1E36B

Porcine pancreatic elastase complexed with (3s, 4s)n-para-nitrobenzenesulphonyl -3-ethyl-4-(carboxylic acid)pyrrolidin-2-one
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(serine protease)
molecule keywords ELASTASE
publication title 'Ph-Jump' Crystallographic Analyses of Gamma-Lactam-Porcine Pancreatic Elastase Complexes
pubmed doi rcsb
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2000-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1e36B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1e36B01
2ZTZA 5DG6A 2GCHF 3ATKA 4BANB 1QCPA 4NIVA 3MH7A 2VB0A 4MDSA 1JMOH 4ZHAA 2J94A 1XUHA 5DP6A 2HNTE 1A5HA 3STJA 5A8ZA 3BTEE 1PQ8A 2QGRA 4BAQB 4GHTA 3URCA 2PUXB 1RTFB 1UMAH 1QA7A 2BX3A 1IHTH 3BSQA 1CA0C 1SGTA 3EYDA 3H5CB 4NZQA 1MTVA 4WMFA 1TNLA 1P2KA 2FOCA 1YP9A 1LHGH 2J9NA 1NC6A 3RXGA 1C1WH 1EZUC 5EOKA 4ZXYH 1FXYA 1MCTA 3R0FA 1BTZA 1O2TA 1MKWK 1C2FA 4UDWH 3DFLA 2UUYA 2SGPE 3E0NB 2AERH 4FUHA 4VGCC 3V12A 4JYVH 5DK1A 1CT0E 3M61U 2FESH 2CHAB 4I31A 1LO6A 4B2AA 3A7WA 1L1NA 3T5FH 2RG3A 4IW4E 1D3PB 3SNCA 2BLOA 8ESTE 3LC3A 4MNYA 5EGMA 1HAVB 3ZZBA 3F1SB 1IQMA 3M5OA 3V7TA 3OX7U 3P8GA 2ULLA 1D3DB 1J9CH 4MVNA 3SGBE 3TK5A 1J8AA 3MHWU 1ZPBA 1S84A 1CBWC 1HYLA 1ELGA 3I78A 4H42U 3UQVA 4GUXA 1HLTH 5ESTE 1SBWA 4NIWA 3ENSB 2BY6X 2XC5A 3E8LA 3IITA 1N6YA 4E06H 1UTQA 2AS9A 2FOHA 1O5DH 3RXDA 4Y8ZA 3RMMH 1OS8A 1C2IA 1ZSKA 1BQYA 3A7TA 2GMTB 4B75A 4GLYA 4ZAEA 2BZ6H 5J4QA 3P6ZB 1GMHG 1FY1A 2D2DA 4I8LA 4MPUA 4JYTA 3SJ8A 3PWCA 2TGAA 3D65E 3RXSA 1UK4A 1V2ST 2R9PA 4TWWA 3OTJE 1A2CH 1MZAA 2SGAA 1GDQA 2H1UA 3T29A 2YNBA 3A8CA 1CT2E 2XTTB 4K60A 1BDAA 5F03A 3UREA 3PB1E 5J4SA 4CHAB 1MH0A 2WINI 4GPGA 1P03A 1Q3XA 5T3HA 2ZDLA 1WCZA 1TNIA 1O5EH 1SQAA 1YPEH 4UFFH 4AG1A 1C5SA 2Z9LA 2C3SA 2XWBI 2ZHQH 2WPKS 2ZGXH 3P70B 4X1RU 3QK1A 4B74A 1EOJA 1WQSA 1YPGH 1DY8A 1IQNA 3UNQA 3I29A 1DSTA 1GBDA 3WY8A 1C2HA 1KLTA 1NRQH 2OD3B 1GBIA 2PFEA 1RJXB 4ZHMU 1JXPA 4FUDA 5IDKA 3UFAA 2QY0B 2WPIS 1IQIA 5BRRE 1HAPH 2PUQH 3ITIA 1K1OA 2XBYA 3LU9B 3RMOH 1ZTJA 2XYAA 4DJZB 1Z8JB 2P94A 1UVPA 4NIYA 3EA8A 2CGAA 4R8TB 5JBAS 2BOHB 1KTTB 1PPZA 3KQBA 2Y6TA 3IWMA 1C2JA 3GYMA 3QX5H 4Y79A 3URDA 1O3BA 1V2OT 3PMHB 2BY7X 3L6PA 2ZPQA 1C1TA 2Z9KA 3TGJE 4NSVA 1UJ1A 4PROA 2H9EH 4K1TA 1GJ7B 1GMHF 1ELDE 3GDUA 1MBMA 1C5OH 1BIOA 1UTNA 3OU0A 5HM2A 3RXRA 4NA9H 1C1SA 1TFXA 1AD8H 1TRNA 1U6QA 2FMJA 5A0AE 3R3GB 2R3YA 2UWOA 4CRGA 1ACBE 4K69A 2BD7A 1E34B 1JRSA 1YPHE 3BG4B 1JIMA 2JETB 1FY8E 2RDLA 2GDDA 5HYOA 1GJAB 1LVBA 2O8LA 3Q3XA 1IOEA 3BTME 1KXAA 2BDBA 4K8YA 5HXFA 1GHYH 2VIVA 5LGOA 3BTKE 4UONA 5FHTA 4UFGH 4GCHF 1S85A 2LPRA 4X2VA 3A7ZA 1ZJKA 3SNBA 3BTGE 2Z3CA 2NU1E 2CV3A 4ABIA 5K7RA 2ODYB 1OWHA 4CRAA 1DWCH 1SFQB 3EDXB 3M7TA 3RXUA 1MMJN 2A32A 4UFDH 2BD8A 2ALPA 3PV4A 4J1YA 1O31A 1GDUA 4K2YA 5I46H 1FLEE 1T8NA 2H9HA 2GCTB 1K21H 5CMXH 3FZZA 4TWYA 5PTPA 4HGCA 4NFFA 3ZZDA 4NFEA 1O2XA 5EPYA 1F0SA 5T6DA 1BTPA 5C1XA 1O2MA 5GCHF 1D9IA 1QNJA 1CHOF 1LVYA 4IMQA 2CHAC 1Z1JA 3MH6A 1QJ1B 1Z8RA 4X8SH 2FOEA 1EASA 5E8EH 3BTHE 1AZZA 3FZDA 1QBNA 2P3FH 2BDHA 4AYVB 1SB1H 1V2UT 2ZQ1A 1OX1A 3KEEA 1H9LB 3VFEA 1ELBA 3RU4T 3C1KA 4DW2U 1K28D 2GGVB 3MTYA 3QTVH 5EG4A 1C5XB 1F5RA 1MUEB 3QDZB 5DPAA 2FS9A 2QF3A 5DP9A 3KIDU 3RXFA 3UOPA 2FO9A 3QZQA 2A5IA 2AYWA 3A81A 1P2MA 1TQ7B 1F0RA 5C1UA 2D26C 5AFZH 4E05H 1BBRE 2FXRA 1ORFA 4ZKRU 1GJ9B 2F9OA 2OBQA 3RXIA 1LKAA 3AVZA 4WVPE 2A7CA 1BBRH 2GMTC 4X2WA 2FTMA 3E91A 1N1LA 4O03A 2ANYA 1ELEE 1TX8A 2Q6GA 3TLOA 1ZGVA 3E90B 1UTPA 1MTWA 1P10A 1V2TT 3ZZ3A 1MD8A 1YYY1 3S7HB 1L2EA 5EXNA 1WTGH 4CH8B 1OWDA 1UVUH 1UCYK 2O9QA 1MAYA 2P3UB 4LOYH 1BRAA 5GWZA 1AUJA 4IN1A 1A61H 4D7GA 4CHAC 3SNEA 3ZZ8A 5FXLA 4BTIB 1C5QA 3AAVA 4I33A 3M37A 2F9BH 1QFKH 1WV7H 1CVWH 1C5TA 1GI9B 1O2ZA 1S0QA 4X6OA 3Q00A 5A0BA 1C5MD 1KIGH 1OWIA 3ZZ7A 1GHWH 1JBUH 1LQEA 2BDCA 5EPNA 3MNXA 1C1NA 3N7OA 3BTTE 2BDGA 3BIUH 1P09A 4WXVA 1EPTA 1CT4E 1FPCH 4CRFA 2HRVA 2J34A 3SN8A 2FOMB 2TRMA 1FJSA 2GV6A 5GXPA 2FYRA 2Y80A 4WMEA 3T26A 4Q2KA 3SI3H 2GX4A 2A0QB 2PV9B 3RLWH 3S0NA 2SNWA 1A3BH 2FODA 3PLBA 2OCVB 1VCQA 1ELVA 1UTKA 1XXDA 5A8YA 1E36B 1WU1A 4FUJA 2VH6A 1GJ5H 1ZHPA 5A0CA 1IQGA 3GOVB 1RRKA 2BQ7B 4YOJA 4Q7ZA 1WBGB 1MTNB 1EXFA 3GCOA 5E0HA 4DG4A 5EW2H 2V35A 1A0JA 1UK3A 1BITA 1TLDA 3TU7H 2P3TB 1SHYA 4X2XA 1HAIH 1QY6A 2VIQA 3UWJH 1C5VA 3F9EA 1SGCA 4FUFA 1UHBA 3BG4C 1OWKA 2JETC 1NFUA 2BVXH 1GI2A 2OINA 1ZZZA 2ZCLP 1YCPH 3O8DA 2P95A 4LZ4B 5JYIA 1ZYOA 3PMAB 1KLJH 1OP0A 3MU4A 4B73A 4TPIZ 1LVMA 2A5AA 4ZH8A 1SLWB 3TNTA 1BTUA 2F3CE 4AG2A 4Y71A 5C20A 2IOTA 1Z6EA 3BEIB 3OSYA 2PR3A 4FU8A 3LJJA 1ZSJA 2XBXA 1B7XB 2BD4A 3RXPA 3GCTG 2A31A 3MU0A 1MQ5A 1GHBG 1LQDB 3E1XB 8LPRA 2GCTC 9ESTA 4IGDA 4OS4A 4ABHA 2BD9A 3KQDA 4U2WA 4A7IB 2FLRH 2QXIA 4CRCA 4FVBA 1O37A 2QN5T 2ODPA 2XRCA 3GDVA 3MU5A 1UVSH 2ZP0H 3UTUH 1GMCF 2WYJA 2CMYA 4MPXA 4X1SU 4X6PA 2C8WB 2QV1A 2B9LA 3SI4H 1JIRA 1XVMA 5T6GA 1EP6A 1O32A 5F8ZA 3HK3B 2PKSB 1O39A 3RXEA 1O0DH 2AMQA 3TNSA 3RC6A 1AGJA 1G3DA 2QYIA 1V6DA 3RXTA 4UD9H 3SV9A 5E2OA 2BXUH 3QUMP 3W94A 4XOJA 1DWEH 2V3HH 4YLQH 1B0EA 4RKJB 3SOSA 2EI8A 3BTDE 1EJAA 1G37A 1TPAE 