1E36B

Porcine pancreatic elastase complexed with (3s, 4s)n-para-nitrobenzenesulphonyl -3-ethyl-4-(carboxylic acid)pyrrolidin-2-one
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE
publication title 'Ph-Jump' Crystallographic Analyses of Gamma-Lactam-Porcine Pancreatic Elastase Complexes
pubmed doi rcsb
molecule tags Hydrolase(serine protease)
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2000-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1e36B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1e36B01
4U2WA 3UOPA 1NESE 1WQSA 1GMDF 3UTUH 1KXFA 1O39A 1GI0A 2A7JA 4NA9H 2ANYA 5AFYH 4R8TB 4ZHMU 4ZH8A 2QGRA 3MI4A 1GJ7B 1A7SA 5TCCA 1GCTB 2OD3B 1P2NA 3Q3XA 3BIVH 1OWEA 2O8LA 1GJCB 5AHGH 1CQQA 3VFEA 2WV5A 2SGDE 5I25A 1YF4A 2FM2A 4SGBE 1KDQB 2GDEH 3AAUA 3U69H 3KHVA 1P10A 2GCHF 2GMTB 2QN5T 1JBUH 1AQ7A 3MOCA 1ETTH 5H4IB 2G5NA 1SMFE 3NCLA 4RKOB 2OUAA 3M7TA 2UUKB 1O32A 1NRRH 4KP0A 4MQAA 3MH5A 4AFUA 1QQ4A 4FUDA 4ABEA 1ZTKA 1GHZA 4MNVA 3UREA 2R2MB 2GCTC 3UIRA 1MZAA 1W11U 5A0AE 1IQHA 2G51A 2V35A 4X8VH 1MKXK 5LPEA 2PW8H 1EPTA 3LIWA 3KN2A 4CH8B 2PHBA 1C2GA 2PSXA 5GDSH 1YP9A 3RMMH 1HGTH 2WPLS 3AVZA 1SLUB 1EAWA 1GGDC 1A61H 4E05H 1QL8A 2AEIH 1O36A 3F68H 1T4UH 1Y3WA 3I29A 1GHXH 1GI9B 4ESTE 1LTOA 1N8OC 1DXWA 3ZZ3A 1DY9A 3FZZA 1A5GH 3MYWA 1MCVA 4NSYA 3NPSA 2F9VA 3TH4H 1IQFA 4OS6A 1ZPCA 1YGCH 5A8XA 2K1QA 1DY8A 1SC8U 1K1JA 2QF3A 1UHBA 1VCPA 3GDVA 3OSYA 4DG4A 1W10U 1XUFA 2JH0D 1UTMA 2NU4E 2TIOA 2W26A 1HJ9A 1TE0A 3GY3A 3GY4A 1SGCA 1C2HA 1C4Y2 4KGAA 1AMHA 2ODYB 1GJAB 3TIUA 4TY7A 1GHBG 2JETB 2ZDNA 2A4GA 2FPZA 1V3XA 1VGCB 2PKSC 1W8BH 3LGUA 2Q6DA 1ELDE 4WMEA 1C5PA 5GCHF 2R3YA 3BN9A 4I32A 4I8HA 4WWYA 1W2KH 1MU8B 4NZLA 1B5GH 1YPHC 2SGPE 1NM6A 3M3SA 1AZ8A 1GDNA 2QXGA 4XBBA 1HRTH 1LVBA 1W3CA 4NA7A 2GZ7A 2V3OH 1FONA 1FY4A 5EW1H 1C4U2 4I8JA 3A89A 1V2RT 1EOJA 1P3CA 4MPXA 5JDUB 3VB5A 1P02A 4K1SA 1MTVA 1CA8B 1BZXE 4H6SB 4ABAA 5J4QA 1GI5A 4B74A 4B76A 1EQ9A 2UUJB 3D62A 1V2LT 3RXFA 3T62A 3T26A 1QJ1B 2QF0A 2ZECA 2BLWA 1O3JA 4IC6A 2VWOA 3TJNA 2XNIA 1BHXB 1EXFA 3P17H 3U98H 3QGJA 3V3MA 3GICB 1W7GH 2PUQH 2ZA5A 1RTLA 2FXRA 5T6DA 1THSH 1W12U 1UTLM 1KDQA 4X2WA 1BTHH 2D1JA 2VU8E 1L1NA 2CGAA 3MFJA 2BLVA 1QY6A 1F5LA 4DIIH 1GJ9B 4FU9A 3TGJE 4A1TA 4J2YB 5ESTE 2BY9X 4YOIA 4BNRA 1YPJH 1O3BA 1QBNA 2BD9A 5T3HA 4DOQA 2O8UA 3SNCA 3TJVA 1MU6B 2G8TA 2P3FH 1H9IE 1KXCA 2TGDA 1QB1A 1WCZA 3SJ8A 1TYNA 3SV6A 3QGNB 3O8CA 1A0JA 2VGCC 1THRH 3EQ0H 5A0BA 2R3UA 1MTSA 5EXMA 3UQOA 3D23A 6CHAC 2FX4A 2XTTB 3FP7E 4AYVB 2PFEA 1DE7H 1P2IA 3BEUA 1JRSA 1KYNA 5A2MH 1AFQB 2BVXH 5FPSA 3NZIA 1FQ3A 3TLOA 3A88A 1O3LA 1V2PT 3KL6A 2VIWA 1MTNB 2BMGB 3ZZ8A 5FPYA 4X1QU 2ZDAH 1EPTC 3A7WA 3SNBA 2C3SA 3ODDA 1W0YH 1QRZA 2BQWB 1C2JA 1EJMA 4HGCA 9ESTA 2VINA 2ZDKA 2XBXA 1RTKA 4D8NA 5HM2A 5L30H 1BMAA 1F92A 3SQHE 1H8IH 2J92A 1Y3UA 1NO9H 1C5VA 4AGKA 1BBRH 2A5KA 3MHWU 3DA9B 2Q1JA 4O9VA 1YCPM 3FP8E 1Z8IB 1DT2A 3MNCA 1YBWA 1G3DA 1QIXB 5A09A 3MO9A 1RTFB 1NPMA 2RA0A 1LKAA 3RUOA 2HNTE 1GHBF 2ANMH 4XFQA 1QBOA 2Z9IA 3A7ZA 1SSXA 6GCHG 1WBGB 4XBCA 1SL3A 1NFWA 2WPKS 2ZWLH 4BXWA 1OSSA 3QK1A 3O8DA 1GL0E 1HXEH 3EYDA 1KIGH 1TIOA 2OC8A 5DP7A 2P16A 3GDUA 3O8BA 2FTMA 2D26C 1QL7A 1O3AA 3RLYH 3MU5A 3F1SB 1WV7H 5FPTA 1HAGE 1S84A 1EAUA 3SNDA 3M37A 3GCNA 2CXVA 2HALA 2J38A 1A3EH 1QJ6B 3DHKH 3SGAE 1TNIA 1EZXC 3QDZB 3ZYEA 1F5RA 4K1EA 5PTPA 1HYLA 4Y8ZA 2ZNKH 1SGIB 2H2ZA 4MDSA 2C8YB 4ZUHA 1EKBB 1TX6A 1CT0E 3T5FH 1FY3A 1O2LA 1YPEH 4ZKNU 1IHTH 4AB8A 2ZU3A 1ZZZA 3KF2A 1EZUC 1C1MA 2ZGJA 1P57B 3H7OA 5G4BA 1H1BA 1TPOA 1AHTH 1C2DA 3ZVGA 1FLEE 1MBMA 7KMEH 3LT3A 3D49H 2GP9B 1TMTH 2SFAA 4NFEA 1YPKH 3M61U 4AFZA 1CA0C 1FMGA 1IQLA 3SGBE 2QCYA 2IPHA 2Z9KA 1ZMNA 1AD8H 1C1QA 4NG9H 4FUCA 4ZROA 2BDBA 5TJXA 1TA2A 2BY6X 5JB8S 5HGGA 4B75A 2ODPA 5EGMA 1DFPA 3S7HB 2BQ7B 1V2KT 1ZTLA 5IDKA 2HVXA 4IC5A 2ZHFH 2Z94A 1RGQA 3OY5U 1BRAA 1GCTC 4ZAEA 1PQAA 2FOHA 1D6WA 1RJXB 2J94A 2Y7ZA 3S9AA 4X8TH 5K0HA 1FI8A 1V2JT 1FIWA 1LCYA 3K6ZA 4LOYH 4UFEH 1QJ7B 4GHTA 4INLA 1GI6A 4HFPB 3SJOA 2GMTC 1AVXA 4FXGH 1HAVA 4ISHH 1EAIA 3RXRA 1MMJN 1VR1H 5EXNA 2FS9A 1FN6A 1P9SA 4ABGA 1KXBA 3SN8A 2A5IA 4AFSA 4AOQA 1C5SA 4Q80A 1SLVB 1NFYA 1J14A 4ABJA 2ANKH 1AO5A 2ILNA 2R2WU 4YO9A 3GY5A 3HKIB 2F9PA 5JBAS 2OC7A 1NROH 1TGTA 4AX9H 1BTPA 2BLOA 3SV7A 1FPCH 5DPAA 1UMAH 2BVSH 4IBLH 2CN0H 1T8LA 3RMOH 2TBSA 1O5BB 4Y8XA 1OWHA 1G3EA 3E0NB 4R0IA 2PKAB 3UNQA 4QT8C 2YOLA 1MKWH 4GVUA 2C93B 2FOBA 1L4ZA 1F0UA 1TFXA 1P2JA 2R0LA 1BIOA 3HKJB 2A4RA 1TGCA 2XRCA 2NU2E 2UUYA 2A32A 1FY8E 3TGIE 3HGNA 3ZZ9A 1C5MD 1OWJA 1HDTH 1ZRBA 1FAKH 4BXSA 4WVPE 2GKVE 5JBBS 1J8AA 3SU2A 1A5IA 1C2IA 4AORA 1C1TA 1EAXA 1AFEH 1UCYE 2J34A 1C2FA 4U30A 3BG8A 5EPYA 1F0SA 5DP8A 2PR3A 1G36A 2FTLE 2FI4E 2HPPH 1SGFA 3ZVDA 1P03A 4X2XA 3VB3A 1CHOG 4I7YH 3E6PH 1OWIA 4RN6A 3ZZAA 6GCHF 4NGAH 1EUFA 1ABIH 2NU1E 2GZ8A 3QUMP 2ZHEH 3ZYDA 3RM2H 4CBNA 4A1VA 3TJOA 3VB6A 3GY2A 1XX9A 2JETC 1C2MA 3NK8A 1ELEE 1ZPZA 1PPGE 1VGCC 2J2UA 3SNAA 2FZZA 1LPKB 5E8EH 1O3KA 1BTZA 1LVOA 5CMXH 5J4SA 1HPGA 1V2WT 1IQKA 2AGEX 3LJOA 2ZFFH 1EJAA 1PPCE 4ZHAA 1YPGH 4FVDA 5CE1A 2F9OA 2FIRH 