1E36B

Porcine pancreatic elastase complexed with (3s, 4s)n-para-nitrobenzenesulphonyl -3-ethyl-4-(carboxylic acid)pyrrolidin-2-one
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 'Ph-Jump' Crystallographic Analyses of Gamma-Lactam-Porcine Pancreatic Elastase Complexes
pubmed doi rcsb
molecule tags Hydrolase(serine protease)
molecule keywords ELASTASE
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2000-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1e36B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1e36B01
3WY8A 1C5MD 1Z6EA 4JK6A 6CHAB 3LOXA 1KYNA 1WCZA 1O3DA 1EZSC 1Q2WA 1GG6C 4X8VH 1TOCB 1FAKH 3TJNA 3AASA 1L0ZA 4ABHA 1D6RA 2FLBH 2W7SA 4CHAB 2A4OA 1ZJDA 1HYLA 1GHBG 2ZU3A 4KP0A 2ZGXH 1YPEH 5I25A 1GVZA 1XUJA 2V3HH 2KAIB 2OINA 4AGKA 1V2LT 2FIRH 3M5MA 5EODA 1DPOA 1W2KH 2HLCA 1UK4A 1FIWA 5A8ZA 2H1UA 3NUMA 4B75A 3KQDA 1QHRB 4FUIA 1J17T 3M7UA 1N8OB 3QTVH 3VB5A 2PTCE 5FXLA 1O2SA 3A7YA 2BY8X 3MO3A 3M3SA 1AFQB 2BD3A 3IG6B 2J38A 1V3XA 3LT3A 1OYTH 1JIMA 4MNVA 3M7QA 4KGAA 4X2XA 3SO3A 2DE9A 1E0FD 1NY22 2Z3DA 3K65B 5DGJA 2PWXA 1E37B 4I31A 2BXUH 4KELA 1X7AC 5CMXH 2PHBA 5E2OA 1C1NA 4K1SA 4X6PA 1V2QT 2BOKA 3MH4A 1PPHE 1FUJA 1GBMA 3R3GB 2ZTXA 1G3CA 2ZU4A 3LGUA 3TPIZ 2FMJA 1TNLA 3PM3A 2UUJB 1QL7A 1K1IA 3ZZ4A 3MYWA 1A3BH 1MBQA 3DFJA 1OXGA 1DM4B 1O2YA 1N6YA 2HPQH 1OWEA 1TNIA 1FZZA 3GDUA 3MMGA 3L3TA 1QFKH 1GI0A 4F49A 2H9EH 2ODQA 1U6QA 1UVOA 3W94A 3SORA 2BY5X 5LPEA 1C9TA 4FVDA 3UUZA 4HI3A 1A5GH 3T5FH 4XBCA 5L2YH 3P95A 9ESTA 1S83A 4NZLA 4YLQH 1THRH 3EQ0H 4ZAEA 4FXGH 1THPB 2RG3A 3LGYA 2WUBA 3E0PB 1HJ8A 4UD9H 1T8LA 1P2JA 2JH0D 4OS7A 4ABGA 1A0JA 3MH5A 2C4FH 4YTAA 2AGEX 4JYVH 2PKSC 5JBAS 4IN1A 4HTCH 4ZHMU 3MNSA 1V2TT 3F9HA 1GHBF 5FPYA 3DA9B 1WAYB 1EXFA 4Y10E 4XSKU 2V3OH 2I6SA 5JBTA 1ARCA 1NRQH 4JZDH 4F4OC 5EXLA 1PYTD 2BTCE 1QB6A 2ODYB 7GCHG 5HGGA 3HKJB 5LPFA 5TCCA 2Z9JA 2AGGX 2WPHS 4Q2KA 4IGDA 1QCPA 2H9TH 1Y8TA 2OQUA 5AFZH 2OC0A 3GY4A 1CGIE 1SGYE 3RXUA 1CT0E 1TQ0B 1BTHH 3NWUA 1C5QA 1C2JA 3DFLA 4MVNA 2P3TB 1TGNA 4B71A 1HFDA 3D62A 1H8IH 3ELAH 4WY3A 1TB6H 2IOTA 1AB9B 1F0SA 1O5DH 1OP0A 2G8TA 2ZDMA 2ZU2A 4NWKA 2ZG0H 2VH0A 1BMMH 1TNGA 2O8TA 4CH8B 1EZQA 3TK6A 3FANA 1BHXF 2FOFA 1DDJA 4ASHA 3UWJH 4LOYH 1KDQB 3GDSA 3CS0A 7LPRA 4MPVA 4BAMB 4I33A 3C1KA 3ZZ9A 2FLRH 1C5ZB 3MO6A 3GY7A 4HZHA 1CHGA 1EAIA 1Q31A 4A92A 4GPGA 2WPKS 1E36B 2G51A 5EU8A 2P3FH 1YC0A 4TYDA 1EPTB 1QY6A 1SLVB 2F9NA 1O5EH 2Q6FA 2FPZA 4XDEA 3E0NB 3A82A 3GCTF 2STAE 4MQAA 1AFQC 1IQIA 2O9QA 1FIZA 4YT7H 5ESBA 3SJOA 2FWWA 1O34A 1PQAA 1GBFA 3MU5A 5A0CA 2AYWA 1S0RA 3BG4C 4U32A 2P93A 1BZXE 1LDTT 1CA8B 2F91A 1W12U 1F5RA 4A6LA 3E16B 1O2XA 1O2IA 1ZTLA 2F3CE 2BDGA 2WPIS 1IQKA 4ZMAH 1PQ5A 5DO4H 1Y3UA 3SV8A 1Z8JB 2G00A 3S9AA 1FY4A 4K5ZA 5L6NH 1NPMA 2ZI2H 1ETTH 1A0HB 1AVWA 4K8BA 4AFSA 3RXEA 3Q3KA 2ANWA 7GCHF 1FNIA 1K28D 3LJOA 3T26A 3MNXA 1GJ6A 1QA7A 1BJUA 2ILNA 2ZCKP 1ZTKA 4WWYA 1SGFA 1IQLA 2CHAC 3O8BA 4MDSA 3GCNA 3OY5U 1E34B 3U9AH 1VITG 5J4QA 4Y7AA 1TBZH 2HPPH 1A1RA 4UFDH 5LH8A 1W7GH 4K8YA 2VU8E 4OS5A 4WF8A 1O3HA 1C5OH 1UK3A 3HPTB 4X0WU 1N6XA 2O8MA 3BTKE 2FTMA 1RS0A 2AFQB 1DXWA 1AB9C 1O5CB 1YGCH 3S9CA 1G32B 1KLTA 4JMYA 3KGPA 3RXSA 2OC7A 1WTHD 1C2LA 1P06A 4J1YA 5L2ZH 2BQWB 4K69A 1ACBE 4FU9A 2HWLB 3RM2H 2XC4A 2QGRA 3RXRA 3OX7U 4CREA 5JB9S 1VR1H 1SMFE 1W8BH 4RN6A 1C5UA 4ZHAA 1UMAH 2ZECA 1EB1H 1SL3A 4B76A 3KEEA 4DOQA 1RFNA 2EI7A 2ZCHP 1PQ8A 3LDXH 1NRNH 2A5IA 4YO9A 1FJSA 2P94A 3RU4D 4INHA 1YPGH 1SGQE 1DY8A 3LC3A 1N8OC 1MCTA 2ZO3H 2ZDAH 5A2MH 1YM0A 3DUXH 1P9SA 5HM9A 1TX7A 3KQCA 2ZEBA 1QL9A 4YOJA 4WXIA 2PUXB 3E3TA 1WQSA 5EGMA 1S5SA 2J9NA 3URCA 3LGIA 3I78A 2QXJA 3QZQA 1GBTA 4NIXA 1BTXA 1DS2E 2ANKH 1OS8A 3PMHB 5T6FA 1ELVA 1KLJH 5J4SA 1INCA 1ZPBA 1AHTH 4Y7BA 2AMDA 5IYTA 1P3EA 1LVBA 3RC6A 3KF2A 4FU7A 3RXJA 1K1OA 2G4UA 3RLWH 2ZKSA 1O37A 1QB1A 2BD4A 1AZZA 1GMDG 3HGNA 2ZHFH 1T8MA 2ZHDA 4U2WA 1TPAE 1C5RA 1D9IA 1WTGH 1RIWB 3BV9B 2GKVE 3ODFA 4CR5A 1YPLH 4X1QU 1WQVH 2H5DA 5EQSA 4D7FA 5C1XA 3LIWA 4KTSA 3ZZ7A 1GMCG 1KDQA 2FOHA 1YP9A 3FFGA 5EXMA 2YNBA 1O2MA 3W95A 1DLKB 1SQTA 2G52A 1EUFA 3LGTA 2ZFSA 4DVAU 2QCYA 3PMJA 1O2TA 1EATA 5JB8S 1GBIA 1TX6A 5E8EH 2GP9B 4ABBA 1UVTH 4UFGH 2VJ1A 1FI8A 1EAUA 1A7SA 3SGBE 3BTME 1QJ7B 2P59A 1HUTH 5AF9H 2FP7B 4AFQA 1SLWB 1MAXA 3RM0H 4FUJA 1BMLA 2VIQA 2H9HA 5JDUB 4OS2A 3PMAB 3SHCH 1ELAA 2ZQ2A 4CRBA 2C90B 1S0QA 1UTNA 1A5IA 5GDSH 4TY6A 3NPSA 2ZPQA 3TITA 3RXDA 3SGAE 3BEFB 3KNXA 1D3DB 3AVZA 3E90B 2Z9IA 1E38B 5C20A 3A7XA 4TWWA 1ANEA 1QQ4A 1ZGVA 3UNRA 1CE5A 4Q7XA 3RXTA 1MU8B 1V2OT 3FP8E 3LONA 4DJZB 4Q7ZA 4X2YA 3TU7H 3SV2H 4H6SB 1MQ5A 2A4GA 3RXIA 2QAAA 3QGNB 1ESTA 1T4VH 2XBVA 3UY9A 4MPXA 1XVMA 1DSTA 3BTGE 3MNCA 1QA0A 1EAXA 4MPWA 4WXVA 4WMEA 1BRBE 2WINI 2F9UA 3UR9A 1O3LA 3A7WA 1TAWA 2ZTZA 4Y76A 1ZSKA 3TH3H 1TWXB 3BTDE 1YPHE 2Q6DA 4WJG2 4UONA 3T29A 1ETSH 2BQ6B 1YKTA 2DUCA 1P2KA 1DFPA 2Y6TA 2VVUA 3P8GA 2BM2A 4DG4A 1ELTA 1ZSJA 2V35A 1UTJA 1HPGA 2ZFTA 5C1YA 4NSYA 3RU4E 3SNDA 2Y80A 4IS5A 2HGTH 3AW0A 4UEHH 1GJ7B 3PLKA 4X1PU 2C8XB 1UVUH 1C1OA 6GCHF 1Z1IA 2BY6X 1O2ZA 4O3TA 3VB3A 3ZVBA 2W5EA 4NA9H 3RXOA 