5A0BA

Crystal structure of human neutrophil elastase in complex with a dihydropyrimidone inhibitor
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
218
structure length
215
Chain Sequence
IVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords NEUTROPHIL ELASTASE
publication title Freezing the Bioactive Conformation to Boost Potency: The Identification of BAY 85-8501, a Selective and Potent Inhibitor of Human Neutrophil Elastase for Pulmonary Diseases.
pubmed doi rcsb
total genus 43
structure length 215
sequence length 218
ec nomenclature ec 3.4.21.37: Leukocyte elastase.
pdb deposition date 2015-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5a0bA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5a0bA02
2O9QA 1O2OA 1ACBE 1BUIA 1PPGE 2J9NA 4U30A 1LTOA 2AERH 4X2VA 1P04A 2P3TB 3A7YA 4DIHH 1P09A 1GDUA 2VWOA 1AVGH 4JZIA 3EA7A 3SZNA 4GHQA 3BTTE 2QA9E 4YOGA 2STAE 4Y79A 4A1TA 4U2WA 2B7DH 3SUGA 1W7GH 1BCUH 4H6SB 4WMDA 5CHAB 2FMJA 3SNDA 1O3FA 1NESE 2QXJA 1GMCG 1A46H 3UQOA 4U01A 1BB0B 4I8GA 3BG4C 4CR5A 1S0RA 4KTCA 1Y59T 3RU4D 3F9EA 5K0HA 1NU9A 1A5IA 1KY9A 1OPHB 5AVDA 4VGCC 4Y6DA 2H1UA 2OP9A 5JPMH 1V2QT 1NRNH 4BAHB 1FPHH 1GJCB 2ANMH 3EE0B 2BY9X 1GMDG 2FLBH 1PFXC 2BLQA 3MWIU 1P10A 2HPQH 1EB2A 1V2MT 1SGTA 1OS8A 3RXSA 4NZQA 4ABJA 4X8TH 1AKSA 1SFQB 4D7FA 4A5TS 2V35A 3ATLA 1DDJA 1ZSJA 1O35A 1TPSA 3LGUA 3RXHA 3GCTG 1GBIA 4AFQA 2FX6A 3U69H 1P06A 3ZVCA 5A2MH 1QL7A 2BY6X 2ZGCA 1O3NA 1O34A 1W0YH 1ZR0A 1O2RA 1SGQE 1J9CH 1EP5A 5A8XA 1SGNE 3GYLB 2YOLA 1FY8E 1GJ4H 2HRVA 1W2KH 3NKKA 4K1TA 3IG6B 2WPLS 1BTXA 2AIPA 3SV8A 1DWBH 1DPOA 2PKAB 4D9RA 2FX4A 3DHKH 4IC5A 1HLTH 4M7GA 2QIQA 3A7ZA 4FUGA 1MD8A 3H7TA 1DS2E 5L30H 1ZGVA 1CO7E 4UFFH 1KXAA 2FOEA 2WPHS 1HUTH 3A84A 1FNIA 4Y8YA 1P3CA 2Z7FE 3TIUA 3RXDA 1FN8A 5C3NA 3BTME 2ZQ2A 1YLDA 4HFPB 1AUTC 2A5IA 4MQAA 2SGPE 1V2RT 3SV9A 1P2OA 1GBMA 4UONA 2G81E 3FP8E 3U98H 1CBWC 2OINA 2A31A 3P8FA 2F9BH 2UWOA 1IAUA 2J94A 1NROH 3C27B 1AGJA 2FZZA 1C5XB 1SQTA 2HALA 1HV7A 2VVUA 3DD2H 2CF9H 1CA8B 4O3UA 1TQ0B 3Q3KA 1GI6A 1WAYB 4SGAE 5EXNA 1EZQA 1KXBA 3KEEA 1W12U 3TU7H 3RXRA 3RXLA 1AO5A 3RXQA 3SJIA 1CHOF 3ZZ9A 3DUXH 3SORA 1LHFH 2JETB 3GCHC 4CREA 1VJ9U 1OX1A 2W5EA 4X8SH 4I7YH 1NU7B 1ARCA 1QBNA 2CV3A 1ELEE 3MU1A 2Y80A 3UY9A 1SPJA 1MTUA 3SU4A 1CVWH 4WMFA 2WV5A 4H6TA 2ZDNA 5E2OA 1SFIA 4BOHA 3EGKH 1FJSA 4B75A 1C2HA 1HAXB 1OWJA 2A5AA 2F91A 1ANCA 1S6HA 2VGCB 4D9QA 4I8KA 2FIRH 4Z0KA 1F2SE 1MCTA 3RXEA 4DCDA 3OY5U 1TNJA 1THPB 1E0FD 2ZFRH 1GJ5H 4JK6A 2C3SA 4CRDA 1DLEA 2ZFFH 3LGWA 1GHAF 3SJ9A 1D6WA 3E6PH 1P11E 5DP3A 1FUJA 5CE1A 2QCYA 1UK2A 3TH4H 1L4ZA 3ZZ6A 1C5TA 3ODFA 2RA0A 1MZAA 2ZU2A 2FP7B 1HIAA 3S9BA 1G37A 2GCHF 2PGBB 2YNBA 5G4BA 3SOSA 3ZVFA 2ZTYA 2QN5T 3Q77A 5DPAA 4Y8ZA 4FUDA 4GUXA 1S83A 4B2CA 1H9IE 3NK8A 3BEUA 4X6NA 1G3BA 2FODA 2BVSH 2BZAA 3LGTA 3G01A 3RXKA 4A6LA 3AVZA 1XUGA 1WUNH 1UTPA 1ANBA 1Y5BT 2AMDA 5C2ZA 3M3SA 1SGFA 3S7KB 1XM1A 2TRMA 1DXPA 4Y8XA 3RLWH 1KTSB 1O3IA 5FHTA 4QT8C 3MNXA 3F6UH 1O3BA 2ZI2H 1W0ZU 3GY3A 3VPKA 1BJVA 2PLXA 3S0NA 1ZHMA 6CHAB 2W7SA 2A4RA 1O2PA 1YPHC 1UTMA 1PPBH 2GX4A 2PHBA 3AW0A 2A4QA 4NZLA 1BJUA 1GI4A 1TE0A 4IN1A 4ZHAA 3A8AA 3RM2H 5IDKA 1WU1A 3TLOA 2VWMA 2G00A 4THNH 3VB5A 5A0BA 5FCRA 1FY5A 3QUMP 1NC6A 1AY6H 2ALVA 3C1KA 3CP7A 2G52A 2PKSC 1UCYK 1UVUH 2J34A 1SGRE 4NWKA 3RXMA 3CS0A 5BPEA 1GHWH 3RXAA 2FOBA 3D49H 1GVZA 3VB6A 3MTYA 1ZZZA 5JB8S 1QURH 1VITF 1V2TT 1KXCA 3QDZB 4XBCA 4MDSA 4KKDA 1VGCC 1AVWA 1OYQA 3KQCA 8LPRA 1HXFH 3UR9A 3PMAB 1NPMA 3B23B 1K22H 1MU6B 3A89A 3ZVAA 4AB8A 4IC6A 2ANKH 2AMPA 1QGFA 3KQBA 3ZVGA 1TIOA 1O5EH 1TWXB 1YPMH 2ZTZA 1TMUH 1SLVB 3PMBB 4ISNA 1GBCA 1XKBC 1QB6A 1MU8B 1TBQH 2AFQB 3SGAE 2FTLE 5E2PA 2TGDA 4A92A 1P02A 1IQFA 8ESTE 1GPZA 4BTIB 1LPZB 3ZZCA 3QO6A 1IHTH 2PSYA 2PSXA 1O2GH 4I33A 1C1SA 1NTPA 3VGCB 3TGJE 1KXEA 1S5SA 1C5QA 2ODPA 3D62A 4IS5A 2LNCA 4Y0ZE 1AFQC 1SLXB 1UCYH 4X1NU 1NM6A 1FIWA 3B8JA 1K28D 5FPYA 2PFEA 2I6SA 1CHOG 2TIOA 2Z94A 4ZMAH 4X1QU 2ASUB 5FPSA 2FOHA 1TMBH 1MQ6A 3SU6A 1UTQA 3ESTA 1QBVH 1Z8IB 2Y7XA 1P57B 1D3DB 2ILNA 1T32A 2F83A 5EOKA 5K7RA 2A45B 3QX5H 3AAVA 1AMHA 2P59A 1UTNA 1NS3A 3STIA 2WV4A 4UD9H 1GMDF 2F3CE 1F7ZA 1UJ1A 1EAXA 5ESTE 1XUJA 1T8NA 1O3AA 5C20A 1AE5A 1SSXA 3SN8A 1FI8A 3PMHB 2PUXB 1GHAG 2VU8E 3U8OH 2P3FH 1X7AC 2ZPQA 4ZKRU 4NA8A 5HYOA 3A7WA 1CA0C 1F0UA 3E8LA 1RIWB 1BRUP 4TPYA 8GCHF 3ZYEA 2BDHA 2O8WA 4D76A 1T7CA 1XMNB 2GCHG 3SQEE 3PYHA 3BTQE 1S85A 3GY5A 3RU4T 4YLUA 3EAJA 3ELAH 4YZUA 5DP4A 2Z6BD 1O2UA 1AN1E 1MD7A 1GHVH 2A4OA 2BTCE 1GBDA 5A0AE 2BX3A 4MNXA 1TA6A 3F1SB 3TJUA 3LOXA 1FQ3A 1FN6A 4DOQA 1O2LA 1V2KT 2NU4E 2SNVA 3M5NA 1V2ST 5C67A 1XUFA 1O5CB 1C1UH 3TVJB 3GDUA 1UVSH 1Q2WA 2VIPA 1UTKA 2V3HH 1TNLA 1KLJH 2ZHEH 1ESTA 5EPYA 3I29A 5DP7A 1BRCE 2ZU1A 4ABDA 5A8ZA 1O31A 3NCLA 3OY6U 3LJJA 4X8UH 1IQMA 3BEIB 2CGAA 3LONA 1O3KA 2FOMB 3QZRA 5GPIB 1AIXH 3O8RA 1HAGE 1HJ8A 1INCA 2XTTB 1Y5AT 1G30B 2ALPA 4MVNA 3T2NA 1OP2A 1A61H 1FZZA 2YNAA 2BY8X 2G5VA 4BTUB 2AGGX 4Y7AA 4KELA 1PYTD 1LKBA 1GBEA 4IN2A 2EC9H 1S81A 1E35B 3MH4A 1UMAH 1HAPH 1Q31A 3M5OA 2ZO3H 3O8CA 1BTUA 2W3IA 1VITG 1P2NA 1HYLA 3EDXB 4WVPE 