1E36B

Porcine pancreatic elastase complexed with (3s, 4s)n-para-nitrobenzenesulphonyl -3-ethyl-4-(carboxylic acid)pyrrolidin-2-one
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
b'VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE
publication title 'Ph-Jump' Crystallographic Analyses of Gamma-Lactam-Porcine Pancreatic Elastase Complexes
pubmed doi rcsb
molecule tags Hydrolase(serine protease)
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2000-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1e36B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1e36B01
4DCDA 1O2NA 4X2YA 1O2ZA 5EQQA 1Z6EA 4NA9H 3L3TA 1V2PT 1YBWA 1SGEE 3ZZ4A 1A61H 3A7VA 2ZFSA 1CT4E 1S6FA 1JIRA 2FLBH 1FPCH 3EYDA 3T25A 5EU8A 1C9TA 3TJOA 1SHYA 1W0ZU 5EQSA 4O3UA 1BBRK 2XW9A 4QT8C 4INKA 1C9PA 1K21H 1C2EA 1G3CA 1F2SE 1GBDA 1GCDA 4B75A 2IOTA 2VIOA 3K2UA 2VIDA 4DIIH 1UJ1A 2H2ZA 5FX6A 2ANKH 1QJ7B 2SGEE 5L30H 5AHGH 1CSOE 1MAYA 1S5SA 1FAKH 1SGYE 2C90B 2F9OA 3NUMA 5ESBA 3S0NA 2J2UA 3PLPA 1LQEA 1AGJA 3SBKA 2STAE 1YGCH 4BAQB 4ISNA 2V3HH 4ZKRU 1K1IA 1V2OT 4BOHA 1BBRE 1ZR0A 4NWLA 2LPRA 5FCRA 1TALA 4NIYA 1TOCB 3P8NA 4ABEA 2P16A 2A45B 2P93A 2FOFA 4I8KA 4D7GA 4YLUA 2PTCE 1H9LB 4WH6A 4A1VA 3SU4A 4CRGA 2ZU2A 1J14A 5A0AE 1A1RA 3RMNH 3M7UA 1CBWB 5C1UA 3ATWA 1HIAB 4JZIA 2ZKSA 3EA8A 3D49H 1AY6H 8KME2 2OBQA 1FUJA 2FI5E 2H1UA 4K3JA 1HAVA 1TPSA 1S6HA 1GL1A 3LGVA 3MH7A 1QQUA 2C8ZB 9ESTA 3A85A 3RC4A 3SU5A 5JB8S 3T27A 4FVBA 3PB1E 3RUOA 3ZYEA 2FOAA 2UWPA 2AERH 1C5VA 1ZTJA 4TPYA 5E0GA 1C2LA 2BY6X 2BD9A 1QBOA 3S7KB 5F8TA 3BTWE 1CGHA 4JZDH 1O38A 2ASUB 3UQOA 3DA9B 1NO9H 1UTLM 3NK8A 3RXUA 4Q2KA 5T6FA 3O8RA 1FZZA 4XSKU 4BAKB 2I6QA 2CXVA 1JRTA 3NPSA 1TE0A 1V2NT 4TPIZ 4CH8B 2R0KA 2BLWA 4AZ2B 4D7FA 3Q3XA 1QL9A 1ZZZA 2WPIS 3ELAH 1NFUA 5IYTA 3SJKA 4Y10E 3M5NA 2NU2E 3PWCA 1JRSA 1K1PA 1VCPA 2ZPSA 1GCTC 3A7WA 1P09A 2AIQA 2A32A 1GDQA 1ELFA 4A1TA 1LMWB 1ELGA 4XBBA 1TNIA 1ELTA 1EAIA 4PROA 1V2JT 1O5FH 2GDEH 2PFEA 1J15A 2C4FH 1UTPA 2BD7A 2BDHA 3FANA 3ZVFA 4GVUA 2AS9A 1S0QA 2Z9GA 2VVUA 2GZ8A 1O5EH 1GJ9B 3Q3KA 1HAGE 5C3NA 4UFFH 1CA8B 5DP3A 3VFEA 3CENA 1RXPA 1YCPK 2QXGA 2F9NA 1TYNA 3E0NB 4TWWA 1O36A 3VB5A 1N6XA 3WY8A 5EW1H 5T6GA 2PV9B 4NCYA 3LGIA 3UR6A 5HM9A 3M5LA 3SNAA 3M3VA 3PYHA 1C2JA 1GJCB 1TPAE 4UONA 3BN9A 2EI7A 4Y8YA 3FFGA 5EG4A 1EJAA 3SUGA 3Q3YA 2DUCA 1O5AB 3AAUA 1LKBA 1CGIE 1ZPCA 1L2EA 1IQNA 1XUFA 2GD4B 4WJG2 2PKSC 5PTPA 1C5PA 3L6PA 2GZ9A 4BNRA 1O2WA 1KXFA 4MPWA 2HNTF 1O2JA 1C5TA 2HNTE 3QGNB 3RU4T 5JB9S 1A46H 4AYYB 3SZNA 1GI6A 4I8JA 1SPJA 1TGSZ 1QL7A 3DFLA 1NT1A 3MYWA 1O2RA 1C1QA 2ZFFH 2C3SA 4CRAA 1NFYA 2STBE 5SGAE 4K1TA 3MH4A 2Q6DA 3UNSA 3TLOA 4I33A 3DHKH 1LPGB 4DGJA 1VJAU 1KTTB 1BRAA 2YOLA 1MQ6A 3KF2A 2BY5X 3RC5A 1C1WH 4Y0ZE 3ZZBA 1XUIA 1IOEA 1CHGA 1MUEB 2G52A 3RLWH 1SC8U 2A7HA 2AGGX 4UD9H 3QX5H 1DVAH 1NRRH 3KN2A 2BXUH 1P06A 4FU7A 3NXPA 2ZCHP 3U69H 2BY8X 4Y6DA 2NU3E 1P2IA 1TPOA 2NU4E 2W3KA 3F1SB 1GG6B 1ZSKA 3PMAB 1ESBA 3BTHE 2BD8A 1C5ZB 2ANWA 1GBBA 2VGCC 2Z7FE 1SFIA 1Y5BT 1P9UA 3BG8A 2DE9A 1DLKB 1PPZA 3SUDA 1JMOH 3SNBA 2OC7A 1VR1H 2QV1A 2XBXA 1IQEA 1QRWA 4HFPB 3QTVH 5EW2H 1BTHH 1C5UA 1Y5AT 1ZHRA 1A4WH 4WF8A 1SQAA 1TGCA 1NRQH 2BX4A 1VITG 2PKAA 1G2MA 1BT7A 1ELBA 2O8WA 5FBEA 4I7YH 3SJOA 1N6YA 4DY7B 3PMHB 1F5KU 1IQHA 2F9BH 3BF6H 2H9TH 1AMHA 4GHQA 3OU0A 1GHAG 1GHBF 3CP7A 1PPFE 4X6OA 2SGQE 2TRMA 1UO6A 1AQ7A 2WUBA 3G01A 3GY7A 3ZZDA 1C5LH 2OLGA 3PTBA 3NKKA 1LPKB 1XXFA 1GVKB 2ZEBA 3P6ZB 2BD4A 1FNIA 2J94A 1D3TB 1THPB 5DP5A 1SOZA 2F9UA 2PGBB 1NFWA 1B7XB 2RG3A 1P2NA 2V35A 2ZHDA 1FLEE 1NPMA 1W13U 2R9PA 5H4IB 4CBNA 1SGPE 3RXJA 1GHVH 4MG3A 9LPRA 3MMGA 2Y80A 1GI8B 1A7SA 2FWWA 1A5HA 1O2HA 5TJXA 1ELCA 3MH5A 4YT6H 1CT2E 1DE7H 1CBWC 1HAHH 2FLRH 1W7GH 5EXNA 1GI2A 1MBMA 4GPGA 1P57B 1QCPA 3VB4A 3MNSA 4JYUH 2ZDLA 1GDNA 4CRDA 3ATKA 2ZWLH 3OSYA 1QB9A 1T8MA 1BRBE 3RXGA 3KIDU 4XBDA 1DX5M 3GY4A 1OP2A 4AORA 1FY3A 2BQWB 3EQ0H 5TCAA 4YTAA 3GCTF 1HCGA 1KXCA 1TOMH 5FXLA 1TWXB 1V2WT 3SQHE 3U98H 1SQOA 1PYTC 1K9OE 1EOJA 2JH0D 3BTQE 1EPTA 3UREA 1FAXA 3MI4A 1SLXB 2SGPE 1B5GH 1GI5A 2A4GA 4SGAE 3ODDA 4OS4A 3EE0B 1P05A 1G32B 1TRNA 1W11U 1HXFH 2TGAA 4VGCB 1UK4A 4UDWH 3DD2H 3S9AA 2BDGA 2ZHWH 1O5GH 4Y79A 3BTGE 1MD7A 3SHCH 3TK5A 1PQ7A 1T7CA 1OOKB 1HYLA 4ABHA 1SOTA 2PWXA 2ZQ1A 1RJXB 3LGTA 1SGRE 1MTUA 1MU8B 2C93B 1KTSB 2WPLS 1EZUC 3A89A 4X2XA 4BANB 5A8XA 2J92A 1OWDA 3T29A 1P10A 1CU1A 3BG4B 1ZGVA 1OYQA 1AUTC 2WV4A 2PR3A 4ASHA 4Z0KA 5J4SA 1DDJA 3MNBA 3RXRA 5EGMA 5CMXH 3PO1B 1ELEE 3LONA 2CF8H 2FOGA 3A80A 1KXBA 3SV2H 1TMTH 1O3GA 1TNGA 2CHAB 1ABIH 1NZQH 2ZGHA 2VWOA 1WBGB 4DURA 1DPOA 2OC0A 5CHAC 2CN0H 3SU0A 1F0RA 1DWBH 1Y3VA 1ZHPA 1K1MA 3RXLA 3ENSB 3ZZ8A 3RM2H 3C27B 4GSOA 3BTEE 1DXWA 1K1OA 4ZH8A 6LPRA 5GIBA 3RXOA 1BRCE 4MNVA 3ZVEA 4J2YB 2G5NA 1D3QB 1BTYA 1PPBH 1TFXA 2PKSB 2OC1A 1GJAB 4ISIH 3D65E 3P8FA 1CVWH 2P8OB 2PKAB 5K7RA 2A2QH 4MLFB 5EXMA 1O3AA 4B1TA 1OS8A 5EPNA 1A3BH 1O2LA 2JETB 1KYNA 4ZMAH 2XCFA 1QB1A 2V3OH 3BTKE 2BD5A 3DFJA 2H5CA 4IC5A 1QQ4A 3QZRA 1O5BB 1EAWA 5A8YA 3T26A 3SUEA 1AFQB 1ANBA 2QA9E 1Y3UA 5AF9H 1C2KA 1GL0E 3UTUH 3FP7E 3LJOA 