4AFUA 1HRTH 2QV1A 2P3UB 3TK9A 2ZFPH 3M37A 2TGDA 1EOLA 1SGTA 5BPEA 1EPTC 1GBHA 1L4ZA 3LJJA 1OWHA 4A1VA 3SU2A 3ATKA 5GCHF 1GMCF 4RSPA 3GYLB 1G3DA 3B9FH 2JH6D 4B2AA 2J95A 3O8CA 1C2IA 3U8OH 1L2EA 2CJIA 5K7RA 1VJAU 2NU2E 1DY9A 2JH5D 1T7CA 2VH6A 3A7VA 4Q80A 2SGFE 3NKKA 3M5OA 2NU1E 1P2MA 3KN2A 4R8TB 1L4DA 2Y7ZA 1QRZA 4Y11E 1H9LB 1PFXC 2RA0A 4Z0KA 2GMTB 2WPLS 4IMQA 6CHAC 4IW4E 2XBYA 3P70B 2XWBI 5F6MA 4FUFA 2ZGBH 1BUIA 1SB1H 2BD8A 1BQYA 2ZQ1A 1XXFA 4OGXA 4NIWA 1XXDA 1AKSB 1GJ5H 1XUGA 2ZWLH 3L6PA 4FUHA 2KAIA 2B9LA 1ZGIA 4U01A 2I6QA 1QB9A 1XUKA 2Y81A 4X8TH 3ODDA 1RJXB 1MUEB 1Y3XA 4Y79A 1OWIA 1ELEE 1ZPCA 1QBVH 1K21H 3EAJA 4Q7YA 1V2NT 2R0KA 4GUXA 4X8SH 3UQVA 4KTUA 3RXLA 2AEIH 4X2VA 2IN2A 1AN1E 4JCNA 2Z9GA 5LGOA 1JMOH 1O2GH 1YPHC 3ESTA 2YNAA 1MTNC 1F0TA 2V6NA 1O36A 3QK1A 5F8ZA 1BTUA 2PGQB 3S7KB 1BOQA 1PQ7A 3TVJB 1FY1A 5FCRA 1NROH 2G4TA 1P3CA 5LPRA 1AQ7A 5EPYA 3A7TA 3VFEA 2A2QH 4SGBE 1SGEE 4GSOA 4NG9H 4YOIA 2XC0A 3K9XB 1WBGB 2QYIA 4ABJA 1C5WB 4DT7B 6ESTA 1EJNA 4A7IB 1P57B 2QC2A 1BRUP 1NZQH 3ATIA 2RDLA 4U30A 4X2WA 2F83A 3PO1B 2BD7A 3TNSA 1YCPK 2UUFB 1CVWH 3SNCA 2FI5E 3TH2H 5GIBA 1HV7A 2ODPA 1KTSB 2XC5A 2OCVB 3GCOA 1Z71A 4BTTB 3ZZ8A 1DUAA 1WSSH 1IQGA 4FUGA 2RA3A 1C2KA 3FAOA 1UJ1A 1IQJA 1L1NA 1V2MT 4XOJA 3UOUA 3VGCC 3ZYDA 3QWCH 1TNJA 5FX6A 3IWMA 1BRCE 2OUAA 1O2HA 2IPHA 4K1EA 4AX9H 1F7ZA 2V0BA 3VPKA 1LPGB 4NA7A 4Y6DA 3LU9B 1BJVA 1GDQA 4M7GA 4XFQA 1KLIH 4D7GA 4NWLA 1T31A 1C5XB 1N1LA 1GDUA 4ABEA 3T62A 8LPRA 1J9CH 1QGFA 3BTTE 2VGCC 4OS1A 1SGFG 1BMAA 1BDAA 1HAGE 1C5SA 1V2UT 5C5NA 1AE5A 1G36A 4AZ2B 1TGSZ 2BLQA 3SQHE 3V7TA 4WMDA 1MU6B 2OBOA 2WYGA 1TMBH 2PKSB 2NWNA 2LNCA 4ABDA 5FPTA 3H7OA 4AB9A 4HFPB 2SGQE 1ZHPA 8GCHF 1DWBH 2XXLA 3ZZCA 4AYYB 1SGRE 1YPJH 1XUIA 1ESBA 1O3IA 2GVFA 1XMNB 3UREA 1K1LA 2BDCA 1GBAA 1F5KU 2F9PA 1FDPA 2A2XH 3UNSA 1TYNA 1EPTA 2XCNA 2HRVA 1IQHA 1EAWA 2TGTA 1AUTC 2CHAB 1O2WA 3CS7A 4JZ1A 1IOEA 1Z8GA 1S85A 1ID5H 1YBWA 5DP8A 3TJUA 1BB0B 1GMDF 3KIDU 1ARBA 2Y5GA 1LTOA 1SGIB 4BANB 1LVYA 2W7UA 1TPOA 4Y8XA 1SQOA 2XYAA 1SFIA 3Q76A 3MU0A 3HKIB 5F8TA 2FEQH 4JYUH 5HM2A 1GBCA 1ZMNA 3PB1E 3MH6A 5E2PA 1C5PA 2ZTYA 3TGKE 1GI8B 4LZ1H 1Y5BT 3HK3B 3KQBA 4AG2A 4UDWH 3SHAH 1C2MA 1ELBA 3SGQE 4ZROA 3E6PH 4ZKNU 1JRSA 5EXNA 3P92A 4BXSA 4CRCA 1SC8U 2O8WA 4I8KA 1O2OA 2QA9E 1ELGA 2ZFQH 1D3PB 3LPRA 1GCDA 1C2FA 4NIVA 3M61U 3VXFH 5GCHG 1V2KT 1A5HA 1CT2E 3DT0H 2OQ5A 1ZHRA 3M5NA 1C1WH 1GVKB 1Z7KA 2BD2A 4I32A 1F92A 1C4V2 5GPIB 1OOKB 3KHVA 1VCPA 1HAPH 5JBBS 4DURA 2Y5HA 4ZKSU 1RGQA 3T27A 3EDXB 1SGCA 2Z3EA 1Z1JA 4X6NA 4TY7A 1ZRKA 4X1RU 3BN9A 3KQEA 2BB4A 1CT4E 1BRAA 1HXFH 2JETB 3RC5A 1ELDE 2ZNKH 1TLDA 4BTUB 2FODA 4O9VA 5AVDA 3ZZBA 3SJ9A 1ZRBA 4YZUA 1CBWC 1GG6B 1O2JA 4K3JA 1HAZB 2VVVA 4LXBH 1TGCA 1C1UH 2D2DA 2UWOA 4BNRA 1THSH 2CMYA 4IMZA 3D49H 4INKA 3MU4A 1EKBB 1P05A 3TIUA 2ZCLP 4CRGA 1GGDC 1BTPA 4XBBA 4NGAH 3SV7A 3A85A 5HMAA 3OYPA 4ISLA 1NESE 1NN6A 1BTYA 2FX6A 2Z9LA 3PLPA 3LH1A 2CF8H 3RXFA 2A4RA 1K1PA 2XNIA 2G5NA 3V3MA 3ZV8A 1P12E 4CRFA 3ZZAA 1TONA 1GJ8B 4X1NU 1A61H 3A86A 2R3YA 1J14A 1KXEA 1AKSA 3BIVH 2AS9A 1LHEH 3S0NA 1UTOA 4BXWA 5FCKA 3H7TA 1QRWA 2BLOA 3SNBA 4CBOA 1SFQB 1O5AB 1UHBA 1HB0B 3SNEA 3OY6U 1A3EH 1D3TB 4D9QA 3BTFE 3VB7A 2VWNA 2ANMH 1KXBA 4H4FA 5DK1A 1QBNA 1SR5C 1HAHH 4UFEH 1GHAF 1NU7B 2A1DB 3QDZB 3NZIA 1Y5AT 4OS6A 1GBDA 1NFUA 3TNTA 5FAHA 1YPMH 2ZHQH 4X6MA 5GJ4B 1O2RA 2C93B 4Y8ZA 2SFAA 3ZVFA 3B8JA 1YLDA 1GBKA 3ZVAA 5F8XA 1P0SH 2A0QB 3M7TA 2QXGA 5T3HA 1BCUH 1P9UA 1GCTC 1OSSA 5A0BA 5SGAE 3OU0A 3TJOA 2AIQA 2FOEA 2XBWA 1CU1A 2FTLE 2RCEA 4RKJB 3ZZ5A 1LHDH 1H1BA 1AU8A 2UUYA 3RXCA 3UQOA 5C2ZA 2VIVA 2GDDA 3DHKH 3D65E 2BXTH 3GISB 2BD5A 2WYJA 3A88A 1GVLA 3Q00A 1QL8A 5T6GA 4AFZA 4K2YA 1O5FH 3KCGH 2TGAA 1TRNA 5DJ7A 2PLXA 3PWBA 2C3SA 1UTMA 1P03A 2SGPE 3UIRA 3F9EA 3MU8A 4BAQB 4ISIH 2PW8H 2QF0A 1EZXC 3ZVCA 4ZKRU 5DPAA 1QURH 2QIQA 1SLXB 1C1PA 2A7JA 3U69H 1TNKA 1F5LA 4AN7A 3PV4A 3QTOH 3TK5A 1AI8H 2NU4E 1EX3A 5E0GA 3FP6E 1QRXA 2STBE 1C2GA 4CH2B 3ENSB 1S84A 1SHYA 2Z94A 4MPUA 4B74A 1AMHA 1TRMA 3MWIU 1GGDB 1C1SA 1JIRA 2QY0B 3B23B 3K2UA 1DVAH 1F2SE 1W11U 2GDEH 1W7XH 1ZMJA 1LQEA 2AGIX 3C27B 2BYAX 1V2PT 1T8NA 4AGJA 4NZQA 2SGDE 4YOGA 3U98H 1KXDA 5C1UA 1MCVA 2UUKB 1ZJKA 4D8NA 5ABWA 1B7XB 2VIDA 3L33A 1V2WT 2A32A 2ZZUH 2FOMB 3DD2H 3RLYH 1NO9H 4BTIB 3S69A 2BLVA 4CHAC 2XW9A 4UFFH 1NC6A 1YLCA 3VB6A 1AD8H 1V2RT 2SNVA 5C5OA 1UVPA 3SUFA 1VCWA 1P04A 1LKAA 3E8LA 1TMUH 2R3UA 2A45B 2Z6BD 3P8OA 1ZR0A 1HDTH 1ZTJA 3UOPA 2O8LA 4A5TS 1GI4A 1S6HA 2A5AA 1L1GA 1CA0B 1G30B 1CGJE 3SV6A 1SOTA 2A5KA 1LQDB 1EZUC 1TA2A 2Q1JA 2ZPRA 2Y82A 1W0YH 4FUCA 1MMJN 5FX5A 2HALA 1K1JA 4JZIA 2ZP0H 1CA0C 4DY7B 1YYY1 1LCYA 1IQNA 1QJ1B 4VGCC 2BY7X 1DE7H 4D9RA 1TNHA 3SNAA 4BAOB 2ZU1A 1AZ8A 1J8AA 1ESAA 2GCTC 3CENA 4H42U 2H2ZA 1OWKA 1T32A 1Q3XA 1HNEE 2FOAA 8GCHG 1MD8A 2ANYA 1TBQH 1NFXA 3SU1A 1O3PB 6LPRA 3BF6H 5ETXA 5EOKA 4DIIH 3K6ZA 1HAYB 1WUNH 1DICA 5JPMH 3SW2B 4Y71A 1GBEA 1SGNE 2C8ZB 1AUJA 1FN6A 3E1XB 3GCHC 2OP9A 1LKBA 1NFWA 1Z6JH 3PTBA 4AOQA 3A87A 5EW2H 4I8JA 4MLFB 1O38A 1OPHB 1DWDH 1LPKB 1O2UA 4ZHLU 1Z8RA 1ANDA 1HJ9A 2BDYA 3PWCA 3PTNA 