5A0BA

Crystal structure of human neutrophil elastase in complex with a dihydropyrimidone inhibitor
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
218
structure length
215
Chain Sequence
IVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEUTROPHIL ELASTASE
publication title Freezing the Bioactive Conformation to Boost Potency: The Identification of BAY 85-8501, a Selective and Potent Inhibitor of Human Neutrophil Elastase for Pulmonary Diseases.
pubmed doi rcsb
molecule tags Hydrolase
total genus 43
structure length 215
sequence length 218
ec nomenclature ec 3.4.21.37: Leukocyte elastase.
pdb deposition date 2015-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5a0bA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5a0bA02
4D9QA 1EJMA 2WYJA 1UVOA 2QYIA 5C1YA 1T8MA 4K69A 4D76A 1QJ7B 4MNWA 1T31A 3Q76A 4K2YA 1G2LA 2GP9B 1AVWA 4NCYA 4XOJA 1NFUA 3TH3H 2AGGX 1CA0B 4ZHLU 2ZPQA 3SW2B 1MZAA 3KF2A 1W2KH 3MU1A 4FUGA 1P9SA 5HXFA 3NK8A 1EPTA 1U6QA 4JYVH 1QBNA 3MO9A 4UEHH 1ARBA 2ODPA 2Z9IA 5A0AE 1C9TA 3BTME 1MTSA 4DY7B 7GCHG 2PGBB 2ZP0H 1IAUA 2C3SA 1C1MA 3A82A 4LK4A 2RA3A 1UCYK 2BX4A 4ZHMU 1TNHA 1INCA 5A8ZA 3TIUA 1GBKA 2BQ7B 1SL3A 1FY8E 3OY6U 4O9VA 4A7IB 1O5GH 6CHAB 2AGEX 3IWMA 1UTOA 3JZ2B 5JYIA 2GTBA 5A8XA 3ZZBA 2Y7XA 2BD5A 1AZZA 2AMPA 1ZR0A 3BTEE 2LPRA 3V0XA 1C2HA 3BTGE 2GMTC 3GY5A 3SUEA 4YM9A 4UFFH 1GMHG 3RC6A 1ETTH 4OS4A 1XUHA 4X1NU 1Y3YA 2ZPSA 1ELAA 4ABHA 2R3YA 5E0HA 1MU6B 4UE7H 4TWWA 1E0FD 4JYUH 1LVYA 2BX3A 3T27A 3UPEA 3RMLH 1YPKH 1GHBG 1AFEH 1DDJA 2JH5D 1G36A 1OOKB 2W26A 2Z3DA 3MO6A 1BT7A 2A2QH 2GDEH 1V2JT 2FDAA 1PPGE 1B0EA 5A09A 2BDAA 5A2MH 1ZGVA 8LPRA 5EODA 2XNIA 4AYYB 1H9LB 5GDSH 3PV4A 2ZFFH 2G5NA 2HPPH 4Q7XA 3RDZA 3RU4T 4X8TH 1Q2WA 4U2WA 1ANCA 2EI6A 1NRSH 4GPGA 1S5SA 4WY3A 3RMMH 4IC5A 2FI4E 1MKWK 1TNGA 4NWLA 2R2MB 2BVRH 4OS1A 2BVXH 2ILNA 4UDWH 1C5SA 3JZ1B 4IMQA 1HV7A 2P95A 5JB9S 1MH0A 3SJKA 3NZIA 5PTPA 3P8OA 3RXSA 2BZAA 1ZRBA 1TWXB 1Z1IA 3SU4A 4Q7ZA 2Y7ZA 3IG6B 3UWIA 4ZROA 2Z9JA 4D8NA 1DE7H 1HFDA 1BRBE 1GCTC 1C1SA 1HAXB 1G3EA 1TA2A 2QXHA 1NRQH 4AB9A 2ZC9H 1UTKA 1YPMH 3QK1A 2VH0A 2J94A 1SR5C 1P03A 3A88A 5I46H 4OGXA 3W95A 4ZUHA 2ANYA 1N6XA 5DO4H 1GDQA 2C8YB 1EKBB 1V2WT 4K3JA 1YYY1 1D3DB 7KMEH 1EX3A 2FS9A 3SI4H 1MTUA 1QRZA 1S84A 2ODQA 1W0YH 5F6MA 3N7OA 2H5CA 1AKSB 1ZPZA 1HAYB 3BTHE 3M37A 1DSTA 3Q3XA 4ZKNU 1GI5A 3LGVA 1GHVH 3PMHB 4NWKA 3RM0H 1OSSA 3U8TH 1O2VA 3HPTB 3PM3A 2QN5T 3EYDA 2ZHWH 3SU6A 1O2IA 2FOBA 1PQAA 2FX4A 1GJ6A 4FUJA 1P2MA 1PYTD 1L4ZA 1A7SA 1Y59T 1V2OT 3BTKE 1S6HA 5K7RA 3SNCA 3KGPA 3BG8A 1B0FA 1YPHC 4X6NA 2OCVB 1ZHPA 5IYTA 4AGJA 1WOFA 1V2PT 1V2LT 2ZHEH 3A7VA 3RXUA 1C5NH 5DP9A 1A1RA 2GMTB 1CU1A 3DT0H 1P01A 1NS3A 1LMWB 1AFQB 3M35A 1VITF 2HNTE 1GL0E 3SHCH 1GBIA 3KEEA 3T62A 3HKIB 1B5GH 2UUKB 1DXWA 5JBAS 1TGNA 2XBYA 4IC6A 4ABAA 2AH4X 3B23B 3CS7A 3L3TA 5EPNA 1O5DH 3SQHE 1P3CA 4YO9A 4DVAU 1L2EA 4FVBA 3E6PH 1J9CH 1IQLA 2CHAC 1W12U 1MTVA 4MNXA 1J17T 5E2OA 5GCHF 5FPTA 3UTUH 2PW8H 3K6ZA 2G55A 1QY6A 1JRTA 4QT8C 1EASA 3NCLA 2UWLA 4Y8XA 2ZTYA 3ZV8A 1TX8A 2ZFQH 3BG4C 2PTNA 1EOLA 5TCAA 3RXAA 1SI5H 2PLXA 5J4QA 2G5VA 2R0KA 4ESTE 3LKWA 1BZXE 4UFGH 3SUFA 1RTFB 1FNIA 1QA0A 1TPSA 3RXEA 3S9CA 1LVMA 4B2CA 1FY4A 2BD9A 5EQSA 1C2KA 1HIAA 2VIWA 1AQ7A 1C2DA 2R2WU 1GCTB 3SNEA 5L30H 3S69A 1P2KA 4YT7H 4MVNA 4X8UH 4NA9H 1AD8H 2CF9H 2BD8A 1Q3XA 2QIQA 1C2IA 1O5FH 2B9LA 4YZUA 4FUCA 3H7OA 1CSOE 1GMCF 4JMYA 3F9FA 3SUDA 4GCHF 3PWCA 5C20A 4DW2U 1LVOA 1OWHA 1A2CH 1FAXA 3E3TA 2R0LA 1J8AA 4GUXA 1DVAH 2QF0A 2WPKS 1F0TA 2P3FH 2BD7A 5HMAA 3A7WA 1JXPA 2D1JA 4UFEH 3F9HA 2QAAA 2B8OH 2D26C 3G01A 4X8VH 2RCEA 1DWBH 1TQ0B 1UHBB 4AB8A 3DFLA 1FAKH 2BY8X 6ESTA 4BAKB 1O3GA 1WV7H 3MHWU 2WINI 3A87A 1AZ8A 4I8LA 4X2WA 1HPGA 5DK1A 4JZIA 1SC8U 2XBVA 3E16B 4NA8A 1GHAF 1TRMA 1O38A 1XKAC 1O2MA 2FXRA 2P3UB 4ASHA 1PPEE 2ZNKH 1ZTJA 3A8DA 3ZVGA 1FIWA 1A5IA 1O2OA 4KELA 1EPTC 1XUKA 2VH6A 2HPQH 1ABJH 1ELTA 1DS2E 4ABDA 1W14U 1ZTKA 5C5NA 2EEKA 2OBOA 2FLRH 3PROA 1KXCA 3VPKA 1QNJA 4MPUA 9ESTA 3ITIA 1LDTT 1UJ1A 2O8WA 2VNTA 1KXEA 2CV3A 3BV9B 1O2JA 4H42U 9LPRA 1THPB 4WMEA 1TONA 1SHYA 1K9OE 3SV8A 2OD3B 1TLDA 1ABIH 1BTUA 2ZHDA 1VCWA 3GCNA 2Y5HA 5LPRA 3OYPA 2ZA5A 4K5ZA 1XMNB 2ASUB 3QTVH 4YTAA 3T28A 1ARCA 4ISLA 3TU7H 1W13U 1NY22 2XYAA 3SORA 3NWUA 2A31A 5EW2H 2P93A 1OKXA 3RXDA 1C2MA 2BDHA 3ZZAA 4J2YB 1TBZH 2O9QA 4BAOB 3MU4A 3IITA 3QX5H 4B1TA 4PROA 2BY7X 1ELFA 1JRSA 4ABEA 1B7XB 1P9UA 3HK6B 2C90B 2VWLA 2ZU2A 1O39A 2AERH 1NESE 2FESH 1QJ1B 1XXDA 3BG4B 1CVWH 1C2GA 4OS7A 1KSNA 4XE4A 1SGNE 1TFXA 4INLA 1EB2A 1O2ZA 4OS2A 1TOCB 1MBQA 5EGMA 1NTPA 2FP7B 1O2TA 3SN8A 1O5AB 1V2UT 1RD3B 2AIQA 3EA9A 1UVSH 1P11E 5JDUB 1DWCH 1LPZB 1TMUH 2FS8A 1UTQA 3ZV9A 3RU4D 1S81A 3QN7A 1GVKB 1LO6A 3I78A 2BOHB 1BBRE 2Q6DA 5JBCS 1A4WH 4MG3A 1HAPH 2TBSA 1TALA 4F4OC 1QA7A 3LH1A 2BLVA 3ODDA 1GJAB 2C4FH 3FP7E 3RXCA 1RIWB 1UK4A 3HKJB 4Q2KA 2BDYA 1GJDB 1HB0B 1DUAA 1EJNA 1UMAH 2G4UA 3R0FA 4KTCA 4WXVA 4XSKU 1K1PA 1SGEE 1HAOH 3SNDA 1HJAC 3SJ9A 1BHXF 3TJVA 2QF3A 4MDSA 5DP5A 4ISNA 3MNXA 4B73A 1GI1A 3BTFE 4B71A 2AS9A 4OS6A 1DWEH 2THFB 2GZ8A 2FOGA 1DXPA 1V2RT 1Y5UT 