1O3EA 3K9XB 5DP4A 3LGIA 1P2OA 1HAHH 2WPIS 1TMUH 2QY0B 4MNYA 2YNBA 3UNSA 3ZVFA 1GJ6A 1C2EA 1O2OA 1TMBH 1UTOA 1JRTA 1TNKA 5DP3A 5GCHG 5DP6A 2GGVB 1QA0A 4K8YA 4TY6A 4DGJA 3QTVH 4JCNA 2ZGHA 2OC0A 2G5VA 3KQDA 1IAUA 3U9AH 5LPRA 1UVTH 1TBRH 1C5YB 2F9UA 2VVUA 7ESTE 4IMQA 2AGGX 3BTTE 4LZ1H 5CHAB 3MU4A 4CRDA 1C9PA 3RU4D 1V2ST 2BY5X 4OS2A 5K7RA 2D8WA 3OY6U 1TQ0B 3A7XA 1TGBA 3B23B 1ESBA 4KTUA 5DP5A 1EZSC 4X8UH 1MKWK 1O3PB 1IOEA 2OC1A 3URDA 3RXVA 2A1DB 4GSOA 1G2MA 1O2ZA 1CSOE 3A7TA 1VITG 3PO1B 1KXDA 2C8WB 1QNJA 1JIRA 3RMLH 2BOHB 1ZTJA 4HTCH 2C8XB 3RXEA 2QXIA 3PMJA 5FBIA 1QTFA 1ANCA 3HK3B 2AS9A 1V2OT 3BEFB 1LQEA 3TVJB 2M5TA 1YPMH 1DVAH 2BB4A 1SI5H 1A4WH 3CS0A 2ALVA 3RC6A 1DDJA 1E36B 3MH4A 1BMMH 2TGPZ 3RMNH 2BDIA 3MNSA 1NN6A 4TWWA 4PROA 1K28D 1GCDA 3M36A 1B0FA 2ULLA 3RXOA 2EEKA 1PPZA 1BTWA 1HXFH 1LVYA 1C5QA 1UK2A 1LHCH 2FOFA 3PMHB 3A8DA 1GJ5H 5B6OA 1AFQC 3SJKA 3TNSA 1VJAU 3QWCH 2BX3A 2A2XH 2G55A 4AGJA 1HAOH 2ALPA 2VWLA 2KAIA 2VH6A 4AN7A 1PFXC 1MTNC 3E0PB 2TPIZ 1VCQA 3PMAB 2STAE 1RRKA 1Z1JA 3LOXA 2AERH 1O2QA 3URCA 1ZJKA 3SHCH 3BF6H 4K69A 5DJ7A 3MO6A 1LHDH 1J17T 1ELVA 3HATH 2WPMS 1BTUA 1SGFG 1MUEB 2AFQB 2BVRH 1UO6A 4GAWA 3SJ9A 3A83A 4IW4E 4IGDA 3UQVA 4X1NU 4JZDH 4MPVA 1O5CB 1CHOF 1G9IE 4A6LA 3U8TH 4YT6H 1QBVH 1O2GH 1G30B 1KLJH 4KTSA 1DS2E 2FOMB 1YLCA 4UFGH 5I46H 3QX5H 3WY8A 1SLWB 1P04A 3GYMA 1E34B 1O3IA 3C27B 3ENSB 3SU6A 3S7KB 2I6QA 1DITH 2BQ6B 1AE5A 5FCKA 1MQ5A 2VWNA 3HK6B 1BMNH 4BAKB 1MAYA 1QHRB 1AU8A 1UTPA 2GT8A 1Y3VA 3T28A 5E0JA 4FUEA 1BCUH 1C9TA 4OS1A 4TWYA 1X7AC 3ZZBA 1DWBH 4DCDA 4FUGA 2I6SA 1BHXF 2NU3E 1O38A 3RXCA 4X8SH 1E35B 1Y3YA 4IN1A 2SGFE 4K2YA 4BTIB 1P01A 1PYTD 2VIVA 2ZPRA 3BIUH 1VZQH 3RXSA 2ZFTA 3PLBA 4Y7AA 2PUXB 3KQEA 3CP7A 1D3DB 2PSYA 2Y7XA 5A8YA 3Q77A 3GY7A 1C5ZB 2PTCE 3O8RA 1D6RA 3L6PA 1CBWB 4AG1A 2R9PA 1YKTA 4Y7BA 3TPIZ 1GI8B 1AIXH 1VITH 3Q00A 2FMJA 3SV2H 3MMGA 1TPPA 3HGPA 1OKXA 4TPYA 2FLRH 2Y5FA 4ZXYH 1NS3A 1Y5AT 2BY7X 4I8LA 4CRAA 2EI8A 5FBEA 3ZZ6A 1VITF 3M5OA 3STJA 3PMBB 1A0HB 3A7YA 2VVCA 1UK4A 1JMOH 1CGIE 1ZGVA 2BXTH 2BHGA 2FOAA 1MAXA 4NIWA 1ORFA 2JKHA 4UEHH 5E0HA 3E8LA 1DOJA 5F6MA 1KTTB 3EGKH 3KGPA 1WTGH 1N6XA 1V2UT 1HLTH 2XWBI 4UD9H 1XKAC 2OINA 1WYKA 1OP2A 1UVOA 1XUHA 3F9FA 2BXUH 1GBMA 4MVNA 2CF8H 2THFB 4UDWH 2OQ5A 3ATKA 4NCYA 1HJ8A 1O0DH 2G00A 2O8WA 2ZZUH 1YM0A 1O2WA 1N6YA 1V2NT 1BOQA 1SB1H 1UTKA 1BQYA 1TNLA 2XYAA 1QA7A 1BT7A 3TNTA 2AH4X 4Y79A 4DIHH 3TITA 1P12E 1D4PB 2LPRA 4UE7H 4OGYA 3PTNA 1LPGB 2BD3A 2VVVA 2ZHDA 2WPHS 1GBLA 1P06A 1DSTA 2NWNA 4WJG2 3AW1A 4A92A 2A4OA 1EP6A 1ZOMA 2O8TA 1Q2WA 1RIWB 2R0KA 1HJAB 3E91A 3UR6A 2XC0A 5C1YA 1GHYH 1KY9A 2V0BA 4ZKSU 2GV7A 1CGJE 1U6QA 3A85A 3U1IB 2ZFSA 3GOVB 3E3TA 4WXIA 1C1OA 1O5DH 1XVMA 4DT7B 4WF8A 3EA9A 1ZGIA 2GD4B 1ZLRA 3GDSA 2XC5A 1BJUA 1SG8B 1GMCG 1ARCA 1ELFA 3KNXA 1GJ8B 3E16B 5F8XA 3MWIU 2QA9E 2XBVA 1HAYB 3P8OA 2HGTH 5DGJA 4D7GA 4JYUH 1P2MA 3KCGH 1KTSB 4GCHG 3VXEH 3T27A 4AZ2B 1D3QB 1O2RA 4D9QA 4OGXA 1GBHA 1CT2E 1OOKB 2CMYA 4BOHA 4Y76A 3ODFA 1C5LH 5FX6A 5L2ZH 1O5GH 3MNXA 3FVFB 1P9UA 2A45B 3V13A 1O3MA 3GY6A 3SW2B 2VNTA 1EB2A 1XUKA 5ESBA 4CRFA 2HWLB 2FI5E 2A7HA 1BUIA 1IQEA 1G3BA 2WUCA 2BOKA 2H6MA 4X6PA 1UTNA 2Y81A 4X6MA 2ZTYA 1V6DA 1LO6A 1SFQB 2UWOA 4X2YA 1ZPBA 3JZ1B 2Z3DA 1GBTA 4NSVA 4FUJA 3RU4T 4D76A 2XBWA 3RM0H 1AI8H 2GV6A 1FN8A 3SV9A 1AGJA 3OYPA 1AN1E 3LJJA 1OYTH 1C4V2 1TX8A 2ZGCA 3ZVEA 3KQBA 4FU8A 1O33A 2UWPA 2UUFB 2XCNA 4WY3A 3RDZA 3VXFH 1HCGA 3GYLB 2ZFRH 5HYOA 3MTYA 3K6YA 2Z9LA 2Z3EA 3SO3A 4VGCB 5EQQA 2QIQA 2RDLA 4JYTA 3STIA 3V0XA 3A7VA 1S6FA 3LKWA 5EODA 3MO3A 2VWMA 1WTHD 2ESTE 1IQJA 3TK6A 4ABBA 1O35A 1Y5UT 3QLPH 1IQNA 1ELGA 5CHAC 1TQ7B 1O3GA 1H9HE 3BTDE 4Q7YA 1SHHB 1QQUA 4CH2B 1S6HA 4JZFH 1GVZA 1FPHH 2A5AA 3LH1A 1WAYB 1YLDA 1ETRH 3SUGA 3T2NA 3LPRA 2BD4A 2J95A 5A8ZA 1CVWH 4ABHA 2BLQA 3PB1E 2XCFA 1W14U 3NKKA 3RP2A 1MH0A 5DG6A 3M35A 3VEQB 2BDCA 3P8NA 3A81A 4I33A 1ZMLA 3PO1C 2CHAB 3SU5A 2H9EH 3UOUA 1B7XB 2RCEA 2FX6A 1O2PA 5EQSA 2ZGXH 3SU4A 3VGCB 4CRBA 1MCTA 3OU0A 5LH8A 1SGPE 2PGQB 4GLYA 3SHAH 3ZZ4A 1GI1A 1G2LA 2FOCA 4BTTB 3NWUA 2GX4A 3PWCA 1E37B 4K5ZA 1K1IA 3M7QA 2SNWA 3ATMA 2HOBA 2FODA 2OLGA 1AVWA 1HIAB 3RXUA 3V7TA 1LHEH 1PQ8A 1UTQA 3RXJA 2V3HH 2H1UA 4X6OA 5BRRE 2HNTC 2Y5GA 1O5AB 1YYY1 3FP6E 4D9RA 1DLEA 4E7NA 2AIPA 3A87A 1Y5BT 2GVFA 4M7GA 2FWWA 3AAVA 1IQMA 1S83A 2ZG0H 2V6NA 4YT7H 2DE8A 1BBRK 4GHQA 4B71A 5DP9A 1A3BH 2RA3A 2GT7A 3BTHE 2ZDLA 3F9GA 1HAZB 2BYAX 3RXAA 1OXGA 2YNAA 4A1XA 1FUJA 1C5XB 1V2MT 2H5CA 3UR9A 3LONA 3P8FA 2D2DA 4YESB 3BG4B 2Q6FA 1AY6H 3PV4A 2A0QB 1GMCF 5LGOA 1Z7KA 1SQTA 3RXHA 1O2XA 3UUZA 1K1LA 7LPRA 1C5TA 2ZO3H 1PJPA 1FAXA 1BTXA 3ZZ7A 3A86A 1ZHRA 2QC2A 1ABJH 4GCHF 5C3NA 1SGEE 1F7ZA 4MNXA 4Y71A 1OP8A 2F91A 1SFIA 1O30A 1GI3A 3GCHB 5GXPA 2A2QH 1DLKB 3LGTA 1GJDB 4OS7A 1TWXB 2UWLA 2Q6GA 1T4VH 1ZSJA 1O3NA 1GG6B 1GVLA 1GHAG 3FFGA 2P94A 1T8OA 3L3TA 1ZJDA 3AW0A 2A4QA 1GMHG 1AKSB 3QN7A 2ZU2A 1JIMA 2G52A 4Q7XA 1QR3E 2ZGBH 4Y8YA 1PPHE 1L1JA 1TOMH 4JK5A 1XM1A 2Z9GA 4DVAU 3G01A 5ABWA 4Z6AH 9LPRA 2ZEBA 4H42U 2P3TB 5EXLA 1GVKB 4OS4A 1EP5A 3TH3H 1SHYA 1GBKA 1BRCE 4YLQH 1V2TT 3VB7A 