2FOEA 4AFUA 2G4UA 2B8OH 1EOLA 3MWIU 1INCA 2ILNA 6CHAB 1TNKA 1FV9A 1C5XB 1C1UH 3UNRA 2BLVA 4UFEH 1X7AC 5DPAA 1M9UA 1LQDB 4X1SU 1F0TA 1NROH 2K1QA 3LU9B 3K65B 3RXKA 5JBCS 1NTPA 1SG8B 3RXIA 1SB1H 2FMJA 1HJ8A 1DWCH 1BJUA 1P2OA 4F4OC 1FI8A 2GMTC 1FMGA 1KDQA 1ZRBA 1UHBA 1YM0A 5BPEA 1YKTA 1CO7E 1BUIA 3AAVA 1HLTH 1S0RA 3O8CA 3GYMA 3K6YA 1IQGA 1BIOA 4Q7XA 1YLDA 5IDKA 4U32A 4FVDA 4D8NA 4MPVA 1IHTH 1BJVA 2ZECA 4CRFA 4KTCA 3SV8A 1GG6C 2GGVB 1E34B 2ZFPH 1QURH 1C1SA 1UVUH 4ZUHA 1G3DA 2HWLB 3H7OA 3LPRA 1XVMA 2RCEA 2XBVA 2OD3B 4WVPE 1GHZA 3SU1A 3Q00A 1OP8A 1OWIA 2G8TA 1GJDB 4MNWA 2SFAA 1G36A 1C5RA 2O8UA 1BITA 1O2PA 1TA6A 2CGAA 3E90B 1EPTB 2BDBA 3CS7A 1B0EA 3GCTG 3VPKA 8GCHF 2B9LA 1AVXA 1EATA 2OC8A 3O8BA 3VB6A 5DO4H 4B2BA 3ZVAA 1UVPA 3UOPA 2OP9A 2V6NA 5GPIB 4MQAA 4IBLH 1AO5A 1P2JA 1MTSA 3V7TA 1Z1IA 4A1XA 3ZZ7A 2ZU3A 4H4FA 1MKWH 4HI3A 3ATIA 4K8YA 1XVOA 2FIRH 3QO6A 3SNEA 1FN6A 1C5OH 1W12U 1NESE 3TVJB 3HPTB 2WPJS 3U1JB 1ID5H 1RTLA 1HAPH 1MTVA 3HGNA 5DP4A 1V3XA 1AVWA 3JZ2B 3PLBA 3DUXH 1GMHG 3KQBA 3EDXB 5F8ZA 1LHFH 1AVGH 1LVBA 1T4UH 3ZYDA 2ZDNA 3SI4H 1O3LA 2R3UA 1C2MA 1V2ST 2W3IA 1ZHMA 2ZHQH 4Q7ZA 1P03A 1UTJA 2XWBI 5T3HA 4K1SA 4ABFA 1A5IA 3V3MA 3BTME 1L1NA 3M7TA 1EJMA 3SJIA 1UCYH 2H6MA 2BD2A 1W10U 4X2VA 2BDYA 2VU8E 4THNH 2RDLA 2ZZUH 1D4PB 1KXEA 3SHAH 5E8EH 1L1GA 1VITF 2BDAA 2ODPA 1EZSC 2AFQB 4MPUA 3F9GA 2EA3A 2HALA 2Z3CA 2O8TA 4GUXA 2D8WA 1W2KH 1EB1H 4RKOB 5GCHG 3MO3A 2W26A 4WXVA 2V0BA 3M5OA 1GHAF 1UVSH 1Z8RA 1OWKA 3MHWU 4CHAB 1BTZA 2Z9JA 2FODA 5FPTA 3SNDA 1KXDA 2GKVE 1V2VT 1LO6A 3V0XA 3MU4A 3U9AH 3BSQA 3SOSA 1JOUB 1SGQE 1QRZA 1TQ7B 3STIA 3A7YA 1SGTA 2FTMA 1Q31A 2R2WU 3FP6E 1C5NH 2ZDKA 4CH2B 1AZZA 4NA8A 1P02A 1JIMA 1MZAA 2GT7A 2FS9A 2UUYA 2Q1JA 3GCNA 3SI3H 3SO3A 1BQYA 3KEEA 4VGCC 1EAUA 1YPGH 5ESTE 1OSSA 3TIUA 5C2ZA 2TIOA 1DWEH 3P17H 2JH6D 1C4U2 4FUCA 1VCQA 1O3EA 2Y5FA 4Y71A 3ZV9A 4NZQA 1BMNH 1LKAA 3KQDA 2IN2A 3MU8A 3PMJA 1P2QA 1Z8IB 5B6OA 3TJVA 5A0BA 1V2TT 2EI6A 2FO9A 1HRTH 2RA3A 2ZDVH 5DP8A 1SFQB 3BG4C 1P3CA 4K60A 5HGGA 3UNQA 1AZ8A 4DOQA 1T8NA 5CHAB 1SMFE 4DJZB 1KDQB 2J95A 1UHBB 2FM2A 1H4WA 1V2QT 3EGKH 3PO1C 4Y7AA 1FJSA 4GAWA 3RXDA 2BZAA 3OX7U 2F3CE 2FI3E 1C5YB 2CHAC 3BTTE 3NZIA 5K0HA 3T2NA 1YYY1 3ATMA 3M61U 1UK2A 1D6RA 1DITH 4B73A 1W7XH 2TPIZ 1GDUA 1AB9B 5JYIA 1O2UA 2XRCA 1UTKA 3RXCA 2FOHA 1O2YA 2Z94A 3MU5A 2FS8A 1IQLA 2HPPH 1TBZH 1UTNA 2J38A 2VIQA 1ZMLA 4AYVB 2A4QA 1ETRH 4HZHA 4KELA 2P8OC 1O2KA 2QN5T 1K1JA 3GDSA 1S85A 3T28A 4NIWA 1FN8A 3QK1A 5I25A 1HAOH 5FHTA 2KAIA 2JETC 4NSYA 1KSNA 1AKSA 3O8DA 2QF3A 3T62A 1TNLA 4IGDA 5C1XA 4D9RA 1FIZA 1VCWA 8GCHG 3U1IB 2BMGB 1TB6H 3E6PH 3E1XB 1DLEA 2CJIA 1AFQC 1EP5A 2F9PA 1MH0A 1PQAA 2WPKS 3K9XB 8LPRA 2FESH 2BDCA 1CHOG 1KXAA 4WMFA 1AU8A 3SU3A 4LZ1H 2GX4A 1A3EH 1EB2A 1AI8H 4M7GA 2SGFE 4A7IB 1AD8H 2ZHFH 1SGNE 4YOGA 4U30A 1G37A 6CHAC 2GT8A 2BY7X 2GMTB 3TITA 4BXWA 7LPRA 2WYJA 1LHDH 2XC4A 2BHGA 1BCUH 1FY1A 4LXBH 1O3KA 5FPSA 4JZEH 1TMUH 1IQKA 1SGFG 5E0JA 4DG4A 4FUDA 1P01A 1NY22 2Q6GA 1DM4B 4H6TA 2CV3A 2M5TA 4E7RG 1L1JA 3UUZA 1EKBB 1ZJDA 2HRVA 2Z3DA 1SL3A 2SGAA 3MOCA 5L2YH 1NU9A 1F5RA 2W7UA 3MFJA 1WTHD 1GBMA 1D3PB 3FZDA 1YCPH 2BLOA 2ZU1A 1GBAA 2C8YB 3BTFE 5HYOA 3RU4D 1QL8A 1B0FA 1AWFH 3SGQE 1W8BH 1KLTA 5DP9A 1NRSH 3A82A 1SI5H 3SJ8A 3NWUA 4DW2U 1K22H 3H5CB 4NA7A 2ZU5A 2BQ6B 4OS7A 1P12E 1NRPH 1SGFA 2VNTA 1F0UA 4JYTA 1BMMH 3C1KA 4FUIA 1A5GH 2VWMA 4UFDH 4B2AA 1DY9A 3P8OA 5DP7A 1ZOMA 1DSUA 1O2SA 5GJ4B 1P04A 1EPTC 4AG1A 5LPEA 3GY6A 1O5DH 1DY8A 1EX3A 1OPHB 1O35A 2I6SA 4X1PU 4YOIA 1EXFA 3ITIA 1BOQA 3TU7H 3URDA 1TQ0B 1TGNA 3UR9A 4CR9A 2A4OA 2CMYA 3TPIZ 4R8TB 1KY9A 4H6SB 2P59A 3QWCH 1JWTA 4Y0YE 2QCYA 3PLKA 5JBAS 2IJOB 1GMCG 3BIVH 3ZVGA 1XUHA 1GMDG 1AIXH 2B0FA 5DGJA 3JZ1B 2RA0A 3VGCB 1DOJA 3UPEA 3TH3H 2BXTH 2Y5GA 5AFYH 3A86A 2ZGXH 4BAOB 2ZU4A 2SGDE 4X0WU 3UWJH 1PQ8A 2BM2A 3RMMH 4XBCA 2ULLA 1RIWB 1OWJA 2H9HA 1GHYH 1G3EA 2UWOA 4GCHG 7GCHG 1THSH 1WOFA 1G2LA 1S82A 1YC0A 2QAAA 5AVDA 1PFXC 1XXDA 2A2XH 3QDZB 1EQ9A 4RKJB 4K8BA 1FPHH 1IQFA 2AEIH 1MTNB 2FZZA 4E7NA 4Y76A 2AMQA 1MCTA 3KCGH 2BB4A 4FUFA 2OQ5A 5A8ZA 1CA0B 2EC9H 2P3FH 2P3UB 4RSPA 2UUJB 1BTPA 3OY5U 2HLCA 2AMPA 2QIQA 1RFNA 3MNXA 1V2KT 3QGJA 4SGBE 1C2IA 1GI9B 1V6DA 4U01A 2AYWA 4WMEA 1SQTA 1IQJA 2QXJA 4I31A 1NC6A 2R0LA 1SGIB 2FYRA 2H9EH 2KAIB 1TRMA 1WU1A 1GGDB 1AKSB 2ZNKH 3V13A 4AB8A 3TK9A 3RXSA 3SV6A 1KLJH 4CHAC 5EPYA 1QA0A 1YPEH 1VZQH 2GVFA 5GXPA 1K1NA 1O34A 2FEQH 3VB3A 5HMAA 3IITA 1NFXA 1ESAA 2ZQ2A 3A7TA 4ZXXH 4ABBA 3A7XA 3GDUA 4AFZA 1XX9A 3F6UH 1GMHF 1MMJN 2FP7B 4YZUA 4WXIA 4Y8XA 4IC6A 1C2GA 2BOHB 1JXPA 1C5QA 4F49A 2XBYA 5FAHA 1MKXH 1DANH 4JZFH 1V2MT 2THFB 4MNXA 4ABJA 4Q7YA 1MCVA 2GTBA 1EUFA 2ZGJA 2TBSA 3SQEE 2OUAA 1O3PB 2FX6A 1T8OA 1C2DA 1TX8A 3SU6A 1WAYB 2Z9KA 1A2CH 1J9CH 4NFEA 1OX1A 5EXLA 1J17T 1E36B 3GY5A 2Y81A 1DICA 3NCLA 3VEQB 2BQ7B 3UOUA 4LK4A 1FY8E 1HV7A 1OKXA 2XYAA 1Y3YA 5L6NH 1GBKA 1G30B 2ZFTA 4KTSA 4TWYA 1C1OA 1T32A 4IN2A 4AFQA 4HTCH 2AGIX 2AGEX 5GCHF 2F9VA 5HXFA 1DWDH 1GBCA 4Y8ZA 1NM6A 1UTMA 2VB0A 1AHTH 2R2MB 1BB0B 4RN6A 1DT2A 1WQVH 2DE8A 1LVOA 3VXFH 3PMBB 4UEHH 1AB9C 2OQUA 4TY7A 