4GLYA 1SGPE 3RXLA 2Z7FE 3URCA 4A6LA 2FOCA 3K6YA 3SI3H 1YP9A 3RXTA 3A8BA 1EZXC 2VVCA 2ZFSA 1F92A 2G4TA 2TGAA 2OP9A 4H6SB 1YC0A 1BMNH 2HRVA 1FQ3A 1QL8A 2A2XH 2OXSA 1BA8B 4HFPB 1CE5A 1GBJA 1ACBE 1V2NT 2UUYA 3BTWE 2BDGA 1SLVB 1G3BA 2P16A 1J14A 7LPRA 3S9BA 4R8TB 1BCUH 2QY0B 1GI8B 3MNCA 1ZTLA 2NWNA 4HGCA 1EPTB 4TWYA 4Y76A 2W3IA 1BJVA 1SBWA 1Z6EA 4WF8A 1L4DA 2BY5X 1Y5BT 1EP6A 4OGYA 5DPAA 1MTNC 3R3GB 3UOPA 1D3TB 1O3JA 1IQGA 2H1UA 1V2KT 1O2KA 2FI3E 3M61U 5A0CA 5FCKA 1N1LA 5FBIA 1G3CA 4X6PA 2XRCA 1W10U 2W3KA 3U1JB 1O5BB 3SJOA 2PUXB 3ZVAA 1GBDA 4I33A 1KYNA 2OTVA 1GMDG 1H8IH 4TPIZ 2FOHA 4IN1A 1C5TA 3LONA 4LZ4B 2V6NA 2BY6X 3MFJA 5TJXA 3UNQA 1FJSA 3FP6E 1O3FA 1S83A 1AY6H 3FANA 3PO1B 4KGAA 2KAIA 3F6UH 1DY8A 1ESBA 4NSYA 2A4RA 4WXIA 1YF4A 4M7GA 1K1JA 1K1OA 1K22H 1EAIA 3UIRA 1WCZA 3NXPA 3ENSB 3M3SA 5C5OA 4A1VA 1XX9A 2VWOA 1X7AC 1A0LA 5TCCA 2ZDLA 4ISIH 1EAXA 2Z94A 1Q31A 3TGJE 4ISOA 1J15A 4GAWA 3SGBE 2F91A 3SHAH 4K60A 4A1XA 4INKA 5T6DA 4IW4E 2ZFPH 2GCHG 2BDIA 1JOUB 4NIYA 3T2NA 6GCHG 3V13A 4FUDA 1O31A 1GJ8B 1F0RA 3A85A 3GY6A 4AFZA 8GCHG 1TBQH 4Y7BA 4E05H 1SGFA 1SLWB 4X2YA 2PUQH 1LVBA 1O2QA 2I6QA 3ODFA 1UVUH 1L0ZA 1HJAB 1C1VH 1KY9A 1QL9A 3SZNA 3M5NA 1KTTB 1O3LA 1OYQA 1QHRB 1JWTA 3H5CB 3S7HB 4WVPE 3EAJA 2ZU3A 4DGJA 1P2NA 3Q00A 2IPHA 4CBOA 5EG4A 1LHCH 3NKKA 4TPYA 2OBQA 4CRBA 2ZI2H 1DPOA 3W94A 4NA7A 4DURA 4DT7B 1HXFH 1P8VC 1UCYH 3TK5A 1K2I1 1QJ6B 5IDKA 1SGQE 3SV2H 2SGQE 1L1GA 1W3CA 1EZSC 1LQDB 4WMFA 1QQ4A 2ZGCA 1MCTA 3TJOA 3E91A 1GVZA 3ZZ9A 2NU1E 5BRRE 3EE0B 1O2RA 4H4FA 2GCTC 1ZLRA 1WTGH 3U98H 3MOCA 3GDUA 3F1SB 2QXJA 1DOJA 1Y3WA 2BOKA 2A5AA 1V2ST 2Z9GA 2DE8A 5LPFA 1TPAE 1ZPCA 3RLYH 4BANB 1Z8JB 2SGAA 4X0WU 1FZZA 1MUEB 3VXEH 1V3XA 1XKBC 4FU7A 3P70B 1OWKA 3ESTA 3RXIA 2J38A 5DP6A 1IQMA 5DG6A 2IOTA 5ESBA 1BB0B 1E37B 2A4QA 1C1UH 2NU2E 4Q80A 1XVOA 3RXHA 1P05A 3V7TA 4GVUA 1F5KU 4I31A 2TGPZ 4RKJB 2H5DA 3M5OA 4VGCC 2A32A 3ZYDA 1HAHH 1UTJA 2A5IA 1QB1A 1ANEA 1K1IA 1TPOA 2AGIX 3CS0A 1P0SH 2ZCHP 3TJNA 1EJAA 1TNKA 1TGSZ 1VJAU 3TH4H 4CHAC 2P8OC 1UK2A 1O35A 4D7FA 1FIZA 5AVDA 1MBMA 1GDUA 3E0PB 2A4OA 1VZQH 3D23A 3BTQE 3LGUA 1EQ9A 5LPEA 2F9VA 3T5FH 1UVPA 1GJ5H 4MTBA 4ABBA 1BHXB 3HK3B 2VIOA 3AVZA 3ZZ7A 3KQBA 1H4WA 2VU8E 4O3TA 4BTUB 3UQVA 1C1QA 1P57B 1P10A 1E36B 5C1UA 1HBTH 2ZQ2A 1ZRKA 1M9UA 2FLBH 1A3EH 3GYLB 5SGAE 1AE8H 4Z6AH 4BXSA 1TYNA 1YCPH 1MMJN 1TOMH 2J92A 1ELDE 3RU4E 1SVPA 2ANWA 3VEQB 6LPRA 3ZZ3A 1FY3A 2ZDKA 5AFZH 1K1LA 3MNSA 1CHOF 4KKDA 4DG4A 2YOLA 4JZFH 1JMOH 1AIXH 3GYMA 4WH8A 1H8DH 1GJ4H 3SU0A 1P04A 4MPWA 3VFEA 2ZF0H 2VINA 3SV7A 4K1TA 3ZVBA 2BYAX 1WTHD 5GXPA 1WYKA 1Z8GA 2XC0A 3A83A 5GWZA 2XW9A 4Y11E 4AOQA 3SU5A 1SSXA 2F83A 2ZGHA 3GCHC 2AEIH 1GBAA 3GY3A 1C5UA 5FAHA 5FPYA 2SGPE 1NO9H 1RGQA 2J34A 1LHDH 3Q3KA 2Y80A 4HI3A 1C1TA 1W7XH 1ZOMA 1GBCA 3HGPA 1C4U2 3H7TA 5GIBA 1O33A 1P2IA 3GDVA 1KDQA 1TX6A 2IN2A 3RXRA 4FXGH 1BRUP 5DP4A 1EXFA 3S0NA 1OX1A 3ZVDA 1N6YA 4GHQA 1AUJA 1FUJA 1G9IE 1ZSKA 1FLEE 3B9FH 4I32A 1Z1JA 4X1SU 1L1NA 1RFNA 1NFXA 4CR9A 1TNJA 1DLKB 4AGKA 3GICB 1CGHA 1MKXH 4NIWA 3U1IB 2BD2A 1BQYA 1DITH 4ZAEA 3SV9A 4E7NA 1P3EA 2Y5GA 1RTLA 1O3MA 3L33A 1KXBA 2V0BA 1BRCE 2EI7A 2PKSC 3QGNB 3UR6A 3LGTA 1H9HE 1NC6A 2VWNA 1VGCC 1CGJE 3M3VA 1WQVH 5FX6A 5AFYH 5B6OA 3PTBA 4WH6A 4CHAB 2W5EA 5T3HA 4CRGA 1AKSA 2ALVA 2EC9H 1SLXB 1TE0A 2BQWB 2OC0A 1ORFA 1VITG 1DICA 5DJ7A 1GL1A 1ZSLA 1QBOA 1LKAA 2BVSH 1NFWA 4Q7YA 1UTNA 2BXTH 1SFQB 4NFFA 2HLCA 1WAYB 4I8HA 1C2EA 1OWEA 1ZGIA 5HYOA 2Z9LA 3MI4A 2K1QA 1LHGH 1O3IA 2PFEA 2OC1A 5DP7A 3STIA 4YLUA 2AIPA 3ZZ4A 1EAUA 1GHZA 3Q3YA 3RP2A 1D3QB 1EP5A 2GX4A 1SPJA 2J2UA 1SMFE 2FWWA 1RTKA 3KQDA 4ABGA 1A61H 3PLKA 2Q6GA 1O2GH 5DKMA 5GCHG 1O36A 2BDCA 1MU8B 1VCQA 4JK5A 4ZKOU 1A5GH 2ANMH 4JK6A 1ANBA 1H9IE 4GSOA 1LHFH 3PLBA 3PWBA 2JH6D 3TNTA 4TY7A 4KP0A 4A1TA 1C1NA 3RXOA 4ZKSU 1Z71A 3P8GA 1C1RA 3SOSA 3TNSA 5FBEA 2ZU4A 2NU4E 1O3DA 4FVDA 5FCRA 4BOHA 3UUZA 1D4PB 1PQ7A 5J4SA 1DY9A 5JPMH 1MD7A 1XUIA 4B74A 3TJUA 1O37A 1GJBB 3BTTE 1W7GH 2UWOA 2B5TB 2C8ZB 3V12A 4ABFA 1BDAA 3P92A 5CHAC 1CA8B 5EW1H 4AORA 4CBNA 1C2FA 3EQ0H 3BIVH 1TRYA 4X1RU 1DFPA 3UNRA 1TGTA 3LJOA 1BUIA 1GMCG 2FI5E 2OINA 2R9PA 4GCHG 2GKVE 3RM2H 4X1PU 1O3HA 2J95A 3RXGA 4XBDA 1LHEH 1WUNH 1A0JA 4KTSA 3NPSA 4IN2A 3BSQA 3OY5U 4MPVA 2AMDA 1RXPA 4FUIA 2FIRH 3LGIA 2G52A 3ZVEA 1BITA 2B7DH 3DFJA 4CRDA 4MLFB 1HAVB 2BLOA 2CHAB 2FMJA 2ODYB 3T26A 1EOJA 5L2YH 3MU0A 3BEUA 2H9HA 2P3TB 5BPEA 3MU8A 3RC4A 2SGFE 1OWJA 2CF8H 3HGNA 4HZHA 1C1OA 4JCNA 4U30A 3EA8A 4YOIA 5FX5A 1GHYH 3PTNA 2YNAA 1ELGA 1HJ9A 1BRAA 1PQ5A 1YKTA 1E35B 1GHAG 1QURH 3I29A 4TY6A 3SUGA 4D7GA 1L1JA 2BB4A 1AHTH 3LGWA 3DUXH 2PKSB 1BTYA 1TPPA 3P8FA 5LGOA 3LC3A 1ZSJA 2NU3E 1QBVH 2F9PA 4D9RA 3OSYA 1THSH 1GBFA 2RG3A 2ZQ1A 1A46H 1GBEA 1IQEA 2QV1A 2PSYA 4THNH 1UHBA 1ELVA 1FY5A 1O0DH 5T6FA 2Z3EA 1GVLA 1BJUA 1GDNA 2D8WA 1HAZB 2A0QB 2AMQA 2I6SA 1IQIA 1DM4B 2WPIS 3M7TA 4TYDA 2RA0A 1FN6A 1SGRE 4I8KA 1S0RA 1KXFA 1DSUA 2OC7A 3ATMA 1TA6A 1C4Y2 2KAIB 1NRPH 3MU5A 3A80A 3QZQA 1TMTH 4I8JA 3RXPA 5FHTA 1A0HB 2DE9A 3D49H 3QWCH 3FP8E 2VIPA 1NROH 3E8LA 5EQQA 1AB9C 4NIVA 1D6RA 2FEQH 2FOMB 3KNXA 3ZZ6A 4AFSA 2PWXA 