3NK8A 3MH4A 1LPKB 1O3EA 1O3JA 5FPSA 1TX6A 1DFPA 1UO6A 4NIXA 1YCPK 2VJ1A 3SNAA 2ZGJA 2BYAX 4AORA 4THNH 4Y8XA 3VXEH 5F6MA 2G5VA 2P8OB 1GI0A 3VPKA 1LKBA 4D8NA 2QXHA 4XBCA 1RS0A 1SGPE 3A8BA 4RSPA 4I8HA 1BZXE 1NS3A 3KQEA 3SU0A 2Z3EA 2ZWLH 1ETTH 3GY4A 1KYNA 2C8ZB 1GHZA 1NRPH 2SFAA 5GIBA 1VITF 1O34A 3D23A 2VVCA 3ZV9A 4AZ2B 3FVFB 3GCTF 4YT6H 4MNVA 1P2OA 1P04A 1XMNB 1BTXA 2ZFRH 5FCKA 1F2SE 2O8WA 3A89A 1C2EA 4B71A 3NUMA 1GCTB 2ZI2H 2PTNA 3DA9B 3BF6H 5I25A 3RXHA 1FPHH 4LZ1H 4ASHA 1AUTC 1QB6A 1JRTA 1MKWH 1O2RA 4Q7YA 1NZQH 2FP7B 1QL9A 2BHGA 1TOCB 3T28A 3T25A 8GCHG 2ZFTA 3RU4E 1H1BA 1Q31A 2HALA 2GDEH 3M3VA 1E38B 1SQOA 1O2HA 1SLVB 5DP3A 1O2JA 4JK5A 2AEIH 3B8JA 1WYKA 2ZC9H 1O3AA 1C2KA 2YNAA 3RXVA 2ZHDA 4BNRA 3GY2A 3MH5A 2EEKA 4SGBE 2QAAA 5DP7A 4Y8YA 3M3SA 4QT8C 1GHVH 5C3NA 1G32B 4AGJA 1Z8GA 3BIVH 2ZO3H 1ANBA 4XFQA 1ZPCA 1W0YH 5FPYA 5FCRA 3VB4A 2GZ8A 1QGFA 1MTNC 3LGTA 3ZV8A 2FOBA 1QB9A 4Y0ZE 2FX4A 2ESTE 1GWAA 1YPMH 1Q2WA 2JKHA 3M36A 4AFZA 3RXAA 4DURA 5JBCS 1HJ9A 3W95A 2A1DB 1ZMNA 3KCGH 1TPOA 4H6SB 1C1QA 4ZROA 1BMLA 3OY5U 1XX9A 2STAE 3UWIA 1CA8B 3S9AA 3ATMA 3SJKA 4X8TH 4K1SA 3Q3YA 3ZZAA 1YCPM 2BOKA 2XW9A 2ZKSA 2P16A 3JZ1B 2HOBA 2J92A 1NN6A 1ARBA 1EZQA 1Y3WA 2OTVA 8GCHF 4KP0A 3LGIA 2J95A 3TJNA 1PPGE 3A7YA 3AW0A 1SI5H 2OBOA 1DUEA 5G4BA 1AO5A 1GL1A 3SGAE 3UNSA 4Y6DA 2PKAA 2SGFE 2FI4E 3CS0A 2QIQA 3MOCA 4JCNA 4I8JA 3PMBB 1BB0B 4A1TA 4X6NA 4NGAH 2RA3A 1GBAA 1V2JT 1J17T 1IQEA 2BY9X 3GDSA 2A45B 2DUCA 5E2PA 1MKXK 1XVOA 1O3DA 1SVPA 4YT7H 2G81E 4FU9A 4NZLA 1K1JA 2O8UA 3SUFA 4NWKA 2Y7XA 3ZVGA 2PKSC 3P17H 1HAZB 4YM9A 5HMAA 3LONA 4BAKB 4Q7XA 1C9PA 1ELCA 5GPIB 1H8DH 4HZHA 1BJUA 1A0LA 2OLGA 3KQCA 1PQAA 2VIOA 1VITH 2ZFFH 3NZIA 1UHBB 1FY3A 1NU7B 1QIXB 3SO3A 4FXGH 1NY22 5L30H 1D3QB 1XUJA 1P2IA 4FUGA 3ODDA 2VINA 1AWHB 1KDQA 1TYNA 1FIZA 1C2LA 1C2DA 1ZMJA 1QURH 1E35B 1QRXA 3MNBA 2P8OC 4YOIA 1WSSH 2W3IA 4WXIA 3LT3A 1TMBH 4JZEH 3B23B 3QGJA 4CBOA 1EKBB 4WH6A 1ABJH 2A2QH 3RXMA 1K1PA 1TBQH 3KHVA 2F9NA 4MQAA 1HCGA 1TA6A 4DIHH 1TRMA 3FFGA 2WUCA 4BTTB 1O3CA 2RCEA 2ZGHA 1IQLA 4ABFA 6LPRA 3S9CA 3GY3A 3QO6A 1C4U2 3FP8E 1UK2A 1Z8IB 1BT7A 3SQHE 4DVAU 3TGKE 4X6MA 2OC0A 1V2LT 2PLXA 3UNRA 1GCTC 2ZCKP 4X1NU 2BQ6B 1W3CA 4RKOB 3LIWA 1Y5UT 2V6NA 4FUEA 1FAKH 3M5LA 2WPJS 1V2WT 3ZVCA 1QQ4A 4AB9A 1TNKA 4OS2A 1VGCB 1G9IE 1O2YA 2RA0A 2FIRH 1LDTT 3K6YA 3ZVDA 4K1EA 2KAIA 1O3LA 2BLWA 1C5NH 4D7FA 1ZJDA 2WPHS 1ESAA 1AB9B 1ZHRA 5DGJA 3FP6E 1BRBE 1DS2E 2GT8A 1DE7H 1TGCA 1TE0A 1TWXB 1NRSH 2BY5X 4M7GA 1TMTH 3RM2H 1ARCA 1WAYB 1E37B 1SGQE 1BTHH 1S81A 4ABBA 3RXCA 2ZQ2A 1EX3A 1EJNA 1TBZH 3JZ2B 1Z71A 1BMMH 3H7OA 1UVTH 4X2YA 1YM0A 1O3PB 4KKDA 2H9TH 1P57B 2VWMA 4B2CA 2B8OH 1UTMA 1O2GH 5JB9S 3G01A 3M7UA 1TGSZ 1VZQH 1Y8TA 3SU1A 3PYHA 3OYPA 3EQ0H 1O3IA 3KF2A 2OQUA 3A86A 1NPMA 1Y5AT 1VR1H 1P12E 2F83A 2ZPSA 4BAHB 4AGKA 1J16A 1QRWA 1V3XA 1KY9A 1UCYE 4E7RG 1A1RA 1A5GH 4JZFH 5DP8A 1T8OA 2O8TA 1SGEE 2B7DH 1UCYH 4OS6A 1GI7B 2QXGA 4MTBA 4BAMB 1W7XH 2ALVA 3A83A 2G00A 4XDEA 3UR9A 3PLKA 2NU3E 4YOGA 1AN1E 1SL3A 3F9HA 1EPTC 1XUKA 2XCNA 1OPHB 4YLUA 1GMDG 1XM1A 3ZYEA 4YTAA 2JH6D 2WYGA 2TPIZ 1J15A 8KME2 2FX6A 1O2NA 4K3JA 3M3TA 2ZGBH 1K1IA 5JBTA 3U9AH 4FUBA 1O3KA 1AY6H 3LGWA 5DO4H 2ASUB 1DXWA 1GJ4H 2G52A 2Y7ZA 3SNDA 2ANKH 3VEQB 4NCYA 1C9TA 1EB2A 1HAHH 1SLXB 2FM2A 3LC5A 3F6UH 2VVVA 2QXJA 3SU3A 1BJVA 2JH0D 1C1RA 4AB8A 1B5GH 2ZECA 1DWDH 3SQEE 2ZGCA 1J14A 4AN7A 4O3TA 1KTSB 1TONA 2NWNA 3TK9A 1AVGH 3MI4A 4O9VA 5T6FA 3SU6A 5F8TA 1SGRE 1P3CA 1RTKA 1ETRH 1SQTA 1W13U 4ZUHA 1O2UA 1SGIB 4FUCA 2UWLA 1F0TA 4Y7AA 2BLVA 1GI8B 1QHRB 1AFEH 2DE8A 1P2JA 3O8RA 3UQOA 1VCPA 2J38A 2ZU1A 1FAXA 1FZZA 4IBLH 1FY5A 2B0FA 1A4WH 1GVKB 2G4UA 3SORA 1INCA 1CGHA 2AIQA 4AFUA 2A4OA 1TPPA 2GP9B 2Y5HA 4D76A 5L2YH 4H4FA 2G55A 1NO9H 4B76A 1IAUA 2PGBB 1GMDF 2ZCHP 3E6PH 1DX5M 2PKAB 4NWLA 1ABIH 1L1JA 1NU9A 2Z9GA 3EA9A 3ODFA 4KELA 4CREA 1MU8B 1ESTA 3P8OA 3VB6A 4ZKNU 2WPMS 1L4DA 1YKTA 2ZU4A 3GCNA 3TH3H 3SU5A 1G36A 1O2QA 1E0FD 3QN7A 1T7CA 3U69H 4ABGA 5ETXA 3SUGA 3NKKA 1VGCC 1W12U 2BTCE 2ZU3A 1GBTA 1QTFA 5C5OA 2OC8A 1C5ZB 1UVOA 3KGPA 1FV9A 1LTOA 1C1VH 2QA9E 3T2NA 1G3EA 3LPRA 3BTQE 3GYLB 5EQRA 1TNJA 1B0FA 1GI4A 3TK6A 1AB9C 1W7GH 1HAVA 1KDQB 2VIWA 4MPWA 1C4V2 4MLFB 1K1NA 3GY8A 4IC6A 4HTCH 1BTWA 2YOLA 1SHHB 1Y3VA 1A5IA 1EAXA 1P02A 1OSSA 3QWCH 2ZFQH 4I7YH 2ZHWH 1LHEH 2Y82A 5TCCA 5K0HA 2DE9A 1O35A 3MO3A 3K6ZA 3MFJA 1YPJH 2BM2A 3UUZA 3BTFE 1O3GA 1TQ0B 2BD3A 5B6OA 1NFXA 4AFSA 3HPTB 5A8XA 3RC4A 3RXBA 2OQ5A 1MTSA 3TJOA 2GT7A 1EZXC 1Z1IA 2FEQH 2D1JA 2UUJB 3O8BA 2FDAA 3NXPA 1XUIA 3RC5A 2FZZA 1HNEE 1NROH 1NTPA 1VJ9U 1WTHD 2QF0A 4KGAA 1BMNH 5FBEA 1WUNH 1O2IA 1C5PA 3DT0H 1IQHA 1PQ7A 1HJAB 1ZPZA 4IN2A 2KAIB 1FUJA 2EC9H 2HNTF 3Q76A 4JZ1A 1MZDA 3MMGA 3GICB 1T8MA 1L0ZA 3S7KB 2J4IA 1HUTH 3SZNA 1PYTD 1C2MA 1ZMLA 2WPLS 3AASA 2Y5GA 2AMPA 4I8KA 2BD2A 4BXSA 4RN6A 3QLPH 1GJCB 1RGQA 2Z9IA 3A88A 2W5EA 3BG8A 3ATLA 3VB5A 1XXFA 2BVSH 3HGPA 2NU2E 4IS5A 1F5LA 3QTOH 3ZVBA 2GVFA 1O36A 1PPBH 4ZKSU 1G2LA 4A6LA 1XUGA 2F9PA 4TPYA 4A92A 1ZRKA 2ZDNA 3MYWA 3FANA 1KXBA 1KXFA 4ABAA 1IHSH 3LDXH 4MNXA 2VIPA 5ESBA 5DP5A 1K22H 