4FUCA

Crystal structure of the urokinase
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
publication title Crystal Structure of the Urokinase
rcsb
source organism Homo sapiens
total genus 54
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fucA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fucA01
2P16A 2Z3CA 4MPWA 4O97A 1EAXA 3GCOA 2GT8A 3KIDU 4GHTA 4FUEA 1BRBE 1KIGH 1HJAB 3P8FA 3PM3A 3ZYDA 1HAHH 2VJ1A 1F2SE 2AFQB 5C5NA 1BTZA 3BTKE 1FN6A 2UUJB 2ZGCA 4AGJA 1BHXB 1CT2E 2F9BH 2XBVA 2ZEBA 1SGEE 4DT7B 1BRAA 1O2JA 3Q76A 1FLEE 4VGCB 2ALVA 1FPCH 1TBZH 5L2ZH 2OC8A 1FY5A 3SBKA 2TPIZ 4MPVA 3LJOA 2M5TA 3BEFB 1AVXA 3LGUA 2ALPA 2G81E 1K1LA 3QWCH 5IDKA 2A7CA 3SJ8A 4GSOA 1V6DA 2QA9E 2Y5HA 1HDTH 4ABEA 4CRBA 4WXVA 5C1YA 3EYDA 2ZGJA 2SGDE 2AMQA 2QXGA 5A8YA 1YPHC 1P2QA 1MBQA 1GJCB 1H4WA 5B6OA 1UTMA 8GCHF 2ZWLH 1W7XH 1GL1A 1ZSJA 1YPMH 1O5CB 2PHBA 2ZHEH 1KXBA 2GCHF 1KDQA 1ZHMA 4I8JA 5TJXA 2ZA5A 4TY7A 4CRGA 3GISB 1GJDB 1C2DA 1RIWB 4D7FA 3FAOA 4ZHLU 1G2MA 3TVJB 3RC5A 2HOBA 4I7YH 2OXSA 4NA8A 2BD3A 1TNHA 2BVRH 4A7IB 3SV7A 1MKXK 3T27A 1GDUA 2VIWA 4XBCA 1E34B 1MU6B 1Z8GA 4O03A 1SGYE 3RXJA 2J4IA 1CA8B 1LPGB 1C5SA 3LOXA 3S9AA 4I8GA 4MTBA 3SV8A 2O8WA 5GXPA 1BUIA 3ZZ3A 1PPEE 1TGBA 1PPBH 3AW1A 3M5LA 4ISOA 2QGRA 2FMJA 1THSH 5EQSA 3E0PB 3LKWA 3RXVA 3MO6A 1ID5H 1TRNA 4OS6A 3F1SB 2A7JA 1DWBH 4NG9H 5DP4A 1GBJA 4INHA 3SU4A 1N8OB 1S81A 3U98H 1RJXB 1P06A 2BB4A 3MH7A 1L1JA 3ZZ9A 1FZZA 1ELDE 1AU8A 4WY3A 1Y59T 3CS0A 2OUAA 1MU8B 1B0FA 2Z9LA 1TFXA 3U8OH 1DWCH 4HGCA 4X1NU 4CH2B 4AG1A 1LVYA 1NS3A 2CXVA 2OBOA 1PQAA 1YF4A 1GHWH 1HYLA 1PPZA 1T8LA 4NFEA 1F0TA 2FXRA 1PQ8A 1BA8B 1WUNH 1OSSA 2HRVA 1T4UH 2ANYA 4I8HA 3MYWA 3M37A 1UCYK 1XUGA 4X8UH 4IC6A 2ZDNA 4X6MA 1Z6EA 4TWWA 2BY5X 2ZHQH 3BTDE 1C9PA 1EOJA 3G01A 2ZNKH 1AE5A 4J1YA 1F5LA 4M7GA 1J9CH 1BMMH 1N6XA 1O2GH 5C1XA 2CHAC 3P95A 4I8KA 4ISIH 1A46H 2VU8E 1FQ3A 2Z3DA 4AG2A 4ZMAH 2SGQE 1PPCE 4JK5A 2A31A 2BOKA 1MKXH 2FOAA 4X6OA 3SJOA 3K65B 5AHGH 1EQ9A 3EGKH 3LGIA 1KXEA 2FODA 1KY9A 3A82A 2Y81A 1EASA 4X2XA 4YESB 3C1KA 5AVDA 1ANDA 2BDBA 4X8TH 3SQHE 4BAOB 4TPYA 1IQIA 1EZXC 3K2UA 1NM6A 3A8AA 1DXWA 1AVWA 5HGGA 1BDAA 2WV5A 3UOPA 2GGVB 1O2UA 5HXFA 3DT0H 3RXSA 2A7HA 3RXDA 1MQ5A 3N7OA 3EAJA 4TY6A 3VGCC 1O2KA 3SNCA 5E2PA 2FPZA 1IQEA 4XSKU 3STIA 5EQQA 1Y3WA 1HAVA 1WQSA 4DJZB 1TGNA 4X1RU 3A88A 5JB8S 3M5MA 1IQMA 1S6HA 1C1WH 4Y0ZE 1BBRE 1YCPM 1CHOG 1GG6C 5A0AE 2FOHA 4ISNA 2PW8H 1D4PB 3MH6A 1GI3A 1OP2A 3FANA 1O5GH 3E0NB 1OWHA 2WINI 1DDJA 1NRRH 1LHDH 1XUHA 