4YM9A 5E2OA 1NN6A 4Y11E 2FOMB 3RXMA 1ZSLA 2HVXA 4AB9A 1Y3XA 4MTBA 2Y5HA 1DUAA 3ESTA 1ZTKA 1V2RT 5F03A 4LZ4B 1C1PA 1QRXA 1C5SA 4X8TH 1QFKH 2PUXB 1L0ZA 2FYQA 5JBTA 5FX5A 2XBWA 1TX7A 2ZP0H 3D23A 4OS6A 2WPMS 1HAIH 1GI7B 2BOKA 3QUMP 4DVAU 1MZDA 2Z6BD 3AVZA 2OBOA 2C8XB 1QGFA 3GY3A 4AGJA 3S9BA 1MKWK 2A5IA 3B9FH 1C1MA 1ARBA 2BLQA 1Y3WA 4I32A 1O2IA 1DUEA 4A92A 2ZI2H 1S83A 5EOKA 3ZZ5A 1O2QA 1QBVH 2OXSA 1C5MD 1BHXB 1GJ6A 1E0FD 1ZTLA 3SN8A 5EQRA 6GCHG 3S7HB 4WH8A 1SHHB 1P0SH 3RLYH 3SUFA 1HJAB 1O2GH 2BY9X 4O9VA 3KL6A 1TBRH 4DIHH 1F0SA 2ODYB 3RXTA 4E05H 2OCVB 4XDEA 4K1EA 1E38B 1QIXB 1N8OB 4UE7H 3KHVA 3BIUH 4ABIA 3HGPA 4ZAEA 3M5MA 2C8WB 2ZFQH 2XC5A 4ABGA 1UCYK 2JKHA 4AOQA 1AUJA 1GBFA 1O3MA 4FU9A 1MBQA 3A8DA 3F68H 1H1BA 1O3JA 2LNCA 2J4IA 1SSXA 1VGCC 2BZ6H 4D76A 3CS0A 1ZMJA 3RC6A 1HAXB 3A8AA 1QA7A 2ZPQA 4A6LA 3FAOA 3LT3A 2FXRA 5JDUB 1UCYE 1OYTH 3E91A 3HK6B 5G4BA 3LGYA 1Y59T 1TNJA 1YPKH 1SGDE 1TX6A 3M7QA 1WUNH 4KTUA 1SLVB 3PROA 4TY6A 5E0HA 3EA9A 1O5CB 1GBTA 2VWLA 5DG6A 5FBIA 1CHOF 1MAXA 2ANMH 2BVRH 2QC2A 4CR5A 2XTTB 1D6WA 4MVNA 1O3FA 4TYDA 3EA7A 2VINA 4K69A 3M36A 4XE4A 1HPGA 1ABJH 4B2CA 5ABWA 2VIWA 3M37A 3E8LA 1PPEE 1CE5A 1H8IH 4U2WA 3ZVBA 1O3NA 1LHEH 2VVVA 6ESTA 1C1VH 1G3BA 1ETTH 1GBJA 1LVYA 1HGTH 2WV5A 2ZTYA 1ZJKA 1UTQA 2ODQA 3KNXA 1MU6B 3R0FA 4AN7A 1MQ5A 2B5TB 1PJPA 4UFGH 5T6DA 1CQQA 3U8TH 1UVOA 1A0LA 2GV6A 4B74A 1ELAA 2R3YA 3VB7A 4FUBA 3KQEA 3IWMA 3VGCC 3E3TA 1BDAA 1CT0E 1HAZB 2JH5D 2W5EA 2XXLA 1A0HB 4B76A 3TH4H 4HGCA 4FUHA 4MPXA 1U6QA 2ZCKP 3MU1A 3RMLH 1THRH 1RIWC 4YT7H 1DFPA 2PHBA 1GI1A 5C5NA 4K5ZA 1GBEA 8ESTE 7ESTE 1ORFA 4CBOA 3LOXA 2G51A 3GDVA 2UUKB 3RXFA 2BYAX 2VIVA 1BHXF 1MTNC 1P9SA 1O39A 4FXGH 4YESB 4FUGA 1BMAA 1GPZA 3FP8E 4NIXA 2ANYA 1O33A 3SJ9A 2BVSH 2ZIQH 3ZZ6A 2FDAA 2UUFB 1CA0C 5DJ7A 2P95A 1UTOA 1XKBC 2WINI 1XKAC 2ZCLP 3Q77A 2HOBA 1EP6A 3V12A 3BV9B 1GWAA 3MTYA 1GGDC 2XCNA 1UK3A 1ZSJA 4BTUB 1C1TA 4DT7B 1ZPZA 1N1LA 1BBRH 2ZO3H 1NS3A 1TMBH 3GYLB 4I8GA 2YNBA 1P11E 4OGYA 1GMCF 3LC3A 1GMDF 2Y7ZA 1VJ9U 1NRNH 3VXEH 1LPZB 1QR3E 1L4DA 1J16A 2HPQH 1GJ5H 4BAHB 3LGUA 1E37B 1HAYB 4ZHMU 4ISOA 2GCTB 1ACBE 4NFFA 3FZZA 3OY6U 1AWHB 1SVPA 3N7OA 5LPRA 1QY6A 2Z3EA 4GCHF 2D2DA 1O2TA 2O8LA 4XOJA 1O3HA 7GCHF 1DSTA 3QN7A 2W7SA 1O0DH 1GBHA 2BD3A 1O37A 1Z8GA 1YP9A 2IPHA 2ZGCA 1P3EA 3GCHB 3P70B 1H8DH 1LHCH 2Y6TA 1QHRB 2G4TA 4MDSA 4OS1A 1HBTH 5LGOA 3F9HA 1FONA 2AH4X 1O3CA 1GBLA 2AMDA 2SNVA 1WQSA 1FY5A 4J1YA 3PTNA 1VITH 1LTOA 1J8AA 3RMOH 2D1JA 4O03A 1O2XA 1AE5A 2PW8H 1OP0A 1OWHA 1HB0B 3RXHA 1XM1A 3E0PB 2UWLA 1TONA 1O3OA 3A81A 2A31A 2BX3A 3UWIA 3P92A 2VJ1A 3M35A 3I78A 4B71A 3TNSA 1GI4A 3F9EA 1FIWA 1QJ6B 1Z7KA 2WYGA 5F8XA 3ATLA 1PPHE 3A8CA 4IS5A 1D9IA 1O31A 2Z9IA 2NWNA 5C5OA 4AGKA 1GJBB 4ZHAA 1T31A 3A84A 2QF0A 2GV7A 1YPLH 2WUCA 2FX4A 4CREA 1RTKA 4Z6AH 5C1YA 2A5KA 2ZFRH 3RDZA 3EAJA 4AX9H 3R3GB 2G5VA 3SV9A 3W95A 1SBWA 3E16B 3S69A 4MNYA 1TAWA 3HKIB 2ZTXA 3PWBA 4OGXA 3SW2B 3BEUA 4Y7BA 3SGAE 3A83A 2FI4E 5DP6A 1HJAC 4ZKSU 3A87A 4KGAA 1SGCA 4X8UH 3LH3A 3QLPH 5I46H 1VGCB 4X6NA 1AN1E 2QY0B 1JBUH 1TGTA 1N8OC 2F91A 1KLIH 1UVTH 3OYPA 1BMLA 1TIOA 1ZPBA 2CF9H 3SGBE 2ALVA 4ZHLU 5DK1A 4ISHH 3B8JA 5TCCA 1FXYA 3B23B 1S84A 1QB6A 1WYKA 1C4V2 2G00A 3T5FH 4AFSA 3A8BA 4ISLA 1V2LT 2NU0E 1GI0A 4LOYH 1ANCA 1HAVB 1H9HE 3KGPA 4IMZA 2VH0A 2ZPRA 1T4VH 1BZXE 3GICB 4FUEA 4O3TA 3RXQA 2FPZA 1ELDE 1Y5UT 2EEKA 3QTOH 4NZLA 1TBQH 1QNJA 3QZQA 1XMNB 3BEIB 3RM0H 3TH2H 3W94A 1L4ZA 3ZZ9A 2ESTE 1PPCE 1BTUA 1EZQA 4ZROA 1ZRKA 4NSVA 4KKDA 3TK6A 3AASA 1QJ1B 5LPFA 1XUGA 2YNAA 2Y82A 2GCHF 1SR5C 5F6MA 3K6ZA 3ODFA 3MH6A 2VVCA 1TPPA 2ALPA 4IMQA 1DXPA 1O3IA 4ABAA 3PM3A 5FPYA 6GCHF 4BTTB 3RXVA 5CE1A 1HJ9A 5FCKA 1MKXK 3TGJE 2QGRA 5BRRE 1ZYOA 3GISB 1IQIA 1GJ7B 2VIPA 1ETSH 1RTFB 1GVLA 4X1NU 1Z8JB 4O97A 1HUTH 1Z71A 1YCPM 1H9IE 2EI8A 5ETXA 1RS0A 2QXHA 2ZDAH 1Z6JH 1Z1JA 4X2WA 3FVFB 1WCZA 4NGAH 3M3SA 3P8GA 5A2MH 3A88A 1W3CA 1O2MA 5L2ZH 4ESTE 3URCA 1QBNA 4JK5A 4FUJA 2Z9LA 1WSSH 3RXBA 1P2MA 1TRYA 1QTFA 3MO6A 4Q80A 4NIVA 1Y8TA 1GJ4H 1AFEH 1C2HA 4JCNA 1HNEE 3BEFB 2PTNA 4IW4E 4WY3A 2GZ7A 2A4RA 1C1RA 1P2KA 4X1RU 2HNTC 5AFZH 3F9FA 4E06H 1F5LA 1OWEA 1FY4A 1BTWA 1MD8A 1G9IE 2WPHS 4X8SH 2GDDA 3GCOA 2QXIA 1HXEH 1C4Y2 3D62A 4R0IA 1AE8H 1PQ5A 2QYIA 3ZV8A 3HKJB 1EJNA 1TLDA 3H7TA 1YPHE 3SNCA 1PPGE 4CRBA 2GP9B 1ELVA 1LDTT 1GJ8B 3KQCA 1UMAH 4JYVH 1RRKA 3TGIE 3STJA 2ZGBH 1OXGA 2NU1E 3SU2A 3Q76A 3A7ZA 3HATH 1V2UT 1YPJH 3AW1A 4INLA 2BVXH 3S9CA 2ZC9H 1GCTB 2ZF0H 2PSYA 2VWNA 1WV7H 2D26C 2FTLE 3DT0H 1KIGH 4AG2A 2OTVA 1Q3XA 2G81E 4WMDA 5J4QA 4CRCA 4XFQA 4WWYA 4X1QU 1P8VC 1XUJA 1K28D 1S81A 2TGDA 2ZA5A 1YPMH 3U8OH 1GBIA 3GOVB 1EZXC 2J9NA 5HM2A 2XNIA 4D9QA 2GCTC 1TABE 2A0QB 4FU8A 4OS2A 5GWZA 2ZDMA 1F7ZA 4JMYA 2P94A 1YF4A 3I77A 1SLWB 1T8LA 2P3TB 2TGPZ 1ANEA 5DKMA 1FDPA 1C2FA 3RXPA 1LCYA 4GHTA 1BRUP 3RXEA 2BTCE 4I8LA 2OINA 3GCHC 5A0CA 1GHWH 1HFDA 2O9QA 1D3DB 3LC5A 1HIAA 3MO9A 4K2YA 3U8RH 4BAMB 2B7DH 2G55A 4NWKA 1YLCA 3P95A 4X8VH 2PGQB 1BTXA 5GDSH 1ZLRA 5JBBS 2XWAA 1MTWA 2O8MA 3LKWA 4ZXYH 3RP2A 2ZHEH 4H42U 3LH1A 1O3DA 4X6PA 1W0YH 3SV7A 1IQMA 2PLXA 1F92A 3L33A 