5GJ4B 1V2PT 4Z6AH 5DKMA 2ZU2A 2ZEBA 5FX5A 1DLKB 1S6FA 2VGCB 3SU2A 1O33A 2TBSA 4KTUA 2FYQA 7GCHG 1BRCE 2QC2A 2BQWB 3TJVA 2EI7A 2UUFB 2FWWA 3HKJB 2W3KA 1F0UA 1GBEA 4MPVA 2ZU5A 1QBVH 1ESBA 1DICA 1GHBF 1EAWA 2GCHG 4I32A 2AGEX 1AHTH 3A8DA 2F9UA 3PTBA 5FAHA 5LH8A 4ESTE 4WY3A 1W2KH 2GZ7A 6ESTA 1O30A 2A7JA 4YZUA 2Q6FA 3F9GA 1LHFH 5SGAE 1GGDB 5L6NH 1VCWA 3K9XB 3LGUA 5AFYH 2Q1JA 1AKSA 4OGYA 4FUIA 4A1VA 1CO7E 1S82A 5EXLA 1TIOA 1RIWB 1GPZA 2ZHEH 1GJBB 3H7TA 1DOJA 4DOQA 1LMWB 4BXWA 3TIUA 1H4WA 4Q80A 4ABEA 1FN6A 4ISIH 1KXCA 4GAWA 3NPSA 4O97A 2BDIA 3B9FH 3F9FA 1FMGA 5DP4A 1ANCA 1HAGE 3RMNH 4UFEH 3RDZA 1SGNE 1GJ6A 1QJ7B 2FOAA 1MKXH 1OKXA 1XUFA 2BD5A 1HRTH 1TBRH 1C5WB 1EP5A 2C93B 3TJUA 1EAUA 4WMDA 2HWLB 2Q6DA 3KNXA 1H9HE 3A82A 3E0PB 3ESTA 7GCHF 5HM9A 3S69A 3SBKA 2ZFPH 1O3FA 1THSH 1TX7A 1CHGA 2WV4A 4A1XA 5A09A 1YPKH 1Y3XA 4WH8A 1EUFA 2ZDAH 1UTLM 7KMEH 5JPMH 4NSYA 2BLQA 1W11U 2GTBA 1HFDA 3A7XA 2UUKB 5CHAB 1O5AB 1N8OB 5F8XA 2C8YB 4MNWA 1PPHE 4GHQA 1NRRH 1DY9A 1CSOE 3U8TH 3GY6A 4AX9H 4NA8A 1SFIA 1SGYE 3I77A 4UEHH 3ZVEA 1ZTLA 1W14U 1W0ZU 5AVDA 4YO9A 3F68H 3FP7E 1DXPA 1EZSC 2HPQH 4HFPB 5C2ZA 2SGEE 1GI6A 2A7HA 3HATH 4ZXXH 3SW2B 3RU4D 4D9QA 1EPTB 1V2MT 2NU4E 2ZTXA 4LK4A 3LKWA 4JYUH 2GZ9A 1DUAA 3A80A 3PTNA 1W10U 2NU0E 1CE5A 2GKVE 2A2XH 1GL0E 2ZDVH 1HPGA 3T62A 1P01A 1AE5A 2FOGA 1HJAC 1S5SA 3HK6B 4TY6A 1Y3UA 3MWIU 1QL8A 1YBWA 1AQ7A 2IPHA 1O5FH 1YGCH 4SGAE 4U32A 4Y11E 1AVWA 5JB8S 1HAOH 2BZAA 4Y76A 1JWTA 1Z6JH 1FNIA 2IN2A 1L1GA 2PGQB 2CXVA 1DSUA 1O2OA 4CRBA 3ZZ6A 3FAOA 3M35A 5FBIA 1O3NA 2VWOA 1ZRBA 1P2QA 5ABWA 2AGIX 1K1MA 1YF4A 3AW1A 4DY7B 1KXDA 2BMGB 3QGNB 3RXQA 1DDJA 1T8LA 2I6SA 4Z0KA 6CHAB 1MQ6A 3MNCA 3D62A 1BCUH 2FLBH 3MO9A 1DT2A 1RFNA 1YC0A 2K1QA 2XC0A 4TY7A 2GD4B 4KTSA 1GBJA 1QB1A 2G8TA 1F5KU 3PO1B 2VGCC 5AF9H 5TCAA 5IYTA 1QJ6B 3PM3A 4AYYB 1CQQA 2HNTC 4WF8A 1C5RA 1O2LA 3U98H 1D3TB 2AIPA 4X8VH 4ZHLU 2BVRH 2W7SA 1P9UA 4A5TS 1L4ZA 4IMZA 4Y0YE 1IQKA 1HAYB 3VB7A 2V3OH 4JZDH 1OWEA 3GY7A 1LPGB 3V13A 2PHBA 4INKA 3STIA 1X7AC 2EI6A 2HVXA 2XNIA 1TNGA 1QA0A 4GCHG 3SUEA 4WWYA 5EODA 1GGDC 3SJOA 1AI8H 1TMUH 1ID5H 5EU8A 1P8VC 4K5ZA 1TPSA 1IQJA 1C2GA 2XXLA 1AFQC 2W26A 4OS5A 1RIWC 1P0SH 1LPZB 1O3OA 1CGJE 3SV7A 2SGDE 2BY8X 4B1TA 4Y7BA 2ZF0H 1KXEA 1G2MA 1P2NA 3SJ9A 5GDSH 7ESTE 1GJDB 3TITA 3A84A 1GCDA 3ATIA 2ZNKH 3RXJA 4BTUB 1O2KA 5GCHG 4J2YB 1DM4B 1CHOG 1TRYA 5C5NA 1GBHA 1AE8H 2R2WU 5HGGA 2G4TA 1WOFA 3ZYDA 2Z94A 2M5TA 4F4OC 1K1LA 4CRDA 1O2PA 2R0KA 4X0WU 1P9SA 1GHAG 1YLDA 5E0JA 1S6HA 2AGGX 4OS7A 1HDTH 2WUBA 1TNHA 1V2RT 1FONA 1C1OA 2BB4A 4ABDA 1TABE 2OUAA 2H5DA 5CHAC 1N8OC 2CJIA 2Z9JA 1BOQA 3VGCB 1DLEA 3BN9A 1C1UH 1EAIA 3HKIB 3KL6A 1H9IE 1CGIE 1NESE 4XBDA 1NM6A 4H6TA 1AKSB 2ANMH 2B5TB 3SGQE 1EQ9A 4DCDA 2STBE 2TGDA 5LPEA 1UTJA 1ELFA 2R0LA 3SU4A 3V0XA 1Y3YA 4U01A 3NCLA 2BDAA 1GHXH 1O2WA 1SGDE 1NT1A 1FDPA 3ZZ5A 3MO6A 1TGTA 2AFQB 2IJOB 1T32A 1SC8U 3RXOA 1HIAA 1W8BH 3RXLA 1DITH 1AIXH 2W7UA 1H8IH 1A0HB 1ZR0A 3M7QA 4B2BA 2A4RA 2CF8H 4IC5A 4LXBH 2Z7FE 1CU1A 1PPFE 3U8OH 2HLCA 1GBLA 2FI5E 2H5CA 1SOTA 1GJ8B 1MTUA 4NA7A 1GHAF 4WJG2 1LVOA 2TIOA 3O8CA 2VIDA 2XWAA 3E3TA 3LGYA 2ILNA 1LHCH 3UPEA 1KLIH 2HGTH 5EW1H 1G3CA 1JOUB 4X8UH 5EXMA 1C5LH 1P06A 3DFJA 1OP2A 2OXSA 1GBMA 6CHAC 5BPEA 4F49A 3M5NA 1A7SA 1QR3E 3TH4H 4NG9H 1NFWA 2R3UA 1ANDA 1P11E 3SV6A 1F92A 2FTLE 1O3MA 1G3BA 3SHAH 4YESB 1YPHC 1QRZA 1PFXC 3PO1C 1A46H 3DUXH 1YPLH 4XE4A 4Y10E 3P95A 1PJPA 2BDYA 4CR5A 2ZFSA 9LPRA 1ZGIA 4INHA 3P92A 1C5YB 1MD7A 2FPZA 1SLUB 1UTOA 1KSNA 2VNTA 4XBBA 3K2UA 3PROA 6GCHG 3P8NA 1GVZA 3UY9A 4R0IA 1PQ5A 1GVLA 5DJ7A 1GI3A 1MAXA 2ZG0H 1RD3B 1XKBC 1WQVH 4K8BA 4O3UA 1LCYA 3V3MA 5A2MH 4FVDA 2SGQE 2D8WA 4OGXA 1D4PB 3LH3A 3L3TA 2P93A 3EGKH 3K65B 3ZVFA 1O5CB 1SSXA 3PWBA 1GBFA 4JZIA 2GV7A 1GI1A 1HV7A 1SGFA 3ZVAA 1RTLA 3HGNA 2VWLA 1AWFH 2FS8A 4CR9A 1GBCA 1SMFE 2XCFA 2ZTYA 4ABJA 1T4VH 2C90B 2SNVA 2ZDKA 1OP8A 1ZTKA 2FI3E 1T31A 1AU8A 1GG6B 4JMYA 1QL7A 1MCVA 1FI8A 3BTWE 1TB6H 3ATWA 3GCHB 1GBKA 2JH5D 3Q77A 1C1PA 7LPRA 4ZMAH 1GMCG 3EA7A 4DGJA 2C8XB 3OY6U 1LHDH 3SUDA 2LNCA 1O2VA 3A87A 4BAOB 2A4QA 4ISOA 1FY4A 1O3HA 1THPB 2ZPRA 2PSXA 3BV9B 2G51A 1EATA 4KTCA 1BBRK 1FIWA 1O5BB 2CF9H 1F7ZA 1SPJA 1ELTA 3RUOA 3KN2A 3P8FA 4GVUA 1Y59T 3GY5A 1P05A 1HBTH 1C4Y2 1CA0B 3TH2H 2A5KA 6GCHF 1TA2A 1THRH 4AOQA 2F91A 2OC1A 1GDNA 1VJAU 3U1IB 4CBNA 2ZHFH 1SOZA 5CE1A 1BHXF 1V2QT 1P3EA 3A8AA 4JK6A 1T4UH 3VGCC 1D6RA 2PTCE 3PMJA 1QQUA 1SR5C 1AZ8A 4X1PU 4TYDA 2VWNA 3RM0H 2ZZUH 1AVXA 1XKAC 5H4IB 2VU8E 2UWPA 4VGCB 5LPFA 1VITG 2P59A 3CENA 1G30B 1RXPA 3L33A 1M9UA 5FX6A 2Y5FA 1V2VT 2AMDA 3T27A 2QCYA 1DWBH 1S0RA 2F9VA 4ZKOU 1DPOA 2H6MA 4INLA 3AAUA 2Z3DA 1CBWB 1N6XA 3A85A 2PW8H 3MU8A 2THFB 4DIIH 1K2I1 4X1QU 3U1JB 5AHGH 1A3EH 2O8MA 2VVUA 3DHKH 1MU6B 4AFQA 3LH1A 1OYTH 1EB1H 1V2NT 4HI3A 3SV2H 1OYQA 1ELAA 1HXFH 4OS1A 1BHXB 2XBVA 1ANEA 3SJIA 5TJXA 3Q3KA 2BXTH 2I6QA 1FN8A 3QZRA 1C5UA 1BA8B 1QBOA 1BRUP 4BOHA 2Z6BD 2R2MB 3EAJA 5C1YA 3PLPA 2CN0H 1GI5A 1PYTC 1SGFG 4MG3A 3E16B 1HB0B 2PSYA 4U30A 3ELAH 1FQ3A 5E0GA 1ETSH 1BTYA 1DANH 4E7NA 1HAXB 1BUIA 4D9RA 2H2ZA 3EE0B 1HJ8A 