4WXIA 2FEQH 1K1MA 4X6PA 4MPXA 5JBCS 4GLYA 4XE4A 4NFFA 4Y11E 4O03A 2FDAA 1LHDH 5EPNA 3PMJA 1AE8H 3RXTA 1XUHA 1GJ9B 2G5NA 3BV9B 3NPSA 3P70B 5DKMA 2OQUA 1ELVA 3ZVBA 1TPOA 3BN9A 4D7GA 3PWCA 2ZFTA 2CHAC 1EZUC 5EODA 1ZMJA 2RCEA 1C4U2 2UWPA 2FTMA 1HPGA 4BANB 1LHEH 3P6ZB 3UOUA 1V2LT 1GBTA 1QR3E 1ZSKA 1UVPA 1OSSA 4HZHA 3E16B 1K9OE 4X2WA 2ZECA 9ESTA 2BD5A 2VIQA 4GAWA 1Z8JB 2KAIA 1MTVA 4X2YA 1C5LH 2C93B 2STBE 2VH6A 1AWHB 2AS9A 2WPJS 2WYGA 5AF9H 2ZCHP 1GL0E 1GI7B 1RTKA 3E1XB 4MLFB 5TJXA 5DGJA 3MU0A 3BG8A 1E34B 1F0TA 1ZOMA 1RGQA 1Y5UT 5FXLA 5DK1A 1BTYA 3BG4B 1TALA 1C5SA 5JBBS 3T5FH 1AVXA 2A32A 1P8VC 1SMFE 5DP6A 3GY2A 4UDWH 2J4IA 4O3TA 2VIDA 4VGCB 3PO1C 2ZHFH 2XBWA 1O3EA 3SU1A 3TITA 1MKWK 1DLKB 1YCPK 4F49A 4A7IB 3UFAA 5EXLA 1A3EH 1C1MA 3QWCH 2NWNA 3RMLH 1ANEA 1CGIE 1G2LA 3E3TA 3GISB 3BEFB 4ABBA 1YC0A 8KME2 4K1SA 1MZDA 2HWLB 4O9VA 3DFJA 3FVFB 1O5GH 4Y76A 1PPZA 3MNSA 4Y0YE 4K2YA 1M9UA 2FI3E 2R9PA 4CHAC 1Z6JH 2TGAA 1DSUA 3K2UA 1SI5H 4OS5A 4BAKB 3PB1E 3PLBA 3SGQE 3QK1A 3RXVA 1V3XA 4Q80A 2HLCA 1TNIA 4WXVA 1P3EA 1T4VH 4NIXA 1TNGA 5ESBA 5LPFA 2G4UA 3SGBE 3M7UA 1C5PA 1ORFA 1O36A 1TPPA 1MCVA 1ELTA 1O37A 3LGVA 1QRZA 3KIDU 1WTGH 1G3EA 1V2PT 8GCHG 3TH3H 2KAIB 4K5ZA 3RMOH 1NY22 1O2XA 4RKJB 2JH5D 5DP5A 3KF2A 1H9LB 3BTKE 5GJ4B 1C5YB 1NFYA 1KDQA 1LVYA 4BXWA 3UIRA 1O3OA 3MH6A 1F5LA 5EG4A 1ZJKA 1YPJH 1K1OA 3UPEA 1GDQA 1MKWH 1YCPH 1SB1H 1GI2A 2QYIA 3IITA 1Z7KA 1TFXA 3TK6A 4AB9A 2OC1A 3KQDA 2CJIA 2W3KA 1CBWB 2EA3A 1D9IA 1C5VA 1ELGA 2B8OH 1SQOA 5EXMA 1B0EA 1OWEA 2ZFPH 4K8YA 1ETTH 2CF8H 3Q76A 1S82A 3K65B 3LH3A 4ABIA 1FAKH 1ESBA 5DG6A 3LIWA 3K9XB 3ZZ7A 4CRGA 2DUCA 3SI3H 1KLIH 1TOMH 2HPPH 5T6FA 1TPAE 3GCOA 5HM2A 2BQ6B 2H6MA 3GCHB 2GCTC 1LVMA 1A3BH 1C4V2 1K1IA 4I8JA 2O8TA 3Q3YA 2P3UB 1HAYB 5HXFA 3SUEA 4JYTA 2BX4A 1H8IH 2OCVB 2A2XH 2O8UA 4DURA 4WWYA 3KNXA 5JDUB 4WJG2 3BTDE 3QN7A 1AKSB 1SG8B 1GBBA 2GZ8A 5E8EH 3E91A 1EX3A 2W26A 3MU4A 3SI4H 1DOJA 1WYKA 3H7OA 3CS7A 4IW4E 3LKWA 2BYAX 4IBLH 4JYVH 3SU0A 1BITA 1T31A 4ISIH 1MTWA 1ELBA 2GKVE 5AFYH 2ODQA 3UUZA 1RS0A 1RFNA 4UFGH 4AORA 4WH6A 3SO3A 2ZU3A 2K1QA 4B73A 1JOUB 2GGVB 2ZNKH 1FAXA 1W8BH 1FY3A 2OC7A 2PV9B 4A1VA 5F8XA 1YGCH 2ANYA 5J4SA 1KDQB 1FLEE 4GHTA 2PGQB 1G2MA 1P2MA 1A4WH 1L2EA 3URDA 3SU3A 5EQRA 4DGJA 1JRSA 2OC0A 1TGNA 1G3CA 3A87A 3HATH 4AZ2B 1OWIA 3UNRA 2R3UA 1NN6A 3A82A 5ETXA 4DIIH 3TJOA 1DUEA 4JZ1A 3SNEA 1E37B 2V0BA 5DJ7A 3DFLA 1QJ6B 1GI9B 1O3HA 2ZEBA 1RTFB 1KTTB 1TNKA 5FPTA 1HB0B 4BAOB 1DWEH 3ATIA 4E7NA 1O32A 3M3VA 1E38B 4LXBH 3P92A 5L6NH 1AB9C 4NWLA 2SGAA 3B9FH 2B0FA 4HI3A 2ODYB 2QY0B 4YO9A 2Z3DA 1VITH 1DXWA 2A1DB 2Q6FA 2OLGA 4INLA 3PLKA 4CBOA 2QF0A 3FP7E 1MAYA 1N8OC 2QXGA 1GJ7B 1O2WA 2GP9B 1C9PA 1BBRE 2FESH 4Q2KA 3UWJH 3R3GB 6LPRA 2BDAA 4WY3A 1V2UT 3AAUA 3S9CA 3LDXH 4J1YA 1EPTC 2BM2A 3KHVA 1BTWA 2HGTH 1HRTH 1NO9H 2FOAA 4AFZA 2ZPRA 3P17H 2H5CA 1LDTT 5C5NA 2BD3A 2GDDA 1YPKH 1JRTA 1J15A 5GXPA 4DG4A 2H5DA 1C1WH 1P12E 2FI5E 2Y6TA 1HAIH 1A0JA 1ZRKA 2Q6DA 1HJ9A 2F9VA 1SGCA 1ZGIA 1PPHE 3MOCA 4ABFA 1GBKA 1ZYOA 1GI3A 1AWFH 1TAWA 3U8RH 1AUJA 1EJMA 3RU4E 4J2YB 1YYY1 2VWNA 3OU0A 2XWBI 4ISLA 9LPRA 2GMTC 4OGYA 1O5AB 4IGDA 4NIYA 2PKSB 3SU2A 3M61U 3VXEH 1S6FA 1NRQH 4TWYA 2BD2A 1Y3YA 2M5TA 2ZFSA 1BHXF 2THFB 2IPHA 1QNJA 1O3PB 2R3YA 1Y3VA 2BDYA 1C5OH 1MUEB 3MI4A 1Z8GA 1K1JA 3ZV9A 2BD9A 1O3GA 1VGCB 3PM3A 2XW9A 3GCNA 3RXCA 3HKIB 2ZGBH 5A09A 3T29A 1O2VA 3TNSA 3TGKE 3E0NB 3MO6A 4ISOA 4K3JA 1HIAB 1C5NH 4HGCA 3MH5A 1WTHD 4K69A 1CQQA 2VIOA 1QHRB 5EGMA 2A7HA 4YLQH 1HFDA 3A7TA 3BTEE 3VXFH 5FBIA 2ZA5A 1FMGA 1TNHA 2FYQA 4E05H 3HGPA 1THRH 3DA9B 4ZHLU 2C4FH 3I78A 3NXPA 1VCPA 3KGPA 3U9AH 1JWTA 2XWAA 3FANA 4FVBA 3TGIE 1O2QA 1DICA 1A0HB 3M7QA 4Q7XA 1O2IA 3ATKA 4BAQB 2NU2E 4ZKNU 1QRXA 1C2GA 4UE7H 3RXJA 1O2TA 2FS9A 4FUIA 1NRRH 3RMNH 2O8MA 1AZZA 2VB0A 2ZGHA 1EAWA 1XX9A 1BQYA 1GGDC 2BDIA 4H4FA 1AFQB 1V2NT 1PQAA 2V6NA 1RD3B 1LVBA 2B9LA 2AIQA 3P95A 3UR6A 2FXRA 3RXUA 4E7RG 2C8YB 1DY9A 3HK6B 2HNTF 1GCDA 3SNBA 1C2LA 5AHGH 3A7XA 3RC6A 2ZDMA 2Y5HA 4KP0A 4B2BA 2Y5GA 3TK9A 1O30A 1HXEH 2BQWB 1ELAA 2V3OH 4JCNA 1UVTH 1LQEA 3BIVH 3OX7U 2QV1A 1YPEH 4LK4A 1W3CA 1O2KA 1TRYA 1LKAA 4DY7B 2G8TA 1QTFA 3SJKA 1O2MA 1BT7A 1W13U 1S84A 2P93A 3VEQB 2ZDKA 3K6YA 2JH6D 3BTGE 1XVMA 3LT3A 5TCAA 3O8BA 1TBZH 3VB4A 1AQ7A 4YM9A 2I6QA 1O3JA 1KLTA 1SOZA 1TRNA 1UTJA 3V12A 1W14U 3L6PA 1P0SH 4ZHMU 4NCYA 1C1OA 1J16A 4O97A 4IMQA 5E0JA 2Z9LA 2VNTA 3RXBA 2ESTE 1DE7H 1CA0B 1YM0A 2GZ9A 1L0ZA 2D1JA 4MNWA 2A2QH 2ZCLP 2WPIS 4OS7A 4XBBA 2ZGJA 3EQ0H 1FY4A 1UTOA 2TBSA 1K1LA 2JKHA 2UUKB 5ABWA 3SV2H 1BTZA 1WQVH 1LHGH 3MU5A 1QB1A 5JBTA 1G9IE 1FY1A 1H4WA 2ZDVH 3AASA 1VZQH 1MMJN 1F5KU 1B5GH 4ZAEA 2SGFE 1SQAA 3L33A 1QA0A 4TPIZ 1C2KA 3ZZAA 5JB9S 3ZZDA 1YPGH 1MKXK 3GDSA 1C2MA 1RTLA 2IN2A 3JZ2B 3MFJA 1UHBA 2HNTC 1HAHH 4MPVA 1L1NA 3A8BA 3UWIA 5FAHA 2GZ7A 1Z1JA 1C4Y2 1IHSH 1GHXH 3GY8A 3T62A 1PPEE 2J2UA 1WCZA 1PQ8A 4Y71A 5A0CA 3ENSB 4X0WU 3FZZA 1ARBA 3P8NA 4AFSA 1HJAC 1MTNC 2H9TH 4WF8A 1F92A 2GT7A 2VH0A 2EEKA 4JK5A 1SL3A 4K8BA 1HBTH 2Q1JA 2XC0A 4AG2A 3E0PB 1GJ8B 3S7HB 1G36A 2CXVA 2XYAA 4FUEA 1PPCE 1SGDE 1A5GH 1NZQH 3KCGH 1DX5M 2BY7X 2SGDE 