2ZGCA

Crystal structure of active human granzyme m
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
231
structure length
231
Chain Sequence
IIGGREVIPHSRPYMASLQRNGSHLCGGVLVHPKWVLTAAHCLAQRMAQLRLVLGLHTLDSPGLTFHIKAAIQHPRYKPVPALENDLALLQLDGKVKPSRTIRPLALPSKRQVVAAGTRCSMAGWGLTHQGGRLSRVLRELDLQVLDTRMCNNSRFWNGSLSPSMVCLAADSKDQAPCKGDSGGPLVCGKGRVLAGVLSFSSRVCTDIFKPPVATAVAPYVSWIRKVTGRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Granzyme M
publication title Structural basis for proteolytic specificity of the human apoptosis-inducing granzyme M
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 231
sequence length 231
ec nomenclature ec 3.4.21.-:
pdb deposition date 2008-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zgcA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zgcA02
2IN2A 3BIUH 3V7TA 1WOFA 4A1XA 1RGQA 3JZ2B 3LPRA 3RC6A 1F2SE 3BTDE 1AHTH 3ESTA 4NCYA 3RXRA 4MQAA 1O3CA 3I77A 4U2WA 3ATMA 3SNDA 1YLCA 1QJ6B 2RCEA 1AWFH 2B8OH 3F1SB 3P17H 2XBYA 8GCHF 4MPWA 1P2JA 1GHZA 5DPAA 4ZKRU 5GCHF 3SV8A 5I46H 3PMJA 2NU2E 1LHFH 5FX5A 2W26A 1TONA 3D49H 1TX6A 5DP3A 2ZO3H 2OXSA 1VITG 1NN6A 1O2ZA 3BEFB 2TGPZ 4X1SU 2ZGXH 2BMGB 2UWOA 3B8JA 3VPKA 1T32A 4ZAEA 3LC3A 1UMAH 1D3TB 4B73A 4AX9H 1SC8U 1C4Y2 2BVXH 1BB0B 3KQDA 1PJPA 4D7GA 3MNXA 2GX4A 1NFXA 4CR9A 2FI5E 3M61U 2D1JA 2ALVA 1O2QA 2OD3B 2AGIX 3E8LA 2G4TA 3GCTF 1NM6A 4MTBA 2WYGA 4A5TS 2THFB 1DFPA 1OPHB 5A2MH 4X8TH 3AASA 2A1DB 1KXCA 2DUCA 1C5QA 5HMAA 1UTLM 5FCRA 4MNXA 1DSUA 1ESBA 3S9BA 2VJ1A 4UFEH 4LXBH 3UNQA 4IS5A 3V12A 1PYTC 1C4U2 2BY6X 1NRSH 3RXPA 2ZU3A 3DUXH 1A1RA 3I78A 5A0BA 2Y80A 2ZU2A 2ZKSA 3A7VA 1MTVA 5EPYA 1AIXH 3KHVA 5EGMA 4TWYA 1EAWA 3HK3B 1WQSA 2ZTYA 3A7TA 1E36B 1SMFE 3BEUA 3UIRA 1GBJA 1UTJA 4NWKA 3BTME 3SUEA 2HNTE 1EZQA 1GDUA 2Z9JA 2W3IA 2CHAB 5FPSA 3SJIA 2FOFA 2ZPSA 2D26C 2RDLA 3DHKH 3DFJA 2G4UA 2ZTXA 1GBFA 3F68H 1GMHF 3RXCA 2ZGHA 4NZQA 2WINI 3NPSA 4DJZB 5JBTA 4Y0ZE 1ELEE 1O3PB 1HJ8A 1HJAC 2BVRH 2FLBH 1FPCH 1DUEA 3P8GA 3A87A 2BQ6B 4XBCA 2J2UA 1LKBA 1TGTA 4X1NU 2ZFQH 1BMMH 3M3VA 4ABDA 1MU8B 1KXFA 1TX7A 3PLBA 2P3FH 8ESTE 1G32B 1O2KA 1YYY1 2OC0A 4CRBA 3RXEA 4K69A 5JDUB 1O5EH 1UO6A 1LVOA 2BOKA 4ZHLU 1EJMA 3SU3A 1CQQA 3A8CA 3QUMP 4FUGA 1SLUB 3IWMA 3O8BA 3NCLA 1XMNB 3M7UA 1Z1IA 3ZYEA 1DDJA 3SI3H 1RXPA 1C5WB 2BDGA 1H9HE 2P94A 3SOSA 1O2TA 4WH6A 5ABWA 2SNWA 1MTNC 4CRGA 3T26A 2VIOA 1W0YH 4HZHA 1VITH 2Z3DA 1MBQA 2G81E 4WF8A 5DP5A 4E7RG 2WV4A 1Q2WA 1A4WH 2QXHA 4AORA 1G30B 2H9TH 1XUIA 4WVPE 3MH5A 1CT2E 3PROA 1O5GH 3K9XB 2ZDVH 1KXEA 3A81A 3VGCB 1BDAA 3OY5U 1MTWA 1RTLA 3PTNA 2AMDA 5K0HA 1DXWA 1C5XB 2C3SA 1AVWA 5BPEA 4E06H 2F9PA 4I8HA 4KELA 3SGQE 3RM2H 1XM1A 1XUKA 3SUDA 2WPJS 2ZF0H 5JBAS 3GY4A 3VB3A 2Y5HA 1F5KU 1ZMJA 1K1NA 1GMDG 1THSH 3M5NA 3SV6A 3RMNH 4JYUH 4RN6A 4TWWA 3SI4H 3SUGA 2AERH 3E16B 3MH4A 3ZV8A 4AGJA 4KP0A 1C2KA 5JPMH 3ELAH 3RDZA 5I25A 3RXJA 3RXHA 1DY8A 2BD3A 1SPJA 1JWTA 1ETRH 1DWCH 3BG8A 1P2NA 1IQMA 1EAIA 4DY7B 1T4VH 4UE7H 2Q6DA 5J4QA 1C9PA 1Y3WA 1F7ZA 2HPPH 2WPLS 4AGKA 3TGKE 2IJOB 1C1PA 1GBTA 1NFWA 3RP2A 1O5FH 1Z71A 2PUQH 4AG2A 1DE7H 3GDSA 4AG1A 1L1JA 1NU9A 1J16A 4YOGA 5A8XA 1HGTH 2YNAA 2FI3E 4FU9A 3RXUA 1FAKH 1C5RA 3F6UH 5E0GA 1EUFA 1GCTB 1Y8TA 1FPHH 2HALA 3SU5A 1YLDA 2SFAA 4XOJA 1GBLA 1BT7A 2H2ZA 1S85A 1DWEH 2WPMS 2BY7X 4CBNA 2PFEA 1FONA 2G52A 2CHAC 4TYDA 2SNVA 4I8KA 3TH3H 1THPB 5DP9A 1ELTA 4Y8ZA 1V2OT 2V35A 3GY6A 4WMFA 5CHAB 1ZLRA 1TGCA 2PR3A 2ZI2H 1ZTKA 1ESTA 2QGRA 3VB6A 1D3QB 1A5HA 1SGTA 2SGDE 4XBDA 1WYKA 4DG4A 2B9LA 1EP6A 3HKIB 4GCHF 1MQ6A 1FY1A 1D3PB 1ZMLA 1DPOA 1QL9A 1GPZA 3HATH 5L2YH 2ODQA 3FANA 2ZDAH 1K1MA 2HWLB 2FYQA 4ABAA 1O3EA 1OWEA 1TQ7B 1BRAA 1O5DH 1PQ5A 3PV4A 1O2GH 1NROH 2QF3A 4OGXA 3NK8A 3SU0A 4ABIA 4UDWH 4H42U 1GVZA 2BDYA 1GWAA 3ATKA 3SUFA 1S82A 1KYNA 1S6FA 1V3XA 1Z8JB 3NUMA 3DD2H 1O2VA 2HNTF 3OYPA 2BY5X 1HAVB 4WY3A 1A61H 1GVLA 1SGDE 1V2PT 2Z3EA 3RU4E 4D9QA 1GJ4H 2RA0A 1B0EA 1BQYA 2A4OA 5DGJA 3QN7A 1FY3A 1NRNH 4ASHA 4MVNA 5E2PA 2A7HA 3AAUA 2HPQH 4AYVB 4OS5A 3RC4A 5EOKA 4RKOB 1SB1H 1A3BH 2XNIA 4BAMB 3VGCC 4NG9H 1UTQA 1UK4A 1MKWH 1HFDA 2FZZA 1O36A 1GI8B 4J1YA 1BRUP 2GDDA 1LKAA 1QB1A 1TX8A 1GVKB 1BTPA 2C8ZB 1YKTA 4X1RU 1XXDA 1BJVA 1OYTH 3ZVCA 3ZVDA 1QB6A 2V6NA 1KSNA 1FZZA 1O37A 2BM2A 4CR5A 2ZQ1A 1A0LA 4FUHA 2FOAA 1XX9A 4IC5A 1HAHH 3A88A 5C20A 1DWBH 1GHBF 5C67A 6CHAB 1C5YB 3MWIU 1W2KH 4Q7XA 1O3FA 5TJXA 3S69A 5SGAE 1ZSJA 4CRAA 1QBNA 2CV3A 1GI1A 4CH8B 1V2VT 2QYIA 1TNHA 3MHWU 2CXVA 3UPEA 1S5SA 2ALPA 2HGTH 3U8TH 1EX3A 4DGJA 2QCYA 4SGAE 2WUCA 5EXMA 3F9HA 2R0LA 5DG6A 2ZGBH 4IMZA 2C8YB 1GHAG 3UY9A 4OS4A 1SL3A 2AEIH 3MO3A 1LVBA 2ODPA 4YT6H 1OWJA 2C8XB 2Y5GA 3RUOA 3EA9A 3LGVA 3GICB 1A5IA 1TAWA 1C1VH 2ZC9H 4CBOA 1FN6A 2XXLA 4CRFA 1T4UH 3QK1A 4ABHA 3ZZAA 2BXUH 5LPFA 3M5OA 4GVUA 1OP0A 2AMQA 2XC0A 1UVPA 1KLIH 3LIWA 3TK9A 1P06A 4Z0KA 2PW8H 1DANH 4BANB 2OP9A 2J4IA 3LGWA 4D8NA 4B2CA 4RSPA 1UK2A 1C2EA 3BN9A 3PWCA 4YZUA 4IN1A 3KQCA 4XSKU 5DP8A 1J15A 2F9NA 3SNAA 2B0FA 5CHAC 1GJCB 3RMLH 4F4OC 4D76A 1W14U 3A82A 4BXSA 5E0JA 1EXFA 3FP8E 1Y59T 2Z3CA 4IN2A 1F0UA 1ZTLA 1TIOA 1Z8IB 4JCNA 3GDUA 1CA0B 2XC5A 1T7CA 2O8MA 1FNIA 