2ZIQH 1Y5BT 1NFYA 3GISB 5LPRA 3D49H 3ZZCA 1IQFA 5L2ZH 1BMAA 1OOKB 1K9OE 3C27B 3SV8A 2WV5A 1OWJA 4ISNA 3UR6A 3LOXA 2J2UA 1ZHMA 1SG8B 2TGTA 2AH4X 1Z7KA 2XC4A 3RMLH 4FU7A 1DVAH 1HIAB 1O38A 1C1MA 3ZZ4A 1TOMH 3VXFH 3U8RH 1AFQB 1MBQA 2G5NA 3MNSA 3RP2A 2ANWA 3S9BA 5JDUB 2XBWA 3M5MA 3A7VA 3IG6B 1TGNA 2OP9A 3SHCH 3RLYH 1OXGA 3DD2H 2ODQA 1PPEE 3LGVA 3BEUA 1TALA 3UOUA 5EQQA 4ISHH 2ZA5A 1GBBA 1HXEH 2C4FH 2ZDMA 4GSOA 1S83A 3NWUA 1AMHA 4I8GA 3CP7A 2V0BA 1D6WA 2FOFA 5EQSA 5JBBS 2HPPH 4CH2B 1PPCE 3BEFB 1EOLA 1NRNH 1YLCA 4XSKU 2EA3A 4UE7H 2PWXA 3MU1A 1HGTH 1TGBA 1ZLRA 2A4GA 3RXKA 5C67A 1O5GH 3LJOA 1TAWA 1V2KT 1GG6C 3VB3A 1O2SA 3CS7A 2VH0A 2TGPZ 2Y81A 3GCHC 3ZZ9A 3UIRA 3TVJB 3TGIE 1EJMA 4ISLA 5FPTA 3TPIZ 2BX4A 2OC7A 4DT7B 1ZOMA 1ZSLA
chains in the Genus database with same CATH superfamily
2ZTZA 5DG6A 2GCHF 3ATKA 4BANB 1QCPA 4ACBA 4NIVA 3MH7A 2VB0A 4MDSA 1JMOH 4ZHAA 2J94A 1XUHA 5DP6A 2HNTE 1A5HA 3STJA 5A8ZA 3BTEE 1PQ8A 2QGRA 4BAQB 4GHTA 3URCA 2J97A 2PUXB 1RTFB 1UMAH 1QA7A 2BX3A 1IHTH 3BSQA 1CA0C 1SGTA 3EYDA 3H5CB 4NZQA 1MTVA 4WMFA 3N7DA 3FKSD 1TNLA 1P2KA 2FOCA 1YP9A 1LHGH 2J9NA 1NC6A 3RXGA 1C1WH 1EZUC 5EOKA 4ZXYH 1FXYA 1MCTA 4Z1MD 3R0FA 1BTZA 1O2TA 1MKWK 1C2FA 4UDWH 4B6EA 3DFLA 2UUYA 2SGPE 3E0NB 2AERH 3SZEA 4FUHA 4VGCC 3V12A 2K8IA 4JYVH 5DK1A 1CT0E 3M61U 2FESH 2CHAB 2V3MA 4I31A 1LO6A 5T1VA 4B2AA 4DT4A 3A7WA 1L1NA 3T5FH 2RG3A 4IW4E 1D3PB 3SNCA 2BLOA 8ESTE 3LC3A 4MNYA 5EGMA 1HAVB 3ZZBA 1NBMD 3F1SB 1IQMA 3M5OA 3V7TA 3OX7U 3P8GA 2ULLA 1D3DB 1J9CH 4MVNA 3SGBE 3TK5A 1J8AA 3MHWU 1ZPBA 1S84A 2F4LA 1CBWC 1HYLA 1ELGA 3I78A 4H42U 3UQVA 4GUXA 1HLTH 5ESTE 1SBWA 4NIWA 3ENSB 2BY6X 2XC5A 3E8LA 3IITA 1N6YA 4E06H 1UTQA 2AS9A 2FOHA 1O5DH 3RXDA 4Y8ZA 3RMMH 1OS8A 1C2IA 1ZSKA 1BQYA 3A7TA 2GMTB 4B75A 4GLYA 4ZAEA 2BZ6H 5J4QA 3P6ZB 1GMHG 1FY1A 2D2DA 2LP6A 4I8LA 3DSGA 4MPUA 4JYTA 3SJ8A 3PWCA 3MQKC 2TGAA 3D65E 3RXSA 1UK4A 1V2ST 2R9PA 4TWWA 3OTJE 1A2CH 1MZAA 2SGAA 1GDQA 2H1UA 3WWBA 3T29A 2YNBA 3A8CA 4M9FA 1CT2E 2XTTB 4K60A 2QE7D 1BDAA 5F03A 3UREA 3PB1E 5J4SA 4CHAB 1MH0A 2WINI 4GPGA 1P03A 1Q3XA 5T3HA 2ZDLA 1WCZA 1TNIA 1O5EH 1SQAA 1YPEH 1K0HA 4UFFH 2W6ID 4AG1A 1C5SA 2Z9LA 2C3SA 2XWBI 2ZHQH 2WPKS 2ZGXH 3P70B 4X1RU 3QK1A 4B74A 1EOJA 1WQSA 1YPGH 1DY8A 1IQNA 3UNQA 3I29A 1DSTA 1GBDA 3WY8A 1C2HA 1KLTA 1NRQH 2OD3B 1GBIA 2PFEA 1RJXB 4ZHMU 1JXPA 4FUDA 5IDKA 3UFAA 2QY0B 2WPIS 1IQIA 5BRRE 1HAPH 2PUQH 3ITIA 1K1OA 2XBYA 3LU9B 3RMOH 1ZTJA 2XYAA 4DJZB 1Z8JB 2P94A 1UVPA 3F0OA 4NIYA 2RFKC 3EA8A 2CGAA 4R8TB 5JBAS 2BOHB 1KTTB 1PPZA 3KQBA 2Y6TA 3IWMA 1C2JA 3GYMA 3QX5H 4Y79A 1W0JD 3URDA 1O3BA 1V2OT 3PMHB 2BY7X 3L6PA 2ZPQA 1C1TA 2Z9KA 3TGJE 4NSVA 1UJ1A 4PROA 2H9EH 4K1TA 1GJ7B 1GMHF 1ELDE 3GDUA 1MBMA 1C5OH 1BIOA 1UTNA 3OU0A 5HM2A 5EJLA 4NA9H 3RXRA 1C1SA 1TFXA 1AD8H 1TRNA 1U6QA 1EFRD 2FMJA 5A0AE 3R3GB 2R3YA 2UWOA 4CRGA 1ACBE 4K69A 2BD7A 1E34B 1JRSA 1YPHE 3BG4B 1JIMA 2JETB 1FY8E 2RDLA 2GDDA 5HYOA 1GJAB 1LVBA 2O8LA 3Q3XA 1IOEA 3BTME 1KXAA 2BDBA 4K8YA 5HXFA 1GHYH 2VIVA 5LGOA 3BTKE 4UONA 5FHTA 4UFGH 4GCHF 1S85A 2LPRA 2OK5A 4X2VA 3A7ZA 1ZJKA 3SNBA 3BTGE 2Z3CA 2NU1E 2CV3A 4ABIA 5K7RA 2ODYB 1OWHA 4CRAA 1DWCH 1SFQB 3EDXB 3M7TA 3RXUA 1MMJN 2A32A 4UFDH 2BD8A 2ALPA 3PV4A 4J1YA 1O31A 1GDUA 4K2YA 5I46H 1FLEE 1T8NA 2H9HA 2GCTB 1K21H 5CMXH 3FZZA 4TWYA 5PTPA 3W1EA 5CDFE 4HGCA 4NFFA 3ZZDA 2JDID 4NFEA 1O2XA 5EPYA 1F0SA 5T6DA 1BTPA 5C1XA 1O2MA 5GCHF 1D9IA 1QNJA 1CHOF 1LVYA 4IMQA 2CHAC 1Z1JA 3MH6A 1QJ1B 1Z8RA 2RDEA 2FOEA 4X8SH 1EASA 5E8EH 3BTHE 1AZZA 3FZDA 1QBNA 2P3FH 2BDHA 4AYVB 1SB1H 1V2UT 2ZQ1A 1OX1A 3KEEA 1H9LB 3VFEA 1ELBA 3RU4T 3C1KA 4DW2U 1K28D 2GGVB 3MTYA 3QTVH 5EG4A 1C5XB 1F5RA 1MUEB 3QDZB 5DPAA 2FS9A 2QF3A 5DP9A 3KIDU 3RXFA 3UOPA 2FO9A 3QZQA 4XRNA 2A5IA 2AYWA 3A81A 1P2MA 1TQ7B 1F0RA 5C1UA 2D26C 5AFZH 4E05H 1BBRE 2HLDD 2FXRA 1ORFA 4ZKRU 1GJ9B 2L74A 2F9OA 2OBQA 3RXIA 1FX0B 1LKAA 3AVZA 4WVPE 2A7CA 1BBRH 2GMTC 4X2WA 2FTMA 4Q63A 3H09A 3E91A 1N1LA 4O03A 2ANYA 3FO8D 1ELEE 1TX8A 2Q6GA 3TLOA 1ZGVA 3E90B 1UTPA 1COWD 1MTWA 1P10A 1V2TT 3ZZ3A 1MD8A 1YYY1 3S7HB 1L2EA 5EXNA 1WTGH 4CH8B 1OWDA 1UVUH 1UCYK 2O9QA 1MAYA 2P3UB 4LOYH 1BRAA 5GWZA 1AUJA 4IN1A 1A61H 4D7GA 4CHAC 3SNEA 3ZZ8A 5FL7D 5FXLA 4BTIB 1C5QA 3AAVA 4I33A 3M37A 2F9BH 1QFKH 1WV7H 1CVWH 1C5TA 1GI9B 1O2ZA 1S0QA 4X6OA 3Q00A 5A0BA 1C5MD 1KIGH 1OWIA 3ZZ7A 1GHWH 1JBUH 1LQEA 2BDCA 5EPNA 3MNXA 1C1NA 3N7OA 3BTTE 2BDGA 2IJD1 1P09A 2AHME 3BIUH 4WXVA 1EPTA 1CT4E 1FPCH 5EJ1A 4CRFA 1H8HD 2HRVA 3OFND 2J34A 3SN8A 2FOMB 2TRMA 1FJSA 2GV6A 5GXPA 2FYRA 2Y80A 2KCOA 4WMEA 3T26A 4Q2KA 3SI3H 2GX4A 2A0QB 2PV9B 3RLWH 3S0NA 2SNWA 1A3BH 2FODA 3PLBA 2OCVB 1VCQA 2YMSB 1ELVA 2F43B 1UTKA 1XXDA 1MABB 5A8YA 1E36B 1WU1A 4FUJA 3FOAA 2VH6A 1GJ5H 1ZHPA 5A0CA 1IQGA 3GOVB 1RRKA 2BQ7B 4YOJA 4Q7ZA 1WBGB 1MTNB 1EXFA 3GCOA 5E0HA 4DG4A 5EW2H 2V35A 1A0JA 1UK3A 1BITA 1TLDA 3TU7H 2P3TB 1SHYA 4X2XA 1HAIH 1QY6A 2VIQA 3UWJH 1C5VA 3F9EA 1SGCA 4FUFA 1UHBA 3BG4C 1OWKA 2JETC 1NFUA 2BVXH 1GI2A 2OINA 1OHHD 1ZZZA 2ZCLP 1YCPH 3O8DA 2P95A 4LZ4B 5JYIA 1ZYOA 3PMAB 1KLJH 1OP0A 3MU4A 4B73A 4TPIZ 1LVMA 2A5AA 4ZH8A 1SLWB 3TNTA 2JIZD 