1V6DA 2B5TB 3ZV8A 3RXGA 4AN7A 1IQHA 1J17T 2FO9A 1BOQA 1EJAA 1SBWA 1ZHRA 4F4OC 1GG6C 4OGXA 1IQNA 2VVCA 4AFUA 4NG9H 4OS2A 2R2WU 1CSOE 2QAAA 5A8YA 6GCHF 1MH0A 1DUAA 4YOJA 2ZU5A 1OP0A 3RM0H 3QLPH 1ZMNA 1DANH 4JZFH 1W11U 2ZU4A 1HNEE 3RXOA 1HAVA 2HNTE 1ID5H 3T28A 4FU9A 1A0LA 2J38A 3F68H 1MKXH 2PW8H 1ZMLA 1T8OA 1FPCH 3UOPA 2P94A 3MNBA 1BMAA 1TQ7B 3RP2A 3NUMA 1TGCA 3P8GA 1GCTC 1V2WT 2OBOA 1HCGA 4INKA 2BZ6H 4OS6A 1C1PA 1T8MA 3UNSA 4ABAA 4ZKOU 1KIGH 3RMMH 1QL9A 2ZKSA 3K6ZA 1SHYA 3SUFA 1UHBB 2CHAB 3GY7A 1A2CH 3H5CB 4UFDH 1C2JA 1BTPA 5C1XA 2ZP0H 1P2JA 3TJNA 2OC8A 1C5MD 1GBAA 2OTVA 1O3DA 3L3TA 3M3TA 4LOYH 4NIWA 1ELCA 4ZROA 3LPRA 4KTSA 1EAUA 1S0QA 2BQ7B 1BBRH 1T8LA 1EZXC 1TGTA 2IOTA 1XUIA 1DWCH 2SNWA 3OSYA 2P8OC 2ZF0H 1QRWA 1KXDA 1W10U 4XFQA 4FUJA 3UREA 2FYRA 3TH2H 3UTUH 1HGTH 1GMHF 3GY6A 3T27A 4ABEA 2WPMS 2P95A 1GBJA 2UUYA 1P2KA 1BMLA 1C5UA 2XC4A 2XNIA 3MO3A 5F6MA 1WQSA 4JYUH 2BDBA 4K1EA 2FLRH 1GJ6A 2FM2A 1PQ7A 3BSQA 3KQEA 1EXFA 1UVOA 1O39A 1QBOA 3LC3A 1D3QB 1YP9A 1DY8A 1HAVB 5T6DA 1EJNA 1AHTH 1GVKB 2BDGA 3W95A 3RXPA 1DT2A 4CHAB 1SC8U 1C5ZB 2ZDAH 2QC2A 2BD7A 4AYYB 4GSOA 4BNRA 1HAZB 3M5LA 1GBHA 1O2JA 1GI8B 2PKAA 4X6MA 1B0FA 3LJOA 2DE8A 1ABJH 5GDSH 3SBKA 3RDZA 1N6XA 3ZZ3A 1TRMA 1ZPCA 2PTNA 2QGRA 3RC5A 1XVOA 3QZQA 3SJ8A 3FP6E 2NU0E 2OD3B 2XCNA 1TBRH 4XDEA 3U8TH 1THSH 5C1YA 1GHZA 3KN2A 4K60A 2PTCE 3STJA 1ANDA 3N7OA 1TX8A 1Y3WA 2ZIQH 3GDVA 5GCHF 4LZ4B 3NWUA 1BTHH 1TABE 1GDNA 1UCYE 3BF6H 4TYDA 1CT0E 1EAIA 3A8CA 5FX5A 1YBWA 1XXDA 2Y82A 5CHAC 2GV6A 2PWXA 1GJBB 1UK3A 1SLUB 1TA2A 1EB1H 4D8NA 4FUHA 2H2ZA 4H42U 2VIVA 2BLWA 2F9PA 3VFEA 1QQUA 1DFPA 1TOCB 1SHHB 2FS8A 4FUFA 1NRPH 2P16A 4YTAA 3RXFA 1RXPA 4YT7H 1FV9A 1O0DH 1PYTC 1LO6A 2SFAA 3QTOH 3U1IB 1MAXA 1SGYE 1OXGA 3U1JB 1OYTH 4GVUA 1B7XB 2VWLA 3ZYDA 5L2YH 2GCTB 1SGPE 3F9GA 2XCFA 5LPRA 1FXYA 1OP8A 1KYNA 4UEHH 5T6GA 2J92A 2OQ5A 1C2FA 1VCQA 5PTPA 4AG1A 3NZIA 5LGOA 4ZH8A 2XXLA 3MU8A 3EYDA 1Z6EA 2ZTXA 4GCHF 2WPKS 3A81A 1SLWB 2ZPSA 1AZ8A 1C1VH 1EPTA 4INHA 3LH1A 4R8TB 4GPGA 1O3LA 5B6OA 1DITH 3T25A 1L4DA 2XBXA 1OWKA 3SUDA 4FUCA 2BLOA 1RJXB 2BY5X 3VB3A 1O2NA 2C8ZB 2HVXA 4X2XA 1NFXA 2Y81A 4TY7A 6GCHG 4X8VH 2UUFB 4LZ1H 1SOTA 2NU3E 3MMGA 2Z3EA 4CRCA 3SV7A 2WUCA 5T3HA 3SNCA 1GI0A 4ABHA 1P05A 3IWMA 7KMEH 1QB9A 3SV6A 1Y8TA 2D26C 1OOKB 1QY6A 1Y3XA 1D3TB 2W7UA 3OTJE 3PLPA 1LPKB 4X1PU 5AFZH 2Z9KA 4MTBA 4NSYA 1ESAA 4CBNA 5CMXH 5E0HA 1TX6A 3BIUH 1XKAC 4NA9H 5EW1H 1P9SA 2BD8A 1WV7H 1P2QA 3FAOA 7ESTE 5I25A 3V13A 4X1RU 1AB9B 1ELDE 1UO6A 1H8DH 1DSTA 5F8ZA 2ZWLH 3S69A 2HOBA 3PV4A 2RG3A 1WOFA 3RXIA 1LQDB 2G55A 2G51A 2A0QB 1ELFA 1N8OB 1VCWA 2JETC 1IQIA 4KTUA 1C1NA 5EQQA 2AGIX 1Z1IA 4B1TA 2ZCKP 2A7CA 1L1JA 3PTBA 2FI4E 1GHBF 1MTSA 2XBYA 1GMHG 2XBVA 5L2ZH 1EPTB 1QL8A 4YESB 1NT1A 3ZVEA 3ATMA 4U32A 1QCPA 1O5BB 2OXSA 4HTCH 7GCHF 3A85A 3M36A 4MPUA 1Z71A 1CT4E 2GDEH 4NSVA 3BTWE 1DVAH 2QF3A 1O2HA 1TLDA 2VGCC 3D23A 4CRBA 6ESTA 3PTNA 4XOJA 3QGNB 5DO4H 4YOIA 1JIRA 4AOQA 4OS1A 1ZLRA 5HGGA 1EP6A 1Y3UA 5C5OA 3QGJA 5JBAS 1RRKA 1NRSH 3A83A 2AMQA 1BRBE 4IMZA 2GMTB 1AFEH 1JBUH 1IQGA 4MG3A 4ZXYH 3F9HA 1F0RA 2OUAA 3W94A 2ZDLA 1LMWB 1VJAU 1UTLM 1ZSLA 5DP8A 4DJZB 3HGNA 1OWDA 2BXUH 1K21H 1G3DA 2F9NA 4ZKSU 3Q00A 1BRAA 3M37A 3GYMA 1C1RA 5JYIA 2ULLA 2A7JA 4AGKA 2ZHWH 2GT8A 1FONA 2BVXH 3F9FA 1O5DH 3KL6A 2BB4A 3TNTA 3QTVH 1AI8H 3TJVA 1OWHA 3LU9B 2FWWA 2EI6A 2XC5A 2G4TA 5GCHG 2ZFQH 1V2VT 1EASA 5TCCA 3A80A 1E36B 3RLYH 5FCKA 1XXFA 3ODDA 2RA3A 1NFWA 3OYPA 5I46H 1UK4A 2BHGA 1Q3XA 2A5KA 4R0IA 4ZUHA 2D8WA 5GWZA 4CH2B 4E06H 1QJ7B 1YF4A 2Z9JA 1ZTKA 2SGEE 2O8LA 4ABGA 3SNAA 1O2SA 1IQEA 1D3PB 1SGEE 2ZQ1A 1K2I1 2GTBA 1GHYH 1K1PA 3MNCA 3PWBA 6CHAC 1JMOH 4B74A 1TGBA 3ZZ8A 1LVOA 1GGDB 1GBFA 1H9HE 1CT2E 4B76A 1C2DA 2QXHA 1Z8RA 2WINI 2IJOB 2NU1E 2GVFA 1P9UA 3SHCH 4AGJA 4B71A 2TGTA 3M7TA 1YLCA 1TMTH 2PR3A 4RN6A 4TWWA 2R2MB 1N6YA 1EOLA 1BA8B 2C90B 1O33A 2BMGB 2ZZUH 1BDAA 1U6QA 2AEIH 1FIZA 2H9HA 1ZHPA 3ZZBA 1PQ5A 2LPRA 1F0SA 4GCHG 3S9AA 3A7VA 2F9OA 1MBQA 3MHWU 3UNQA 1CE5A 2ZG0H 3V3MA 1CGHA 1BHXB 2AYWA 1YPHE 5FX6A 2PUQH 3SW2B 4MPWA 3RC4A 3T26A 4JMYA 4JZDH 2R0KA 1TB6H 1C5RA 4NIVA 1IQJA 4WH8A 1ETSH 5BRRE 1O2YA 1AU8A 4TY6A 2Z3CA 4ASHA 1EUFA 3WY8A 3LGYA 3A86A 2EI8A 5C1UA 2AH4X 3JZ1B 1DM4B 1H1BA 3BTHE 4NFEA 4WMEA 1EQ9A 5EW2H 1V2JT 5H4IB 1CHGA 4I32A 1A5HA 2WUBA 1GJDB 1ZTLA 2QXIA 3DT0H 4PROA 4Y10E 2Z9GA 2BOKA 4AYVB 1AD8H 2BDCA 3UQVA 1ABIH 4OS4A 4UFEH 3GICB 1GWAA 1GL1A 4X6OA 5F03A 2CMYA 1KSNA 1GBLA 4RSPA 1C2IA 1TYNA 2JH0D 2A4GA 2R0LA 1BMMH 4I31A 3V7TA 4CH8B 3VGCC 1ZPZA 4BAMB 3CENA 2AGEX 1TONA 3Q3XA 4JZEH 3FFGA 1GMCF 2D2DA 5LPEA 2BLVA 1ZJDA 5SGAE 2Y7ZA 2DE9A 5EQSA 4AX9H 1YKTA 2EI7A 1EKBB 1SR5C 2H9EH 4NA7A 1NFUA 3SHAH 2VVVA 3LGIA 4DVAU 1IOEA 1GVLA 4ESTE 4XSKU 4CRFA 1O3CA 1GHBG 1F5RA 2BXTH 3MYWA 1W7XH 1BIOA 1IQLA 1O3MA 1PPFE 1P03A 3E90B 7GCHG 7LPRA 1HJAB 1MTNB 3VB7A 1ETRH 2FOGA 4KGAA 4FU8A 3GCTF 4Z6AH 4RKOB 2ANWA 1QQ4A 1CGJE 1WBGB 1MBMA 1HDTH 2Y5FA 4CRAA 3SJOA 2BVRH 1YPLH 2VINA 1C1QA 3I77A 3HPTB 4ZXXH 1DWDH 5F8TA 1O38A 3ZZ5A 4B2AA 4ISHH 2FPZA 1QJ1B 5DP9A 5LH8A 1GJAB 2FOFA 1C5WB 2RDLA 2XRCA 1VR1H 2VJ1A 3LC5A 1V2OT 4I8HA 