1YPEH 1TAWA 5AF9H 1W0ZU 5HM9A 5C1XA 2PGQB 1YCPM 4AFUA 4B76A 3O8DA 4SGBE 1C5ZB 2W7UA 4B2AA 4Y79A 1TX7A 5G4BA 2XCFA 2OQ5A 2ESTE 4B2BA 1FXYA 3LJJA 1CT0E 2ZKSA 1P2QA 3QZRA 6CHAC 1QRXA 1GGDC 1LPGB 2ZHFH 4DIIH 3A84A 3A89A 8KME2 2O8MA 3VB3A 2P59A 5CHAB 5EOKA 4Z0KA 2Z3CA 1NRNH 4YESB 3SNAA 1O2XA 3K9XB 1BIOA 1YM0A 2C93B 1W11U 2FOFA 1NT1A 2F9NA 3U8OH 1KIGH 3FZZA 1IHTH 1GJ9B 3M3TA 1TGCA 2STAE 1C1PA 1JBUH 1Z8IB 2VIDA 5L6NH 2GVFA 3BEFB 2HVXA 1O3KA 1YPJH 1UTLM 3ATIA 1KXDA 3MH4A 1NRRH 3SU1A 3KQCA 3MYWA 4MPXA 1NFYA 1SOTA 2ULLA 4YOGA 4RSPA 2PKAA 4ZMAH 1XVMA 2FX6A 3VB7A 1C1WH 3PYHA 4YLQH 2JH0D 4F49A 4AG2A 1D9IA 1FY1A 1QGFA 2VVVA 2H9TH 1F0UA 1HAIH 1O3AA 1NN6A 2C8WB 2TPIZ 4BAQB 1BBRH 3GY7A 3LGYA 2XXLA 1IHSH 1RRKA 2Y82A 2VWMA 1ELEE 1NPMA 1HAGE 1S85A 2FYQA 3MTYA 3RMOH 1EATA 7GCHF 4FUFA 5JBTA 3RC5A 3HATH 3GOVB 5EXNA 4GHTA 2CXVA 2ZGJA 1MD8A 4ZXXH 2F9BH 3ATKA 3MO3A 3P6ZB 1E34B 1YBWA 2XC4A 4DOQA 3EGKH 2JETC 2XWBI 4IMZA 1BMLA 1XM1A 2ZDAH 2H6MA 1IQHA 3M7QA 1FMGA 4X8SH 1T32A 1Y3UA 5EPYA 5H4IB 2QGRA 4CREA 1OPHB 3QLPH 1GI3A 4J1YA 1ZMLA 1C9PA 2HALA 1KTSB 3FZDA 4MNYA 4BTIB 3A81A 1WBGB 5GPIB 2UUFB 1TABE 1C5XB 1IQJA 3ATLA 2B0FA 3LPRA 1F5RA 3ATWA 1K21H 2WPHS 1G2MA 3ZVFA 3KQEA 2AFQB 1GG6C 4JZDH 3TK9A 3RUOA 1F5LA 1KLJH 1O34A 1ZMJA 1AE5A 3UY9A 1GMHF 1QB9A 1W8BH 1C5PA 1OP8A 5I25A 1YLCA 3O8BA 5C67A 4NZLA 1O3BA 3BEIB 1O3CA 2OUAA 1GHBF 1GBTA 1O2HA 2J9NA 4BNRA 3S9AA 1EZUC 1AB9B 3AAUA 4XBBA 1BTXA 2BY9X 2LNCA 1LTOA 1YGCH 2FTMA 4NSVA 1V6DA 2BDBA 5ESTE 1ESAA 3F9GA 1MAXA 2HNTF 1WSSH 3LC5A 4RN6A 1FI8A 1ZJKA 3LOXA 4NG9H 1LKBA 5HM2A 4WMDA 2STBE 3A8CA 3T29A 3A8AA 3FFGA 1SG8B 3A7YA 3ZYEA 2IJOB 1DLEA 4XFQA 1C5YB 2D2DA 1YLDA 1GCDA 1CBWC 1EZQA 3U69H 1UVTH 1CGIE 1GGDB 4X1QU 3GY8A 1C2JA 2FM2A 2ZDNA 4AYVB 2SGDE 2ZCKP 1EUFA 1N8OC 1T8OA 4DIHH 5EU8A 3Q77A 3TH2H 1SGCA 2GZ7A 3RXFA 1MTNB 2ZWLH 5F8ZA 1GHXH 2XBWA 3E0NB 3VGCC 1G32B 2FYRA 5EXLA 3TPIZ 1AFQC 1SGTA 2EI8A 1O5CB 3P95A 1F2SE 2BD3A 2HWLB 3KL6A 3A7TA 3SNBA 1AGJA 2DUCA 2GT7A 1SLUB 2ZG0H 3T25A 1NU9A 1SGDE 1SQOA 3BN9A 2XCNA 4O3UA 4SGAE 3FAOA 2Z6BD 3AAVA 2ZZUH 4IBLH 1AU8A 3TGIE 2F9OA 1T4UH 1P12E 1V2QT 2ALPA 5CMXH 2ZDVH 1TBRH 1LQEA 2YNBA 1AWHB 1C4V2 5FPSA 1KDQB 3SGAE 1MKWH 4BAMB 1P06A 1NZQH 3GISB 3P17H 3SV6A 1Y3VA 3F68H 1Y8TA 3O8CA 1TB6H 2BM2A 3BF6H 4I8GA 5C2ZA 1OP0A 4KTUA 2JETB 3AW1A 3URDA 1TRNA 2CN0H 3A86A 2PV9B 1O2YA 3GY2A 2H2ZA 2XBXA 1F7ZA 3KN2A 2WYGA 4FU9A 3TK6A 1QQUA 3QO6A 1VCPA 1LCYA 1BTPA 1C5MD 5E8EH 4U01A 1S0QA 3KCGH 2BTCE 3RLWH 3NUMA 1DANH 1GG6B 1BMMH 1GI6A 1O2PA 2H9EH 1FN8A 2Y6TA 1YCPK 4UD9H 1QCPA 4Y7AA 1MCVA 2HNTC 1C5QA 1ZYOA 1FONA 4UONA 4FUHA 1GI0A 1JIRA 3RXQA 1ZHRA 2ZEBA 4AX9H 5F03A 1GWAA 1S82A 2BMGB 2A1DB 1HIAB 2A5KA 1E38B 5E0GA 3ELAH 3QGJA 1OYTH 2O8TA 3SGQE 2Q6FA 3LU9B 1SGYE 1V2VT 3UWJH 4X6MA 3F9EA 1TMBH 2BXUH 1HGTH 3PMJA 1P2JA 4JZEH 4UFDH 3O8RA 2BZ6H 2A4GA 3ZZ8A 1WU1A 1ZHMA 1PFXC 2O8UA 1MTWA 1GBBA 1CBWB 1PPBH 1O3OA 1Y5AT 2P94A 3SO3A 1HXEH 3KHVA 4IS5A 1DX5M 3ZVCA 1UTMA 1N8OB 1C5LH 1TIOA 2FOAA 2GCTB 5LH8A 4K1SA 1T8NA 1ETSH 2BLQA 2ZU1A 3PB1E 2G81E 4LXBH 3VGCB 1P2OA 1C5WB 1HJ8A 1XUFA 1YPGH 2FOEA 3A7ZA 1AI8H 2FZZA 3TVJB 1OWDA 3ZZDA 1PPFE 2OLGA 2FPZA 1PJPA 2UUJB 1ELCA 3K2UA 3OU0A 1F0SA 1ZMNA 4YOJA 2ANKH 1GJCB 3A7XA 2WUBA 5FXLA 1CHOG 1D3PB 4AZ2B 1TNLA 2G51A 2PR3A 1P02A 3BIUH 1OP2A 3EDXB 1O2WA 2G00A 1O3PB 1MKXK 1KLTA 1MQ5A 2GD4B 1FPCH 3DHKH 5JB8S 1GI9B 5EQRA 3SJ8A 1G3DA 4VGCB 1BTZA 2WV5A 2QXGA 1ZPBA 2SFAA 3AASA 1MZDA 1O2UA 1YPHE 2CMYA 2FTLE 4Y8ZA 3GDSA 2A7HA 1O2NA 3RMNH 1OXGA 5AHGH 1GI4A 2P8OB 3VXFH 1HYLA 2BQ6B 2J4IA 1ANDA 1NU7B 4H6TA 4X2VA 3E1XB 2O8LA 4X6OA 5L2ZH 3SQEE 4ABIA 2VB0A 2PSXA 1ZJDA 2FODA 2QXIA 3MH5A 1O3EA 1UTPA 4O97A 1BMAA 1HLTH 1KXAA 1SGFG 1AWFH 3LIWA 1HUTH 3UR9A 1GJ7B 3UNSA 1GBLA 2BLWA 1GI7B 1AUTC 2QCYA 3STJA 1QTFA 3FVFB 2GV6A 3U9AH 1HRTH 2HOBA 1JIMA 1S6FA 1XUJA 3RXVA 1V2MT 2ZCLP 3BTDE 2QA9E 4B75A 3MNBA 3RXJA 1CO7E 3RXKA 1WQSA 2TIOA 3C1KA 3MH7A 3GCTF 1Y3XA 1SQTA 2OQUA 3M36A 3MMGA 3QTOH 4HTCH 5DP8A 1RIWC 1PPHE 3M7UA 1Z6JH 2CJIA 2ZPRA 2WPJS 5JBBS 3K65B 2HGTH 2UWPA 1K1MA 3L6PA 3OX7U 3RXMA 1MQ6A 3PLPA 2RDLA 3C27B 2VVUA 1GBHA 4A5TS 4Y6DA 4FUBA 3MH6A 4AG1A 3RXBA 1G30B 3PMAB 1O30A 4CRFA 4X2XA 1FDPA 3GCHB 4Y0ZE 1MAYA 2BHGA 1C2LA 2V3OH 2ZO3H 1VR1H 3CP7A 3LDXH 1DWDH 1BOQA 1K28D 4R0IA 2GGVB 3SU3A 3M5MA 3UQOA 4A92A 1TNIA 2XTTB 4NIXA 4Y71A 4BAHB 1C5OH 1QRWA 2Z9KA 1TQ7B 1GI2A 5F8TA 4K8BA 3SJIA 1PPZA 1BTHH 3CENA 3GCTG 2G8TA 4K1EA 4LOYH 4FUEA 4CRCA 1K1NA 5E0JA 3EA7A 2ZFRH 3GY4A 4K8YA 5EXMA 1C5RA 4BXWA 3ZZ5A 1HDTH 4E7RG 2ZTXA 2ZTZA 1FV9A 1SB1H 1RJXB 2OC8A 2XWAA 2XC5A 3ZZCA 1UK3A 1SOZA 4AFQA 2WV4A 4U32A 1SFIA 1QIXB 2PHBA 1J16A 2A45B 2GZ9A 1GPZA 4ZHAA 3SU2A 1GBMA 1UO6A 1QL7A 3PO1C 5HGGA 1VJ9U 1VGCB 2VGCC 1G37A 1RS0A 2ZIQH 2WPMS 4IGDA 5F8XA 3M5LA 3VB6A 2ZGBH 2A7JA 1ESTA 1DUEA 2GV7A 3D62A 2PKAB 4JYTA 5ETXA 5C3NA 3DD2H 1A3BH 1OS8A 1QR3E 2F9UA 2WPLS 5K0HA 4BTTB 1SGIB 2V3HH 3SBKA 1ID5H 4DJZB 2FO9A 4OS5A 2ZECA 1CA0C 1AMHA 1T8LA 1AO5A 2SNVA 4NFEA 4CRAA 1O2LA 1GHWH 3WY8A 1SQAA 3UREA 1PYTC 5ABWA 1AVGH 1C5VA 2JKHA 1EB1H 1Z7KA 2SGEE 4CR5A 4CH8B 3UFAA 1H1BA 4Y8YA 4JZ1A 3V3MA 1AN1E 