1BTUA 2F3CE 4AG2A 4Y71A 5C20A 4P02A 2IOTA 1Z6EA 3BEIB 3OSYA 1E79D 2PR3A 4FU8A 3LJJA 1ZSJA 2XBXA 1B7XB 2BD4A 3RXPA 3GCTG 2A31A 3MU0A 1MQ5A 1GHBG 1LQDB 3E1XB 8LPRA 2GCTC 9ESTA 4IGDA 4OS4A 4ABHA 2BD9A 3KQDA 4U2WA 4A7IB 2FLRH 2QXIA 4CRCA 4FVBA 1O37A 2QN5T 2ODPA 2XRCA 3GDVA 3MU5A 1UVSH 2ZP0H 3UTUH 1GMCF 2WYJA 2CMYA 4MPXA 4X1SU 4X6PA 2C8WB 2QV1A 2B9LA 3SI4H 1JIRA 1XVMA 5T6GA 1EP6A 5DSFA 1O32A 5F8ZA 3HK3B 2PKSB 1O39A 5IK2D 3RXEA 1O0DH 2AMQA 3TNSA 3RC6A 1AGJA 1G3DA 2QYIA 1V6DA 3RXTA 4UD9H 1SQRA 3SV9A 5E2OA 2BXUH 3QUMP 3W94A 4XOJA 1DWEH 2V3HH 4YLQH 1B0EA 4RKJB 3SOSA 2EI8A 3BTDE 1EJAA 1YY3A 1G37A 1VKYA 1TPAE 3NK8A 4P00A 3MH4A 1LPKB 1O3EA 1O3JA 2WSSD 1TX6A 1DFPA 1UO6A 5FPSA 4NIXA 1YCPK 2VJ1A 3SNAA 2ZGJA 2BYAX 4AORA 4THNH 4Y8XA 3VXEH 5F6MA 2G5VA 2P8OB 1GI0A 3VPKA 1LKBA 4D8NA 2QXHA 4XBCA 1RS0A 1SGPE 3A8BA 5GNDA 4RSPA 4I8HA 1BZXE 1NS3A 3KQEA 3SU0A 2Z3EA 2ZWLH 1ETTH 3GY4A 1KYNA 2C8ZB 4TT3D 1GHZA 3OE7D 1NRPH 2SFAA 5GIBA 3N99A 1VITF 1O34A 3D23A 2VVCA 3ZV9A 2JJ2D 4AZ2B 2KFWA 3FVFB 3GCTF 2KR7A 4YT6H 4AC9A 4MNVA 1P2OA 1P04A 1XMNB 1BTXA 2ZFRH 5FCKA 1F2SE 2O8WA 3A89A 1C2EA 4B71A 2LELA 2IPQX 1GCTB 3NUMA 2ZI2H 2PTNA 3DA9B 3BF6H 5I25A 3RXHA 1FPHH 4LZ1H 4ASHA 1AUTC 1QB6A 1JRTA 1MKWH 1O2RA 4Q7YA 1NZQH 2FP7B 2J98A 1QL9A 2BHGA 1TOCB 3T28A 3T25A 8GCHG 2ZFTA 3RU4E 1H1BA 1Q31A 2HALA 2GDEH 3M3VA 1E38B 1SQOA 1YWUA 1O2HA 1SLVB 5DP3A 4ASUD 1O2JA 4JK5A 2AEIH 3B8JA 1WYKA 2ZC9H 1O3AA 1C2KA 2YNAA 3AK5A 3RXVA 2ZHDA 4BNRA 3GY2A 3MH5A 2EEKA 4SGBE 2QAAA 5DP7A 4Y8YA 3M3SA 4QT8C 1GHVH 2YMSC 5C3NA 1G32B 4AGJA 1Z8GA 3BIVH 2ZO3H 1ANBA 4XFQA 1ZPCA 1W0YH 5FPYA 5FCRA 3VB4A 2GZ8A 1QGFA 2M2AA 1MTNC 3LGTA 3ZV8A 2FOBA 1QB9A 4Y0ZE 2FX4A 5KEDA 5HIZA 2ESTE 1GWAA 1YPMH 1Q2WA 2JKHA 3M36A 4AFZA 3RXAA 4DURA 5JBCS 1HJ9A 3W95A 2A1DB 1ZMNA 3KCGH 1TPOA 4H6SB 1C1QA 4ZROA 1BMLA 3OY5U 1XX9A 2STAE 3UWIA 1CA8B 3S9AA 3ATMA 3SJKA 4X8TH 4FETA 3Q3YA 4K1SA 3ZZAA 1YCPM 2BOKA 2XW9A 2ZKSA 2P16A 3JZ1B 2HOBA 2J92A 1NN6A 1ARBA 1EZQA 1Y3WA 2OTVA 3F3BA 8GCHF 4KP0A 3WW7A 3LGIA 2J95A 3TJNA 1PPGE 3A7YA 3AW0A 1SI5H 2OBOA 1DUEA 5G4BA 1AO5A 1GL1A 3SGAE 3UNSA 4Y6DA 2PKAA 2SGFE 2FI4E 3CS0A 2L6OA 2QIQA 3MOCA 4JCNA 4I8JA 3PMBB 1BB0B 4A1TA 4X6NA 4NGAH 2RA3A 1GBAA 1V2JT 1J17T 1IQEA 2BY9X 3GDSA 2A45B 2DUCA 5E2PA 1MKXK 1XVOA 1O3DA 1SVPA 4YT7H 2G81E 4FU9A 4NZLA 1K1JA 2O8UA 3SUFA 4NWKA 2Y7XA 3ZVGA 2PKSC 3P17H 1HAZB 2KX4A 4YM9A 5HMAA 3LONA 4BAKB 4Q7XA 1C9PA 1ELCA 5GPIB 2K0QA 1H8DH 4HZHA 1BJUA 1A0LA 2OLGA 3KQCA 1PQAA 2VIOA 1VITH 2ZFFH 3NZIA 1UHBB 1FY3A 1NU7B 1QIXB 3SO3A 4FXGH 1NY22 5L30H 1D3QB 1XUJA 1P2IA 4FUGA 3ODDA 2VINA 1AWHB 1KDQA 1TYNA 1FIZA 1C2LA 1C2DA 1ZMJA 1QURH 1E35B 1QRXA 3MNBA 2P8OC 4YOIA 1WSSH 2WHXA 2W3IA 4WXIA 3LT3A 1TMBH 4JZEH 3B23B 3F2FA 3QGJA 4CBOA 1EKBB 4WH6A 1ABJH 2A2QH 3RXMA 1K1PA 1TBQH 3KHVA 2F9NA 4MQAA 4ACAA 1HCGA 2VBCA 1TA6A 4DIHH 1TRMA 1SKYE 3FFGA 2WUCA 4BTTB 3N7EA 1O3CA 2RCEA 2ZGHA 1IQLA 4ABFA 6LPRA 4FOUC 3GY3A 3S9CA 3QO6A 1C4U2 3FP8E 1UK2A 1Z8IB 1BT7A 5C0UA 3SQHE 4DVAU 3TGKE 2QF5A 4X6MA 2OC0A 1V2LT 2PLXA 4I86A 3UNRA 1GCTC 2ZCKP 4X1NU 2BQ6B 1W3CA 4RKOB 3LIWA 1Y5UT 2V6NA 4FUEA 1FAKH 3M5LA 2WPJS 1V2WT 3ZVCA 1QQ4A 4AB9A 1TNKA 3F0PA 4OS2A 1VGCB 1G9IE 1O2YA 2RA0A 2FIRH 1LDTT 3K6YA 3ZVDA 4K1EA 2KAIA 1O3LA 2WPDD 2BLWA 1C5NH 4D7FA 1ZJDA 2WPHS 1ESAA 1AB9B 1ZHRA 5DGJA 3FP6E 1BRBE 1DS2E 2GT8A 1DE7H 1TGCA 1TE0A 1TWXB 1NRSH 2BY5X 4M7GA 1TMTH 2XOKD 1ARCA 3RM2H 1WAYB 1E37B 1SGQE 1BTHH 1S81A 4ABBA 3RXCA 2ZQ2A 1EX3A 1EJNA 1TBZH 3JZ2B 1Z71A 1BMMH 3H7OA 1UVTH 4X2YA 1YM0A 1O3PB 4KKDA 2H9TH 1P57B 2VWMA 4B2CA 2B8OH 1UTMA 1O2GH 5JB9S 3G01A 3M7UA 1TGSZ 1VZQH 1Y8TA 3SU1A 3PYHA 3OYPA 3EQ0H 1O3IA 3KF2A 2OQUA 3A86A 1NPMA 1Y5AT 1VR1H 1P12E 2F83A 2ZPSA 4BAHB 4AGKA 1J16A 1QRWA 1V3XA 2XNDD 1KY9A 1UCYE 4E7RG 1A1RA 1A5GH 4JZFH 5DP8A 1T8OA 2O8TA 2QF4A 1SGEE 2B7DH 1WDIA 1UCYH 4OS6A 2J98B 1GI7B 2QXGA 4MTBA 4BAMB 1W7XH 2ALVA 3A83A 2G00A 4XDEA 3UR9A 3PLKA 2NU3E 4YOGA 1AN1E 1SL3A 4Q4LA 3F9HA 1EPTC 1XUKA 2XCNA 1OPHB 3OTPA 1GMDG 1XM1A 4YLUA 3ZYEA 4YTAA 2JH6D 2WYGA 2TPIZ 1J15A 2WZQA 8KME2 2FX6A 1O2NA 4K3JA 3M3TA 3SYJA 2ZGBH 1K1IA 5JBTA 3U9AH 4FUBA 1O3KA 1AY6H 3LGWA 5DO4H 2ASUB 1DXWA 1GJ4H 2G52A 2Y7ZA 3SNDA 2ANKH 3VEQB 4NCYA 1C9TA 1EB2A 1HAHH 1SLXB 2FM2A 3LC5A 3F6UH 2VVVA 2QXJA 3SU3A 1BJVA 2JH0D 1C1RA 4AB8A 1B5GH 2ZECA 1DWDH 3SQEE 2ZGCA 1J14A 4AN7A 4O3TA 1KTSB 1TONA 2NWNA 3TK9A 1AVGH 3MI4A 4O9VA 5T6FA 3SU6A 5F8TA 1SGRE 1P3CA 1RTKA 1ETRH 1SQTA 1W13U 4ZUHA 1O2UA 1SGIB 4FUCA 2UWLA 1F0TA 4Y7AA 2BLVA 1GI8B 1QHRB 1AFEH 2DE8A 1P2JA 3O8RA 3UQOA 1VCPA 2KCPA 2J38A 2ZU1A 1FAXA 1FZZA 4IBLH 1FY5A 2B0FA 1A4WH 1GVKB 2G4UA 3SORA 1INCA 1CGHA 2AIQA 4AFUA 2A4OA 1TPPA 2GP9B 2Y5HA 4D76A 5L2YH 4H4FA 2G55A 1NO9H 4B76A 2KZ4A 1IAUA 2PGBB 1GMDF 2ZCHP 3E6PH 1DX5M 2PKAB 4NWLA 5B6LA 1ABIH 4YXWD 1L1JA 1NU9A 2Z9GA 3EA9A 3ODFA 3PRDA 4KELA 3DCLA 4CREA 1MU8B 1ESTA 3P8OA 3VB6A 4ZKNU 2WPMS 1L4DA 1YKTA 2ZU4A 3GCNA 3TH3H 5HIYA 3SU5A 1G36A 1O2QA 1E0FD 3QN7A 1T7CA 3U69H 4ABGA 5ETXA 3SUGA 3NKKA 1VGCC 1W12U 2BTCE 2ZU3A 1GBTA 1QTFA 5C5OA 2OC8A 1C5ZB 1UVOA 3KGPA 1FV9A 1LTOA 1C1VH 2QA9E 3T2NA 1G3EA 