4HZHA 1AUTC 3I78A 4AFQA 1XXDA 3UPEA 1AE8H 2IN2A 1ELAA 1GI7B 3PWBA 2TGTA 1T8MA 1C1NA 3AASA 2ZFQH 2BDAA 5EG4A 2SGAA 3RXLA 1GL1A 1GPZA 1NRQH 4OS5A 1XUIA 3SU0A 1YPLH 3RXBA 1WUNH 1OP0A 1TBZH 3SOSA 1E38B 4Q7ZA 1GHVH 1GBIA 3RC5A 3RXDA 1CO7E 3SU1A 4TYDA 3S9BA 3FANA 3RXKA 2ZIQH 4IS5A 3P95A 3F9EA 8GCHG 5EPNA 3EDXB 4K3JA 4AYYB 1CBWC 2XW9A 4CR5A 1K1MA 3Q3YA 1O2UA 4K8BA 4B1TA 3DT0H 5AVDA 4WH8A 1TALA 1QRXA 4DW2U 1W0ZU 3S69A 1WQVH 1SGDE 2BDGA 3UWJH 5DKMA 1AUJA 1QURH 1TAWA 1L2EA 2PV9B 2VIDA 4K1TA 1C1SA 3SNEA 1AWHB 2HNTF 1LQDB 2JH6D 1LKBA 1XKBC 2BD5A 5FHTA 3A80A 2FP7B 1SVPA 1GBAA 2O9QA 1NRNH 1L4DA 5F8TA 1ELCA 3PYHA 1XVOA 1C1VH 1EX3A 3KEEA 3ZVBA 2ZCHP 5GWZA 1JXPA 1DANH 1XXFA 3IITA 6LPRA 3P8GA 5SGAE 4JYVH 2FO9A 2FEQH 3V12A 1K1OA 1XUGA 1LHGH 2BM2A 3P6ZB 3KIDU 1TONA 5C5OA 1TX7A 4X0WU 5A0CA 3U8OH 4E06H 1C5NH 1DWCH 4JK6A 2QXJA 1DPOA 1TLDA 3EE0B 2F83A 5F8ZA 2RG3A 4NIXA 5FCRA 2F9NA 4MNWA 1Q31A 3RLWH 1OYQA 2EA3A 4AB9A 3QZQA 2ZU1A 5FX5A 2FYQA 1QGFA 1QCPA 3LH3A 1CT4E 3D65E 4F49A 1RIWC 1HFDA 2ZP0H 4BAOB 1HJAC 1AWFH 2PKAA 2BD2A 2VIQA 4LXBH 1TPSA 1SOTA 2WYGA 2ZU5A 3UWIA 3VPKA 2G81E 1A5HA 1LPZB 3T29A 1ZHPA 5GJ4B 3TK9A 5L6NH 3DFJA 1LHFH 1M9UA 3FZDA 1O2NA 1Y8TA 4LK4A 2XBYA 5EW2H 5TCAA 1BDAA 3U8RH 1TNHA 1AKSA 2VJ1A 2B7DH 1P8VC 5E2OA 3QO6A 3NXPA 4XOJA 1GHAF 3ATLA 2W5EA 1K22H 2OTVA 1C1UH 1GMHF 1Z8RA 2AGIX 4JZ1A 4YLUA 1UVPA 4BTUB 1TPAE 3RXTA 1MQ6A 1YPHE 4BAHB 1TRMA 2SGQE 1C2KA 1BBRE 5BPEA 1DWEH 3SZNA 2DE9A 1IQIA 1FJSA 1NRPH 1O2JA 3ZZ5A 1O5EH 1TNJA 1SGQE 3FAOA 4E7RG 2H9HA 3PLPA 4Q2KA 4YTAA 2IJOB 3LGVA 2B9LA 2LNCA 3SV8A 1C5WB 3Q76A 2ZDVH 1QL9A 2BY8X 1S82A 4I8GA 3EAJA 3ZV9A 1LVMA 5DK1A 5HMAA 1DSUA 2XXLA 2Z7FE 2AMPA 3I77A 4ISLA 4YZUA 1NC6A 5HXFA 1TGNA 1EB1H 6ESTA 4RKJB 2DUCA 2Y80A 1RS0A 4B2BA 4VGCC 8GCHF 3JZ2B 2QAAA 4XE4A 1UCYH 5EOKA 3U1JB 5JBCS 2QXHA 1IQGA 3BTQE 1SGTA 2ZCLP 2VIPA 1MD8A 3TH2H 1DM4B 4NWKA 4O97A 1GJBB 1QRWA 4HI3A 1W7XH 1O37A 1D3TB 1TGSZ 1MBQA 1P2QA 3RXPA 2WV4A 1KLIH 1V2QT 1KXEA 1OS8A 1A46H 3S0NA 3OX7U 4A5TS 2BTCE 2Z9JA 4O3TA 3A82A 1GHWH 1NU9A 5E0GA 4MPWA 3RXIA 1Z6JH 1FV9A 7GCHF 3M5LA 3C1KA 3SI3H 1GBEA 2W3IA 3IWMA 2FOGA 2AMQA 1NFXA 4JZEH 2AMDA 2CHAC 2SGEE 1FDPA 2C4FH 1E0FD 4X1RU 1C5RA 1G32B 4CRCA 3GCTG 3VGCC 2EI7A 1ANBA 4MPUA 1XUJA 1BB0B 1GBCA 2BD8A 2J4IA 4WMFA 3MU8A 1A0LA 1J15A 2FOEA 4IMZA 3F6UH 1TBQH 4Y0ZE 5FXLA 2B5TB 1UTJA 1N1LA 4JZIA 1BMLA 1WOFA 4RSPA 4FUHA 3MH6A 5DO4H 1AZZA 1TA6A 3A8CA 4XBDA 1C1WH 1K1PA 4CHAB 1ZRKA 2ZQ1A 1A2CH 4MG3A 4ASHA 4NWLA 1P05A 3GY8A 1O2TA 1O2KA 5IYTA 3ATWA 3KQCA 4KKDA 5T6GA 1AB9B 2P95A 1SLXB 1CU1A 1EOLA 2ODQA 1T31A 1PQ7A 1GWAA 3K2UA 3RXGA 2O8MA 3W94A 4H4FA 4B2CA 3UNRA 5JB9S 1Z6EA 4MTBA 3BG4C 3QZRA 1FXYA 1FY5A 2B0FA 2OQUA 2P8OB 1SQOA 1F0RA 4SGAE 4WMDA 1BA8B 1INCA 1T7CA 3BSQA 1Z8JB 5AF9H 2GZ9A 3ZV8A 3E1XB 2TRMA 3LGYA 4A7IB 1HV7A 2ANWA 1K9OE 3N7OA 1F2SE 3GCHC 5JYIA 4IN2A 1O2SA 3P92A 5EQRA 5T6FA 1P2KA 1GG6C 1UCYK 1OWDA 4Y11E 1FNIA 8LPRA 1BTYA 3F9HA 1SGNE 1O34A 4MLFB 4X1PU 5EU8A 4Y10E 4NA8A 1HAVB 1K2I1 1UVUH 3SQEE 3DUXH 2EI6A 4FUFA 2OP9A 1OPHB 3S9CA 1KLTA 1HAXB 2H5DA 1G37A 1B0EA 2ZPQA 2ZTZA 1O3DA 1NT1A 1O2YA 3B8JA 5F03A 3EA8A 4B2AA 2GCTB 3QTOH 2C8ZB 2OBOA 1GI4A 4YOGA 3MU0A 5FAHA 1YC0A 2WUBA 2XC4A 4BAQB 1ZR0A 4ZKOU 1EJNA 1NU7B 3H5CB 5C1XA 3UFAA 1NRSH 1ACBE 2QV1A 1HUTH 2BDYA 2BDHA 1SBWA 3DD2H 3SI4H 4GPGA 1GGDB 1OX1A 1P09A 2CJIA 3H7TA 1Y3XA 4CBOA 1HAIH 5AFZH 2F9BH 3VB4A 1FIZA 1CE5A 2STBE 4ABIA 1O2VA 1N8OB 3BTME 2OCVB 1RFNA 2Z3CA 3MNBA 2BZ6H 1JOUB 1O3FA 1VJ9U 2FESH 2ZFPH 1OWKA 2NU0E 2ZKSA 1ANEA 2TGAA 3NUMA 2FLBH 2F3CE 1Z1IA 3MU1A 2BX4A 4NFFA 1Q3XA 1FZZA 2GTBA 3RU4E 3GCTF 1ELTA 1DWDH 1THPB 4U01A 4FVBA 4WH6A 2CF9H 4YM9A 1J16A 4WXVA 3PLKA 5C1UA 2P3UB 4ISOA 1UK3A 2ZPSA 1L0ZA 2W7SA 2PKSB 1YCPH 2FS8A 3LGWA 1GI2A 1A1RA 2P93A 1MD7A 3A8BA 2Y6TA 2ZDMA 4ISNA 1BRBE 4FUIA 4JMYA 2OBQA 2SNVA 2C90B 3P70B 1Z71A 2ZQ2A 4BAMB 2GDDA 1MZDA 3SJIA 4F4OC 3B9FH 4ZHLU 3OTJE 2PTNA 1F0TA 4KTCA 1F5KU 2VB0A 4CR9A 1O2MA 1H4WA 2Z6BD 4FUBA 1VCWA 2P59A 2ASUB 4INKA 4O3UA 1H8DH 1ETSH 2FI3E 2QYIA 5ETXA 1TRNA 3ZZDA 3BTFE 1S85A 1AVGH 2JH5D 5LPFA 5C2ZA 1O31A 3LU9B 1D3PB 4FU7A 1BJVA 1O3OA 4UFFH 3SBKA 1S0RA 1ESAA 3GCOA 1RXPA 1ARBA 4CREA 2Y5HA 1G3CA 3UY9A 1SOZA 1SR5C 1TNGA 1ID5H 1P3EA 3BV9B 4Z0KA 1XMNB 3TGKE 1O2IA 4Y6DA 1O3HA 5GIBA 1MTWA 1ESTA 3EA7A 2HPQH 1ZHMA 3R3GB 1BITA 2XWAA 4ZKRU 8KME2 3ZZCA 3TK5A 3LC5A 1QB9A 1NFUA 2J9NA 1V2VT 3PROA 3DFLA 1DUAA 2Y82A 4ZMAH 1GMDG 3ESTA 1HAPH 4NIYA 3HPTB 3Q3KA 1S0QA 2VH0A 1C5UA 4D7FA 2ZU4A 2WYJA 3R0FA 1WSSH 3BTGE 1CHGA 4BANB 1GBBA 3K65B 4DJZB 2ZHQH 1GBJA 1GDQA 2EC9H 1T8NA 2A31A 2FDAA 1JWTA 1EZQA 1KXAA 2GCHG 1PPBH 1GBFA 3SUDA 1Z8GA 2VGCB 1TOCB 4YOJA 5JBTA 4U32A 1O2HA 4Y0YE 1SPJA 4B73A 2ZF0H 3BTKE 1KSNA 1ZYOA 4X1SU 3SORA 3T25A 1SQAA 6CHAB 4KELA 1IHSH 2W7UA 1W13U 1EASA 1J9CH 3TJUA 3LDXH 1C1PA 3E90B 1ZSLA 3CENA 4CRGA 3M7UA 4ISIH 3RXQA 4LZ4B 2KAIB 2BD7A 2ZCKP 1YCPK 2G4TA 2ZC9H 2WINI 1SGYE 3LC3A 1EPTB 3L33A 2VIOA 1NTPA 1K1NA 2A7CA 1TRYA 1RD3B 1DUEA 3ZVCA 3ATIA 1LMWB 1DX5M 1LDTT 1O5FH 4K60A 5E2PA 2ZTXA 1GDUA 1EATA 3MH7A 5C5NA 1CGHA 4GUXA 1S81A 2OXSA 4I8KA 4X6NA 4XDEA 2B8OH 3M5MA 1HBTH 1ZSKA 2PGBB 8ESTE 1TABE 2AIQA 2PLXA 3M5NA 4H6TA 1PPFE 2ZHWH 1BRUP 3TU7H 3SUEA 1GBDA 1P11E 1QFKH 4NIVA 1HB0B 1NY22 1MKXH 1C1RA 2ZI2H 4I31A 3BTWE 1UHBB 4ABDA 1MTUA 1C2LA 3RC4A 2AYWA 4THNH 5HM9A 1ANDA 3GISB 1C5OH 1HNEE 1L1GA 3BEIB 1GJ4H 3SGQE 7GCHG 1T32A 1HIAA 2HRVA 1UJ1A 2HLCA 1S5SA 3ZVAA 3SUFA 3M3VA 4CHAC 3PM3A 5GPIB 1DICA 4TPIZ 2IOTA 1WU1A 3IG6B 4ZXXH 1UVSH 1NZQH 4O03A 5L2YH 4ABFA 2FYRA 1AB9C 1ELBA 4X2VA 1D9IA 5C20A 3W95A 2PWXA 3BTEE 3CS7A 3RXMA 2G4UA 1K21H 1FY1A 2CV3A 4INHA 4AG2A 2H9TH 5JPMH 3ELAH 1TB6H 4J1YA 3ITIA 1ZMJA 1O3CA 4DY7B 1SGRE 3SU3A 1H9LB 1Y59T 1QB6A 2P8OC 3PTBA 3M3TA 2WPJS 3A84A 2BZAA 1PPEE 1PYTC 3A8AA 5C67A 1CA0B 4XSKU 4NZQA 4DURA 4UFDH 1P0SH 1PQ5A 4UONA 1DXPA 2W3KA