2JETC 1OKXA 1C2HA 1GHXH 1CHOF 1RTFB 3OTJE 3UFAA 1FPHH 1O2NA 2ZU5A 4GVUA 2BMGB 2ESTE 3FP7E 5ESTE 2PSXA 1ZPZA 4QT8C 2B5TB 3BTWE 1Y3YA 3A80A 1L1JA 3VEQB 3U1IB 5GXPA 1LHCH 3A89A 1HCGA 4MNYA 1IQMA 1MTWA 3LC5A 4DGJA 4KTCA 4Y0ZE 1SGPE 2W3KA 1GI2A 2ULLA 1GI5A 1A46H 4ISOA 3SN8A 3M3VA 1K1NA 4E7RG 2F9VA 2ZFRH 2QXIA 1ABIH 3S7HB 2P8OB 5FBEA 1ETRH 1DITH 2J92A 1FAXA 2BVXH 2P16A 3LKWA 1GJ4H 2FOBA 1FV9A 1VGCC 3Q3YA 4A1XA 1C4U2 4WH8A 1D3QB 1UTKA 3LGVA 1MD7A 1G2LA 3TGIE 1GI7B 2R2MB 3I29A 2PKAA 1J15A 2OC8A 3QZRA 3O8DA 3P17H 2BZ6H 2AMPA 4GCHG 1GBLA 2QN5T 4MG3A 2ZDNA 1CHOG 1H9IE 5DP7A 2PSYA 5AFYH 1GI9B 5E0JA 1BTWA 1GMHG 1UTPA 2AERH 1HLTH 3QN7A 1GPZA 1J16A 3A8BA 2FO9A 3LH3A 2DE8A 1DUEA 5PTPA 4LZ4B 3SV9A 2BZAA 3NXPA 2G81E 4ZUHA 1GJCB 2ZC9H 1P2IA 1CGHA 2BX4A 3V0XA 3KL6A 3RMOH 1GL0E 4ESTE 1UK2A 1NU9A 1TMTH 4Z6AH 3JZ2B 4NIYA 5CE1A 3UWIA 1HJAB 1HGTH 2OBQA 4CR9A 2SGEE 1KXCA 1V6DA 2ALPA 2XWAA 2VGCB 2CXVA 1BIOA 1HAXB 1TGBA 2FYQA 2O8UA 4GAWA 8ESTE 1DT2A 1GI6A 5G4BA 4XBDA 3O8RA 1C9PA 2FXRA 1KTTB 1G2MA 3SU6A 2G55A 2VB0A 2ZGCA 3SUDA 1MH0A 2GZ8A 1PPBH 1WYKA 2WV5A 2HNTF 3GY6A 3RXVA 2XRCA 1LHFH 2VWMA 2GZ9A 4ZKOU 1FY3A 3RXHA 3PROA 1PPFE 2HVXA 1RXPA 3HGPA 5AHGH 1RRKA 4JZEH 2Z9KA 4TWYA 2FX4A 3BSQA 3SUEA 1GBJA 3K6YA 1UTQA 2GX4A 4I8LA 4X6OA 2VNTA 2GTBA 4ZXYH 4HGCA 1TFXA 1S81A 3ZVDA 4Y8YA 2R0LA 2GT8A 4GLYA 3SBKA 2Y5FA 2BHGA 3SJKA 3A83A 3M35A 1FXYA 1FONA 2QXHA 3BTQE 1IHSH 2ZHEH 1MTSA 1AWHB 2J34A 1SOZA 1O35A 1ZHMA 2P95A 3VB4A 1P10A 2GT7A 1JBUH 2FYRA 1TABE 2FOCA 5DP4A 1P09A 4I8GA 3U1JB 1GHAG 4MNWA 1XVOA 1O3BA 4IC5A 2GGVB 1C1MA 1WV7H 1KIGH 2ALVA 5EQRA 4FU8A 2H6MA 3AAVA 3RDZA 1DOJA 5JYIA 1EQ9A 1EB2A 1B0EA 5K0HA 3T2NA 3H5CB 4NCYA 2OD3B 4B2BA 2XBXA 1PYTC 4WVPE 2ZDVH 1VITH 2BX3A 2FI4E 4FVBA 1GWAA 2VIPA 5A09A 1NRRH 1CSOE 5DP9A 1WOFA 1QNJA 2TRMA 1HIAB 1V2JT 3TH4H 1ELCA 2EEKA 3BEUA 1OWDA 1W14U 2F9OA 3QO6A 1YF4A 1VITF 1QJ6B 1T8OA 1AFEH 1UO6A 1C2DA 1O3CA 1AY6H 4BAKB 4CRDA 1E35B 2H5CA 1LHGH 3GY5A 4O3UA 1Y3VA 1IHTH 3MOCA 3PMBB 4ZH8A 1BBRE 3RXAA 2VIOA 1PPGE 2BOHB 2PUQH 3RXKA 1GMHF 3BTEE 2G5VA 1K2I1 1BTZA 3BIUH 2D1JA 2CN0H 1XKBC 1DWCH 1LO6A 1NTPA 3ZV9A 1C5LH 1C1TA 2PKAB 3RMLH 2ZPSA 4ISHH 2WV4A 2GCHF 4ABFA 1DANH 1DSUA 1NS3A 1GJBB 1BA8B 5C3NA 2FZZA 1YPKH 3RXBA 1O5BB 1QBOA 4I8HA 3G01A 3SU0A 1XM1A 2NU0E 3JZ1B 3ZVEA 2W26A 1C1VH 3FZZA 3RU4T 2BDHA 2CGAA 2P8OC 3S9BA 3U8TH 5A8XA 2FI3E 3SUGA 1AIXH 2PR3A 1VCQA 1MTUA 3ATMA 3A8DA 3RP2A 4K1TA 2Q6GA 1AVXA 1XKAC 1WU1A 1P8VC 1OX1A 4AB8A 4LK4A 3MI4A 3A81A 4B2CA 4MTBA 4THNH 1EASA 1AO5A 1UCYE 1C1QA 1ZOMA 2WPMS 3ATLA 2BVSH 4INLA 2PGBB 2EA3A 1OP8A 4X1SU 4XE4A 3V12A 4B1TA 1LPZB 5E0HA 1NRPH 3EGKH 4OS4A 3RC4A 3BEIB 5FHTA 5DP5A 1W10U 1SQAA 5I46H 4K60A 3LGWA 1SG8B 2TPIZ 2ZIQH 4YT6H 1AVGH 4ABAA 5A8YA 3GCTG 2B0FA 2VIWA 3OSYA 1G37A 1ELFA 1LMWB 3GOVB 2M5TA 2ZA5A 3BTHE 1O3AA 2BY9X 1F0RA 2HNTC 4GHQA 3CP7A 1OWJA 3EE0B 4YESB 2GV6A 1XX9A 1ZSLA 4BOHA 2IJOB 1P2OA 2SNWA 3GDVA 2GD4B 1GJAB 1C2EA 2J94A 9LPRA 2JKHA 1O32A 4DW2U 1P01A 1LVOA 4FUEA 2AIPA 3VXEH 3P6ZB 4B73A 3ZZ3A 1A2CH 3ITIA 1SSXA 1G3EA 3P8FA 1JRTA 7ESTE 1PPEE 5EPNA 3ATWA 4IN2A 5C67A 1MKWH 5BRRE 1T4UH 2TGPZ 1O2PA 3QGJA 3T25A 1GJ9B 3RMMH 1TOMH 4Y0YE 1NT1A 1C4Y2 3BG8A 5GWZA 1O3JA 2QF3A 3T28A 1BBRH 5FBIA 1PPZA 1K22H 1VJ9U 1MZAA 5B6OA 1MKWK 1F0UA 1YCPM 4IC6A 1GDNA 3GY3A 4FUDA 2UWLA 1FLEE 6GCHG 2BQ7B 1G3BA 1JOUB 1O3FA 1B5GH 2W3IA 4AG1A 3RMNH 1IAUA 2B8OH 1XUHA 3F1SB 4ZXXH 1FQ3A 3URDA 3MFJA 1MBMA 1UHBB 1EP6A 3SJ8A 1TGTA 2TBSA 3QX5H 4BAHB 3HATH 2FDAA 3EYDA 1KSNA 5A0AE 3F9GA 1BITA 4YM9A 1ANCA 3UTUH 1EJAA 1P2NA 3GYMA 1TALA 1UCYK 2J4IA 1ABJH 2R2WU 2FESH 1OP2A 2OC1A 5F03A 1MQ6A 1EJMA 1S6FA 3ZYEA 3STIA 2PFEA 3AAUA 2BDIA 1B0FA 1C5TA 1FMGA 1DXPA 1H9HE 1O3KA 1PJPA 3SU3A 1O3NA 1O3EA 1TA6A 5TJXA 3SU4A 1Z8IB 1Y3WA 3NCLA 4GCHF 3SI3H 4JYTA 2WUCA 4O03A 1PPCE 1SHHB 1QTFA 2VWLA 2TIOA 1UCYH 4WH6A 1O39A 5CHAB 3MHWU 1GHZA 1GHYH 4GHTA 4UE7H 1LVMA 1YCPH 1MKXH 1K1MA 2GCTB 1C5VA 2YOLA 2SGAA 2PV9B 3R0FA 3M3TA 1TQ7B 3D23A 5IDKA 3RXMA 2D26C 2ZDKA 3F9FA 1SVPA 4H6TA 3RXGA 3STJA 4NFFA 1AE8H 1DWEH 1KXFA 1AWFH 3A8AA 2FOGA 2Z3CA 1UTLM 3SZNA 3P8NA 3GY2A 2BDBA 3U8RH 2OTVA 3I77A 1HBTH 4CRAA 1H4WA 3SQEE 3N7OA 1DX5M 1TPPA 2VWOA 1D6WA 1BBRK 1RIWC 4DIHH 4I7YH 1ZLRA 1C1RA 1CQQA 1ORFA 2BDAA 5CHAC 2XCFA 3HK6B 2FS8A 3MH7A 1KXAA 4AORA 2K1QA 2WPJS 1GHWH 1O2LA 1O2QA 1OYQA 1GJDB 1VGCB 4CBNA 2NU3E 2AH4X 2GMTC 1JWTA 3PYHA 1HIAA 3ZZDA 1W13U 1NM6A 2VINA 2THFB 2FS9A 1TE0A 1GCTB 1FN8A 1TIOA 1RTLA 2ZHWH 2ZGJA 1GHVH 2BLWA 2ZGHA 1K9OE 3IITA 2BVRH 2EI6A 2PTNA 1C5YB 3VGCB 1IQFA 1CBWB 3V13A 4TPYA 2A31A 2CF9H 2C8YB 1O3OA 3TGJE 1HAIH 1P02A 4DCDA 4OGYA 3A7ZA 3MO9A 1MZDA 3MNBA 4VGCB 1SBWA 1ANBA 3Q3XA 1O3GA 3Q77A 2EI8A 3GICB 3MTYA 4NA8A 3RUOA 3QLPH 1NRSH 1TBRH 2HNTE 3M5LA 1W0ZU 2F9BH 4JK5A 4PROA 1KY9A 2Y7XA 5HYOA 1GL1A 1FY8E 2A4QA 4FUBA 5JBCS 1HAVA 2D8WA 4JZFH 1GI3A 3E91A 4NFEA 2ZDLA 1O33A 4ABIA 1W3CA 1TPSA 3M36A 3SU5A 4E06H 1MKXK 3GY8A 1TX8A 3MU1A 2EC9H 1VZQH 1ZYOA 3TJVA 4YLUA 3F68H 2AMQA 1AGJA 1A0LA 5EG4A 1V2VT 1HJAC 1O3MA 1CO7E 3PO1C 1RTKA 1GI1A 4R0IA 5DP6A 1M9UA 2Z7FE 3SOSA 1S82A 5FPSA 1SI5H 