3LPRA 3BTQE 3GYLB 5EQRA 1TNJA 1B0FA 1GI4A 3TK6A 1AB9C 1W7GH 1HAVA 1KDQB 2VIWA 4MPWA 1C4V2 4MLFB 1K1NA 3GY8A 4IC6A 4HTCH 1BTWA 2YOLA 1SHHB 1Y3VA 1A5IA 1EAXA 2JJ1D 1P02A 1OSSA 3QWCH 2ZFQH 4I7YH 2ZHWH 1LHEH 2Y82A 5TCCA 5K0HA 2DE9A 1O35A 3MO3A 3K6ZA 3MFJA 1YPJH 2BM2A 3UUZA 2KCYA 4RT1A 4ZCNA 3BTFE 1O3GA 1TQ0B 2BD3A 3PV5A 5B6OA 1NFXA 4AFSA 3HPTB 5A8XA 3RC4A 3RXBA 2OQ5A 1MTSA 3TJOA 2GT7A 1EZXC 1Z1IA 2FEQH 2D1JA 2UUJB 3O8BA 2FDAA 3NXPA 1XUIA 3RC5A 2FZZA 1HNEE 1NROH 1NTPA 1VJ9U 1WTHD 2QF0A 4KGAA 1BMNH 5FBEA 1WUNH 1O2IA 1C5PA 3DT0H 1IQHA 1PQ7A 1HJAB 1ZPZA 4IN2A 2KAIB 1KMHB 1FUJA 2EC9H 2HNTF 3Q76A 4JZ1A 1MZDA 3MMGA 3GICB 1T8MA 1L0ZA 3S7KB 2J4IA 1HUTH 3SZNA 1PYTD 1C2MA 1ZMLA 2WPLS 3AASA 2Y5GA 2AMPA 4I8KA 2BD2A 4BXSA 4RN6A 3QLPH 1GJCB 1RGQA 2Z9IA 3A88A 2W5EA 3BG8A 3ATLA 3VB5A 1XXFA 2BVSH 3HGPA 2NU2E 4IS5A 1F5LA 3QTOH 3ZVBA 2CK3D 2GVFA 1O36A 1PPBH 4ZKSU 1G2LA 4A6LA 1XUGA 2F9PA 4TPYA 4A92A 1ZRKA 3F2HA 2ZDNA 3MYWA 3FANA 1KXBA 1KXFA 4ABAA 1IHSH 3LDXH 4MNXA 2VIPA 5ESBA 5DP5A 1K22H 5GJ4B 1V2PT 4Z6AH 5DKMA 2ZU2A 2ZEBA 5FX5A 1DLKB 1S6FA 2VGCB 3SU2A 1O33A 2TBSA 4KTUA 2FYQA 7GCHG 1BRCE 3KYFA 2QC2A 2BQWB 3TJVA 2EI7A 2UUFB 2FWWA 3HKJB 2W3KA 1F0UA 1GBEA 4MPVA 2ZU5A 1QBVH 1ESBA 1DICA 1GHBF 1EAWA 2GCHG 4I32A 2AGEX 1AHTH 3A8DA 2F9UA 3PTBA 5FAHA 5LH8A 4ESTE 4WY3A 1W2KH 2GZ7A 6ESTA 1O30A 2A7JA 4YZUA 2Q6FA 3F9GA 1LHFH 5SGAE 1GGDB 5L6NH 1VCWA 3K9XB 3LGUA 5AFYH 2Q1JA 1AKSA 4OGYA 4FUIA 4A1VA 1CO7E 1S82A 5EXLA 1TIOA 1RIWB 1GPZA 2ZHEH 1GJBB 3H7TA 1DOJA 5KGOA 4DOQA 1LMWB 4BXWA 3TIUA 1H4WA 3KQ5A 4Q80A 4ABEA 1FN6A 4ISIH 1KXCA 4GAWA 3NPSA 4O97A 2BDIA 3B9FH 3F9FA 1FMGA 5DP4A 1ANCA 1HAGE 3RMNH 4UFEH 3RDZA 1SGNE 1GJ6A 1QJ7B 2FOAA 1MKXH 1OKXA 1XUFA 2BD5A 1HRTH 1TBRH 1C5WB 1EP5A 2C93B 3TJUA 1EAUA 4WMDA 2HWLB 2Q6DA 1NBME 3KNXA 1H9HE 3A82A 3E0PB 3ESTA 7GCHF 5HM9A 3S69A 3SBKA 2ZFPH 5HKKD 1O3FA 1THSH 1TX7A 1CHGA 2WV4A 4A1XA 5A09A 1YPKH 1Y3XA 4WH8A 1EUFA 2ZDAH 1UTLM 7KMEH 5JPMH 4NSYA 2BLQA 1W11U 2GTBA 1HFDA 3A7XA 2UUKB 5CHAB 1O5AB 1N8OB 5F8XA 2C8YB 4MNWA 1PPHE 4GHQA 1NRRH 1DY9A 1CSOE 3U8TH 3GY6A 4AX9H 4NA8A 1SFIA 1SGYE 3I77A 4UEHH 3ZVEA 1ZTLA 1W14U 1W0ZU 3VG8A 5AVDA 4YO9A 3F68H 3FP7E 1DXPA 1EZSC 2HPQH 4HFPB 5C2ZA 2SGEE 1GI6A 2A7HA 3HATH 4ZXXH 3SW2B 3RU4D 4D9QA 1EPTB 1V2MT 2NU4E 2ZTXA 4LK4A 3LKWA 4JYUH 2GZ9A 1DUAA 3A80A 3PTNA 1W10U 2NU0E 1CE5A 2GKVE 2A2XH 1GL0E 2ZDVH 3DSOA 1HPGA 3T62A 1P01A 1AE5A 2FOGA 1HJAC 1S5SA 3HK6B 4TY6A 1Y3UA 3MWIU 1QL8A 1YBWA 1AQ7A 2IPHA 1O5FH 3PRBA 1YGCH 4SGAE 4U32A 4Y11E 1AVWA 5JB8S 1HAOH 2BZAA 4Y76A 1JWTA 1Z6JH 1FNIA 2IN2A 1L1GA 2PGQB 2CXVA 1DSUA 1O2OA 4CRBA 1E1RD 3ZZ6A 3FAOA 3M35A 5FBIA 1O3NA 2VWOA 1ZRBA 1P2QA 5ABWA 2AGIX 1K1MA 1YF4A 3AW1A 4DY7B 1KXDA 2BMGB 3QGNB 3RXQA 4B6FA 1DDJA 1T8LA 2I6SA 4Z0KA 6CHAB 1MQ6A 2PP6A 3MNCA 3D62A 1BCUH 2FLBH 3MO9A 1DT2A 1RFNA 1YC0A 5KECA 2K1QA 2XC0A 4TY7A 3PV2A 2GD4B 4KTSA 1GBJA 1QB1A 2G8TA 1F5KU 3PO1B 2VGCC 5AF9H 5TCAA 5IYTA 1QJ6B 3PM3A 4HG6A 4AYYB 1CQQA 2HNTC 4WF8A 1C5RA 1O2LA 5CHBA 3U98H 1D3TB 2AIPA 4X8VH 4ZHLU 2BVRH 2W7SA 1P9UA 4A5TS 1L4ZA 4IMZA 4Y0YE 1IQKA 1HAYB 3VB7A 2V3OH 4JZDH 1OWEA 3GY7A 1LPGB 2GJGA 3V13A 2PHBA 4INKA 3STIA 1X7AC 2EI6A 2HVXA 2XNIA 1TNGA 1QA0A 3CNRA 4GCHG 3SUEA 4WWYA 5EODA 1GGDC 3SJOA 1AI8H 1TMUH 1ID5H 5EU8A 1P8VC 4K5ZA 1TPSA 1IQJA 1C2GA 2XXLA 1AFQC 2W26A 4OS5A 1RIWC 1P0SH 1LPZB 1O3OA 1CGJE 3SV7A 2SGDE 2BY8X 5C94A 4B1TA 4Y7BA 2ZF0H 1KXEA 2KM0A 1G2MA 1P2NA 3SJ9A 5GDSH 7ESTE 1GJDB 3TITA 3A84A 1GCDA 3ATIA 2ZNKH 3RXJA 4BTUB 1O2KA 5GCHG 4J2YB 1DM4B 1CHOG 1TRYA 5C5NA 1GBHA 1AE8H 2R2WU 5HGGA 1H8ED 1WOFA 2G4TA 3ZYDA 2Z94A 2M5TA 4F4OC 1K1LA 4CRDA 1O2PA 2R0KA 4X0WU 1P9SA 1GHAG 3NRLA 3WWFA 1YLDA 5E0JA 1S6HA 2AGGX 1W0KD 3OEED 1E1QD 4OS7A 5C0TA 1HDTH 2WUBA 4OM9A 1TNHA 1V2RT 1FONA 1C1OA 2BB4A 4ABDA 1TABE 2OUAA 2H5DA 5CHAC 4RT0A 1N8OC 2CJIA 2Z9JA 1BOQA 3VGCB 1DLEA 3BN9A 1C1UH 1EAIA 3HKIB 3KL6A 3UAIC 1H9IE 1CGIE 3EE7A 1NESE 4XBDA 1NM6A 4H6TA 1AKSB 2ANMH 2B5TB 3SGQE 1EQ9A 4DCDA 2STBE 2TGDA 5LPEA 1UTJA 1ELFA 2R0LA 3SU4A 3V0XA 1Y3YA 4U01A 3NCLA 2BDAA 1GHXH 1O2WA 1SGDE 1NT1A 1FDPA 3ZZ5A 3MO6A 1TGTA 2AFQB 2IJOB 1T32A 1SC8U 3RXOA 1HIAA 1W8BH 3RXLA 1DITH 1AIXH 2W7UA 1H8IH 1A0HB 1ZR0A 3M7QA 5C17A 4B2BA 2A4RA 2CF8H 4IC5A 4LXBH 2WV9A 1CU1A 2Z7FE 3ZIAD 1PPFE 3U8OH 2HLCA 1GBLA 2FI5E 1S6LA 2H5CA 3GS9A 1SOTA 1GJ8B 1MTUA 4NA7A 1GHAF 4WJG2 1LVOA 2TIOA 3O8CA 2VIDA 2XWAA 3E3TA 3LGYA 2ILNA 1LHCH 3UPEA 1KLIH 2HGTH 5EJZA 5EW1H 1G3CA 1JOUB 4X8UH 5EXMA 1C5LH 1P06A 3DFJA 1OP2A 2OXSA 1GBMA 6CHAC 5BPEA 4F49A 3M5NA 1A7SA 1QR3E 3TH4H 4NG9H 1NFWA 2R3UA 1ANDA 1P11E 3SV6A 1F92A 2FTLE 1O3MA 1G3BA 3SHAH 4YESB 1YPHC 1QRZA 1PFXC 3PO1C 1A46H 3DUXH 1YPLH 4XE4A 4Y10E 3P95A 1PJPA 3F2GA 2BDYA 4CR5A 2ZFSA 9LPRA 1ZGIA 4INHA 3P92A 1C5YB 1MD7A 2FPZA 1SLUB 1UTOA 1KSNA 2VNTA 4XBBA 3K2UA 3DSPA 3PROA 6GCHG 3P8NA 1GVZA 3UY9A 4R0IA 1PQ5A 1GVLA 5DJ7A 1GI3A 1MAXA 2ZG0H 1RD3B 1XKBC 1WQVH 4K8BA 4O3UA 1LCYA 3V3MA 5A2MH 4FVDA 2SGQE 2D8WA 4OGXA 1D4PB 3LH3A 2W6JD 3L3TA 2P93A 3EGKH 3K65B 3ZVFA 1O5CB 1SSXA 3PWBA 1GBFA 3OEHD 4JZIA 2GV7A 1GI1A 1HV7A 1SGFA 3ZVAA 1QZ8A 1RTLA 3HGNA 