1SSXA 1ELGA 1P3CA 1TABE 2AGGX 1OWHA 3GYMA 2NU0E 1E38B 1A0HB 1E37B 2PSYA 1QQ4A 4FUCA 5C3NA 3N7OA 1ZMNA 4MPXA 1PFXC 3K6YA 1V2RT 2ZDNA 1J17T 4XFQA 1EATA 3FP6E 1KDQB 1NT1A 2VWOA 4BTTB 3GY7A 1XUHA 1FI8A 2ZTZA 3LGUA 4JZEH 1F5RA 1P2OA 2OQ5A 1QJ7B 3A83A 1C1QA 1JRTA 2O9QA 4FU7A 1TPPA 2P3UB 2W7SA 1BCUH 1BZXE 1PPHE 3BTEE 5AHGH 1K1IA 5CE1A 3QZRA 4B1TA 1SGQE 1EPTA 1WQVH 2AMPA 2CJIA 3SJOA 1ARCA 4ABBA 3SNCA 3RMMH 4GHTA 1W11U 1O3NA 1N8OB 1XVMA 3EQ0H 3TIUA 1P2QA 4Y7AA 1C2FA 2FOCA 2RG3A 2ZFTA 1D3DB 3GCHB 1A2CH 3E6PH 2OCVB 3SN8A 2I6SA 7ESTE 4AFUA 1O3LA 1BIOA 3Q3XA 1IHTH 1BJUA 1Y3XA 5EXNA 1H8IH 2QXGA 4K60A 1SGRE 1CE5A 2GCHG 3Q3YA 4TPIZ 5TCAA 3TJUA 2VH6A 1C5PA 1TNIA 2J9NA 1G3EA 1K1OA 1G3CA 2ILNA 2BLQA 2QC2A 1TMBH 4UONA 2ZFSA 3NKKA 2Q6FA 3BEIB 6CHAC 7GCHG 2EC9H 4X2XA 4ZXXH 1O3DA 2Z94A 3EE0B 4ZH8A 1MBMA 1W7GH 3SORA 4U01A 1P03A 2VVUA 1EAXA 3A7WA 2GKVE 1PPBH 1P01A 1HRTH 2EI8A 1IOEA 3ZZ6A 2BX4A 6GCHG 3ZZCA 1ELAA 4YESB 1GHYH 1YGCH 2ZPQA 1Y3VA 4Y8XA 2VINA 4YM9A 2FESH 2BDCA 2EI6A 5FX6A 1AD8H 1JXPA 2GT8A 3PLKA 2P16A 2CN0H 1WTGH 1YPKH 1VZQH 2VB0A 4GHQA 1AZ8A 3STIA 3GDVA 2FYRA 4F49A 1ZRBA 3MU1A 3SBKA 5LPRA 1UJ1A 2VNTA 3UQVA 1GHVH 4YT7H 3RLYH 4ISNA 5H4IB 5HXFA 4ABFA 1BRBE 4VGCB 2AGEX 2F9UA 1SGNE 4O9VA 3FZZA 4GAWA 2J38A 1MTSA 1NFUA 1EP5A 3U1JB 1GJ6A 1ETSH 1ZJDA 3LH3A 3M35A 2ULLA 1EJNA 3BTWE 1Z6EA 1TA2A 3MNBA 2KAIA 4AYYB 4QT8C 1SGFA 1SGCA 4WMDA 1LMWB 3NWUA 5LPEA 2F9VA 1SBWA 1TMUH 2FM2A 3KEEA 3G01A 2VIWA 5C1UA 1NESE 4Y71A 2GCTB 3P70B 1EB2A 1TQ0B 1GMDF 1O3IA 3A8DA 2ZNKH 2CMYA 2SGAA 3SJ8A 2ZP0H 3SNEA 1BMAA 1ORFA 1AUTC 3P8FA 4JZIA 5FPTA 1ABJH 3SJ9A 4DOQA 1U6QA 3KQEA 1DVAH 1HLTH 1O3GA 1VR1H 2BD4A 3M5MA 1GGDB 2XYAA 3QZQA 1JMOH 3E3TA 1O2UA 3UQOA 1BTHH 3Q77A 2TGTA 1P10A 2PSXA 1INCA 2WPIS 1K2I1 2TGAA 2UUYA 1SFIA 4KGAA 1AE8H 2V3OH 3PMAB 1C1OA 1YPGH 3RU4D 1CGIE 2R2WU 1AVGH 4ZKOU 5EQRA 1MCTA 1G9IE 2ZIQH 3SJKA 1TBRH 1F92A 1TPAE 1H8DH 5FBIA 5DJ7A 1F0SA 4GPGA 1TNLA 2C93B 1ABIH 1O5CB 3EDXB 1UTMA 2P59A 4FVBA 5A0AE 4I31A 1QB9A 1ELCA 1L0ZA 1OWKA 3ENSB 1LVMA 2NU3E 1PQ7A 2QN5T 1HIAA 1QURH 2GMTB 1PPEE 3LJJA 1O2XA 1O3OA 5GXPA 3U8OH 1TNJA 4NA9H 4YOIA 1ZR0A 1GMCF 1RTFB 2SGFE 5FAHA 2A32A 4JZ1A 1GL1A 1CHOG 1EQ9A 3KIDU 2ZCHP 1JIRA 4HTCH 4WMEA 2PGBB 1EZSC 1ELVA 1LTOA 2FEQH 1BA8B 1Q3XA 1RJXB 1GJAB 1ELDE 1V2ST 2W5EA 1YPHC 1MAYA 1TPSA 4ZXYH 3OSYA 3SHCH 2DE8A 1FQ3A 1Y5UT 3D65E 4BAQB 4K8BA 2XWBI 3PLPA 2BD2A 2FTMA 2ZQ2A 2QV1A 4KTUA 1K1PA 4JYVH 2JETC 4A1TA 3MOCA 1TGSZ 1SGYE 1C2JA 1GBMA 1PQAA 3DFLA 2PUXB 3E0PB 1O3MA 1ZRKA 2Z7FE 3I29A 3OTJE 4OS2A 3RXAA 1O31A 2OINA 1A3EH 5K7RA 2BD7A 3M5LA 4NFEA 4FVDA 7KMEH 3SU4A 1YF4A 1TFXA 3SQEE 2PV9B 3BTQE 3UR6A 1JBUH 2P8OB 2ZCLP 4HGCA 2ZDMA 4VGCC 2BZAA 2UWLA 3LC5A 2IOTA 4OS6A 1HXEH 3S9CA 2FX6A 3LGYA 1JIMA 2VH0A 4WWYA 3S7HB 1UTPA 2A31A 1DM4B 1XKBC 5F8XA 4INHA 1Z8GA 3TNTA 3A86A 5LGOA 3E0NB 3MH7A 3MYWA 4FUDA 4B71A 1O3HA 1UVOA 2WUBA 1V2NT 1CGHA 8GCHG 4Y6DA 1AKSA 4AZ2B 2JKHA 3GYLB 3QLPH 1SR5C 5GCHG 1HJ9A 2QA9E 1FN8A 2GZ7A 3A89A 1G2MA 1BHXF 2HLCA 1AN1E 1P12E 4UFFH 1CU1A 4WJG2 3ZVEA 3BTTE 3A8BA 1L1NA 2A2XH 5L6NH 3BTGE 1DT2A 1UHBA 3PM3A 3ZZ3A 1XUFA 2PKAA 4X0WU 1MD7A 1S81A 1AI8H 1ANCA 2ZU4A 4DIHH 1O38A 3BTKE 4Q7YA 1C2DA 1LO6A 5AFZH 1Z1JA 1HDTH 2F83A 3T29A 2BLVA 1NRQH 2VWLA 5HM9A 3F9FA 1AQ7A 3SQHE 4JZFH 4MDSA 2Z9KA 3GCTG 5DO4H 1HAZB 1PPFE 4A6LA 5EPNA 2ESTE 1EOJA 3RXQA 1MU6B 2B7DH 4Z6AH 2Z9IA 2I6QA 1YBWA 4FU8A 1CSOE 5BRRE 3AW0A 1GBBA 4BTUB 4CHAB 1VCWA 1GI2A 2Q1JA 1C4V2 1C9TA 5LH8A 2VIVA 5A8ZA 3SGBE 2V3HH 2W7UA 1L1GA 2WPKS 2ANWA 4B2AA 1UVSH 1SOZA 1EAUA 2C90B 1MKXK 2M5TA 3JZ1B 1QY6A 1QR3E 1TRYA 4KKDA 5FXLA 1NU7B 4CRCA 5E0HA 1ID5H 4I8GA 2QF0A 1PPZA 2J95A 5L2ZH 3KL6A 4R0IA 2BOHB 1O3KA 3GCOA 1F0RA 1MKXH 1SQAA 1FDPA 2STBE 1SHHB 2H5DA 1GMHG 1GBCA 1EKBB 2K1QA 1L2EA 1P0SH 1HNEE 2GZ8A 3KN2A 4BTIB 2P95A 1SQOA 1Y5BT 2ODYB 3T5FH 2FP7B 2H9EH 3ZZDA 1B7XB 1C5MD 2BVSH 1P02A 1IQFA 1CA8B 1TA6A 2H6MA 1O2MA 2Y81A 1FV9A 3P92A 4Y10E 2C4FH 2ZGJA 1P8VC 3RU4T 3ATWA 1L4ZA 2XBVA 1YPEH 1GI7B 1MKWK 5ETXA 2ZCKP 2F9OA 3LOXA 1QIXB 3F9EA 1AVXA 4UFGH 1P3EA 2R3UA 4ZHMU 1GBEA 2BD8A 3SU6A 1TNGA 2A7CA 5EW1H 2AFQB 1RS0A 1LCYA 1AWHB 1C5SA 4FXGH 1PYTD 5AFYH 1X7AC 2G5VA 1W13U 3SZNA 2ZU5A 4IBLH 1LHEH 2AIPA 1BTYA 2GT7A 3SNBA 3HGPA 1E34B 1RD3B 1KXBA 1K28D 1S84A 2FOBA 3UTUH 5DP4A 1THRH 5HYOA 1UTKA 2GCHF 5G4BA 1GI6A 2WPHS 3MU8A 1P09A 5F8ZA 2PWXA 1XXFA 5EQSA 3HPTB 2IPHA 3BF6H 5HGGA 2EEKA 4WXIA 4NIXA 3T28A 1UCYK 3AVZA 1LHDH 1QBVH 2PHBA 1G3BA 1DSTA 1ZJKA 3SGAE 4MNVA 4NIVA 2FIRH 1VJAU 5J4SA 1MMJN 1V2LT 1QFKH 1O0DH 3LKWA 3TJVA 1S83A 2FWWA 1G2LA 2GZ9A 4DT7B 3P8OA 3LGTA 1ANDA 5EODA 6GCHF 1AB9B 1UCYH 3BG4B 1O2HA 2XCFA 3NZIA 1Q31A 1GCTC 2CF8H 1KLJH 1P11E 2SGPE 3L3TA 1SOTA 2H5CA 5A8YA 1FY4A 1J8AA 1XVOA 2JH6D 4MG3A 1YP9A 5FHTA 3TK5A 1OX1A 1Z8RA 1C5OH 5C2ZA 2AH4X 3K2UA 3CP7A 1RFNA 1TALA 1AY6H 4BAKB 3RXSA 3PWBA 1O5AB 1SGPE 4I33A 1F5LA 1G3DA 8LPRA 4ISHH 1C1NA 2HVXA 4B2BA 2ZDKA 4AB9A 1QBOA 2JH5D 1IHSH 4X6PA 1OOKB 1QNJA 1XUJA 1SI5H 2Y5FA 4MNYA 4XBBA 5T6DA 3M7TA 1PQ8A 2ZFFH 1E0FD 2UUJB 3A85A 2ZHQH 1TRNA 4Q80A 4YTAA 4LOYH 1VITF 3EYDA 3HK6B 4YO9A 1N6XA 2BD9A 3EA8A 4GCHG 3ATIA 