 3MH4A 3SU1A 2C8ZB 1UMAH 3MU1A 2BD7A 1DS2E 2VIPA 1RTFB 9LPRA 3E90B 4ZROA 1SC8U 1T8LA 4CBOA 2TGAA 1IQMA 1GJCB 5FX5A 4GLYA 3U1IB 4CRGA 4ABDA 5JDUB 2WPIS 1KTSB 3URCA 2WUBA 3SU5A 2ZFFH 3RXLA 3LC5A 1PPBH 1T31A 2FI4E 1MCTA 1Y5AT 5EXMA 1NRNH 1EB2A 4K2YA 1SSXA 3GY4A 1C5SA 3QGNB 3N7OA 1O2XA 6ESTA 1BITA 1C4V2 1ZHPA 3KCGH 2OD3B 2G4UA 2ZDKA 3NWUA 5F8ZA 1V2ST 1CHOF 1UTNA 3UQVA 5F6MA 3TGIE 1EATA 2AIQA 3M3SA 1GJ9B 3L3TA 1UTKA 1IAUA 1JXPA 1ESTA 1BMNH 1B7XB 1P2QA 5A8XA 1C5ZB 3PLBA 1QQUA 2R3UA 2ZF0H 1ZR0A 5GCHG 1N1LA 1O2TA 1NFYA 4IMQA 1C2FA 1GHVH 3HPTB 4DT7B 1V2LT 2EA3A 3KGPA 3GISB 1SI5H 3RXPA 2HVXA 3ELAH 1SGTA 1SHHB 4Y8ZA 1GPZA 4SGAE 5T3HA 1NS3A 2XC0A 5F8TA 1O2RA 4Y10E 2FX6A 5A2MH 1QCPA 3LOXA 2FWWA 2WV4A 4AFUA 1LHEH 1KDQA 1YCPH 1XXDA 2BVXH 1ARBA 4IN1A 4GPGA 1YGCH 3S9AA 1HAOH 2G4TA 4MTBA 4B75A 1WTGH 2BDAA 1K22H 1MAXA 2NU2E 1TNJA 1CT4E 2SFAA 1ELVA 4JYVH 3S7HB 1UHBB 1XUGA 3A87A 3KHVA 1P2KA 1ORFA 2H9TH 8KME2 2GV6A 3RXCA 4ISOA 1TA6A 4A7IB 3E91A 1IQEA 3VGCB 1MQ5A 4B76A 4NSYA 4BAQB 3B8JA 2W7SA 4CBNA 4JZFH 2BLOA 2ZEBA 2HLCA 3ZZ4A 3ZVEA 2WUCA 1P03A 1JIRA 3ZZ9A 3HATH 1OKXA 2J4IA 1CA0C 3KNXA 1GMCF 5EXLA 1K21H 2BDCA 4MNXA 2ZGXH 3A7ZA 3RMMH 1DWCH 1C1PA 2O9QA 1O3KA 1ELAA 1LVYA 2VJ1A 3GDVA 3ATWA 1FONA 1TMBH 2OC8A 2B8OH 3GCNA 4ZHAA 2Z94A 3S0NA 2QC2A 5GIBA 1HB0B 1INCA 2V3OH 3F9FA 4NA7A 3A7YA 9ESTA 3M35A 1ZSKA 3ATMA 4IC6A 2ZA5A 3TVJB 1K1NA 3PB1E 4J2YB 1J15A 5T6DA 1Q2WA 1HYLA 4GVUA 3E6PH 4K5ZA 1C1WH 2VH6A 1SFQB 1QRXA 2ANKH 1LPKB 1ELEE 3RXSA 2ODYB 3SV6A 4HTCH 4K69A 1ZYOA 1BZXE 3OY5U 2G52A 4FUCA 1C5YB 4INKA 5EPYA 1ELTA 5LPFA 2C93B 5F03A 3LT3A 3SJOA 4Z6AH 4LZ1H 1AFQC 1FY8E 1A4WH 2J38A 4WMFA 5J4SA 2ZGHA 1IQNA 1DWBH 1SGRE 2ZCHP 1H9LB 1C5VA 3SI4H 2QGRA 3SV7A 4AG2A 3U98H 2C90B 2BLWA 