1A5HA 4DCDA 1XXFA 3VB4A 3UOUA 5A0BA 2BD4A 3VB5A 1CT4E 1KLIH 3AW0A 1GMDF 4ISHH 2ZHQH 2SNWA 2ZFTA 4O03A 5T6GA 4WJG2 1O2SA 1V2TT 1NM6A 4Y10E 2VIVA 3LH3A 5DP3A 1QFKH 3QUMP 1THRH 1P09A 7ESTE 2CGAA 1FPHH 2M5TA 3D65E 2VJ1A 4YT6H 2TRMA 1LPKB 4FU8A 4RKOB 2EA3A 1BTWA 4ZKRU 3TGKE 2C8XB 1HAVA 2W7SA 2WUCA 1HCGA 2Q1JA 1O32A 4MNVA 3KIDU 5CE1A 1VITH 8ESTE 1ZZZA 3LT3A 5GJ4B 3S7KB 3E90B 2QC2A 2GDDA 2GCHF 4ABJA 2TGTA 4CH2B 1IOEA 2V35A 3I77A 4INHA 3TLOA 6GCHF 1PPCE 1T7CA 2ZU5A 3B8JA 1YPLH 2F3CE 1IQNA 8GCHF 1BBRK 1ETRH 1EAWA 1T4VH 4Y0YE 4ZXYH 5A8YA 1O5EH 5E2PA 3GCOA 1ELBA 2AYWA 1QB6A 2ZGXH 1D6WA 3TITA 3PMBB 1UCYE 1IQFA 2Y5FA 1PQ8A 1O3NA 3OTJE 3MWIU 1XUGA 1SHHB 4MQAA 4XBCA 2TGDA 4I7YH 1HNEE 4E06H 4NZQA 4WWYA 2NU0E 1OWIA 1TGBA 1DT2A 1CT2E 2R3UA 4NGAH 2A7CA 2GT8A 3U8RH 1IQKA 2VGCB 5DGJA 4ZH8A 4AN7A 4LZ1H 2PTCE 1CQQA 3QDZB 2VIQA 2Y81A 2ZDMA 3P8NA 1Z8RA 1CHGA 4XDEA 3DA9B 1AVXA
chains in the Genus database with same CATH superfamily
4D9QA 1EJMA 5T1VA 4RT0A 2WYJA 1UVOA 2QYIA 5C1YA 1T8MA 4K69A 4D76A 1QJ7B 4MNWA 1T31A 3Q76A 4K2YA 1G2LA 2GP9B 1AVWA 4NCYA 4XOJA 1NFUA 3TH3H 2AGGX 1CA0B 4ZHLU 2ZPQA 4RT1A 3SW2B 1MZAA 3KF2A 1W2KH 3MU1A 4FUGA 3NRLA 1P9SA 5HXFA 3NK8A 1EPTA 1U6QA 4JYVH 1QBNA 3MO9A 4UEHH 1ARBA 2ODPA 2Z9IA 5A0AE 1C9TA 3BTME 1MTSA 4DY7B 7GCHG 2PGBB 1VKYA 2ZP0H 1IAUA 2C3SA 1C1MA 3A82A 4LK4A 2RA3A 1UCYK 2BX4A 4ZHMU 1TNHA 1INCA 5A8ZA 3TIUA 1GBKA 2BQ7B 1SL3A 1FY8E 3OY6U 4O9VA 4A7IB 1O5GH 6CHAB 2AGEX 3IWMA 1UTOA 3JZ2B 5JYIA 2GTBA 5A8XA 3ZZBA 2Y7XA 2BD5A 1AZZA 2AMPA 1ZR0A 3BTEE 2LPRA 3V0XA 1C2HA 3BTGE 2GMTC 2YMSC 3GY5A 3SUEA 4YM9A 4UFFH 1GMHG 3RC6A 1ETTH 4OS4A 1XUHA 4X1NU 2KM0A 1Y3YA 2ZPSA 1ELAA 4ABHA 2R3YA 5E0HA 1MU6B 4UE7H 4TWWA 1E0FD 4JYUH 1LVYA 2BX3A 3T27A 3UPEA 3RMLH 1YPKH 5C0TA 1GHBG 1AFEH 1DDJA 2JH5D 1G36A 1OOKB 2W26A 2Z3DA 3MO6A 1BT7A 2A2QH 2GDEH 1V2JT 2FDAA 1PPGE 1B0EA 5A09A 2BDAA 5A2MH 1ZGVA 8LPRA 5EODA 2XNIA 4AYYB 1H9LB 5GDSH 3PV4A 2ZFFH 2G5NA 2HPPH 4Q7XA 3RDZA 3RU4T 1K0HA 4X8TH 1Q2WA 4U2WA 1ANCA 2EI6A 1NRSH 4GPGA 1S5SA 4WY3A 3RMMH 4IC5A 2FI4E 1MKWK 3N7EA 2WV9A 1TNGA 4NWLA 2R2MB 2BVRH 4OS1A 2BVXH 2ILNA 4UDWH 1C5SA 3JZ1B 4IMQA 1H8HD 1HV7A 2P95A 5JB9S 1MH0A 3SJKA 3NZIA 5PTPA 3P8OA 3RXSA 2BZAA 1ZRBA 1TWXB 1EFRD 1Z1IA 3U28C 3SU4A 4Q7ZA 2Y7ZA 3IG6B 3UWIA 4Q4LA 4ZROA 2Z9JA 4D8NA 1DE7H 1HFDA 1BRBE 1GCTC 1C1SA 1HAXB 1G3EA 1TA2A 2QXHA 1NRQH 4AB9A 2ZC9H 1UTKA 1YPMH 3QK1A 2VH0A 3UB0A 2J94A 3PV2A 1SR5C 1P03A 3A88A 5I46H 4OGXA 3W95A 4ZUHA 2ANYA 1N6XA 5DO4H 1GDQA 2C8YB 1EKBB 1V2WT 4K3JA 1YYY1 1D3DB 7KMEH 1EX3A 2FS9A 3SI4H 1MTUA 1QRZA 1S84A 2ODQA 2J98B 1W0YH 5F6MA 3N7OA 2H5CA 2KCAA 1AKSB 1ZPZA 1HAYB 3BTHE 3M37A 1DSTA 3Q3XA 4ZKNU 1GI5A 3LGVA 4HG6A 1GHVH 3PMHB 4NWKA 3RM0H 1OSSA 3U8TH 1O2VA 3HPTB 2JIZD 3PM3A 2QN5T 3EYDA 2ZHWH 3SU6A 1O2IA 2FOBA 1PQAA 4XD7D 2FX4A 1GJ6A 4FUJA 1P2MA 1PYTD 1L4ZA 5EJ1A 1A7SA 1E79D 1Y59T 3FO8D 1V2OT 3BTKE 1S6HA 5K7RA 3SNCA 3KGPA 3BG8A 1B0FA 1YPHC 4X6NA 2OCVB 1ZHPA 5IYTA 4AGJA 1WOFA 1V2PT 1V2LT 2ZHEH 3A7VA 3RXUA 1C5NH 5DP9A 1A1RA 2GMTB 1CU1A 2YMSB 3DT0H 1P01A 1NS3A 1LMWB 1AFQB 3M35A 1NBMD 1VITF 2HNTE 1GL0E 3SHCH 1GBIA 5KEDA 3KEEA 3T62A 3HKIB 1B5GH 2UUKB 1DXWA 5JBAS 1TGNA 2XBYA 4IC6A 4ABAA 2AH4X 3B23B 3CS7A 3L3TA 5EPNA 1O5DH 3SQHE 1P3CA 4YO9A 4DVAU 1L2EA 4FVBA 3E6PH 1J9CH 1IQLA 2CHAC 1W12U 1MTVA 4MNXA 1J17T 5B6LA 5E2OA 5GCHF 5FPTA 3UTUH 2PW8H 3K6ZA 2G55A 1QY6A 1JRTA 4QT8C 1EASA 3NCLA 2UWLA 4Y8XA 2ZTYA 3ZV8A 1S6LA 1TX8A 2ZFQH 3BG4C 2PTNA 1EOLA 5TCAA 3RXAA 1SI5H 2PLXA 5J4QA 2G5VA 2R0KA 4ESTE 3LKWA 1BZXE 4UFGH 3SUFA 1RTFB 1FNIA 1QA0A 1TPSA 3RXEA 3S9CA 1LVMA 4B2CA 1FY4A 2BD9A 5EQSA 1C2KA 1HIAA 2VIWA 1AQ7A 1C2DA 2R2WU 1GCTB 3SNEA 5L30H 3S69A 1P2KA 4YT7H 4MVNA 4X8UH 5EJLA 4NA9H 1AD8H 2CF9H 2BD8A 1Q3XA 2QIQA 1C2IA 1O5FH 2K0QA 2WSSD 2B9LA 4YZUA 4FUCA 3H7OA 1CSOE 1GMCF 4JMYA 3F9FA 3SUDA 4GCHF 3PWCA 5C20A 4ASUD 4DW2U 1LVOA 1OWHA 1A2CH 1FAXA 4P00A 3E3TA 2R0LA 1J8AA 4GUXA 1DVAH 2QF0A 2WPKS 1F0TA 2P3FH 1WXRA 2BD7A 5HMAA 3A7WA 1JXPA 2D1JA 4UFEH 3F9HA 2QAAA 2B8OH 2D26C 3G01A 4X8VH 2RCEA 1DWBH 1TQ0B 1UHBB 2EQNA 4AB8A 3DFLA 1FAKH 2BY8X 6ESTA 4BAKB 1O3GA 1WV7H 3MHWU 2WINI 3A87A 1AZ8A 4I8LA 4X2WA 1HPGA 5DK1A 4JZIA 1SC8U 2XBVA 3E16B 4NA8A 1GHAF 1TRMA 1O38A 1XKAC 1O2MA 2FXRA 2P3UB 4ASHA 1PPEE 4OM9A 2ZNKH 1ZTJA 3A8DA 3ZVGA 1FIWA 1A5IA 1O2OA 4KELA 1EPTC 1XUKA 2VH6A 2HPQH 1ABJH 1ELTA 1DS2E 4ABDA 1W14U 1ZTKA 5C5NA 2F43B 2EEKA 2K8IA 2OBOA 2FLRH 3PROA 1KXCA 3VPKA 1QNJA 4MPUA 9ESTA 3ITIA 1LDTT 1UJ1A 2O8WA 2VNTA 1KXEA 2CV3A 3BV9B 1O2JA 4H42U 9LPRA 3DSGA 1THPB 4WMEA 1TONA 1SHYA 1K9OE 3SV8A 2OD3B 1TLDA 1ABIH 1BTUA 2ZHDA 2OK5A 1VCWA 3GCNA 2Y5HA 4TSFD 5LPRA 3OYPA 2ZA5A 4K5ZA 1XMNB 2ASUB 3QTVH 4YTAA 3T28A 1ARCA 4ISLA 3TU7H 1W13U 1NY22 2XYAA 3F2HA 3SORA 3NWUA 2A31A 5HIZA 5EW2H 2P93A 1OKXA 5C17A 3RXDA 1C2MA 2BDHA 2YMSD 3ZZAA 4J2YB 1TBZH 2O9QA 4BAOB 3MU4A 3IITA 3QX5H 4B1TA 4PROA 2BY7X 1ELFA 5KGOA 1JRSA 4ABEA 1B7XB 1P9UA 3HK6B 2C90B 2VWLA 2ZU2A 1O39A 2AERH 1NESE 2FESH 1QJ1B 1XXDA 3BG4B 1CVWH 1C2GA 4OS7A 1KSNA 4XE4A 1SGNE 1TFXA 4INLA 1EB2A 1O2ZA 4OS2A 1TOCB 1MBQA 5EGMA 1NTPA 2FP7B 5GNDA 1O2TA 3SN8A 3ZIAD 1O5AB 