4FU7A 3ATWA 5HMAA 1GG6B 2C8WB 1RIWC 4A1XA 3P8OA 1XUKA 1GI5A 2Q6GA 1C2EA 1ZPBA 1LPGB 1BBRK 3ITIA 3URCA 1YCPM 2J95A 3EA9A 4YT6H 1EOJA 4SGBE 3TPIZ 1O2ZA 2FOCA 1SGFG 1SVPA 5FBEA 3MH7A 3MO9A 4FVDA 1JIMA 1GCTB 1WSSH 1A1RA 3FZDA 1O5FH 1GI1A 1C1TA 1G32B 3ZVDA 2TPIZ 3RUOA 3EA8A 1QA7A 3R0FA 4MNYA 1MQ5A 1ZRBA 1BMNH 1J8AA 4Q7ZA 2WYJA 3M5MA 2GV7A 1IQKA 2SGQE 3SQHE 1QFKH 1OKXA 2ZHQH 3BTFE 1C9TA 1PJPA 3GOVB 3A88A 1T4UH 3A8DA 3O8DA 5HM9A 4I8LA 4DT7B 4NGAH 1EZSC 1K1NA 2P8OB 3ZZ4A 2UWLA 4MNVA 3V0XA 3D65E 1JXPA 1LCYA 2ZHDA 4FXGH 5GIBA 2OBQA 1ZTJA 2BOHB 2TGPZ 3AW1A 1QIXB 2VIWA 5J4QA 2C8XB 2F9UA 1D6RA 1P01A 1P2IA 3HKJB 5EU8A 4BTTB 3SU5A 1FDPA 3GY4A 1KXFA 1LHCH 4BXSA 1SGIB 1BZXE 1TX7A 1EATA 1L1GA 4CR9A 3PROA 4DW2U 2CN0H 4X1SU 2ZGXH 5IYTA 2UUJB 1CU1A 2GD4B 2Z9IA 1J14A 1TGSZ 4XBDA 4FUBA 1HAOH 3PO1B 1A7SA 2ZC9H 4Q7YA 4Y7BA 5E0GA 3M35A 3TK5A 2BD4A 3HK3B 1D4PB 1N1LA
chains in the Genus database with same CATH superfamily
2O9QA 1O2OA 1ACBE 3ZIAD 1BUIA 1PPGE 2J9NA 4U30A 3DSPA 1LTOA 2AERH 4X2VA 1P04A 2P3TB 3A7YA 4DIHH 1P09A 1GDUA 2VWOA 1AVGH 4JZIA 3EA7A 3SZNA 3MQKC 4GHQA 3BTTE 2QA9E 4YOGA 2WZQA 2STAE 4Y79A 4A1TA 4U2WA 2B7DH 3SUGA 1W7GH 1BCUH 4H6SB 4WMDA 5CHAB 2FMJA 3SNDA 1O3FA 1NESE 2QXJA 1GMCG 1A46H 3UQOA 4U01A 1BB0B 4I8GA 3BG4C 4CR5A 1S0RA 4KTCA 1Y59T 3RU4D 3F9EA 5K0HA 1NU9A 1A5IA 1FX0B 1KY9A 1OPHB 4VGCC 5AVDA 4Y6DA 2H1UA 2OP9A 5JPMH 1V2QT 1NRNH 4BAHB 1FPHH 1GJCB 2ANMH 3EE0B 2BY9X 1GMDG 2FLBH 3WWBA 1PFXC 2BLQA 3MWIU 1P10A 2HPQH 1EB2A 1V2MT 1SGTA 1OS8A 3RXSA 4NZQA 4ABJA 4X8TH 1AKSA 1SFQB 4D7FA 4A5TS 2V35A 3ATLA 1DDJA 1ZSJA 1O35A 1TPSA 3LGUA 3RXHA 3GCTG 1GBIA 4AFQA 2FX6A 3U69H 1P06A 3ZVCA 5A2MH 1QL7A 2BY6X 2ZGCA 1O3NA 1O34A 1W0YH 1ZR0A 1O2RA 1SGQE 1J9CH 1EP5A 5A8XA 1SGNE 3GYLB 2YOLA 1FY8E 1GJ4H 2HRVA 1W2KH 3NKKA 4K1TA 3IG6B 2WPLS 1BTXA 2AIPA 3SV8A 1DWBH 1DPOA 2PKAB 4D9RA 2FX4A 3DHKH 4IC5A 1HLTH 4M7GA 2QIQA 3A7ZA 4FUGA 1MD8A 3H7TA 1DS2E 5L30H 1ZGVA 1CO7E 4UFFH 1KXAA 2FOEA 2WPHS 1HUTH 3A84A 1FNIA 4Y8YA 1P3CA 2Z7FE 3TIUA 3RXDA 1FN8A 5C3NA 3BTME 2ZQ2A 1YLDA 4HFPB 1AUTC 2A5IA 4MQAA 2SGPE 1V2RT 3SV9A 1P2OA 1GBMA 4UONA 2G81E 3FP8E 3U98H 1CBWC 2OINA 2A31A 3P8FA 2F9BH 2UWOA 1IAUA 2J94A 1NROH 3C27B 1AGJA 2FZZA 1C5XB 2K8IA 3KQ5A 1SQTA 2HALA 1HV7A 2VVUA 3DD2H 2CF9H 4TSFD 1CA8B 4O3UA 1TQ0B 3Q3KA 1GI6A 1WAYB 4SGAE 5EXNA 1EZQA 1KXBA 3KEEA 1W12U 3TU7H 3NRLA 5GNDA 3RXRA 3F2GA 4M9FA 3RXLA 1AO5A 3RXQA 3SJIA 1CHOF 3ZZ9A 3DUXH 2KFWA 3SORA 1LHFH 2JETB 3GCHC 4CREA 1VJ9U 1OX1A 2W5EA 4X8SH 4I7YH 1NU7B 1ARCA 2M2AA 1QBNA 2CV3A 1ELEE 3MU1A 2Y80A 3PRDA 3UY9A 1SPJA 1MTUA 3SU4A 1CVWH 4WMFA 2WV5A 4H6TA 2ZDNA 5E2OA 1SFIA 4BOHA 3EGKH 1FJSA 4B75A 2RDEA 1C2HA 1HAXB 1OWJA 2A5AA 2F91A 1ANCA 1S6HA 2VGCB 4D9QA 4I8KA 2YMSC 2FIRH 4Z0KA 1F2SE 1MCTA 3RXEA 4DCDA 3OY5U 1TNJA 1THPB 3U28C 1E0FD 5KGOA 2ZFRH 1GJ5H 4JK6A 2C3SA 4CRDA 1DLEA 2ZFFH 3LGWA 1GHAF 3SJ9A 1D6WA 3E6PH 1P11E 5DP3A 1FUJA 5CE1A 2QCYA 1UK2A 3TH4H 5CDFE 1L4ZA 3ZZ6A 1C5TA 3ODFA 2RA0A 1MZAA 2ZU2A 2FP7B 1HIAA 3S9BA 1G37A 2GCHF 2PGBB 2YNBA 5G4BA 3SOSA 3ZVFA 2ZTYA 2QN5T 3Q77A 5DPAA 4Y8ZA 4FUDA 4GUXA 1S83A 2QE7D 4B2CA 1H9IE 3NK8A 3BEUA 4X6NA 1G3BA 2FODA 2BVSH 2BZAA 3LGTA 3G01A 3RXKA 4A6LA 3AVZA 1XUGA 1WUNH 1UTPA 1ANBA 1Y5BT 2AMDA 5C2ZA 3M3SA 1SGFA 3S7KB 1XM1A 2TRMA 1DXPA 4Y8XA 3RLWH 1W0KD 1KTSB 1O3IA 5FHTA 4QT8C 3MNXA 3F6UH 5FL7D 1O3BA 2ZI2H 1W0ZU 2VBCA 3GY3A 3VPKA 1BJVA 2PLXA 4B6EA 3S0NA 1ZHMA 6CHAB 2W7SA 1YWUA 2A4RA 1O2PA 1YPHC 1UTMA 1PPBH 2GX4A 2PHBA 3AW0A 3PV2A 2A4QA 4NZLA 3KYGA 1BJUA 1GI4A 1TE0A 4IN1A 4ZHAA 3A8AA 3RM2H 5IDKA 1WU1A 3TLOA 5C0UA 2KCPA 2VWMA 2G00A 4THNH 3VB5A 5A0BA 5FCRA 1FY5A 3QUMP 1NC6A 1AY6H 2ALVA 3C1KA 3CP7A 2G52A 2PKSC 1UCYK 1UVUH 2J34A 1SGRE 4NWKA 3RXMA 3CS0A 5BPEA 1GHWH 3RXAA 2FOBA 3D49H 1GVZA 3VB6A 3MTYA 1ZZZA 5JB8S 1QURH 1VITF 1V2TT 1KXCA 3QDZB 4XBCA 4MDSA 4KKDA 1VGCC 1AVWA 1OYQA 3KQCA 8LPRA 1HXFH 3UR9A 3PMAB 1NPMA 3B23B 1K22H 1MU6B 3A89A 3ZVAA 4AB8A 4IC6A 2ANKH 2AMPA 1QGFA 3KQBA 3ZVGA 1TIOA 1O5EH 1TWXB 1YPMH 2ZTZA 1TMUH 1SLVB 3PMBB 4ISNA 1GBCA 1XKBC 1QB6A 1MU8B 1TBQH 2AFQB 3SGAE 2FTLE 5E2PA 2TGDA 4A92A 1P02A 1IQFA 8ESTE 1GPZA 4BTIB 1LPZB 3ZZCA 3QO6A 5C94A 1IHTH 2PSYA 2PSXA 1O2GH 4I33A 1C1SA 1NTPA 3VGCB 3TGJE 1KXEA 1S5SA 1C5QA 2ODPA 3D62A 4IS5A 2LNCA 4Y0ZE 1AFQC 1SLXB 1UCYH 4X1NU 1NM6A 1FIWA 2KZ4A 3B8JA 1K28D 5FPYA 2PFEA 2I6SA 1CHOG 2J97A 2TIOA 2Z94A 4ZMAH 4Q4LA 4X1QU 2ASUB 5FPSA 2FOHA 1TMBH 1MQ6A 3SU6A 1UTQA 3ESTA 1QBVH 3UAIC 1Z8IB 2Y7XA 1P57B 1D3DB 2ILNA 1T32A 2F83A 5KEDA 5EOKA 5K7RA 2A45B 3QX5H 3AAVA 1AMHA 2P59A 1UTNA 1NS3A 3STIA 2WV4A 4UD9H 1GMDF 3EE7A 1OHHD 2F3CE 1F7ZA 1UJ1A 1EAXA 5ESTE 1XUJA 1T8NA 1O3AA 5C20A 1AE5A 1SSXA 3SN8A 1FI8A 3PMHB 2PUXB 1GHAG 2VU8E 3U8OH 2P3FH 1X7AC 2ZPQA 4ZKRU 4NA8A 5HYOA 3A7WA 5DSFA 4ASUD 1NBME 1CA0C 1F0UA 3E8LA 1RIWB 1BRUP 4TPYA 8GCHF 3ZYEA 2BDHA 2O8WA 4D76A 1T7CA 1XMNB 2GCHG 3SQEE 3PYHA 3BTQE 1S85A 3GY5A 3OEED 4YLUA 3EAJA 3ELAH 4YZUA 5DP4A 3RU4T 2Z6BD 1O2UA 1AN1E 1MD7A 1GHVH 2A4OA 2BTCE 1GBDA 5A0AE 4F48B 3WWFA 2BX3A 4MNXA 1TA6A 3F1SB 3H09A 3TJUA 3LOXA 1FQ3A 1FN6A 4DOQA 1O2LA 1V2KT 2NU4E 2SNVA 4RT1A 3M5NA 1V2ST 5C67A 