chains in the Genus database with same CATH superfamily
4U2WA 3UOPA 1NESE 2JDID 1WQSA 1GMDF 3UTUH 1KXFA 1O39A 1GI0A 2A7JA 1FX0B 2ANYA 4NA9H 4R8TB 5AFYH 2YMSC 4ZH8A 4ZHMU 2QGRA 3MI4A 1GJ7B 1A7SA 2OK5A 5TCCA 1GCTB 2OD3B 1P2NA 3Q3XA 3BIVH 2K0QA 1OWEA 2O8LA 1GJCB 3F0PA 5AHGH 1CQQA 3VFEA 2WV5A 2SGDE 5I25A 1YF4A 2FM2A 4SGBE 1KDQB 2GDEH 3AAUA 3U69H 3KHVA 1P10A 2GCHF 2GMTB 2QN5T 1JBUH 1AQ7A 3MOCA 1ETTH 5H4IB 2G5NA 1SMFE 3NCLA 4RKOB 2OUAA 3M7TA 1E1QD 2UUKB 1O32A 1NRRH 4KP0A 4MQAA 3MH5A 4RT1A 4AFUA 1QQ4A 4FUDA 4ABEA 1ZTKA 1GHZA 4MNVA 3UREA 2R2MB 2GCTC 3UIRA 1MZAA 1W11U 5A0AE 1IQHA 2G51A 2V35A 2QE7D 4X8VH 1MKXK 5LPEA 2PW8H 1EPTA 3LIWA 3KN2A 4CH8B 2PHBA 4ASUD 1C2GA 2PSXA 5GDSH 1YP9A 3RMMH 2PP6A 1HGTH 2WPLS 3AVZA 1SLUB 1EAWA 1GGDC 1A61H 4E05H 1QL8A 2AEIH 1O36A 3F68H 1T4UH 1Y3WA 3I29A 1GHXH 1GI9B 4ESTE 1LTOA 1N8OC 1DXWA 3ZZ3A 1DY9A 3FZZA 1A5GH 3MYWA 1MCVA 4NSYA 3NPSA 2F9VA 3TH4H 1QZ8A 1IQFA 4OS6A 1ZPCA 1YGCH 5A8XA 2K1QA 1SKYE 1DY8A 1SC8U 1K1JA 2QF3A 1UHBA 1VCPA 3GDVA 3OSYA 3F0OA 4DG4A 1W10U 1XUFA 2JH0D 1UTMA 2NU4E 2TIOA 2W26A 1HJ9A 1TE0A 3GY3A 3GY4A 1SGCA 1C2HA 1C4Y2 4KGAA 1AMHA 2ODYB 5KEDA 1GJAB 3TIUA 4TY7A 1GHBG 2JETB 2ZDNA 2A4GA 2FPZA 1V3XA 1VGCB 2PKSC 1W8BH 3LGUA 2Q6DA 1ELDE 4WMEA 1C5PA 1W0JD 1EFRD 5GCHF 2R3YA 3BN9A 4I32A 4I8HA 4WWYA 1W2KH 1MU8B 4NZLA 1B5GH 1YPHC 2SGPE 3KYFA 1NM6A 3M3SA 1AZ8A 1GDNA 2QXGA 4XBBA 1HRTH 1LVBA 1W3CA 4P00A 4NA7A 2GZ7A 2V3OH 1FONA 1FY4A 5EW1H 1C4U2 4I8JA 3A89A 1V2RT 1EOJA 1P3CA 4MPXA 5JDUB 3VB5A 1P02A 4K1SA 1MTVA 1CA8B 1BZXE 4H6SB 4ABAA 5J4QA 1GI5A 4B74A 4B76A 1EQ9A 2UUJB 3D62A 1V2LT 3RXFA 3T62A 3T26A 1QJ1B 2QF0A 2ZECA 2V3MA 2F43B 2BLWA 1O3JA 4IC6A 2VWOA 3TJNA 2XNIA 1BHXB 1EXFA 3P17H 3U98H 1W0KD 3QGJA 3V3MA 3GICB 1W7GH 2PUQH 4YXWD 2ZA5A 1RTLA 2FXRA 2KCPA 5T6DA 1THSH 1W12U 1UTLM 1KDQA 3WWFA 2QF5A 4X2WA 1BTHH 2D1JA 2VU8E 1L1NA 2CGAA 3MFJA 2BLVA 1QY6A 1F5LA 4DIIH 1GJ9B 4FU9A 3TGJE 4A1TA 4J2YB 5ESTE 2BY9X 4YOIA 4BNRA 1YPJH 1O3BA 1QBNA 2BD9A 5T3HA 4DOQA 2O8UA 3SNCA 3TJVA 1MU6B 2G8TA 2P3FH 1H9IE 1KXCA 2TGDA 1QB1A 1WCZA 2XOKD 3SJ8A 3N7DA 1TYNA 3SV6A 3QGNB 3O8CA 1A0JA 2VGCC 1THRH 3EQ0H 5A0BA 2R3UA 1MTSA 5EXMA 3UQOA 3D23A 6CHAC 2FX4A 2XTTB 3FP7E 1H8ED 4AYVB 2PFEA 1DE7H 1P2IA 3BEUA 1JRSA 1KYNA 5A2MH 1AFQB 2BVXH 5FPSA 3NZIA 1FQ3A 3TLOA 3A88A 1O3LA 1V2PT 3KL6A 2VIWA 1MTNB 2BMGB 3ZZ8A 5FPYA 4X1QU 2VBCA 1EPTC 2ZDAH 3A7WA 3SNBA 2C3SA 3ODDA 1W0YH 1QRZA 2BQWB 1C2JA 2EY4C 1EJMA 4HGCA 9ESTA 2VINA 2ZDKA 2XBXA 1RTKA 4D8NA 5HM2A 5L30H 1BMAA 1F92A 3SQHE 1H8IH 2J92A 1Y3UA 1NO9H 1C5VA 4AGKA 1BBRH 2A5KA 3MHWU 3DA9B 2Q1JA 4O9VA 1YCPM 3FP8E 1Z8IB 1DT2A 3MNCA 1YBWA 1G3DA 1QIXB 5A09A 2JJ1D 3MO9A 1RTFB 1NPMA 4TSFD 2RA0A 1LKAA 3RUOA 2HNTE 1GHBF 2ANMH 2L74A 4XFQA 1QBOA 2Z9IA 3A7ZA 1SSXA 6GCHG 1WBGB 4XBCA 1SL3A 1NFWA 2WPKS 3VG8A 2ZWLH 4BXWA 1OSSA 3QK1A 3O8DA 1GL0E 1HXEH 3EYDA 1KIGH 1TIOA 2OC8A 2IJD1 5DP7A 2P16A 3GDUA 3O8BA 2FTMA 2D26C 1QL7A 1O3AA 3RLYH 3MU5A 3F1SB 1WV7H 4TT3D 5FPTA 1HAGE 1S84A 1EAUA 3SNDA 3M37A 3GCNA 2CXVA 2HALA 2J38A 1A3EH 1QJ6B 3DHKH 3SGAE 1TNIA 1EZXC 3QDZB 3ZYEA 1F5RA 4K1EA 5PTPA 1HYLA 4Y8ZA 2ZNKH 1SGIB 2H2ZA 4MDSA 2C8YB 4ZUHA 1EKBB 1TX6A 4ACAA 1CT0E 3T5FH 1FY3A 1O2LA 1YPEH 4ZKNU 5DN6D 1IHTH 4AB8A 2ZU3A 4OM9A 1ZZZA 3KF2A 1EZUC 1C1MA 2ZGJA 1P57B 3H7OA 5G4BA 1H1BA 1TPOA 1AHTH 1C2DA 3ZVGA 1FLEE 1MBMA 7KMEH 3LT3A 3D49H 2GP9B 2KX4A 1TMTH 2SFAA 4NFEA 1YPKH 3M61U 4AFZA 1CA0C 2V7QD 1FMGA 1IQLA 3SGBE 2QCYA 2IPHA 2Z9KA 1YY3A 1ZMNA 1AD8H 1C1QA 4NG9H 4FUCA 4ZROA 2BDBA 5TJXA 1TA2A 4HG6A 2BY6X 5JB8S 5HGGA 4B75A 2ODPA 5EGMA 3WWBA 1DFPA 3S7HB 2BQ7B 1V2KT 1ZTLA 2KFWA 5IDKA 2HVXA 4IC5A 2ZHFH 2Z94A 1RGQA 2J5UA 1BRAA 1GCTC 3OY5U 4ZAEA 1PQAA 2FOHA 1D6WA 1RJXB 2J94A 2Y7ZA 3S9AA 3SZEA 4X8TH 5F53A 5K0HA 1FI8A 1V2JT 1FIWA 1LCYA 3K6ZA 4LOYH 4UFEH 1QJ7B 4GHTA 4INLA 1GI6A 5IK2D 4HFPB 3SJOA 2GMTC 2J97A 3OTPA 1AVXA 4FXGH 1HAVA 4ISHH 1EAIA 3RXRA 1MMJN 1VR1H 5EXNA 2FS9A 1FN6A 1P9SA 4ABGA 1KXBA 3SN8A 2A5IA 4AFSA 4AOQA 1C5SA 4Q80A 1SLVB 1NFYA 1J14A 4ABJA 2ANKH 1AO5A 2ILNA 2R2WU 4YO9A 3GY5A 3HKIB 2F9PA 5JBAS 2OC7A 1NROH 1TGTA 4AX9H 1BTPA 2BLOA 3SV7A 1FPCH 5DPAA 1UMAH 2BVSH 4IBLH 2CN0H 1T8LA 3RMOH 2TBSA 1O5BB 4Y8XA 1OWHA 1G3EA 3E0NB 4R0IA 2PKAB 3UNQA 4QT8C 2YOLA 1MKWH 4GVUA 2C93B 2FOBA 1L4ZA 1F0UA 1TFXA 1P2JA 2R0LA 1BIOA 3HKJB 2A4RA 1TGCA 2XRCA 2NU2E 2UUYA 