5JBAS 1GWAA 5DP4A 1HAIH 4X8UH 2B9LA 3UNQA 3SJIA 1S6HA 4XDEA 2VH0A 5ABWA 3FP7E 3AASA 3S7KB 1QQ4A 3MYWA 3UWIA 3RXEA 1GDQA 2BM2A 1HIAB 4JZEH 1KIGH 1SBWA 1A5IA 1HNEE 2Z3DA 1CHOG 2OC1A 1MQ6A 1O2NA 5H4IB 1XX9A 1VGCB 2A4RA 4X1RU 4Q7YA 4D7GA 4ZHMU 4WWYA 4U30A 1LPGB 3PLKA 3MH7A 4TYDA 5FPYA 1EZSC 5SGAE 3KQDA 1O3FA 4CRDA 3BSQA 1RJXB 1P57B 1UCYK 2A0QB 2A5IA 4UFDH 3MO3A 2TBSA 1AQ7A 4I8KA 2VIWA 3TJOA 1S6FA 1SMFE 2ZDVH 1O3AA 2ZHWH 1F5LA 4AOQA 3OYPA 1A61H 1GJ7B 1IQKA 4A1VA 3RU4T 1AUJA 4FUFA 4M7GA 2CMYA 1E0FD 1PJPA 2P94A 1KY9A 3SNBA 4WXIA 4MPVA 5C3NA 1ACBE 3EYDA 1GMHF 1OWDA 4DVAU 2LNCA 4X2VA 4IGDA 2GZ8A 2O8TA 1KXDA 1ANCA 1SFIA 2F9PA 2ZU1A 3VB3A 4JK5A 3RXAA 3O8RA 2TGPZ 1C2GA 2ZNKH 2BXUH 3BTTE 4ZKRU 4ABFA 2F83A 3VPKA 1ZZZA 1BHXF 5FX6A 3SZNA 1UTQA 2BLVA 2SGQE 4DW2U 2ZFQH 1CBWC 1TGCA 2SGPE 5E8EH 3GY8A 1KSNA 4OS2A 1WQVH 2M5TA 1ZOMA 1GHZA 2BDBA 1WAYB 2XWAA 1IQIA 1N8OB 1GHXH 2PGQB 3ZZ5A 1GMCG 3DFJA 1RTKA 3HKJB 1LHFH 4BAKB 2FOAA 1ELFA 1GHBF 1O2OA 1SLVB 2ZTYA 3P8GA 1BBRK 4Z0KA 2CN0H 1SLWB 2V3HH 3RM2H 4TY6A 3GCTF 4KTUA 1UVUH 1VJ9U 4WY3A 1D6WA 5GDSH 1VCWA 1TYNA 1GBJA 4K8YA 4CH8B 2ZTXA 5BRRE 5IDKA 3A88A 1JWTA 1GI5A 1O3EA 3D49H 2BB4A 3HGPA 4NFFA 2DE8A 4JZDH 1H9IE 1O5GH 3F68H 1P9UA 4KGAA 1WYKA 1XVMA 2ZGJA 1O2KA 1UK4A 1KXFA 2GV7A 4FUEA 3SQHE 3UREA 2VINA 1H9HE 2JETB 1XXFA 1PYTD 1S5SA 3ZV8A 2VWNA 1C5PA 4ZXYH 1GDUA 2FI3E 3M5NA 1K1JA 1MTNC 1FY4A 4BXSA 5EQRA 4I8JA 2G81E 5F8XA 4ZKNU 4A6LA 1B0FA 1Z71A 3BIVH 4VGCC 1P04A 3BTQE 2VVUA 1MTVA 1EAIA 1TB6H 1TRNA 2ZU2A 2FIRH 1C2IA 1EZQA 5ETXA 1SGFG 1ESBA 1GBKA 1FIZA 1SQOA 1G9IE 2ZCLP 2TRMA 4NG9H 1RGQA 4H6TA 2ZDAH 5I46H 1V2UT 3QTOH 1MTWA 2GZ7A 1W10U 1GI7B 2A31A 2A7CA 1QRZA 2FTMA 1IQLA 1MUEB 3Q00A 1PQAA 1ZRBA 1FAXA 5EQSA 2P3TB 1V2NT 2JH5D 