4Y76A 2BQ7B 1GCDA 2OC8A 3O8RA 1B5GH 1DY9A 1NTPA 3PTBA 4YOJA 1UCYE 3PMHB 2GV7A 4BAOB 1CBWB 2GP9B 3CS0A 5E2OA 3FFGA 1D6RA 1P2KA 2O8UA 1OYQA 2G8TA 5ESBA 2CGAA 1K21H 4I8LA 1DS2E 4ISIH 4ZMAH 1GBAA 1GHXH 2VWMA 4IC6A 1CO7E 1MQ5A 5T6GA 1SLVB 3RXTA 1V6DA 3KNXA 1IQGA 2BY8X 1DITH 1FIWA 2GD4B 4NSYA 1FUJA 1EPTB 4HI3A 3L6PA 1C1RA 4BAHB 1NPMA 2C8WB 2AS9A 1OKXA 3P6ZB 2WV5A 2GGVB 1EOLA 1SGFG 1NRRH 2J34A 1C1WH 4LK4A 3HGNA 3MO9A 5GPIB 2D2DA 3ZVAA 2ZHDA 4A7IB 4OS7A 4AFSA 1ETTH 3MO6A 1UVUH 1GBHA 1C1UH 2G00A 1Y3YA 2BLWA 1TRMA 1VGCB 3W95A 3FVFB 2STAE 4ZROA 4Y79A 3KQBA 2BB4A 5IYTA 2XCNA 1BTUA 3MH6A 3TPIZ 6ESTA 2DE9A 1ACBE 1CHOF 1KLTA 4K1SA 1LPKB 5CMXH 4AN7A 3P95A 3ZVFA 3U69H 1FAXA 1WV7H 4JYTA 1CT0E 1SQTA 1GHBG 2FS8A 2TPIZ 3B23B 3PO1B 1AE5A 1L4DA 4ABJA 1MTUA 2ZEBA 1O32A 4O97A 1QCPA 4FUEA 5EW2H 2R3YA 5F6MA 1W3CA 3U8RH 2AYWA 1HYLA 2VVVA 4Q7ZA 1ZTJA 4YLQH 2F9BH 5TCCA 1GDQA 1O2NA 2FOEA 4X8UH 2SGQE 3OU0A 4A92A 1HAGE 2A4QA 2PTNA 1HAOH 1DLKB 3ODFA 1GI3A 1GHWH 1P57B 1DWDH 4GLYA 3T62A 1E35B 1VJ9U 3MU0A 3MNSA 5PTPA 1WBGB 3SHAH 1C2GA 1LQDB 1MTNB 1RIWB 4NWLA 4SGBE 2ANMH 1QA0A 4TPYA 1CA0C 1QJ1B 2A4GA 3RXLA 3GISB 1PPCE 2QIQA 4D9RA 3PMBB 2R2MB 1DOJA 3A84A 2H9HA 3H7OA 3ZZ4A 3RXIA 4Q2KA 1OP2A 3MMGA 2KAIB 3AW1A 1FLEE 3B9FH 5A0CA 1EZXC 1H1BA 4UFDH 3VXFH 3IG6B 1GDNA 1AO5A 5DKMA 4ISOA 1K1LA 2EI7A 3VB7A 1ZHMA 1BITA 4BOHA 4JMYA 1CBWC 4MNWA 1CVWH 1NFYA 1TE0A 3VEQB 3GCNA 3BV9B 2XTTB 3VB4A 3RXVA 3IITA 1P04A 2FX4A 2XBWA 3VFEA 3TGIE 3U98H 1D4PB 1FY8E 1YPHE 3UWIA 1HAYB 5JYIA 1MZAA 1W8BH 1SFQB 4GSOA 1C1TA 4MPVA 4ABGA 1AGJA 2B5TB 3SV9A 5GWZA 2ZA5A 3BTHE 1N8OC 1EPTC 2FMJA 3E1XB 1V2JT 2R9PA 4X2VA 5L30H 1V2KT 2XC4A 4I32A 1Z6JH 1ANBA 1IQEA 1BUIA 2OUAA 4JK6A 1GJDB 3MFJA 3GCHC 3OX7U 1KY9A 5B6OA 3D62A 1BOQA 3RC5A 3CS7A 4H4FA 4LZ4B 1SLWB 2Z9LA 5C1XA 1FMGA 4D7FA 3BSQA 1Y3UA 1LHCH 4K1TA 2PLXA 1ZOMA 1EJAA 1DX5M 3UOUA 3A7XA 5EQQA 3M36A 5EG4A 1HIAB 3QGJA 1TPOA 1A7SA 1VGCC 5EXLA 1M9UA 3S0NA 3P8NA 1C1SA 2OC1A 2JH0D 4WH8A 3PB1E 1RRKA 3R3GB 1O39A 3RLWH 2G51A 1GJ9B 1K1JA 3EA7A 4FUJA 1FIZA 3UFAA 1BMNH 1NRPH 1MAXA 1N1LA 3BIVH 2O8TA 1W12U 2BYAX 4J2YB 2BDAA 3ATLA 2TGDA 1EASA 1C5UA 4FUFA 3V0XA 3Q00A 4K3JA 1C5TA 3PO1C 3RXOA 3SO3A 1T8OA 4UD9H 1DLEA 1B0FA 1G37A 1TYNA 1SLXB 1WTHD 3T2NA 2YOLA 1ANEA 1ELFA 2A5AA 1TB6H 2XW9A 1KTTB 4YLUA 1TLDA 3U9AH 4INLA 3RXMA 2BD5A 1TGNA 5EU8A 3D23A 1C1MA 1LHGH 4B75A 4NZLA 3SW2B 3M3SA 2A0QB 2ZWLH 2FODA 5T6FA 2O8WA 4ISLA 5FPYA 1TNKA 4Y0YE 3ZZ9A 1QHRB 3TU7H 1O2LA 1N6YA 1P9UA 1C2MA 3RXKA 3TJNA 2QXJA 1EB1H 3SV7A 1VCPA 1BBRK 1RIWC 4H6TA 1NO9H 1BTWA 2ZU1A 3RXFA 3LDXH 2HNTC 2UUFB 2BTCE 2BHGA 2R0KA 1C5NH 1P05A 3WY8A 1DXPA 5C5OA 2D8WA 4BNRA 1ARBA 4NIYA 4M7GA 1BBRH 3TNSA 3ZVBA 5A09A 1AKSB 9ESTA 1SG8B 3KGPA 1VCQA 2GCTC 4RKJB 1GJ5H 3MI4A 2ZFRH 1LPGB 4HFPB 3UNRA 1K22H 2A4RA 1ZPZA 4NA8A 4E7NA 1ZGVA 5C1YA 1IQHA 1UHBB 1GGDC 1V2TT 1Z7KA 2VWNA 2Y7ZA 2TIOA 2BDIA 1T8LA 4GUXA 3LU9B 1F0TA 2FDAA 2PKAB 1D6WA 4U32A 1H9IE 1UK3A 2VIPA 4ESTE 3W94A 2OLGA 2PGQB 1GHAF 3LT3A 2XRCA 4X1PU 1S6HA 2NWNA 1AU8A 3E90B 5E8EH 1IQJA 4CRDA 2GV6A 1UTOA 1TWXB 2HRVA 1O2IA 1QTFA 4A1VA 4Y8YA 1WSSH 6LPRA 4I7YH 4E05H 1K9OE 4ZUHA 1ZHRA 2YNBA 4BXWA 4DCDA 2FPZA 3BTFE 8KME2 4DW2U 4ZKNU 1QRZA 2LPRA 1H4WA 3K6ZA 4JZDH 3KCGH 1V2MT 4LZ1H 5GJ4B 2GMTC 2FOMB 1ZPCA 5DK1A 4X8VH 3MU5A 1BBRE 3DT0H 3QTVH 5JBCS 1GJBB 1P2MA 2QAAA 2BY9X 2FTLE 2ANYA 1HPGA 1RTKA 3M3TA 4K5ZA 2FLRH 2V0BA 1GI5A 1OP8A 3UOPA 2A5IA 2QY0B 3A7ZA 3M7QA 3O8DA 2VIDA 3EAJA 1V2WT 2P93A 2GVFA 4FUIA 4ZKSU 1AZZA 4JK5A 4NA7A 2ZECA 4O3TA 1GMCG 4WXVA 5HM2A 4AFZA 3DA9B 3ZV9A 3A7YA 1QRWA 3RXGA 1YCPK 4B74A 2VVCA 3LGIA 3CENA 4INKA 1JOUB 1GL0E 1O5BB 3Q3KA 5IDKA 2F91A 1V2UT 3U1IB 1ZPBA 1H9LB 2BXTH 3QDZB 3TH4H 2ZGCA 4PROA 4IMQA 2ANKH 2VU8E 2P8OC 1YCPH 1W0ZU 4XE4A 3QGNB 4IW4E 4NIWA 4ZHAA 1O2PA 2VGCB 2GDEH 4NSVA 1YM0A 1HAVA 2ZHEH 5FCKA 5C5NA 1O3JA 3NXPA 2FI4E 4KTCA 2UUKB 1MUEB 1T8NA 4CREA 3E91A 1BMLA 1KIGH 1AFQB 2QXIA 3SU2A 5GDSH 3ZYDA 1WCZA 1WUNH 2OQUA 2ZG0H 1MD8A 2G5NA 3URDA 1TOMH 3A8AA 3HKJB 4NGAH 1FY5A 1FJSA 1HAIH 2HOBA 1IQIA 1EZUC 4X2WA 3RXBA 1O2WA 1OXGA 3MTYA 1D9IA 1SVPA 1ZSKA 1GI4A 2XWAA 1NC6A 1GG6B 3TK6A 2SGEE 2FOHA 2PKSB 3ZZ7A 3KF2A 1NY22 2H1UA 4I8JA 2A7JA 4X8SH 1A46H 3QTOH 7GCHF 2A5KA 3GY5A 1C5VA 3C1KA 1J14A 1SHYA 2ZPRA 1LDTT 5GIBA 1O2YA 1Y5AT 1OWDA 1TOCB 4X6MA 4IGDA 4O03A 3Q76A 5JB9S 2P3TB 4AOQA 1IAUA 4R8TB 1AUJA 1ESAA 3T25A 2BDBA 1GI9B 1GJ8B 1QL7A 3GY8A 2AIQA 1AFEH 4H6SB 4CH2B 2A45B 3UNSA 4Y7BA 1HBTH 3QX5H 5F03A 4ABEA 4CHAC 2CF9H 2J94A 1O33A 4K1EA 3AAVA 1O34A 4XDEA 1V2QT 1ZSLA 1MCVA 1MZDA 1XKAC 4Y11E 2O8LA 1O2OA 3QO6A 4THNH 3GY3A 3TVJB 1MH0A 3VB5A 2Q6GA 1LPZB 3F9GA 2Z6BD 2XBXA 4X6NA 1P9SA 1UTNA 3S7KB 1KXDA 1TMTH 5JB8S 3UUZA 3RMOH 1QA7A 3T27A 1QRXA 2BQWB 1C2IA 2UWPA 3URCA 1GBDA 1UVTH 1CGJE 2PTCE 1CHGA 4DVAU 1O3AA 2NU4E 3L33A 3LONA 3SV2H 3UREA 1YPMH 2A2QH 1PPGE 1LQEA 2ZHWH 1C5LH 5AVDA 2EA3A 2ASUB 5FBEA 1O35A 1ZHPA 3TH2H 5ESTE 2FXRA 4OGYA 1LVYA 3PYHA 1O2SA 3VXEH 3V13A 3ZZ8A 1G36A 1FXYA 3RXDA 2LNCA 3TJOA 1NZQH 1W7XH 2WYJA 2FOGA 1OSSA 3ITIA 3RM0H 5F8TA 1IQLA 4B76A 3FZDA 1JRSA 1ELBA 2ZZUH 1O3BA 1YC0A 1YPJH 1ZGIA 2OTVA 1P2IA 