2ZGCA

Crystal structure of active human granzyme m
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
231
structure length
231
Chain Sequence
b'IIGGREVIPHSRPYMASLQRNGSHLCGGVLVHPKWVLTAAHCLAQRMAQLRLVLGLHTLDSPGLTFHIKAAIQHPRYKPVPALENDLALLQLDGKVKPSRTIRPLALPSKRQVVAAGTRCSMAGWGLTHQGGRLSRVLRELDLQVLDTRMCNNSRFWNGSLSPSMVCLAADSKDQAPCKGDSGGPLVCGKGRVLAGVLSFSSRVCTDIFKPPVATAVAPYVSWIRKVTGRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Granzyme M
publication title Structural basis for proteolytic specificity of the human apoptosis-inducing granzyme M
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 51
structure length 231
sequence length 231
ec nomenclature ec 3.4.21.-:
pdb deposition date 2008-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zgcA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zgcA02
1SGYE 1GHAF 3GISB 2UWLA 2F9VA 1TB6H 1Z1JA 1YCPK 1O3OA 1CGJE 3OYPA 1LCYA 1P2IA 1HJ9A 3TJOA 3BTTE 1YBWA 1GHZA 1ZZZA 3NK8A 1GGDB 1TPOA 2Y82A 3URCA 3PM3A 1C5OH 2H5CA 3QZQA 2IJOB 1IQKA 3EA8A 1GL0E 1GHYH 1TOCB 1D9IA 3A8AA 2CV3A 2GMTC 3SI4H 1AZZA 1O5EH 2AMDA 4KP0A 2BOKA 2GX4A 4ASHA 4ZH8A 2FOCA 1S82A 3QX5H 3DA9B 4WXIA 2J95A 1ELFA 2QV1A 2BQ7B 1DXPA 5I25A 3E0NB 1P2NA 3Q00A 3Q76A 5EGMA 1HAOH 1QJ1B 1V2WT 2PSYA 4BXWA 2BZAA 4TY6A 1CO7E 2Z3DA 3UOPA 1DUAA 1JRTA 3A89A 1K1JA 4DIIH 1A5GH 2TBSA 1OP2A 1SGEE 4CR5A 2FXRA 5FXLA 1SGQE 2GZ8A 4XOJA 3SJKA 1Z6EA 1O2LA 1O3EA 1GJDB 3P8FA 5FHTA 2XWBI 4CRDA 2R3UA 2A2QH 4RKJB 2DE9A 2F9OA 1AUTC 1EJMA 1KXEA 4UFEH 1KXBA 4ZMAH 4O3UA 1EB2A 1P2MA 1HJAC 2WUCA 1GJ4H 5G4BA 1YPMH 2CF8H 1UK2A 2HRVA 3H5CB 2STAE 3EGKH 2A4QA 2ZFPH 5SGAE 1P01A 3MNBA 1LHGH 3RLYH 3ZZDA 3TK5A 1RD3B 3E8LA 1B0FA 2OC0A 3BIVH 4DT7B 1GBDA 1HV7A 2H1UA 2ZCKP 1PPEE 1T8OA 1BRUP 3BG4B 3SV6A 3H7OA 3BN9A 1TNLA 1QGFA 1GBFA 3GYMA 4VGCC 1QQ4A 5C5OA 3NZIA 9ESTA 2OBOA 3GY2A 4ZUHA 1S6FA 3RXCA 3VFEA 3MFJA 1A46H 4JZFH 3RMOH 2FZZA 1T8LA 3MHWU 3LGUA 3QTOH 1SHYA 1EB1H 1W12U 1DWDH 1MQ5A 2NU2E 2VVVA 4SGBE 1WUNH 2B5TB 3UUZA 1ELTA 2FI4E 2PUQH 2XBVA 1OWEA 3E1XB 4FVBA 1P9UA 2PTCE 4K8BA 1P09A 1DX5M 1GJCB 1NC6A 3STIA 4Y0YE 2ZQ2A 5T6FA 1DSUA 1U6QA 5CHAC 2C8WB 5C5NA 4B1TA 1C5PA 4IC5A 1G3DA 2TRMA 4AORA 2GCHG 2Y7XA 1TA2A 2QC2A 1TOMH 2P3UB 3CS7A 2F83A 4XE4A 2NWNA 4B75A 2PSXA 4X1PU 1DLEA 1C2DA 1C2KA 1W13U 1BMAA 1AI8H 2SNWA 2WYJA 2D8WA 1G37A 2WV4A 3Q3YA 4KELA 2AIQA 1C2LA 1EOJA 2ZDMA 3SNCA 3ESTA 3UREA 3S7HB 1CGIE 1ZTKA 4ZKRU 2OXSA 2PV9B 1Y8TA 3HPTB 2A4RA 1GCTB 1HIAA 5HM2A 1WTHD 2F9UA 1O3CA 1EP6A 2J2UA 2CGAA 2ZWLH 4AFSA 3SJ8A 1GVZA 5C1YA 1C5VA 1NS3A 1SGPE 2HNTE 3BEIB 4XBDA 2THFB 3A7TA 1E0FD 4NWLA 1GGDC 1GI6A 2J38A 3A85A 2JH6D 1EZXC 2ZPSA 1OOKB 4E7RG 4ABJA 3O8BA 3ZZCA 5ESBA 2XTTB 1GI3A 3FP6E 2HWLB 4Y71A 4ISIH 2H9EH 1G36A 1WCZA 1A3BH 1G3EA 4UFDH 1TYNA 1KLTA 1TQ7B 3VXFH 2GCHF 2V3OH 2WV5A 3GY3A 4U30A 1XX9A 1MD8A 1L1NA 3SGAE 3LH3A 1OPHB 1V2TT 2GDEH 1ACBE 1QB9A 4TY7A 1RIWB 1ZTLA 4MVNA 1QY6A 3EAJA 1A1RA 4Q7YA 1H9HE 1BJVA 1O3NA 3A7VA 1C5LH 4WMDA 1CHOF 3I29A 2XNIA 1LVMA 2ZU1A 3FFGA 2OLGA 5DKMA 3RUOA 1ZOMA 3EQ0H 2VWLA 3MNCA 4O03A 2AMQA 1MTSA 2UUJB 1HCGA 3M7UA 3QUMP 3PLPA 5F6MA 4X8UH 3ZZAA 2PKAB 3RXPA 1C2GA 3GY4A 5HGGA 3PB1E 2UUKB 3SJIA 4AFZA 4X6PA 2GV6A 2ZDNA 1GMDF 2VIOA 1F0TA 5E2OA 3VEQB 3AAVA 5JB8S 4ESTE 3M36A 2IOTA 2JETB 3SUEA 2Q6FA 1RS0A 2BVSH 1ESTA 2FM2A 3KHVA 5T6GA 3T26A 4HZHA 1MBMA 1YPHC 3RXUA 3A81A 1W10U 1TGBA 1BUIA 2VWOA 1G3CA 1D3QB 2JH5D 1A0JA 5BPEA 1EUFA 1BRBE 5E2PA 4Y6DA 2ZGHA 3TGKE 2EEKA 1Y59T 4FUFA 1O2VA 1PPHE 1A0HB 3GY8A 1THRH 1EZQA 3ZZ3A 1C2EA 1SLWB 4HFPB 1O2XA 4X2YA 4I8LA 4MQAA 2BLOA 4NSYA 3O8DA 1P3CA 2BTCE 2AYWA 1IQLA 5A0CA 2H9TH 2SNVA 4X8SH 1L4DA 2FEQH 3BTGE 3RXIA 5DP3A 3PYHA 1BB0B 1NPMA 2W7SA 3A88A 4J1YA 2XRCA 3T27A 1EATA 1MMJN 3LGIA 3UIRA 3SQEE 1O2UA 4BTTB 1DXWA 6ESTA 2FYRA 1HAVB 1ZSLA 1WV7H 1GI2A 3RXLA 5FAHA 1TGTA 2ILNA 2PW8H 3AVZA 4JZIA 5F03A 1VR1H 3SGQE 1NRRH 3PROA 1SI5H 1O2ZA 1CGHA 1QRZA 1CE5A 1QQUA 2GP9B 5DP6A 1O3IA 1SGDE 4ISLA 1K1LA 1HAGE 2ODYB 2PHBA 2VIQA 1F0RA 4HI3A 4R8TB 2CJIA 1MKWH 2HPQH 2Z7FE 5CE1A 1P9SA 1VCPA 1O3JA 2AGGX 2O8LA 3I78A 3LJOA 3C27B 1P06A 1ZPZA 2BY8X 1A2CH 1YCPM 4JMYA 3A7ZA 1DM4B 1SPJA 3W95A 2ANWA 1SMFE 1CU1A 1O3BA 1SL3A 4A1XA 3LGWA 1HAXB 5GJ4B 1FV9A 3ITIA 1B7XB 2WPIS 2Y7ZA 1K1MA 2V35A 1AFQC 3K2UA 2P94A 1WAYB 3RU4E 1DY8A 1PQAA 3TGIE 3MH7A 1UMAH 1O2GH 3TNSA 2VWMA 2V6NA 3P8GA 2BY6X 1GBBA 3M3TA 1O3GA 2ZCLP 1G3BA 1P02A 3KGPA 2GCTC 1O2WA 3GCHB 4ABHA 2F3CE 4MTBA 1Z8IB 3SU2A 1SFIA 1OWKA 1GI9B 1SGTA 4WVPE 1SGCA 3MO3A 2BY9X 1C5YB 3OSYA 4DGJA 3RM2H 2BX4A 1J16A 1CT2E 2FO9A 2OD3B 2J94A 1FY8E 1QFKH 2VH6A 4X1NU 1ELGA 3BTDE 5I46H 2G51A 2UWPA 1OWIA 2RG3A 2RDLA 4WH6A 2AH4X 2XW9A 1P10A 3PTBA 2A7HA 2EI8A 1DLKB 1GJAB 4IN1A 3WY8A 1OS8A 1ZJDA 1GBCA 1TX7A 1CBWC 2VIVA 3LC3A 5TCAA 2HOBA 4OS5A 2QXIA 3MTYA 1Y3WA 2M5TA 3TJVA 3MH4A 2RA3A 3BEUA 4FUIA 2SGAA 1Y3UA 1C5NH 3ZVFA 3K6ZA 1C1PA 3RXSA 1HJAB 1HB0B 4NGAH 2VJ1A 1HAPH 1HUTH 1FIZA 1TMUH 5TCCA 4YM9A 3A86A 1H4WA 3QGJA 3RC4A 1LPGB 1IQHA 4XBCA 3SQHE 4AG2A 2ZO3H 1OWHA 4ABDA 1C5UA 5B6OA 1TNKA 4GCHF 4D7FA 1O5FH 2P8OC 1UTPA 4YLUA 3A80A 2FOFA 3ZV8A 2D2DA 4XFQA 1S81A 4DOQA 