2VWLA 1AWFH 2FS8A 4CR9A 1GBCA 1SMFE 2XCFA 2ZTYA 4ABJA 1T4VH 5EIYA 2C90B 2SNVA 2ZDKA 1OP8A 1ZTKA 2FI3E 1T31A 1AU8A 1GG6B 4JMYA 1QL7A 1MCVA 1FI8A 3BTWE 1TB6H 3ATWA 3GCHB 1GBKA 2JH5D 3Q77A 1YLNA 1C1PA 7LPRA 4TSFD 4ZMAH 1GMCG 3EA7A 4DGJA 2C8XB 3OY6U 1LHDH 3SUDA 2LNCA 1O2VA 3A87A 4RI0A 4BAOB 2A4QA 4ISOA 1FY4A 1O3HA 1THPB 2ZPRA 2PSXA 3BV9B 2G51A 1EATA 4KTCA 1BBRK 1FIWA 1O5BB 2CF9H 1F7ZA 1SPJA 1ELTA 3RUOA 3KN2A 3P8FA 4GVUA 1Y59T 3GY5A 1P05A 1HBTH 1C4Y2 1CA0B 3TH2H 2A5KA 5DN6D 1TA2A 1THRH 6GCHF 4AOQA 2F91A 2OC1A 1GDNA 1VJAU 3U1IB 4CBNA 2ZHFH 1SOZA 5CE1A 2KCAA 1BHXF 1V2QT 1P3EA 3A8AA 4JK6A 1T4UH 3VGCC 1D6RA 2PTCE 3PMJA 1QQUA 1SR5C 1AZ8A 4X1PU 4TYDA 1BMFD 2VWNA 3RM0H 2ZZUH 1AVXA 1XKAC 5H4IB 2VU8E 2UWPA 4VGCB 5LPFA 1VITG 2P59A 3CENA 1G30B 1RXPA 3L33A 1M9UA 5FX6A 2Y5FA 1V2VT 2AMDA 3T27A 2QCYA 1DWBH 1S0RA 2F9VA 4ZKOU 1DPOA 3U28C 2H6MA 4INLA 3AAUA 2Z3DA 1CBWB 1N6XA 3A85A 2PW8H 3MU8A 2THFB 4DIIH 1K2I1 4X1QU 3U1JB 5AHGH 1A3EH 2O8MA 2VVUA 3DHKH 1MU6B 4AFQA 3LH1A 1OYTH 1EB1H 1V2NT 4HI3A 3SV2H 1OYQA 1ELAA 1WXRA 1HXFH 3OAAD 4OS1A 1BHXB 2XBVA 1ANEA 3SJIA 5TJXA 3Q3KA 2BXTH 2I6QA 1FN8A 3QZRA 1C5UA 1BA8B 1QBOA 1BRUP 4BOHA 2Z6BD 2R2MB 3EAJA 5C1YA 3PLPA 2CN0H 1GI5A 1PYTC 1SGFG 4MG3A 3E16B 1HB0B 2PSYA 4U30A 3ELAH 1FQ3A 5E0GA 1ETSH 1BTYA 1DANH 4E7NA 1HAXB 1BUIA 4D9RA 2H2ZA 5F53A 3EE0B 1HJ8A 2ZIQH 3KYGA 1Y5BT 2EQNA 1NFYA 2HVYB 3GISB 2V7QD 5LPRA 3D49H 3ZZCA 1IQFA 5L2ZH 1BMAA 1OOKB 1K9OE 3C27B 3SV8A 2WV5A 1OWJA 4ISNA 3UR6A 3LOXA 2J2UA 4XD7D 1ZHMA 1SG8B 2TGTA 2AH4X 1Z7KA 2XC4A 3RMLH 4FU7A 1DVAH 1HIAB 1O38A 1C1MA 3ZZ4A 1TOMH 3VXFH 3U8RH 1AFQB 1MBQA 2G5NA 3MNSA 3RP2A 2ANWA 4F48B 5JDUB 3S9BA 2XBWA 3M5MA 3A7VA 3IG6B 1TGNA 2OP9A 3SHCH 2YMSD 1OXGA 3RLYH 3DD2H 2ODQA 1PPEE 3LGVA 3BEUA 2EY4C 1TALA 3UOUA 5EQQA 4ISHH 2ZA5A 1GBBA 1HXEH 2C4FH 2ZDMA 4GSOA 3UB0A 1S83A 3NWUA 1AMHA 4I8GA 3FN8A 3CP7A 2V0BA 1D6WA 2FOFA 5EQSA 5JBBS 2HPPH 4CH2B 1PPCE 3BEFB 1EOLA 1NRNH 1YLCA 4XSKU 2EA3A 4UE7H 2PWXA 3MU1A 1HGTH 1TGBA 1ZLRA 2A4GA 3RXKA 5C67A 1O5GH 3LJOA 1TAWA 1V2KT 1GG6C 3VB3A 2J5UA 1O2SA 3CS7A 2VH0A 2TGPZ 2Y81A 3GCHC 3ZZ9A 3UIRA 3TVJB 1UW7A 3TGIE 1EJMA 4ISLA 5FPTA 3TPIZ 2BX4A 2OC7A 4DT7B 4F55A 1ZOMA 1ZSLA
chains in the Genus database with same CATH topology
2ZTZA 5DG6A 2GCHF 3ATKA 4BANB 1QCPA 4NIVA 3MH7A 2VB0A 4MDSA 1JMOH 4ZHAA 2J94A 1XUHA 5DP6A 2HNTE 1A5HA 3STJA 5A8ZA 3BTEE 1PQ8A 2QGRA 4BAQB 4GHTA 3URCA 2PUXB 1RTFB 1UMAH 1QA7A 2BX3A 1IHTH 3BSQA 1CA0C 1SGTA 3EYDA 3H5CB 4NZQA 1MTVA 4WMFA 1TNLA 1P2KA 2FOCA 1YP9A 1LHGH 2J9NA 1NC6A 3RXGA 1C1WH 1EZUC 5EOKA 4ZXYH 1FXYA 1MCTA 3R0FA 1BTZA 1O2TA 1MKWK 1C2FA 4UDWH 3DFLA 2UUYA 2SGPE 3E0NB 2AERH 4FUHA 4VGCC 3V12A 4JYVH 5DK1A 1CT0E 3M61U 2FESH 2CHAB 4I31A 1LO6A 4B2AA 3A7WA 1L1NA 3T5FH 2RG3A 4IW4E 1D3PB 3SNCA 2BLOA 8ESTE 3LC3A 4MNYA 5EGMA 1HAVB 3ZZBA 3F1SB 1IQMA 3M5OA 3V7TA 3OX7U 3P8GA 2ULLA 1D3DB 1J9CH 4MVNA 3SGBE 3TK5A 1J8AA 3MHWU 1ZPBA 1S84A 1CBWC 1HYLA 1ELGA 3I78A 4H42U 3UQVA 4GUXA 1HLTH 5ESTE 1SBWA 4NIWA 3ENSB 2BY6X 2XC5A 3E8LA 3IITA 1N6YA 4E06H 1UTQA 2AS9A 2FOHA 1O5DH 3RXDA 4Y8ZA 3RMMH 1OS8A 1C2IA 1ZSKA 1BQYA 3A7TA 2GMTB 4B75A 4GLYA 4ZAEA 2BZ6H 5J4QA 3P6ZB 1GMHG 1FY1A 2D2DA 4I8LA 4MPUA 4JYTA 3SJ8A 3PWCA 2TGAA 3D65E 3RXSA 1UK4A 1V2ST 2R9PA 4TWWA 3OTJE 1A2CH 1MZAA 2SGAA 1GDQA 2H1UA 3T29A 2YNBA 3A8CA 1CT2E 2XTTB 4K60A 1BDAA 5F03A 3UREA 3PB1E 5J4SA 4CHAB 1MH0A 2WINI 4GPGA 1P03A 1Q3XA 5T3HA 2ZDLA 1WCZA 1TNIA 1O5EH 1SQAA 1YPEH 4UFFH 4AG1A 1C5SA 2Z9LA 2C3SA 2XWBI 2ZHQH 2WPKS 2ZGXH 3P70B 4X1RU 3QK1A 4B74A 1EOJA 1WQSA 1YPGH 1DY8A 1IQNA 3UNQA 3I29A 1DSTA 1GBDA 3WY8A 1C2HA 1KLTA 1NRQH 2OD3B 1GBIA 2PFEA 1RJXB 4ZHMU 1JXPA 4FUDA 5IDKA 3UFAA 2QY0B 2WPIS 1IQIA 5BRRE 1HAPH 2PUQH 3ITIA 1K1OA 2XBYA 3LU9B 3RMOH 1ZTJA 2XYAA 4DJZB 1Z8JB 2P94A 1UVPA 4NIYA 3EA8A 2CGAA 4R8TB 5JBAS 2BOHB 1KTTB 1PPZA 3KQBA 2Y6TA 3IWMA 1C2JA 3GYMA 3QX5H 4Y79A 3URDA 1O3BA 1V2OT 3PMHB 2BY7X 3L6PA 2ZPQA 1C1TA 2Z9KA 3TGJE 4NSVA 1UJ1A 4PROA 2H9EH 4K1TA 1GJ7B 1GMHF 1ELDE 3GDUA 1MBMA 1C5OH 1BIOA 1UTNA 3OU0A 5HM2A 3RXRA 4NA9H 1C1SA 1TFXA 1AD8H 1TRNA 1U6QA 2FMJA 5A0AE 3R3GB 2R3YA 2UWOA 4CRGA 1ACBE 4K69A 2BD7A 1E34B 1JRSA 1YPHE 3BG4B 1JIMA 2JETB 1FY8E 2RDLA 2GDDA 5HYOA 1GJAB 1LVBA 2O8LA 3Q3XA 1IOEA 3BTME 1KXAA 2BDBA 4K8YA 5HXFA 1GHYH 2VIVA 5LGOA 3BTKE 4UONA 5FHTA 4UFGH 4GCHF 1S85A 2LPRA 4X2VA 3A7ZA 1ZJKA 3SNBA 3BTGE 2Z3CA 2NU1E 2CV3A 4ABIA 5K7RA 2ODYB 1OWHA 4CRAA 1DWCH 1SFQB 3EDXB 3M7TA 3RXUA 1MMJN 2A32A 4UFDH 2BD8A 2ALPA 3PV4A 4J1YA 1O31A 1GDUA 4K2YA 5I46H 1FLEE 1T8NA 2H9HA 2GCTB 1K21H 5CMXH 3FZZA 4TWYA 5PTPA 4HGCA 4NFFA 3ZZDA 4NFEA 1O2XA 5EPYA 1F0SA 5T6DA 1BTPA 5C1XA 1O2MA 5GCHF 1D9IA 1QNJA 1CHOF 1LVYA 4IMQA 2CHAC 1Z1JA 3MH6A 1QJ1B 1Z8RA 4X8SH 2FOEA 1EASA 5E8EH 3BTHE 1AZZA 3FZDA 1QBNA 2P3FH 2BDHA 4AYVB 1SB1H 1V2UT 2ZQ1A 1OX1A 3KEEA 1H9LB 3VFEA 1ELBA 3RU4T 3C1KA 4DW2U 1K28D 2GGVB 3MTYA 3QTVH 5EG4A 1C5XB 1F5RA 1MUEB 3QDZB 5DPAA 2FS9A 2QF3A 5DP9A 3KIDU 3RXFA 3UOPA 2FO9A 3QZQA 2A5IA 2AYWA 3A81A 1P2MA 1TQ7B 1F0RA 5C1UA 2D26C 5AFZH 4E05H 1BBRE 2FXRA 1ORFA 4ZKRU 1GJ9B 2F9OA 2OBQA 3RXIA 1LKAA 3AVZA 