1KDQA 1AMHA 4X6OA 2G55A 1HCGA 2GTBA 1J9CH 4MPUA 4O3UA 4AB8A 1GBIA 2RA3A 4DIIH 3O8CA 3MNCA 1BHXB 2Z9GA 4K2YA 1HV7A 1GBKA 2VGCC 3A80A 5JBBS 1BTXA 3ODDA 1NS3A 2BLOA 3TITA 3OY6U 4NFFA 4KTSA 1HAXB 5DP6A 1WU1A 1O2RA 1AFQC 3FAOA 3SU1A 4K8YA 4TY6A 3V3MA 1T31A 4AFQA 1A0JA 1O30A 1T8MA 1OWIA 3S9AA 1C2LA 4X2YA 7LPRA 4FUBA 1C5ZB 1KTSB 3C27B 1DICA 1C2HA 5AF9H 3H5CB 4UEHH 3STJA 1DUAA 3ZZ5A 2BDHA 1CT4E 1GG6C 9LPRA 3TGJE 2PKSC 1XUGA 1WAYB 2F3CE 2Y7XA 1KXAA 3QWCH 2FO9A 3K65B 3TLOA 1HUTH 1BTZA 2W3KA 1S0QA 1IQKA 2FS9A 4MLFB 2NU1E 1TBZH 1YPLH 3H7TA 1A5GH 2VIQA 2Y82A 3UWJH 4OS1A 1SGIB 4TY7A 3EGKH 3UR9A 1AB9C 1HJAB 1QGFA 2BX3A 1W10U 5DP7A 3BG4C 1HB0B 1HAPH 3ZZBA 1ZZZA 2TBSA 2Y6TA 1IQNA 1SGEE 4U30A 2BZ6H 4X1QU 3FP7E 1GI0A 2ZHFH 1OS8A 2J92A 1YCPM 5T3HA 3LH1A 3M37A 1O2JA 2OBQA 3GOVB 3GY2A 1HXFH 1ZYOA 1S0RA 1BRCE 4DURA 1TGBA 2ZFPH 2OC7A 3LJOA 2OBOA 1QQUA 1GJ7B 3MU4A 1QL8A 2JETB 1TBQH 2ZDLA 3R0FA 2TRMA 3ZVGA
chains in the Genus database with same CATH superfamily
2IN2A 3BIUH 3V7TA 1WOFA 4A1XA 1RGQA 3JZ2B 3LPRA 3RC6A 1F2SE 3BTDE 2IPQX 1AHTH 3ESTA 4NCYA 2V3MA 3RXRA 4MQAA 1O3CA 5C0UA 3I77A 4U2WA 3ATMA 3SNDA 1YLCA 1QJ6B 2RCEA 1AWFH 2B8OH 3F1SB 3P17H 2XBYA 2J97A 8GCHF 4MPWA 1P2JA 1GHZA 5DPAA 3OEHD 4ZKRU 5GCHF 3U28C 3SV8A 5I46H 3PMJA 2NU2E 1LHFH 5FX5A 2W26A 1TONA 3D49H 1TX6A 1W0JD 5DP3A 2ZO3H 2OXSA 1VITG 1NN6A 1O2ZA 3BEFB 2TGPZ 4X1SU 2ZGXH 2BMGB 2UWOA 3B8JA 3VPKA 1T32A 4ZAEA 3LC3A 1UMAH 1D3TB 4B73A 4AX9H 1SC8U 1C4Y2 2YMSC 2BVXH 1BB0B 3KQDA 1PJPA 4D7GA 3MNXA 2GX4A 1NFXA 4CR9A 2FI5E 3M61U 2D1JA 2ALVA 1O2QA 3EE7A 2OD3B 2AGIX 3E8LA 2G4TA 3GCTF 1NM6A 4MTBA 2WYGA 4A5TS 2THFB 1DFPA 1OPHB 5A2MH 4X8TH 3AASA 2A1DB 1KXCA 2DUCA 1C5QA 3F0PA 5HMAA 1UTLM 5FCRA 4MNXA 1DSUA 2HVYB 1ESBA 3S9BA 2VJ1A 4UFEH 4LXBH 3UNQA 4IS5A 3V12A 1PYTC 1C4U2 2BY6X 1NRSH 3H09A 3RXPA 2ZU3A 3DUXH 1A1RA 3I78A 5EJZA 5A0BA 2Y80A 2ZU2A 2ZKSA 3A7VA 1MTVA 5EPYA 1AIXH 3KHVA 5EGMA 4TWYA 1EAWA 4B6EA 3HK3B 1WQSA 2ZTYA 3A7TA 1E36B 1SMFE 3BEUA 3UIRA 1GBJA 1UTJA 4NWKA 3BTME 3SUEA 2HNTE 1EZQA 1GDUA 2Z9JA 2W3IA 1WXRA 2CHAB 5FPSA 3SJIA 2FOFA 2ZPSA 1YY3A 2D26C 2RDLA 3DHKH 3DFJA 2G4UA 2ZTXA 2J98B 1GBFA 3F68H 1GMHF 3RXCA 2ZGHA 4NZQA 2WINI 3NPSA 4DJZB 5JBTA 4Y0ZE 1ELEE 1O3PB 1HJ8A 1HJAC 2BVRH 2FLBH 1FPCH 1DUEA 3P8GA 3A87A 2BQ6B 4XBCA 2J2UA 1LKBA 1TGTA 4X1NU 2ZFQH 1BMMH 3M3VA 4ABDA 1MU8B 1KXFA 1TX7A 3PLBA 2P3FH 8ESTE 1G32B 1O2KA 1YYY1 2OC0A 4CRBA 3RXEA 4K69A 5JDUB 1O5EH 1UO6A 1LVOA 2BOKA 4ZHLU 1EJMA 3SU3A 1CQQA 3A8CA 3QUMP 4FUGA 1SLUB 3IWMA 3O8BA 3NCLA 1XMNB 3M7UA 1Z1IA 3ZYEA 1DDJA 3SI3H 1RXPA 1C5WB 2BDGA 1H9HE 2P94A 3SOSA 1O2TA 4WH6A 5ABWA 2SNWA 1MTNC 2L6OA 4CRGA 3T26A 2VIOA 1W0YH 4HZHA 1VITH 1S6LA 2Z3DA 1MBQA 2G81E 4WF8A 5DP5A 4E7RG 2WV4A 1Q2WA 1A4WH 2QXHA 4AORA 1G30B 3FN8A 2H9TH 2J5UA 1XUIA 4WVPE 3MH5A 1CT2E 3PROA 1O5GH 3K9XB 2ZDVH 1KXEA 3A81A 3VGCB 1BDAA 2KR7A 2WZQA 3OY5U 3W1EA 1MTWA 1RTLA 3DCLA 3PTNA 2AMDA 5K0HA 1DXWA 1C5XB 2C3SA 1AVWA 5BPEA 4E06H 2F9PA 4I8HA 4KELA 3SGQE 3RM2H 5CDFE 1XM1A 1XUKA 3SUDA 2WPJS 2ZF0H 5JBAS 3GY4A 3VB3A 2Y5HA 1F5KU 1ZMJA 1K1NA 1GMDG 1THSH 3M5NA 2KCOA 3SV6A 2JIZD 3RMNH 4JYUH 2IJD1 4RN6A 4TWWA 4YXWD 3SI4H 3SUGA 2AERH 3E16B 3MH4A 3ZV8A 4AGJA 4KP0A 1C2KA 5JPMH 3ELAH 4M9FA 3RDZA 5I25A 3RXJA 3RXHA 1DY8A 2BD3A 1SPJA 1JWTA 1ETRH 1DWCH 3BG8A 1P2NA 1IQMA 1EAIA 4DY7B 1T4VH 4UE7H 2Q6DA 5J4QA 1C9PA 1Y3WA 1F7ZA 2HPPH 2WPLS 4AGKA 3TGKE 2IJOB 1C1PA 1GBTA 1NFWA 3RP2A 1O5FH 1Z71A 2PUQH 4AG2A 1DE7H 3GDSA 4AG1A 1L1JA 1NU9A 1J16A 4YOGA 5A8XA 1HGTH 2YNAA 2FI3E 4FU9A 3RXUA 1FAKH 1C5RA 3F6UH 5E0GA 1EUFA 1GCTB 1Y8TA 1FPHH 2HALA 3SU5A 1YLDA 2SFAA 4XOJA 1GBLA 1BT7A 2H2ZA 1S85A 1DWEH 2WPMS 2BY7X 1H8ED 4CBNA 1FONA 2PFEA 2G52A 2CHAC 4TYDA 2SNVA 4I8KA 3TH3H 5C0TA 1THPB 5DP9A 1ELTA 4Y8ZA 1V2OT 2V35A 3GY6A 4WMFA 5CHAB 1ZLRA 1TGCA 2PR3A 2ZI2H 1ZTKA 1ESTA 2QGRA 3VB6A 1D3QB 1A5HA 1SGTA 2SGDE 4XBDA 1WYKA 4DG4A 2B9LA 4FETA 1EP6A 4TSFD 3HKIB 5F53A 4GCHF 1MQ6A 1FY1A 1D3PB 1ZMLA 1DPOA 1QL9A 1GPZA 3HATH 5L2YH 2ODQA 3FANA 2LP6A 2ZDAH 1K1MA 2HWLB 5GNDA 2FYQA 4ABAA 1O3EA 3F2GA 1OWEA 1TQ7B 1BRAA 1O5DH 1PQ5A 3PV4A 1O2GH 1NROH 2QF3A 4OGXA 3NK8A 3SU0A 4ABIA 4UDWH 4H42U 1GVZA 2BDYA 1GWAA 3ATKA 3SUFA 1S82A 1KYNA 1S6FA 1V3XA 1Z8JB 3NUMA 3DD2H 2YMSD 1O2VA 2HNTF 3OYPA 2BY5X 1HAVB 4WY3A 1A61H 1GVLA 1SGDE 1V2PT 2Z3EA 3RU4E 4D9QA 1GJ4H 2RA0A 1B0EA 1BQYA 2A4OA 5DGJA 3QN7A 1FY3A 1NRNH 4ASHA 4MVNA 5E2PA 2A7HA 1QZ8A 3AAUA 2HPQH 4AYVB 4OS5A 3RC4A 5EOKA 4RKOB 1SB1H 2KM0A 3CNRA 1A3BH 2XNIA 4BAMB 3VGCC 4NG9H 1UTQA 1UK4A 1MKWH 1HFDA 2FZZA 1O36A 1GI8B 4J1YA 1BRUP 2QF4A 2GDDA 1LKAA 1QB1A 1TX8A 1GVKB 1BTPA 2C8ZB 5C94A 1YKTA 4X1RU 1XXDA 1BJVA 1OYTH 3ZVCA 3ZVDA 1QB6A 2V6NA 1KSNA 1FZZA 1O37A 2BM2A 4CR5A 2ZQ1A 1A0LA 4FUHA 2FOAA 1XX9A 4IC5A 1HAHH 3A88A 5C20A 1DWBH 1GHBF 5C67A 6CHAB 1C5YB 3MWIU 1W2KH 4Q7XA 1O3FA 5TJXA 3S69A 5SGAE 1ZSJA 4CRAA 1QBNA 2CV3A 1GI1A 4CH8B 1V2VT 2QYIA 1TNHA 3MHWU 2CXVA 3UPEA 1S5SA 2ALPA 2HGTH 3U8TH 1EX3A 4DGJA 2QCYA 4SGAE 2WUCA 5EXMA 3F9HA 2R0LA 5DG6A 2ZGBH 4IMZA 2C8YB 1GHAG 2KX4A 3UY9A 4OS4A 1SL3A 2AEIH 3MO3A 1LVBA 2ODPA 4YT6H 1OWJA 2C8XB 2Y5GA 3RUOA 3EA9A 3LGVA 3GICB 1A5IA 