3A84A 1HXEH 1A4WH 1O31A 1V2ST 1SLUB 4D76A 2GCHG 2B7DH 4X8UH 1ZMLA 4E05H 3NK8A 4RKOB 4J2YB 4SGAE 4TPIZ 5TCAA 1FPCH 2ZF0H 3PLBA 8KME2 1C5NH 1QQUA 3GCHB 1ZZZA 2R9PA 1O5GH 2BD9A 1JXPA 1UVSH 1NFYA 1TRYA 1O30A 3FZDA 1XUFA 3A8CA 1GBBA 2C8WB 1FY5A 1P2QA 4O97A 4KKDA 2ASUB 3ZVGA 1EP5A 3BG4B 2XTTB 3UPEA 2J2UA 5EQQA 1IQEA 2VVCA 1HAOH 2LPRA 2OLGA 2A7HA 1D4PB 3SJIA 3SI4H 3RXPA 1Y5UT 4A1TA 3FVFB 3UR6A 4ISNA 5DP3A 1RD3B 7KMEH 1H8DH 3TLOA 1O0DH 1HAVB 3EA7A 4NSVA 1QR3E 4AYVB 1DLEA 2GZ7A 2HOBA 4E7NA 1O2KA 3EA8A 5H4IB 5T6DA 1BMNH 3QUMP 1BT7A 4MNXA 1QIXB 1MTNB 3ZZ6A 1O2VA 3RXQA 1MAYA 2OXSA 5DKMA 4IBLH 2A7CA 4WMFA 1SGDE 2FM2A 3F6UH 1P11E 1G9IE 1SPJA 1Y59T 5HXFA 1MTVA 1EOJA 2UWPA 3UNQA 2GV7A 2CV3A 3EA9A 1BHXB 3AW1A 2ZFFH 5EW1H 5L30H 5DG6A
chains in the Genus database with same CATH superfamily
3WY8A 1C5MD 1Z6EA 4JK6A 6CHAB 3LOXA 2L6OA 1E79D 1KYNA 1WCZA 1O3DA 1EZSC 1Q2WA 1GG6C 4X8VH 2KCPA 1TOCB 1FAKH 3TJNA 3AASA 1L0ZA 4ABHA 1D6RA 2FLBH 2W7SA 4CHAB 2A4OA 1ZJDA 1HYLA 1GHBG 2ZU3A 4KP0A 2ZGXH 1YPEH 2WSSD 5I25A 1GVZA 1XUJA 2V3HH 2KAIB 2OINA 4AGKA 1V2LT 2FIRH 3M5MA 5EODA 1DPOA 1W2KH 2HLCA 1UK4A 1FIWA 5A8ZA 2H1UA 2J98A 3NUMA 4B75A 3KQDA 1QHRB 4FUIA 1J17T 3M7UA 1N8OB 3QTVH 3VB5A 2PTCE 5FXLA 1O2SA 3A7YA 2BY8X 3MO3A 3M3SA 1AFQB 2BD3A 3IG6B 2J38A 1V3XA 3LT3A 1OYTH 1JIMA 4MNVA 3M7QA 4KGAA 4X2XA 3SO3A 2DE9A 1E0FD 1NY22 2Z3DA 3K65B 5DGJA 2PWXA 1E37B 4I31A 2BXUH 4KELA 2KCOA 1X7AC 5CMXH 2PHBA 5E2OA 1C1NA 4K1SA 4X6PA 1V2QT 2BOKA 3MH4A 1PPHE 1FUJA 1GBMA 3PRBA 3R3GB 2ZTXA 1G3CA 2ZU4A 3LGUA 3TPIZ 2FMJA 1TNLA 3PM3A 2UUJB 1QL7A 1K1IA 1WDIA 3ZZ4A 3MYWA 1A3BH 1MBQA 2V7QD 3AK5A 3DFJA 1OXGA 1DM4B 1O2YA 1N6YA 5EJ1A 2HPQH 1OWEA 1TNIA 1FZZA 3GDUA 3MMGA 3L3TA 1QFKH 1GI0A 4F49A 2H9EH 2ODQA 1U6QA 1UVOA 3W94A 3SORA 2BY5X 5LPEA 1C9TA 4FVDA 3UUZA 4HI3A 1A5GH 3T5FH 4XBCA 5CHBA 5L2YH 2CK3D 3P95A 9ESTA 1S83A 4NZLA 4YLQH 1THRH 1NBME 3EQ0H 4ZAEA 4FXGH 2AHME 1THPB 2RG3A 3LGYA 2WUBA 3E0PB 1HJ8A 4UD9H 1T8LA 2QF5A 1P2JA 3MQKC 2JH0D 4OS7A 4ABGA 1A0JA 1OHHD 3MH5A 2C4FH 4YTAA 2AGEX 4JYVH 2PKSC 5JBAS 3U28C 4IN1A 4HTCH 4ZHMU 3MNSA 1V2TT 3F9HA 1GHBF 5FPYA 4Q63A 3DA9B 1WAYB 1EXFA 4Y10E 4XSKU 2V3OH 2I6SA 5JBTA 1S6LA 1ARCA 1NRQH 2M2AA 4JZDH 4F4OC 5EXLA 1PYTD 2BTCE 1QB6A 2ODYB 7GCHG 5HGGA 3HKJB 5LPFA 5TCCA 2Z9JA 2AGGX 2WPHS 4Q2KA 4IGDA 1QCPA 2H9TH 1Y8TA 2OQUA 5AFZH 2OC0A 3GY4A 1CGIE 1SGYE 2YMSC 3RXUA 1CT0E 1TQ0B 1BTHH 3NWUA 4Q4LA 1C5QA 1C2JA 3DFLA 4MVNA 2P3TB 1TGNA 4B71A 1HFDA 3D62A 1H8IH 3ELAH 4WY3A 1TB6H 2IOTA 1AB9B 1F0SA 1O5DH 1OP0A 2G8TA 2ZDMA 2ZU2A 4NWKA 2ZG0H 2VH0A 1BMMH 1TNGA 2O8TA 4CH8B 1EZQA 1H8HD 3TK6A 3FANA 4RI0A 1BHXF 2FOFA 1DDJA 3F2GA 4ASHA 3UWJH 4LOYH 1KDQB 3GDSA 2PP6A 3CS0A 7LPRA 4MPVA 4BAMB 4I33A 3C1KA 3ZZ9A 2FLRH 1C5ZB 3MO6A 3GY7A 3OTPA 4HZHA 1CHGA 1EAIA 1Q31A 4A92A 4GPGA 2WPKS 1E36B 2G51A 5EU8A 2P3FH 1YC0A 4TYDA 1EPTB 1QY6A 1SLVB 2F9NA 1O5EH 2Q6FA 2FPZA 4XDEA 3E0NB 3A82A 3GCTF 2STAE 4MQAA 1AFQC 1IQIA 2O9QA 1FIZA 4I86A 4YT7H 5ESBA 3SJOA 2FWWA 1O34A 1PQAA 1GBFA 3MU5A 5A0CA 2AYWA 1S0RA 3BG4C 4U32A 2P93A 1BZXE 1LDTT 1CA8B 2F91A 1W12U 1F5RA 4A6LA 3E16B 1O2XA 1O2IA 1ZTLA 2F3CE 2BDGA 2WPIS 1IQKA 4ZMAH 1PQ5A 5DO4H 1Y3UA 3SV8A 1Z8JB 2G00A 3S9AA 1FY4A 4K5ZA 5L6NH 1NPMA 2ZI2H 1ETTH 1A0HB 1AVWA 4K8BA 3N99A 4AFSA 3RXEA 3Q3KA 2ANWA 7GCHF 1FNIA 1K28D 3LJOA 3T26A 3MNXA 1GJ6A 1QA7A 1BJUA 3OEED 2ILNA 2ZCKP 1ZTKA 4WWYA 1SGFA 1IQLA 2CHAC 3O8BA 4MDSA 3GCNA 3OY5U 1E34B 3U9AH 1VITG 5J4QA 4Y7AA 1TBZH 2HPPH 1A1RA 4UFDH 5LH8A 1W7GH 4K8YA 2VU8E 4OS5A 4WF8A 1O3HA 1C5OH 1UK3A 3HPTB 4X0WU 1N6XA 2O8MA 3BTKE 2FTMA 1RS0A 2AFQB 1DXWA 1AB9C 1O5CB 1YGCH 3S9CA 1G32B 1KLTA 4JMYA 3KGPA 3RXSA 2OC7A 1WTHD 1C2LA 1P06A 4J1YA 5L2ZH 1YLNA 2BQWB 4K69A 1ACBE 4FU9A 2HWLB 3RM2H 2XC4A 2QGRA 3RXRA 3OX7U 4CREA 5JB9S 1VR1H 1SMFE 1W8BH 4RN6A 1C5UA 4ZHAA 1UMAH 2ZECA 1EB1H 1SL3A 4B76A 3KEEA 2K8IA 4DOQA 1RFNA 2EI7A 2ZCHP 1PQ8A 3LDXH 1NRNH 2A5IA 4YO9A 1FJSA 2P94A 3RU4D 4INHA 1YPGH 1SGQE 1DY8A 2J5UA 3LC3A 1N8OC 1MCTA 2ZO3H 3F2FA 2ZDAH 5A2MH 1YM0A 3DUXH 1P9SA 5HM9A 1TX7A 3KQCA 3WWBA 2ZEBA 1QL9A 4YOJA 4WXIA 2PUXB 3E3TA 1WQSA 5EGMA 1S5SA 2J9NA 3URCA 3LGIA 3I78A 2QXJA 3QZQA 1GBTA 4NIXA 1BTXA 1DS2E 2ANKH 1OS8A 3PMHB 5T6FA 1ELVA 2V3MA 1KLJH 5KGOA 5J4SA 1INCA 1ZPBA 1AHTH 4Y7BA 2AMDA 5IYTA 1P3EA 1LVBA 3RC6A 3KF2A 4FU7A 3RXJA 1K1OA 2G4UA 3RLWH 2ZKSA 1O37A 1QB1A 2BD4A 1AZZA 1GMDG 3HGNA 2ZHFH 1T8MA 2ZHDA 4U2WA 3OEHD 1TPAE 1C5RA 1D9IA 1WTGH 1RIWB 3BV9B 3PRDA 2GKVE 3ODFA 4CR5A 1YPLH 4X1QU 2WPDD 1WQVH 1WXRA 2H5DA 5EQSA 4D7FA 5C1XA 3LIWA 4KTSA 3ZZ7A 1GMCG 1KDQA 2FOHA 1YP9A 3FFGA 5EXMA 2YNBA 1O2MA 3W95A 1DLKB 1SKYE 1SQTA 2G52A 1EUFA 3LGTA 2ZFSA 4DVAU 2QCYA 3PMJA 1O2TA 1EATA 5JB8S 1GBIA 1TX6A 5E8EH 2GP9B 3KQ5A 4ABBA 1UVTH 4UFGH 2VJ1A 1FI8A 1EAUA 1A7SA 3SGBE 3BTME 1QJ7B 2P59A 1HUTH 5AF9H 2FP7B 5DN6D 4AFQA 1SLWB 1MAXA 3RM0H 4FUJA 1BMLA 2VIQA 2H9HA 5JDUB 4OS2A 3PMAB 3SHCH 3FKSD 1ELAA 1BMFD 2ZQ2A 4CRBA 2C90B 1S0QA 1UTNA 1A5IA 5GDSH 4TY6A 3NPSA 2ZPQA 3TITA 3RXDA 3SGAE 3BEFB 3KNXA 1D3DB 3AVZA 3E90B 2Z9IA 1E38B 5C20A 3A7XA 4TWWA 1ANEA 1QQ4A 1ZGVA 3UNRA 1CE5A 4Q7XA 3RXTA 