3UY9A 1FQ3A 4YO9A 4YOJA 3AW0A 3HK3B 1EAXA 3TJNA 2Q6FA 4A5TS 1CGJE 5E2PA 1TGBA 3MNCA 1Q2WA 4BXSA 5LH8A 7KMEH 4JZ1A 3OTJE 3UFAA 1W14U 4YLQH 2J34A 3TNTA 1TA2A 2GCHG 1ZGIA 3LJJA 2TGTA 1C1NA 2ZG0H 3M3TA 2Y7XA 2H5DA 2AIPA 2XC0A 3RXAA 1LHGH 2BDIA 3RU4E 4IN1A 4GLYA 1GHBG 3MU0A 1O2OA 1WTGH 1ZMNA 1XUKA 1TNHA 3PV4A 3LDXH 1GVZA 1K2I1 1K1LA 1RGQA 2ZTZA 3BTDE 4ZKNU 4X6MA 4INHA 2A7CA 4OS5A 4BTIB 1HDTH 2VH6A 3ZVCA 3TJUA 1IHSH 1YPHC 5C67A 2PUQH 1O30A 4NG9H 4ABDA 3I29A 4ZKOU 1BA8B 4KP0A 4I8HA 3TGKE 5A09A 2F83A 1NU7B 2A7JA 3ZZCA 1ESTA 2FOCA 4JK6A 1O32A 3ZZAA 1O2VA 3GY8A 1GHXH 2VGCB 2A5AA 1O3BA 1A0JA 3UIRA 3GY2A 1GI3A 1ANDA 1E35B 1C5WB 3SORA 1EASA 1IAUA 3ZVDA 5EODA 3LIWA 3UQVA 3ZZ3A 1PYTD 2PSXA 3LGWA 5C20A 1SLUB 1RD3B 2A1DB 2SNWA 2FOBA 1ARCA 1DS2E 3IG6B 5JPMH 1LVMA 2HGTH
chains in the Genus database with same CATH superfamily
4DCDA 1O2NA 4X2YA 1O2ZA 5EQQA 1Z6EA 4NA9H 3L3TA 1V2PT 1YBWA 5EJ1A 2L74A 1SGEE 3ZZ4A 1A61H 3A7VA 2ZFSA 1CT4E 1S6FA 1JIRA 2FLBH 1FPCH 3EYDA 3T25A 5EU8A 1C9TA 3TJOA 1SHYA 1W0ZU 5EQSA 4O3UA 1BBRK 2XW9A 4QT8C 4INKA 1C9PA 1K21H 1C2EA 1G3CA 1F2SE 1GBDA 1GCDA 4B75A 2IOTA 2VIOA 3K2UA 2VIDA 4DIIH 1UJ1A 2H2ZA 5FX6A 2ANKH 1QJ7B 2SGEE 5L30H 5AHGH 1CSOE 1MAYA 1S5SA 1FAKH 1SGYE 2C90B 2F9OA 3NUMA 5ESBA 3S0NA 2J2UA 3PLPA 1LQEA 1AGJA 3SBKA 2STAE 1YGCH 4BAQB 4ISNA 1COWD 2V3HH 4ZKRU 1K1IA 1V2OT 4BOHA 1BBRE 5C0TA 1ZR0A 4NWLA 2LPRA 5FCRA 1TALA 4NIYA 1TOCB 3P8NA 4ABEA 2P16A 2A45B 2P93A 2FOFA 4I8KA 4D7GA 4YLUA 1E1RD 2PTCE 1H9LB 4WH6A 4A1VA 3SU4A 4CRGA 2ZU2A 1J14A 5A0AE 1A1RA 4M9FA 3RMNH 3M7UA 1CBWB 5C1UA 3ATWA 3N7DA 1HIAB 4JZIA 5DN6D 2ZKSA 3EA8A 3D49H 1AY6H 8KME2 2OBQA 1FUJA 2FI5E 2H1UA 3NRLA 4K3JA 1HAVA 1TPSA 1S6HA 1GL1A 3LGVA 3MH7A 1QQUA 2C8ZB 9ESTA 3A85A 3RC4A 3SU5A 5JB8S 3T27A 4FVBA 3PB1E 3RUOA 4XRNA 3ZYEA 2FOAA 3AK5A 2UWPA 2AERH 1C5VA 1ZTJA 4TPYA 2KM0A 5E0GA 1C2LA 1SKYE 2BY6X 2BD9A 1QBOA 3S7KB 5F8TA 3BTWE 1CGHA 4JZDH 1O38A 2ASUB 3UQOA 3DA9B 1NO9H 1UTLM 4ACBA 3NK8A 3RXUA 4Q2KA 5T6FA 3O8RA 1FZZA 4XSKU 4BAKB 2I6QA 2CXVA 1JRTA 3NPSA 1TE0A 1V2NT 4TPIZ 4CH8B 2R0KA 2BLWA 4AZ2B 4D7FA 3Q3XA 1QL9A 1ZZZA 2WPIS 3ELAH 1NFUA 5IYTA 3SJKA 4Y10E 3M5NA 2NU2E 3PWCA 1JRSA 1K1PA 1VCPA 2ZPSA 1GCTC 3A7WA 1P09A 4F48B 2AIQA 2A32A 1GDQA 1ELFA 4A1TA 1LMWB 1ELGA 4XBBA 1TNIA 1ELTA 3SYJA 1EAIA 4PROA 1V2JT 1O5FH 2GDEH 1J15A 2PFEA 2C4FH 1UTPA 2BD7A 4ZCNA 2BDHA 3FANA 3ZVFA 4GVUA 2AS9A 1S0QA 4XD7D 2Z9GA 2VVUA 2GZ8A 1O5EH 1GJ9B 3Q3KA 1HAGE 5C3NA 4UFFH 1CA8B 5DP3A 3VFEA 3CENA 1RXPA 1YCPK 2QXGA 2F9NA 1TYNA 3E0NB 4TWWA 1O36A 3VB5A 1N6XA 3WY8A 5EW1H 5T6GA 2PV9B 4NCYA 3LGIA 3WW7A 1QZ8A 3UR6A 5IK2D 5HM9A 3M5LA 3SNAA 3M3VA 3PYHA 1C2JA 1GJCB 1TPAE 4UONA 3BN9A 2EI7A 3WWFA 4Y8YA 3FFGA 5EG4A 2IPQX 1EJAA 3SUGA 3Q3YA 2LP6A 2DUCA 1O5AB 3AAUA 1LKBA 1CGIE 1ZPCA 1L2EA 1IQNA 1XUFA 2GD4B 4WJG2 2PKSC 5PTPA 1C5PA 3L6PA 2GZ9A 4BNRA 3DSOA 1O2WA 1KXFA 4MPWA 2HNTF 1O2JA 1C5TA 2GJGA 2HNTE 3QGNB 2JIZD 3RU4T 5JB9S 1A46H 4AYYB 3SZNA 1GI6A 4I8JA 4RT0A 1SPJA 1TGSZ 1QL7A 5EJZA 3DFLA 1NT1A 3MYWA 1O2RA 1C1QA 2ZFFH 5GNDA 2C3SA 4CRAA 1NFYA 2STBE 5SGAE 4K1TA 3MH4A 2Q6DA 3UNSA 3TLOA 4I33A 3DHKH 1LPGB 4DGJA 1VJAU 1KTTB 1BRAA 2YOLA 3F3BA 1MQ6A 3KF2A 2BY5X 3RC5A 1C1WH 4Y0ZE 3ZZBA 1XUIA 1IOEA 1CHGA 1MUEB 2G52A 3RLWH 1SC8U 2A7HA 2AGGX 4UD9H 3QX5H 1DVAH 1NRRH 3KN2A 2BXUH 1P06A 4FU7A 3NXPA 2ZCHP 3U69H 2BY8X 4Y6DA 2K8IA 2NU3E 1P2IA 1TPOA 2NU4E 2W3KA 3F1SB 1GG6B 1ZSKA 3PMAB 1ESBA 3BTHE 2BD8A 1C5ZB 2ANWA 1GBBA 2VGCC 2Z7FE 1SFIA 1Y5BT 1P9UA 3BG8A 2DE9A 2J97A 1DLKB 1PPZA 3SUDA 1JMOH 3SNBA 3W1EA 2OC7A 1VR1H 2QV1A 2XBXA 1IQEA 1QRWA 4HFPB 3QTVH 5EW2H 1BTHH 1C5UA 1Y5AT 1ZHRA 1A4WH 4WF8A 1SQAA 1TGCA 1NRQH 2BX4A 3ZIAD 1VITG 2PKAA 1G2MA 1BT7A 1ELBA 2O8WA 5FBEA 4I7YH 3SJOA 1N6YA 4DY7B 3PMHB 1F5KU 1IQHA 2F9BH 3BF6H 5KGOA 2H9TH 1AMHA 4GHQA 3OU0A 1GHAG 1GHBF 3CP7A 1PPFE 4X6OA 2SGQE 2TRMA 1UO6A 1AQ7A 2WUBA 3G01A 3GY7A 2IJD1 3ZZDA 1KMHB 1C5LH 2OLGA 1BMFD 3PTBA 3NKKA 4ACAA 1LPKB 1XXFA 1GVKB 2ZEBA 3P6ZB 2BD4A 1FNIA 2J94A 1D3TB 1THPB 5DP5A 1SOZA 2F9UA 4P02A 2PGBB 1NFWA 1B7XB 2RG3A 1P2NA 2V35A 2ZHDA 1FLEE 2KCOA 1NPMA 1W13U 2R9PA 5H4IB 4CBNA 1SGPE 3RXJA 1GHVH 4MG3A 9LPRA 3MMGA 2Y80A 1GI8B 1A7SA 2FWWA 2HLDD 1A5HA 1O2HA 5TJXA 1ELCA 3OAAD 3MH5A 4YT6H 1CT2E 3DCLA 1DE7H 1CBWC 2F43B 1HAHH 2FLRH 1W7GH 5EXNA 1GI2A 1MBMA 4GPGA 1P57B 1QCPA 3OFND 3MNSA 4JYUH 2ZDLA 1GDNA 3VB4A 3ATKA 2ZWLH 4CRDA 3OSYA 1QB9A 1T8MA 1BRBE 3RXGA 3KIDU 4XBDA 1DX5M 3GY4A 1OP2A 4AORA 1FY3A 2BQWB 3EQ0H 5TCAA 4FETA 4YTAA 3GCTF 1HCGA 1KXCA 1TOMH 5FXLA 1TWXB 1V2WT 3SQHE 4Q4LA 3U98H 1SQOA 1PYTC 1K9OE 1EOJA 2JH0D 3BTQE 1EPTA 3UREA 1FAXA 3MI4A 1SLXB 2SGPE 1B5GH 1GI5A 2A4GA 4SGAE 3PV5A 3ODDA 4OS4A 3EE0B 1P05A 1G32B 1TRNA 1W11U 1HXFH 2TGAA 4VGCB 1UK4A 4UDWH 3DD2H 3S9AA 2BDGA 2ZHWH 1O5GH 4Y79A 4DT4A 3BTGE 1MD7A 3SHCH 3TK5A 1PQ7A 1T7CA 1OOKB 1HYLA 4ABHA 1SOTA 2PWXA 2ZQ1A 1RJXB 3LGTA 1SGRE 1MTUA 1MU8B 5KEDA 2C93B 1KTSB 2WPLS 1EZUC 3A89A 4X2XA 4BANB 5A8XA 2J92A 1OWDA 3T29A 1P10A 1CU1A 3BG4B 1ZGVA 1OYQA 1AUTC 2WV4A 2PR3A 4ASHA 4Z0KA 5J4SA 1DDJA 3MNBA 3RXRA 5EGMA 5CMXH 3PO1B 1ELEE 3LONA 2CF8H 2FOGA 3A80A 1KXBA 