3G01A 4X8TH 4H6SB 4IS5A 5DPAA 1ZMNA 6GCHG 1PPFE 1D4PB 8GCHF 2BB4A 5FBIA 2BD8A 1VGCB 1ORFA 1D3PB 2G81E 1UVOA 1O2IA 4MPUA 3BTWE 4LZ4B 1P2JA 2XWAA 4FU7A 1C1OA 1GI7B 1EXFA 3RXGA 1NFXA 2GT8A 4X1RU 1GDQA 4AOQA 4D8NA 1E35B 1BHXB 3SGBE 1FJSA 1GBMA 3GICB 2SFAA 1AKSA 1V2ST 2GT7A 1V2PT 1V2KT 1OXGA 1V6DA 2F91A 1C1TA 1P11E 1FDPA 2FWWA 1D3TB 3L3TA 1BRCE 4A92A 3F9HA 3ZVEA 2ZGBH 2FX6A 4AGKA 1NESE 5C3NA 1EZSC 2LPRA 1P57B 2QIQA 1GBEA 5IYTA 1N8OC 1MTNB 5GCHF 5JDUB 1PPGE 1Y5BT 1HLTH 5JBAS 4AB9A 2BD2A 4LZ1H 3Q3XA 3F9FA 5EPNA 1RGQA 1UCYH 4JZDH 1SG8B 3SHAH 5DJ7A 1O3FA 1O2SA 1K22H 1ESBA 2OQ5A 1BOQA 3QZRA 1TRNA 3ZZ4A 4ABEA 1O0DH 3T5FH 4B74A 1VITF 1FN8A 2EI7A 2IPHA 5L2ZH 2FI5E 1YPLH 4XSKU 1PYTC 2ZHFH 4CRAA 8KME2 3SV9A 3DT0H 1C1RA 1LPKB 1T8NA 1CT4E 1DWEH 1OYQA 1TNJA 2BQWB 1LTOA 2C8XB 4ABFA 5EODA 3LGYA 4RN6A 1G2MA 1F7ZA 2BD7A 2Y81A 2YNAA 3O8CA 5DP7A 1AVWA 2O8TA 4DVAU 1UVSH 1GBAA 3BTEE 4K1SA 3GCHC 4YT7H 4Q7XA 1QJ7B 2QF3A 1UTQA 1GDNA 2JH0D 2QN5T 4ABIA 2TIOA 1AIXH 4A1VA 4DJZB 4B73A 1YYY1 3U9AH 1GMHF 1O2RA 2ODPA 4X8VH 2Z3EA 1J9CH 2ANKH 1GI1A 1TRYA 2UWOA 4FUDA 3UPEA 1YP9A 2PKAA 3H7TA 2FS9A 1AUJA 1EPTC 3B8JA 3KL6A 3ODDA 4B2BA 3UWIA 2NU1E 3B9FH 3SU0A 3TGJE 4PROA 1K21H 1XUKA 1QL7A 4H4FA 4E7NA 1PFXC 1HFDA 3KF2A 4Y7BA 4FUJA 1BMLA 1DVAH 1N6XA 3A82A 3SV7A 3V0XA 4Z0KA 1CT0E 1UVUH 3ATWA 3L33A 2ALPA 2XBWA 3GY6A 1DOJA 2ZG0H 2NU4E 3RMNH 3N7OA 1LVYA 4NIXA 1ANBA 2Z9JA 3E6PH 1QA7A 3GDVA 5DP9A 3SU4A 2ZHDA 3PWCA 1TRMA 4X2VA 3SBKA 2FTLE 4X2XA 4ABBA 3LPRA 4YOIA 5DO4H 4U32A 1GJBB 2ULLA 4A6LA 1YKTA 1THPB 1ZYOA 1UTLM 1L2EA 4A7IB 1SQAA 1EKBB 1SQOA 3UFAA 5IDKA 1NT1A 3M7TA 2FTMA 2XC4A 5ETXA 2FLRH 1ZR0A 3S9BA 4OS1A 1KTTB 1VGCC 1H1BA 2OTVA 4K69A 5FBEA 1NFWA 5K7RA 3GCTG 3BTHE 4UFFH 3A7XA 1AE5A 2Z9LA 1O2YA 3IG6B 4MLFB 1FUJA 4BANB 1SLUB 3TK9A 1HAVA 2R0LA 5T6DA 1EOLA 1LQDB 4FUHA 1S0QA 2AFQB 3PMJA 2DE8A 5F8TA 3ATLA 5J4SA 2BDIA 3T62A 1WSSH 3RLWH 2Z6BD 3RM0H 1AB9B 5EPYA 3T28A 4K60A 2HNTC 2O9QA 3S9AA 1F0UA 2CXVA 1ELCA 3D65E 1ANEA 4B2CA 1UJ1A 3U69H 1BBRE 1J8AA 1SFQB 2TPIZ 1F2SE 2CHAB 1LQEA 1MTNC 5FPTA 1UK4A 2ZFFH 3SUFA 1O2OA 3P8NA 1MUEB 1SBWA 1TMBH 1AKSB 3GYLB 4DIHH 1O37A 1NM6A 2XYAA 1H8DH 3T25A 4IBLH 4HGCA 4NZLA 2G8TA 3PLBA 3DUXH 3KEEA 2ZHEH 1PQ7A 1BT7A 1SLVB 3SZNA 1BCUH 3EA7A 2ZTZA 3OTJE 2OBQA 4NA8A 2W3KA 1AMHA 1O3AA 1UHBA 3AAUA 4CRCA 3ZV9A 3GCTF 1TALA 2I6SA 1LHCH 1BRAA 1RRKA 1TBZH 4ISHH 2P3FH 3RU4D 1P04A 3BG8A 1FY4A 5FX6A 4ZHAA 1KDQA 1QB1A 3RXQA 4GHQA 1A5IA 1AFQB 5FPYA 1HXEH 4D76A 1NFYA 3VGCC 3Q3KA 1EASA 1OSSA 1XUHA 1C1MA 1HGTH 4OGXA 1T32A 1O36A 1DE7H 1O30A 1KTSB 4AFQA 3ENSB 1UVPA 1C2FA 5E0GA 1NRPH 2ANMH 7ESTE 1ZPCA 1TONA 5GXPA 2R9PA 1J14A 1BTYA 2TGAA 1RFNA 1GBTA 5C1UA 1T31A 2GCTB 1HRTH 1IOEA 4Y0ZE 3UR6A 1EPTA 1EQ9A 2FX4A 5AF9H 2ZFRH 4OS2A 1DITH 1JIMA 2BLVA 3D62A 1LVBA 2HLCA 3QLPH 2SGDE 4B76A 1BTWA 1O31A 4I31A 4TWYA 1C2MA 3RXFA 1ANDA 1ZGVA 4NIWA 1Z8JB 3FP7E 4WF8A 1C1WH 4FUGA 2BD4A 4OS7A 2R2MB 4IN2A 3PMBB 3LKWA 2STBE 1Z1IA 3L6PA 1GHXH 1CBWB 2A5KA 3A84A 4M7GA 1IQFA 1DANH 3E91A 2FESH 1QR3E 4XBBA 4FUCA 1AO5A 4F4OC 3U1JB 1NROH 1YPKH 3RXTA 4TPIZ 2AMPA 3RC5A 3GY5A 5JBTA 2FOBA 3F68H 4I8KA 3MOCA 4Q80A 2YNBA 1BQYA 2K1QA 1XUGA 3OY6U 2PWXA 1KSNA 4AFUA 1Y3XA 2H5DA 1JWTA 1P0SH 3RXJA 1UTNA 1QCPA 4D7GA 1O3KA 1G32B 1KXCA 2BLWA 2ZPRA 3M35A 4NIYA 3E3TA 5K0HA 4O9VA 1IHTH 3SNBA 1Z6JH 9LPRA 1RJXB 1JRSA 3DHKH 1K1IA 1LHFH 1S84A 2VVCA 1DUEA 2QCYA 1UK3A 2P8OB 1XM1A 1TNHA 4FUBA 1C2IA 1O38A 1FAKH 1MD7A 3UNQA 3D23A 1ZRBA 3LH1A 1YPJH 1C9TA 2BD3A 3CENA 4ZKOU 4E06H 1SGIB 5E8EH 4HTCH 1G30B 3U8OH 5BRRE 5JPMH 2ESTE 5JBCS 3QDZB 1CA0C 4I8GA 2OP9A 1CSOE 2R2WU 3TNTA 3TH3H 5LPFA 3HK3B 3LGTA 1AB9C 1LKAA 4LXBH 1QBVH 3SU1A 4NA9H 2FOEA 1MKXH 5EQQA 1OP8A 2ZHQH 1ARBA 3SUDA 4ZAEA 4X1SU 3VXEH 3MWIU 1C5SA 3GOVB 2CHAC 1B0EA 3RMMH 3C1KA 1TNIA 1FLEE 1IQNA 1BMNH 1V2MT 3BIUH 3SNEA 4NWKA 4UE7H 1W7GH 5A0BA 1WBGB 2H6MA 1FIWA 1RTKA 2FI3E 2SGFE 2GGVB 3ZVDA 2AGIX 5E0HA 2WPHS 2SGQE 5E0JA 3HATH 4AZ2B 4BAKB 2ZGJA 3ZVGA 1N8OB 1GVKB 2D1JA 2FDAA 3ELAH 4OGYA 4Y8YA 4I33A 3ZZ7A 1GI0A 3M61U 2ZGXH 3RXHA 3E0PB 3ZZ6A 2FOAA 1HBTH 3TLOA 1N6YA 1Z7KA 5H4IB 4NG9H 3SORA 4DG4A 3SU6A 2WYGA 1QL9A 2QY0B 2BQ6B 2XCFA 3ZVAA 2O8MA 1YF4A 2I6QA 1ELEE 4INKA 1MKXK 1AQ7A 5AFYH 1ELBA 3PTNA 3A87A 1BTXA 1YLCA 3DFJA 1Z8RA 3RXVA 3SOSA 1AFEH 4KTCA 5GWZA 1GWAA 1J15A 1GBKA 1ZSJA 1ETRH 2A4GA 1UHBB 2VIPA 1UVTH 1AWFH 1ETSH 5HMAA 2OINA 4AB8A 3F9GA 4IC6A 3EE0B 1ELVA 1GBHA 1KDQB 1YLDA 1MKWK 2OC1A 1L4ZA 2SGPE 2EA3A 3UOUA 3MO6A 1N1LA 2ZDAH 2FOHA 2ZHWH 4JYTA 3UY9A 1OYTH 3QWCH 3RC6A 2PR3A 4K1TA 1GJ5H 4Y79A 3SNAA 2G4TA 1IQGA 4INLA 2FMJA 4AN7A 1GJ7B 3M5NA 1O2MA 2C3SA 1SSXA 3SU3A 4Y7AA 1ZHRA 1ZMJA 1RXPA 3LT3A 4BNRA 3AW1A 1MTWA 1JIRA 3VB6A 1TIOA 1O5DH 3NPSA 1XUIA 5HM9A 1EPTB 4GHTA 2F9BH 3SO3A 1XVMA 1L0ZA 1P3EA 3KN2A 1A61H 2A31A 3B23B 1JMOH 1SGNE 1WTGH 3PO1B 2PGBB 5EQRA 4JK5A 4I8JA 1O2JA 1HPGA 1C1UH 2A4OA 4FVDA 4J2YB 1SGFG 3MYWA 3EYDA 3BTFE 4FU8A 2XC5A 3A8DA 2G55A 1IQJA 1P03A 4IMQA 2B9LA 3PLKA 3EDXB 4A5TS 1SQTA 2P59A 1EX3A 2BVXH 3ZYDA 1ABJH 4BAHB 5J4QA 1TX6A 3RXAA 1BTHH 4Z6AH 3LONA 2BY5X 1SOZA 3P8OA 3S69A 1OKXA 7LPRA 5FX5A 1THSH 4MDSA 2FLBH 1SHHB 