1MU8B 1V2OT 3FP8E 3LONA 4DJZB 4Q7ZA 4X2YA 3TU7H 3SV2H 4H6SB 1MQ5A 2A4GA 3RXIA 2QAAA 3QGNB 1ESTA 1T4VH 3KYFA 2XBVA 3UY9A 3DSPA 4MPXA 1XVMA 1DSTA 3BTGE 3MNCA 1QA0A 1EAXA 4MPWA 4WXVA 4WMEA 1BRBE 2WINI 2F9UA 3UR9A 1O3LA 3A7WA 1TAWA 2ZTZA 4Y76A 1ZSKA 3TH3H 1TWXB 3BTDE 1YPHE 2Q6DA 4WJG2 4UONA 3T29A 1ETSH 2BQ6B 1YKTA 2DUCA 1P2KA 1DFPA 2Y6TA 2VVUA 3P8GA 2BM2A 4DG4A 1ELTA 1ZSJA 2V35A 1UTJA 2JJ2D 2F4LA 1HPGA 2ZFTA 5C1YA 4NSYA 3DCLA 3RU4E 3SNDA 2Y80A 4IS5A 2HGTH 3AW0A 4UEHH 1GJ7B 3PLKA 4X1PU 1W0JD 2C8XB 1UVUH 1C1OA 6GCHF 1Z1IA 2BY6X 1O2ZA 4O3TA 3VB3A 3ZVBA 2W5EA 4NA9H 3RXOA 4AFUA 1HRTH 2QV1A 2P3UB 3TK9A 2ZFPH 3M37A 2TGDA 1EOLA 1SGTA 5BPEA 1EPTC 1GBHA 1L4ZA 3LJJA 1OWHA 4A1VA 3SU2A 3ATKA 5GCHF 1GMCF 4RSPA 3GYLB 2WV9A 1G3DA 3B9FH 2JH6D 4B2AA 4XD7D 2J95A 3O8CA 1C2IA 3U8OH 1L2EA 2CJIA 5K7RA 1VJAU 2NU2E 1DY9A 2JH5D 1T7CA 2VH6A 3A7VA 4Q80A 2SGFE 3NKKA 3M5OA 2NU1E 1P2MA 3KN2A 4R8TB 1L4DA 3F2HA 4ACBA 2Y7ZA 1QRZA 4Y11E 1H9LB 1PFXC 2RA0A 4Z0KA 2GMTB 2WPLS 4IMQA 6CHAC 4IW4E 2XBYA 3P70B 2XWBI 5F6MA 4FUFA 2ZGBH 5FL7D 1BUIA 1SB1H 2BD8A 1BQYA 2ZQ1A 1XXFA 4OGXA 4NIWA 1XXDA 1AKSB 1GJ5H 1XUGA 2ZWLH 3L6PA 4FUHA 2KAIA 2B9LA 1ZGIA 3WWFA 4U01A 2I6QA 1QB9A 1XUKA 2Y81A 4X8TH 3ODDA 1RJXB 1MUEB 1Y3XA 4Y79A 3W1EA 1OWIA 1ELEE 4Z1MD 1ZPCA 1QBVH 4F55A 1K21H 3EAJA 4Q7YA 1V2NT 2R0KA 4GUXA 4X8SH 3UQVA 4KTUA 3RXLA 2AEIH 2VBCA 4X2VA 3OE7D 2IN2A 1AN1E 4JCNA 2Z9GA 5LGOA 1JMOH 1O2GH 1YPHC 3ESTA 2YNAA 1MTNC 1F0TA 2V6NA 1O36A 3QK1A 5F8ZA 1BTUA 2PGQB 3S7KB 1BOQA 1PQ7A 5KEDA 3TVJB 1FY1A 4ACAA 5FCRA 1NROH 2G4TA 1P3CA 5LPRA 2IJD1 1AQ7A 5EPYA 3A7TA 3VFEA 2A2QH 4SGBE 1SGEE 4GSOA 4NG9H 4YOIA 2XC0A 3K9XB 1WBGB 2QYIA 4ABJA 1C5WB 4DT7B 6ESTA 2LP6A 1EJNA 4A7IB 1P57B 2QC2A 1BRUP 1NZQH 3ATIA 2RDLA 4U30A 4X2WA 2F83A 3PO1B 2BD7A 3TNSA 1YCPK 2UUFB 1CVWH 3SNCA 2FI5E 3TH2H 5GIBA 1HV7A 2ODPA 1KTSB 2XC5A 5EJLA 2OCVB 3FOAA 3GCOA 1Z71A 4BTTB 3ZZ8A 1DUAA 1WSSH 1IQGA 4FUGA 2RA3A 1C2KA 1MABB 1UJ1A 3FAOA 1IQJA 1L1NA 1V2MT 4XOJA 3UOUA 3VGCC 3ZYDA 3QWCH 1TNJA 5FX6A 3IWMA 1BRCE 2OUAA 1O2HA 2IPHA 4K1EA 4AX9H 1F7ZA 2V0BA 3VPKA 1LPGB 4NA7A 4Y6DA 3LU9B 1BJVA 1GDQA 4M7GA 4XFQA 1KLIH 4D7GA 4NWLA 1T31A 1C5XB 1N1LA 1GDUA 4ABEA 3T62A 8LPRA 1J9CH 1QGFA 3BTTE 2VGCC 4OS1A 1SGFG 1BMAA 1BDAA 1HAGE 3CNRA 1C5SA 1V2UT 5C5NA 1AE5A 1G36A 4AZ2B 1TGSZ 2BLQA 3SQHE 3V7TA 4WMDA 1MU6B 2OBOA 2WYGA 1TMBH 2PKSB 2NWNA 2LNCA 4ABDA 5FPTA 3H7OA 3FO8D 4AB9A 4HFPB 2SGQE 1ZHPA 8GCHF 1DWBH 2XXLA 3ZZCA 4AYYB 1SGRE 1YPJH 1XUIA 1ESBA 1O3IA 2GVFA 1XMNB 3UREA 1K1LA 2BDCA 3SYJA 1GBAA 2KFWA 1F5KU 2F9PA 1FDPA 1COWD 2A2XH 1TYNA 1EPTA 3UNSA 2XCNA 2HRVA 1IQHA 1EAWA 2TGTA 3F3BA 1AUTC 2CHAB 1O2WA 3CS7A 4JZ1A 1IOEA 1Z8GA 1S85A 1ID5H 1YBWA 5DP8A 3TJUA 1BB0B 1GMDF 3KIDU 1ARBA 2Y5GA 1LTOA 1SGIB 4BANB 1LVYA 2W7UA 1TPOA 4Y8XA 1SQOA 2XYAA 1SFIA 3Q76A 3MU0A 4AC9A 3HKIB 5F8TA 2FEQH 1E1RD 4JYUH 5HM2A 1GBCA 1ZMNA 3PB1E 3MH6A 5E2PA 1C5PA 2ZTYA 3TGKE 1GI8B 4LZ1H 2KX4A 1Y5BT 3HK3B 5DSFA 3KQBA 4AG2A 4UDWH 3SHAH 1C2MA 1EFRD 1ELBA 3SGQE 4ZROA 3E6PH 4ZKNU 1JRSA 1UW7A 5EXNA 3P92A 4BXSA 4CRCA 1SC8U 2O8WA 2XNDD 4I8KA 1O2OA 2QA9E 1ELGA 2ZFQH 1D3PB 3LPRA 1GCDA 1C2FA 4NIVA 3M61U 2YMSD 3VXFH 5GCHG 1V2KT 1A5HA 1CT2E 3DT0H 2OQ5A 1ZHRA 3M5NA 1C1WH 1GVKB 1Z7KA 2BD2A 4I32A 1F92A 1C4V2 5GPIB 1OOKB 3KHVA 1VCPA 1HAPH 5JBBS 4DURA 2Y5HA 4ZKSU 1RGQA 3T27A 3SZEA 3EDXB 1SGCA 2Z3EA 1Z1JA 4X6NA 4TY7A 1ZRKA 4X1RU 3BN9A 3KQEA 2BB4A 1CT4E 1BRAA 1HXFH 2JETB 3RC5A 1ELDE 2ZNKH 1TLDA 4BTUB 2FODA 2HLDD 4O9VA 5AVDA 3ZZBA 3SJ9A 1ZRBA 4YZUA 1CBWC 1GG6B 1O2JA 1YWUA 4K3JA 5C0UA 1HAZB 2VVVA 4LXBH 1TGCA 1C1UH 2D2DA 2UWOA 4BNRA 2K0QA 1THSH 2CMYA 4IMZA 3D49H 4INKA 3MU4A 1EKBB 1P05A 3TIUA 2ZCLP 2OK5A 4CRGA 1GGDC 1BTPA 4XBBA 4NGAH 3SV7A 3A85A 5HMAA 3OYPA 4ISLA 1NESE 1NN6A 1BTYA 2FX6A 2Z9LA 3PLPA 3LH1A 1H8ED 2CF8H 3RXFA 2A4RA 1K1PA 2XNIA 2G5NA 3V3MA 3ZV8A 2KR7A 1P12E 4CRFA 3ZZAA 1TONA 1GJ8B 4X1NU 1A61H 2YMSB 3A86A 2R3YA 1J14A 1KXEA 1AKSA 3BIVH 2AS9A 1LHEH 3S0NA 1UTOA 4BXWA 5FCKA 4F48B 3H7TA 1QRWA 2BLOA 3SNBA 4CBOA 1SFQB 2LELA 1O5AB 2QE7D 1UHBA 1HB0B 3SNEA 3OY6U 1A3EH 1D3TB 4D9QA 3BTFE 3VB7A 2VWNA 2ANMH 1KXBA 4H4FA 5DK1A 1QBNA 1SR5C 1HAHH 4UFEH 1GHAF 1NU7B 2A1DB 3QDZB 3NZIA 1Y5AT 4OS6A 1GBDA 3N7DA 1NFUA 3TNTA 5FAHA 1YPMH 2ZHQH 4X6MA 5GJ4B 1O2RA 2C93B 4XRNA 4Y8ZA 2SFAA 3ZVFA 3B8JA 1YLDA 1GBKA 3ZVAA 5F8XA 1P0SH 2A0QB 3M7TA 2QXGA 5T3HA 1BCUH 1P9UA 1GCTC 1OSSA 5A0BA 5SGAE 3OU0A 3TJOA 2AIQA 2FOEA 2XBWA 1CU1A 2FTLE 2RCEA 4RKJB 3ZZ5A 1LHDH 1H1BA 1AU8A 2UUYA 3RXCA 2GJGA 3UQOA 1KMHB 2VIVA 1VKYA 2GDDA 3DHKH 5C2ZA 3D65E 2BXTH 3GISB 2BD5A 2L74A 2WYJA 1GVLA 3A88A 3Q00A 1QL8A 5T6GA 4AFZA 4K2YA 1O5FH 3KCGH 2TGAA 1TRNA 5DJ7A 2PLXA 3PWBA 2C3SA 1UTMA 1P03A 2SGPE 3UIRA 3F9EA 3MU8A 4BAQB 4ISIH 2PW8H 2QF0A 2HVYB 1NBMD 1EZXC 3ZVCA 4B6EA 4ZKRU 5DPAA 1QURH 2QIQA 1SLXB 1C1PA 2A7JA 3U69H 1TNKA 1F5LA 4AN7A 2JDID 3PV4A 3QTOH 3TK5A 1AI8H 2NU4E 1EX3A 5E0GA 3FP6E 1QRXA 2STBE 1C2GA 4CH2B 3ENSB 1S84A 1SHYA 2Z94A 4MPUA 3N7EA 4B74A 1AMHA 1TRMA 5HKKD 3MWIU 1GGDB 1C1SA 1JIRA 2QY0B 3B23B 3K2UA 2EY4C 1DVAH 1F2SE 1W11U 2GDEH 1W7XH 1ZMJA 1LQEA 2AGIX 3C27B 2BYAX 