3SV2H 1TMTH 1O3GA 2JJ2D 1TNGA 2CHAB 1ABIH 1NZQH 2ZGHA 2VWOA 1WBGB 4DURA 1DPOA 2OC0A 5CHAC 2CN0H 3SU0A 1F0RA 1DWBH 1Y3VA 1ZHPA 1K1MA 3RXLA 3ENSB 3UB0A 3RM2H 3ZZ8A 3C27B 4GSOA 3BTEE 1DXWA 1K1OA 4ZH8A 6LPRA 5GIBA 3RXOA 1BRCE 4MNVA 3ZVEA 4J2YB 2G5NA 1D3QB 1BTYA 1PPBH 1TFXA 2EQNA 2PKSB 2OC1A 1GJAB 4ISIH 3D65E 3P8FA 1UW7A 1CVWH 2P8OB 2PKAB 5K7RA 2A2QH 4MLFB 5EXMA 1O3AA 4B1TA 1OS8A 5EPNA 1A3BH 1O2LA 2JETB 1KYNA 4ZMAH 2KCAA 2XCFA 1QB1A 2V3OH 3BTKE 2BD5A 3DFJA 3UAIC 2H5CA 4IC5A 1QQ4A 3QZRA 1O5BB 2L6OA 1EAWA 5A8YA 2KX4A 3T26A 3SUEA 1AFQB 1ANBA 2QA9E 1Y3UA 4I86A 5AF9H 1C2KA 1GL0E 3UTUH 3FP7E 3LJOA 2FOEA 4AFUA 2G4UA 1E1QD 2B8OH 1EOLA 3MWIU 1INCA 2ILNA 6CHAB 1TNKA 1FV9A 1C5XB 1C1UH 3UNRA 1EFRD 2BLVA 4TT3D 4UFEH 1X7AC 5DPAA 1M9UA 1LQDB 4X1SU 1F0TA 1NROH 2K1QA 3LU9B 3K65B 3RXKA 5JBCS 1NTPA 1SG8B 3RXIA 1SB1H 2FMJA 1HJ8A 2WV9A 1DWCH 1BJUA 1P2OA 4F4OC 1FI8A 2GMTC 1FMGA 1KDQA 1ZRBA 1UHBA 1YM0A 5BPEA 1YKTA 1CO7E 1BUIA 3AAVA 1HLTH 1S0RA 3O8CA 3GYMA 3K6YA 3KYFA 1IQGA 1BIOA 4Q7XA 1YLDA 5IDKA 4U32A 4FVDA 4D8NA 4MPVA 1IHTH 1BJVA 2ZECA 4CRFA 4KTCA 3SV8A 1GG6C 2GGVB 1E34B 2ZFPH 1QURH 1C1SA 1UVUH 4ZUHA 1G3DA 2HWLB 3H7OA 3LPRA 1XVMA 2RCEA 2XBVA 2OD3B 4WVPE 1GHZA 3SU1A 3Q00A 1OP8A 1OWIA 2G8TA 1GJDB 4MNWA 2SFAA 1G36A 1C5RA 2O8UA 3CNRA 1BITA 1H8HD 1O2PA 1TA6A 2CGAA 3E90B 1EPTB 2BDBA 2LELA 3CS7A 1B0EA 5B6LA 3GCTG 3VPKA 8GCHF 2KCYA 2B9LA 1AVXA 1EATA 2OC8A 3O8BA 3VB6A 5DO4H 4B2BA 3ZVAA 5FL7D 1UVPA 3UOPA 2OP9A 2V6NA 5GPIB 4MQAA 4IBLH 1AO5A 1P2JA 1MTSA 3V7TA 1Z1IA 4A1XA 3ZZ7A 2ZU3A 4H4FA 3N99A 1MKWH 4HI3A 3ATIA 4K8YA 1XVOA 2FIRH 3QO6A 3SNEA 1FN6A 1C5OH 1W12U 1NESE 3TVJB 3HPTB 2WPJS 3U1JB 1ID5H 1RTLA 1HAPH 1MTVA 3HGNA 5DP4A 1V3XA 1AVWA 3JZ2B 3PLBA 3DUXH 1GMHG 3KQBA 3EDXB 5F8ZA 1LHFH 1AVGH 1LVBA 1T4UH 3ZYDA 2ZDNA 3SI4H 1O3LA 2R3UA 1C2MA 1V2ST 2W3IA 1ZHMA 2ZHQH 4Q7ZA 1P03A 1UTJA 2KZ4A 2XWBI 5T3HA 4K1SA 4ABFA 1A5IA 3V3MA 3BTME 1L1NA 3M7TA 1EJMA 3SJIA 1UCYH 2QF5A 2H6MA 2BD2A 1W10U 4X2VA 2BDYA 2VU8E 4THNH 2RDLA 2ZZUH 1D4PB 1KXEA 5C94A 3SHAH 5E8EH 1L1GA 1VITF 2BDAA 2ODPA 1EZSC 2AFQB 4MPUA 3F9GA 2EA3A 2HALA 2Z3CA 2O8TA 4GUXA 2D8WA 3FKSD 1W2KH 1EB1H 4RKOB 5GCHG 3MO3A 2W26A 4WXVA 2V0BA 3M5OA 1GHAF 1UVSH 1Z8RA 1OWKA 3MHWU 4CHAB 2VBCA 3OTPA 3KYGA 4B6EA 1BTZA 2Z9JA 2FODA 5FPTA 1E79D 3SNDA 1KXDA 2GKVE 1V2VT 1LO6A 3V0XA 3MU4A 3U9AH 3BSQA 3SOSA 1JOUB 1SGQE 1QRZA 1TQ7B 3STIA 3A7YA 1SGTA 2FTMA 1Q31A 2R2WU 3FP6E 1C5NH 2ZDKA 4CH2B 1AZZA 4NA8A 1P02A 1JIMA 1MZAA 2GT7A 2FS9A 2UUYA 2Q1JA 3GCNA 3SI3H 3SO3A 1BQYA 3KEEA 4VGCC 1EAUA 1YPGH 5ESTE 1OSSA 3TIUA 5C2ZA 2TIOA 1DWEH 3P17H 2JH6D 1C4U2 4FUCA 1VCQA 1O3EA 2Y5FA 4Y71A 3ZV9A 4NZQA 1BMNH 1LKAA 3KQDA 2IN2A 3MU8A 3PMJA 1P2QA 1Z8IB 5B6OA 3TJVA 5A0BA 1V2TT 4ASUD 2EI6A 1MABB 2FO9A 1HRTH 2RA3A 2ZDVH 5DP8A 1SFQB 3BG4C 1P3CA 4K60A 5HGGA 3UNQA 1AZ8A 4DOQA 1T8NA 5CHAB 1SMFE 4DJZB 1KDQB 2J95A 1UHBB 2FM2A 1H4WA 1V2QT 3EGKH 3PO1C 4Y7AA 1FJSA 4GAWA 3RXDA 2BZAA 3OX7U 2F3CE 2FI3E 3F2HA 1C5YB 2CHAC 3BTTE 3NZIA 5K0HA 3T2NA 1YYY1 3ATMA 3M61U 1UK2A 1D6RA 1DITH 4B73A 1W7XH 2TPIZ 1GDUA 1AB9B 5JYIA 1O2UA 2XRCA 1UTKA 3RXCA 2FOHA 1O2YA 2Z94A 3MU5A 2FS8A 1IQLA 2HPPH 1TBZH 1UTNA 2J38A 2VIQA 1ZMLA 4AYVB 2A4QA 1ETRH 4HZHA 4KELA 2P8OC 1O2KA 2QN5T 1K1JA 3GDSA 1S85A 4P00A 3T28A 4NIWA 1FN8A 3QK1A 5I25A 1HAOH 5FHTA 2KAIA 2JETC 4NSYA 1KSNA 1AKSA 3O8DA 2QF3A 3T62A 1YWUA 1TNLA 4IGDA 5C1XA 4D9RA 1FIZA 1VCWA 8GCHG 3U1IB 2BMGB 1TB6H 3E6PH 3E1XB 1DLEA 2CJIA 1AFQC 1EP5A 2F9PA 2CK3D 1MH0A 1PQAA 2WPKS 3K9XB 8LPRA 5HIYA 2FESH 2BDCA 5F53A 1CHOG 1KXAA 4WMFA 1AU8A 3SU3A 4LZ1H 2GX4A 1A3EH 1EB2A 1AI8H 4M7GA 2SGFE 4A7IB 1AD8H 2ZHFH 1SGNE 4YOGA 4U30A 1G37A 6CHAC 2GT8A 2BY7X 2GMTB 3TITA 4BXWA 7LPRA 2WYJA 1LHDH 2XC4A 2BHGA 1BCUH 1FY1A 4LXBH 1O3KA 5FPSA 4JZEH 1TMUH 1IQKA 1SGFG 1W0JD 5E0JA 4DG4A 4FUDA 1P01A 1NY22 2Q6GA 1DM4B 4H6TA 2CV3A 2M5TA 4E7RG 1L1JA 3UUZA 1EKBB 1ZJDA 2HRVA 2Z3DA 1SL3A 2SGAA 3MOCA 5L2YH 1NU9A 1F5RA 5EIYA 2W7UA 3MFJA 1WTHD 1GBMA 1D3PB 3FZDA 1YCPH 2BLOA 2ZU1A 1GBAA 3DSGA 2C8YB 3BTFE 5HYOA 3RU4D 1QL8A 1B0FA 1AWFH 3SGQE 1W8BH 1KLTA 5DP9A 1NRSH 3A82A 1SI5H 3SJ8A 3NWUA 4DW2U 1K22H 3H5CB 4NA7A 2ZU5A 2BQ6B 4OS7A 1P12E 1NRPH 1SGFA 2VNTA 1F0UA 4JYTA 1BMMH 3C1KA 4FUIA 1A5GH 2VWMA 4UFDH 5CHBA 4B2AA 1DY9A 3P8OA 5DP7A 1ZOMA 1DSUA 1O2SA 5GJ4B 1OHHD 1P04A 1EPTC 4AG1A 5LPEA 3GY6A 1O5DH 1DY8A 1EX3A 1OPHB 1O35A 2I6SA 4X1PU 4YOIA 1EXFA 3ITIA 1BOQA 3TU7H 3URDA 1TQ0B 1TGNA 3F2FA 3UR9A 4CR9A 2A4OA 2CMYA 3TPIZ 4R8TB 1KY9A 2JDID 4H6SB 2P59A 3QWCH 1JWTA 4Y0YE 3KQ5A 2QCYA 3PLKA 5JBAS 2IJOB 1GMCG 3BIVH 3ZVGA 1XUHA 1GMDG 1AIXH 2B0FA 5DGJA 3JZ1B 2RA0A 3VGCB 1DOJA 3UPEA 3TH3H 2BXTH 1YLNA 2Y5GA 5AFYH 3A86A 2ZGXH 4BAOB 2ZU4A 3PRBA 2SGDE 4X0WU 3UWJH 1PQ8A 2BM2A 3RMMH 4XBCA 2ULLA 1RIWB 1OWJA 3FN8A 2H9HA 1GHYH 1G3EA 2UWOA 4GCHG 7GCHG 1THSH 4RI0A 1WOFA 1G2LA 1S82A 1YC0A 2QAAA 5AVDA 1PFXC 1XXDA 2A2XH 3QDZB 1EQ9A 4RKJB 4K8BA 1WXRA 1FPHH 1IQFA 2AEIH 1MTNB 5HKKD 2FZZA 4E7NA 4Y76A 2AMQA 1MCTA 3KCGH 2BB4A 4FUFA 2OQ5A 5A8ZA 1CA0B 2EC9H 2P3FH 2P3UB 4RSPA 2UUJB 1BTPA 3OY5U 2HLCA 2AMPA 2QIQA 1RFNA 3MNXA 1V2KT 3QGJA 4SGBE 1C2IA 1GI9B 