1V2UT 1RD3B 3N7DA 2AIQA 3EA9A 1UVSH 1P11E 5JDUB 1DWCH 1LPZB 1TMUH 2FS8A 1UTQA 3ZV9A 3RU4D 3OEHD 5EIYA 1S81A 3QN7A 1GVKB 1LO6A 3I78A 2BOHB 1BBRE 2Q6DA 5JBCS 1A4WH 4MG3A 1HAPH 2TBSA 1TALA 4F4OC 1QA7A 3LH1A 2BLVA 3ODDA 1GJAB 2C4FH 3FP7E 3RXCA 1RIWB 1UK4A 3HKJB 4Q2KA 2BDYA 1GJDB 1HB0B 1DUAA 1EJNA 1UMAH 2G4UA 3R0FA 4KTCA 4WXVA 4XSKU 1K1PA 1SGEE 1W0JD 1HAOH 3KYGA 3SNDA 1HJAC 3SJ9A 1BHXF 3TJVA 2QF3A 4MDSA 5DP5A 4ISNA 3MNXA 4B73A 1GI1A 3BTFE 4B71A 2AS9A 4OS6A 3OE7D 1DWEH 2THFB 2GZ8A 2M2AA 2FOGA 1DXPA 1V2RT 1Y5UT 4GLYA 1SGPE 3RXLA 2Z7FE 3URCA 4A6LA 1KMHB 2FOCA 3K6YA 3SI3H 1YP9A 3RXTA 3A8BA 1EZXC 2VVCA 2ZFSA 1F92A 2G4TA 2TGAA 2OP9A 4H6SB 1YC0A 1BMNH 2HRVA 1FQ3A 1QL8A 2IJD1 2A2XH 2OXSA 1BA8B 4HFPB 1CE5A 1GBJA 1ACBE 1V2NT 2UUYA 3BTWE 2BDGA 1SLVB 1G3BA 2P16A 1J14A 7LPRA 3S9BA 4R8TB 1BCUH 2QY0B 1GI8B 3MNCA 1SKYE 1ZTLA 2NWNA 4HGCA 1EPTB 4TWYA 4Y76A 2W3IA 2KX4A 1BJVA 1SBWA 1Z6EA 4WF8A 1L4DA 2BY5X 1Y5BT 1EP6A 4OGYA 5DPAA 1MTNC 3R3GB 3UOPA 1D3TB 1O3JA 1IQGA 2H1UA 1V2KT 1O2KA 2FI3E 3M61U 5A0CA 5FCKA 1N1LA 5FBIA 1G3CA 1YY3A 4X6PA 2XRCA 5FL7D 1W10U 2W3KA 3U1JB 1O5BB 3SJOA 2PUXB 3ZVAA 1GBDA 4I33A 2PP6A 1KYNA 2OTVA 1NBME 1GMDG 1H8IH 4TPIZ 2FOHA 4IN1A 1C5TA 3LONA 4LZ4B 2V6NA 3VG8A 2BY6X 3MFJA 5TJXA 3UNQA 1FJSA 3FP6E 1O3FA 1S83A 1AY6H 3FANA 3PO1B 4KGAA 2EY4C 2KAIA 1DY8A 3F6UH 1ESBA 4NSYA 2A4RA 4WXIA 1YF4A 4M7GA 1K1JA 1K1OA 1K22H 1EAIA 3DCLA 1WCZA 3NXPA 3ENSB 3M3SA 5C5OA 3UIRA 4A1VA 1XX9A 2VWOA 1X7AC 1A0LA 5TCCA 3N99A 2ZDLA 4ISIH 1EAXA 2Z94A 1Q31A 3TGJE 4ISOA 1J15A 4GAWA 3SGBE 2F91A 3SHAH 4K60A 4A1XA 4INKA 5IK2D 5T6DA 4IW4E 2ZFPH 2GCHG 2BDIA 1JOUB 1BMFD 4NIYA 3AK5A 3T2NA 6GCHG 3V13A 4FUDA 1O31A 1GJ8B 1F0RA 3A85A 3GY6A 4AFZA 8GCHG 1TBQH 4Y7BA 4E05H 1SGFA 1SLWB 4X2YA 2PUQH 1LVBA 1O2QA 2I6QA 3ODFA 1UVUH 1L0ZA 1HJAB 3OFND 1C1VH 1KY9A 1QL9A 3SZNA 3M5NA 1KTTB 3WW7A 3F2FA 1O3LA 1OYQA 1QHRB 1JWTA 3H5CB 3S7HB 4WVPE 3EAJA 2ZU3A 4DGJA 1P2NA 3Q00A 2IPHA 4CBOA 5EG4A 1LHCH 3NKKA 4TPYA 2OBQA 4CRBA 2ZI2H 1DPOA 3W94A 4NA7A 4DURA 4DT7B 1HXFH 4B6EA 1P8VC 1UCYH 3TK5A 1K2I1 1QJ6B 5IDKA 1SGQE 3SV2H 2SGQE 1L1GA 1W3CA 1EZSC 1LQDB 4WMFA 1QQ4A 2ZGCA 1MCTA 3TJOA 3E91A 1GVZA 3ZZ9A 2NU1E 5BRRE 2KFWA 1O2RA 3EE0B 2GCTC 4H4FA 1ZLRA 1WTGH 3U98H 3MOCA 3GDUA 3F1SB 2QXJA 1DOJA 1Y3WA 2BOKA 2A5AA 1V2ST 2Z9GA 2DE8A 5LPFA 1TPAE 1ZPCA 3OTPA 3RLYH 4BANB 1Z8JB 2SGAA 4X0WU 1FZZA 1MUEB 3VXEH 1V3XA 1XKBC 4FU7A 3P70B 1OWKA 3ESTA 3RXIA 2J38A 5DP6A 1IQMA 4FETA 5DG6A 2IOTA 5ESBA 1BB0B 1E37B 2A4QA 1C1UH 2NU2E 4Q80A 1XVOA 3RXHA 1P05A 3V7TA 4GVUA 1F5KU 4I31A 2TGPZ 4RKJB 2H5DA 3M5OA 4VGCC 2A32A 3ZYDA 1HAHH 1UTJA 2A5IA 1QB1A 1ANEA 1K1IA 1TPOA 2AGIX 2F4LA 3CS0A 4AC9A 1P0SH 2ZCHP 3TJNA 1EJAA 1TNKA 1TGSZ 1VJAU 3TH4H 4CHAC 2P8OC 1UK2A 1O35A 4D7FA 1FIZA 5AVDA 1MBMA 1GDUA 3E0PB 2A4OA 1VZQH 3D23A 3BTQE 5CHBA 3LGUA 1EQ9A 5LPEA 2F9VA 3T5FH 1UVPA 1GJ5H 5CDFE 4MTBA 4ABBA 1BHXB 3HK3B 2VIOA 3AVZA 3ZZ7A 3KQBA 1H4WA 2VU8E 4O3TA 4BTUB 3UQVA 1C1QA 1P57B 1P10A 1E36B 5C1UA 1HBTH 2ZQ2A 1ZRKA 1M9UA 2FLBH 1A3EH 3GYLB 5SGAE 1AE8H 4Z6AH 4BXSA 1TYNA 1YCPH 1MMJN 1TOMH 2J92A 1ELDE 3RU4E 1SVPA 2ANWA 3VEQB 6LPRA 3ZZ3A 1FY3A 2ZDKA 5AFZH 1K1LA 3MNSA 1CHOF 4KKDA 4DG4A 2YOLA 4JZFH 4TT3D 1JMOH 1AIXH 3GYMA 4WH8A 1H8DH 1GJ4H 3SU0A 1P04A 4MPWA 3VFEA 2ZF0H 2VINA 3SV7A 4K1TA 3ZVBA 2BYAX 1WTHD 5GXPA 1WYKA 1Z8GA 2XC0A 3A83A 5GWZA 2XW9A 4Y11E 4AOQA 3SU5A 1SSXA 2F83A 2ZGHA 3GCHC 2AEIH 2CK3D 1GBAA 3GY3A 1C5UA 5FAHA 5FPYA 2SGPE 1NO9H 1RGQA 2J34A 1LHDH 4F48B 3Q3KA 2Y80A 4HI3A 1C1TA 1W7XH 1ZOMA 1GBCA 3HGPA 1C4U2 3H7TA 5GIBA 1O33A 1P2IA 3GDVA 1KDQA 1TX6A 2IN2A 3RXRA 4FXGH 1BRUP 5DP4A 1EXFA 3S0NA 1OX1A 3F2GA 3ZVDA 2XOKD 1N6YA 4YXWD 4GHQA 1AUJA 1E1QD 1FUJA 3SZEA 2LP6A 1G9IE 1ZSKA 1FLEE 3UAIC 3B9FH 4I32A 1Z1JA 4X1SU 1L1NA 1RFNA 1NFXA 1UW7A 4CR9A 1TNJA 1DLKB 2J5UA 4AGKA 3GICB 1CGHA 1MKXH 4NIWA 3U1IB 3DSPA 2BD2A 1BQYA 1DITH 4ZAEA 3SV9A 4E7NA 1P3EA 2Y5GA 1RTLA 1O3MA 3L33A 1KXBA 2V0BA 1BRCE 2EI7A 2PKSC 3QGNB 3UR6A 3LGTA 1H9HE 1NC6A 2VWNA 1VGCC 1CGJE 3M3VA 1WQVH 5FX6A 5AFYH 5B6OA 3PTBA 4WH6A 4CHAB 2W5EA 5T3HA 4CRGA 1AKSA 2ALVA 2EC9H 1SLXB 1TE0A 2BQWB 1QZ8A 2OC0A 1ORFA 1VITG 1DICA 5DJ7A 1GL1A 1ZSLA 1QBOA 1LKAA 2BVSH 1NFWA 4Q7YA 1UTNA 2BXTH 1SFQB 4NFFA 2HLCA 1WAYB 4I8HA 1C2EA 1OWEA 1ZGIA 5HYOA 2Z9LA 3MI4A 2K1QA 1LHGH 1O3IA 2PFEA 2OC1A 5DP7A 3STIA 4YLUA 2AIPA 3ZZ4A 1EAUA 1GHZA 3Q3YA 3RP2A 1D3QB 1EP5A 2GX4A 1SPJA 2J2UA 1SMFE 2FWWA 1RTKA 3KQDA 4ABGA 1A61H 3PLKA 2Q6GA 1O2GH 5DKMA 5GCHG 1O36A 2BDCA 1MU8B 1VCQA 4JK5A 4ZKOU 1A5GH 2ANMH 4JK6A 1ANBA 1H9IE 4GSOA 5EJZA 1LHFH 3PLBA 3PWBA 2JH6D 3TNTA 4TY7A 4KP0A 4A1TA 1C1NA 3RXOA 4ZKSU 1Z71A 3P8GA 1C1RA 3SOSA 3TNSA 5FBEA 2ZU4A 2NU4E 1OHHD 1O3DA 4FVDA 5FCRA 4BOHA 3UUZA 1D4PB 1PQ7A 5J4SA 1DY9A 5JPMH 1MD7A 1XUIA 4B74A 3TJUA 1O37A 1GJBB 3BTTE 1W7GH 2UWOA 2B5TB 2C8ZB 3V12A 4ABFA 1BDAA 3P92A 5CHAC 2KCPA 1CA8B 5EW1H 4AORA 4CBNA 1C2FA 3F0PA 3F3BA 3EQ0H 3BIVH 1TRYA 5DSFA 4X1RU 1DFPA 3UNRA 1TGTA 3LJOA 1BUIA 1GMCG 2FI5E 2OINA 2R9PA 4GCHG 2GKVE 3RM2H 4X1PU 1O3HA 2J95A 3RXGA 4XBDA 1LHEH 1WUNH 1A0JA 4KTSA 3NPSA 5HKKD 4IN2A 3BSQA 3OY5U 4MPVA 2AMDA 1RXPA 4FUIA 2FIRH 3LGIA 