4ABGA 4BAOB 3LGVA 1J17T 2P93A 4I8HA 3P70B 1F5KU 5F8XA 1AU8A 3GCOA 1HXFH 3NWUA 4O3TA 5DG6A 2BMGB 4TYDA 1IHSH 5ABWA 1LVOA 3SN8A 2J34A 2R3YA 4IW4E 5CMXH 3IITA 1UTJA 4WWYA 1DSTA 1VCWA 1V2UT 4K3JA 3FP8E 1XMNB 1C4Y2 1XUJA 1LO6A 2ZU5A 1BZXE 1ZRKA 1MCVA 1D6RA 1SVPA 3M7QA 1Y5UT 1QL8A 1EP5A 1DDJA 2ZGCA 2HVXA 1DICA 2Y6TA 1QHRB 4THNH 4AGJA 4ZKSU 2Z9IA 1GI8B 1X7AC 4K2YA 2BD5A 1F0SA 4BAQB 4D9QA 1WQVH 3MH6A 3TVJB 1LDTT 4BAMB 3W94A 4DURA 3FAOA 3UR9A 1HNEE 3QK1A 1UTKA 5A8YA 1ETTH 2H9HA 5FPSA 1W14U 2P16A 3MU1A 3KIDU 1KLJH 1M9UA 5A2MH 1F5LA 1KXDA 2B8OH 2ZDLA 4Q7ZA 1PQ5A 1PPZA 2NU3E 4MG3A 4K8YA 3TH2H 1BHXF 3TH4H 4ABAA 1WYKA 1GJ9B 4MPVA 1NRNH 1DWBH 5DP5A 1CA8B 1FI8A 1MZAA 6GCHF 3QO6A 4I32A 2GTBA 1QTFA 1FNIA 5ESTE 2GZ7A 3P92A 4JZEH 1MH0A 4U2WA 3MU0A 1C5QA 4H6TA 2G5VA 5DK1A 2Z94A 4X2WA 1ZSKA 4YTAA 1E38B 1P12E 3VGCB 8ESTE 5EW2H 1W3CA 2BDYA 3VB5A 1SB1H 3R0FA 2VIWA 3FVFB 3K65B 2BXUH 1MU8B 1INCA 3F1SB 1UCYK 2RCEA 4MNVA 4RKOB 1IAUA 1GVLA 4R0IA 3UNSA 1C5TA 1NU9A 1C4U2 3M3VA 1OWJA 4ZKNU 1FN6A 2FPZA 3SJ9A 1QIXB 1AZ8A 1AD8H 3OY5U 3TIUA 1LPZB 2NU0E 5EQSA 1O2KA 1Z8GA 2BDAA 2HPPH 3A83A 4OS4A 5EG4A 2AIPA 3VB3A 3UQVA 3VB4A 1ZHMA 2O8WA 1LMWB 3PO1C 1V2NT 2D26C 3MO9A 3LIWA 1V2OT 2J4IA 5LPEA 1VCQA 4NIVA 1TBRH 1RTFB 5T3HA 3ATKA 1KXFA 1NTPA 2WPKS 5C1XA 1WQSA 3R3GB 2WUBA 4UD9H 4MPXA 3DD2H 1O2QA 1K28D 3BSQA 1ZJKA 1V2LT 2BDGA 3MH5A 4YO9A 1GI4A 1O3DA 2ZU3A 3DFLA 2VGCB 1O32A 2ZFSA 1O5GH 1XUFA 2UUYA 2GV7A 3BTQE 1T4UH 1O3HA 1A5HA 4A1TA 1AVXA 1ZMLA 3BV9B 3ZVCA 1C5XB 4BTIB 1NN6A 2Y80A 4B71A 2ODQA 1GI5A 1SC8U 3ATMA 3NXPA 1BITA 4UFGH 3TPIZ 1C1SA 2XC0A 3BTME 4KGAA 1GBLA 4AX9H 2ZCHP 2Y5HA 1EAWA 1AN1E 1CQQA 3RMLH 1JOUB 1C1QA 1L1JA 3PMHB 3HKJB 3RDZA 4JYVH 1GDUA 4UEHH 1E36B 4TWWA 1ABIH 3NUMA 3LOXA 1ZGIA 2R0KA 2OUAA 3URDA 1CA0B 1DFPA 1GG6B 3PMAB 1BIOA 1C1VH 1C2JA 4Y10E 3S0NA 2FIRH 2YOLA 1QNJA 2FOMB 4X6NA 2QAAA 7KMEH 1YM0A 2BDBA 3SW2B 1FY1A 2J92A 3GCNA 2A7CA 3SI3H 1NO9H 1YGCH 1FPCH 1FXYA 1HAIH 3JZ1B 2VINA 1V2QT 3MMGA 3GY7A 2FP7B 2OQUA 2OC8A 1W11U 3V13A 1G2LA 3FZZA 2A32A 5AFZH 4FU9A 2BM2A 4ZHMU 1O34A 1P8VC 3A8CA 4K1EA 4WXVA 2G52A 2XBXA 1TBQH 5C2ZA 4CRBA 1OX1A 4NCYA 3TU7H 1TE0A 3MNXA 1HDTH 4OS6A 1W7XH 3M5MA 1DS2E 4Y11E 3QN7A 2VH0A 5GIBA 1PQ8A 2KAIA 1FAXA 4X6MA 3PV4A 1SOTA 4BOHA 1C5ZB 3M37A 1PPCE 4IMZA 3LDXH 1SR5C 1AY6H 2PKSC 4FUEA 4CRGA 1CHOG 1MCTA 1NFUA 1YC0A 2BX3A 4ZHLU 1AHTH 5A8ZA 3SUGA 2ASUB 5L2YH 4LK4A 1ZPBA 1W0ZU 1ARCA 2PFEA 4DW2U 4CRFA 5HYOA 2BLQA 4CR9A 1QBOA 2PGQB 1S83A 3UTUH 1C5WB 1TFXA 2V3HH 1A0LA 1GCDA 3CS0A 1K1NA 3T29A 1GHWH 3S7KB 3ZZ8A 3UNRA 1GMDG 2FYQA 4X6OA 1C9PA 5EXLA 3KCGH 3M5OA 1ELAA 1ZHPA 2QYIA 2AGEX 2WPMS 2Y5GA 3OU0A 1TMTH 2GDDA 2Q1JA 4ZXXH 2WPLS 3ODFA 1K1PA 3P17H 1TAWA 1OP0A 4H42U 1GHVH 5GPIB 2QXHA 2ZFTA 3RXOA 1O5CB 2W5EA 1H9IE 4IGDA 1AE8H 1QBNA 2ZC9H 3HK6B 3O8RA 3LC5A 1ELDE 2DUCA 1TGSZ 3A8BA 5EXMA 3D49H 1MBQA 1O2NA 2TGTA 1KYNA 1WU1A 1V2RT 4BTUB 3U8TH 4CREA 2VU8E 5GDSH 3HGNA 3TK6A 1MQ6A 1Q2WA 1SGFA 3FANA 5JB9S 2VGCC 3HKIB 2HGTH 3PWBA 1QA0A 5AHGH 5LPRA 1FQ3A 2QGRA 3KQEA 3T2NA 1E37B 5C67A 2GVFA 2ZI2H 6CHAB 1VJAU 3STJA 4YZUA 5HXFA 4MNWA 4ZROA 1O2TA 1W2KH 1MTUA 1L1GA 3A7WA 1FONA 2W26A 3KQDA 2A5IA 3MU8A 3HGPA 4SGAE 3F6UH 1MZDA 1TABE 2A1DB 3E90B 3M5LA 4RSPA 4NA7A 4KTSA 5EW1H 4F49A 4B2AA 2PUXB 3VB7A 2BDHA 2G4UA 5L6NH 3BG4C 4WMEA 4JK6A 2ZTYA 2EI6A 3SU5A 4GPGA 1P05A 5DP8A 1QRXA 1CHGA 1ZLRA 4CHAB 2ZDKA 3P95A 4DCDA 1XXDA 3K9XB 1Q31A 4Q2KA 1YPEH 1G9IE 1GG6C 3QGNB 1T7CA 1EAXA 2FS8A 3S9CA 1PJPA 1V2VT 2G5NA 1QJ6B 4LOYH 3ZYEA 1PPBH 1UTMA 3ZZ9A 1HJ8A 1HAHH 1F92A 2C93B 2ZFQH 3SV2H 1GBIA 2UUFB 2BVRH 1VJ9U 1BBRH 1XKBC 2BD9A 4CBOA 2QF0A 2FODA 1FPHH 2P95A 2IN2A 3GDUA 5JYIA 2AEIH 1QURH 1IQIA 1O3LA 1TPSA 5A0AE 3NKKA 1O5BB 2ZDVH 3VPKA 2QXGA 3AASA 3MI4A 1QRWA 3TJNA 2O8UA 1K2I1 2VB0A 1TPPA 4Y76A 3MNSA 4GAWA 1YPHE 1LKBA 1HYLA 1VZQH 1NU7B 2GZ9A 1E34B 2ZECA 1BTZA 1DWCH 1MAXA 5DP4A 5F8ZA 3RXBA 1EJNA 2ZP0H 2ZTXA 2Z9KA 3QTVH 4YESB 2Z9GA 2W3IA 5LGOA 1EAUA 3SV8A 3OX7U 5L30H 5LH8A 4NFFA 3P6ZB 3LJJA 1TGCA 1C2HA 3SNDA 1UO6A 1BBRK 1FMGA 4ZXYH 2BXTH 1AGJA 1K1OA 3I77A 2PTNA 1VITH 1GBJA 1Y5AT 2A7JA 3FZDA 3M3SA 2ZNKH 3KQBA 1GPZA 1HAYB 4YT6H 2VWNA 1Q3XA 1GCTC 5EOKA 1GJ6A 2KAIB 4WJG2 4E05H 1TX8A 1O5AB 1BJUA 3MU4A 1UCYE 2ZF0H 2F9PA 1D3DB 2BDCA 4K5ZA 2F9NA 1S85A 2A0QB 2Z3CA 3BTKE 2GKVE 4CH2B 1GL1A 1V3XA 1MTVA 3U1IB 1TNGA 4GUXA 5C20A 2SGEE 3RXMA 1P2OA 4WMFA 5A8XA 1KY9A 1C1NA 3AW0A 2RA0A 4YLQH 3ZVBA 1OWDA 3KQCA 3CP7A 1HIAB 1SGRE 1A7SA 6LPRA 1EZUC 4AG1A 1Y3YA 2GMTB 1QB6A 1AVGH 1P2QA 2BHGA 1W8BH 2BZ6H 2C90B 1XVOA 1ANCA 4MNXA 4GCHG 1GHBG 1S6HA 4NSVA 2JKHA 1FZZA 5AVDA 2V0BA 2ZQ1A 1RIWC 1TPAE 1DPOA 2ALVA 1P2KA 3IWMA 4MNYA 1BTUA 2PLXA 5EXNA 8LPRA 3LU9B 1NZQH 1SLXB 5JBBS 1PYTD 8GCHG 4GVUA 1W0YH 5A09A 1DT2A 1UTOA 4XDEA 2A2XH 4YOJA 1IQEA 5FCRA 2ZU2A 1EJAA 1O39A 1T4VH 2VVUA 3ZZBA 5PTPA 3SHCH 4AYYB 2CF9H 3U8RH 2C8YB 1ID5H 5TJXA 3RXKA 6CHAC 2Q6GA 1TGNA 2ZZUH 4UONA 1BTPA 1XXFA 4AYVB 4TPYA 2XXLA 3V3MA 3UQOA 3NCLA 1BMMH 3RP2A 1IQMA 1V2JT 4ISNA 4D9RA 4X0WU 2Q6DA 1AWHB 4X1QU 1A3EH 1Z71A 1FY5A 2BY7X 2C8ZB 3V7TA 3RU4T 1NY22 3EA9A 2WINI 1XKAC 2JETC 2WPJS 3U98H 1O2PA 4KTUA 