1V6DA 4U01A 2AYWA 4WMEA 5EJLA 1SQTA 1IQJA 2QXJA 4I31A 1NC6A 2R0LA 1SGIB 2FYRA 2H9EH 2KAIB 1TRMA 1WU1A 1GGDB 1AKSB 2ZNKH 3V13A 4AB8A 3TK9A 3RXSA 3SV6A 1KLJH 4CHAC 5EPYA 1QA0A 1YPEH 1VZQH 2GVFA 5GXPA 1K1NA 1O34A 2FEQH 3VB3A 5HMAA 3IITA 1NFXA 1ESAA 2ZQ2A 3A7TA 3PV2A 4ZXXH 4ABBA 3A7XA 3GDUA 4AFZA 1XX9A 3F6UH 1GMHF 1MMJN 2FP7B 2V7QD 4YZUA 4WXIA 4Y8XA 4IC6A 1C2GA 2BOHB 1JXPA 1C5QA 4F49A 2XBYA 5FAHA 1MKXH 1DANH 4JZFH 1V2MT 2THFB 4MNXA 4ABJA 4Q7YA 1MCVA 2GTBA 1EUFA 2ZGJA 2TBSA 3SQEE 1O3PB 2FX6A 2OUAA 1T8OA 1C2DA 1TX8A 3SU6A 1WAYB 2Z9KA 1A2CH 1J9CH 4NFEA 1OX1A 3PRDA 5EXLA 1J17T 1E36B 3GY5A 2Y81A 1DICA 3NCLA 3VEQB 2BQ7B 3UOUA 4LK4A 1FY8E 1HV7A 1OKXA 2XYAA 1Y3YA 5L6NH 1GBKA 1G30B 2ZFTA 4KTSA 4TWYA 1C1OA 3U28C 1T32A 4IN2A 4AFQA 4HTCH 2AGIX 3OEHD 2AGEX 5GCHF 2F9VA 5HXFA 1DWDH 1GBCA 4Y8ZA 1NM6A 1UTMA 2VB0A 1AHTH 2R2MB 1BB0B 4RN6A 1DT2A 1WQVH 2DE8A 1LVOA 3VXFH 3PMBB 4UEHH 1AB9C 2OQUA 4TY7A 4YM9A 5E2OA 1NN6A 4Y11E 2FOMB 3RXMA 1ZSLA 2HVXA 4AB9A 1Y3XA 4MTBA 2Y5HA 1DUAA 3ESTA 1ZTKA 1V2RT 5F03A 4LZ4B 1C1PA 1QRXA 1C5SA 4X8TH 1QFKH 2PUXB 1L0ZA 2FYQA 5JBTA 5FX5A 2XBWA 1TX7A 2ZP0H 3D23A 4OS6A 2WPMS 1HAIH 2HVYB 1GI7B 2BOKA 3QUMP 4DVAU 1MZDA 2Z6BD 3AVZA 2OBOA 2C8XB 1QGFA 3GY3A 4AGJA 3S9BA 1MKWK 2A5IA 3B9FH 1C1MA 1ARBA 2BLQA 1Y3WA 2YMSD 4I32A 1O2IA 1DUEA 4A92A 2ZI2H 1S83A 5EOKA 3ZZ5A 1O2QA 1QBVH 2OXSA 1C5MD 1BHXB 4FOUC 1GJ6A 1E0FD 1ZTLA 3SN8A 5EQRA 6GCHG 3S7HB 4WH8A 1SHHB 1P0SH 3RLYH 3SUFA 1HJAB 1O2GH 2BY9X 4O9VA 3KL6A 1TBRH 4DIHH 1F0SA 2ODYB 3RXTA 4E05H 2OCVB 4XDEA 4K1EA 1E38B 1QIXB 1N8OB 4UE7H 3KHVA 3BIUH 4ABIA 3HGPA 4ZAEA 3M5MA 2C8WB 2ZFQH 2XC5A 4ABGA 1UCYK 2JKHA 4AOQA 1AUJA 1GBFA 1O3MA 4FU9A 1MBQA 2RDEA 3A8DA 1H1BA 3F68H 1O3JA 2LNCA 2W6ID 2J4IA 1SSXA 1VGCC 2BZ6H 4D76A 3CS0A 1ZMJA 3RC6A 1HAXB 3A8AA 1QA7A 2ZPQA 4A6LA 3FAOA 3LT3A 2FXRA 5JDUB 1UCYE 2EY4C 1OYTH 3E91A 3HK6B 2J98B 5G4BA 2F4LA 3LGYA 1Y59T 1TNJA 1YPKH 1SGDE 1TX6A 3M7QA 1WUNH 4KTUA 1SLVB 3PROA 4TY6A 5E0HA 3EA9A 1O5CB 1GBTA 2VWLA 5DG6A 5FBIA 2QF4A 1CHOF 1MAXA 2ANMH 3H09A 2BVRH 2QC2A 4CR5A 2XTTB 1D6WA 4MVNA 1O3FA 4TYDA 3EA7A 2VINA 4K69A 3M36A 4XE4A 5CDFE 1HPGA 2WZQA 1ABJH 4B2CA 5ABWA 2VIWA 3M37A 3E8LA 1PPEE 1CE5A 1H8IH 4U2WA 3ZVBA 1O3NA 1LHEH 2VVVA 6ESTA 1C1VH 1G3BA 1ETTH 1GBJA 1LVYA 1HGTH 2WV5A 2ZTYA 1ZJKA 1UTQA 2ODQA 3KNXA 1MU6B 3R0FA 4AN7A 1MQ5A 2B5TB 1PJPA 4UFGH 2YMSB 5T6DA 1CQQA 3U8TH 1UVOA 4YXWD 1A0LA 2GV6A 4B74A 1ELAA 2R3YA 1YY3A 3VB7A 4FUBA 3KQEA 3IWMA 3VGCC 3E3TA 1BDAA 1CT0E 1HAZB 2JH5D 2W5EA 2XXLA 1A0HB 4B76A 3TH4H 4HGCA 4FUHA 4MPXA 1U6QA 2ZCKP 3MU1A 3RMLH 1THRH 1RIWC 5HIZA 4YT7H 1DFPA 2PHBA 1GI1A 5C5NA 4K5ZA 1GBEA 8ESTE 7ESTE 1ORFA 4CBOA 3LOXA 2G51A 3GDVA 2UUKB 3RXFA 2BYAX 2VIVA 1BHXF 1MTNC 1P9SA 1O39A 4FXGH 4YESB 4FUGA 3F0PA 1BMAA 1GPZA 3FP8E 4NIXA 2ANYA 1O33A 3SJ9A 2BVSH 1FX0B 2ZIQH 3ZZ6A 2FDAA 2UUFB 1CA0C 3N7EA 5DJ7A 2P95A 1UTOA 1XKBC 2WINI 1XKAC 2ZCLP 3Q77A 2HOBA 1EP6A 3V12A 3BV9B 1GWAA 3MTYA 1GGDC 2XCNA 1UK3A 1ZSJA 4BTUB 1C1TA 4DT7B 1ZPZA 1N1LA 1BBRH 2ZO3H 1NS3A 1TMBH 3GYLB 4I8GA 2YNBA 1P11E 4OGYA 1GMCF 3LC3A 1GMDF 2Y7ZA 1VJ9U 1NRNH 3VXEH 1LPZB 1QR3E 1L4DA 1J16A 2HPQH 1GJ5H 4BAHB 3LGUA 1E37B 1HAYB 4ZHMU 4ISOA 2GCTB 1ACBE 4NFFA 3FZZA 3OY6U 1AWHB 1SVPA 3N7OA 5LPRA 1QY6A 2Z3EA 4GCHF 2D2DA 1O2TA 2O8LA 4XOJA 1O3HA 7GCHF 1DSTA 3QN7A 2W7SA 1O0DH 1GBHA 2BD3A 1O37A 1Z8GA 1YP9A 2IPHA 2ZGCA 2KR7A 1P3EA 3GCHB 3OE7D 3P70B 3FOAA 1H8DH 1LHCH 2Y6TA 1QHRB 2G4TA 4MDSA 4OS1A 1HBTH 5LGOA 3F9HA 1FONA 2AH4X 1O3CA 1GBLA 2AMDA 2SNVA 1WQSA 1FY5A 4J1YA 3PTNA 1VITH 1LTOA 1J8AA 3RMOH 2D1JA 4O03A 1O2XA 4B6FA 1AE5A 2PW8H 1OP0A 1OWHA 1HB0B 3RXHA 1XM1A 3E0PB 2UWLA 3MQKC 1TONA 1O3OA 2K0QA 3A81A 2A31A 2BX3A 3DSPA 3UWIA 3P92A 2VJ1A 3M35A 3I78A 4B71A 3TNSA 1GI4A 3F9EA 1FIWA 1QJ6B 1Z7KA 2WYGA 5F8XA 3ATLA 1PPHE 3A8CA 4IS5A 4Z1MD 1D9IA 1O31A 2Z9IA 2NWNA 5C5OA 4AGKA 3WWBA 1GJBB 1SQRA 4ZHAA 1T31A 3A84A 2QF0A 2GV7A 1YPLH 2WUCA 2FX4A 4CREA 1RTKA 4Z6AH 5C1YA 2A5KA 2ZFRH 3RDZA 3EAJA 4AX9H 3R3GB 5C0UA 2G5VA 3SV9A 3W95A 1SBWA 3E16B 2OK5A 3S69A 4MNYA 1TAWA 3HKIB 2ZTXA 3PWBA 4OGXA 3SW2B 3BEUA 4Y7BA 3SGAE 3A83A 2FI4E 1NBMD 5DP6A 1HJAC 4ZKSU 3A87A 4KGAA 1SGCA 4X8UH 3LH3A 3QLPH 5I46H 1VGCB 4X6NA 1AN1E 2QY0B 1JBUH 1TGTA 1N8OC 2F91A 1KLIH 1UVTH 3OYPA 1BMLA 1TIOA 1ZPBA 2CF9H 3SGBE 2ALVA 4ZHLU 5DK1A 4ISHH 3B8JA 5TCCA 1FXYA 3B23B 1S84A 1QB6A 1WYKA 1C4V2 2G00A 3T5FH 4AFSA 3A8BA 4ISLA 1V2LT 2NU0E 2W6JD 1GI0A 4LOYH 1ANCA 1HAVB 1H9HE 4Q63A 3KGPA 5KECA 4IMZA 2VH0A 2ZPRA 1T4VH 1BZXE 3GICB 2M2AA 4FUEA 4O3TA 3RXQA 2FPZA 1ELDE 1Y5UT 2EEKA 3QTOH 4NZLA 1TBQH 1QNJA 3QZQA 1XMNB 3BEIB 3RM0H 3TH2H 3W94A 1L4ZA 2RFKC 3ZZ9A 2ESTE 1PPCE 1BTUA 1EZQA 4ZROA 1ZRKA 4NSVA 4KKDA 3TK6A 3AASA 1QJ1B 5LPFA 1XUGA 2YNAA 2Y82A 2GCHF 1SR5C 3F0OA 5F6MA 3K6ZA 3ODFA 3MH6A 2JJ1D 2VVCA 1TPPA 2ALPA 4IMQA 5DSFA 1DXPA 1O3IA 4ABAA 3PM3A 5FPYA 6GCHF 5T1VA 4BTTB 3RXVA 5CE1A 1HJ9A 1VKYA 3FO8D 5FCKA 1MKXK 3TGJE 2QGRA 5BRRE 1ZYOA 3GISB 1IQIA 1GJ7B 2VIPA 1ETSH 1RTFB 1GVLA 4X1NU 1Z8JB 4O97A 1HUTH 2YMSC 1Z71A 1YCPM 1H9IE 2EI8A 5ETXA 1RS0A 2QXHA 2ZDAH 1Z6JH 1Z1JA 4X2WA 3FVFB 1WCZA 2KCPA 4NGAH 