1XUFA 1O5CB 1C1UH 3TVJB 3GDUA 1UVSH 3W1EA 1Q2WA 2VIPA 1UTKA 2V3HH 1TNLA 1KLJH 2ZHEH 1ESTA 5EPYA 3I29A 5DP7A 1BRCE 2ZU1A 4ABDA 5A8ZA 1O31A 1E1QD 3NCLA 1SQRA 3LJJA 3OY6U 4X8UH 1IQMA 3BEIB 3DCLA 2CGAA 2J5UA 3LONA 1O3KA 2FOMB 1SKYE 3QZRA 1AIXH 5GPIB 3O8RA 1HAGE 3SYJA 1HJ8A 1INCA 1MABB 2XTTB 1Y5AT 1G30B 2ALPA 4MVNA 3T2NA 1OP2A 1A61H 1FZZA 2YNAA 2BY8X 2G5VA 4BTUB 2AGGX 4Y7AA 4KELA 5B6LA 1PYTD 1LKBA 1GBEA 4IN2A 5HKKD 2EC9H 3F2HA 1S81A 1E35B 3MH4A 1UMAH 1HAPH 1Q31A 3M5OA 2ZO3H 3O8CA 1BTUA 2W3IA 1VITG 1P2NA 1HYLA 3EDXB 4WVPE 4WXIA 2FEQH 1K1MA 4X6PA 4MPXA 5JBCS 2RFKC 4GLYA 3OEHD 3FKSD 4XE4A 4NFFA 4Y11E 4O03A 2FDAA 3F2FA 1LHDH 5EPNA 3PMJA 1AE8H 3RXTA 1XUHA 1GJ9B 2G5NA 3BV9B 3NPSA 3P70B 5DKMA 2OQUA 1ELVA 3ZVBA 1TPOA 3BN9A 4D7GA 3PWCA 2XOKD 2ZFTA 2CHAC 1EZUC 5EODA 1ZMJA 2J98A 2RCEA 1C4U2 2UWPA 2FTMA 1HPGA 4BANB 1LHEH 3P6ZB 3UOUA 1V2LT 1GBTA 1QR3E 1ZSKA 1UVPA 1OSSA 4HZHA 3E16B 1K9OE 4X2WA 2ZECA 9ESTA 2BD5A 2VIQA 4GAWA 1Z8JB 2LP6A 2KAIA 1MTVA 4X2YA 1C5LH 2C93B 2STBE 2F4LA 1AWHB 2AS9A 2VH6A 2WPJS 2WYGA 5AF9H 2ZCHP 1GL0E 1GI7B 1RTKA 3E1XB 4MLFB 5TJXA 1E79D 2W6ID 5DGJA 3MU0A 3BG8A 1E34B 1F0TA 4P02A 1ZOMA 1RGQA 1Y5UT 5FXLA 5DK1A 1BTYA 3BG4B 1TALA 1C5SA 5JBBS 3T5FH 1AVXA 2A32A 1P8VC 1SMFE 5DP6A 3GY2A 4UDWH 2J4IA 4O3TA 2VIDA 4VGCB 3PO1C 2ZHFH 2XBWA 1O3EA 3SU1A 3TITA 1MKWK 1DLKB 1YCPK 4F49A 2OK5A 4A7IB 3UFAA 5EXLA 1A3EH 1C1MA 3QWCH 2NWNA 3RMLH 1ANEA 1CGIE 1G2LA 3E3TA 3GISB 3BEFB 4ABBA 1YC0A 8KME2 4K1SA 1MZDA 2HWLB 4O9VA 3DFJA 3FVFB 1O5GH 4Y76A 1PPZA 3MNSA 4Y0YE 4K2YA 1M9UA 2FI3E 2R9PA 4CHAC 1Z6JH 2TGAA 1DSUA 3K2UA 1SI5H 4OS5A 4BAKB 3PB1E 3PLBA 3SGQE 3QK1A 3RXVA 1V3XA 4Q80A 2HLCA 1TNIA 4WXVA 1P3EA 1T4VH 4NIXA 1TNGA 5ESBA 5LPFA 2G4UA 3SGBE 3M7UA 1C5PA 1ORFA 1O36A 1TPPA 1MCVA 1ELTA 1O37A 3LGVA 1QRZA 3KIDU 1WTGH 2HLDD 1G3EA 1V2PT 4P00A 8GCHG 3TH3H 2KAIB 4K5ZA 3RMOH 1NY22 1O2XA 4RKJB 2JH5D 5DP5A 3KF2A 1H9LB 3BTKE 5GJ4B 1C5YB 1NFYA 1KDQA 2XNDD 1LVYA 4BXWA 3UIRA 1O3OA 3MH6A 1F5LA 5EG4A 1ZJKA 4Q63A 1YPJH 1K1OA 3UPEA 1GDQA 1MKWH 1YCPH 1SB1H 1GI2A 2QYIA 3IITA 1Z7KA 1TFXA 3TK6A 4AB9A 2OC1A 3KQDA 2CJIA 2W3KA 1CBWB 2EA3A 1D9IA 1C5VA 1ELGA 2B8OH 1SQOA 5EXMA 1B0EA 1OWEA 2ZFPH 4K8YA 1ETTH 2CF8H 3Q76A 1S82A 3K65B 3LH3A 4ABIA 1FAKH 1ESBA 5DG6A 3LIWA 3K9XB 3ZZ7A 4ACAA 4CRGA 2DUCA 3SI3H 1KLIH 1TOMH 2HVYB 2HPPH 3OTPA 2V7QD 5T6FA 1TPAE 3GCOA 5HM2A 2BQ6B 2H6MA 3GCHB 2GCTC 1LVMA 1A3BH 1C4V2 1K1IA 4I8JA 2O8TA 3Q3YA 2P3UB 1HAYB 5C17A 5HXFA 3SUEA 4JYTA 2BX4A 1H8IH 2OCVB 2A2XH 2O8UA 4DURA 4WWYA 3KNXA 5JDUB 4WJG2 3BTDE 3QN7A 1AKSB 3DSGA 1SG8B 1GBBA 2GZ8A 5E8EH 3E91A 1EX3A 2W26A 3MU4A 3SI4H 1DOJA 1WYKA 3H7OA 3CS7A 4IW4E 3LKWA 2BYAX 4IBLH 4JYVH 3SU0A 1BITA 1T31A 4ISIH 1MTWA 1ELBA 2GKVE 5AFYH 2ODQA 3UUZA 1RS0A 2YMSB 1H8ED 1RFNA 4UFGH 5HIZA 4WH6A 3SO3A 2ZU3A 4AORA 2K1QA 4F55A 4B73A 1JOUB 2GGVB 2ZNKH 1FAXA 3VG8A 1W8BH 1FY3A 2OC7A 2PV9B 4A1VA 5F8XA 1YGCH 2ANYA 5J4SA 1KDQB 1FLEE 4GHTA 2PGQB 1G2MA 1P2MA 1A4WH 1L2EA 3URDA 1COWD 3SU3A 5EQRA 4DGJA 1JRSA 2OC0A 1TGNA 1G3CA 3A87A 3HATH 4AZ2B 1OWIA 3UNRA 2R3UA 1NN6A 3A82A 5ETXA 4DIIH 3TJOA 1DUEA 4JZ1A 3SNEA 1E37B 2V0BA 5DJ7A 3CNRA 3DFLA 1QJ6B 1GI9B 1O3HA 2ZEBA 1RTFB 1KTTB 1TNKA 5FPTA 3FN8A 1HB0B 4BAOB 1DWEH 3ATIA 4E7NA 1O32A 3M3VA 2KCYA 1E38B 4LXBH 3P92A 5L6NH 1AB9C 4NWLA 2SGAA 3B9FH 2B0FA 4HI3A 2ODYB 2QY0B 4YO9A 2Z3DA 1VITH 1DXWA 2A1DB 2Q6FA 2OLGA 4INLA 3PLKA 4CBOA 2QF0A 3FP7E 1MAYA 1N8OC 2QXGA 1GJ7B 1O2WA 2GP9B 1C9PA 1BBRE 2FESH 4Q2KA 3UWJH 3F0PA 3R3GB 6LPRA 2BDAA 4WY3A 1V2UT 3AAUA 3S9CA 3LDXH 2QF4A 4J1YA 1EPTC 2BM2A 3KHVA 1BTWA 2HGTH 1HRTH 1NO9H 2FOAA 4AFZA 2ZPRA 3P17H 2H5CA 1LDTT 5C5NA 2BD3A 2GDDA 1YPKH 1JRTA 2KM0A 1J15A 5GXPA 4DG4A 2H5DA 1C1WH 1P12E 2FI5E 2Y6TA 1HAIH 1A0JA 1ZRKA 2Q6DA 1HJ9A 2F9VA 1SGCA 1ZGIA 1PPHE 3MOCA 4ABFA 1GBKA 1ZYOA 5C0TA 1GI3A 1AWFH 1TAWA 3U8RH 1AUJA 1EJMA 3RU4E 4J2YB 1YYY1 2VWNA 3OU0A 2XWBI 4ISLA 9LPRA 2GMTC 4OGYA 1O5AB 4IGDA 4NIYA 2PKSB 3SU2A 3M61U 3VXEH 1S6FA 1NRQH 4TWYA 2BD2A 1Y3YA 2M5TA 1WDIA 2ZFSA 1BHXF 2THFB 2IPHA 1QNJA 1UW7A 1O3PB 2R3YA 1Y3VA 2BDYA 1C5OH 1MUEB 3MI4A 1Z8GA 1K1JA 5CHBA 3ZV9A 2BD9A 1O3GA 1VGCB 3PM3A 2XW9A 3GCNA 3RXCA 3HKIB 2ZGBH 5A09A 3T29A 1O2VA 3TNSA 3TGKE 3E0NB 3MO6A 4ISOA 4K3JA 1HIAB 1C5NH 4HGCA 3MH5A 1WTHD 4K69A 5EJZA 1CQQA 2VIOA 1QHRB 5EGMA 2A7HA 4YLQH 1HFDA 3A7TA 3BTEE 3VXFH 5FBIA 2ZA5A 1FMGA 1TNHA 2FYQA 4E05H 3HGPA 1THRH 3DA9B 4ZHLU 2C4FH 3I78A 3NXPA 1VCPA 3KGPA 3U9AH 1JWTA 3UB0A 2XWAA 3FANA 4FVBA 3TGIE 1VKYA 1O2QA 1DICA 1A0HB 3M7QA 4Q7XA 1O2IA 3ATKA 4BAQB 2NU2E 4ZKNU 1QRXA 1C2GA 4UE7H 3RXJA 1O2TA 2FS9A 4FUIA 1NRRH 3RMNH 2O8MA 1AZZA 2VB0A 2ZGHA 1EAWA 1XX9A 3FO8D 1BQYA 1GGDC 2BDIA 4H4FA 1AFQB 1V2NT 1PQAA 2V6NA 1RD3B 1LVBA 2B9LA 2AIQA 2V3MA 3P95A 3UR6A 2FXRA 3RXUA 4E7RG 2C8YB 1DY9A 3HK6B 2HNTF 1GCDA 3SNBA 1C2LA 5AHGH 3A7XA 3RC6A 2ZDMA 2Y5HA 5DN6D 4KP0A 1KMHB 4B2BA 2Y5GA 3TK9A 1O30A 1HXEH 2BQWB 1ELAA 2V3OH 4JCNA 1UVTH 1LQEA 3BIVH 3OX7U 2QV1A 1YPEH 4LK4A 1W3CA 1O2KA 1TRYA 1LKAA 4DY7B 2G8TA 1QTFA 3SJKA 1O2MA 1BT7A 1W13U 1S84A 2P93A 3VEQB 2ZDKA 3K6YA 2JH6D 3BTGE 1XVMA 3LT3A 5TCAA 3O8BA 2EY4C 1TBZH 3VB4A 1AQ7A 4YM9A 