4WVPE 2A7CA 1BBRH 2GMTC 4X2WA 2FTMA 3E91A 1N1LA 4O03A 2ANYA 1ELEE 1TX8A 2Q6GA 3TLOA 1ZGVA 3E90B 1UTPA 1MTWA 1P10A 1V2TT 3ZZ3A 1MD8A 1YYY1 3S7HB 1L2EA 5EXNA 1WTGH 4CH8B 1OWDA 1UVUH 1UCYK 2O9QA 1MAYA 2P3UB 4LOYH 1BRAA 5GWZA 1AUJA 4IN1A 1A61H 4D7GA 4CHAC 3SNEA 3ZZ8A 5FXLA 4BTIB 1C5QA 3AAVA 4I33A 3M37A 2F9BH 1QFKH 1WV7H 1CVWH 1C5TA 1GI9B 1O2ZA 1S0QA 4X6OA 3Q00A 5A0BA 1C5MD 1KIGH 1OWIA 3ZZ7A 1GHWH 1JBUH 1LQEA 2BDCA 5EPNA 3MNXA 1C1NA 3N7OA 3BTTE 2BDGA 3BIUH 1P09A 4WXVA 1EPTA 1CT4E 1FPCH 4CRFA 2HRVA 2J34A 3SN8A 2FOMB 2TRMA 1FJSA 2GV6A 5GXPA 2FYRA 2Y80A 4WMEA 3T26A 4Q2KA 3SI3H 2GX4A 2A0QB 2PV9B 3RLWH 3S0NA 2SNWA 1A3BH 2FODA 3PLBA 2OCVB 1VCQA 1ELVA 1UTKA 1XXDA 5A8YA 1E36B 1WU1A 4FUJA 2VH6A 1GJ5H 1ZHPA 5A0CA 1IQGA 3GOVB 1RRKA 2BQ7B 4YOJA 4Q7ZA 1WBGB 1MTNB 1EXFA 3GCOA 5E0HA 4DG4A 5EW2H 2V35A 1A0JA 1UK3A 1BITA 1TLDA 3TU7H 2P3TB 1SHYA 4X2XA 1HAIH 1QY6A 2VIQA 3UWJH 1C5VA 3F9EA 1SGCA 4FUFA 1UHBA 3BG4C 1OWKA 2JETC 1NFUA 2BVXH 1GI2A 2OINA 1ZZZA 2ZCLP 1YCPH 3O8DA 2P95A 4LZ4B 5JYIA 1ZYOA 3PMAB 1KLJH 1OP0A 3MU4A 4B73A 4TPIZ 1LVMA 2A5AA 4ZH8A 1SLWB 3TNTA 1BTUA 2F3CE 4AG2A 4Y71A 5C20A 2IOTA 1Z6EA 3BEIB 3OSYA 2PR3A 4FU8A 3LJJA 1ZSJA 2XBXA 1B7XB 2BD4A 3RXPA 3GCTG 2A31A 3MU0A 1MQ5A 1GHBG 1LQDB 3E1XB 8LPRA 2GCTC 9ESTA 4IGDA 4OS4A 4ABHA 2BD9A 3KQDA 4U2WA 4A7IB 2FLRH 2QXIA 4CRCA 4FVBA 1O37A 2QN5T 2ODPA 2XRCA 3GDVA 3MU5A 1UVSH 2ZP0H 3UTUH 1GMCF 2WYJA 2CMYA 4MPXA 4X1SU 4X6PA 2C8WB 2QV1A 2B9LA 3SI4H 1JIRA 1XVMA 5T6GA 1EP6A 1O32A 5F8ZA 3HK3B 2PKSB 1O39A 3RXEA 1O0DH 2AMQA 3TNSA 3RC6A 1AGJA 1G3DA 2QYIA 1V6DA 3RXTA 4UD9H 3SV9A 5E2OA 2BXUH 3QUMP 3W94A 4XOJA 1DWEH 2V3HH 4YLQH 1B0EA 4RKJB 3SOSA 2EI8A 3BTDE 1EJAA 1G37A 1TPAE 3NK8A 3MH4A 1LPKB 1O3EA 1O3JA 5FPSA 1TX6A 1DFPA 1UO6A 4NIXA 1YCPK 2VJ1A 3SNAA 2ZGJA 2BYAX 4AORA 4THNH 4Y8XA 3VXEH 5F6MA 2G5VA 2P8OB 1GI0A 3VPKA 1LKBA 4D8NA 2QXHA 4XBCA 1RS0A 1SGPE 3A8BA 4RSPA 4I8HA 1BZXE 1NS3A 3KQEA 3SU0A 2Z3EA 2ZWLH 1ETTH 3GY4A 1KYNA 2C8ZB 1GHZA 1NRPH 2SFAA 5GIBA 1VITF 1O34A 3D23A 2VVCA 3ZV9A 4AZ2B 3FVFB 3GCTF 4YT6H 4MNVA 1P2OA 1P04A 1XMNB 1BTXA 2ZFRH 5FCKA 1F2SE 2O8WA 3A89A 1C2EA 4B71A 3NUMA 1GCTB 2ZI2H 2PTNA 3DA9B 3BF6H 5I25A 3RXHA 1FPHH 4LZ1H 4ASHA 1AUTC 1QB6A 1JRTA 1MKWH 1O2RA 4Q7YA 1NZQH 2FP7B 1QL9A 2BHGA 1TOCB 3T28A 3T25A 8GCHG 2ZFTA 3RU4E 1H1BA 1Q31A 2HALA 2GDEH 3M3VA 1E38B 1SQOA 1O2HA 1SLVB 5DP3A 1O2JA 4JK5A 2AEIH 3B8JA 1WYKA 2ZC9H 1O3AA 1C2KA 2YNAA 3RXVA 2ZHDA 4BNRA 3GY2A 3MH5A 2EEKA 4SGBE 2QAAA 5DP7A 4Y8YA 3M3SA 4QT8C 1GHVH 5C3NA 1G32B 4AGJA 1Z8GA 3BIVH 2ZO3H 1ANBA 4XFQA 1ZPCA 1W0YH 5FPYA 5FCRA 3VB4A 2GZ8A 1QGFA 1MTNC 3LGTA 3ZV8A 2FOBA 1QB9A 4Y0ZE 2FX4A 2ESTE 1GWAA 1YPMH 1Q2WA 2JKHA 3M36A 4AFZA 3RXAA 4DURA 5JBCS 1HJ9A 3W95A 2A1DB 1ZMNA 3KCGH 1TPOA 4H6SB 1C1QA 4ZROA 1BMLA 3OY5U 1XX9A 2STAE 3UWIA 1CA8B 3S9AA 3ATMA 3SJKA 4X8TH 4K1SA 3Q3YA 3ZZAA 1YCPM 2BOKA 2XW9A 2ZKSA 2P16A 3JZ1B 2HOBA 2J92A 1NN6A 1ARBA 1EZQA 1Y3WA 2OTVA 8GCHF 4KP0A 3LGIA 2J95A 3TJNA 1PPGE 3A7YA 3AW0A 1SI5H 2OBOA 1DUEA 5G4BA 1AO5A 1GL1A 3SGAE 3UNSA 4Y6DA 2PKAA 2SGFE 2FI4E 3CS0A 2QIQA 3MOCA 4JCNA 4I8JA 3PMBB 1BB0B 4A1TA 4X6NA 4NGAH 2RA3A 1GBAA 1V2JT 1J17T 1IQEA 2BY9X 3GDSA 2A45B 2DUCA 5E2PA 1MKXK 1XVOA 1O3DA 1SVPA 4YT7H 2G81E 4FU9A 4NZLA 1K1JA 2O8UA 3SUFA 4NWKA 2Y7XA 3ZVGA 2PKSC 3P17H 1HAZB 4YM9A 5HMAA 3LONA 4BAKB 4Q7XA 1C9PA 1ELCA 5GPIB 1H8DH 4HZHA 1BJUA 1A0LA 2OLGA 3KQCA 1PQAA 2VIOA 1VITH 2ZFFH 3NZIA 1UHBB 1FY3A 1NU7B 1QIXB 3SO3A 4FXGH 1NY22 5L30H 1D3QB 1XUJA 1P2IA 4FUGA 3ODDA 2VINA 1AWHB 1KDQA 1TYNA 1FIZA 1C2LA 1C2DA 1ZMJA 1QURH 1E35B 1QRXA 3MNBA 2P8OC 4YOIA 1WSSH 2W3IA 4WXIA 3LT3A 1TMBH 4JZEH 3B23B 3QGJA 4CBOA 1EKBB 4WH6A 1ABJH 2A2QH 3RXMA 1K1PA 1TBQH 3KHVA 2F9NA 4MQAA 1HCGA 1TA6A 4DIHH 1TRMA 3FFGA 2WUCA 4BTTB 1O3CA 2RCEA 2ZGHA 1IQLA 4ABFA 6LPRA 3S9CA 3GY3A 3QO6A 1C4U2 3FP8E 1UK2A 1Z8IB 1BT7A 3SQHE 4DVAU 3TGKE 4X6MA 2OC0A 1V2LT 2PLXA 3UNRA 1GCTC 2ZCKP 4X1NU 2BQ6B 1W3CA 4RKOB 3LIWA 1Y5UT 2V6NA 4FUEA 1FAKH 3M5LA 2WPJS 1V2WT 3ZVCA 1QQ4A 4AB9A 1TNKA 4OS2A 1VGCB 1G9IE 1O2YA 2RA0A 2FIRH 1LDTT 3K6YA 3ZVDA 4K1EA 2KAIA 1O3LA 2BLWA 1C5NH 4D7FA 1ZJDA 2WPHS 1ESAA 1AB9B 1ZHRA 5DGJA 3FP6E 1BRBE 1DS2E 2GT8A 1DE7H 1TGCA 1TE0A 1TWXB 1NRSH 2BY5X 4M7GA 1TMTH 3RM2H 1ARCA 1WAYB 1E37B 1SGQE 1BTHH 1S81A 4ABBA 3RXCA 2ZQ2A 1EX3A 1EJNA 1TBZH 3JZ2B 1Z71A 1BMMH 3H7OA 1UVTH 4X2YA 1YM0A 1O3PB 4KKDA 2H9TH 1P57B 2VWMA 4B2CA 2B8OH 1UTMA 1O2GH 5JB9S 3G01A 3M7UA 1TGSZ 1VZQH 1Y8TA 3SU1A 3PYHA 3OYPA 3EQ0H 1O3IA 3KF2A 2OQUA 3A86A 1NPMA 1Y5AT 1VR1H 1P12E 2F83A 2ZPSA 4BAHB 4AGKA 1J16A 1QRWA 1V3XA 1KY9A 1UCYE 4E7RG 1A1RA 1A5GH 4JZFH 5DP8A 1T8OA 2O8TA 1SGEE 2B7DH 1UCYH 4OS6A 1GI7B 2QXGA 4MTBA 4BAMB 1W7XH 2ALVA 3A83A 2G00A 4XDEA 3UR9A 3PLKA 2NU3E 4YOGA 1AN1E 1SL3A 3F9HA 1EPTC 1XUKA 2XCNA 1OPHB 4YLUA 1GMDG 1XM1A 3ZYEA 4YTAA 2JH6D 2WYGA 2TPIZ 1J15A 8KME2 2FX6A 1O2NA 4K3JA 3M3TA 2ZGBH 1K1IA 5JBTA 3U9AH 4FUBA 1O3KA 1AY6H 3LGWA 5DO4H 2ASUB 1DXWA 1GJ4H 2G52A 2Y7ZA 3SNDA 2ANKH 3VEQB 4NCYA 1C9TA 1EB2A 1HAHH 1SLXB 2FM2A 3LC5A 3F6UH 2VVVA 2QXJA 3SU3A 1BJVA 2JH0D 1C1RA 4AB8A 1B5GH 2ZECA 1DWDH 3SQEE 2ZGCA 1J14A