1BDAA 1O3MA 4CHAC 2P3TB 3E16B 4MPWA 4WY3A 3Q77A 1LHEH 4CBNA 5GCHG 3RXDA 2A45B 3A7YA 3JZ2B 1FY3A 2C4FH 3ZZ5A 2CN0H 7GCHG 2A5AA 4CH8B 2AS9A 4GLYA 1EAIA 2CMYA 1DY9A 1GHBF 4KKDA 1GMCG 4NZQA 1TLDA 1BA8B 2VIDA 1O2HA 1RTLA 2ANYA 4VGCB 2ZU4A 1NRSH 2G00A 4INHA 4QT8C 2TGDA 1VITG 2OC7A 4WH8A 3K6YA 3F9EA 2XCNA 1GHAG 2XBYA 1GJ8B 1H9LB 3KNXA 4ISOA 4UDWH 4DY7B 1C5RA 3ATIA 2B0FA 2OCVB 3RXRA 1HAZB 4NFEA 1S0RA 5FCKA 3BEFB 4YOGA 1CVWH 3SJOA 3TITA 1O3PB 1KXAA 1O33A 3GDSA 1H8IH 2AERH 4Y8XA 1TQ0B 1JBUH 2ZIQH 2ZKSA 1MU6B 1YCPH 4JCNA 3RXEA 3TJUA 2ZEBA 4FXGH 1LHDH 2W7UA 1ESAA 2GD4B 1MAYA 1Y3VA 2EC9H 5CHAB 1T8MA 1GMHG 1O35A 4JZ1A 1YPGH 4U01A 1F5RA 2LNCA 2ZPQA 3MU5A 4BXSA 4I7YH 2B7DH 1C5MD 2VNTA 1KIGH 1WOFA 4Y8ZA 3UWJH 1TWXB 1C4V2 2QA9E 1NRQH 1ZTJA 4JYUH 5DGJA 1D6WA 1S5SA 7GCHF 2HNTF 2J9NA 2QXJA 1K9OE 1A4WH 4O97A 1TA6A 1JXPA 2PKSB 1GMCF 2BOHB 1KLIH 5EU8A 3BF6H 2Y5FA 1B5GH 2HALA 2ZA5A 4GSOA 2FOGA 2H2ZA 2BYAX 3V12A 2TGPZ
chains in the Genus database with same CATH superfamily
1SGYE 1GHAF 3GISB 2UWLA 2F9VA 1TB6H 3DSPA 1Z1JA 1YCPK 1O3OA 1CGJE 3OYPA 1LCYA 1P2IA 1HJ9A 3TJOA 3BTTE 1YBWA 1GHZA 1ZZZA 3NK8A 1GGDB 1TPOA 2Y82A 3URCA 3PM3A 1C5OH 2H5CA 3QZQA 2IJOB 1IQKA 3EA8A 1GL0E 1GHYH 1TOCB 1D9IA 3A8AA 2CV3A 2GMTC 5EJZA 3SI4H 1AZZA 1O5EH 2AMDA 4KP0A 2BOKA 2GX4A 4ASHA 4ZH8A 2FOCA 1S82A 3QX5H 3DA9B 4WXIA 2J95A 1ELFA 2QV1A 2BQ7B 1DXPA 5I25A 3E0NB 1P2NA 2J97A 3Q00A 3Q76A 5EGMA 1HAOH 1QJ1B 1V2WT 2PSYA 4BXWA 2BZAA 4TY6A 1CO7E 2Z3DA 3UOPA 1DUAA 1JRTA 3A89A 1K1JA 4DIIH 1A5GH 2TBSA 1OP2A 1SGEE 4CR5A 2FXRA 2V3MA 5FXLA 1SGQE 2GZ8A 4XOJA 3SJKA 1Z6EA 1O2LA 1O3EA 1GJDB 3P8FA 5FHTA 2XWBI 4CRDA 2R3UA 2A2QH 4RKJB 2DE9A 3PV2A 2F9OA 1AUTC 1EJMA 1KXEA 4UFEH 1KXBA 4ZMAH 4O3UA 1EB2A 1P2MA 1HJAC 2WUCA 2YMSC 1GJ4H 5G4BA 1YPMH 2CF8H 1UK2A 2HRVA 3H5CB 2STAE 3EGKH 2A4QA 2ZFPH 5SGAE 1P01A 3MNBA 1LHGH 3RLYH 3ZZDA 3TK5A 1RD3B 3E8LA 1B0FA 2OC0A 3BIVH 4DT7B 1GBDA 1HV7A 2H1UA 2ZCKP 1PPEE 1T8OA 1WDIA 1BRUP 3BG4B 3SV6A 3OTPA 3H7OA 3BN9A 1TNLA 1QGFA 1GBFA 3GYMA 4VGCC 1QQ4A 3KYGA 5C5OA 3NZIA 9ESTA 2OBOA 3GY2A 4ZUHA 1S6FA 3RXCA 3VFEA 3MFJA 1A46H 4JZFH 3RMOH 2FZZA 1T8LA 3MHWU 3LGUA 3QTOH 1SHYA 1EB1H 1W12U 1DWDH 1MQ5A 2NU2E 2VVVA 4SGBE 1WUNH 2B5TB 3UUZA 1ELTA 2FI4E 2PUQH 2XBVA 1OWEA 4FETA 3E1XB 4FVBA 1P9UA 2PTCE 4K8BA 1P09A 1DX5M 1GJCB 1NC6A 3STIA 4Y0YE 2ZQ2A 5T6FA 1DSUA 4I86A 1U6QA 5CHAC 2C8WB 5C5NA 4B1TA 1C5PA 4IC5A 1G3DA 2TRMA 4AORA 2GCHG 2Y7XA 1TA2A 2QC2A 1TOMH 2P3UB 3CS7A 2F83A 4XE4A 2NWNA 1S6LA 4B75A 2PSXA 3FN8A 4X1PU 1DLEA 1C2DA 1C2KA 1W13U 1BMAA 1AI8H 2SNWA 2WYJA 2D8WA 1G37A 2WV4A 3Q3YA 4KELA 2AIQA 1C2LA 1EOJA 2ZDMA 3SNCA 3ESTA 2HLDD 3UREA 3S7HB 1CGIE 1ZTKA 4ZKRU 3F2HA 2OXSA 2PV9B 1Y8TA 3HPTB 2JJ1D 2A4RA 1GCTB 1HIAA 5HM2A 1WTHD 2F9UA 1O3CA 1EP6A 2J2UA 2CGAA 2ZWLH 4AFSA 3SJ8A 2J98A 1GVZA 5C1YA 1C5VA 1NS3A 1SGPE 2HNTE 3BEIB 4XBDA 2THFB 3A7TA 1E0FD 4NWLA 1GGDC 1GI6A 2J38A 3A85A 2JH6D 1EZXC 3EE7A 2ZPSA 1OOKB 4E7RG 4ABJA 3O8BA 3ZZCA 5ESBA 2XTTB 1GI3A 3FP6E 2HWLB 1MABB 4Y71A 4ISIH 2H9EH 1G36A 1WCZA 1A3BH 1G3EA 4UFDH 1TYNA 1KLTA 1TQ7B 3VXFH 2GCHF 2V3OH 2WV5A 3GY3A 4U30A 4F55A 1XX9A 1MD8A 1L1NA 3SGAE 5KECA 3LH3A 1OPHB 1V2TT 2GDEH 1ACBE 1QB9A 4TY7A 1RIWB 1ZTLA 4MVNA 1QY6A 3EAJA 1A1RA 4Q7YA 1H9HE 1BJVA 1O3NA 3A7VA 1C5LH 4WMDA 1CHOF 3I29A 2XNIA 2HVYB 1LVMA 2ZU1A 3FFGA 2OLGA 5DKMA 3RUOA 1ZOMA 3EQ0H 2VWLA 3MNCA 4O03A 2AMQA 1MTSA 2UUJB 1HCGA 3M7UA 3QUMP 3PLPA 5F6MA 4X8UH 3ZZAA 2PKAB 3RXPA 1C2GA 3GY4A 5HGGA 3PB1E 2UUKB 3SJIA 4AFZA 4X6PA 2GV6A 2ZDNA 1GMDF 2VIOA 1F0TA 5E2OA 3VEQB 3AAVA 5JB8S 4ESTE 3M36A 2IOTA 2JETB 5EIYA 3SUEA 2Q6FA 1RS0A 2BVSH 1ESTA 2FM2A 3KHVA 5T6GA 3T26A 4Q4LA 4HZHA 1MBMA 1YPHC 3RXUA 3A81A 2KCYA 2F4LA 1W10U 1TGBA 1BUIA 2VWOA 1G3CA 1D3QB 2JH5D 1A0JA 3H09A 3PRBA 5BPEA 2EY4C 1EUFA 1BRBE 5E2PA 4Y6DA 2ZGHA 3TGKE 2EEKA 1Y59T 4FUFA 1O2VA 1PPHE 1A0HB 3GY8A 1THRH 1EZQA 3ZZ3A 1C2EA 1SLWB 4HFPB 1O2XA 4X2YA 4I8LA 4MQAA 2BLOA 2J5UA 3O8DA 4NSYA 1P3CA 2BTCE 2AYWA 5KEDA 1IQLA 1QZ8A 5A0CA 2H9TH 2SNVA 4X8SH 2RFKC 1L4DA 2FEQH 3BTGE 3RXIA 5DP3A 3WW7A 3PYHA 1BB0B 1NPMA 2W7SA 3A88A 4J1YA 2XRCA 3F3BA 3T27A 1EATA 1MMJN 3LGIA 3UIRA 3SQEE 1O2UA 4BTTB 1DXWA 2WSSD 6ESTA 2FYRA 1HAVB 1ZSLA 1WV7H 1GI2A 3RXLA 5FAHA 1TGTA 2ILNA 2PW8H 3AVZA 4JZIA 5F03A 1VR1H 3SGQE 1NRRH 3PROA 1SI5H 1O2ZA 1CGHA 1QRZA 1CE5A 1QQUA 2GP9B 5DP6A 1O3IA 1SGDE 4ISLA 1K1LA 1HAGE 2ODYB 2PHBA 2VIQA 4ZCNA 1F0RA 4HI3A 4R8TB 2CJIA 1MKWH 2HPQH 2Z7FE 5CE1A 1P9SA 1VCPA 1O3JA 1YY3A 2AGGX 2O8LA 3I78A 3LJOA 3C27B 1P06A 1ZPZA 2BY8X 1A2CH 1YCPM 4JMYA 3A7ZA 1DM4B 1SPJA 3W95A 2ANWA 1SMFE 1CU1A 1O3BA 1SL3A 4A1XA 3LGWA 1HAXB 5GJ4B 1FV9A 3ITIA 1B7XB 2KX4A 2WPIS 2Y7ZA 1K1MA 2V35A 1AFQC 3K2UA 2P94A 1WAYB 3RU4E 1DY8A 1PQAA 3TGIE 3MH7A 3WWFA 1UMAH 1O2GH 3TNSA 2JIZD 2VWMA 2V6NA 3P8GA 2BY6X 1GBBA 3M3TA 3N7EA 1O3GA 2ZCLP 1G3BA 1P02A 3KGPA 2GCTC 1O2WA 3GCHB 4ABHA 2F3CE 4MTBA 1Z8IB 3SU2A 1SFIA 1OWKA 4RT1A 1GI9B 1SGTA 4WVPE 1SGCA 3MO3A 2BY9X 1C5YB 3OSYA 4DGJA 3RM2H 2BX4A 1J16A 1CT2E 2FO9A 1FY8E 2J94A 2OD3B 1QFKH 2VH6A 4X1NU 1ELGA 3BTDE 3SYJA 5I46H 2G51A 2UWPA 1OWIA 2RG3A 2RDLA 4WH6A 2AH4X 2XW9A 1P10A 3PTBA 2A7HA 2EI8A 