2I6QA 1O3JA 1KLTA 1SOZA 1TRNA 1UTJA 3V12A 1W14U 3L6PA 1P0SH 4ZHMU 4NCYA 1C1OA 1J16A 4O97A 4IMQA 5E0JA 2Z9LA 2VNTA 3RXBA 2ESTE 1DE7H 1CA0B 1YM0A 2GZ9A 1L0ZA 2D1JA 4MNWA 2A2QH 2ZCLP 2WPIS 4OS7A 4XBBA 2ZGJA 3EQ0H 1FY4A 1UTOA 2TBSA 1K1LA 2JKHA 2UUKB 5ABWA 3SV2H 1BTZA 1WQVH 1LHGH 3MU5A 5EIYA 1QB1A 5JBTA 1G9IE 1FY1A 1H4WA 2ZDVH 3AASA 4RI0A 1VZQH 1MMJN 1F5KU 1B5GH 4ZAEA 5IK2D 2SGFE 1SQAA 3L33A 1QA0A 4OM9A 4TPIZ 1C2KA 3ZZAA 5JB9S 3ZZDA 1YPGH 1MKXK 3GDSA 1C2MA 1RTLA 2CK3D 2IN2A 3GS9A 3JZ2B 3MFJA 1UHBA 2HNTC 1K0HA 1HAHH 4MPVA 1L1NA 2KCAA 3A8BA 3UWIA 5FAHA 2GZ7A 1Z1JA 1C4Y2 1IHSH 1GHXH 3GY8A 3T62A 1PPEE 2J2UA 1WCZA 1PQ8A 4Y71A 5A0CA 3ENSB 4X0WU 3FZZA 1ARBA 3P8NA 4AFSA 1HJAC 1MTNC 3OE7D 2H9TH 4WF8A 1F92A 2GT7A 2VH0A 2EEKA 4JK5A 1SL3A 1W0JD 4K8BA 1HBTH 2Q1JA 2XC0A 4AG2A 3E0PB 1GJ8B 3S7HB 1G36A 2CXVA 2QF5A 2XYAA 4FUEA 1PPCE 1SGDE 1A5GH 1NZQH 3KCGH 1DX5M 2BY7X 2SGDE 1V6DA 2B5TB 3ZV8A 3RXGA 4AN7A 5EJ1A 1IQHA 1J17T 4I86A 2FO9A 1BOQA 1EJAA 1SBWA 1ZHRA 4F4OC 1GG6C 4OGXA 1IQNA 2VVCA 4AFUA 4NG9H 4OS2A 2R2WU 1CSOE 2QAAA 5A8YA 6GCHF 1MH0A 1DUAA 4YOJA 2ZU5A 1OP0A 3RM0H 3QLPH 1ZMNA 1DANH 4JZFH 1W11U 2ZU4A 1HNEE 3RXOA 1HAVA 2HNTE 1ID5H 3T28A 4FU9A 1A0LA 2J38A 3F68H 1MKXH 2PW8H 1ZMLA 1T8OA 1FPCH 3UOPA 2P94A 3MNBA 1BMAA 1TQ7B 3RP2A 3NUMA 1TGCA 3P8GA 1GCTC 1V2WT 2OBOA 1HCGA 4INKA 2BZ6H 4OS6A 1C1PA 2GJGA 1T8MA 3UNSA 4ABAA 4ZKOU 1KIGH 3RMMH 1QL9A 2ZKSA 3K6ZA 1SHYA 3SUFA 1UHBB 2CHAB 3GY7A 1A2CH 3H5CB 4UFDH 1C2JA 1BTPA 5C1XA 2ZP0H 1P2JA 3TJNA 2OC8A 1C5MD 1GBAA 2OTVA 1O3DA 3L3TA 3M3TA 4LOYH 4NIWA 1ELCA 4ZROA 3LPRA 4KTSA 1EAUA 1S0QA 2BQ7B 1BBRH 1T8LA 1EZXC 1TGTA 2IOTA 1XUIA 1DWCH 2SNWA 3OSYA 2P8OC 2WPDD 2ZF0H 1QRWA 1KXDA 1W10U 4XFQA 4FUJA 3UREA 2FYRA 3TH2H 3UTUH 1HGTH 1GMHF 2IJD1 3GY6A 3T27A 4ABEA 2WPMS 2P95A 1GBJA 2UUYA 1P2KA 1BMLA 1C5UA 2XC4A 2XNIA 3MO3A 5F6MA 1WQSA 4JYUH 2BDBA 4K1EA 2FLRH 1GJ6A 2FM2A 1PQ7A 3BSQA 3KQEA 1EXFA 4AC9A 1UVOA 1O39A 1QBOA 3LC3A 1D3QB 1QZ8A 1YP9A 3KYFA 1DY8A 1HAVB 5T6DA 1EJNA 1AHTH 1GVKB 2BDGA 3W95A 3RXPA 1DT2A 4CHAB 1SC8U 1C5ZB 2ZDAH 2QC2A 2BD7A 4AYYB 4GSOA 4BNRA 1HAZB 3M5LA 1GBHA 1O2JA 1GI8B 2PKAA 4X6MA 1B0FA 3LJOA 2DE8A 1ABJH 3F0OA 5GDSH 3SBKA 3RDZA 1N6XA 3ZZ3A 1TRMA 1ZPCA 2PTNA 2QGRA 3RC5A 1XVOA 2YMSD 3QZQA 3SJ8A 3FP6E 2NU0E 2OD3B 2XCNA 1TBRH 4XDEA 3U8TH 1THSH 5C1YA 1GHZA 3KN2A 4K60A 2PTCE 4DT4A 3STJA 3F3BA 1ANDA 3N7OA 1TX8A 1Y3WA 2ZIQH 3GDVA 2J98B 5GCHF 4LZ4B 3NWUA 1BTHH 1TABE 1GDNA 1UCYE 3BF6H 4TYDA 1S6LA 1CT0E 1EAIA 3A8CA 5FX5A 1YBWA 1XXDA 2Y82A 5CHAC 2GV6A 2PWXA 1GJBB 3N7EA 1UK3A 2WHXA 1SLUB 1TA2A 1EB1H 4D8NA 4FUHA 2H2ZA 4H42U 4XRNA 2VIVA 2BLWA 2F9PA 3VFEA 1QQUA 1DFPA 1TOCB 1SHHB 2FS8A 4FUFA 1NRPH 2P16A 4YTAA 3RXFA 1RXPA 4YT7H 1FV9A 1O0DH 1PYTC 1LO6A 2SFAA 3QTOH 3U1IB 1MAXA 3N99A 1SGYE 1OXGA 3U1JB 1OYTH 4GVUA 1B7XB 1YLNA 2VWLA 3ZYDA 5L2YH 2GCTB 1SGPE 3F9GA 2XCFA 5LPRA 1FXYA 1OP8A 1KYNA 4UEHH 5T6GA 2J92A 2OQ5A 1C2FA 1VCQA 5EJLA 5PTPA 4AG1A 3NZIA 5LGOA 2JJ2D 4ZH8A 2XXLA 3MU8A 3EYDA 1Z6EA 2ZTXA 4GCHF 5T1VA 2WPKS 3DSOA 3A81A 1SLWB 2ZPSA 1AZ8A 1C1VH 1EPTA 4INHA 3LH1A 4R8TB 4GPGA 1O3LA 5B6OA 1DITH 3T25A 1L4DA 2XBXA 1OWKA 3SUDA 4FUCA 2BLOA 1RJXB 2BY5X 3VB3A 1O2NA 2C8ZB 2HVXA 4X2XA 1NFXA 1BMFD 2Y81A 4TY7A 6GCHG 4X8VH 2UUFB 4LZ1H 1SOTA 2NU3E 3MMGA 2Z3EA 4CRCA 3SV7A 2WUCA 5T3HA 3SNCA 1GI0A 4ABHA 1P05A 3IWMA 7KMEH 1QB9A 3SV6A 1Y8TA 2D26C 1OOKB 3SZEA 1QY6A 1Y3XA 1D3TB 2W7UA 3OTJE 3PLPA 1LPKB 4X1PU 5AFZH 2Z9KA 4MTBA 4NSYA 1ESAA 4CBNA 5CMXH 5E0HA 1TX6A 3BIUH 1XKAC 4NA9H 4B6FA 5EW1H 1P9SA 2BD8A 1WV7H 1P2QA 3FAOA 7ESTE 5I25A 3V13A 4X1RU 1AB9B 1ELDE 1UO6A 1H8DH 1DSTA 5F8ZA 2ZWLH 3S69A 2HOBA 3PV4A 2RG3A 1WOFA 3RXIA 1LQDB 2G55A 2G51A 2K0QA 2A0QB 1ELFA 2L6OA 3WW7A 1N8OB 1VCWA 2JETC 1IQIA 4KTUA 1C1NA 5EQQA 2AGIX 1Z1IA 4B1TA 2ZCKP 2A7CA 1L1JA 3PTBA 2FI4E 1GHBF 1MTSA 2XBYA 1GMHG 2XBVA 5L2ZH 1EPTB 1QL8A 4YESB 1NT1A 3ZVEA 3ATMA 4U32A 1QCPA 1O5BB 2OXSA 4HTCH 7GCHF 3A85A 4FOUC 3M36A 4Z1MD 4MPUA 1Z71A 1CT4E 1NBMD 2GDEH 4NSVA 3BTWE 1DVAH 2QF3A 1O2HA 1TLDA 2VGCC 3D23A 4CRBA 6ESTA 3PTNA 4XOJA 3QGNB 5DO4H 4YOIA 2KR7A 1JIRA 4AOQA 4OS1A 1ZLRA 5HGGA 1EP6A 1Y3UA 5C5OA 3QGJA 5JBAS 1RRKA 2IPQX 1NRSH 3A83A 2AMQA 1BRBE 4IMZA 2GMTB 1AFEH 1JBUH 1IQGA 4MG3A 4ZXYH 3F9HA 1F0RA 2OUAA 3W94A 2ZDLA 1LMWB 1VJAU 1UTLM 1ZSLA 5DP8A 4DJZB 3HGNA 1OWDA 2BXUH 1K21H 1G3DA 2F9NA 4ZKSU 2WSSD 2KCOA 3Q00A 1BRAA 3M37A 3GYMA 1C1RA 5JYIA 2ULLA 2A7JA 4AGKA 2ZHWH 2GT8A 1FONA 2BVXH 3F9FA 1O5DH 3KL6A 2BB4A 3TNTA 3QTVH 1AI8H 3TJVA 1OWHA 3LU9B 2FWWA 2EI6A 2XC5A 2G4TA 5GCHG 2ZFQH 1V2VT 1EASA 5TCCA 3A80A 1E36B 3RLYH 5FCKA 1XXFA 3ODDA 2RA3A 1NFWA 3OYPA 5I46H 1UK4A 2BHGA 1Q3XA 2A5KA 4R0IA 4ZUHA 2D8WA 5GWZA 2KX4A 4CH2B 4E06H 1QJ7B 1YF4A 2Z9JA 1ZTKA 2SGEE 2O8LA 4ABGA 3SNAA 3OAAD 1YY3A 1O2SA 1IQEA 1D3PB 1SGEE 2ZQ1A 1K2I1 2GTBA 3N7DA 1GHYH 4XD7D 1K1PA 3MNCA 3PWBA 6CHAC 1E1RD 1JMOH 4B74A 1TGBA 3ZZ8A 1LVOA 1GGDB 1GBFA 1H9HE 4ACBA 1CT2E 4B76A 1C2DA 2QXHA 1Z8RA 2WINI 2IJOB 2F43B 2NU1E 2GVFA 1P9UA 3SHCH 4AGJA 4B71A 2TGTA 3M7TA 1YLCA 1H8HD 1TMTH 2PR3A 4RN6A 4TWWA 2R2MB 1N6YA 1EOLA 1BA8B 2C90B 1O33A 2BMGB 2ZZUH 1BDAA 1U6QA 2AEIH 1FIZA 2H9HA 