2G52A 3ZVEA 3MQKC 1BITA 2B7DH 3DFJA 4CRDA 4MLFB 1HAVB 2BLOA 2CHAB 2FMJA 2ODYB 3T26A 1EOJA 5HIYA 2JJ1D 5L2YH 3MU0A 3BEUA 2H9HA 2P3TB 5BPEA 3MU8A 3RC4A 2SGFE 1OWJA 2CF8H 3HGNA 4HZHA 1C1OA 4JCNA 4U30A 3EA8A 4YOIA 5FX5A 1GHYH 3PTNA 2YNAA 1ELGA 1HJ9A 1BRAA 1PQ5A 1YKTA 1E35B 1GHAG 1QURH 3I29A 2XNDD 4TY6A 3SUGA 4D7GA 1L1JA 2BB4A 1AHTH 3LGWA 3DUXH 2PKSB 1BTYA 1TPPA 3P8FA 5LGOA 3LC3A 1ZSJA 2NU3E 2KCYA 1QBVH 2F9PA 4D9RA 3OSYA 1THSH 1GBFA 2RG3A 2ZQ1A 1A46H 1GBEA 1IQEA 2QV1A 2PSYA 4THNH 1UHBA 1ELVA 1FY5A 1O0DH 5T6FA 2Z3EA 1GVLA 1BJUA 1GDNA 2D8WA 1HAZB 2A0QB 2AMQA 2I6SA 1IQIA 1DM4B 2WPIS 3M7TA 4TYDA 2RA0A 1FN6A 1SGRE 4I8KA 1S0RA 1KXFA 1DSUA 2OC7A 3ATMA 1TA6A 1C4Y2 2KAIB 1NRPH 3MU5A 3A80A 3QZQA 1TMTH 4I8JA 3RXPA 5FHTA 1A0HB 2DE9A 3D49H 3QWCH 3FP8E 2VIPA 1NROH 3E8LA 5EQQA 1AB9C 4NIVA 1D6RA 2FEQH 2FOMB 3KNXA 3ZZ6A 4AFSA 2PWXA 1YPEH 1TAWA 5AF9H 1W0ZU 5HM9A 5C1XA 2PGQB 1YCPM 4AFUA 4B76A 3O8DA 4SGBE 1C5ZB 2W7UA 4B2AA 4Y79A 1TX7A 5G4BA 2XCFA 2OQ5A 2ESTE 4B2BA 1FXYA 3LJJA 2GJGA 1CT0E 2ZKSA 1P2QA 3QZRA 6CHAC 1QRXA 1GGDC 1LPGB 2ZHFH 4DIIH 3A84A 3A89A 8KME2 2O8MA 3VB3A 2P59A 5CHAB 5EOKA 4Z0KA 2Z3CA 1NRNH 4YESB 3SNAA 1O2XA 3K9XB 1BIOA 1YM0A 2C93B 1W11U 2FOFA 1NT1A 2F9NA 3U8OH 1KIGH 3FZZA 1IHTH 1GJ9B 3M3TA 1TGCA 2STAE 1C1PA 1JBUH 1Z8IB 2VIDA 5L6NH 2GVFA 3BEFB 2HVXA 1O3KA 1YPJH 1UTLM 3ATIA 1KXDA 3MH4A 1NRRH 3SU1A 3KQCA 3MYWA 4MPXA 1NFYA 1SOTA 2ULLA 4YOGA 4RSPA 1H8ED 2PKAA 4ZMAH 1XVMA 2FX6A 3VB7A 1C1WH 3PYHA 4YLQH 2JH0D 4F49A 4AG2A 1D9IA 1FY1A 1QGFA 2VVVA 4B6FA 2H9TH 1F0UA 1HAIH 1O3AA 1NN6A 2C8WB 2TPIZ 4BAQB 1BBRH 3GY7A 3LGYA 2XXLA 1IHSH 1RRKA 2Y82A 2VWMA 1ELEE 1NPMA 1HAGE 1S85A 2FYQA 3MTYA 3RMOH 1EATA 4F55A 7GCHF 4FUFA 5JBTA 3RC5A 3HATH 3GOVB 5EXNA 4GHTA 2CXVA 2ZGJA 1MD8A 4ZXXH 2F9BH 3ATKA 3MO3A 3P6ZB 1E34B 1YBWA 2XC4A 4DOQA 3EGKH 2V7QD 2JETC 2XWBI 4IMZA 1BMLA 1XM1A 2ZDAH 2H6MA 1IQHA 3M7QA 1FMGA 4X8SH 1T32A 1Y3UA 5EPYA 5H4IB 2KZ4A 2QGRA 4CREA 1OPHB 3QLPH 4P02A 1GI3A 4J1YA 1ZMLA 1C9PA 2HALA 1KTSB 3CNRA 3FZDA 4MNYA 4BTIB 3A81A 1WBGB 5GPIB 2UUFB 1TABE 1C5XB 1IQJA 3ATLA 2B0FA 3LPRA 1F5RA 3ATWA 1K21H 2WPHS 1G2MA 3ZVFA 3KQEA 2AFQB 1GG6C 3EE7A 4JZDH 3TK9A 3RUOA 1F5LA 1KLJH 1O34A 1ZMJA 1AE5A 3UY9A 1GMHF 1QB9A 1W8BH 1C5PA 1OP8A 5I25A 1YLCA 3O8BA 5C67A 4NZLA 1O3BA 3BEIB 1O3CA 2OUAA 1GHBF 1GBTA 1O2HA 3FOAA 2J9NA 4BNRA 3S9AA 1EZUC 1AB9B 3AAUA 4XBBA 1BTXA 2BY9X 2LNCA 4ZCNA 2W6JD 1LTOA 1YGCH 2FTMA 4NSVA 1V6DA 2BDBA 5ESTE 1ESAA 3F9GA 1MAXA 2HNTF 1WSSH 3LC5A 4RN6A 1FI8A 1ZJKA 3LOXA 4NG9H 1LKBA 5HM2A 4WMDA 2STBE 3A8CA 3T29A 3A8AA 3FFGA 1SG8B 3A7YA 3ZYEA 2IJOB 1DLEA 4XFQA 1C5YB 2D2DA 1YLDA 1GCDA 1CBWC 1EZQA 3U69H 1UVTH 1CGIE 4FOUC 1GGDB 4X1QU 3GY8A 1C2JA 3OEED 3OAAD 2FM2A 2ZDNA 4AYVB 2SGDE 2ZCKP 1EUFA 1N8OC 1T8OA 4DIHH 5EU8A 3Q77A 3TH2H 1SGCA 2GZ7A 3RXFA 1MTNB 2ZWLH 5F8ZA 1GHXH 2XBWA 3E0NB 3VGCC 1G32B 2FYRA 5EXLA 3TPIZ 1AFQC 1SGTA 2EI8A 1O5CB 3P95A 1F2SE 2BD3A 2HWLB 3KL6A 3A7TA 3SNBA 1AGJA 2DUCA 2GT7A 1SLUB 2ZG0H 3T25A 1NU9A 2RDEA 1SGDE 1SQOA 3BN9A 2XCNA 4O3UA 4SGAE 3FAOA 2Z6BD 3AAVA 2ZZUH 4IBLH 2QF4A 1AU8A 3TGIE 2F9OA 1T4UH 1P12E 1V2QT 2ALPA 2AHME 5CMXH 2ZDVH 1TBRH 1LQEA 2YNBA 1AWHB 1C4V2 5FPSA 1KDQB 3SGAE 1MKWH 4BAMB 1P06A 1NZQH 3GISB 3P17H 2J97A 3SV6A 1Y3VA 3F68H 1Y8TA 3O8CA 1TB6H 2BM2A 3BF6H 4I8GA 5C2ZA 1FX0B 1OP0A 4KTUA 2JETB 3AW1A 3URDA 1TRNA 2CN0H 3A86A 2PV9B 4Q63A 1MABB 3PRBA 1O2YA 3GY2A 2H2ZA 2XBXA 1F7ZA 3KN2A 2WYGA 4FU9A 3TK6A 1QQUA 4ACBA 3QO6A 1VCPA 1LCYA 1BTPA 1C5MD 5E8EH 4U01A 1S0QA 3KCGH 2BTCE 3RLWH 3NUMA 1DANH 1GG6B 1BMMH 1GI6A 1O2PA 2H9EH 1FN8A 2Y6TA 1YCPK 4UD9H 1QCPA 4Y7AA 1MCVA 2HNTC 1C5QA 1ZYOA 1FONA 4UONA 4FUHA 1GI0A 1JIRA 3RXQA 1ZHRA 2ZEBA 4AX9H 5F03A 1GWAA 1S82A 2BMGB 2A1DB 4M9FA 3W1EA 1HIAB 2A5KA 1E38B 5E0GA 5KECA 3ELAH 3QGJA 1OYTH 2O8TA 3SGQE 2Q6FA 3LU9B 1SGYE 3H09A 1V2VT 3UWJH 4X6MA 3F9EA 1TMBH 2BXUH 1HGTH 3PMJA 2QE7D 1P2JA 5C94A 4JZEH 4UFDH 3O8RA 3WWBA 2BZ6H 2A4GA 3ZZ8A 1WU1A 1ZHMA 1PFXC 2O8UA 3WWFA 1MTWA 1GBBA 1CBWB 1PPBH 1O3OA 1Y5AT 2P94A 3SO3A 1HXEH 3KHVA 2KR7A 4IS5A 1DX5M 3ZVCA 1UTMA 1N8OB 1C5LH 1COWD 1TIOA 2FOAA 2GCTB 5LH8A 4K1SA 1T8NA 1ETSH 2BLQA 2W6ID 2ZU1A 3PB1E 2G81E 4LXBH 3VGCB 1P2OA 1C5WB 1HJ8A 1XUFA 1YPGH 2FOEA 3A7ZA 1AI8H 2FZZA 3TVJB 1OWDA 3ZZDA 1PPFE 2OLGA 3KYFA 2FPZA 1PJPA 2UUJB 1ELCA 1SQRA 2JDID 3FKSD 3K2UA 3OU0A 1F0SA 1ZMNA 4YOJA 2ANKH 1GJCB 2WHXA 2WUBA 3A7XA 5FXLA 1CHOG 1D3PB 4AZ2B 3F0OA 1TNLA 2G51A 2PR3A 1P02A 3BIUH 1OP2A 3EDXB 1O2WA 2G00A 3PRDA 1O3PB 1MKXK 1KLTA 1MQ5A 2GD4B 1FPCH 3DHKH 5JB8S 1GI9B 5EQRA 3SJ8A 2V3MA 1G3DA 3SYJA 1YWUA 4VGCB 1BTZA 2WV5A 2QXGA 1ZPBA 2SFAA 3AASA 1MZDA 1O2UA 1YPHE 2CMYA 2FTLE 1YLNA 4Y8ZA 3FN8A 3GDSA 2A7HA 1O2NA 2J98A 3RMNH 2WPDD 1OXGA 5AHGH 1GI4A 2P8OB 3VXFH 5DN6D 1HYLA 2BQ6B 2J4IA 1ANDA 1NU7B 4H6TA 4X2VA 3E1XB 2O8LA 4X6OA 5L2ZH 3SQEE 4ABIA 2VB0A 2PSXA 1ZJDA 2FODA 2QXIA 3MH5A 1O3EA 1UTPA 4O97A 1BMAA 1HLTH 1KXAA 1SGFG 1AWFH 4XRNA 3LIWA 1HUTH 3UR9A 1GJ7B 3UNSA 1GBLA 2BLWA 1GI7B 1AUTC 2HLDD 2QCYA 3STJA 1QTFA 3FVFB 2GV6A 3U9AH 1HRTH 2KCOA 2HOBA 4ACAA 1JIMA 1S6FA 1W0KD 1XUJA 3RXVA 1V2MT 2ZCLP 3BTDE 2QA9E 4B75A 2LELA 3PV5A 3MNBA 3RXJA 1CO7E 