5K7RA 2HNTF 1DUAA 1AIXH 4K8BA 2ZPRA 1EPTB 1O2PA 3ATKA 3EA8A 3F9EA 5EU8A 4D8NA 1M9UA 4CH2B 1C1OA 4X2XA 2D2DA 1TGNA 2Y82A 2CF9H 3R0FA 3U1JB 5T6FA 2ZO3H 5EG4A 2ZFSA 1K9OE 5TCAA 4IBLH 1CGIE 1NY22 3Q77A 4YM9A 1EJNA 1YPHC 1NU7B 4YLUA 4Y7BA 3LH1A 2ZPQA 3EE0B 2A32A 4X1NU 4ZAEA 1V2OT 1MBQA 2OP9A 2GP9B 1Z8JB 3BTEE 1EAXA 1IHTH 2Q6GA 1DY9A 2HGTH 2PKAA 3TNTA 3RXFA 4GHTA 2QN5T 2GX4A 1EXFA 2F9UA 1TQ7B 1ID5H 4AYYB 1HAGE 2ODPA 2HOBA 1QGFA 1GVKB 2KAIA 1T8MA 2PUQH 4K1TA 1LDTT 1UTOA 3PO1C 2RDLA 4AFSA 1MTSA 2G51A 1O2GH 3GY5A 5AHGH 2G8TA 2TPIZ 2FTLE 1S81A 3K9XB 4X6MA 1SQTA 2GKVE 1ANDA 1ETRH 1XUKA 3ESTA 1WQSA 1AHTH 2TGDA 3RXHA 2ZQ2A 4AGKA 1GBAA 3OTJE 2Y5FA 1CGHA 1BDAA 4FUBA 4ISHH 3R3GB 5JBCS 1Z8IB 5DO4H 1XUJA 1KYNA 3W94A 2PV9B 1GBLA 1HLTH 5C1UA 1NU9A 1UTLM 1XUFA 2ZGCA 2PFEA 4B71A 1Y59T 1GHBG 2D1JA 1O2HA 7GCHF 3SUEA 1GHWH 5DGJA 1CVWH 5EW2H 2Q1JA 4B1TA 1NRPH 1TAWA 2BQ6B 1FDPA 1MKWH 1T8OA 2VVVA 1TX7A 3A7TA 3VXEH 1LQDB 2EI6A 2ZDLA 1HAXB 1XKAC 5JB9S 2AEIH 4ZXXH 1GJ6A 2WPKS 2A4QA 2YOLA 3RXJA 1A3EH 2GDDA 2ZDMA 1V2QT 4O03A 3RXDA 5C67A 1GGDC 1K1OA 1J14A 1G3DA 4YT6H 2ZFTA 2XNIA 2J95A 2WPMS 3VEQB 2XBYA 1P09A 1TNKA 2ULLA 4E7NA 4LOYH 1L4ZA 5DP9A 1SGPE 3A81A 3DFLA 1XUHA 1HAVB 1DITH 1NROH 2IJOB 2J9NA 2O8MA 2RA0A 2FOHA 2QAAA 1LTOA 5G4BA 4NIWA 5BPEA 1AN1E 2ZG0H 1O2UA 1PQ8A 2IOTA 1AY6H 3O8BA 3MU4A 1O34A 1NFWA 1K1MA 1YYY1 2OC0A 1C9TA 4HGCA 3SGBE 2Y5GA 3TGJE 2HNTE 5DKMA 1AB9C 3FVFB 2V6NA 2EI7A 4UFGH 1RRKA 1HXEH 5FXLA 1CA0B 4JYTA 3BTWE 2GZ9A 1BT7A 4CRCA 1ZSJA 4Y7AA 2NU4E 2ALPA 4X6PA 3RU4E 2THFB 1QHRB 3FFGA 3ZZBA 1AO5A 1HXFH 1F0UA 3RXIA 2G55A 1G2LA 3MOCA 4YOJA 4NZLA 4FUDA 2LPRA 2BLQA 1O2WA 2Z6BD 2BMGB 4GCHF 4MDSA 3STIA 1BMMH 2QXGA 5GWZA 1CQQA 4MNWA 2GT8A 1L1NA 1GJDB 3TPIZ 1G3EA 3SI3H 3