1ZHPA 3ZZBA 1PQ5A 2LPRA 1F0SA 4GCHG 3S9AA 3A7VA 2F9OA 1MBQA 3OFND 3MHWU 3UNQA 1CE5A 2ZG0H 3V3MA 1CGHA 1BHXB 2AYWA 1YPHE 5FX6A 2PUQH 3SW2B 2AHME 4MPWA 3RC4A 3T26A 4JMYA 4JZDH 2R0KA 1TB6H 1C5RA 4NIVA 1IQJA 4WH8A 1ETSH 5BRRE 1O2YA 1AU8A 4TY6A 3PRBA 2Z3CA 4ASHA 1EUFA 3WY8A 3LGYA 5HIYA 3A86A 2EI8A 5C1UA 2AH4X 3JZ1B 4TT3D 1DM4B 1H1BA 3BTHE 4NFEA 4WMEA 1EQ9A 5EW2H 1V2JT 5H4IB 1CHGA 4I32A 1A5HA 2WUBA 1GJDB 1ZTLA 2QXIA 3DT0H 4PROA 4Y10E 2Z9GA 2BOKA 4AYVB 1AD8H 2BDCA 3UQVA 2LELA 2PP6A 1ABIH 4OS4A 4UFEH 3GICB 1GWAA 1GL1A 4X6OA 5F03A 2CMYA 1KSNA 1GBLA 4RSPA 1C2IA 1TYNA 2JH0D 2A4GA 2R0LA 1BMMH 4I31A 3V7TA 4CH8B 3VGCC 1ZPZA 4BAMB 3CENA 2AGEX 1TONA 3Q3XA 4JZEH 3FFGA 1GMCF 2D2DA 5LPEA 2BLVA 1ZJDA 5SGAE 2Y7ZA 2DE9A 5EQSA 4AX9H 1YKTA 2W6JD 2EI7A 1EKBB 1SR5C 2H9EH 4NA7A 1NFUA 3SHAH 2VVVA 3LGIA 4DVAU 1IOEA 1GVLA 4ESTE 4XSKU 4CRFA 1O3CA 1WXRA 1GHBG 1F5RA 2BXTH 3MYWA 1W7XH 1BIOA 1IQLA 2WV9A 1O3MA 1PPFE 1P03A 3E90B 7GCHG 2EQNA 7LPRA 1HJAB 1MTNB 3VB7A 1ETRH 2FOGA 4KGAA 4FU8A 3GCTF 4Z6AH 2JIZD 4RKOB 2ANWA 1QQ4A 1CGJE 1WBGB 1MBMA 1HDTH 2Y5FA 4CRAA 3SJOA 2BVRH 1YPLH 2VINA 1C1QA 3I77A 3HPTB 4ZXXH 1DWDH 5F8TA 1O38A 3ZZ5A 4B2AA 4ISHH 2FPZA 2L74A 1QJ1B 5DP9A 4FETA 5LH8A 1GJAB 2FOFA 1C5WB 2RDLA 2XRCA 1VR1H 2VJ1A 3LC5A 1V2OT 4I8HA 4FU7A 3ATWA 5HMAA 1GG6B 2C8WB 1RIWC 4A1XA 3P8OA 1XUKA 1GI5A 2Q6GA 1C2EA 1ZPBA 1LPGB 1BBRK 3ITIA 3URCA 1YCPM 2J95A 3EA9A 4YT6H 1EOJA 4SGBE 3TPIZ 1O2ZA 2FOCA 4RT0A 1SGFG 1SVPA 5FBEA 3MH7A 2JDID 3MO9A 4FVDA 1EFRD 1JIMA 1GCTB 1WSSH 1A1RA 3FZDA 1O5FH 1GI1A 1C1TA 5F53A 1G32B 3ZVDA 2TPIZ 3RUOA 3EA8A 1QA7A 3R0FA 4MNYA 3PV5A 1MQ5A 1ZRBA 1BMNH 1J8AA 4Q7ZA 2WYJA 3M5MA 2GV7A 1IQKA 2SGQE 3SQHE 1QFKH 1OKXA 2ZHQH 3BTFE 1C9TA 1PJPA 3FOAA 3GOVB 3A88A 1T4UH 3AK5A 3A8DA 3O8DA 5HM9A 4I8LA 4DT7B 4NGAH 1EZSC 1K1NA 2P8OB 3ZZ4A 4HG6A 5KECA 2UWLA 4MNVA 3V0XA 3D65E 1JXPA 1LCYA 2ZHDA 4FXGH 5GIBA 2OBQA 1ZTJA 2BOHB 2TGPZ 2JJ1D 3AW1A 1QIXB 4YXWD 2VIWA 5J4QA 2C8XB 2F9UA 1D6RA 1P01A 1P2IA 3HKJB 5EU8A 4BTTB 3SU5A 1FDPA 3GY4A 1KXFA 1LHCH 4BXSA 1SGIB 1BZXE 1TX7A 1EATA 1L1GA 4CR9A 3PROA 4DW2U 2CN0H 4X1SU 2ZGXH 5IYTA 2UUJB 1CU1A 2GD4B 2Z9IA 1J14A 1TGSZ 4XBDA 4FUBA 1HAOH 3PO1B 1A7SA 4ZCNA 2ZC9H 4Q7YA 4Y7BA 5E0GA 3M35A 3TK5A 2BD4A 3HK3B 1D4PB 1N1LA
chains in the Genus database with same CATH topology
2O9QA 1O2OA 1ACBE 1BUIA 1PPGE 2J9NA 4U30A 1LTOA 2AERH 4X2VA 1P04A 2P3TB 3A7YA 4DIHH 1P09A 1GDUA 2VWOA 1AVGH 4JZIA 3EA7A 3SZNA 4GHQA 3BTTE 2QA9E 4YOGA 2STAE 4Y79A 4A1TA 4U2WA 2B7DH 3SUGA 1W7GH 1BCUH 4H6SB 4WMDA 5CHAB 2FMJA 3SNDA 1O3FA 1NESE 2QXJA 1GMCG 1A46H 3UQOA 4U01A 1BB0B 4I8GA 3BG4C 4CR5A 1S0RA 4KTCA 1Y59T 3RU4D 3F9EA 5K0HA 1NU9A 1A5IA 1KY9A 1OPHB 5AVDA 4VGCC 4Y6DA 2H1UA 2OP9A 5JPMH 1V2QT 1NRNH 4BAHB 1FPHH 1GJCB 2ANMH 3EE0B 2BY9X 1GMDG 2FLBH 1PFXC 2BLQA 3MWIU 1P10A 2HPQH 1EB2A 1V2MT 1SGTA 1OS8A 3RXSA 4NZQA 4ABJA 4X8TH 1AKSA 1SFQB 4D7FA 4A5TS 2V35A 3ATLA 1DDJA 1ZSJA 1O35A 1TPSA 3LGUA 3RXHA 3GCTG 1GBIA 4AFQA 2FX6A 3U69H 1P06A 3ZVCA 5A2MH 1QL7A 2BY6X 2ZGCA 1O3NA 1O34A 1W0YH 1ZR0A 1O2RA 1SGQE 1J9CH 1EP5A 5A8XA 1SGNE 3GYLB 2YOLA 1FY8E 1GJ4H 2HRVA 1W2KH 3NKKA 4K1TA 3IG6B 2WPLS 1BTXA 2AIPA 3SV8A 1DWBH 1DPOA 2PKAB 4D9RA 2FX4A 3DHKH 4IC5A 1HLTH 4M7GA 2QIQA 3A7ZA 4FUGA 1MD8A 3H7TA 1DS2E 5L30H 1ZGVA 1CO7E 4UFFH 1KXAA 2FOEA 2WPHS 1HUTH 3A84A 1FNIA 4Y8YA 1P3CA 2Z7FE 3TIUA 3RXDA 1FN8A 5C3NA 3BTME 2ZQ2A 1YLDA 4HFPB 1AUTC 2A5IA 4MQAA 2SGPE 1V2RT 3SV9A 1P2OA 1GBMA 4UONA 2G81E 3FP8E 3U98H 1CBWC 2OINA 2A31A 3P8FA 2F9BH 2UWOA 1IAUA 2J94A 1NROH 3C27B 1AGJA 2FZZA 1C5XB 1SQTA 2HALA 1HV7A 2VVUA 3DD2H 2CF9H 1CA8B 4O3UA 1TQ0B 3Q3KA 1GI6A 1WAYB 4SGAE 5EXNA 1EZQA 1KXBA 3KEEA 1W12U 3TU7H 3RXRA 3RXLA 1AO5A 3RXQA 3SJIA 1CHOF 3ZZ9A 3DUXH 3SORA 1LHFH 2JETB 3GCHC 4CREA 1VJ9U 1OX1A 2W5EA 4X8SH 4I7YH 1NU7B 1ARCA 1QBNA 2CV3A 1ELEE 3MU1A 2Y80A 3UY9A 1SPJA 1MTUA 3SU4A 1CVWH 4WMFA 2WV5A 4H6TA 2ZDNA 5E2OA 1SFIA 4BOHA 3EGKH 1FJSA 4B75A 1C2HA 1HAXB 1OWJA 2A5AA 2F91A 1ANCA 1S6HA 2VGCB 4D9QA 4I8KA 2FIRH 4Z0KA 1F2SE 1MCTA 3RXEA 4DCDA 3OY5U 1TNJA 1THPB 1E0FD 2ZFRH 1GJ5H 4JK6A 2C3SA 4CRDA 1DLEA 2ZFFH 3LGWA 1GHAF 3SJ9A 1D6WA 3E6PH 1P11E 5DP3A 1FUJA 5CE1A 2QCYA 1UK2A 3TH4H 1L4ZA 3ZZ6A 1C5TA 3ODFA 2RA0A 1MZAA 2ZU2A 2FP7B 1HIAA 3S9BA 1G37A 2GCHF 2PGBB 2YNBA 5G4BA 3SOSA 3ZVFA 2ZTYA 2QN5T 3Q77A 5DPAA 4Y8ZA 4FUDA 4GUXA 1S83A 4B2CA 1H9IE 3NK8A 3BEUA 4X6NA 1G3BA 2FODA 2BVSH 2BZAA 3LGTA 3G01A 3RXKA 4A6LA 3AVZA 1XUGA 1WUNH 1UTPA 1ANBA 1Y5BT 2AMDA 5C2ZA 3M3SA 1SGFA 3S7KB 1XM1A 2TRMA 1DXPA 4Y8XA 3RLWH 1KTSB 1O3IA 5FHTA 4QT8C 3MNXA 3F6UH 1O3BA 2ZI2H 1W0ZU 3GY3A 3VPKA 1BJVA 2PLXA 3S0NA 1ZHMA 6CHAB 2W7SA 2A4RA 1O2PA 1YPHC 1UTMA 1PPBH 2GX4A 2PHBA 3AW0A 2A4QA 4NZLA 1BJUA 1GI4A 1TE0A 4IN1A 4ZHAA 3A8AA 3RM2H 5IDKA 1WU1A 3TLOA 2VWMA 2G00A 4THNH 3VB5A 5A0BA 5FCRA 1FY5A 3QUMP 1NC6A 1AY6H 2ALVA 3C1KA 3CP7A 2G52A 2PKSC 1UCYK 1UVUH 2J34A 1SGRE 4NWKA 3RXMA 3CS0A 5BPEA 1GHWH 3RXAA 2FOBA 3D49H 1GVZA 3VB6A 3MTYA 1ZZZA 5JB8S 1QURH 1VITF 1V2TT 1KXCA 3QDZB 4XBCA 4MDSA 4KKDA 1VGCC 1AVWA 1OYQA 3KQCA 8LPRA 1HXFH 3UR9A 3PMAB 1NPMA 3B23B 1K22H 1MU6B 3A89A 3ZVAA 4AB8A 4IC6A 2ANKH 2AMPA 