1V2PT 1T8NA 4AGJA 2QF4A 4NZQA 2SGDE 4YOGA 3U98H 1KXDA 5C1UA 1MCVA 2UUKB 1ZJKA 4D8NA 5ABWA 1B7XB 2VIDA 3L33A 1V2WT 2A32A 2ZZUH 2FOMB 3DD2H 3RLYH 1NO9H 4BTIB 3S69A 2BLVA 4CHAC 2XW9A 4UFFH 3UB0A 1NC6A 1YLCA 3VB6A 1AD8H 1V2RT 2SNVA 5C5OA 1UVPA 3SUFA 1VCWA 4DT4A 1P04A 1LKAA 3E8LA 1TMUH 2R3UA 2A45B 2Z6BD 3P8OA 1ZR0A 1HDTH 1ZTJA 3UOPA 2O8LA 4A5TS 5C17A 1GI4A 1S6HA 2A5AA 1L1GA 1CA0B 1G30B 1CGJE 3SV6A 1SOTA 2A5KA 1LQDB 1EZUC 4FOUC 1TA2A 2KCAA 2Q1JA 2ZPRA 2Y82A 1W0YH 4FUCA 1MMJN 5FX5A 2HALA 1K1JA 4JZIA 2ZP0H 1CA0C 4DY7B 1YYY1 1LCYA 1IQNA 1QJ1B 4VGCC 2BY7X 1DE7H 4D9RA 1TNHA 3SNAA 4BAOB 2ZU1A 1AZ8A 1J8AA 1ESAA 2GCTC 3CENA 4H42U 2H2ZA 1OWKA 1T32A 1Q3XA 1HNEE 2FOAA 8GCHG 1MD8A 2ANYA 1TBQH 1NFXA 3SU1A 1O3PB 6LPRA 3BF6H 5ETXA 5EOKA 4DIIH 3K6ZA 3NRLA 1HAYB 1WUNH 1DICA 5JPMH 3SW2B 1SQRA 4Y71A 1GBEA 1SGNE 2C8ZB 1AUJA 1FN6A 4ASUD 3E1XB 3GCHC 2OP9A 1LKBA 1NFWA 1Z6JH 3PTBA 4AOQA 5KECA 3A87A 5EW2H 4I8JA 4MLFB 1O38A 1W0KD 1OPHB 1DWDH 1LPKB 1O2UA 4ZHLU 2J98B 1Z8RA 1ANDA 1HJ9A 2BDYA 3PWCA 3PTNA 2JETC 5B6LA 1OKXA 1C2HA 1GHXH 1CHOF 1RTFB 3OTJE 3UFAA 1FPHH 1O2NA 2ZU5A 3PV2A 4GVUA 2BMGB 2ESTE 3FP7E 5ESTE 2PSXA 1ZPZA 4QT8C 2B5TB 3BTWE 1Y3YA 3A80A 1L1JA 3VEQB 3U1IB 5GXPA 1LHCH 3A89A 1HCGA 4MNYA 1IQMA 5EIYA 1MTWA 3LC5A 4DGJA 4KTCA 4Y0ZE 1SGPE 2F43B 3UAIC 2W3KA 1GI2A 2ULLA 1GI5A 1A46H 4ISOA 3SN8A 3M3VA 1K1NA 4E7RG 2F9VA 2ZFRH 2QXIA 1ABIH 3S7HB 2P8OB 3OAAD 1ETRH 5FBEA 1DITH 2J92A 1FAXA 2BVXH 2P16A 3LKWA 1GJ4H 2FOBA 1FV9A 1VGCC 3Q3YA 4A1XA 1C4U2 4WH8A 1D3QB 1UTKA 3LGVA 2KM0A 1MD7A 1G2LA 3TGIE 1GI7B 2R2MB 3I29A 1YY3A 2PKAA 1J15A 3ZIAD 2OC8A 3QZRA 3O8DA 3P17H 3WW7A 2BZ6H 2AMPA 4GCHG 1GBLA 2QN5T 4MG3A 2ZDNA 1CHOG 1H9IE 5DP7A 2PSYA 5AFYH 1GI9B 5E0JA 1BTWA 1GMHG 1UTPA 2AERH 1HLTH 3QN7A 1GPZA 1J16A 3A8BA 2FO9A 2JJ1D 2DE8A 3LH3A 1DUEA 5PTPA 4LZ4B 3SV9A 2BZAA 3NXPA 2G81E 4ZUHA 1GJCB 2ZC9H 1P2IA 1CGHA 2BX4A 3V0XA 3KL6A 3RMOH 4B6FA 1K0HA 1GL0E 4ESTE 1UK2A 1NU9A 1TMTH 4Z6AH 3JZ2B 4NIYA 5CE1A 2WHXA 3UWIA 1HJAB 1HGTH 2OBQA 4CR9A 2SGEE 1KXCA 1V6DA 2ALPA 2XWAA 2O8UA 2CXVA 1BIOA 1HAXB 1TGBA 2FYQA 2VGCB 4GAWA 2KCYA 8ESTE 1DT2A 1GI6A 5G4BA 4XBDA 3O8RA 4M9FA 1C9PA 2FXRA 1KTTB 1G2MA 3SU6A 2G55A 2VB0A 2ZGCA 3SUDA 1MH0A 2GZ8A 1PPBH 1WYKA 2WV5A 2HNTF 3GY6A 3RXVA 2XRCA 1LHFH 2VWMA 2GZ9A 4ZKOU 1FY3A 3RXHA 3PROA 1PPFE 2HVXA 1RXPA 2RDEA 3HGPA 1RRKA 5AHGH 4JZEH 2Z9KA 4TWYA 2FX4A 3BSQA 3SUEA 1GBJA 3K6YA 1UTQA 2GX4A 4I8LA 4X6OA 2VNTA 2GTBA 4ZXYH 4HGCA 1TFXA 5GNDA 1S81A 3ZVDA 4Y8YA 2R0LA 2GT8A 4GLYA 3SBKA 2Y5FA 2BHGA 3SJKA 3A83A 3M35A 3DSGA 1FXYA 1FONA 2QXHA 3BTQE 1IHSH 5CDFE 2ZHEH 1MTSA 1AWHB 2J34A 1SOZA 1O35A 1ZHMA 2P95A 3VB4A 1P10A 2GT7A 1JBUH 2FYRA 1TABE 2FOCA 5DP4A 1P09A 4I8GA 3U1JB 1GHAG 2W6JD 4MNWA 1XVOA 1O3BA 4IC5A 2GGVB 1C1MA 1WV7H 1KIGH 2ALVA 5EQRA 4FU8A 2H6MA 3AAVA 3RDZA 1DOJA 5JYIA 1EQ9A 1EB2A 1B0EA 5K0HA 3T2NA 3H5CB 4NCYA 4ZCNA 2OD3B 4B2BA 2XBXA 1PYTC 4WVPE 2ZDVH 1VITH 2BX3A 2FI4E 4FVBA 1GWAA 2VIPA 5A09A 1NRRH 1CSOE 5DP9A 1WOFA 1QNJA 2TRMA 1HIAB 1V2JT 3TH4H 1ELCA 2EEKA 3BEUA 1OWDA 1W14U 2F9OA 3QO6A 1YF4A 1VITF 1QJ6B 1T8OA 1AFEH 1UO6A 1C2DA 1O3CA 1AY6H 4BAKB 4CRDA 1E35B 2H5CA 1LHGH 3GY5A 4FETA 4O3UA 1Y3VA 1IHTH 3MOCA 3PMBB 4ZH8A 1BBRE 3RXAA 2VIOA 1PPGE 2IPQX 5F53A 2BOHB 2PUQH 3RXKA 1GMHF 3BTEE 2G5VA 1K2I1 1BTZA 5IK2D 3BIUH 2D1JA 2CN0H 1XKBC 1DWCH 1LO6A 1NTPA 3ZV9A 1C5LH 1C1TA 2PKAB 3RMLH 4P02A 4RT1A 2ZPSA 4ISHH 2WV4A 2GCHF 4ABFA 1DANH 1DSUA 1NS3A 1FX0B 1GJBB 1BA8B 5C3NA 2FZZA 1YPKH 3RXBA 1O5BB 1QBOA 4I8HA 2J97A 3G01A 3SU0A 1XM1A 2NU0E 3JZ1B 3ZVEA 2W26A 1C1VH 3FZZA 3RU4T 2BDHA 2CGAA 2P8OC 4OM9A 3S9BA 3U8TH 5A8XA 2FI3E 5HIYA 3SUGA 1AIXH 3OFND 2PR3A 1VCQA 1MTUA 3ATMA 3A8DA 3RP2A 4K1TA 2Q6GA 1AVXA 1XKAC 1WU1A 1P8VC 1OX1A 4AB8A 4LK4A 3MI4A 3A81A 4B2CA 4MTBA 5C0TA 4THNH 1EASA 1AO5A 1UCYE 1C1QA 1ZOMA 2WPMS 3ATLA 2BVSH 4INLA 2PGBB 2EA3A 1OP8A 2EQNA 4X1SU 4XE4A 5T1VA 3V12A 4B1TA 4P00A 1LPZB 5E0HA 1NRPH 3EGKH 4OS4A 3RC4A 4TT3D 3BEIB 5FHTA 5HIZA 5DP5A 1W10U 1SQAA 5I46H 4K60A 3LGWA 1SG8B 2TPIZ 2ZIQH 4YT6H 1AVGH 4ABAA 5A8YA 3GCTG 2B0FA 1E1QD 2VIWA 3OSYA 1G37A 1ELFA 1LMWB 3GOVB 2M5TA 2ZA5A 3BTHE 1O3AA 2BY9X 1F0RA 2HNTC 4GHQA 3CP7A 1OWJA 3EE0B 4YESB 2GV6A 1XX9A 1ZSLA 4BOHA 2IJOB 1P2OA 2SNWA 3GDVA 2GD4B 1GJAB 1C2EA 2J94A 5C94A 9LPRA 2JKHA 1O32A 4DW2U 1P01A 1LVOA 4FUEA 2AIPA 3VXEH 3P6ZB 4B73A 3ZZ3A 1A2CH 3ITIA 1SSXA 1G3EA 3P8FA 1JRTA 7ESTE 1PPEE 5EPNA 3ATWA 4IN2A 5C67A 1MKWH 5BRRE 1T4UH 2TGPZ 1O2PA 3QGJA 3T25A 1GJ9B 3RMMH 1TOMH 4Y0YE 1NT1A 1C4Y2 3BG8A 5GWZA 1O3JA 2QF3A 3T28A 1BBRH 5FBIA 1PPZA 1K22H 1VJ9U 1MZAA 5B6OA 1MKWK 1F0UA 1YCPM 4IC6A 3DSOA 1GDNA 3KYGA 3GY3A 4FUDA 2UWLA 1FLEE 6GCHG 2BQ7B 1G3BA 1JOUB 1O3FA 2XOKD 1B5GH 2W3IA 4AG1A 3RMNH 1IAUA 2B8OH 1XUHA 3F1SB 3GS9A 4ZXXH 1FQ3A 3URDA 3MFJA 1MBMA 1UHBB 1EP6A 3SJ8A 1TGTA 2TBSA 3QX5H 4BAHB 3HATH 2FDAA 3EYDA 1KSNA 5A0AE 3F9GA 1BITA 4YM9A 1ANCA 3UTUH 1EJAA 1P2NA 3GYMA 1TALA 1UCYK 2J4IA 1ABJH 2R2WU 2FESH 1OP2A 2RFKC 2OC1A 5F03A 1MQ6A 1EJMA 1S6FA 3ZYEA 3STIA 2PFEA 3AAUA 2BDIA 1B0FA 1C5TA 1FMGA 1DXPA 1H9HE 1O3KA 1PJPA 3SU3A 1O3NA 1O3EA 1TA6A 5TJXA 3SU4A 1Z8IB 