1TAWA 1C1VH 2ZC9H 4CBOA 1FN6A 2XXLA 4CRFA 1T4UH 1YLNA 3QK1A 4ABHA 3ZZAA 2BXUH 5LPFA 3M5OA 4GVUA 1OP0A 2AMQA 2K8IA 2XC0A 1UVPA 1KLIH 3LIWA 3F3BA 1P06A 3TK9A 4Z0KA 2PW8H 1DANH 4BANB 2OP9A 2J4IA 3LGWA 4D8NA 4B2CA 4RSPA 1UK2A 1C2EA 3BN9A 3PWCA 4YZUA 4IN1A 3KQCA 4XSKU 5DP8A 1J15A 2F9NA 3SNAA 2B0FA 5CHAC 1GJCB 3RMLH 4F4OC 4D76A 1W14U 3A82A 4BXSA 5E0JA 1EXFA 3FP8E 3FO8D 1Y59T 2Z3CA 4IN2A 1F0UA 1ZTLA 1TIOA 1Z8IB 4JCNA 3GDUA 1CA0B 2XC5A 1T7CA 2O8MA 1FNIA 1SSXA 1ELGA 1P3CA 3VG8A 1TABE 2AGGX 1OWHA 3GYMA 2NU0E 3WWBA 1E38B 3MQKC 1A0HB 1E37B 2K0QA 2PSYA 1QQ4A 4FUCA 5C3NA 3N7OA 1ZMNA 4MPXA 1PFXC 3K6YA 1V2RT 2ZDNA 1J17T 4XFQA 1EATA 3FP6E 1KDQB 1NT1A 2VWOA 4BTTB 3GY7A 1XUHA 1FI8A 2ZTZA 1SQRA 3LGUA 4JZEH 1F5RA 1P2OA 2OQ5A 1QJ7B 3A83A 1C1QA 1JRTA 2O9QA 4FU7A 1TPPA 2P3UB 2W7SA 1BCUH 1BZXE 3N7DA 1PPHE 3BTEE 5AHGH 2KCPA 1K1IA 5CE1A 1WDIA 3QZRA 4B1TA 1SGQE 1EPTA 1WQVH 2AMPA 2CJIA 3SJOA 1ARCA 4ABBA 3SNCA 1K0HA 3RMMH 4GHTA 1W11U 1O3NA 1N8OB 1XVMA 3EQ0H 3TIUA 1P2QA 4Y7AA 1C2FA 3OTPA 2FOCA 2KCYA 2RG3A 2ZFTA 1D3DB 3GCHB 1A2CH 3E6PH 2OCVB 3SN8A 2I6SA 7ESTE 4AFUA 1O3LA 1BIOA 3Q3XA 1IHTH 1BJUA 1Y3XA 5EXNA 1H8IH 2QXGA 4K60A 1SGRE 1CE5A 2GCHG 3Q3YA 4TPIZ 5TCAA 3TJUA 2VH6A 1C5PA 1TNIA 2J9NA 1G3EA 1K1OA 1G3CA 2ILNA 2BLQA 2QC2A 1TMBH 4UONA 2ZFSA 3NKKA 2Q6FA 3BEIB 6CHAC 7GCHG 2EC9H 4X2XA 4ZXXH 1O3DA 2Z94A 3EE0B 4ZH8A 1MBMA 1W7GH 3SORA 4U01A 1P03A 2VVUA 3DSPA 1EAXA 3A7WA 2GKVE 1PPBH 1P01A 1HRTH 2EI8A 1IOEA 3ZZ6A 2BX4A 6GCHG 3ZZCA 1ELAA 4YESB 1GHYH 1YGCH 2ZPQA 1Y3VA 4Y8XA 2VINA 4YM9A 2FESH 2BDCA 2EI6A 5FX6A 1AD8H 1JXPA 3SYJA 2GT8A 3PLKA 2P16A 2CN0H 1WTGH 1YPKH 1VZQH 2VB0A 4GHQA 1AZ8A 3STIA 3GDVA 2FYRA 4F49A 1ZRBA 3MU1A 3SBKA 5LPRA 1UJ1A 2VNTA 3UQVA 1GHVH 4YT7H 3RLYH 4ISNA 5H4IB 5HXFA 4ABFA 1BRBE 4VGCB 2KCAA 2AGEX 2F9UA 1SGNE 4O9VA 3FZZA 4GAWA 2J38A 1MTSA 1NFUA 1EP5A 3U1JB 1GJ6A 1ETSH 1ZJDA 3LH3A 3M35A 2ULLA 1EJNA 3BTWE 1Z6EA 1TA2A 3MNBA 2KAIA 4AYYB 4QT8C 1SGFA 1SGCA 4WMDA 1LMWB 3NWUA 5LPEA 2F9VA 1SBWA 1TMUH 2FM2A 3KEEA 3G01A 2VIWA 5C1UA 1NESE 4Y71A 2GCTB 3P70B 1EB2A 1TQ0B 1GMDF 1O3IA 3A8DA 2ZNKH 2CMYA 2SGAA 3SJ8A 2ZP0H 3SNEA 1BMAA 1ORFA 5C17A 1AUTC 3P8FA 4JZIA 5FPTA 1ABJH 3SJ9A 4DOQA 1U6QA 3KQEA 1DVAH 1HLTH 1O3GA 1VR1H 2M2AA 2BD4A 3M5MA 1GGDB 2XYAA 3QZQA 1JMOH 3E3TA 1O2UA 3UQOA 1BTHH 3Q77A 2TGTA 1P10A 2PSXA 1INCA 2WPIS 1K2I1 2TGAA 2UUYA 1SFIA 4KGAA 1AE8H 2V3OH 3PMAB 1C1OA 5B6LA 3UAIC 3AK5A 1YPGH 3RU4D 1CGIE 2R2WU 1AVGH 4ZKOU 5EQRA 1MCTA 1G9IE 2ZIQH 3SJKA 1TBRH 1F92A 1TPAE 1H8DH 5FBIA 5DJ7A 1F0SA 4GPGA 1TNLA 2C93B 1ABIH 1O5CB 3EDXB 1UTMA 2P59A 4FVBA 5A0AE 4I31A 1QB9A 1ELCA 1L0ZA 1OWKA 3ENSB 1LVMA 2NU3E 1PQ7A 2QN5T 1HIAA 1QURH 1E1RD 2GMTB 1PPEE 3OE7D 3LJJA 1O2XA 1O3OA 5GXPA 3U8OH 1TNJA 4NA9H 4YOIA 1ZR0A 1GMCF 1RTFB 2SGFE 5FAHA 2A32A 4JZ1A 1GL1A 1CHOG 1EQ9A 3KIDU 2ZCHP 1JIRA 4HTCH 4WMEA 2PGBB 1EZSC 1ELVA 1LTOA 2FEQH 1BA8B 1Q3XA 1RJXB 1GJAB 1ELDE 5HKKD 1V2ST 2W5EA 1YPHC 1MAYA 1TPSA 4ZXYH 3OSYA 3SHCH 2DE8A 1FQ3A 1Y5UT 3D65E 4BAQB 4K8BA 2XWBI 3PLPA 2BD2A 2FTMA 2ZQ2A 2QV1A 4KTUA 1K1PA 4JYVH 2JETC 4A1TA 3MOCA 1TGSZ 1SGYE 1C2JA 1GBMA 1PQAA 3DFLA 2PUXB 3E0PB 1O3MA 1ZRKA 2Z7FE 3I29A 3OTJE 4OS2A 3RXAA 3NRLA 1O31A 2OINA 1A3EH 5K7RA 2BD7A 3M5LA 4NFEA 4FVDA 2W6ID 7KMEH 3SU4A 1YF4A 1TFXA 5HIYA 2PV9B 3BTQE 3SQEE 3UR6A 1JBUH 2P8OB 2ZCLP 4HGCA 2ZDMA 4VGCC 2BZAA 2UWLA 3LC5A 2IOTA 4OS6A 1HXEH 3S9CA 2FX6A 3LGYA 1JIMA 2VH0A 4WWYA 3S7HB 1UTPA 2A31A 1DM4B 1XKBC 1W0KD 5F8XA 4INHA 1Z8GA 3TNTA 3A86A 5LGOA 3E0NB 3MH7A 3MYWA 4FUDA 2AHME 4B71A 1O3HA 1UVOA 2WUBA 1V2NT 1CGHA 8GCHG 4Y6DA 1AKSA 4AZ2B 2JKHA 3GYLB 3QLPH 1UW7A 1SR5C 5GCHG 1HJ9A 2QA9E 1FN8A 2GZ7A 3A89A 1G2MA 1BHXF 2HLCA 1AN1E 1P12E 4UFFH 1CU1A 4WJG2 3ZVEA 3BTTE 3A8BA 1L1NA 1SKYE 2A2XH 5L6NH 3BTGE 1DT2A 1UHBA 3PM3A 3ZZ3A 1XUFA 5KECA 2PKAA 4X0WU 1MD7A 1S81A 1AI8H 1ANCA 2ZU4A 4DIHH 1O38A 3BTKE 4Q7YA 1C2DA 1LO6A 5AFZH 1Z1JA 1HDTH 2F83A 3T29A 2BLVA 1NRQH 2VWLA 3KYGA 5HM9A 3F9FA 1AQ7A 3SQHE 4JZFH 4MDSA 2Z9KA 3GCTG 5DO4H 1HAZB 1PPFE 4A6LA 5EPNA 1COWD 2ESTE 1EOJA 3RXQA 1MU6B 2B7DH 4Z6AH 2Z9IA 2I6QA 1YBWA 4FU8A 1CSOE 5BRRE 3AW0A 1GBBA 4BTUB 4CHAB 1VCWA 1GI2A 2Q1JA 1C4V2 1C9TA 5LH8A 2VIVA 5A8ZA 3SGBE 2V3HH 2W7UA 1L1GA 2WPKS 2ANWA 4B2AA 1UVSH 1SOZA 1EAUA 2C90B 1MKXK 2M5TA 3JZ1B 4F48B 1QY6A 2CK3D 1QR3E 1TRYA 4KKDA 5FXLA 1NU7B 4CRCA 5E0HA 1ID5H 4I8GA 2QF0A 1PPZA 1NBME 2J95A 5L2ZH 3KL6A 4B6FA 4R0IA 2BOHB 1O3KA 3GCOA 1F0RA 1MKXH 1SQAA 1FDPA 2STBE 1SHHB 2H5DA 1GMHG 1GBCA 1EKBB 2K1QA 1L2EA 1P0SH 1HNEE 2GZ8A 3KN2A 4BTIB 2P95A 1SQOA 1Y5BT 2ODYB 3T5FH 2FP7B 2H9EH 3ZZDA 1B7XB 1C5MD 2BVSH 1P02A 1IQFA 1CA8B 3PRDA 1TA6A 2H6MA 1O2MA 2Y81A 1FV9A 3P92A 4Y10E 2C4FH 2ZGJA 1P8VC 3RU4T 3ATWA 1L4ZA 2XBVA 1YPEH 1GI7B 1MKWK 5ETXA 2ZCKP 2F9OA 3LOXA 1QIXB 3F9EA 1AVXA 4UFGH 1P3EA 2R3UA 4ZHMU 1GBEA 2BD8A 3SU6A 1TNGA 2A7CA 5EW1H 2AFQB 1RS0A 1LCYA 1AWHB 1C5SA 4FXGH 1PYTD 5AFYH 1X7AC 2G5VA 1W13U 3SZNA 4P00A 2ZU5A 2RDEA 4IBLH 1LHEH 2AIPA 1BTYA 2GT7A 3SNBA 3HGPA 1E34B 1RD3B 1KXBA 1K28D 1S84A 2FOBA 3UTUH 5DP4A 1THRH 5HYOA 1UTKA 2GCHF 5G4BA 1GI6A 2WPHS 3MU8A 1P09A 5F8ZA 4HG6A 2PWXA 1XXFA 2WHXA 5EQSA 3PV2A 3HPTB 2IPHA 