1QGFA 3KQBA 3ZVGA 1TIOA 1O5EH 1TWXB 1YPMH 2ZTZA 1TMUH 1SLVB 3PMBB 4ISNA 1GBCA 1XKBC 1QB6A 1MU8B 1TBQH 2AFQB 3SGAE 2FTLE 5E2PA 2TGDA 4A92A 1P02A 1IQFA 8ESTE 1GPZA 4BTIB 1LPZB 3ZZCA 3QO6A 1IHTH 2PSYA 2PSXA 1O2GH 4I33A 1C1SA 1NTPA 3VGCB 3TGJE 1KXEA 1S5SA 1C5QA 2ODPA 3D62A 4IS5A 2LNCA 4Y0ZE 1AFQC 1SLXB 1UCYH 4X1NU 1NM6A 1FIWA 3B8JA 1K28D 5FPYA 2PFEA 2I6SA 1CHOG 2TIOA 2Z94A 4ZMAH 4X1QU 2ASUB 5FPSA 2FOHA 1TMBH 1MQ6A 3SU6A 1UTQA 3ESTA 1QBVH 1Z8IB 2Y7XA 1P57B 1D3DB 2ILNA 1T32A 2F83A 5EOKA 5K7RA 2A45B 3QX5H 3AAVA 1AMHA 2P59A 1UTNA 1NS3A 3STIA 2WV4A 4UD9H 1GMDF 2F3CE 1F7ZA 1UJ1A 1EAXA 5ESTE 1XUJA 1T8NA 1O3AA 5C20A 1AE5A 1SSXA 3SN8A 1FI8A 3PMHB 2PUXB 1GHAG 2VU8E 3U8OH 2P3FH 1X7AC 2ZPQA 4ZKRU 4NA8A 5HYOA 3A7WA 1CA0C 1F0UA 3E8LA 1RIWB 1BRUP 4TPYA 8GCHF 3ZYEA 2BDHA 2O8WA 4D76A 1T7CA 1XMNB 2GCHG 3SQEE 3PYHA 3BTQE 1S85A 3GY5A 3RU4T 4YLUA 3EAJA 3ELAH 4YZUA 5DP4A 2Z6BD 1O2UA 1AN1E 1MD7A 1GHVH 2A4OA 2BTCE 1GBDA 5A0AE 2BX3A 4MNXA 1TA6A 3F1SB 3TJUA 3LOXA 1FQ3A 1FN6A 4DOQA 1O2LA 1V2KT 2NU4E 2SNVA 3M5NA 1V2ST 5C67A 1XUFA 1O5CB 1C1UH 3TVJB 3GDUA 1UVSH 1Q2WA 2VIPA 1UTKA 2V3HH 1TNLA 1KLJH 2ZHEH 1ESTA 5EPYA 3I29A 5DP7A 1BRCE 2ZU1A 4ABDA 5A8ZA 1O31A 3NCLA 3OY6U 3LJJA 4X8UH 1IQMA 3BEIB 2CGAA 3LONA 1O3KA 2FOMB 3QZRA 5GPIB 1AIXH 3O8RA 1HAGE 1HJ8A 1INCA 2XTTB 1Y5AT 1G30B 2ALPA 4MVNA 3T2NA 1OP2A 1A61H 1FZZA 2YNAA 2BY8X 2G5VA 4BTUB 2AGGX 4Y7AA 4KELA 1PYTD 1LKBA 1GBEA 4IN2A 2EC9H 1S81A 1E35B 3MH4A 1UMAH 1HAPH 1Q31A 3M5OA 2ZO3H 3O8CA 1BTUA 2W3IA 1VITG 1P2NA 1HYLA 3EDXB 4WVPE 4WXIA 2FEQH 1K1MA 4X6PA 4MPXA 5JBCS 4GLYA 4XE4A 4NFFA 4Y11E 4O03A 2FDAA 1LHDH 5EPNA 3PMJA 1AE8H 3RXTA 1XUHA 1GJ9B 2G5NA 3BV9B 3NPSA 3P70B 5DKMA 2OQUA 1ELVA 3ZVBA 1TPOA 3BN9A 4D7GA 3PWCA 2ZFTA 2CHAC 1EZUC 5EODA 1ZMJA 2RCEA 1C4U2 2UWPA 2FTMA 1HPGA 4BANB 1LHEH 3P6ZB 3UOUA 1V2LT 1GBTA 1QR3E 1ZSKA 1UVPA 1OSSA 4HZHA 3E16B 1K9OE 4X2WA 2ZECA 9ESTA 2BD5A 2VIQA 4GAWA 1Z8JB 2KAIA 1MTVA 4X2YA 1C5LH 2C93B 2STBE 2VH6A 1AWHB 2AS9A 2WPJS 2WYGA 5AF9H 2ZCHP 1GL0E 1GI7B 1RTKA 3E1XB 4MLFB 5TJXA 5DGJA 3MU0A 3BG8A 1E34B 1F0TA 1ZOMA 1RGQA 1Y5UT 5FXLA 5DK1A 1BTYA 3BG4B 1TALA 1C5SA 5JBBS 3T5FH 1AVXA 2A32A 1P8VC 1SMFE 5DP6A 3GY2A 4UDWH 2J4IA 4O3TA 2VIDA 4VGCB 3PO1C 2ZHFH 2XBWA 1O3EA 3SU1A 3TITA 1MKWK 1DLKB 1YCPK 4F49A 4A7IB 3UFAA 5EXLA 1A3EH 1C1MA 3QWCH 2NWNA 3RMLH 1ANEA 1CGIE 1G2LA 3E3TA 3GISB 3BEFB 4ABBA 1YC0A 8KME2 4K1SA 1MZDA 2HWLB 4O9VA 3DFJA 3FVFB 1O5GH 4Y76A 1PPZA 3MNSA 4Y0YE 4K2YA 1M9UA 2FI3E 2R9PA 4CHAC 1Z6JH 2TGAA 1DSUA 3K2UA 1SI5H 4OS5A 4BAKB 3PB1E 3PLBA 3SGQE 3QK1A 3RXVA 1V3XA 4Q80A 2HLCA 1TNIA 4WXVA 1P3EA 1T4VH 4NIXA 1TNGA 5ESBA 5LPFA 2G4UA 3SGBE 3M7UA 1C5PA 1ORFA 1O36A 1TPPA 1MCVA 1ELTA 1O37A 3LGVA 1QRZA 3KIDU 1WTGH 1G3EA 1V2PT 8GCHG 3TH3H 2KAIB 4K5ZA 3RMOH 1NY22 1O2XA 4RKJB 2JH5D 5DP5A 3KF2A 1H9LB 3BTKE 5GJ4B 1C5YB 1NFYA 1KDQA 1LVYA 4BXWA 3UIRA 1O3OA 3MH6A 1F5LA 5EG4A 1ZJKA 1YPJH 1K1OA 3UPEA 1GDQA 1MKWH 1YCPH 1SB1H 1GI2A 2QYIA 3IITA 1Z7KA 1TFXA 3TK6A 4AB9A 2OC1A 3KQDA 2CJIA 2W3KA 1CBWB 2EA3A 1D9IA 1C5VA 1ELGA 2B8OH 1SQOA 5EXMA 1B0EA 1OWEA 2ZFPH 4K8YA 1ETTH 2CF8H 3Q76A 1S82A 3K65B 3LH3A 4ABIA 1FAKH 1ESBA 5DG6A 3LIWA 3K9XB 3ZZ7A 4CRGA 2DUCA 3SI3H 1KLIH 1TOMH 2HPPH 5T6FA 1TPAE 3GCOA 5HM2A 2BQ6B 2H6MA 3GCHB 2GCTC 1LVMA 1A3BH 1C4V2 1K1IA 4I8JA 2O8TA 3Q3YA 2P3UB 1HAYB 5HXFA 3SUEA 4JYTA 2BX4A 1H8IH 2OCVB 2A2XH 2O8UA 4DURA 4WWYA 3KNXA 5JDUB 4WJG2 3BTDE 3QN7A 1AKSB 1SG8B 1GBBA 2GZ8A 5E8EH 3E91A 1EX3A 2W26A 3MU4A 3SI4H 1DOJA 1WYKA 3H7OA 3CS7A 4IW4E 3LKWA 2BYAX 4IBLH 4JYVH 3SU0A 1BITA 1T31A 4ISIH 1MTWA 1ELBA 2GKVE 5AFYH 2ODQA 3UUZA 1RS0A 1RFNA 4UFGH 4AORA 4WH6A 3SO3A 2ZU3A 2K1QA 4B73A 1JOUB 2GGVB 2ZNKH 1FAXA 1W8BH 1FY3A 2OC7A 2PV9B 4A1VA 5F8XA 1YGCH 2ANYA 5J4SA 1KDQB 1FLEE 4GHTA 2PGQB 1G2MA 1P2MA 1A4WH 1L2EA 3URDA 3SU3A 5EQRA 4DGJA 1JRSA 2OC0A 1TGNA 1G3CA 3A87A 3HATH 4AZ2B 1OWIA 3UNRA 2R3UA 1NN6A 3A82A 5ETXA 4DIIH 3TJOA 1DUEA 4JZ1A 3SNEA 1E37B 2V0BA 5DJ7A 3DFLA 1QJ6B 1GI9B 1O3HA 2ZEBA 1RTFB 1KTTB 1TNKA 5FPTA 1HB0B 4BAOB 1DWEH 3ATIA 4E7NA 1O32A 3M3VA 1E38B 4LXBH 3P92A 5L6NH 1AB9C 4NWLA 2SGAA 3B9FH 2B0FA 4HI3A 2ODYB 2QY0B 4YO9A 2Z3DA 1VITH 1DXWA 2A1DB 2Q6FA 2OLGA 4INLA 3PLKA 4CBOA 2QF0A 3FP7E 1MAYA 1N8OC 2QXGA 1GJ7B 1O2WA 2GP9B 1C9PA 1BBRE 2FESH 4Q2KA 3UWJH 3R3GB 6LPRA 2BDAA 4WY3A 1V2UT 3AAUA 3S9CA 3LDXH 4J1YA 1EPTC 2BM2A 3KHVA 1BTWA 2HGTH 1HRTH 1NO9H 2FOAA 4AFZA 2ZPRA 3P17H 2H5CA 1LDTT 5C5NA 2BD3A 2GDDA 1YPKH 1JRTA 1J15A 5GXPA 4DG4A 2H5DA 1C1WH 1P12E 2FI5E 2Y6TA 1HAIH 1A0JA 1ZRKA 2Q6DA 1HJ9A 2F9VA 1SGCA 1ZGIA 1PPHE 3MOCA 4ABFA 1GBKA 1ZYOA 1GI3A 1AWFH 1TAWA 3U8RH 1AUJA 1EJMA 3RU4E 4J2YB 1YYY1 2VWNA 3OU0A 2XWBI 4ISLA 9LPRA 2GMTC 4OGYA 1O5AB 4IGDA 4NIYA 2PKSB 3SU2A 3M61U 3VXEH 1S6FA 1NRQH 4TWYA 2BD2A 1Y3YA 2M5TA 2ZFSA 1BHXF 2THFB 2IPHA 1QNJA 1O3PB 2R3YA 1Y3VA 2BDYA 1C5OH 1MUEB 3MI4A 1Z8GA 1K1JA 3ZV9A 2BD9A 1O3GA 1VGCB 3PM3A 2XW9A 3GCNA 3RXCA 3HKIB 2ZGBH 5A09A 3T29A 1O2VA 3TNSA 3TGKE 3E0NB 3MO6A 4ISOA 4K3JA 1HIAB 1C5NH 4HGCA 3MH5A 1WTHD 4K69A 1CQQA 2VIOA 1QHRB 5EGMA 2A7HA 4YLQH 1HFDA 3A7TA 3BTEE 3VXFH 5FBIA 2ZA5A 1FMGA 1TNHA 2FYQA 4E05H 3HGPA 1THRH