3M3SA 3P8GA 3OEED 2QE7D 5A2MH 3A88A 1W3CA 1O2MA 5L2ZH 4ESTE 3URCA 1QBNA 4JK5A 4FUJA 2Z9LA 1WSSH 3RXBA 1P2MA 1TRYA 1QTFA 3MO6A 4Q80A 4NIVA 1Y8TA 1GJ4H 1AFEH 1C2HA 4JCNA 1HNEE 3BEFB 2PTNA 4IW4E 4WY3A 2GZ7A 2A4RA 1C1RA 1P2KA 4X1RU 2HNTC 5AFZH 3F9FA 4E06H 1F5LA 1OWEA 1FY4A 1BTWA 1MD8A 1G9IE 2WPHS 4X8SH 2GDDA 3GCOA 2J98A 2QXIA 2XNDD 1HXEH 1C4Y2 3D62A 4R0IA 1AE8H 1PQ5A 2QYIA 3ZV8A 3HKJB 1EJNA 2WSSD 1TLDA 1S6LA 3H7TA 1YPHE 3SNCA 1PPGE 4CRBA 2GP9B 1ELVA 1LDTT 2AHME 1GJ8B 2KFWA 3KQCA 1UMAH 4JYVH 1RRKA 4RT1A 3TGIE 3STJA 2ZGBH 1OXGA 2V3MA 2NU1E 3SU2A 4AC9A 3Q76A 3A7ZA 3HATH 1V2UT 1YPJH 3AW1A 4INLA 2BVXH 3S9CA 2ZC9H 1GCTB 2ZF0H 2PSYA 2VWNA 1WV7H 2D26C 2FTLE 3DT0H 1KIGH 4AG2A 2OTVA 1Q3XA 2G81E 4WMDA 5J4QA 4HG6A 4CRCA 4XFQA 4WWYA 4X1QU 1P8VC 1XUJA 1K28D 1S81A 2TGDA 2ZA5A 1YPMH 3U8OH 1GBIA 3GOVB 1EZXC 2J9NA 5HM2A 2XNIA 4D9QA 2GCTC 1TABE 2A0QB 2WHXA 4FU8A 4OS2A 2PP6A 5GWZA 2ZDMA 1F7ZA 4JMYA 4OM9A 2P94A 1YF4A 3I77A 1SLWB 1T8LA 2P3TB 2TGPZ 1ANEA 5DKMA 1FDPA 1C2FA 3RXPA 1LCYA 4GHTA 1BRUP 3RXEA 2BTCE 4I8LA 2OINA 3GCHC 5A0CA 1GHWH 1HFDA 2O9QA 1D3DB 3LC5A 1HIAA 3MO9A 4K2YA 3U8RH 4BAMB 2B7DH 2G55A 4NWKA 1YLCA 3P95A 4X8VH 2PGQB 1BTXA 5GDSH 1ZLRA 5JBBS 2XWAA 1MTWA 2O8MA 3LKWA 4ZXYH 3RP2A 2ZHEH 4H42U 3LH1A 1O3DA 4X6PA 1W0YH 3SV7A 1IQMA 2PLXA 1F92A 3L33A 1H8ED 3UY9A 1W0KD 1FQ3A 4YO9A 4YOJA 1WDIA 3AW0A 3HK3B 1EAXA 3TJNA 2Q6FA 4A5TS 1CGJE 5E2PA 1TGBA 3MNCA 2WPDD 1Q2WA 4BXSA 5LH8A 7KMEH 1NBME 4JZ1A 3OTJE 4TSFD 3UFAA 1W14U 4YLQH 2J34A 3TNTA 1TA2A 2GCHG 1ZGIA 3LJJA 2J5UA 2TGTA 1C1NA 2ZG0H 3M3TA 2Y7XA 2H5DA 3EE7A 2AIPA 2XC0A 3RXAA 1LHGH 2BDIA 3RU4E 4IN1A 4GLYA 1GHBG 3MU0A 1O2OA 1WTGH 1ZMNA 1XUKA 1TNHA 3PV4A 3LDXH 1GVZA 1K2I1 1K1LA 1RGQA 2ZTZA 3BTDE 4ZKNU 4X6MA 4INHA 2A7CA 4OS5A 4BTIB 1HDTH 2VH6A 3ZVCA 3TJUA 1IHSH 2XOKD 1YPHC 5C67A 2PUQH 1O30A 3F2GA 4NG9H 4ABDA 3I29A 3SZEA 4ZKOU 1BA8B 4KP0A 4I8HA 3TGKE 5A09A 2F83A 1NU7B 2A7JA 3ZZCA 1ESTA 2FOCA 4JK6A 1O32A 3ZZAA 1O2VA 3GS9A 3GY8A 1GHXH 2VGCB 2A5AA 1O3BA 5C17A 3VG8A 1A0JA 3UIRA 3GY2A 1GI3A 1ANDA 1E35B 1C5WB 3SORA 1EASA 1IAUA 3ZVDA 5EODA 3LIWA 3UQVA 3ZZ3A 1PYTD 4F55A 2PSXA 3LGWA 5C20A 1SLUB 1RD3B 2A1DB 2SNWA 2FOBA 1ARCA 1DS2E 3IG6B 5JPMH 1K0HA 1LVMA 2HGTH
chains in the Genus database with same CATH topology
4DCDA 1O2NA 4X2YA 1O2ZA 5EQQA 1Z6EA 4NA9H 3L3TA 1V2PT 1YBWA 1SGEE 3ZZ4A 1A61H 3A7VA 2ZFSA 1CT4E 1S6FA 1JIRA 2FLBH 1FPCH 3EYDA 3T25A 5EU8A 1C9TA 3TJOA 1SHYA 1W0ZU 5EQSA 4O3UA 1BBRK 2XW9A 4QT8C 4INKA 1C9PA 1K21H 1C2EA 1G3CA 1F2SE 1GBDA 1GCDA 4B75A 2IOTA 2VIOA 3K2UA 2VIDA 4DIIH 1UJ1A 2H2ZA 5FX6A 2ANKH 1QJ7B 2SGEE 5L30H 5AHGH 1CSOE 1MAYA 1S5SA 1FAKH 1SGYE 2C90B 2F9OA 3NUMA 5ESBA 3S0NA 2J2UA 3PLPA 1LQEA 1AGJA 3SBKA 2STAE 1YGCH 4BAQB 4ISNA 2V3HH 4ZKRU 1K1IA 1V2OT 4BOHA 1BBRE 1ZR0A 4NWLA 2LPRA 5FCRA 1TALA 4NIYA 1TOCB 3P8NA 4ABEA 2P16A 2A45B 2P93A 2FOFA 4I8KA 4D7GA 4YLUA 2PTCE 1H9LB 4WH6A 4A1VA 3SU4A 4CRGA 2ZU2A 1J14A 5A0AE 1A1RA 3RMNH 3M7UA 1CBWB 5C1UA 3ATWA 1HIAB 4JZIA 2ZKSA 3EA8A 3D49H 1AY6H 8KME2 2OBQA 1FUJA 2FI5E 2H1UA 4K3JA 1HAVA 1TPSA 1S6HA 1GL1A 3LGVA 3MH7A 1QQUA 2C8ZB 9ESTA 3A85A 3RC4A 3SU5A 5JB8S 3T27A 4FVBA 3PB1E 3RUOA 3ZYEA 2FOAA 2UWPA 2AERH 1C5VA 1ZTJA 4TPYA 5E0GA 1C2LA 2BY6X 2BD9A 1QBOA 3S7KB 5F8TA 3BTWE 1CGHA 4JZDH 1O38A 2ASUB 3UQOA 3DA9B 1NO9H 1UTLM 3NK8A 3RXUA 4Q2KA 5T6FA 3O8RA 1FZZA 4XSKU 4BAKB 2I6QA 2CXVA 1JRTA 3NPSA 1TE0A 1V2NT 4TPIZ 4CH8B 2R0KA 2BLWA 4AZ2B 4D7FA 3Q3XA 1QL9A 1ZZZA 2WPIS 3ELAH 1NFUA 5IYTA 3SJKA 4Y10E 3M5NA 2NU2E 3PWCA 1JRSA 1K1PA 1VCPA 2ZPSA 1GCTC 3A7WA 1P09A 2AIQA 2A32A 1GDQA 1ELFA 4A1TA 1LMWB 1ELGA 4XBBA 1TNIA 1ELTA 1EAIA 4PROA 1V2JT 1O5FH 2GDEH 2PFEA 1J15A 2C4FH 1UTPA 2BD7A 2BDHA 3FANA 3ZVFA 4GVUA 2AS9A 1S0QA 2Z9GA 2VVUA 2GZ8A 1O5EH 1GJ9B 3Q3KA 1HAGE 5C3NA 4UFFH 1CA8B 5DP3A 3VFEA 3CENA 1RXPA 1YCPK 2QXGA 2F9NA 1TYNA 3E0NB 4TWWA 1O36A 3VB5A 1N6XA 3WY8A 5EW1H 5T6GA 2PV9B 4NCYA 3LGIA 3UR6A 5HM9A 3M5LA 3SNAA 3M3VA 3PYHA 1C2JA 1GJCB 1TPAE 4UONA 3BN9A 2EI7A 4Y8YA 3FFGA 5EG4A 1EJAA 3SUGA 3Q3YA 2DUCA 1O5AB 3AAUA 1LKBA 1CGIE 1ZPCA 1L2EA 1IQNA 1XUFA 2GD4B 4WJG2 2PKSC 5PTPA 1C5PA 3L6PA 2GZ9A 4BNRA 1O2WA 1KXFA 4MPWA 2HNTF 1O2JA 1C5TA 2HNTE 3QGNB 3RU4T 5JB9S 1A46H 4AYYB 3SZNA 1GI6A 4I8JA 1SPJA 1TGSZ 1QL7A 3DFLA 1NT1A 3MYWA 1O2RA 1C1QA 2ZFFH 2C3SA 4CRAA 1NFYA 2STBE 5SGAE 4K1TA 3MH4A 2Q6DA 3UNSA 3TLOA 4I33A 3DHKH 1LPGB 4DGJA 1VJAU 1KTTB 1BRAA 2YOLA 1MQ6A 3KF2A 2BY5X 3RC5A 1C1WH 4Y0ZE 3ZZBA 1XUIA 1IOEA 1CHGA 1MUEB 2G52A 3RLWH 1SC8U 2A7HA 2AGGX 4UD9H 3QX5H 1DVAH 1NRRH 3KN2A 2BXUH 1P06A 4FU7A 3NXPA 2ZCHP 3U69H 2BY8X 4Y6DA 2NU3E 1P2IA 1TPOA 2NU4E 2W3KA 3F1SB 1GG6B 1ZSKA 3PMAB 1ESBA 3BTHE 2BD8A 1C5ZB 2ANWA 1GBBA 2VGCC 2Z7FE 1SFIA 1Y5BT 1P9UA 3BG8A 2DE9A 1DLKB 1PPZA 3SUDA 1JMOH 3SNBA 2OC7A 1VR1H 2QV1A 2XBXA 1IQEA 1QRWA 4HFPB 3QTVH 5EW2H 1BTHH 1C5UA 1Y5AT 1ZHRA 1A4WH 4WF8A 1SQAA 1TGCA 1NRQH 2BX4A 1VITG 2PKAA 1G2MA 1BT7A 1ELBA 2O8WA 5FBEA 4I7YH 3SJOA 1N6YA 4DY7B 3PMHB 1F5KU 1IQHA 2F9BH 3BF6H 2H9TH 1AMHA 4GHQA 3OU0A 1GHAG 1GHBF 3CP7A 1PPFE 4X6OA 2SGQE 2TRMA 1UO6A 1AQ7A 2WUBA 3G01A 3GY7A 3ZZDA 1C5LH 2OLGA 3PTBA 3NKKA 