3BF6H 3F0OA 5HGGA 2EEKA 4WXIA 4NIXA 4ACAA 3T28A 1UCYK 3UB0A 1KMHB 1LHDH 3AVZA 1QBVH 2PHBA 1G3BA 4RI0A 1DSTA 1ZJKA 3SGAE 4MNVA 4NIVA 2FIRH 1VJAU 5J4SA 1MMJN 1V2LT 1QFKH 1O0DH 3LKWA 3TJVA 1S83A 2FWWA 1G2LA 2GZ9A 4DT7B 3P8OA 3LGTA 1ANDA 5EODA 6GCHF 1AB9B 2F43B 1UCYH 3BG4B 1O2HA 2XCFA 3NZIA 1Q31A 1GCTC 2CF8H 1KLJH 1P11E 2SGPE 3L3TA 1SOTA 2H5CA 5A8YA 1FY4A 1J8AA 1XVOA 2JH6D 4MG3A 1YP9A 5FHTA 3TK5A 1OX1A 1Z8RA 1C5OH 5C2ZA 2AH4X 3K2UA 2JDID 3CP7A 1RFNA 1TALA 1AY6H 4BAKB 3RXSA 2WPDD 3PWBA 1O5AB 1SGPE 4I33A 1F5LA 1G3DA 8LPRA 2GJGA 4ISHH 1C1NA 2HVXA 4B2BA 2ZDKA 4AB9A 1QBOA 3N7EA 2JH5D 1IHSH 4X6PA 1OOKB 1QNJA 1XUJA 3FKSD 1SI5H 2Y5FA 4MNYA 4XBBA 5T6DA 3M7TA 1PQ8A 2ZFFH 1E0FD 2UUJB 3A85A 2ZHQH 1TRNA 4Q80A 4YTAA 4LOYH 1VITF 3EYDA 3HK6B 4YO9A 1N6XA 2BD9A 3F2HA 3EA8A 4GCHG 3ATIA 4Y76A 2BQ7B 1GCDA 2OC8A 3O8RA 1BMFD 1B5GH 1DY9A 1NTPA 3OEED 3PTBA 4YOJA 1UCYE 3PMHB 2GV7A 4BAOB 1CBWB 2GP9B 3CS0A 5E2OA 3FFGA 1D6RA 1P2KA 5FL7D 2O8UA 1OYQA 2G8TA 5ESBA 2CGAA 2WV9A 1K21H 3N99A 4I8LA 2YMSB 1DS2E 4ISIH 4ZMAH 1GBAA 1GHXH 2VWMA 4IC6A 1CO7E 1MQ5A 5T6GA 1SLVB 3RXTA 1V6DA 3KNXA 3DSGA 1IQGA 5DN6D 2BY8X 1DITH 1FIWA 2GD4B 4NSYA 1FUJA 1EPTB 4HI3A 3L6PA 1C1RA 4BAHB 1NPMA 2C8WB 2AS9A 1OKXA 3P6ZB 2WV5A 2GGVB 1EOLA 1SGFG 1NRRH 2J34A 1C1WH 4LK4A 3HGNA 3MO9A 5GPIB 2D2DA 3ZVAA 1FX0B 2ZHDA 4A7IB 4OS7A 4AFSA 1ETTH 3MO6A 1UVUH 1GBHA 1C1UH 2G00A 1Y3YA 3GS9A 2RFKC 2BLWA 4Q4LA 1TRMA 2QF5A 1VGCB 3W95A 3FVFB 2STAE 4ZROA 4Y79A 3KQBA 2BB4A 5IYTA 2XCNA 1BTUA 3MH6A 3DSOA 3TPIZ 2DE9A 6ESTA 1ACBE 1CHOF 1KLTA 4K1SA 1LPKB 5CMXH 4AN7A 3P95A 3ZVFA 3U69H 1FAXA 1WV7H 4JYTA 1CT0E 1SQTA 1GHBG 2FS8A 5DSFA 2TPIZ 3B23B 3PO1B 4Q63A 1AE5A 1L4DA 4ABJA 1MTUA 2ZEBA 1O32A 4O97A 1QCPA 4FUEA 5EW2H 2R3YA 5F6MA 1W3CA 3U8RH 4AC9A 2AYWA 3ZIAD 1HYLA 2VVVA 4Q7ZA 1ZTJA 4YLQH 2F9BH 5TCCA 1GDQA 1O2NA 2FOEA 4X8UH 2SGQE 3OU0A 4A92A 1HAGE 2A4QA 2PTNA 1HAOH 1DLKB 3ODFA 1GI3A 3WWFA 1GHWH 1P57B 1DWDH 4GLYA 3T62A 1E35B 1VJ9U 3MU0A 3MNSA 5PTPA 1WBGB 3SHAH 1C2GA 1LQDB 1MTNB 1RIWB 4NWLA 4SGBE 2ANMH 1QA0A 4TPYA 1CA0C 1QJ1B 2A4GA 3RXLA 3GISB 1PPCE 2QIQA 4D9RA 3PMBB 2R2MB 1DOJA 3A84A 2H9HA 3H7OA 3ZZ4A 3RXIA 4Q2KA 1NBMD 1OP2A 5KGOA 3MMGA 2KAIB 2W6JD 3AW1A 1FLEE 3B9FH 5A0CA 1EZXC 1H1BA 4UFDH 4RT0A 2PP6A 3VXFH 3IG6B 1GDNA 1AO5A 5DKMA 4ISOA 1K1LA 2EI7A 3VB7A 1ZHMA 1BITA 4BOHA 4JMYA 1CBWC 4MNWA 1CVWH 1NFYA 1TE0A 4XRNA 3VEQB 3GCNA 3BV9B 2XTTB 3VB4A 3RXVA 3IITA 1P04A 2FX4A 2XBWA 3VFEA 3TGIE 3U98H 1D4PB 1FY8E 1YPHE 3UWIA 1HAYB 5JYIA 1MZAA 1W8BH 1SFQB 4GSOA 1C1TA 4MPVA 3KYFA 4ABGA 1AGJA 2B5TB 3SV9A 5GWZA 2ZA5A 3BTHE 1N8OC 1EPTC 2FMJA 3E1XB 1V2JT 2R9PA 4X2VA 5L30H 1V2KT 2XC4A 4I32A 1Z6JH 1ANBA 1IQEA 1BUIA 2OUAA 4JK6A 5T1VA 4F55A 1GJDB 2KZ4A 3MFJA 3GCHC 3OX7U 1KY9A 5B6OA 3D62A 1BOQA 3RC5A 3CS7A 4H4FA 4LZ4B 1SLWB 2Z9LA 5C1XA 1FMGA 4D7FA 3BSQA 1Y3UA 1LHCH 1OHHD 4K1TA 2PLXA 3FOAA 1ZOMA 3OAAD 1EJAA 1DX5M 3UOUA 3A7XA 5EQQA 3M36A 5EG4A 1HIAB 3QGJA 1TPOA 1A7SA 1VGCC 5EXLA 5CHBA 1M9UA 3S0NA 3P8NA 1C1SA 2OC1A 2JH0D 4WH8A 3PB1E 1RRKA 3R3GB 1O39A 3RLWH 2G51A 1GJ9B 1H8HD 2J98A 1K1JA 3EA7A 4FUJA 2LELA 1FIZA 3UFAA 1BMNH 1NRPH 1MAXA 1N1LA 3BIVH 2O8TA 1W12U 2BYAX 4J2YB 2BDAA 3ATLA 2TGDA 2JJ1D 1EASA 1C5UA 4FUFA 3V0XA 3Q00A 4K3JA 1C5TA 3PO1C 3RXOA 3SO3A 1T8OA 4UD9H 1DLEA 1B0FA 1G37A 1TYNA 1SLXB 1WTHD 3T2NA 2YOLA 1ANEA 1ELFA 2A5AA 5KEDA 1TB6H 2XW9A 1KTTB 4YLUA 1TLDA 3U9AH 4INLA 2WSSD 3RXMA 2BD5A 1TGNA 5EU8A 3D23A 1C1MA 1LHGH 4B75A 4NZLA 3SW2B 3M3SA 2A0QB 2ZWLH 2FODA 5T6FA 2O8WA 4ISLA 5FPYA 1TNKA 2L74A 3OFND 1QHRB 4Y0YE 1O2LA 3TU7H 3ZZ9A 1EFRD 1N6YA 1P9UA 2QE7D 1C2MA 3RXKA 3TJNA 2QXJA 1EB1H 3SV7A 1VCPA 1BBRK 1RIWC 4H6TA 1NO9H 1BTWA 2ZU1A 3RXFA 3LDXH 2HNTC 2UUFB 2XOKD 2BTCE 2BHGA 2R0KA 4Z1MD 1C5NH 4ZCNA 1P05A 3WY8A 1DXPA 5C5OA 2D8WA 4DT4A 2V7QD 4BNRA 1ARBA 4NIYA 4M7GA 2EQNA 1BBRH 3TNSA 4ACBA 3ZVBA 5A09A 1AKSB 1E1QD 9ESTA 1SG8B 3KGPA 1VCQA 2GCTC 4RKJB 1GJ5H 3MI4A 2ZFRH 1LPGB 3F2FA 4HFPB 3UNRA 1K22H 2A4RA 1ZPZA 4NA8A 4E7NA 1ZGVA 5C1YA 1IQHA 1UHBB 5EJ1A 1GGDC 1V2TT 1Z7KA 2VWNA 2Y7ZA 2TIOA 3PV5A 2BDIA 1T8LA 4GUXA 3LU9B 1F0TA 2FDAA 2PKAB 1D6WA 4U32A 1H9IE 1UK3A 2F4LA 2VIPA 4ESTE 4RT1A 3W94A 2OLGA 2PGQB 1GHAF 3LT3A 2XRCA 4X1PU 1S6HA 2NWNA 1AU8A 3E90B 5E8EH 1IQJA 4CRDA 5IK2D 2GV6A 1UTOA 1TWXB 2HRVA 1O2IA 1QTFA 4A1VA 4Y8YA 4XD7D 1WSSH 6LPRA 4I7YH 4E05H 1K9OE 4ZUHA 1ZHRA 2YNBA 4BXWA 4DCDA 2FPZA 3BTFE 8KME2 4DW2U 4ZKNU 1QRZA 2LPRA 1H4WA 3K6ZA 4JZDH 3KCGH 1V2MT 4LZ1H 5GJ4B 2GMTC 2FOMB 4I86A 1ZPCA 5DK1A 4X8VH 3MU5A 1BBRE 3DT0H 3QTVH 5JBCS 1GJBB 1P2MA 2QAAA 2BY9X 2FTLE 2ANYA 1HPGA 1RTKA 3M3TA 4K5ZA 2FLRH 2V0BA 1GI5A 1OP8A 3UOPA 2A5IA 2QY0B 3A7ZA 3M7QA 2VBCA 3O8DA 2VIDA 3EAJA 1V2WT 2P93A 2GVFA 4FUIA 4ZKSU 3PRBA 1AZZA 4JK5A 4NA7A 2ZECA 4O3TA 1GMCG 4WXVA 5HIZA 5HM2A 4AFZA 1MABB 3DA9B 3ZV9A 3A7YA 1QRWA 3RXGA 1YCPK 1YWUA 4B74A 2VVCA 3LGIA 3CENA 4INKA 1JOUB 3WW7A 1GL0E 1O5BB 3Q3KA 5IDKA 2F91A 1V2UT 3U1IB 1ZPBA 1H9LB 2BXTH 3QDZB 3TH4H 2ZGCA 4PROA 4IMQA 2ANKH 2VU8E 2P8OC 1YCPH 1W0ZU 1VKYA 4XE4A 3QGNB 4IW4E 4NIWA 4ZHAA 1O2PA 2VGCB 2GDEH 4NSVA 1YM0A 1HAVA 2ZHEH 5FCKA 5C5NA 1O3JA 3NXPA 2FI4E 4KTCA 2UUKB 1MUEB 1T8NA 