1DLKB 1GJAB 4IN1A 3WY8A 1OS8A 1ZJDA 1GBCA 1TX7A 1CBWC 2VIVA 3WWBA 3LC3A 5TCAA 2HOBA 4OS5A 2QXIA 3MTYA 1Y3WA 2M5TA 3TJVA 3MH4A 2RA3A 3BEUA 4FUIA 2SGAA 4XD7D 1Y3UA 1C5NH 2W6ID 3ZVFA 3K6ZA 1C1PA 5FL7D 3RXSA 1HJAB 1HB0B 4NGAH 2YMSB 2VJ1A 1HAPH 1HUTH 1VKYA 1FIZA 1TMUH 5TCCA 4YM9A 3A86A 4Z1MD 1WXRA 1H4WA 3QGJA 3RC4A 5HKKD 1LPGB 1IQHA 4XBCA 3SQHE 4AG2A 2ZO3H 1OWHA 4P02A 5C0TA 4ABDA 1C5UA 5B6OA 1TNKA 4GCHF 3DSGA 1O5FH 2P8OC 4D7FA 1UTPA 4YLUA 3A80A 2KR7A 2FOFA 3ZV8A 2D2DA 4XFQA 1S81A 4DOQA 3G01A 4X8TH 4H6SB 4IS5A 5DPAA 1ZMNA 6GCHG 1PPFE 1D4PB 8GCHF 2BB4A 5FBIA 2BD8A 1VGCB 1ORFA 1D3PB 2G81E 1UVOA 1O2IA 4MPUA 1OHHD 3BTWE 4LZ4B 1P2JA 2XWAA 4FU7A 1C1OA 4OM9A 1GI7B 1EXFA 3RXGA 1NFXA 2GT8A 4X1RU 1GDQA 4AOQA 4D8NA 1E35B 1BHXB 3SGBE 1FJSA 1GBMA 3GICB 2SFAA 1AKSA 1V2ST 2GT7A 1V2PT 1V2KT 2KFWA 1OXGA 1V6DA 2F91A 1C1TA 1P11E 1FDPA 2FWWA 1D3TB 3L3TA 1BRCE 4A92A 3F9HA 3ZVEA 2ZGBH 2FX6A 4AGKA 1NESE 5C3NA 1EZSC 2LPRA 1P57B 2QIQA 1GBEA 5IYTA 1N8OC 1MTNB 2K0QA 5GCHF 5JDUB 1PPGE 1Y5BT 1HLTH 5JBAS 4AB9A 2BD2A 4LZ1H 3Q3XA 3F9FA 5EPNA 1RGQA 1UCYH 1NBMD 4JZDH 1SG8B 3SHAH 5DJ7A 1O3FA 3N7DA 1O2SA 1K22H 1ESBA 2OQ5A 4P00A 1BOQA 3QZRA 1TRNA 3OEED 3ZZ4A 4ABEA 1O0DH 3T5FH 4B74A 1VITF 1FN8A 2EI7A 2IPHA 5L2ZH 1W0KD 2FI5E 1YPLH 4XSKU 1PYTC 2ZHFH 4CRAA 8KME2 3SV9A 2JJ2D 3DT0H 1C1RA 1LPKB 1T8NA 1CT4E 1DWEH 1OYQA 1TNJA 2BQWB 1LTOA 2C8XB 4ABFA 5EODA 3LGYA 4RN6A 1G2MA 1F7ZA 2BD7A 2Y81A 2YNAA 4FOUC 3O8CA 5DP7A 1AVWA 2LELA 2O8TA 4DVAU 1UVSH 1GBAA 3BTEE 4K1SA 3GCHC 4YT7H 4Q7XA 1QJ7B 2QF3A 1UTQA 3F2GA 1GDNA 2JH0D 2QN5T 4ABIA 4HG6A 2TIOA 1AIXH 4A1VA 4DJZB 4RI0A 4B73A 1YYY1 3U9AH 1GMHF 1O2RA 2ODPA 4X8VH 2Z3EA 1J9CH 2ANKH 1GI1A 1TRYA 2UWOA 4FUDA 3UPEA 1YP9A 2PKAA 3H7TA 2FS9A 1AUJA 1EPTC 3B8JA 3KL6A 3ODDA 4B2BA 3UWIA 2NU1E 3B9FH 3SU0A 3TGJE 4PROA 1K21H 1XUKA 1QL7A 4H4FA 4E7NA 1PFXC 1HFDA 3KF2A 4Y7BA 4FUJA 1BMLA 1DVAH 1N6XA 2EQNA 3A82A 3SV7A 3V0XA 4Z0KA 1CT0E 1UVUH 2WV9A 3ATWA 3L33A 2ALPA 2XBWA 3GY6A 1DOJA 2ZG0H 2NU4E 3RMNH 3N7OA 1LVYA 4NIXA 1ANBA 1SQRA 2Z9JA 4B6EA 3E6PH 1H8ED 1QA7A 3GDVA 5DP9A 3SU4A 2ZHDA 3PWCA 1TRMA 4X2VA 3SBKA 2FTLE 4X2XA 3ZIAD 4ABBA 3LPRA 4YOIA 5DO4H 4U32A 1GJBB 2ULLA 4A6LA 1YKTA 1THPB 1ZYOA 1UTLM 1L2EA 4A7IB 1SQAA 1EKBB 1SQOA 3UFAA 5IDKA 1NT1A 5F53A 3M7TA 2FTMA 2XC4A 3DSOA 5ETXA 2FLRH 5CHBA 1ZR0A 3S9BA 4OS1A 1KTTB 1VGCC 1EFRD 1H1BA 2OTVA 4K69A 5FBEA 1NFWA 5K7RA 3GCTG 3BTHE 4UFFH 3A7XA 1AE5A 2Z9LA 1O2YA 3IG6B 4MLFB 1FUJA 4BANB 1SLUB 3TK9A 1HAVA 2R0LA 5T6DA 1EOLA 1LQDB 4Q63A 4FUHA 1S0QA 2AFQB 3PMJA 2DE8A 5F8TA 1H8HD 3ATLA 5J4SA 2BDIA 3OFND 3T62A 1WSSH 3RLWH 2Z6BD 3RM0H 2PP6A 1AB9B 5EPYA 3T28A 4K60A 2HNTC 2O9QA 3S9AA 1F0UA 2CXVA 1ELCA 3D65E 1ANEA 5DSFA 4B2CA 1UJ1A 3U69H 1BBRE 1J8AA 1SFQB 2TPIZ 1F2SE 2CHAB 1LQEA 1MTNC 5FPTA 1UK4A 2ZFFH 3SUFA 1O2OA 3P8NA 1MUEB 1SBWA 1TMBH 1AKSB 3GYLB 4DIHH 1E1RD 1O37A 2IPQX 1NM6A 2XYAA 1H8DH 3T25A 4IBLH 4HGCA 4NZLA 5B6LA 2G8TA 3PLBA 3DUXH 3KEEA 2ZHEH 1PQ7A 1BT7A 1SLVB 3SZNA 1BCUH 3EA7A 2ZTZA 3OTJE 2OBQA 4NA8A 2W3KA 3PRDA 5GNDA 1AMHA 1O3AA 1UHBA 3AAUA 4CRCA 3U28C 3ZV9A 3GCTF 1TALA 2I6SA 1LHCH 1BRAA 1YWUA 1RRKA 1TBZH 4ISHH 2P3FH 3RU4D 1P04A 3BG8A 1FY4A 5FX6A 4ZHAA 1KDQA 1QB1A 3RXQA 4GHQA 1A5IA 1AFQB 5FPYA 1HXEH 4D76A 1NFYA 3VGCC 3Q3KA 1EASA 1OSSA 1XUHA 1C1MA 1HGTH 4OGXA 1T32A 1O36A 1DE7H 1O30A 1KTSB 4AFQA 3ENSB 1UVPA 1C2FA 5E0GA 1NRPH 2ANMH 7ESTE 1ZPCA 1TONA 5GXPA 2R9PA 1J14A 1BTYA 2TGAA 1RFNA 1GBTA 5C1UA 1T31A 2GCTB 1HRTH 1IOEA 4Y0ZE 3UR6A 1EPTA 1EQ9A 2FX4A 5AF9H 2ZFRH 4OS2A 1DITH 1JIMA 2BLVA 3D62A 1LVBA 2HLCA 3QLPH 2SGDE 3OEHD 4B76A 1BTWA 1O31A 4I31A 4TWYA 1C2MA 3RXFA 1ANDA 1ZGVA 4NIWA 1Z8JB 3FP7E 4WF8A 1C1WH 4FUGA 2BD4A 4OS7A 1K0HA 2R2MB 4IN2A 3PMBB 2OK5A 3LKWA 2STBE 1Z1IA 3L6PA 1GHXH 1CBWB 2A5KA 2WZQA 3A84A 4M7GA 1IQFA 1DANH 3E91A 2FESH 1QR3E 4XBBA 4FUCA 1AO5A 4F4OC 3U1JB 1NROH 1YPKH 3RXTA 4TPIZ 1BMFD 2AMPA 3RC5A 3GY5A 5JBTA 2FOBA 3F68H 4I8KA 3MOCA 4Q80A 2YNBA 1BQYA 2K1QA 1XUGA 3OY6U 2PWXA 1KSNA 4AFUA 1Y3XA 2H5DA 1JWTA 1P0SH 3RXJA 1UTNA 1QCPA 4D7GA 1O3KA 1G32B 1KXCA 2BLWA 2ZPRA 3M35A 4NIYA 3E3TA 5K0HA 4O9VA 1IHTH 3SNBA 1Z6JH 9LPRA 1RJXB 1JRSA 3DHKH 1K1IA 1LHFH 1S84A 2VVCA 5HIZA 1DUEA 2QCYA 1UK3A 2P8OB 4DT4A 1XM1A 1TNHA 4FUBA 1C2IA 1O38A 1FAKH 1MD7A 3UNQA 3D23A 1ZRBA 3LH1A 1YPJH 1C9TA 2BD3A 3CENA 5KGOA 4E06H 4ZKOU 1SGIB 5E8EH 4HTCH 1G30B 3U8OH 5BRRE 2WHXA 5JPMH 2ESTE 5JBCS 3KQ5A 3QDZB 1CA0C 4I8GA 2OP9A 1E1QD 1CSOE 2R2WU 3TNTA 3TH3H 5LPFA 3HK3B 3LGTA 4B6FA 1AB9C 1LKAA 4LXBH 1QBVH 3SU1A 1KMHB 2FOEA 1MKXH 3FKSD 1OP8A 4NA9H 2ZHQH 1ARBA 5EQQA 3SUDA 4ZAEA 4X1SU 3VXEH 3MWIU 1C5SA 3GOVB 2CHAC 1B0EA 3RMMH 3C1KA 1TNIA 1FLEE 4TSFD 1IQNA 1BMNH 1V2MT 3BIUH 3SNEA 4NWKA 4UE7H 1W7GH 5A0BA 1WBGB 2H6MA 1FIWA 1RTKA 2FI3E 2SGFE 2GGVB 3ZVDA 2AGIX 5E0HA 2WPHS 2SGQE 5E0JA 3HATH 4AZ2B 4BAKB 2ZGJA 3ZVGA 1N8OB 1GVKB 2D1JA 2FDAA 3ELAH 4OGYA 4Y8YA 4I33A 3ZZ7A 1GI0A 4F48B 3M61U 2ZGXH 3RXHA 3E0PB 3ZZ6A 2FOAA 1HBTH 3TLOA 1N6YA 1Z7KA 5H4IB 4NG9H 3SORA 4DG4A 3SU6A 2WYGA 1QL9A 2F43B 2QY0B 2BQ6B 2XCFA 3OAAD 3ZVAA 2O8MA 1YF4A 2I6QA 1ELEE 4INKA 1MKXK 1AQ7A 5AFYH 1ELBA 3PTNA 3A87A 2QF4A 1BTXA 1YLCA 3DFJA 