1LPKB 1XXFA 1GVKB 2ZEBA 3P6ZB 2BD4A 1FNIA 2J94A 1D3TB 1THPB 5DP5A 1SOZA 2F9UA 2PGBB 1NFWA 1B7XB 2RG3A 1P2NA 2V35A 2ZHDA 1FLEE 1NPMA 1W13U 2R9PA 5H4IB 4CBNA 1SGPE 3RXJA 1GHVH 4MG3A 9LPRA 3MMGA 2Y80A 1GI8B 1A7SA 2FWWA 1A5HA 1O2HA 5TJXA 1ELCA 3MH5A 4YT6H 1CT2E 1DE7H 1CBWC 1HAHH 2FLRH 1W7GH 5EXNA 1GI2A 1MBMA 4GPGA 1P57B 1QCPA 3VB4A 3MNSA 4JYUH 2ZDLA 1GDNA 4CRDA 3ATKA 2ZWLH 3OSYA 1QB9A 1T8MA 1BRBE 3RXGA 3KIDU 4XBDA 1DX5M 3GY4A 1OP2A 4AORA 1FY3A 2BQWB 3EQ0H 5TCAA 4YTAA 3GCTF 1HCGA 1KXCA 1TOMH 5FXLA 1TWXB 1V2WT 3SQHE 3U98H 1SQOA 1PYTC 1K9OE 1EOJA 2JH0D 3BTQE 1EPTA 3UREA 1FAXA 3MI4A 1SLXB 2SGPE 1B5GH 1GI5A 2A4GA 4SGAE 3ODDA 4OS4A 3EE0B 1P05A 1G32B 1TRNA 1W11U 1HXFH 2TGAA 4VGCB 1UK4A 4UDWH 3DD2H 3S9AA 2BDGA 2ZHWH 1O5GH 4Y79A 3BTGE 1MD7A 3SHCH 3TK5A 1PQ7A 1T7CA 1OOKB 1HYLA 4ABHA 1SOTA 2PWXA 2ZQ1A 1RJXB 3LGTA 1SGRE 1MTUA 1MU8B 2C93B 1KTSB 2WPLS 1EZUC 3A89A 4X2XA 4BANB 5A8XA 2J92A 1OWDA 3T29A 1P10A 1CU1A 3BG4B 1ZGVA 1OYQA 1AUTC 2WV4A 2PR3A 4ASHA 4Z0KA 5J4SA 1DDJA 3MNBA 3RXRA 5EGMA 5CMXH 3PO1B 1ELEE 3LONA 2CF8H 2FOGA 3A80A 1KXBA 3SV2H 1TMTH 1O3GA 1TNGA 2CHAB 1ABIH 1NZQH 2ZGHA 2VWOA 1WBGB 4DURA 1DPOA 2OC0A 5CHAC 2CN0H 3SU0A 1F0RA 1DWBH 1Y3VA 1ZHPA 1K1MA 3RXLA 3ENSB 3ZZ8A 3RM2H 3C27B 4GSOA 3BTEE 1DXWA 1K1OA 4ZH8A 6LPRA 5GIBA 3RXOA 1BRCE 4MNVA 3ZVEA 4J2YB 2G5NA 1D3QB 1BTYA 1PPBH 1TFXA 2PKSB 2OC1A 1GJAB 4ISIH 3D65E 3P8FA 1CVWH 2P8OB 2PKAB 5K7RA 2A2QH 4MLFB 5EXMA 1O3AA 4B1TA 1OS8A 5EPNA 1A3BH 1O2LA 2JETB 1KYNA 4ZMAH 2XCFA 1QB1A 2V3OH 3BTKE 2BD5A 3DFJA 2H5CA 4IC5A 1QQ4A 3QZRA 1O5BB 1EAWA 5A8YA 3T26A 3SUEA 1AFQB 1ANBA 2QA9E 1Y3UA 5AF9H 1C2KA 1GL0E 3UTUH 3FP7E 3LJOA 2FOEA 4AFUA 2G4UA 2B8OH 1EOLA 3MWIU 1INCA 2ILNA 6CHAB 1TNKA 1FV9A 1C5XB 1C1UH 3UNRA 2BLVA 4UFEH 1X7AC 5DPAA 1M9UA 1LQDB 4X1SU 1F0TA 1NROH 2K1QA 3LU9B 3K65B 3RXKA 5JBCS 1NTPA 1SG8B 3RXIA 1SB1H 2FMJA 1HJ8A 1DWCH 1BJUA 1P2OA 4F4OC 1FI8A 2GMTC 1FMGA 1KDQA 1ZRBA 1UHBA 1YM0A 5BPEA 1YKTA 1CO7E 1BUIA 3AAVA 1HLTH 1S0RA 3O8CA 3GYMA 3K6YA 1IQGA 1BIOA 4Q7XA 1YLDA 5IDKA 4U32A 4FVDA 4D8NA 4MPVA 1IHTH 1BJVA 2ZECA 4CRFA 4KTCA 3SV8A 1GG6C 2GGVB 1E34B 2ZFPH 1QURH 1C1SA 1UVUH 4ZUHA 1G3DA 2HWLB 3H7OA 3LPRA 1XVMA 2RCEA 2XBVA 2OD3B 4WVPE 1GHZA 3SU1A 3Q00A 1OP8A 1OWIA 2G8TA 1GJDB 4MNWA 2SFAA 1G36A 1C5RA 2O8UA 1BITA 1O2PA 1TA6A 2CGAA 3E90B 1EPTB 2BDBA 3CS7A 1B0EA 3GCTG 3VPKA 8GCHF 2B9LA 1AVXA 1EATA 2OC8A 3O8BA 3VB6A 5DO4H 4B2BA 3ZVAA 1UVPA 3UOPA 2OP9A 2V6NA 5GPIB 4MQAA 4IBLH 1AO5A 1P2JA 1MTSA 3V7TA 1Z1IA 4A1XA 3ZZ7A 2ZU3A 4H4FA 1MKWH 4HI3A 3ATIA 4K8YA 1XVOA 2FIRH 3QO6A 3SNEA 1FN6A 1C5OH 1W12U 1NESE 3TVJB 3HPTB 2WPJS 3U1JB 1ID5H 1RTLA 1HAPH 1MTVA 3HGNA 5DP4A 1V3XA 1AVWA 3JZ2B 3PLBA 3DUXH 1GMHG 3KQBA 3EDXB 5F8ZA 1LHFH 1AVGH 1LVBA 1T4UH 3ZYDA 2ZDNA 3SI4H 1O3LA 2R3UA 1C2MA 1V2ST 2W3IA 1ZHMA 2ZHQH 4Q7ZA 1P03A 1UTJA 2XWBI 5T3HA 4K1SA 4ABFA 1A5IA 3V3MA 3BTME 1L1NA 3M7TA 1EJMA 3SJIA 1UCYH 2H6MA 2BD2A 1W10U 4X2VA 2BDYA 2VU8E 4THNH 2RDLA 2ZZUH 1D4PB 1KXEA 3SHAH 5E8EH 1L1GA 1VITF 2BDAA 2ODPA 1EZSC 2AFQB 4MPUA 3F9GA 2EA3A 2HALA 2Z3CA 2O8TA 4GUXA 2D8WA 1W2KH 1EB1H 4RKOB 5GCHG 3MO3A 2W26A 4WXVA 2V0BA 3M5OA 1GHAF 1UVSH 1Z8RA 1OWKA 3MHWU 4CHAB 1BTZA 2Z9JA 2FODA 5FPTA 3SNDA 1KXDA 2GKVE 1V2VT 1LO6A 3V0XA 3MU4A 3U9AH 3BSQA 3SOSA 1JOUB 1SGQE 1QRZA 1TQ7B 3STIA 3A7YA 1SGTA 2FTMA 1Q31A 2R2WU 3FP6E 1C5NH 2ZDKA 4CH2B 1AZZA 4NA8A 1P02A 1JIMA 1MZAA 2GT7A 2FS9A 2UUYA 2Q1JA 3GCNA 3SI3H 3SO3A 1BQYA 3KEEA 4VGCC 1EAUA 1YPGH 5ESTE 1OSSA 3TIUA 5C2ZA 2TIOA 1DWEH 3P17H 2JH6D 1C4U2 4FUCA 1VCQA 1O3EA 2Y5FA 4Y71A 3ZV9A 4NZQA 1BMNH 1LKAA 3KQDA 2IN2A 3MU8A 3PMJA 1P2QA 1Z8IB 5B6OA 3TJVA 5A0BA 1V2TT 2EI6A 2FO9A 1HRTH 2RA3A 2ZDVH 5DP8A 1SFQB 3BG4C 1P3CA 4K60A 5HGGA 3UNQA 1AZ8A 4DOQA 1T8NA 5CHAB 1SMFE 4DJZB 1KDQB 2J95A 1UHBB 2FM2A 1H4WA 1V2QT 3EGKH 3PO1C 4Y7AA 1FJSA 4GAWA 3RXDA 2BZAA 3OX7U 2F3CE 2FI3E 1C5YB 2CHAC 3BTTE 3NZIA 5K0HA 3T2NA 1YYY1 3ATMA 3M61U 1UK2A 1D6RA 1DITH 4B73A 1W7XH 2TPIZ 1GDUA 1AB9B 5JYIA 1O2UA 2XRCA 1UTKA 3RXCA 2FOHA 1O2YA 2Z94A 3MU5A 2FS8A 1IQLA 2HPPH 1TBZH 1UTNA 2J38A 2VIQA 1ZMLA 4AYVB 2A4QA 1ETRH 4HZHA 4KELA 2P8OC 1O2KA 2QN5T 1K1JA 3GDSA 1S85A 3T28A 4NIWA 1FN8A 3QK1A 5I25A 1HAOH 5FHTA 2KAIA 2JETC 4NSYA 1KSNA 1AKSA 3O8DA 2QF3A 3T62A 1TNLA 4IGDA 5C1XA 4D9RA 1FIZA 1VCWA 8GCHG 3U1IB 2BMGB 1TB6H 3E6PH 3E1XB 1DLEA 2CJIA 1AFQC 1EP5A 2F9PA 1MH0A 1PQAA 2WPKS 3K9XB 8LPRA 2FESH 2BDCA 1CHOG 1KXAA 4WMFA 1AU8A 3SU3A 4LZ1H 2GX4A 1A3EH 1EB2A 1AI8H 4M7GA 2SGFE 4A7IB 1AD8H 2ZHFH 1SGNE 4YOGA 4U30A 1G37A 6CHAC 2GT8A 2BY7X 2GMTB 3TITA 4BXWA 7LPRA 2WYJA 1LHDH 2XC4A 2BHGA 1BCUH 1FY1A 4LXBH 1O3KA 5FPSA 4JZEH 1TMUH 1IQKA 1SGFG 5E0JA 4DG4A 4FUDA 1P01A 1NY22 2Q6GA 1DM4B 4H6TA 2CV3A 2M5TA 4E7RG 1L1JA 3UUZA 1EKBB 1ZJDA 2HRVA 2Z3DA 1SL3A 2SGAA 3MOCA 5L2YH 1NU9A 1F5RA 2W7UA 3MFJA 1WTHD 1GBMA 1D3PB 3FZDA 1YCPH 2BLOA 2ZU1A 1GBAA 2C8YB 3BTFE 5HYOA 3RU4D 1QL8A 1B0FA 1AWFH 3SGQE 1W8BH 1KLTA 5DP9A 1NRSH 3A82A 1SI5H 3SJ8A 3NWUA 4DW2U 1K22H 3H5CB 4NA7A 2ZU5A 2BQ6B 4OS7A 1P12E 1NRPH 1SGFA 2VNTA 1F0UA 4JYTA 1BMMH 3C1KA 4FUIA 1A5GH 2VWMA 4UFDH 4B2AA 1DY9A 3P8OA 5DP7A 1ZOMA 1DSUA 1O2SA