4CREA 3E91A 5EJLA 1BMLA 1KIGH 1AFQB 2QXIA 3SU2A 5GDSH 3ZYDA 1WCZA 1WUNH 2OQUA 2ZG0H 1MD8A 2G5NA 3URDA 1TOMH 3A8AA 3HKJB 4NGAH 1FY5A 1FJSA 1HAIH 2HOBA 1IQIA 1EZUC 4X2WA 3RXBA 1O2WA 1OXGA 3MTYA 1D9IA 1SVPA 1ZSKA 1GI4A 2XWAA 1NC6A 1GG6B 3TK6A 2SGEE 2FOHA 2PKSB 3ZZ7A 3KF2A 1NY22 2H1UA 4I8JA 2A7JA 4X8SH 1A46H 3QTOH 7GCHF 2A5KA 3GY5A 1C5VA 3C1KA 4TT3D 1J14A 1SHYA 2ZPRA 1LDTT 5GIBA 1O2YA 1Y5AT 1OWDA 1TOCB 4X6MA 4IGDA 4O03A 2HLDD 3Q76A 5JB9S 2P3TB 4AOQA 1IAUA 4R8TB 1AUJA 1ESAA 3T25A 2BDBA 1GI9B 1GJ8B 1QL7A 3GY8A 2AIQA 1AFEH 4H6SB 2XNDD 4CH2B 2A45B 3UNSA 4Y7BA 1HBTH 3QX5H 5F03A 4ABEA 4CHAC 2CF9H 2J94A 1O33A 4K1EA 3AAVA 1O34A 4XDEA 1V2QT 1ZSLA 1MCVA 1MZDA 1XKAC 4Y11E 2O8LA 2EY4C 1O2OA 3QO6A 4THNH 3GY3A 3TVJB 1MH0A 1E79D 3VB5A 2Q6GA 1LPZB 3F9GA 2Z6BD 2XBXA 4X6NA 1P9SA 2JJ2D 1UTNA 3S7KB 1KXDA 1TMTH 5JB8S 3UUZA 3RMOH 1QA7A 3T27A 1QRXA 2BQWB 1C2IA 2UWPA 3URCA 1GBDA 1UVTH 1CGJE 2PTCE 2OK5A 1CHGA 4DVAU 1O3AA 2NU4E 3L33A 3LONA 3SV2H 3UREA 1YPMH 2A2QH 1PPGE 2KFWA 1LQEA 2ZHWH 1C5LH 5AVDA 2EA3A 2ASUB 5FBEA 1O35A 1ZHPA 3TH2H 5ESTE 2FXRA 4OGYA 1LVYA 3PYHA 1O2SA 3VXEH 3V13A 3ZZ8A 4OM9A 1G36A 1FXYA 3RXDA 2LNCA 3TJOA 1NZQH 5EIYA 1W7XH 2WYJA 2FOGA 1OSSA 3ITIA 3RM0H 5F8TA 1IQLA 4B76A 3FZDA 1JRSA 1ELBA 2ZZUH 1O3BA 1YC0A 1YPJH 1ZGIA 2OTVA 1P2IA 1KDQA 1AMHA 4X6OA 2G55A 1HCGA 4FOUC 2GTBA 1J9CH 4MPUA 4O3UA 4AB8A 1GBIA 2RA3A 4DIIH 3O8CA 3MNCA 1BHXB 2Z9GA 4K2YA 1HV7A 1GBKA 2VGCC 3A80A 5JBBS 1BTXA 3ODDA 1NS3A 2BLOA 3TITA 3OY6U 4NFFA 4KTSA 1HAXB 5DP6A 1WU1A 1O2RA 1AFQC 3FAOA 3SU1A 4K8YA 4TY6A 3V3MA 1T31A 4AFQA 1A0JA 1O30A 1T8MA 1OWIA 3S9AA 1C2LA 4X2YA 7LPRA 4FUBA 1C5ZB 1KTSB 3C27B 1DICA 1C2HA 5AF9H 3H5CB 4UEHH 3STJA 1DUAA 3ZZ5A 2BDHA 1CT4E 1GG6C 9LPRA 3TGJE 2PKSC 1XUGA 1WAYB 2F3CE 4P02A 2Y7XA 1KXAA 3QWCH 2FO9A 3K65B 3SZEA 3TLOA 1HUTH 1BTZA 2W3KA 1S0QA 1IQKA 2FS9A 4MLFB 2NU1E 1TBZH 1YPLH 3H7TA 1A5GH 2VIQA 2Y82A 3UWJH 4OS1A 4ASUD 1SGIB 4TY7A 3EGKH 3UR9A 1AB9C 1HJAB 1QGFA 2BX3A 1W10U 5DP7A 3BG4C 1HB0B 1HAPH 3ZZBA 1ZZZA 2TBSA 2Y6TA 1IQNA 1SGEE 4U30A 2BZ6H 4X1QU 3FP7E 1GI0A 2ZHFH 1OS8A 2J92A 1YCPM 5T3HA 3LH1A 3M37A 1O2JA 2OBQA 3GOVB 3GY2A 1HXFH 1ZYOA 1S0RA 1BRCE 4DURA 1TGBA 2ZFPH 2OC7A 3LJOA 2OBOA 1QQUA 1GJ7B 3MU4A 1QL8A 2JETB 1TBQH 2ZDLA 3R0FA 2TRMA 3ZVGA 3KQ5A
chains in the Genus database with same CATH topology
2IN2A 3BIUH 3V7TA 1WOFA 4A1XA 1RGQA 3JZ2B 3LPRA 3RC6A 1F2SE 3BTDE 1AHTH 3ESTA 4NCYA 3RXRA 4MQAA 1O3CA 3I77A 4U2WA 3ATMA 3SNDA 1YLCA 1QJ6B 2RCEA 1AWFH 2B8OH 3F1SB 3P17H 2XBYA 8GCHF 4MPWA 1P2JA 1GHZA 5DPAA 4ZKRU 5GCHF 3SV8A 5I46H 3PMJA 2NU2E 1LHFH 5FX5A 2W26A 1TONA 3D49H 1TX6A 5DP3A 2ZO3H 2OXSA 1VITG 1NN6A 1O2ZA 3BEFB 2TGPZ 4X1SU 2ZGXH 2BMGB 2UWOA 3B8JA 3VPKA 1T32A 4ZAEA 3LC3A 1UMAH 1D3TB 4B73A 4AX9H 1SC8U 1C4Y2 2BVXH 1BB0B 3KQDA 1PJPA 4D7GA 3MNXA 2GX4A 1NFXA 4CR9A 2FI5E 3M61U 2D1JA 2ALVA 1O2QA 2OD3B 2AGIX 3E8LA 2G4TA 3GCTF 1NM6A 4MTBA 2WYGA 4A5TS 2THFB 1DFPA 1OPHB 5A2MH 4X8TH 3AASA 2A1DB 1KXCA 2DUCA 1C5QA 5HMAA 1UTLM 5FCRA 4MNXA 1DSUA 1ESBA 3S9BA 2VJ1A 4UFEH 4LXBH 3UNQA 4IS5A 3V12A 1PYTC 1C4U2 2BY6X 1NRSH 3RXPA 2ZU3A 3DUXH 1A1RA 3I78A 5A0BA 2Y80A 2ZU2A 2ZKSA 3A7VA 1MTVA 5EPYA 1AIXH 3KHVA 5EGMA 4TWYA 1EAWA 3HK3B 1WQSA 2ZTYA 3A7TA 1E36B 1SMFE 3BEUA 3UIRA 1GBJA 1UTJA 4NWKA 3BTME 3SUEA 2HNTE 1EZQA 1GDUA 2Z9JA 2W3IA 2CHAB 5FPSA 3SJIA 2FOFA 2ZPSA 2D26C 2RDLA 3DHKH 3DFJA 2G4UA 2ZTXA 1GBFA 3F68H 1GMHF 3RXCA 2ZGHA 4NZQA 2WINI 3NPSA 4DJZB 5JBTA 4Y0ZE 1ELEE 1O3PB 1HJ8A 1HJAC 2BVRH 2FLBH 1FPCH 1DUEA 3P8GA 3A87A 2BQ6B 4XBCA 2J2UA 1LKBA 1TGTA 4X1NU 2ZFQH 1BMMH 3M3VA 4ABDA 1MU8B 1KXFA 1TX7A 3PLBA 2P3FH 8ESTE 1G32B 1O2KA 1YYY1 2OC0A 4CRBA 3RXEA 4K69A 5JDUB 1O5EH 1UO6A 1LVOA 2BOKA 4ZHLU 1EJMA 3SU3A 1CQQA 3A8CA 3QUMP 4FUGA 1SLUB 3IWMA 3O8BA 3NCLA 1XMNB 3M7UA 1Z1IA 3ZYEA 1DDJA 3SI3H 1RXPA 1C5WB 2BDGA 1H9HE 2P94A 3SOSA 1O2TA 4WH6A 5ABWA 2SNWA 1MTNC 4CRGA 3T26A 2VIOA 1W0YH 4HZHA 1VITH 2Z3DA 1MBQA 2G81E 4WF8A 5DP5A 4E7RG 2WV4A 1Q2WA 1A4WH 2QXHA 4AORA 1G30B 2H9TH 1XUIA 4WVPE 3MH5A 1CT2E 3PROA 1O5GH 3K9XB 2ZDVH 1KXEA 3A81A 3VGCB 1BDAA 3OY5U 1MTWA 1RTLA 3PTNA 2AMDA 5K0HA 1DXWA 1C5XB 2C3SA 1AVWA 5BPEA 4E06H 2F9PA 4I8HA 4KELA 3SGQE 3RM2H 1XM1A 1XUKA 3SUDA 2WPJS 2ZF0H 5JBAS 3GY4A 3VB3A 2Y5HA 1F5KU 1ZMJA 1K1NA 1GMDG 1THSH 3M5NA 3SV6A 3RMNH 4JYUH 4RN6A 4TWWA 3SI4H 3SUGA 2AERH 3E16B 3MH4A 3ZV8A 4AGJA 4KP0A 1C2KA 5JPMH 3ELAH 3RDZA 5I25A 3RXJA 3RXHA 1DY8A 2BD3A 1SPJA 1JWTA 1ETRH 1DWCH 3BG8A 1P2NA 1IQMA 1EAIA 4DY7B 1T4VH 4UE7H 2Q6DA 5J4QA 1C9PA 1Y3WA 1F7ZA 2HPPH 2WPLS 4AGKA 3TGKE 2IJOB 1C1PA 1GBTA 1NFWA 3RP2A 1O5FH 1Z71A 2PUQH 4AG2A 1DE7H 3GDSA 4AG1A 1L1JA 1NU9A 1J16A 4YOGA 5A8XA 1HGTH 2YNAA 2FI3E 4FU9A 3RXUA 1FAKH 1C5RA 3F6UH 5E0GA 1EUFA 1GCTB 1Y8TA 1FPHH 2HALA 3SU5A 1YLDA 2SFAA 4XOJA 1GBLA 1BT7A 2H2ZA 1S85A 1DWEH 2WPMS 2BY7X 4CBNA 2PFEA 1FONA 2G52A 2CHAC 4TYDA 2SNVA 4I8KA 3TH3H 1THPB 5DP9A 1ELTA 4Y8ZA 1V2OT 2V35A 3GY6A 4WMFA 5CHAB 1ZLRA 1TGCA 2PR3A 2ZI2H 1ZTKA 1ESTA 2QGRA 3VB6A 1D3QB 1A5HA 1SGTA 2SGDE 4XBDA 1WYKA 4DG4A 2B9LA 1EP6A 3HKIB 4GCHF 1MQ6A 1FY1A 1D3PB 1ZMLA 1DPOA 1QL9A 1GPZA 3HATH 5L2YH 2ODQA 3FANA 2ZDAH 1K1MA 2HWLB 