1Z8RA 3RXVA 3SOSA 1AFEH 4KTCA 5GWZA 1GWAA 1J15A 1GBKA 1ZSJA 1ETRH 2A4GA 1UHBB 2VIPA 1UVTH 2GJGA 2XNDD 1UW7A 1AWFH 2M2AA 1ETSH 5HMAA 2OINA 4AB8A 3F9GA 4IC6A 3EE0B 1ELVA 1GBHA 1KDQB 1YLDA 1MKWK 2OC1A 1L4ZA 2SGPE 2EA3A 3UOUA 3MO6A 1N1LA 2ZDAH 2FOHA 2ZHWH 4JYTA 3UY9A 1OYTH 3QWCH 3RC6A 2PR3A 4K1TA 1GJ5H 2XOKD 4Y79A 3SNAA 2G4TA 1IQGA 4INLA 2FMJA 4AN7A 1GJ7B 3M5NA 1O2MA 2C3SA 1SSXA 3SU3A 4Y7AA 1ZHRA 1ZMJA 1RXPA 3LT3A 4BNRA 3AW1A 1MTWA 1JIRA 3VB6A 1TIOA 1O5DH 3NPSA 1XUIA 5HM9A 1EPTB 4GHTA 2F9BH 3SO3A 1XVMA 1L0ZA 1P3EA 3KN2A 1A61H 2A31A 3B23B 1JMOH 1SGNE 1WTGH 3PO1B 2PGBB 5EQRA 4JK5A 4I8JA 1O2JA 1HPGA 1C1UH 2A4OA 3GS9A 4FVDA 4J2YB 1SGFG 3MYWA 3EYDA 3BTFE 4FU8A 2XC5A 3A8DA 2G55A 1IQJA 1P03A 4IMQA 2B9LA 3PLKA 3EDXB 4A5TS 1SQTA 3UAIC 2P59A 1EX3A 2BVXH 3ZYDA 1ABJH 4BAHB 5J4QA 1TX6A 3RXAA 1BTHH 4Z6AH 3LONA 2BY5X 1SOZA 3P8OA 3S69A 1OKXA 7LPRA 5FX5A 1THSH 4MDSA 3SZEA 2FLBH 1SHHB 4ABGA 4BAOB 3LGVA 1J17T 2P93A 4I8HA 3P70B 1F5KU 5F8XA 1AU8A 3GCOA 1HXFH 3NWUA 4O3TA 5DG6A 2BMGB 4TYDA 1IHSH 2KZ4A 5ABWA 1LVOA 3SN8A 2J34A 2R3YA 4IW4E 5CMXH 3IITA 1UTJA 4WWYA 1DSTA 1VCWA 1V2UT 4K3JA 3FP8E 1XMNB 1C4Y2 1XUJA 1LO6A 2ZU5A 1BZXE 1ZRKA 1MCVA 1D6RA 1SVPA 3M7QA 1Y5UT 1QL8A 1EP5A 1DDJA 2ZGCA 2HVXA 1DICA 2Y6TA 3DCLA 3KYFA 1QHRB 4THNH 4AGJA 4ZKSU 2Z9IA 1GI8B 1X7AC 4K2YA 2BD5A 1F0SA 4BAQB 4D9QA 1WQVH 3MH6A 3TVJB 4AC9A 1LDTT 4BAMB 3W94A 4DURA 3FAOA 2CK3D 3UR9A 4ASUD 1HNEE 3QK1A 1UTKA 5A8YA 1ETTH 2H9HA 5FPSA 1W14U 2P16A 3MU1A 3KIDU 1KLJH 1M9UA 5A2MH 1F5LA 1KXDA 2B8OH 2ZDLA 4Q7ZA 1PQ5A 1PPZA 2NU3E 4MG3A 4K8YA 3TH2H 1BHXF 3CNRA 3TH4H 4ABAA 1WYKA 1GJ9B 4MPVA 1NRNH 1DWBH 5DP5A 1CA8B 1FI8A 1MZAA 6GCHF 3QO6A 4I32A 2GTBA 1QTFA 1FNIA 5EJLA 5ESTE 2GZ7A 3P92A 4JZEH 1MH0A 4U2WA 3MU0A 1C5QA 4H6TA 2G5VA 5DK1A 2Z94A 4X2WA 1ZSKA 4YTAA 1E38B 1P12E 3VGCB 8ESTE 5EW2H 1W3CA 2BDYA 3VB5A 1SB1H 3F2FA 3R0FA 2VIWA 3FVFB 3K65B 2BXUH 1MU8B 1INCA 3F1SB 1UCYK 2RCEA 4MNVA 4RKOB 5C17A 1IAUA 1GVLA 4R0IA 3UNSA 1C5TA 1NU9A 1C4U2 3M3VA 1OWJA 4ZKNU 1FN6A 2FPZA 3SJ9A 1QIXB 1AZ8A 2RDEA 1AD8H 3OY5U 3TIUA 1LPZB 2NU0E 5EQSA 3OE7D 1O2KA 1Z8GA 2BDAA 2HPPH 3A83A 4OS4A 5EG4A 2AIPA 3VB3A 2W6JD 3UQVA 3VB4A 1ZHMA 4XRNA 2O8WA 1LMWB 3PO1C 1V2NT 2D26C 3MO9A 3LIWA 1V2OT 2J4IA 5LPEA 1VCQA 4NIVA 1TBRH 1RTFB 5T3HA 3ATKA 1KXFA 1NTPA 2WPKS 5C1XA 1WQSA 3R3GB 2WUBA 4UD9H 4MPXA 3DD2H 1O2QA 1K28D 3BSQA 1ZJKA 1V2LT 2BDGA 2WPDD 3MH5A 4YO9A 3UB0A 1GI4A 3MQKC 1O3DA 2ZU3A 3DFLA 2VGCB 1O32A 2ZFSA 1O5GH 1XUFA 2UUYA 2GV7A 3BTQE 2V7QD 1T4UH 1O3HA 1A5HA 4A1TA 1AVXA 1ZMLA 3BV9B 3ZVCA 1C5XB 4BTIB 1NN6A 2Y80A 4B71A 2ODQA 1GI5A 4RT0A 1SC8U 3ATMA 3NXPA 1BITA 4UFGH 3TPIZ 1C1SA 2XC0A 3BTME 4KGAA 1GBLA 3NRLA 4AX9H 2ZCHP 2KCOA 2Y5HA 1EAWA 1AN1E 1CQQA 3RMLH 1JOUB 1C1QA 1L1JA 3PMHB 3HKJB 3RDZA 4JYVH 1GDUA 4UEHH 1E36B 4TWWA 1ABIH 3NUMA 3LOXA 1ZGIA 2R0KA 2OUAA 3URDA 1CA0B 1DFPA 1GG6B 3PMAB 1BIOA 1C1VH 1C2JA 4Y10E 3S0NA 2FIRH 2YOLA 1QNJA 2FOMB 4X6NA 2QAAA 7KMEH 1YM0A 2BDBA 3SW2B 1FY1A 2J92A 3GCNA 2A7CA 3SI3H 1NO9H 1YGCH 1FPCH 1FXYA 1HAIH 3JZ1B 2VINA 1V2QT 3MMGA 3GY7A 2FP7B 2OQUA 2OC8A 1W11U 3V13A 1G2LA 3FZZA 2A32A 5AFZH 4FU9A 2BM2A 4ZHMU 1O34A 1P8VC 3A8CA 4K1EA 4WXVA 2G52A 2XBXA 1TBQH 5C2ZA 4CRBA 1OX1A 4NCYA 3TU7H 1TE0A 3MNXA 1HDTH 4OS6A 1W7XH 3M5MA 1DS2E 4Y11E 3QN7A 2VH0A 5GIBA 1PQ8A 2K8IA 2KAIA 1FAXA 4X6MA 3PV4A 1SOTA 5DN6D 4BOHA 1C5ZB 3M37A 1PPCE 2KCPA 4IMZA 3LDXH 1SR5C 1AY6H 2PKSC 4FUEA 4CRGA 1CHOG 1MCTA 1NFUA 1YC0A 2BX3A 4ZHLU 1AHTH 5A8ZA 1NBME 3FO8D 3SUGA 2ASUB 5L2YH 4LK4A 1ZPBA 1W0ZU 1ARCA 2PFEA 4DW2U 4CRFA 5HYOA 2BLQA 4CR9A 1QBOA 2PGQB 1S83A 5C94A 3UTUH 1C5WB 1TFXA 2V3HH 1A0LA 1GCDA 3CS0A 5EJ1A 1K1NA 3T29A 1GHWH 3S7KB 3ZZ8A 3UNRA 1GMDG 2FYQA 4X6OA 1C9PA 5EXLA 3KCGH 4M9FA 3M5OA 1ELAA 1ZHPA 2QYIA 2AGEX 2WPMS 2Y5GA 3OU0A 1TMTH 2GDDA 2Q1JA 4ZXXH 2WPLS 3ODFA 1K1PA 3P17H 1TAWA 1OP0A 4H42U 1GHVH 5GPIB 2QXHA 2ZFTA 3RXOA 1O5CB 2W5EA 1H9IE 4IGDA 1AE8H 1QBNA 2ZC9H 3HK6B 3W1EA 3LC5A 1ELDE 3O8RA 2DUCA 1TGSZ 3A8BA 5EXMA 3D49H 1MBQA 1O2NA 2TGTA 1KYNA 1WU1A 1V2RT 4BTUB 2KCAA 3U8TH 4CREA 2VU8E 5GDSH 3HGNA 3TK6A 1MQ6A 1Q2WA 1SGFA 3FANA 5JB9S 2VGCC 3HKIB 2HGTH 3PWBA 1QA0A 5AHGH 5LPRA 1FQ3A 2QGRA 3KQEA 3T2NA 1E37B 5C67A 2GVFA 2ZI2H 6CHAB 1VJAU 3STJA 4YZUA 5HXFA 4MNWA 2IJD1 2LP6A 4ZROA 1O2TA 1W2KH 1MTUA 1L1GA 3A7WA 1FONA 2W26A 3KQDA 2A5IA 3MU8A 3HGPA 4SGAE 3F6UH 1MZDA 1TABE 2A1DB 3E90B 3M5LA 4RSPA 4NA7A 4KTSA 5EW1H 4F49A 4B2AA 2PUXB 3VB7A 2BDHA 2G4UA 5L6NH 3BG4C 4WMEA 4ACAA 4JK6A 2ZTYA 2EI6A 3SU5A 4GPGA 1P05A 5DP8A 1QRXA 1CHGA 1ZLRA 4CHAB 2QE7D 2ZDKA 3P95A 4DCDA 1XXDA 3K9XB 1Q31A 4Q2KA 1E79D 1YPEH 1YLNA 1G9IE 1GG6C 3QGNB 1T7CA 1EAXA 2FS8A 3S9CA 1PJPA 1V2VT 2G5NA 1QJ6B 3F0PA 4LOYH 3ZYEA 1PPBH 1UTMA 3ZZ9A 1HJ8A 1HAHH 1F92A 2C93B 2L74A 2ZFQH 3SV2H 1GBIA 2UUFB 2BVRH 1VJ9U 1BBRH 1XKBC 2BD9A 4CBOA 2QF0A 2FODA 1FPHH 2P95A 2IN2A 4TT3D 3GDUA 5JYIA 2AEIH 1QURH 1IQIA 1O3LA 1TPSA 5A0AE 3NKKA 5IK2D 5HIYA 1O5BB 2ZDVH 3VPKA 2QXGA 3AASA 3MI4A 1QRWA 3TJNA 2O8UA 1K2I1 2VB0A 1TPPA 4Y76A 3MNSA 4GAWA 1YPHE 1LKBA 1HYLA 1VZQH 1NU7B 2GZ9A 1E34B 2ZECA 1BTZA 1DWCH 1MAXA 5DP4A 5F8ZA 3RXBA 1EJNA 2ZP0H 2ZTXA 2Z9KA 3QTVH 4YESB 2Z9GA 