1Y3WA 3NCLA 4RT0A 4GCHF 3SI3H 4JYTA 2WUCA 4O03A 3F0PA 1PPCE 1SHHB 3PV5A 1QTFA 2VWLA 2TIOA 1UCYH 4WH6A 1O39A 5CHAB 3MHWU 1GHZA 1GHYH 4GHTA 4UE7H 1LVMA 1YCPH 1MKXH 1K1MA 2GCTB 2W6ID 1C5VA 2YOLA 2SGAA 2PV9B 3R0FA 3M3TA 1TQ7B 3D23A 5IDKA 3RXMA 2D26C 2ZDKA 3F9FA 1SVPA 4H6TA 3RXGA 3STJA 4NFFA 1AE8H 1DWEH 1KXFA 1AWFH 3A8AA 2FOGA 2Z3CA 1UTLM 3SZNA 3P8NA 3GY2A 2BDBA 3U8RH 2OTVA 3I77A 1HBTH 4CRAA 1H4WA 3SQEE 3N7OA 1DX5M 1TPPA 1D6WA 1RIWC 1BBRK 2VWOA 4DIHH 4I7YH 1ZLRA 1C1RA 1CQQA 1ORFA 2BDAA 5CHAC 2XCFA 3HK6B 2FS8A 3MH7A 1KXAA 4AORA 2K1QA 2WPJS 1GHWH 1O2LA 1O2QA 1OYQA 1GJDB 1VGCB 4CBNA 2NU3E 2AH4X 2GMTC 1JWTA 3PYHA 1HIAA 3ZZDA 1W13U 1NM6A 2VINA 2THFB 2FS9A 1TE0A 1GCTB 1FN8A 1TIOA 1RTLA 2ZHWH 2ZGJA 1GHVH 2BLWA 2ZGHA 1K9OE 3IITA 2BVRH 2EI6A 2PTNA 1C5YB 3VGCB 1IQFA 1CBWB 3V13A 4TPYA 2A31A 2CF9H 2C8YB 1O3OA 3TGJE 1HAIH 1P02A 4DCDA 4OGYA 3A7ZA 3F0OA 3MO9A 1MZDA 2WZQA 3MNBA 4VGCB 1SBWA 1ANBA 3Q3XA 1O3GA 3Q77A 2EI8A 3GICB 3MTYA 4NA8A 3RUOA 3QLPH 1NRSH 1TBRH 2HNTE 3M5LA 1W0ZU 2F9BH 4JK5A 4PROA 1KY9A 2Y7XA 5HYOA 1GL1A 1FY8E 2A4QA 4FUBA 5JBCS 1HAVA 2D8WA 4JZFH 1GI3A 3E91A 4NFEA 2ZDLA 1O33A 4ABIA 1W3CA 1TPSA 3M36A 3SU5A 4E06H 1MKXK 3GY8A 1TX8A 5EJZA 3MU1A 3H09A 2EC9H 1VZQH 1ZYOA 3TJVA 4YLUA 3F68H 2AMQA 1AGJA 3EE7A 1A0LA 5EG4A 1V2VT 1HJAC 1O3MA 1CO7E 3PO1C 1RTKA 4HG6A 1GI1A 4R0IA 2KZ4A 5DP6A 1M9UA 2Z7FE 3SOSA 1S82A 5FPSA 1SI5H 3A84A 1HXEH 1A4WH 1O31A 1V2ST 1SLUB 4D76A 2GCHG 2B7DH 4X8UH 1ZMLA 4E05H 3NK8A 4RKOB 4J2YB 4SGAE 4TPIZ 5TCAA 3VG8A 4YXWD 1FPCH 2ZF0H 3PLBA 8KME2 1C5NH 1QQUA 3GCHB 1ZZZA 2R9PA 1O5GH 2BD9A 1JXPA 1UVSH 1NFYA 1TRYA 1O30A 3FZDA 1XUFA 3A8CA 1GBBA 2C8WB 1FY5A 1P2QA 4O97A 4KKDA 2ASUB 3ZVGA 4TSFD 1EP5A 3BG4B 2XTTB 3UPEA 2J2UA 5EQQA 1QZ8A 1IQEA 2VVCA 1HAOH 2LPRA 2OLGA 2A7HA 1D4PB 3SJIA 3SI4H 3RXPA 1Y5UT 4A1TA 3FVFB 3UR6A 4ISNA 5DP3A 1RD3B 7KMEH 1H8DH 3TLOA 1O0DH 3FN8A 1HAVB 3EA7A 4NSVA 1QR3E 4AYVB 1DLEA 2GZ7A 2HOBA 4E7NA 1O2KA 3EA8A 5H4IB 5T6DA 1BMNH 3QUMP 1BT7A 4MNXA 1QIXB 1MTNB 3ZZ6A 1O2VA 3RXQA 1MAYA 2OXSA 5DKMA 4IBLH 2A7CA 4WMFA 1SGDE 2FM2A 3F6UH 2JIZD 1P11E 1G9IE 1SPJA 1Y59T 5HXFA 1MTVA 1EOJA 2UWPA 3UNQA 2GV7A 2CV3A 3EA9A 1BHXB 3AW1A 2ZFFH 5EW1H 5L30H 5DG6A
chains in the Genus database with same CATH topology
3WY8A 1C5MD 1Z6EA 4JK6A 6CHAB 3LOXA 1KYNA 1WCZA 1O3DA 1EZSC 1Q2WA 1GG6C 4X8VH 1TOCB 1FAKH 3TJNA 3AASA 1L0ZA 4ABHA 1D6RA 2FLBH 2W7SA 4CHAB 2A4OA 1ZJDA 1HYLA 1GHBG 2ZU3A 4KP0A 2ZGXH 1YPEH 5I25A 1GVZA 1XUJA 2V3HH 2KAIB 2OINA 4AGKA 1V2LT 2FIRH 3M5MA 5EODA 1DPOA 1W2KH 2HLCA 1UK4A 1FIWA 5A8ZA 2H1UA 3NUMA 4B75A 3KQDA 1QHRB 4FUIA 1J17T 3M7UA 1N8OB 3QTVH 3VB5A 2PTCE 5FXLA 1O2SA 3A7YA 2BY8X 3MO3A 3M3SA 1AFQB 2BD3A 3IG6B 2J38A 1V3XA 3LT3A 1OYTH 1JIMA 4MNVA 3M7QA 4KGAA 4X2XA 3SO3A 2DE9A 1E0FD 1NY22 2Z3DA 3K65B 5DGJA 2PWXA 1E37B 4I31A 2BXUH 4KELA 1X7AC 5CMXH 2PHBA 5E2OA 1C1NA 4K1SA 4X6PA 1V2QT 2BOKA 3MH4A 1PPHE 1FUJA 1GBMA 3R3GB 2ZTXA 1G3CA 2ZU4A 3LGUA 3TPIZ 2FMJA 1TNLA 3PM3A 2UUJB 1QL7A 1K1IA 3ZZ4A 3MYWA 1A3BH 1MBQA 3DFJA 1OXGA 1DM4B 1O2YA 1N6YA 2HPQH 1OWEA 1TNIA 1FZZA 3GDUA 3MMGA 3L3TA 1QFKH 1GI0A 4F49A 2H9EH 2ODQA 1U6QA 1UVOA 3W94A 3SORA 2BY5X 5LPEA 1C9TA 4FVDA 3UUZA 4HI3A 1A5GH 3T5FH 4XBCA 5L2YH 3P95A 9ESTA 1S83A 4NZLA 4YLQH 1THRH 3EQ0H 4ZAEA 4FXGH 1THPB 2RG3A 3LGYA 2WUBA 3E0PB 1HJ8A 4UD9H 1T8LA 1P2JA 2JH0D 4OS7A 4ABGA 1A0JA 3MH5A 2C4FH 4YTAA 2AGEX 4JYVH 2PKSC 5JBAS 4IN1A 4HTCH 4ZHMU 3MNSA 1V2TT 3F9HA 1GHBF 5FPYA 3DA9B 1WAYB 1EXFA 4Y10E 4XSKU 2V3OH 2I6SA 5JBTA 1ARCA 1NRQH 4JZDH 4F4OC 5EXLA 1PYTD 2BTCE 1QB6A 2ODYB 7GCHG 5HGGA 3HKJB 5LPFA 5TCCA 2Z9JA 2AGGX 2WPHS 4Q2KA 4IGDA 1QCPA 2H9TH 1Y8TA 2OQUA 5AFZH 2OC0A 3GY4A 1CGIE 1SGYE 3RXUA 1CT0E 1TQ0B 1BTHH 3NWUA 1C5QA 1C2JA 3DFLA 4MVNA 2P3TB 1TGNA 4B71A 1HFDA 3D62A 1H8IH 3ELAH 4WY3A 1TB6H 2IOTA 1AB9B 1F0SA 1O5DH 1OP0A 2G8TA 2ZDMA 2ZU2A 4NWKA 2ZG0H 2VH0A 1BMMH 1TNGA 2O8TA 4CH8B 1EZQA 3TK6A 3FANA 1BHXF 2FOFA 1DDJA 4ASHA 3UWJH 4LOYH 1KDQB 3GDSA 3CS0A 7LPRA 4MPVA 4BAMB 4I33A 3C1KA 3ZZ9A 2FLRH 1C5ZB 3MO6A 3GY7A 4HZHA 1CHGA 1EAIA 1Q31A 4A92A 4GPGA 2WPKS 1E36B 2G51A 5EU8A 2P3FH 1YC0A 4TYDA 1EPTB 1QY6A 1SLVB 2F9NA 1O5EH 2Q6FA 2FPZA 4XDEA 3E0NB 3A82A 3GCTF 2STAE 4MQAA 1AFQC 1IQIA 2O9QA 1FIZA 4YT7H 5ESBA 3SJOA 2FWWA 1O34A 1PQAA 1GBFA 3MU5A 5A0CA 2AYWA 1S0RA 3BG4C 4U32A 2P93A 1BZXE 1LDTT 1CA8B 2F91A 1W12U 1F5RA 4A6LA 3E16B 1O2XA 1O2IA 1ZTLA 2F3CE 2BDGA 2WPIS 1IQKA 4ZMAH 1PQ5A 5DO4H 1Y3UA 3SV8A 1Z8JB 2G00A 3S9AA 1FY4A 4K5ZA 5L6NH 1NPMA 2ZI2H 1ETTH 1A0HB 1AVWA 4K8BA 4AFSA 3RXEA 3Q3KA 2ANWA 7GCHF 1FNIA 1K28D 3LJOA 3T26A 3MNXA 1GJ6A 1QA7A 1BJUA 2ILNA 2ZCKP 1ZTKA 4WWYA 1SGFA 1IQLA 2CHAC 3O8BA 4MDSA 3GCNA 3OY5U 1E34B 3U9AH 1VITG 5J4QA 4Y7AA 1TBZH 2HPPH 1A1RA 4UFDH 5LH8A 1W7GH 4K8YA 2VU8E 4OS5A 4WF8A 1O3HA 1C5OH 1UK3A 3HPTB 4X0WU 1N6XA 2O8MA 3BTKE 2FTMA 1RS0A 2AFQB 1DXWA 1AB9C 1O5CB 1YGCH 3S9CA 1G32B 1KLTA 4JMYA 3KGPA 3RXSA 2OC7A 1WTHD 1C2LA 1P06A 4J1YA 5L2ZH 2BQWB 4K69A 1ACBE 4FU9A 2HWLB 3RM2H 2XC4A 2QGRA 3RXRA 3OX7U 4CREA 5JB9S 1VR1H 1SMFE 1W8BH 4RN6A 1C5UA 4ZHAA 1UMAH 2ZECA 1EB1H 1SL3A 4B76A 3KEEA 4DOQA 1RFNA 2EI7A 