2A32A 1FY8E 3TGIE 3HGNA 1SQRA 3WW7A 3ZZ9A 1C5MD 3ZIAD 1OWJA 1HDTH 1ZRBA 1FAKH 4BXSA 4WVPE 2GKVE 5JBBS 1J8AA 3SU2A 5KGOA 1A5IA 1C2IA 4AORA 1C1TA 1EAXA 1AFEH 1UCYE 2J34A 1C2FA 4U30A 2J98A 3BG8A 1F0SA 5EPYA 5DP8A 2PR3A 1G36A 2FTLE 2FI4E 2HPPH 1SGFA 3ZVDA 1P03A 4X2XA 3VB3A 1CHOG 4I7YH 3E6PH 1OWIA 4RN6A 3ZZAA 6GCHF 4NGAH 1EUFA 3F2FA 1ABIH 2NU1E 2GZ8A 3QUMP 2ZHEH 3ZYDA 3RM2H 4CBNA 4A1VA 3TJOA 3VB6A 3GY2A 1XX9A 2JETC 1C2MA 3NK8A 1ELEE 1ZPZA 1PPGE 1VGCC 2J2UA 3SNAA 2FZZA 1LPKB 5E8EH 1O3KA 1BTZA 1LVOA 5CMXH 5J4SA 1HPGA 1V2WT 1IQKA 2AGEX 1OHHD 2ZFFH 3LJOA 1EJAA 1PPCE 4ZHAA 1YPGH 4FVDA 5CE1A 2F9OA 2FIRH 1O3EA 3K9XB 5DP4A 2W6JD 3LGIA 1P2OA 1HAHH 2WPIS 1TMUH 2QY0B 4MNYA 2YNBA 3UNSA 3ZVFA 1GJ6A 1C2EA 1O2OA 3OEHD 1TMBH 1UTOA 1JRTA 1TNKA 5DP3A 5GCHG 5DP6A 2GGVB 1QA0A 4K8YA 4TY6A 4DGJA 3QTVH 4JCNA 2ZGHA 2OC0A 2G5VA 3KQDA 1IAUA 3U9AH 5LPRA 1UVTH 1TBRH 1C5YB 2F9UA 2VVUA 7ESTE 4IMQA 2AGGX 3BTTE 4XD7D 2M2AA 1COWD 5CHAB 4LZ1H 3MU4A 4CRDA 1C9PA 3RU4D 1V2ST 2BY5X 4OS2A 5K7RA 2D8WA 3OY6U 1TQ0B 3A7XA 1TGBA 4RT0A 3B23B 1ESBA 4KTUA 5DP5A 1EZSC 4X8UH 1MKWK 1O3PB 1IOEA 2OC1A 3URDA 3RXVA 2A1DB 4GSOA 1G2MA 3DCLA 1O2ZA 1CSOE 3A7TA 1VITG 3PO1B 1KXDA 2C8WB 1QNJA 1JIRA 3RMLH 2BOHB 1ZTJA 4HTCH 2C8XB 3RXEA 2QXIA 3PMJA 5FBIA 1QTFA 1ANCA 3HK3B 2AS9A 1V2OT 3BEFB 1LQEA 3TVJB 2M5TA 1YPMH 1DVAH 2BB4A 1SI5H 1A4WH 3CS0A 2ALVA 3RC6A 1DDJA 1E36B 3MH4A 1BMMH 2TGPZ 3RMNH 5C0TA 2BDIA 3MNSA 1NN6A 4TWWA 4PROA 1K28D 1GCDA 3M36A 1B0FA 2ULLA 3RXOA 2EEKA 1PPZA 1BTWA 1HXFH 1LVYA 1C5QA 1UK2A 1LHCH 2FOFA 3PMHB 3A8DA 1GJ5H 5B6OA 1AFQC 3SJKA 3TNSA 1VJAU 3QWCH 2BX3A 2A2XH 2G55A 4AGJA 1HAOH 3GS9A 2ALPA 2VWLA 2KAIA 2VH6A 4AN7A 1PFXC 1MTNC 3E0PB 2TPIZ 1VCQA 3PMAB 2STAE 1RRKA 1Z1JA 3LOXA 2AERH 1O2QA 3URCA 1ZJKA 3SHCH 3BF6H 4K69A 5DJ7A 3MO6A 1LHDH 1J17T 1ELVA 3HATH 2WPMS 1BTUA 1SGFG 1MUEB 2AFQB 2BVRH 1UO6A 4GAWA 3SJ9A 3A83A 4IW4E 4IGDA 3UQVA 4X1NU 4JZDH 4MPVA 1O5CB 1CHOF 1G9IE 4Q63A 4A6LA 3U8TH 4YT6H 1QBVH 1O2GH 1G30B 1KLJH 4KTSA 1DS2E 2FOMB 1YLCA 4UFGH 5I46H 3QX5H 3WY8A 1SLWB 1P04A 3GYMA 1E34B 1O3IA 3C27B 3ENSB 3SU6A 3S7KB 3W1EA 2I6QA 1DITH 2BQ6B 1AE5A 5FCKA 1MQ5A 2VWNA 3HK6B 1BMNH 4BAKB 1MAYA 1QHRB 1AU8A 1UTPA 2GT8A 1Y3VA 1UW7A 3T28A 5E0JA 5EJZA 4FUEA 1BCUH 1C9TA 2WV9A 4OS1A 4TWYA 1X7AC 3ZZBA 1DWBH 4DCDA 3FKSD 4FUGA 2I6SA 1BHXF 2NU3E 1O38A 3RXCA 4X8SH 1E35B 1Y3YA 4IN1A 2SGFE 4K2YA 4BTIB 1P01A 1PYTD 2VIVA 2ZPRA 3BIUH 1VZQH 3RXSA 2ZFTA 3PLBA 4Y7AA 2PUXB 3KQEA 3CP7A 1D3DB 2PSYA 2Y7XA 5A8YA 3Q77A 2HVYB 4P02A 3GY7A 1C5ZB 2PTCE 3O8RA 1D6RA 3L6PA 1CBWB 2YMSD 4AG1A 2R9PA 1YKTA 4Y7BA 3TPIZ 1GI8B 1AIXH 1VITH 3Q00A 2FMJA 3SV2H 3MMGA 1TPPA 3HGPA 1OKXA 4TPYA 2FLRH 2Y5FA 4ZXYH 1NS3A 1Y5AT 2BY7X 4I8LA 4CRAA 2EI8A 5FBEA 3ZZ6A 1VITF 3M5OA 3STJA 3PMBB 1A0HB 3A7YA 2VVCA 1UK4A 1JMOH 1CGIE 1ZGVA 2BXTH 2BHGA 2FOAA 1MAXA 4NIWA 1ORFA 2JKHA 4UEHH 4F55A 5E0HA 3E8LA 1DOJA 5F6MA 1KTTB 3EGKH 3KGPA 1WTGH 1N6XA 1V2UT 1HLTH 2XWBI 4UD9H 1XKAC 2OINA 2KCYA 1WYKA 1OP2A 1UVOA 1XUHA 3F9FA 2BXUH 1GBMA 4MVNA 1WXRA 2CF8H 2THFB 4UDWH 2OQ5A 3ATKA 4NCYA 1HJ8A 1O0DH 2G00A 2O8WA 2ZZUH 1YM0A 1O2WA 2KZ4A 1N6YA 1V2NT 1BOQA 1SB1H 1UTKA 1BQYA 1TNLA 2XYAA 1QA7A 1BT7A 3TNTA 2AH4X 4Y79A 4DIHH 3TITA 1P12E 1D4PB 2LPRA 4UE7H 4OGYA 4I86A 3PTNA 1LPGB 2BD3A 2VVVA 2ZHDA 2WPHS 1GBLA 1P06A 1DSTA 2NWNA 4WJG2 3AW1A 4A92A 2A4OA 1EP6A 1ZOMA 2O8TA 1Q2WA 1RIWB 2R0KA 1HJAB 3E91A 3UR6A 4Q4LA 2XC0A 5C1YA 1GHYH 1KY9A 2V0BA 4ZKSU 2GV7A 5HIYA 1CGJE 2QF4A 1U6QA 3A85A 3U1IB 2ZFSA 3GOVB 3E3TA 4WXIA 1C1OA 1O5DH 1XVMA 4DT7B 4WF8A 3EA9A 1ZGIA 2GD4B 1ZLRA 3GDSA 5T1VA 2XC5A 3CNRA 1BJUA 1SG8B 1GMCG 1ARCA 1ELFA 3KNXA 1GJ8B 3E16B 5F8XA 5CHBA 3KYGA 2QA9E 2XBVA 3MWIU 1HAYB 3NRLA 3P8OA 2HGTH 5DGJA 4D7GA 1S6LA 4JYUH 1P2MA 3KCGH 2WHXA 1KTSB 4GCHG 3VXEH 3T27A 4AZ2B 1D3QB 1O2RA 4D9QA 2XNDD 4OGXA 1GBHA 1CT2E 1OOKB 2CMYA 4BOHA 4Y76A 3ODFA 1C5LH 5FX6A 5L2ZH 1O5GH 3MNXA 1KMHB 3FVFB 1NBMD 1P9UA 2A45B 5GNDA 3V13A 1O3MA 3GY6A 3SW2B 2VNTA 1EB2A 1XUKA 5ESBA 4CRFA 2HWLB 2FI5E 2A7HA 1BUIA 1IQEA 4F48B 1G3BA 2WUCA 2H6MA 2BOKA 4X6PA 1UTNA 2Y81A 4X6MA 1BMFD 2ZTYA 1V6DA 1LO6A 1SFQB 2UWOA 4X2YA 1ZPBA 3JZ1B 2Z3DA 1GBTA 4NSVA 1K0HA 4FUJA 3RU4T 4D76A 2XBWA 3RM0H 1AI8H 2GV6A 1FN8A 3SV9A 1AGJA 3OYPA 1AN1E 3LJJA 1OYTH 1C4V2 1TX8A 2ZGCA 3ZVEA 3KQBA 4FU8A 1O33A 2LELA 2UWPA 2UUFB 2XCNA 4WY3A 3RDZA 3VXFH 1HCGA 3GYLB 2ZFRH 5HYOA 3MTYA 3K6YA 2Z9LA 2Z3EA 3SO3A 4VGCB 5EQQA 2QIQA 2RDLA 4JYTA 3STIA 3V0XA 3A7VA 1S6FA 3LKWA 5EODA 3MO3A 2VWMA 2GJGA 1WTHD 2ESTE 1IQJA 3TK6A 4ABBA 1O35A 1Y5UT 3QLPH 1IQNA 1ELGA 4ZCNA 5CHAC 1TQ7B 1O3GA 1H9HE 3BTDE 4Q7YA 1SHHB 1QQUA 4CH2B 1S6HA 4JZFH 1GVZA 1FPHH 2A5AA 3LH1A 1WAYB 1YLDA 1ETRH 2IPQX 3SUGA 3T2NA 3LPRA 2BD4A 2J95A 5A8ZA 1CVWH 4ABHA 2BLQA 3PB1E 2XCFA 1W14U 3MQKC 3NKKA 3RP2A 1MH0A 5DG6A 3M35A 3VEQB 2BDCA 3P8NA 3A81A 4I33A 1ZMLA 3PO1C 2CHAB 3SU5A 2H9EH 3UOUA 1B7XB 2RCEA 2FX6A 1O2PA 5EQSA 2ZGXH 3SU4A 3VGCB 4CRBA 1MCTA 3OU0A 5LH8A 1SGPE 2PGQB 4GLYA 3SHAH 3ZZ4A 3FO8D 1GI1A 1G2LA 2FOCA 4BTTB 3NWUA 4Z1MD 2GX4A 3PWCA 1E37B 4K5ZA 1K1IA 3M7QA 5KECA 2SNWA 3ATMA 2HOBA 2FODA 2OLGA 1AVWA 1HIAB 3RXUA 