2W3IA 2JDID 5LGOA 1EAUA 3SV8A 2L6OA 3OX7U 5L30H 5LH8A 4NFFA 3P6ZB 3LJJA 1TGCA 1C2HA 3SNDA 1UO6A 1BBRK 1FMGA 4ZXYH 2BXTH 1AGJA 1K1OA 3I77A 2PTNA 1VITH 1GBJA 1Y5AT 2A7JA 3FZDA 3M3SA 2ZNKH 3KQBA 1GPZA 1HAYB 4YT6H 2VWNA 1Q3XA 1GCTC 5EOKA 1GJ6A 2KAIB 4WJG2 4E05H 1TX8A 1O5AB 1BJUA 3MU4A 1UCYE 2ZF0H 2F9PA 1D3DB 2BDCA 4K5ZA 2F9NA 1S85A 2A0QB 2Z3CA 3BTKE 2GKVE 4CH2B 1GL1A 1V3XA 3AK5A 1MTVA 3U1IB 1TNGA 4GUXA 5C20A 2SGEE 3RXMA 1P2OA 4WMFA 5T1VA 5A8XA 1KY9A 1C1NA 3AW0A 2RA0A 4YLQH 3ZVBA 1OWDA 5C0UA 3KQCA 3CP7A 3F0OA 1HIAB 1SGRE 1A7SA 1COWD 6LPRA 2J98B 1EZUC 1FX0B 4AG1A 1Y3YA 2GMTB 1QB6A 1AVGH 1P2QA 2BHGA 1W8BH 2BZ6H 2C90B 1XVOA 1ANCA 4MNXA 4GCHG 1GHBG 1S6HA 4NSVA 2JKHA 1FZZA 5AVDA 2V0BA 2ZQ1A 1RIWC 1TPAE 1DPOA 2ALVA 1P2KA 3IWMA 2VBCA 1BTUA 2PLXA 4MNYA 5EXNA 8LPRA 3LU9B 1NZQH 1SLXB 5JBBS 1PYTD 8GCHG 4GVUA 1W0YH 2KM0A 5A09A 1DT2A 1UTOA 4XDEA 2A2XH 4YOJA 1IQEA 5FCRA 2ZU2A 1EJAA 1O39A 5CDFE 1T4VH 2VVUA 3ZZBA 5PTPA 3SHCH 4AYYB 2CF9H 3U8RH 2C8YB 1ID5H 5TJXA 3RXKA 6CHAC 2Q6GA 1TGNA 2ZZUH 4UONA 1BTPA 1XXFA 4AYVB 4TPYA 2XXLA 3V3MA 3UQOA 3NCLA 1BMMH 2AHME 3RP2A 1IQMA 1V2JT 4ISNA 4ACBA 4D9RA 4X0WU 2Q6DA 1AWHB 4X1QU 1A3EH 1Z71A 1FY5A 2BY7X 2C8ZB 3V7TA 3RU4T 3FOAA 1NY22 3EA9A 2WINI 1XKAC 2JETC 2WPJS 3U98H 1O2PA 4KTUA 1BDAA 1O3MA 4CHAC 2P3TB 3E16B 4MPWA 4WY3A 3Q77A 1LHEH 3PV5A 4CBNA 5GCHG 3RXDA 2A45B 3A7YA 3JZ2B 1FY3A 2C4FH 3ZZ5A 2CN0H 7GCHG 2A5AA 4CH8B 2AS9A 4GLYA 1W0JD 1EAIA 2CMYA 1DY9A 1GHBF 4KKDA 1GMCG 4NZQA 1TLDA 1BA8B 2VIDA 1O2HA 1RTLA 2ANYA 4VGCB 2ZU4A 1SKYE 1NRSH 2G00A 4INHA 4QT8C 2TGDA 1VITG 2OC7A 4WH8A 3K6YA 3F9EA 2XCNA 3N99A 1GHAG 3VG8A 2XBYA 1GJ8B 2YMSD 1H9LB 3KNXA 4ISOA 4UDWH 4DY7B 1C5RA 3ATIA 2B0FA 2OCVB 3RXRA 1HAZB 4NFEA 1S0RA 5FCKA 3BEFB 4YOGA 1CVWH 3SJOA 3TITA 1O3PB 1KXAA 1O33A 3GDSA 1H8IH 2AERH 4Y8XA 1TQ0B 1JBUH 2ZIQH 2ZKSA 4YXWD 1MU6B 1YCPH 4JCNA 3RXEA 3TJUA 2ZEBA 4FXGH 1LHDH 2W7UA 1ESAA 2GD4B 1MAYA 1Y3VA 2EC9H 2QF5A 5CHAB 1T8MA 1GMHG 1O35A 4JZ1A 1YPGH 4U01A 1F5RA 2LNCA 2ZPQA 3MU5A 4BXSA 4I7YH 2B7DH 1C5MD 2VNTA 1KIGH 1WOFA 4Y8ZA 3UWJH 1TWXB 1C4V2 2QA9E 1NRQH 1ZTJA 4JYUH 5DGJA 1D6WA 1S5SA 7GCHF 2HNTF 2J9NA 2QXJA 1K9OE 1A4WH 4O97A 1TA6A 1JXPA 2PKSB 1GMCF 2BOHB 1KLIH 5EU8A 3BF6H 2Y5FA 1B5GH 2HALA 2ZA5A 4GSOA 2FOGA 2H2ZA 2BYAX 3V12A 2TGPZ
chains in the Genus database with same CATH topology
1SGYE 1GHAF 3GISB 2UWLA 2F9VA 1TB6H 1Z1JA 1YCPK 1O3OA 1CGJE 3OYPA 1LCYA 1P2IA 1HJ9A 3TJOA 3BTTE 1YBWA 1GHZA 1ZZZA 3NK8A 1GGDB 1TPOA 2Y82A 3URCA 3PM3A 1C5OH 2H5CA 3QZQA 2IJOB 1IQKA 3EA8A 1GL0E 1GHYH 1TOCB 1D9IA 3A8AA 2CV3A 2GMTC 3SI4H 1AZZA 1O5EH 2AMDA 4KP0A 2BOKA 2GX4A 4ASHA 4ZH8A 2FOCA 1S82A 3QX5H 3DA9B 4WXIA 2J95A 1ELFA 2QV1A 2BQ7B 1DXPA 5I25A 3E0NB 1P2NA 3Q00A 3Q76A 5EGMA 1HAOH 1QJ1B 1V2WT 2PSYA 4BXWA 2BZAA 4TY6A 1CO7E 2Z3DA 3UOPA 1DUAA 1JRTA 3A89A 1K1JA 4DIIH 1A5GH 2TBSA 1OP2A 1SGEE 4CR5A 2FXRA 5FXLA 1SGQE 2GZ8A 4XOJA 3SJKA 1Z6EA 1O2LA 1O3EA 1GJDB 3P8FA 5FHTA 2XWBI 4CRDA 2R3UA 2A2QH 4RKJB 2DE9A 2F9OA 1AUTC 1EJMA 1KXEA 4UFEH 1KXBA 4ZMAH 4O3UA 1EB2A 1P2MA 1HJAC 2WUCA 1GJ4H 5G4BA 1YPMH 2CF8H 1UK2A 2HRVA 3H5CB 2STAE 3EGKH 2A4QA 2ZFPH 5SGAE 1P01A 3MNBA 1LHGH 3RLYH 3ZZDA 3TK5A 1RD3B 3E8LA 1B0FA 2OC0A 3BIVH 4DT7B 1GBDA 1HV7A 2H1UA 2ZCKP 1PPEE 1T8OA 1BRUP 3BG4B 3SV6A 3H7OA 3BN9A 1TNLA 1QGFA 1GBFA 3GYMA 4VGCC 1QQ4A 5C5OA 3NZIA 9ESTA 2OBOA 3GY2A 4ZUHA 1S6FA 3RXCA 3VFEA 3MFJA 1A46H 4JZFH 3RMOH 2FZZA 1T8LA 3MHWU 3LGUA 3QTOH 1SHYA 1EB1H 1W12U 1DWDH 1MQ5A 2NU2E 2VVVA 4SGBE 1WUNH 2B5TB 3UUZA 1ELTA 2FI4E 2PUQH 2XBVA 1OWEA 3E1XB 4FVBA 1P9UA 2PTCE 4K8BA 1P09A 1DX5M 1GJCB 1NC6A 3STIA 4Y0YE 2ZQ2A 5T6FA 1DSUA 1U6QA 5CHAC 2C8WB 5C5NA 4B1TA 1C5PA 4IC5A 1G3DA 2TRMA 4AORA 2GCHG 2Y7XA 1TA2A 2QC2A 1TOMH 2P3UB 3CS7A 2F83A 4XE4A 2NWNA 4B75A 2PSXA 4X1PU 1DLEA 1C2DA 1C2KA 1W13U 1BMAA 1AI8H 2SNWA 2WYJA 2D8WA 1G37A 2WV4A 3Q3YA 4KELA 2AIQA 1C2LA 1EOJA 2ZDMA 3SNCA 3ESTA 3UREA 3S7HB 1CGIE 1ZTKA 4ZKRU 2OXSA 2PV9B 1Y8TA 3HPTB 2A4RA 1GCTB 1HIAA 5HM2A 1WTHD 2F9UA 1O3CA 1EP6A 2J2UA 2CGAA 2ZWLH 4AFSA 3SJ8A 1GVZA 5C1YA 1C5VA 1NS3A 1SGPE 2HNTE 3BEIB 4XBDA 2THFB 3A7TA 1E0FD 4NWLA 1GGDC 1GI6A 2J38A 3A85A 2JH6D 1EZXC 2ZPSA 1OOKB 4E7RG 4ABJA 3O8BA 3ZZCA 5ESBA 2XTTB 1GI3A 3FP6E 2HWLB 4Y71A 4ISIH 2H9EH 1G36A 1WCZA 1A3BH 1G3EA 4UFDH 1TYNA 1KLTA 1TQ7B 3VXFH 2GCHF 2V3OH 2WV5A 3GY3A 4U30A 1XX9A 1MD8A 1L1NA 3SGAE 3LH3A 1OPHB 1V2TT 2GDEH 1ACBE 1QB9A 4TY7A 1RIWB 1ZTLA 4MVNA 1QY6A 3EAJA 1A1RA 4Q7YA 1H9HE 1BJVA 1O3NA 3A7VA 1C5LH 4WMDA 1CHOF 3I29A 2XNIA 1LVMA 2ZU1A 3FFGA 2OLGA 5DKMA 3RUOA 1ZOMA 3EQ0H 2VWLA 3MNCA 4O03A 2AMQA 1MTSA 2UUJB 1HCGA 3M7UA 3QUMP 3PLPA 5F6MA 4X8UH 3ZZAA 2PKAB 3RXPA 1C2GA 3GY4A 5HGGA 3PB1E 2UUKB 3SJIA 4AFZA 4X6PA 2GV6A 2ZDNA 1GMDF 2VIOA 1F0TA 5E2OA 3VEQB 3AAVA 5JB8S 4ESTE 3M36A 2IOTA 2JETB 3SUEA 2Q6FA 1RS0A 2BVSH 1ESTA 2FM2A 3KHVA 5T6GA 3T26A 4HZHA 1MBMA 1YPHC 3RXUA 3A81A 1W10U 1TGBA 1BUIA 2VWOA 1G3CA 1D3QB 2JH5D 1A0JA 5BPEA 1EUFA 1BRBE 5E2PA 4Y6DA 2ZGHA 3TGKE 2EEKA 1Y59T 4FUFA 1O2VA 1PPHE 1A0HB 3GY8A 1THRH 1EZQA 3ZZ3A 1C2EA 1SLWB 4HFPB 1O2XA 4X2YA 4I8LA 4MQAA 2BLOA 4NSYA 3O8DA 1P3CA 2BTCE 2AYWA 1IQLA 5A0CA 2H9TH 2SNVA 