2ZCHP 1PQ8A 3LDXH 1NRNH 2A5IA 4YO9A 1FJSA 2P94A 3RU4D 4INHA 1YPGH 1SGQE 1DY8A 3LC3A 1N8OC 1MCTA 2ZO3H 2ZDAH 5A2MH 1YM0A 3DUXH 1P9SA 5HM9A 1TX7A 3KQCA 2ZEBA 1QL9A 4YOJA 4WXIA 2PUXB 3E3TA 1WQSA 5EGMA 1S5SA 2J9NA 3URCA 3LGIA 3I78A 2QXJA 3QZQA 1GBTA 4NIXA 1BTXA 1DS2E 2ANKH 1OS8A 3PMHB 5T6FA 1ELVA 1KLJH 5J4SA 1INCA 1ZPBA 1AHTH 4Y7BA 2AMDA 5IYTA 1P3EA 1LVBA 3RC6A 3KF2A 4FU7A 3RXJA 1K1OA 2G4UA 3RLWH 2ZKSA 1O37A 1QB1A 2BD4A 1AZZA 1GMDG 3HGNA 2ZHFH 1T8MA 2ZHDA 4U2WA 1TPAE 1C5RA 1D9IA 1WTGH 1RIWB 3BV9B 2GKVE 3ODFA 4CR5A 1YPLH 4X1QU 1WQVH 2H5DA 5EQSA 4D7FA 5C1XA 3LIWA 4KTSA 3ZZ7A 1GMCG 1KDQA 2FOHA 1YP9A 3FFGA 5EXMA 2YNBA 1O2MA 3W95A 1DLKB 1SQTA 2G52A 1EUFA 3LGTA 2ZFSA 4DVAU 2QCYA 3PMJA 1O2TA 1EATA 5JB8S 1GBIA 1TX6A 5E8EH 2GP9B 4ABBA 1UVTH 4UFGH 2VJ1A 1FI8A 1EAUA 1A7SA 3SGBE 3BTME 1QJ7B 2P59A 1HUTH 5AF9H 2FP7B 4AFQA 1SLWB 1MAXA 3RM0H 4FUJA 1BMLA 2VIQA 2H9HA 5JDUB 4OS2A 3PMAB 3SHCH 1ELAA 2ZQ2A 4CRBA 2C90B 1S0QA 1UTNA 1A5IA 5GDSH 4TY6A 3NPSA 2ZPQA 3TITA 3RXDA 3SGAE 3BEFB 3KNXA 1D3DB 3AVZA 3E90B 2Z9IA 1E38B 5C20A 3A7XA 4TWWA 1ANEA 1QQ4A 1ZGVA 3UNRA 1CE5A 4Q7XA 3RXTA 1MU8B 1V2OT 3FP8E 3LONA 4DJZB 4Q7ZA 4X2YA 3TU7H 3SV2H 4H6SB 1MQ5A 2A4GA 3RXIA 2QAAA 3QGNB 1ESTA 1T4VH 2XBVA 3UY9A 4MPXA 1XVMA 1DSTA 3BTGE 3MNCA 1QA0A 1EAXA 4MPWA 4WXVA 4WMEA 1BRBE 2WINI 2F9UA 3UR9A 1O3LA 3A7WA 1TAWA 2ZTZA 4Y76A 1ZSKA 3TH3H 1TWXB 3BTDE 1YPHE 2Q6DA 4WJG2 4UONA 3T29A 1ETSH 2BQ6B 1YKTA 2DUCA 1P2KA 1DFPA 2Y6TA 2VVUA 3P8GA 2BM2A 4DG4A 1ELTA 1ZSJA 2V35A 1UTJA 1HPGA 2ZFTA 5C1YA 4NSYA 3RU4E 3SNDA 2Y80A 4IS5A 2HGTH 3AW0A 4UEHH 1GJ7B 3PLKA 4X1PU 2C8XB 1UVUH 1C1OA 6GCHF 1Z1IA 2BY6X 1O2ZA 4O3TA 3VB3A 3ZVBA 2W5EA 4NA9H 3RXOA 4AFUA 1HRTH 2QV1A 2P3UB 3TK9A 2ZFPH 3M37A 2TGDA 1EOLA 1SGTA 5BPEA 1EPTC 1GBHA 1L4ZA 3LJJA 1OWHA 4A1VA 3SU2A 3ATKA 5GCHF 1GMCF 4RSPA 3GYLB 1G3DA 3B9FH 2JH6D 4B2AA 2J95A 3O8CA 1C2IA 3U8OH 1L2EA 2CJIA 5K7RA 1VJAU 2NU2E 1DY9A 2JH5D 1T7CA 2VH6A 3A7VA 4Q80A 2SGFE 3NKKA 3M5OA 2NU1E 1P2MA 3KN2A 4R8TB 1L4DA 2Y7ZA 1QRZA 4Y11E 1H9LB 1PFXC 2RA0A 4Z0KA 2GMTB 2WPLS 4IMQA 6CHAC 4IW4E 2XBYA 3P70B 2XWBI 5F6MA 4FUFA 2ZGBH 1BUIA 1SB1H 2BD8A 1BQYA 2ZQ1A 1XXFA 4OGXA 4NIWA 1XXDA 1AKSB 1GJ5H 1XUGA 2ZWLH 3L6PA 4FUHA 2KAIA 2B9LA 1ZGIA 4U01A 2I6QA 1QB9A 1XUKA 2Y81A 4X8TH 3ODDA 1RJXB 1MUEB 1Y3XA 4Y79A 1OWIA 1ELEE 1ZPCA 1QBVH 1K21H 3EAJA 4Q7YA 1V2NT 2R0KA 4GUXA 4X8SH 3UQVA 4KTUA 3RXLA 2AEIH 4X2VA 2IN2A 1AN1E 4JCNA 2Z9GA 5LGOA 1JMOH 1O2GH 1YPHC 3ESTA 2YNAA 1MTNC 1F0TA 2V6NA 1O36A 3QK1A 5F8ZA 1BTUA 2PGQB 3S7KB 1BOQA 1PQ7A 3TVJB 1FY1A 5FCRA 1NROH 2G4TA 1P3CA 5LPRA 1AQ7A 5EPYA 3A7TA 3VFEA 2A2QH 4SGBE 1SGEE 4GSOA 4NG9H 4YOIA 2XC0A 3K9XB 1WBGB 2QYIA 4ABJA 1C5WB 4DT7B 6ESTA 1EJNA 4A7IB 1P57B 2QC2A 1BRUP 1NZQH 3ATIA 2RDLA 4U30A 4X2WA 2F83A 3PO1B 2BD7A 3TNSA 1YCPK 2UUFB 1CVWH 3SNCA 2FI5E 3TH2H 5GIBA 1HV7A 2ODPA 1KTSB 2XC5A 2OCVB 3GCOA 1Z71A 4BTTB 3ZZ8A 1DUAA 1WSSH 1IQGA 4FUGA 2RA3A 1C2KA 3FAOA 1UJ1A 1IQJA 1L1NA 1V2MT 4XOJA 3UOUA 3VGCC 3ZYDA 3QWCH 1TNJA 5FX6A 3IWMA 1BRCE 2OUAA 1O2HA 2IPHA 4K1EA 4AX9H 1F7ZA 2V0BA 3VPKA 1LPGB 4NA7A 4Y6DA 3LU9B 1BJVA 1GDQA 4M7GA 4XFQA 1KLIH 4D7GA 4NWLA 1T31A 1C5XB 1N1LA 1GDUA 4ABEA 3T62A 8LPRA 1J9CH 1QGFA 3BTTE 2VGCC 4OS1A 1SGFG 1BMAA 1BDAA 1HAGE 1C5SA 1V2UT 5C5NA 1AE5A 1G36A 4AZ2B 1TGSZ 2BLQA 3SQHE 3V7TA 4WMDA 1MU6B 2OBOA 2WYGA 1TMBH 2PKSB 2NWNA 2LNCA 4ABDA 5FPTA 3H7OA 4AB9A 4HFPB 2SGQE 1ZHPA 8GCHF 1DWBH 2XXLA 3ZZCA 4AYYB 1SGRE 1YPJH 1XUIA 1ESBA 1O3IA 2GVFA 1XMNB 3UREA 1K1LA 2BDCA 1GBAA 1F5KU 2F9PA 1FDPA 2A2XH 3UNSA 1TYNA 1EPTA 2XCNA 2HRVA 1IQHA 1EAWA 2TGTA 1AUTC 2CHAB 1O2WA 3CS7A 4JZ1A 1IOEA 1Z8GA 1S85A 1ID5H 1YBWA 5DP8A 3TJUA 1BB0B 1GMDF 3KIDU 1ARBA 2Y5GA 1LTOA 1SGIB 4BANB 1LVYA 2W7UA 1TPOA 4Y8XA 1SQOA 2XYAA 1SFIA 3Q76A 3MU0A 3HKIB 5F8TA 2FEQH 4JYUH 5HM2A 1GBCA 1ZMNA 3PB1E 3MH6A 5E2PA 1C5PA 2ZTYA 3TGKE 1GI8B 4LZ1H 1Y5BT 3HK3B 3KQBA 4AG2A 4UDWH 3SHAH 1C2MA 1ELBA 3SGQE 4ZROA 3E6PH 4ZKNU 1JRSA 5EXNA 3P92A 4BXSA 4CRCA 1SC8U 2O8WA 4I8KA 1O2OA 2QA9E 1ELGA 2ZFQH 1D3PB 3LPRA 1GCDA 1C2FA 4NIVA 3M61U 3VXFH 5GCHG 1V2KT 1A5HA 1CT2E 3DT0H 2OQ5A 1ZHRA 3M5NA 1C1WH 1GVKB 1Z7KA 2BD2A 4I32A 1F92A 1C4V2 5GPIB 1OOKB 3KHVA 1VCPA 1HAPH 5JBBS 4DURA 2Y5HA 4ZKSU 1RGQA 3T27A 3EDXB 1SGCA 2Z3EA 1Z1JA 4X6NA 4TY7A 1ZRKA 4X1RU 3BN9A 3KQEA 2BB4A 1CT4E 1BRAA 1HXFH 2JETB 3RC5A 1ELDE 2ZNKH 1TLDA 4BTUB 2FODA 4O9VA 5AVDA 3ZZBA 3SJ9A 1ZRBA 4YZUA 1CBWC 1GG6B 1O2JA 4K3JA 1HAZB 2VVVA 4LXBH 1TGCA 1C1UH 2D2DA 2UWOA 4BNRA 1THSH 2CMYA 4IMZA 3D49H 4INKA 3MU4A 1EKBB 1P05A 3TIUA 2ZCLP 4CRGA 1GGDC 1BTPA 4XBBA 4NGAH 3SV7A 3A85A 5HMAA 3OYPA 4ISLA 1NESE 1NN6A 1BTYA 2FX6A 2Z9LA 3PLPA 3LH1A 2CF8H 3RXFA 2A4RA 1K1PA 2XNIA 2G5NA 3V3MA 3ZV8A 1P12E 4CRFA 3ZZAA 1TONA 1GJ8B 4X1NU 1A61H 3A86A 2R3YA 1J14A 1KXEA 1AKSA 3BIVH 2AS9A 1LHEH 3S0NA 1UTOA 4BXWA 5FCKA 3H7TA 1QRWA 2BLOA 3SNBA 4CBOA 1SFQB 1O5AB 1UHBA 1HB0B 3SNEA 3OY6U 1A3EH 1D3TB 4D9QA 3BTFE 3VB7A 2VWNA 2ANMH 1KXBA 4H4FA 5DK1A 1QBNA 1SR5C 1HAHH 4UFEH 1GHAF 1NU7B 2A1DB 3QDZB 3NZIA 1Y5AT 4OS6A 1GBDA 1NFUA 3TNTA 5FAHA 1YPMH 2ZHQH 4X6MA 5GJ4B 1O2RA 2C93B 4Y8ZA 2SFAA 3ZVFA 3B8JA