3V7TA 1LHEH 1PQ8A 1UTQA 3RXJA 2V3HH 2H1UA 4X6OA 5BRRE 2HNTC 2Y5GA 1O5AB 1YYY1 3FP6E 4D9RA 1DLEA 4E7NA 2AIPA 3A87A 2WZQA 1Y5BT 2LP6A 2GVFA 4M7GA 2FWWA 3AAVA 1IQMA 2W6ID 1S83A 2ZG0H 2V6NA 4YT7H 2DE8A 3KQ5A 1BBRK 4GHQA 4B71A 5DP9A 1A3BH 2RA3A 2GT7A 3BTHE 2ZDLA 3F9GA 1HAZB 2BYAX 3RXAA 1OXGA 2YNAA 4A1XA 2RFKC 1FUJA 1C5XB 1V2MT 2H5CA 3UR9A 3LONA 3P8FA 2D2DA 4YESB 3BG4B 2Q6FA 1AY6H 3PV4A 2A0QB 1GMCF 5LGOA 1Z7KA 1SQTA 3RXHA 1O2XA 3UUZA 1K1LA 7LPRA 1C5TA 2ZO3H 1PJPA 1FAXA 1BTXA 3ZZ7A 3A86A 1ZHRA 2QC2A 1ABJH 4GCHF 5C3NA 1SGEE 1F7ZA 4MNXA 4Y71A 1OP8A 2F91A 1SFIA 1O30A 1GI3A 3GCHB 5GXPA 2A2QH 1DLKB 3LGTA 1GJDB 4OS7A 1TWXB 2UWLA 2Q6GA 1T4VH 5HIZA 1ZSJA 1O3NA 1GG6B 1GVLA 1GHAG 3FFGA 2P94A 1T8OA 3L3TA 1ZJDA 3AW0A 2A4QA 1GMHG 1AKSB 3QN7A 2ZU2A 1JIMA 2G52A 4Q7XA 1QR3E 2ZGBH 4Y8YA 1PPHE 1L1JA 1TOMH 4JK5A 1XM1A 2Z9GA 4DVAU 3G01A 2K8IA 5ABWA 4Z6AH 9LPRA 2ZEBA 4H42U 3F3BA 2P3TB 5EXLA 1GVKB 4OS4A 1EP5A 3TH3H 1SHYA 1GBKA 1BRCE 4YLQH 5EJ1A 1V2TT 3VB7A 4HZHA 1AUTC 3I78A 4AFQA 1XXDA 3UPEA 1AE8H 2IN2A 1ELAA 1GI7B 3PWBA 2TGTA 1T8MA 1C1NA 3AASA 2ZFQH 2BDAA 5EG4A 2SGAA 3RXLA 3UB0A 1GL1A 1GPZA 1NRQH 4OS5A 3N99A 1XUIA 3SU0A 1YPLH 3RXBA 1WUNH 1OP0A 1TBZH 3SOSA 4DT4A 1E38B 4Q7ZA 1GHVH 1GBIA 3RC5A 3RXDA 1CO7E 2KCOA 3SU1A 4TYDA 3S9BA 3FANA 3RXKA 2ZIQH 4IS5A 3P95A 3F9EA 8GCHG 5EPNA 3EDXB 4K3JA 4AYYB 1CBWC 2XW9A 4CR5A 1K1MA 3Q3YA 1O2UA 4K8BA 4B1TA 3DT0H 5AVDA 4WH8A 1TALA 1QRXA 4DW2U 1W0ZU 3S69A 1WQVH 1SGDE 2BDGA 3UWJH 5DKMA 1AUJA 1QURH 1TAWA 4M9FA 1L2EA 2PV9B 2VIDA 4FETA 1C1SA 4K1TA 3SNEA 1AWHB 2HNTF 1LQDB 2JH6D 1LKBA 1XKBC 2BD5A 5FHTA 1E79D 2FP7B 3A80A 1SVPA 1GBAA 2O9QA 1NRNH 1L4DA 5F8TA 1ELCA 3PYHA 1XVOA 1C1VH 1EX3A 3KEEA 3ZVBA 2ZCHP 5GWZA 1JXPA 1DANH 3H09A 1XXFA 3IITA 6LPRA 3P8GA 5SGAE 4JYVH 2FO9A 2FEQH 3V12A 1K1OA 1MABB 1XUGA 1LHGH 2BM2A 3P6ZB 3KIDU 1TONA 5C5OA 1TX7A 4X0WU 5A0CA 3U8OH 4E06H 1C5NH 1DWCH 4JK6A 2QXJA 1DPOA 1TLDA 3EE0B 2F83A 5F8ZA 2RG3A 4NIXA 5FCRA 2F9NA 4MNWA 1Q31A 4B6EA 3RLWH 1OYQA 2EA3A 5C94A 4AB9A 3QZQA 2ZU1A 5FX5A 2FYQA 3F2GA 1QGFA 5CDFE 1QCPA 3LH3A 1CT4E 3D65E 4F49A 1RIWC 1HFDA 2ZP0H 4BAOB 1HJAC 1AWFH 2PKAA 2BD2A 2VIQA 4LXBH 1TPSA 1SOTA 2WYGA 2ZU5A 3UWIA 3VPKA 2G81E 1A5HA 1LPZB 3T29A 1ZHPA 3DSPA 3U28C 5GJ4B 3TK9A 5L6NH 3DFJA 1LHFH 1M9UA 3FZDA 1O2NA 1Y8TA 2EQNA 4LK4A 5FL7D 2XBYA 5EW2H 5TCAA 1BDAA 1WDIA 3U8RH 1TNHA 1AKSA 2VJ1A 2B7DH 1P8VC 5E2OA 3QO6A 1H8HD 3NXPA 4XOJA 1GHAF 3ATLA 2W5EA 1K22H 2OTVA 3PRBA 1C1UH 1GMHF 1Z8RA 2AGIX 4JZ1A 4YLUA 1UVPA 4BTUB 1NBME 1TPAE 3RXTA 1MQ6A 1YPHE 4BAHB 1TRMA 2SGQE 1C2KA 1BBRE 5BPEA 1DWEH 3SZNA 2DE9A 1IQIA 1FJSA 1NRPH 1O2JA 3ZZ5A 1O5EH 1TNJA 1SGQE 3FAOA 4E7RG 2H9HA 3UAIC 3PLPA 4Q2KA 4YTAA 2IJOB 3LGVA 2B9LA 2LNCA 3SV8A 1C5WB 3Q76A 2ZDVH 1QL9A 2BY8X 1S82A 4I8GA 3EAJA 3ZV9A 1LVMA 5DK1A 5HMAA 1DSUA 2XXLA 3N7EA 2Z7FE 2AMPA 3I77A 1YLNA 4ISLA 4YZUA 1NC6A 5HXFA 1TGNA 1EB1H 6ESTA 4RKJB 2DUCA 2Y80A 1RS0A 4B2BA 3FOAA 4VGCC 3OFND 8GCHF 3JZ2B 2QAAA 4XE4A 1UCYH 5EOKA 3U1JB 5JBCS 2QXHA 1IQGA 3BTQE 1SGTA 2ZCLP 2VIPA 1MD8A 3TH2H 1DM4B 4NWKA 4O97A 3SYJA 1GJBB 1QRWA 4HI3A 1W7XH 1O37A 1D3TB 1TGSZ 1MBQA 1P2QA 3RXPA 2WV4A 1KLIH 1V2QT 1KXEA 1OS8A 1A46H 3S0NA 3OX7U 4A5TS 2BTCE 2Z9JA 4O3TA 3A82A 1GHWH 1NU9A 5E0GA 4MPWA 3RXIA 1Z6JH 1FV9A 7GCHF 3M5LA 3C1KA 3SI3H 1GBEA 2W3IA 3IWMA 2FOGA 2AMQA 1NFXA 4JZEH 4B6FA 2AMDA 2CHAC 2SGEE 1FDPA 2C4FH 1E0FD 4X1RU 1C5RA 1G32B 4CRCA 3GCTG 3VGCC 2EI7A 5C17A 1ANBA 4MPUA 1XUJA 1BB0B 1GBCA 2BD8A 2J4IA 4WMFA 2F4LA 3MU8A 1A0LA 1J15A 2FOEA 4IMZA 3F6UH 1TBQH 4Y0ZE 5FXLA 2KR7A 2B5TB 1UTJA 1N1LA 4JZIA 1BMLA 5DSFA 1WOFA 4RSPA 4FUHA 3MH6A 5DO4H 1AZZA 1TA6A 3A8CA 4XBDA 1C1WH 1K1PA 4CHAB 1ZRKA 2ZQ1A 1A2CH 4MG3A 4ASHA 4NWLA 1P05A 3GY8A 1O2TA 1O2KA 3F2HA 5IYTA 3ATWA 3KQCA 4KKDA 5T6GA 1AB9B 2P95A 1SLXB 1CU1A 1EOLA 2ODQA 1T31A 1PQ7A 1GWAA 3K2UA 3RXGA 2O8MA 3W94A 4H4FA 4B2CA 3UNRA 3DSGA 5JB9S 1Z6EA 2WSSD 4MTBA 3BG4C 3QZRA 1FXYA 1FY5A 2B0FA 1VKYA 2OQUA 2P8OB 1SQOA 1F0RA 4SGAE 4WMDA 1BA8B 1INCA 1T7CA 3BSQA 1Z8JB 5AF9H 2GZ9A 3ZV8A 3E1XB 2TRMA 3LGYA 4A7IB 1HV7A 2ANWA 1K9OE 3N7OA 1F2SE 3GCHC 5JYIA 4IN2A 3AK5A 1O2SA 3P92A 2YMSB 5EQRA 5T6FA 1P2KA 1GG6C 1UCYK 1OWDA 4Y11E 1FNIA 8LPRA 1BTYA 3F9HA 1SGNE 1O34A 4MLFB 4X1PU 5EU8A 4Y10E 4NA8A 1HAVB 1K2I1 1UVUH 3SQEE 3DUXH 2EI6A 4FUFA 2OP9A 1OPHB 3S9CA 1KLTA 1HAXB 2H5DA 1G37A 1B0EA 2CK3D 2L6OA 2ZPQA 2ZTZA 1O3DA 1NT1A 1O2YA 2JJ2D 3B8JA 5F03A 4RI0A 3EA8A 1E1RD 4B2AA 2GCTB 3QTOH 2C8ZB 2OBOA 1GI4A 4YOGA 3MU0A 5FAHA 3PRDA 1YC0A 2WUBA 2XC4A 4BAQB 1ZR0A 4ZKOU 1EJNA 1NU7B 3H5CB 5C1XA 2JIZD 3UFAA 1NRSH 1ACBE 2QV1A 1HUTH 2BDYA 2BDHA 1SBWA 3DD2H 3SI4H 4GPGA 1GGDB 1OX1A 1P09A 2CJIA 3H7TA 1Y3XA 4CBOA 1HAIH 5AFZH 2F9BH 3VB4A 1FIZA 1CE5A 2STBE 4ABIA 1O2VA 1N8OB 3BTME 2OCVB 5HKKD 1RFNA 2Z3CA 3MNBA 2BZ6H 1JOUB 3DSOA 2J98B 1O3FA 1VJ9U 2FESH 2ZFPH 1OWKA 2NU0E 2ZKSA 1ANEA 2TGAA 3NUMA 4XRNA 2FLBH 1YWUA 2F3CE 1Z1IA 3MU1A 2BX4A 4NFFA 1Q3XA 1FZZA 2GTBA 3RU4E 3GCTF 1ELTA 1DWDH 1THPB 4U01A 4FVBA 4WH6A 2CF9H 4YM9A 1J16A 4WXVA 3PLKA 5C1UA 2P3UB 4ISOA 1UK3A 2ZPSA 1L0ZA 2W7SA 2PKSB 1YCPH 2FS8A 3LGWA 1GI2A 1A1RA 2P93A 