3RXKA 1WQSA 2TIOA 3C1KA 3MH7A 3GCTF 1Y3XA 1E1RD 1SQTA 4I86A 5C0UA 2OQUA 3M36A 3MMGA 3QTOH 4HTCH 5DP8A 1RIWC 1PPHE 3M7UA 1Z6JH 2CJIA 2ZPRA 2WPJS 5JBBS 3K65B 2HGTH 5F53A 2UWPA 1K1MA 3L6PA 3OX7U 3RXMA 1MQ6A 3PLPA 2RDLA 3C27B 2VVUA 1GBHA 4A5TS 4Y6DA 2RFKC 4FUBA 3MH6A 4AG1A 3RXBA 1G30B 3PMAB 1O30A 4CRFA 4X2XA 1FDPA 3GCHB 4Y0ZE 1MAYA 2BHGA 1C2LA 2V3OH 2ZO3H 1VR1H 3CP7A 3LDXH 1DWDH 1BOQA 1K28D 4R0IA 2GGVB 3SU3A 3M5MA 3UQOA 4A92A 1TNIA 2XTTB 4NIXA 4Y71A 2L74A 1C5OH 4BAHB 1QRWA 2Z9KA 1TQ7B 1GI2A 5F8TA 4K8BA 3SJIA 1PPZA 1BTHH 3CENA 2IPQX 3GCTG 2G8TA 4K1EA 4LOYH 4FUEA 4CRCA 1K1NA 5E0JA 3EA7A 2ZFRH 3GY4A 4K8YA 5EXMA 2QF5A 1C5RA 4BXWA 3ZZ5A 1HDTH 2HVYB 4E7RG 2WZQA 2ZTXA 2ZTZA 1FV9A 1SB1H 1RJXB 2OC8A 2XWAA 2XC5A 3ZZCA 1UK3A 1SOZA 4AFQA 2WV4A 4U32A 1SFIA 1QIXB 2PHBA 1J16A 2A45B 2GZ9A 1GPZA 4ZHAA 3SU2A 1GBMA 1UO6A 1QL7A 3PO1C 5HGGA 1VJ9U 1VGCB 2VGCC 1G37A 1RS0A 2ZIQH 2WPMS 4IGDA 5F8XA 3M5LA 3VB6A 2ZGBH 2A7JA 1ESTA 1DUEA 2GV7A 3D62A 2PKAB 4JYTA 5ETXA 5C3NA 3DD2H 1A3BH 4DT4A 1OS8A 1QR3E 2F9UA 2WPLS 5K0HA 4BTTB 1SGIB 2V3HH 3SBKA 1ID5H 4DJZB 2FO9A 4OS5A 3DSOA 2VBCA 2ZECA 1CA0C 1AMHA 1T8LA 1AO5A 2SNVA 4NFEA 4CRAA 1O2LA 1GHWH 3WY8A 1SQAA 3UREA 1PYTC 5ABWA 1AVGH 1C5VA 2JKHA 1EB1H 1Z7KA 2SGEE 4CR5A 4CH8B 3UFAA 1H1BA 4Y8YA 4JZ1A 3V3MA 1AN1E 1A5HA 2JJ2D 4DCDA 1XXFA 4RI0A 3VB4A 3GS9A 3UOUA 5A0BA 2BD4A 3VB5A 1CT4E 1KLIH 3AW0A 1GMDF 4ISHH 2ZHQH 2SNWA 2ZFTA 4O03A 5T6GA 4WJG2 1O2SA 1V2TT 1NM6A 4Y10E 2VIVA 3LH3A 5DP3A 1QFKH 3QUMP 1THRH 1P09A 7ESTE 2CGAA 1FPHH 2M5TA 3D65E 2VJ1A 4YT6H 2TRMA 1LPKB 4FU8A 4RKOB 2EA3A 1BTWA 4ZKRU 1WDIA 3TGKE 2C8XB 1HAVA 2W7SA 2WUCA 1HCGA 2Q1JA 1O32A 4MNVA 3KIDU 5CE1A 1VITH 8ESTE 1ZZZA 3LT3A 5GJ4B 3S7KB 3E90B 2QC2A 2GDDA 2GCHF 4Z1MD 4ABJA 2TGTA 4CH2B 1IOEA 2V35A 3I77A 4INHA 3TLOA 6GCHF 1PPCE 1T7CA 2ZU5A 3B8JA 1YPLH 2F3CE 1IQNA 8GCHF 1BBRK 1ETRH 1EAWA 1T4VH 4Y0YE 4ZXYH 5A8YA 1O5EH 5E2PA 3GCOA 1ELBA 2AYWA 1QB6A 2ZGXH 1D6WA 3TITA 3PMBB 1UCYE 1IQFA 2Y5FA 1PQ8A 1O3NA 3OTJE 3MWIU 1XUGA 1SHHB 4MQAA 4XBCA 2TGDA 4I7YH 1HNEE 4E06H 4NZQA 4WWYA 2NU0E 1OWIA 1TGBA 1DT2A 3KQ5A 1CT2E 2R3UA 4NGAH 2A7CA 2GT8A 3U8RH 1IQKA 2VGCB 2L6OA 5DGJA 4ZH8A 4AN7A 4LZ1H 2PTCE 1CQQA 3QDZB 2VIQA 2Y81A 2ZDMA 3P8NA 1Z8RA 1CHGA 4XDEA 3DA9B 1AVXA
chains in the Genus database with same CATH topology
4D9QA 1EJMA 2WYJA 1UVOA 2QYIA 5C1YA 1T8MA 4K69A 4D76A 1QJ7B 4MNWA 1T31A 3Q76A 4K2YA 1G2LA 2GP9B 1AVWA 4NCYA 4XOJA 1NFUA 3TH3H 2AGGX 1CA0B 4ZHLU 2ZPQA 3SW2B 1MZAA 3KF2A 1W2KH 3MU1A 4FUGA 1P9SA 5HXFA 3NK8A 1EPTA 1U6QA 4JYVH 1QBNA 3MO9A 4UEHH 1ARBA 2ODPA 2Z9IA 5A0AE 1C9TA 3BTME 1MTSA 4DY7B 7GCHG 2PGBB 2ZP0H 1IAUA 2C3SA 1C1MA 3A82A 4LK4A 2RA3A 1UCYK 2BX4A 4ZHMU 1TNHA 1INCA 5A8ZA 3TIUA 1GBKA 2BQ7B 1SL3A 1FY8E 3OY6U 4O9VA 4A7IB 1O5GH 6CHAB 2AGEX 3IWMA 1UTOA 3JZ2B 5JYIA 2GTBA 5A8XA 3ZZBA 2Y7XA 2BD5A 1AZZA 2AMPA 1ZR0A 3BTEE 2LPRA 3V0XA 1C2HA 3BTGE 2GMTC 3GY5A 3SUEA 4YM9A 4UFFH 1GMHG 3RC6A 1ETTH 4OS4A 1XUHA 4X1NU 1Y3YA 2ZPSA 1ELAA 4ABHA 2R3YA 5E0HA 1MU6B 4UE7H 4TWWA 1E0FD 4JYUH 1LVYA 2BX3A 3T27A 3UPEA 3RMLH 1YPKH 1GHBG 1AFEH 1DDJA 2JH5D 1G36A 1OOKB 2W26A 2Z3DA 3MO6A 1BT7A 2A2QH 2GDEH 1V2JT 2FDAA 1PPGE 1B0EA 5A09A 2BDAA 5A2MH 1ZGVA 8LPRA 5EODA 2XNIA 4AYYB 1H9LB 5GDSH 3PV4A 2ZFFH 2G5NA 2HPPH 4Q7XA 3RDZA 3RU4T 4X8TH 1Q2WA 4U2WA 1ANCA 2EI6A 1NRSH 4GPGA 1S5SA 4WY3A 3RMMH 4IC5A 2FI4E 1MKWK 1TNGA 4NWLA 2R2MB 2BVRH 4OS1A 2BVXH 2ILNA 4UDWH 1C5SA 3JZ1B 4IMQA 1HV7A 2P95A 5JB9S 1MH0A 3SJKA 3NZIA 5PTPA 3P8OA 3RXSA 2BZAA 1ZRBA 1TWXB 1Z1IA 3SU4A 4Q7ZA 2Y7ZA 3IG6B 3UWIA 4ZROA 2Z9JA 4D8NA 1DE7H 1HFDA 1BRBE 1GCTC 1C1SA 1HAXB 1G3EA 1TA2A 2QXHA 1NRQH 4AB9A 2ZC9H 1UTKA 1YPMH 3QK1A 2VH0A 2J94A 1SR5C 1P03A 3A88A 5I46H 4OGXA 3W95A 4ZUHA 2ANYA 1N6XA 5DO4H 1GDQA 2C8YB 1EKBB 1V2WT 4K3JA 1YYY1 1D3DB 7KMEH 1EX3A 2FS9A 3SI4H 1MTUA 1QRZA 1S84A 2ODQA 1W0YH 5F6MA 3N7OA 2H5CA 1AKSB 1ZPZA 1HAYB 3BTHE 3M37A 1DSTA 3Q3XA 4ZKNU 1GI5A 3LGVA 1GHVH 3PMHB 4NWKA 3RM0H 1OSSA 3U8TH 1O2VA 3HPTB 3PM3A 2QN5T 3EYDA 2ZHWH 3SU6A 1O2IA 2FOBA 1PQAA 2FX4A 1GJ6A 4FUJA 1P2MA 1PYTD 1L4ZA 1A7SA 1Y59T 1V2OT 3BTKE 1S6HA 5K7RA 3SNCA 3KGPA 3BG8A 1B0FA 1YPHC 4X6NA 2OCVB 1ZHPA 5IYTA 4AGJA 1WOFA 1V2PT 1V2LT 2ZHEH 3A7VA 3RXUA 1C5NH 5DP9A 1A1RA 2GMTB 1CU1A 3DT0H 1P01A 1NS3A 1LMWB 1AFQB 3M35A 1VITF 2HNTE 1GL0E 3SHCH 1GBIA 3KEEA 3T62A 3HKIB 1B5GH 2UUKB 1DXWA 5JBAS 1TGNA 2XBYA 4IC6A 4ABAA 2AH4X 3B23B 3CS7A 3L3TA 5EPNA 1O5DH 3SQHE 1P3CA 4YO9A 4DVAU 1L2EA 4FVBA 3E6PH 1J9CH 1IQLA 2CHAC 1W12U 1MTVA 4MNXA 1J17T 5E2OA 5GCHF 5FPTA 3UTUH 2PW8H 3K6ZA 2G55A 1QY6A 1JRTA 4QT8C 1EASA 3NCLA 2UWLA 4Y8XA 2ZTYA 3ZV8A 1TX8A 2ZFQH 3BG4C 2PTNA 1EOLA 5TCAA 3RXAA 1SI5H 2PLXA 5J4QA 2G5VA 2R0KA 4ESTE 3LKWA 1BZXE 4UFGH 3SUFA 1RTFB 1FNIA 1QA0A 1TPSA 3RXEA 3S9CA 1LVMA 4B2CA 1FY4A 2BD9A 5EQSA 1C2KA 1HIAA 2VIWA 1AQ7A 1C2DA 2R2WU 1GCTB 3SNEA 5L30H 3S69A 1P2KA 4YT7H 4MVNA 4X8UH 4NA9H 1AD8H 2CF9H 2BD8A 1Q3XA 2QIQA 1C2IA 1O5FH 2B9LA 4YZUA 4FUCA 3H7OA 1CSOE 1GMCF 4JMYA 3F9FA 3SUDA 4GCHF 3PWCA 5C20A 4DW2U 1LVOA 1OWHA 1A2CH 1FAXA 3E3TA 2R0LA 1J8AA 4GUXA 1DVAH 2QF0A 2WPKS 1F0TA 2P3FH 2BD7A 5HMAA 3A7WA 1JXPA 2D1JA 4UFEH 