2FYQA 4ABAA 1O3EA 1OWEA 1TQ7B 1BRAA 1O5DH 1PQ5A 3PV4A 1O2GH 1NROH 2QF3A 4OGXA 3NK8A 3SU0A 4ABIA 4UDWH 4H42U 1GVZA 2BDYA 1GWAA 3ATKA 3SUFA 1S82A 1KYNA 1S6FA 1V3XA 1Z8JB 3NUMA 3DD2H 1O2VA 2HNTF 3OYPA 2BY5X 1HAVB 4WY3A 1A61H 1GVLA 1SGDE 1V2PT 2Z3EA 3RU4E 4D9QA 1GJ4H 2RA0A 1B0EA 1BQYA 2A4OA 5DGJA 3QN7A 1FY3A 1NRNH 4ASHA 4MVNA 5E2PA 2A7HA 3AAUA 2HPQH 4AYVB 4OS5A 3RC4A 5EOKA 4RKOB 1SB1H 1A3BH 2XNIA 4BAMB 3VGCC 4NG9H 1UTQA 1UK4A 1MKWH 1HFDA 2FZZA 1O36A 1GI8B 4J1YA 1BRUP 2GDDA 1LKAA 1QB1A 1TX8A 1GVKB 1BTPA 2C8ZB 1YKTA 4X1RU 1XXDA 1BJVA 1OYTH 3ZVCA 3ZVDA 1QB6A 2V6NA 1KSNA 1FZZA 1O37A 2BM2A 4CR5A 2ZQ1A 1A0LA 4FUHA 2FOAA 1XX9A 4IC5A 1HAHH 3A88A 5C20A 1DWBH 1GHBF 5C67A 6CHAB 1C5YB 3MWIU 1W2KH 4Q7XA 1O3FA 5TJXA 3S69A 5SGAE 1ZSJA 4CRAA 1QBNA 2CV3A 1GI1A 4CH8B 1V2VT 2QYIA 1TNHA 3MHWU 2CXVA 3UPEA 1S5SA 2ALPA 2HGTH 3U8TH 1EX3A 4DGJA 2QCYA 4SGAE 2WUCA 5EXMA 3F9HA 2R0LA 5DG6A 2ZGBH 4IMZA 2C8YB 1GHAG 3UY9A 4OS4A 1SL3A 2AEIH 3MO3A 1LVBA 2ODPA 4YT6H 1OWJA 2C8XB 2Y5GA 3RUOA 3EA9A 3LGVA 3GICB 1A5IA 1TAWA 1C1VH 2ZC9H 4CBOA 1FN6A 2XXLA 4CRFA 1T4UH 3QK1A 4ABHA 3ZZAA 2BXUH 5LPFA 3M5OA 4GVUA 1OP0A 2AMQA 2XC0A 1UVPA 1KLIH 3LIWA 3TK9A 1P06A 4Z0KA 2PW8H 1DANH 4BANB 2OP9A 2J4IA 3LGWA 4D8NA 4B2CA 4RSPA 1UK2A 1C2EA 3BN9A 3PWCA 4YZUA 4IN1A 3KQCA 4XSKU 5DP8A 1J15A 2F9NA 3SNAA 2B0FA 5CHAC 1GJCB 3RMLH 4F4OC 4D76A 1W14U 3A82A 4BXSA 5E0JA 1EXFA 3FP8E 1Y59T 2Z3CA 4IN2A 1F0UA 1ZTLA 1TIOA 1Z8IB 4JCNA 3GDUA 1CA0B 2XC5A 1T7CA 2O8MA 1FNIA 1SSXA 1ELGA 1P3CA 1TABE 2AGGX 1OWHA 3GYMA 2NU0E 1E38B 1A0HB 1E37B 2PSYA 1QQ4A 4FUCA 5C3NA 3N7OA 1ZMNA 4MPXA 1PFXC 3K6YA 1V2RT 2ZDNA 1J17T 4XFQA 1EATA 3FP6E 1KDQB 1NT1A 2VWOA 4BTTB 3GY7A 1XUHA 1FI8A 2ZTZA 3LGUA 4JZEH 1F5RA 1P2OA 2OQ5A 1QJ7B 3A83A 1C1QA 1JRTA 2O9QA 4FU7A 1TPPA 2P3UB 2W7SA 1BCUH 1BZXE 1PPHE 3BTEE 5AHGH 1K1IA 5CE1A 3QZRA 4B1TA 1SGQE 1EPTA 1WQVH 2AMPA 2CJIA 3SJOA 1ARCA 4ABBA 3SNCA 3RMMH 4GHTA 1W11U 1O3NA 1N8OB 1XVMA 3EQ0H 3TIUA 1P2QA 4Y7AA 1C2FA 2FOCA 2RG3A 2ZFTA 1D3DB 3GCHB 1A2CH 3E6PH 2OCVB 3SN8A 2I6SA 7ESTE 4AFUA 1O3LA 1BIOA 3Q3XA 1IHTH 1BJUA 1Y3XA 5EXNA 1H8IH 2QXGA 4K60A 1SGRE 1CE5A 2GCHG 3Q3YA 4TPIZ 5TCAA 3TJUA 2VH6A 1C5PA 1TNIA 2J9NA 1G3EA 1K1OA 1G3CA 2ILNA 2BLQA 2QC2A 1TMBH 4UONA 2ZFSA 3NKKA 2Q6FA 3BEIB 6CHAC 7GCHG 2EC9H 4X2XA 4ZXXH 1O3DA 2Z94A 3EE0B 4ZH8A 1MBMA 1W7GH 3SORA 4U01A 1P03A 2VVUA 1EAXA 3A7WA 2GKVE 1PPBH 1P01A 1HRTH 2EI8A 1IOEA 3ZZ6A 2BX4A 6GCHG 3ZZCA 1ELAA 4YESB 1GHYH 1YGCH 2ZPQA 1Y3VA 4Y8XA 2VINA 4YM9A 2FESH 2BDCA 2EI6A 5FX6A 1AD8H 1JXPA 2GT8A 3PLKA 2P16A 2CN0H 1WTGH 1YPKH 1VZQH 2VB0A 4GHQA 1AZ8A 3STIA 3GDVA 2FYRA 4F49A 1ZRBA 3MU1A 3SBKA 5LPRA 1UJ1A 2VNTA 3UQVA 1GHVH 4YT7H 3RLYH 4ISNA 5H4IB 5HXFA 4ABFA 1BRBE 4VGCB 2AGEX 2F9UA 1SGNE 4O9VA 3FZZA 4GAWA 2J38A 1MTSA 1NFUA 1EP5A 3U1JB 1GJ6A 1ETSH 1ZJDA 3LH3A 3M35A 2ULLA 1EJNA 3BTWE 1Z6EA 1TA2A 3MNBA 2KAIA 4AYYB 4QT8C 1SGFA 1SGCA 4WMDA 1LMWB 3NWUA 5LPEA 2F9VA 1SBWA 1TMUH 2FM2A 3KEEA 3G01A 2VIWA 5C1UA 1NESE 4Y71A 2GCTB 3P70B 1EB2A 1TQ0B 1GMDF 1O3IA 3A8DA 2ZNKH 2CMYA 2SGAA 3SJ8A 2ZP0H 3SNEA 1BMAA 1ORFA 1AUTC 3P8FA 4JZIA 5FPTA 1ABJH 3SJ9A 4DOQA 1U6QA 3KQEA 1DVAH 1HLTH 1O3GA 1VR1H 2BD4A 3M5MA 1GGDB 2XYAA 3QZQA 1JMOH 3E3TA 1O2UA 3UQOA 1BTHH 3Q77A 2TGTA 1P10A 2PSXA 1INCA 2WPIS 1K2I1 2TGAA 2UUYA 1SFIA 4KGAA 1AE8H 2V3OH 3PMAB 1C1OA 1YPGH 3RU4D 1CGIE 2R2WU 1AVGH 4ZKOU 5EQRA 1MCTA 1G9IE 2ZIQH 3SJKA 1TBRH 1F92A 1TPAE 1H8DH 5FBIA 5DJ7A 1F0SA 4GPGA 1TNLA 2C93B 1ABIH 1O5CB 3EDXB 1UTMA 2P59A 4FVBA 5A0AE 4I31A 1QB9A 1ELCA 1L0ZA 1OWKA 3ENSB 1LVMA 2NU3E 1PQ7A 2QN5T 1HIAA 1QURH 2GMTB 1PPEE 3LJJA 1O2XA 1O3OA 5GXPA 3U8OH 1TNJA 4NA9H 4YOIA 1ZR0A 1GMCF 1RTFB 2SGFE 5FAHA 2A32A 4JZ1A 1GL1A 1CHOG 1EQ9A 3KIDU 2ZCHP 1JIRA 4HTCH 4WMEA 2PGBB 1EZSC 1ELVA 1LTOA 2FEQH 1BA8B 1Q3XA 1RJXB 1GJAB 1ELDE 1V2ST 2W5EA 1YPHC 1MAYA 1TPSA 4ZXYH 3OSYA 3SHCH 2DE8A 1FQ3A 1Y5UT 3D65E 4BAQB 4K8BA 2XWBI 3PLPA 2BD2A 2FTMA 2ZQ2A 2QV1A 4KTUA 1K1PA 4JYVH 2JETC 4A1TA 3MOCA 1TGSZ 1SGYE 1C2JA 1GBMA 1PQAA 3DFLA 2PUXB 3E0PB 1O3MA 1ZRKA 2Z7FE 3I29A 3OTJE 4OS2A 3RXAA 1O31A 2OINA 1A3EH 5K7RA 2BD7A 3M5LA 4NFEA 4FVDA 7KMEH 3SU4A 1YF4A 1TFXA 3SQEE 2PV9B 3BTQE 3UR6A 1JBUH 2P8OB 2ZCLP 4HGCA 2ZDMA 4VGCC 2BZAA 2UWLA 3LC5A 2IOTA 4OS6A 1HXEH 3S9CA 2FX6A 3LGYA 1JIMA 2VH0A 4WWYA 3S7HB 1UTPA 2A31A 1DM4B 1XKBC 5F8XA 4INHA 1Z8GA 3TNTA 3A86A 5LGOA 3E0NB 3MH7A 3MYWA 4FUDA 4B71A 1O3HA 1UVOA 2WUBA 1V2NT 1CGHA 8GCHG 4Y6DA 1AKSA 4AZ2B 2JKHA 3GYLB 3QLPH 1SR5C 5GCHG 1HJ9A 2QA9E 1FN8A 2GZ7A 3A89A 1G2MA 1BHXF 2HLCA 1AN1E 1P12E 4UFFH 1CU1A 4WJG2 3ZVEA 3BTTE 3A8BA 1L1NA 2A2XH 5L6NH 3BTGE 1DT2A 1UHBA 3PM3A 3ZZ3A 1XUFA 2PKAA 4X0WU 1MD7A 1S81A 1AI8H 1ANCA 2ZU4A 4DIHH 1O38A 3BTKE 4Q7YA 1C2DA 1LO6A 5AFZH 1Z1JA 1HDTH 2F83A 3T29A 2BLVA 1NRQH 2VWLA 5HM9A 3F9FA 1AQ7A 3SQHE 4JZFH 4MDSA 2Z9KA 3GCTG 5DO4H 1HAZB 1PPFE 4A6LA 5EPNA 2ESTE 1EOJA 3RXQA 1MU6B 2B7DH 4Z6AH 2Z9IA 2I6QA 1YBWA 4FU8A 1CSOE 5BRRE 3AW0A 1GBBA 4BTUB 4CHAB 1VCWA 1GI2A 2Q1JA 1C4V2 1C9TA 5LH8A 2VIVA 5A8ZA 3SGBE 2V3HH 2W7UA 1L1GA 2WPKS 2ANWA 4B2AA 1UVSH 1SOZA 1EAUA 2C90B 1MKXK 2M5TA 3JZ1B 1QY6A 1QR3E 1TRYA 4KKDA 5FXLA 1NU7B 4CRCA 5E0HA