1MD7A 4ACBA 3A8BA 2Y6TA 2ZDMA 4ISNA 1BRBE 4FUIA 4JMYA 2OBQA 2SNVA 2C90B 3P70B 1Z71A 2ZQ2A 4BAMB 3PV2A 2GDDA 1MZDA 3SJIA 4F4OC 3B9FH 4ZHLU 3OTJE 2PTNA 1F0TA 4AC9A 4KTCA 1F5KU 2VB0A 4CR9A 1O2MA 1H4WA 2Z6BD 4FUBA 1VCWA 2P59A 2ASUB 4INKA 4O3UA 1H8DH 1ETSH 2FI3E 2QYIA 5ETXA 1TRNA 3ZZDA 3BTFE 1S85A 1AVGH 2JH5D 5LPFA 5C2ZA 1O31A 3LU9B 1D3PB 4FU7A 1BJVA 1O3OA 4UFFH 3SBKA 1S0RA 1ESAA 3GCOA 1RXPA 1ARBA 4CREA 2Y5HA 1G3CA 3UY9A 1SOZA 1SR5C 1TNGA 1ID5H 1P3EA 3BV9B 4Z0KA 1XMNB 3TGKE 1O2IA 4Y6DA 1O3HA 5GIBA 1MTWA 1ESTA 3EA7A 2HPQH 1ZHMA 3R3GB 1BITA 2XWAA 4ZKRU 8KME2 3ZZCA 3TK5A 3LC5A 1QB9A 5EIYA 1NFUA 2J9NA 1V2VT 3PROA 3DFLA 3PV5A 1DUAA 4FOUC 2Y82A 4ZMAH 1GMDG 3ESTA 3FN8A 1HAPH 4NIYA 3HPTB 3Q3KA 1S0QA 2VH0A 1C5UA 4D7FA 2ZU4A 2WYJA 3R0FA 1WSSH 3BTGE 1CHGA 4BANB 1GBBA 3K65B 4DJZB 2ZHQH 5EJLA 1GBJA 1GDQA 2EC9H 1T8NA 2A31A 2FDAA 1JWTA 1EZQA 1KXAA 2GCHG 1PPBH 1GBFA 3SUDA 1Z8GA 2VGCB 1TOCB 4YOJA 5JBTA 4U32A 1O2HA 4Y0YE 1SPJA 4B73A 2ZF0H 3BTKE 1KSNA 1ZYOA 4X1SU 3SORA 3T25A 1SQAA 5C0UA 6CHAB 4KELA 5B6LA 1IHSH 2W7UA 1W13U 3EE7A 1EASA 1J9CH 3TJUA 3LDXH 1C1PA 3E90B 1ZSLA 3CENA 4CRGA 3M7UA 4ISIH 3RXQA 4LZ4B 2KAIB 2BD7A 2ZCKP 2AHME 1YCPK 2G4TA 2ZC9H 2WINI 1SGYE 3LC3A 1EPTB 3L33A 2VIOA 1NTPA 1K1NA 2A7CA 1TRYA 1RD3B 1DUEA 3ZVCA 3ATIA 1LMWB 1DX5M 1LDTT 1O5FH 4K60A 5E2PA 2ZTXA 1GDUA 1EATA 3MH7A 5C5NA 1CGHA 4GUXA 1S81A 2OXSA 4I8KA 4X6NA 4XDEA 2B8OH 3M5MA 1HBTH 1ZSKA 2PGBB 8ESTE 1TABE 2AIQA 2HLDD 2PLXA 3M5NA 4H6TA 1PPFE 2ZHWH 1BRUP 3TU7H 3SUEA 1GBDA 1P11E 1QFKH 4NIVA 2KM0A 1HB0B 1NY22 1MKXH 1C1RA 2ZI2H 4I31A 3BTWE 1UHBB 4ABDA 1MTUA 3OE7D 1C2LA 3RC4A 2AYWA 4THNH 5HM9A 1ANDA 3GISB 1C5OH 1HNEE 1L1GA 3BEIB 1GJ4H 3SGQE 7GCHG 1T32A 1HIAA 2HRVA 1UJ1A 2HLCA 1S5SA 3ZVAA 3OEED 3SUFA 3OAAD 3M3VA 4CHAC 3PM3A 5GPIB 1DICA 4TPIZ 2IOTA 1WU1A 3IG6B 4ZXXH 1UVSH 1NZQH 4O03A 5L2YH 4ABFA 2FYRA 1AB9C 1ELBA 4X2VA 1D9IA 5C20A 3W95A 2PWXA 3BTEE 3CS7A 3RXMA 2G4UA 1K21H 1FY1A 2CV3A 4INHA 4AG2A 2H9TH 5JPMH 3ELAH 1TB6H 4J1YA 3ITIA 2WPDD 1ZMJA 1O3CA 4DY7B 1SGRE 3SU3A 1H9LB 1Y59T 1QB6A 2RDEA 2P8OC 3PTBA 3M3TA 2WPJS 2KCAA 3A84A 2BZAA 1PPEE 1PYTC 3A8AA 5C67A 1CA0B 4XSKU 4NZQA 4DURA 4UFDH 1P0SH 1PQ5A 4UONA 1DXPA 2W3KA
chains in the Genus database with same CATH topology
4U2WA 3UOPA 1NESE 1WQSA 1GMDF 3UTUH 1KXFA 1O39A 1GI0A 2A7JA 4NA9H 2ANYA 5AFYH 4R8TB 4ZHMU 4ZH8A 2QGRA 3MI4A 1GJ7B 1A7SA 5TCCA 1GCTB 2OD3B 1P2NA 3Q3XA 3BIVH 1OWEA 2O8LA 1GJCB 5AHGH 1CQQA 3VFEA 2WV5A 2SGDE 5I25A 1YF4A 2FM2A 4SGBE 1KDQB 2GDEH 3AAUA 3U69H 3KHVA 1P10A 2GCHF 2GMTB 2QN5T 1JBUH 1AQ7A 3MOCA 1ETTH 5H4IB 2G5NA 1SMFE 3NCLA 4RKOB 2OUAA 3M7TA 2UUKB 1O32A 1NRRH 4KP0A 4MQAA 3MH5A 4AFUA 1QQ4A 4FUDA 4ABEA 1ZTKA 1GHZA 4MNVA 3UREA 2R2MB 2GCTC 3UIRA 1MZAA 1W11U 5A0AE 1IQHA 2G51A 2V35A 4X8VH 1MKXK 5LPEA 2PW8H 1EPTA 3LIWA 3KN2A 4CH8B 2PHBA 1C2GA 2PSXA 5GDSH 1YP9A 3RMMH 1HGTH 2WPLS 3AVZA 1SLUB 1EAWA 1GGDC 1A61H 4E05H 1QL8A 2AEIH 1O36A 3F68H 1T4UH 1Y3WA 3I29A 1GHXH 1GI9B 4ESTE 1LTOA 1N8OC 1DXWA 3ZZ3A 1DY9A 3FZZA 1A5GH 3MYWA 1MCVA 4NSYA 3NPSA 2F9VA 3TH4H 1IQFA 4OS6A 1ZPCA 1YGCH 5A8XA 2K1QA 1DY8A 1SC8U 1K1JA 2QF3A 1UHBA 1VCPA 3GDVA 3OSYA 4DG4A 1W10U 1XUFA 2JH0D 1UTMA 2NU4E 2TIOA 2W26A 1HJ9A 1TE0A 3GY3A 3GY4A 1SGCA 1C2HA 1C4Y2 4KGAA 1AMHA 2ODYB 1GJAB 3TIUA 4TY7A 1GHBG 2JETB 2ZDNA 2A4GA 2FPZA 1V3XA 1VGCB 2PKSC 1W8BH 3LGUA 2Q6DA 1ELDE 4WMEA 1C5PA 5GCHF 2R3YA 3BN9A 4I32A 4I8HA 4WWYA 1W2KH 1MU8B 4NZLA 1B5GH 1YPHC 2SGPE 1NM6A 3M3SA 1AZ8A 1GDNA 2QXGA 4XBBA 1HRTH 1LVBA 1W3CA 4NA7A 2GZ7A 2V3OH 1FONA 1FY4A 5EW1H 1C4U2 4I8JA 3A89A 1V2RT 1EOJA 1P3CA 4MPXA 5JDUB 3VB5A 1P02A 4K1SA 1MTVA 1CA8B 1BZXE 4H6SB 4ABAA 5J4QA 1GI5A 4B74A 4B76A 1EQ9A 2UUJB 3D62A 1V2LT 3RXFA 3T62A 3T26A 1QJ1B 2QF0A 2ZECA 2BLWA 1O3JA 4IC6A 2VWOA 3TJNA 2XNIA 1BHXB 1EXFA 3P17H 3U98H 3QGJA 3V3MA 3GICB 1W7GH 2PUQH 2ZA5A 1RTLA 2FXRA 5T6DA 1THSH 1W12U 1UTLM 1KDQA 4X2WA 1BTHH 2D1JA 2VU8E 1L1NA 2CGAA 3MFJA 2BLVA 1QY6A 1F5LA 4DIIH 1GJ9B 4FU9A 3TGJE 4A1TA 4J2YB 5ESTE 2BY9X 4YOIA 4BNRA 1YPJH 1O3BA 1QBNA 2BD9A 5T3HA 4DOQA 2O8UA 3SNCA 3TJVA 1MU6B 2G8TA 2P3FH 1H9IE 1KXCA 2TGDA 1QB1A 1WCZA 3SJ8A 1TYNA 3SV6A 3QGNB 3O8CA 1A0JA 2VGCC 1THRH 3EQ0H 5A0BA 2R3UA 1MTSA 5EXMA 3UQOA 3D23A 6CHAC 2FX4A 2XTTB 3FP7E 4AYVB 2PFEA 1DE7H 1P2IA 3BEUA 1JRSA 1KYNA 5A2MH 1AFQB 2BVXH 5FPSA 3NZIA 1FQ3A 3TLOA 3A88A 1O3LA 1V2PT 3KL6A 2VIWA 1MTNB 2BMGB 3ZZ8A 5FPYA 4X1QU 2ZDAH 1EPTC 3A7WA 3SNBA 2C3SA 3ODDA 1W0YH 1QRZA 2BQWB 1C2JA 1EJMA 4HGCA 9ESTA 2VINA 2ZDKA 2XBXA 1RTKA 4D8NA 5HM2A 5L30H 1BMAA 1F92A 3SQHE 1H8IH 2J92A 1Y3UA 1NO9H 1C5VA 4AGKA 1BBRH 2A5KA 3MHWU 3DA9B 2Q1JA 4O9VA 1YCPM 3FP8E 1Z8IB 1DT2A 3MNCA 1YBWA 1G3DA 1QIXB 5A09A 3MO9A 1RTFB 1NPMA 2RA0A 1LKAA 3RUOA 2HNTE 1GHBF 2ANMH 4XFQA 1QBOA 2Z9IA 3A7ZA 1SSXA 6GCHG 1WBGB 4XBCA 1SL3A 1NFWA 2WPKS 2ZWLH 4BXWA 1OSSA 3QK1A 3O8DA 1GL0E 1HXEH 3EYDA 1KIGH 1TIOA 2OC8A 5DP7A 2P16A 3GDUA 3O8BA 2FTMA 2D26C 1QL7A 1O3AA 3RLYH 3MU5A 3F1SB 1WV7H 5FPTA 1HAGE 1S84A 1EAUA 3SNDA 3M37A 3GCNA 2CXVA 2HALA 2J38A 1A3EH 1QJ6B 3DHKH 3SGAE 1TNIA 1EZXC 3QDZB 3ZYEA 1F5RA 4K1EA 5PTPA 1HYLA 4Y8ZA 2ZNKH 1SGIB 