4X8SH 1L4DA 2FEQH 3BTGE 3RXIA 5DP3A 3PYHA 1BB0B 1NPMA 2W7SA 3A88A 4J1YA 2XRCA 3T27A 1EATA 1MMJN 3LGIA 3UIRA 3SQEE 1O2UA 4BTTB 1DXWA 6ESTA 2FYRA 1HAVB 1ZSLA 1WV7H 1GI2A 3RXLA 5FAHA 1TGTA 2ILNA 2PW8H 3AVZA 4JZIA 5F03A 1VR1H 3SGQE 1NRRH 3PROA 1SI5H 1O2ZA 1CGHA 1QRZA 1CE5A 1QQUA 2GP9B 5DP6A 1O3IA 1SGDE 4ISLA 1K1LA 1HAGE 2ODYB 2PHBA 2VIQA 1F0RA 4HI3A 4R8TB 2CJIA 1MKWH 2HPQH 2Z7FE 5CE1A 1P9SA 1VCPA 1O3JA 2AGGX 2O8LA 3I78A 3LJOA 3C27B 1P06A 1ZPZA 2BY8X 1A2CH 1YCPM 4JMYA 3A7ZA 1DM4B 1SPJA 3W95A 2ANWA 1SMFE 1CU1A 1O3BA 1SL3A 4A1XA 3LGWA 1HAXB 5GJ4B 1FV9A 3ITIA 1B7XB 2WPIS 2Y7ZA 1K1MA 2V35A 1AFQC 3K2UA 2P94A 1WAYB 3RU4E 1DY8A 1PQAA 3TGIE 3MH7A 1UMAH 1O2GH 3TNSA 2VWMA 2V6NA 3P8GA 2BY6X 1GBBA 3M3TA 1O3GA 2ZCLP 1G3BA 1P02A 3KGPA 2GCTC 1O2WA 3GCHB 4ABHA 2F3CE 4MTBA 1Z8IB 3SU2A 1SFIA 1OWKA 1GI9B 1SGTA 4WVPE 1SGCA 3MO3A 2BY9X 1C5YB 3OSYA 4DGJA 3RM2H 2BX4A 1J16A 1CT2E 2FO9A 2OD3B 2J94A 1FY8E 1QFKH 2VH6A 4X1NU 1ELGA 3BTDE 5I46H 2G51A 2UWPA 1OWIA 2RG3A 2RDLA 4WH6A 2AH4X 2XW9A 1P10A 3PTBA 2A7HA 2EI8A 1DLKB 1GJAB 4IN1A 3WY8A 1OS8A 1ZJDA 1GBCA 1TX7A 1CBWC 2VIVA 3LC3A 5TCAA 2HOBA 4OS5A 2QXIA 3MTYA 1Y3WA 2M5TA 3TJVA 3MH4A 2RA3A 3BEUA 4FUIA 2SGAA 1Y3UA 1C5NH 3ZVFA 3K6ZA 1C1PA 3RXSA 1HJAB 1HB0B 4NGAH 2VJ1A 1HAPH 1HUTH 1FIZA 1TMUH 5TCCA 4YM9A 3A86A 1H4WA 3QGJA 3RC4A 1LPGB 1IQHA 4XBCA 3SQHE 4AG2A 2ZO3H 1OWHA 4ABDA 1C5UA 5B6OA 1TNKA 4GCHF 4D7FA 1O5FH 2P8OC 1UTPA 4YLUA 3A80A 2FOFA 3ZV8A 2D2DA 4XFQA 1S81A 4DOQA 3G01A 4X8TH 4H6SB 4IS5A 5DPAA 1ZMNA 6GCHG 1PPFE 1D4PB 8GCHF 2BB4A 5FBIA 2BD8A 1VGCB 1ORFA 1D3PB 2G81E 1UVOA 1O2IA 4MPUA 3BTWE 4LZ4B 1P2JA 2XWAA 4FU7A 1C1OA 1GI7B 1EXFA 3RXGA 1NFXA 2GT8A 4X1RU 1GDQA 4AOQA 4D8NA 1E35B 1BHXB 3SGBE 1FJSA 1GBMA 3GICB 2SFAA 1AKSA 1V2ST 2GT7A 1V2PT 1V2KT 1OXGA 1V6DA 2F91A 1C1TA 1P11E 1FDPA 2FWWA 1D3TB 3L3TA 1BRCE 4A92A 3F9HA 3ZVEA 2ZGBH 2FX6A 4AGKA 1NESE 5C3NA 1EZSC 2LPRA 1P57B 2QIQA 1GBEA 5IYTA 1N8OC 1MTNB 5GCHF 5JDUB 1PPGE 1Y5BT 1HLTH 5JBAS 4AB9A 2BD2A 4LZ1H 3Q3XA 3F9FA 5EPNA 1RGQA 1UCYH 4JZDH 1SG8B 3SHAH 5DJ7A 1O3FA 1O2SA 1K22H 1ESBA 2OQ5A 1BOQA 3QZRA 1TRNA 3ZZ4A 4ABEA 1O0DH 3T5FH 4B74A 1VITF 1FN8A 2EI7A 2IPHA 5L2ZH 2FI5E 1YPLH 4XSKU 1PYTC 2ZHFH 4CRAA 8KME2 3SV9A 3DT0H 1C1RA 1LPKB 1T8NA 1CT4E 1DWEH 1OYQA 1TNJA 2BQWB 1LTOA 2C8XB 4ABFA 5EODA 3LGYA 4RN6A 1G2MA 1F7ZA 2BD7A 2Y81A 2YNAA 3O8CA 5DP7A 1AVWA 2O8TA 4DVAU 1UVSH 1GBAA 3BTEE 4K1SA 3GCHC 4YT7H 4Q7XA 1QJ7B 2QF3A 1UTQA 1GDNA 2JH0D 2QN5T 4ABIA 2TIOA 1AIXH 4A1VA 4DJZB 4B73A 1YYY1 3U9AH 1GMHF 1O2RA 2ODPA 4X8VH 2Z3EA 1J9CH 2ANKH 1GI1A 1TRYA 2UWOA 4FUDA 3UPEA 1YP9A 2PKAA 3H7TA 2FS9A 1AUJA 1EPTC 3B8JA 3KL6A 3ODDA 4B2BA 3UWIA 2NU1E 3B9FH 3SU0A 3TGJE 4PROA 1K21H 1XUKA 1QL7A 4H4FA 4E7NA 1PFXC 1HFDA 3KF2A 4Y7BA 4FUJA 1BMLA 1DVAH 1N6XA 3A82A 3SV7A 3V0XA 4Z0KA 1CT0E 1UVUH 3ATWA 3L33A 2ALPA 2XBWA 3GY6A 1DOJA 2ZG0H 2NU4E 3RMNH 3N7OA 1LVYA 4NIXA 1ANBA 2Z9JA 3E6PH 1QA7A 3GDVA 5DP9A 3SU4A 2ZHDA 3PWCA 1TRMA 4X2VA 3SBKA 2FTLE 4X2XA 4ABBA 3LPRA 4YOIA 5DO4H 4U32A 1GJBB 2ULLA 4A6LA 1YKTA 1THPB 1ZYOA 1UTLM 1L2EA 4A7IB 1SQAA 1EKBB 1SQOA 3UFAA 5IDKA 1NT1A 3M7TA 2FTMA 2XC4A 5ETXA 2FLRH 1ZR0A 3S9BA 4OS1A 1KTTB 1VGCC 1H1BA 2OTVA 4K69A 5FBEA 1NFWA 5K7RA 3GCTG 3BTHE 4UFFH 3A7XA 1AE5A 2Z9LA 1O2YA 3IG6B 4MLFB 1FUJA 4BANB 1SLUB 3TK9A 1HAVA 2R0LA 5T6DA 1EOLA 1LQDB 4FUHA 1S0QA 2AFQB 3PMJA 2DE8A 5F8TA 3ATLA 5J4SA 2BDIA 3T62A 1WSSH 3RLWH 2Z6BD 3RM0H 1AB9B 5EPYA 3T28A 4K60A 2HNTC 2O9QA 3S9AA 1F0UA 2CXVA 1ELCA 3D65E 1ANEA 4B2CA 1UJ1A 3U69H 1BBRE 1J8AA 1SFQB 2TPIZ 1F2SE 2CHAB 1LQEA 1MTNC 5FPTA 1UK4A 2ZFFH 3SUFA 1O2OA 3P8NA 1MUEB 1SBWA 1TMBH 1AKSB 3GYLB 4DIHH 1O37A 1NM6A 2XYAA 1H8DH 3T25A 4IBLH 4HGCA 4NZLA 2G8TA 3PLBA 3DUXH 3KEEA 2ZHEH 1PQ7A 1BT7A 1SLVB 3SZNA 1BCUH 3EA7A 2ZTZA 3OTJE 2OBQA 4NA8A 2W3KA 1AMHA 1O3AA 1UHBA 3AAUA 4CRCA 3ZV9A 3GCTF 1TALA 2I6SA 1LHCH 1BRAA 1RRKA 1TBZH 4ISHH 2P3FH 3RU4D 1P04A 3BG8A 1FY4A 5FX6A 4ZHAA 1KDQA 1QB1A 3RXQA 4GHQA 1A5IA 1AFQB 5FPYA 1HXEH 4D76A 1NFYA 3VGCC 3Q3KA 1EASA 1OSSA 1XUHA 1C1MA 1HGTH 4OGXA 1T32A 1O36A 1DE7H 1O30A 1KTSB 4AFQA 3ENSB 1UVPA 1C2FA 5E0GA 1NRPH 2ANMH 7ESTE 1ZPCA 1TONA 5GXPA 2R9PA 1J14A 1BTYA 2TGAA 1RFNA 1GBTA 5C1UA 1T31A 2GCTB 1HRTH 1IOEA 4Y0ZE 3UR6A 1EPTA 1EQ9A 2FX4A 5AF9H 2ZFRH 4OS2A 1DITH 1JIMA 2BLVA 3D62A 1LVBA 2HLCA 3QLPH 2SGDE 4B76A 1BTWA 1O31A 4I31A 4TWYA 1C2MA 3RXFA 1ANDA 1ZGVA 4NIWA 1Z8JB 3FP7E 4WF8A 1C1WH 4FUGA 2BD4A 4OS7A 2R2MB 4IN2A 3PMBB 3LKWA 2STBE 1Z1IA 3L6PA 1GHXH 1CBWB 2A5KA 3A84A 4M7GA 1IQFA 1DANH 3E91A 2FESH 1QR3E 4XBBA 4FUCA 1AO5A 4F4OC 3U1JB 1NROH 1YPKH 3RXTA 4TPIZ 2AMPA 3RC5A 3GY5A 5JBTA 2FOBA 3F68H 4I8KA 3MOCA 4Q80A 2YNBA 1BQYA 2K1QA 1XUGA 3OY6U 2PWXA 1KSNA 4AFUA 1Y3XA 2H5DA 1JWTA 1P0SH 3RXJA 1UTNA 1QCPA 4D7GA 1O3KA 1G32B 1KXCA 2BLWA 2ZPRA 3M35A 4NIYA 3E3TA 5K0HA 4O9VA 1IHTH 3SNBA 1Z6JH 9LPRA 1RJXB 1JRSA 3DHKH 1K1IA 1LHFH 1S84A 2VVCA 1DUEA 2QCYA 1UK3A 2P8OB 1XM1A 1TNHA 4FUBA 1C2IA 1O38A 1FAKH 1MD7A 3UNQA 3D23A 1ZRBA 3LH1A 1YPJH 1C9TA 2BD3A 3CENA 4ZKOU 4E06H 1SGIB 5E8EH 4HTCH 1G30B 3U8OH 5BRRE 5JPMH 2ESTE 5JBCS 3QDZB 1CA0C 4I8GA 2OP9A 1CSOE 2R2WU 3TNTA 3TH3H 5LPFA 3HK3B 3LGTA 1AB9C