3F9HA 2QAAA 2B8OH 2D26C 3G01A 4X8VH 2RCEA 1DWBH 1TQ0B 1UHBB 4AB8A 3DFLA 1FAKH 2BY8X 6ESTA 4BAKB 1O3GA 1WV7H 3MHWU 2WINI 3A87A 1AZ8A 4I8LA 4X2WA 1HPGA 5DK1A 4JZIA 1SC8U 2XBVA 3E16B 4NA8A 1GHAF 1TRMA 1O38A 1XKAC 1O2MA 2FXRA 2P3UB 4ASHA 1PPEE 2ZNKH 1ZTJA 3A8DA 3ZVGA 1FIWA 1A5IA 1O2OA 4KELA 1EPTC 1XUKA 2VH6A 2HPQH 1ABJH 1ELTA 1DS2E 4ABDA 1W14U 1ZTKA 5C5NA 2EEKA 2OBOA 2FLRH 3PROA 1KXCA 3VPKA 1QNJA 4MPUA 9ESTA 3ITIA 1LDTT 1UJ1A 2O8WA 2VNTA 1KXEA 2CV3A 3BV9B 1O2JA 4H42U 9LPRA 1THPB 4WMEA 1TONA 1SHYA 1K9OE 3SV8A 2OD3B 1TLDA 1ABIH 1BTUA 2ZHDA 1VCWA 3GCNA 2Y5HA 5LPRA 3OYPA 2ZA5A 4K5ZA 1XMNB 2ASUB 3QTVH 4YTAA 3T28A 1ARCA 4ISLA 3TU7H 1W13U 1NY22 2XYAA 3SORA 3NWUA 2A31A 5EW2H 2P93A 1OKXA 3RXDA 1C2MA 2BDHA 3ZZAA 4J2YB 1TBZH 2O9QA 4BAOB 3MU4A 3IITA 3QX5H 4B1TA 4PROA 2BY7X 1ELFA 1JRSA 4ABEA 1B7XB 1P9UA 3HK6B 2C90B 2VWLA 2ZU2A 1O39A 2AERH 1NESE 2FESH 1QJ1B 1XXDA 3BG4B 1CVWH 1C2GA 4OS7A 1KSNA 4XE4A 1SGNE 1TFXA 4INLA 1EB2A 1O2ZA 4OS2A 1TOCB 1MBQA 5EGMA 1NTPA 2FP7B 1O2TA 3SN8A 1O5AB 1V2UT 1RD3B 2AIQA 3EA9A 1UVSH 1P11E 5JDUB 1DWCH 1LPZB 1TMUH 2FS8A 1UTQA 3ZV9A 3RU4D 1S81A 3QN7A 1GVKB 1LO6A 3I78A 2BOHB 1BBRE 2Q6DA 5JBCS 1A4WH 4MG3A 1HAPH 2TBSA 1TALA 4F4OC 1QA7A 3LH1A 2BLVA 3ODDA 1GJAB 2C4FH 3FP7E 3RXCA 1RIWB 1UK4A 3HKJB 4Q2KA 2BDYA 1GJDB 1HB0B 1DUAA 1EJNA 1UMAH 2G4UA 3R0FA 4KTCA 4WXVA 4XSKU 1K1PA 1SGEE 1HAOH 3SNDA 1HJAC 3SJ9A 1BHXF 3TJVA 2QF3A 4MDSA 5DP5A 4ISNA 3MNXA 4B73A 1GI1A 3BTFE 4B71A 2AS9A 4OS6A 1DWEH 2THFB 2GZ8A 2FOGA 1DXPA 1V2RT 1Y5UT 4GLYA 1SGPE 3RXLA 2Z7FE 3URCA 4A6LA 2FOCA 3K6YA 3SI3H 1YP9A 3RXTA 3A8BA 1EZXC 2VVCA 2ZFSA 1F92A 2G4TA 2TGAA 2OP9A 4H6SB 1YC0A 1BMNH 2HRVA 1FQ3A 1QL8A 2A2XH 2OXSA 1BA8B 4HFPB 1CE5A 1GBJA 1ACBE 1V2NT 2UUYA 3BTWE 2BDGA 1SLVB 1G3BA 2P16A 1J14A 7LPRA 3S9BA 4R8TB 1BCUH 2QY0B 1GI8B 3MNCA 1ZTLA 2NWNA 4HGCA 1EPTB 4TWYA 4Y76A 2W3IA 1BJVA 1SBWA 1Z6EA 4WF8A 1L4DA 2BY5X 1Y5BT 1EP6A 4OGYA 5DPAA 1MTNC 3R3GB 3UOPA 1D3TB 1O3JA 1IQGA 2H1UA 1V2KT 1O2KA 2FI3E 3M61U 5A0CA 5FCKA 1N1LA 5FBIA 1G3CA 4X6PA 2XRCA 1W10U 2W3KA 3U1JB 1O5BB 3SJOA 2PUXB 3ZVAA 1GBDA 4I33A 1KYNA 2OTVA 1GMDG 1H8IH 4TPIZ 2FOHA 4IN1A 1C5TA 3LONA 4LZ4B 2V6NA 2BY6X 3MFJA 5TJXA 3UNQA 1FJSA 3FP6E 1O3FA 1S83A 1AY6H 3FANA 3PO1B 4KGAA 2KAIA 3F6UH 1DY8A 1ESBA 4NSYA 2A4RA 4WXIA 1YF4A 4M7GA 1K1JA 1K1OA 1K22H 1EAIA 3UIRA 1WCZA 3NXPA 3ENSB 3M3SA 5C5OA 4A1VA 1XX9A 2VWOA 1X7AC 1A0LA 5TCCA 2ZDLA 4ISIH 1EAXA 2Z94A 1Q31A 3TGJE 4ISOA 1J15A 4GAWA 3SGBE 2F91A 3SHAH 4K60A 4A1XA 4INKA 5T6DA 4IW4E 2ZFPH 2GCHG 2BDIA 1JOUB 4NIYA 3T2NA 6GCHG 3V13A 4FUDA 1O31A 1GJ8B 1F0RA 3A85A 3GY6A 4AFZA 8GCHG 1TBQH 4Y7BA 4E05H 1SGFA 1SLWB 4X2YA 2PUQH 1LVBA 1O2QA 2I6QA 3ODFA 1UVUH 1L0ZA 1HJAB 1C1VH 1KY9A 1QL9A 3SZNA 3M5NA 1KTTB 1O3LA 1OYQA 1QHRB 1JWTA 3H5CB 3S7HB 4WVPE 3EAJA 2ZU3A 4DGJA 1P2NA 3Q00A 2IPHA 4CBOA 5EG4A 1LHCH 3NKKA 4TPYA 2OBQA 4CRBA 2ZI2H 1DPOA 3W94A 4NA7A 4DURA 4DT7B 1HXFH 1P8VC 1UCYH 3TK5A 1K2I1 1QJ6B 5IDKA 1SGQE 3SV2H 2SGQE 1L1GA 1W3CA 1EZSC 1LQDB 4WMFA 1QQ4A 2ZGCA 1MCTA 3TJOA 3E91A 1GVZA 3ZZ9A 2NU1E 5BRRE 3EE0B 1O2RA 4H4FA 2GCTC 1ZLRA 1WTGH 3U98H 3MOCA 3GDUA 3F1SB 2QXJA 1DOJA 1Y3WA 2BOKA 2A5AA 1V2ST 2Z9GA 2DE8A 5LPFA 1TPAE 1ZPCA 3RLYH 4BANB 1Z8JB 2SGAA 4X0WU 1FZZA 1MUEB 3VXEH 1V3XA 1XKBC 4FU7A 3P70B 1OWKA 3ESTA 3RXIA 2J38A 5DP6A 1IQMA 5DG6A 2IOTA 5ESBA 1BB0B 1E37B 2A4QA 1C1UH 2NU2E 4Q80A 1XVOA 3RXHA 1P05A 3V7TA 4GVUA 1F5KU 4I31A 2TGPZ 4RKJB 2H5DA 3M5OA 4VGCC 2A32A 3ZYDA 1HAHH 1UTJA 2A5IA 1QB1A 1ANEA 1K1IA 1TPOA 2AGIX 3CS0A 1P0SH 2ZCHP 3TJNA 1EJAA 1TNKA 1TGSZ 1VJAU 3TH4H 4CHAC 2P8OC 1UK2A 1O35A 4D7FA 1FIZA 5AVDA 1MBMA 1GDUA 3E0PB 2A4OA 1VZQH 3D23A 3BTQE 3LGUA 1EQ9A 5LPEA 2F9VA 3T5FH 1UVPA 1GJ5H 4MTBA 4ABBA 1BHXB 3HK3B 2VIOA 3AVZA 3ZZ7A 3KQBA 1H4WA 2VU8E 4O3TA 4BTUB 3UQVA 1C1QA 1P57B 1P10A 1E36B 5C1UA 1HBTH 2ZQ2A 1ZRKA 1M9UA 2FLBH 1A3EH 3GYLB 5SGAE 1AE8H 4Z6AH 4BXSA 1TYNA 1YCPH 1MMJN 1TOMH 2J92A 1ELDE 3RU4E 1SVPA 2ANWA 3VEQB 6LPRA 3ZZ3A 1FY3A 2ZDKA 5AFZH 1K1LA 3MNSA 1CHOF 4KKDA 4DG4A 2YOLA 4JZFH 1JMOH 1AIXH 3GYMA 4WH8A 1H8DH 1GJ4H 3SU0A 1P04A 4MPWA 3VFEA 2ZF0H 2VINA 3SV7A 4K1TA 3ZVBA 2BYAX 1WTHD 5GXPA 1WYKA 1Z8GA 2XC0A 3A83A 5GWZA 2XW9A 4Y11E 4AOQA 3SU5A 1SSXA 2F83A 2ZGHA 3GCHC 2AEIH 1GBAA 3GY3A 1C5UA 5FAHA 5FPYA 2SGPE 1NO9H 1RGQA 2J34A 1LHDH 3Q3KA 2Y80A 4HI3A 1C1TA 1W7XH 1ZOMA 1GBCA 3HGPA 1C4U2 3H7TA 5GIBA 1O33A 1P2IA 3GDVA 1KDQA 1TX6A 2IN2A 3RXRA 4FXGH 1BRUP 5DP4A 1EXFA 3S0NA 1OX1A 3ZVDA 1N6YA 4GHQA 1AUJA 1FUJA 1G9IE 1ZSKA 1FLEE 3B9FH 4I32A 1Z1JA 4X1SU 1L1NA 1RFNA 1NFXA 4CR9A 1TNJA 1DLKB 4AGKA 3GICB 1CGHA 1MKXH 4NIWA 3U1IB 2BD2A 1BQYA 1DITH 4ZAEA 3SV9A 4E7NA 1P3EA 2Y5GA 1RTLA 1O3MA 3L33A 1KXBA 2V0BA 1BRCE 2EI7A 2PKSC 3QGNB 3UR6A 3LGTA 1H9HE 1NC6A 2VWNA 1VGCC 1CGJE 3M3VA 1WQVH 5FX6A 5AFYH 5B6OA 3PTBA 4WH6A 4CHAB 2W5EA 5T3HA 4CRGA 1AKSA 2ALVA 2EC9H 1SLXB 1TE0A 2BQWB 2OC0A 1ORFA 1VITG 1DICA 5DJ7A 1GL1A 1ZSLA 1QBOA 1LKAA 2BVSH 1NFWA 4Q7YA 1UTNA 2BXTH 1SFQB 4NFFA 2HLCA 1WAYB 4I8HA 1C2EA 1OWEA 1ZGIA 5HYOA 2Z9LA 3MI4A 2K1QA 1LHGH 1O3IA 2PFEA 2OC1A 5DP7A 3STIA 4YLUA 2AIPA 3ZZ4A 1EAUA 1GHZA 3Q3YA 3RP2A 1D3QB 1EP5A 2GX4A 1SPJA 2