2H2ZA 4MDSA 2C8YB 4ZUHA 1EKBB 1TX6A 1CT0E 3T5FH 1FY3A 1O2LA 1YPEH 4ZKNU 1IHTH 4AB8A 2ZU3A 1ZZZA 3KF2A 1EZUC 1C1MA 2ZGJA 1P57B 3H7OA 5G4BA 1H1BA 1TPOA 1AHTH 1C2DA 3ZVGA 1FLEE 1MBMA 7KMEH 3LT3A 3D49H 2GP9B 1TMTH 2SFAA 4NFEA 1YPKH 3M61U 4AFZA 1CA0C 1FMGA 1IQLA 3SGBE 2QCYA 2IPHA 2Z9KA 1ZMNA 1AD8H 1C1QA 4NG9H 4FUCA 4ZROA 2BDBA 5TJXA 1TA2A 2BY6X 5JB8S 5HGGA 4B75A 2ODPA 5EGMA 1DFPA 3S7HB 2BQ7B 1V2KT 1ZTLA 5IDKA 2HVXA 4IC5A 2ZHFH 2Z94A 1RGQA 3OY5U 1BRAA 1GCTC 4ZAEA 1PQAA 2FOHA 1D6WA 1RJXB 2J94A 2Y7ZA 3S9AA 4X8TH 5K0HA 1FI8A 1V2JT 1FIWA 1LCYA 3K6ZA 4LOYH 4UFEH 1QJ7B 4GHTA 4INLA 1GI6A 4HFPB 3SJOA 2GMTC 1AVXA 4FXGH 1HAVA 4ISHH 1EAIA 3RXRA 1MMJN 1VR1H 5EXNA 2FS9A 1FN6A 1P9SA 4ABGA 1KXBA 3SN8A 2A5IA 4AFSA 4AOQA 1C5SA 4Q80A 1SLVB 1NFYA 1J14A 4ABJA 2ANKH 1AO5A 2ILNA 2R2WU 4YO9A 3GY5A 3HKIB 2F9PA 5JBAS 2OC7A 1NROH 1TGTA 4AX9H 1BTPA 2BLOA 3SV7A 1FPCH 5DPAA 1UMAH 2BVSH 4IBLH 2CN0H 1T8LA 3RMOH 2TBSA 1O5BB 4Y8XA 1OWHA 1G3EA 3E0NB 4R0IA 2PKAB 3UNQA 4QT8C 2YOLA 1MKWH 4GVUA 2C93B 2FOBA 1L4ZA 1F0UA 1TFXA 1P2JA 2R0LA 1BIOA 3HKJB 2A4RA 1TGCA 2XRCA 2NU2E 2UUYA 2A32A 1FY8E 3TGIE 3HGNA 3ZZ9A 1C5MD 1OWJA 1HDTH 1ZRBA 1FAKH 4BXSA 4WVPE 2GKVE 5JBBS 1J8AA 3SU2A 1A5IA 1C2IA 4AORA 1C1TA 1EAXA 1AFEH 1UCYE 2J34A 1C2FA 4U30A 3BG8A 5EPYA 1F0SA 5DP8A 2PR3A 1G36A 2FTLE 2FI4E 2HPPH 1SGFA 3ZVDA 1P03A 4X2XA 3VB3A 1CHOG 4I7YH 3E6PH 1OWIA 4RN6A 3ZZAA 6GCHF 4NGAH 1EUFA 1ABIH 2NU1E 2GZ8A 3QUMP 2ZHEH 3ZYDA 3RM2H 4CBNA 4A1VA 3TJOA 3VB6A 3GY2A 1XX9A 2JETC 1C2MA 3NK8A 1ELEE 1ZPZA 1PPGE 1VGCC 2J2UA 3SNAA 2FZZA 1LPKB 5E8EH 1O3KA 1BTZA 1LVOA 5CMXH 5J4SA 1HPGA 1V2WT 1IQKA 2AGEX 3LJOA 2ZFFH 1EJAA 1PPCE 4ZHAA 1YPGH 4FVDA 5CE1A 2F9OA 2FIRH 1O3EA 3K9XB 5DP4A 3LGIA 1P2OA 1HAHH 2WPIS 1TMUH 2QY0B 4MNYA 2YNBA 3UNSA 3ZVFA 1GJ6A 1C2EA 1O2OA 1TMBH 1UTOA 1JRTA 1TNKA 5DP3A 5GCHG 5DP6A 2GGVB 1QA0A 4K8YA 4TY6A 4DGJA 3QTVH 4JCNA 2ZGHA 2OC0A 2G5VA 3KQDA 1IAUA 3U9AH 5LPRA 1UVTH 1TBRH 1C5YB 2F9UA 2VVUA 7ESTE 4IMQA 2AGGX 3BTTE 4LZ1H 5CHAB 3MU4A 4CRDA 1C9PA 3RU4D 1V2ST 2BY5X 4OS2A 5K7RA 2D8WA 3OY6U 1TQ0B 3A7XA 1TGBA 3B23B 1ESBA 4KTUA 5DP5A 1EZSC 4X8UH 1MKWK 1O3PB 1IOEA 2OC1A 3URDA 3RXVA 2A1DB 4GSOA 1G2MA 1O2ZA 1CSOE 3A7TA 1VITG 3PO1B 1KXDA 2C8WB 1QNJA 1JIRA 3RMLH 2BOHB 1ZTJA 4HTCH 2C8XB 3RXEA 2QXIA 3PMJA 5FBIA 1QTFA 1ANCA 3HK3B 2AS9A 1V2OT 3BEFB 1LQEA 3TVJB 2M5TA 1YPMH 1DVAH 2BB4A 1SI5H 1A4WH 3CS0A 2ALVA 3RC6A 1DDJA 1E36B 3MH4A 1BMMH 2TGPZ 3RMNH 2BDIA 3MNSA 1NN6A 4TWWA 4PROA 1K28D 1GCDA 3M36A 1B0FA 2ULLA 3RXOA 2EEKA 1PPZA 1BTWA 1HXFH 1LVYA 1C5QA 1UK2A 1LHCH 2FOFA 3PMHB 3A8DA 1GJ5H 5B6OA 1AFQC 3SJKA 3TNSA 1VJAU 3QWCH 2BX3A 2A2XH 2G55A 4AGJA 1HAOH 2ALPA 2VWLA 2KAIA 2VH6A 4AN7A 1PFXC 1MTNC 3E0PB 2TPIZ 1VCQA 3PMAB 2STAE 1RRKA 1Z1JA 3LOXA 2AERH 1O2QA 3URCA 1ZJKA 3SHCH 3BF6H 4K69A 5DJ7A 3MO6A 1LHDH 1J17T 1ELVA 3HATH 2WPMS 1BTUA 1SGFG 1MUEB 2AFQB 2BVRH 1UO6A 4GAWA 3SJ9A 3A83A 4IW4E 4IGDA 3UQVA 4X1NU 4JZDH 4MPVA 1O5CB 1CHOF 1G9IE 4A6LA 3U8TH 4YT6H 1QBVH 1O2GH 1G30B 1KLJH 4KTSA 1DS2E 2FOMB 1YLCA 4UFGH 5I46H 3QX5H 3WY8A 1SLWB 1P04A 3GYMA 1E34B 1O3IA 3C27B 3ENSB 3SU6A 3S7KB 2I6QA 1DITH 2BQ6B 1AE5A 5FCKA 1MQ5A 2VWNA 3HK6B 1BMNH 4BAKB 1MAYA 1QHRB 1AU8A 1UTPA 2GT8A 1Y3VA 3T28A 5E0JA 4FUEA 1BCUH 1C9TA 4OS1A 4TWYA 1X7AC 3ZZBA 1DWBH 4DCDA 4FUGA 2I6SA 1BHXF 2NU3E 1O38A 3RXCA 4X8SH 1E35B 1Y3YA 4IN1A 2SGFE 4K2YA 4BTIB 1P01A 1PYTD 2VIVA 2ZPRA 3BIUH 1VZQH 3RXSA 2ZFTA 3PLBA 4Y7AA 2PUXB 3KQEA 3CP7A 1D3DB 2PSYA 2Y7XA 5A8YA 3Q77A 3GY7A 1C5ZB 2PTCE 3O8RA 1D6RA 3L6PA 1CBWB 4AG1A 2R9PA 1YKTA 4Y7BA 3TPIZ 1GI8B 1AIXH 1VITH 3Q00A 2FMJA 3SV2H 3MMGA 1TPPA 3HGPA 1OKXA 4TPYA 2FLRH 2Y5FA 4ZXYH 1NS3A 1Y5AT 2BY7X 4I8LA 4CRAA 2EI8A 5FBEA 3ZZ6A 1VITF 3M5OA 3STJA 3PMBB 1A0HB 3A7YA 2VVCA 1UK4A 1JMOH 1CGIE 1ZGVA 2BXTH 2BHGA 2FOAA 1MAXA 4NIWA 1ORFA 2JKHA 4UEHH 5E0HA 3E8LA 1DOJA 5F6MA 1KTTB 3EGKH 3KGPA 1WTGH 1N6XA 1V2UT 1HLTH 2XWBI 4UD9H 1XKAC 2OINA 1WYKA 1OP2A 1UVOA 1XUHA 3F9FA 2BXUH 1GBMA 4MVNA 2CF8H 2THFB 4UDWH 2OQ5A 3ATKA 4NCYA 1HJ8A 1O0DH 2G00A 2O8WA 2ZZUH 1YM0A 1O2WA 1N6YA 1V2NT 1BOQA 1SB1H 1UTKA 1BQYA 1TNLA 2XYAA 1QA7A 1BT7A 3TNTA 2AH4X 4Y79A 4DIHH 3TITA 1P12E 1D4PB 2LPRA 4UE7H 4OGYA 3PTNA 1LPGB 2BD3A 2VVVA 2ZHDA 2WPHS 1GBLA 1P06A 1DSTA 2NWNA 4WJG2 3AW1A 4A92A 2A4OA 1EP6A 1ZOMA 2O8TA 1Q2WA 1RIWB 2R0KA 1HJAB 3E91A 3UR6A 2XC0A 5C1YA 1GHYH 1KY9A 2V0BA 4ZKSU 2GV7A 1CGJE 1U6QA 3A85A 3U1IB 2ZFSA 3GOVB 3E3TA 4WXIA 1C1OA 1O5DH 1XVMA 4DT7B 4WF8A 3EA9A 1ZGIA 2GD4B 1ZLRA 3GDSA 2XC5A 1BJUA 1SG8B 1GMCG 1ARCA 1ELFA 3KNXA 1GJ8B 3E16B 5F8XA 3MWIU 2QA9E 2XBVA 1HAYB 3P8OA 2HGTH 5DGJA 4D7GA 4JYUH 1P2MA 3KCGH 1KTSB 4GCHG 3VXEH 3T27A 4AZ2B 1D3QB 1O2RA 4D9QA 4OGXA 1GBHA 1CT2E 1OOKB 2CMYA 4BOHA 4Y76A 3ODFA 1C5LH 5FX6A 5L2ZH 1O5GH 3MNXA 3FVFB 1P9UA 2A45B 3V13A 1O3MA 3GY6A 3SW2B 2VNTA 1EB2A 1XUKA 5ESBA 4CRFA 2HWLB 2FI5E 2A7HA 1BUIA 1IQEA 1G3BA 2WUCA 2BOKA 2H6MA 4X6PA 1UTNA 2Y81A 4X6MA 2ZTYA 1V6DA 1LO6A 1SFQB 2UWOA 4X2YA 1ZPBA 3JZ1B 2Z3DA 1GBTA 4NSVA 4FUJA 3RU4T 4D76A 2XBWA 3RM0H 1AI8H 2GV6A 1FN8A 3SV9A 1AGJA 3OYPA 1AN1E 3LJJA 1OYTH 1C4V2 1TX8A 2ZGCA 3ZVEA 3KQBA 4FU8A 1O33