2FOCA 1UCYH 3PTBA 3GOVB 3QZQA 3TGIE 2ZTXA 2HNTC 5ESTE 4NWLA 3NKKA 5E8EH 1TNKA 1HAOH 1KXFA 5LGOA 1AWFH 3RUOA 3RXCA 4O3UA 3KF2A 2G00A 4Y7BA 5FCRA 2XWAA 4BTTB 1DUAA 3M35A 4Y7AA 1C5VA 3EA8A 3D23A 5DJ7A 1QCPA 4X6NA 1GI8B 2FTMA 1BB0B 1TBQH 1GBAA 2NWNA 1BMNH 1NESE 1YPEH 3RP2A 4UFFH 1HJ8A 1C1RA 1YPLH 1JBUH 2EI7A 1DE7H 2VWLA 4A6LA 1C2GA 1AFQB 2TRMA 1P03A 2OD3B 2QF0A 2BLWA 3VFEA 2PKSB 1C5WB 2LPRA 4DCDA 1T8NA 4UDWH 1P05A 1F7ZA 3RC6A 2BXUH 1UVSH 3SU6A 4U32A 1L4DA 1FAXA 3GY5A 2Y7XA 1CT4E 2QCYA 2QY0B 1GL0E 1W10U 2Z94A 1O38A 1ESAA 3GCHC 3TJNA 2VH0A 1CGJE 1NY22 1TX7A 4PROA 1T7CA 5HYOA 2SFAA 1HXFH 2UUKB 1UTQA 4THNH 5DPAA 2BYAX 4IN2A 3SGBE 1NC6A 1GMHG 1NFXA 5FAHA 3QZRA 3MTYA 2VIOA 4NWKA 5T6FA 8LPRA 3GDUA 1C1OA 1AIXH 2TBSA 1O3FA 3FZZA 4FUHA 3AVZA 3NCLA 3A8CA 3TIUA 1GMCG 4CREA 5TCAA 3ZZ7A 1MD8A 1A4WH 1IAUA 1N6YA 3RXFA 1GI7B 2G4UA 4WXIA 1HB0B 4I31A 1C5OH 2XCFA 1C2MA 2ZFFH 2W26A 1GHBF 3ZVCA 1XVMA 1FAKH 2KAIA 1PPHE 4LOYH 3PMAB 1S82A 3BTQE 4MNXA 1O3NA 2EI8A 4UONA 2GTBA 4ZKOU 4YOIA 1Y8TA 2ZU5A 1O31A 3BTHE 2P59A 5LPRA 1CGIE 2PUXB 1NN6A 2R2WU 1G3EA 2FOBA 2J92A 2BMGB 2RCEA 2ASUB 1KXAA 5DP8A 1X7AC 4GCHG 3NK8A 1MMJN 1A0LA 1RD3B 1EXFA 1ANEA 1HAZB 2QYIA 3HK6B 1EAUA 1UJ1A 2D26C 4DY7B 3A8DA 4IN1A 4WJG2 3MNCA 5A09A 1O5DH 1SGFA 2AIQA 4HZHA 4BAHB 1JRSA 2ODYB 1WSSH 3PWCA 5DKMA 3MU0A 3UREA 3A7TA 1AGJA 1EJMA 2B0FA 4JCNA 4F49A 1ZGVA 4MNVA 4MPUA 1EZUC 1C5YB 4B2AA 2J38A 1S85A 5DGJA 3V13A 3ZVGA 2Z3EA 4O3TA 2YNAA 1DXPA 3SJKA 5JBAS 1F5KU 4K1TA 3ZZBA 1HCGA 1IQGA 1LVBA 4ABGA 1DWDH 3Q3YA 1GBBA 1FJSA 3E90B 1KLTA 3LC5A 1PQ5A 4DW2U 3SJ9A 2WV4A 1VJAU 1CA0C 3BEUA 4CHAB 2HVXA 4INLA 2BM2A 2BD4A 3L6PA 1Z8IB 5FPYA 1DY9A 1H9LB 1SPJA 2BDCA 4AYYB 3SN8A 1ZMLA 2O8LA 1QB6A 2CF9H 2HPQH 2J9NA 2ZDMA 4Y8ZA 3DFLA 1F0RA 2XXLA 4KTUA 2BQ7B 1TOMH 1MTWA 1KLIH 2WYJA 3MWIU 3MU1A 1LPZB 1BJUA 1T31A 1AUJA 3KN2A 3UNQA 1QFKH 4UFEH 1C5MD 4D76A 4DIIH 2P8OC 1Z71A 1ANBA 2C90B 1Y5AT 2VWOA 3MNXA 3ODFA 3T62A 2CF8H 1QBOA 1J8AA 1SQAA 5EXNA 4OS5A 1C4U2 3H7TA 1S5SA 2AIPA 1GJAB 5GPIB 1V2UT 2OC7A 5A8ZA 1ELVA 4I33A 1O5BB 2FS9A 1QJ7B 3ITIA 1DX5M 1BBRK 4IMZA 1H9HE 1JWTA 1O2SA 1TLDA 2J34A 4B74A 3SNDA 1NFYA 1G30B 1ZJKA 1O3BA 2XC4A 1WU1A 3RDZA 4ABDA 1CO7E 1D3TB 1TNLA 5FBEA 3T2NA 2VIDA 3HGPA 2FOGA 4IGDA 3FVFB 3T26A 2PFEA 3C27B 4NA7A 2FI4E 1GBHA 1BHXF 4X2VA 1ELAA 5AF9H 2CHAB 4JZDH 3K9XB 1IQKA 4JZ1A 5T6GA 2P3FH 1JMOH 2BD5A 3T28A 2GP9B 2G4TA 4Y10E 3RM0H 3VXFH 1VGCB 1ZTKA 2W7SA 2R3YA 1ZLRA 2FO9A 5E2OA 3BEIB 1GI2A 3BV9B 3QX5H 1TPPA 4Q80A 3A7YA 1UVOA 4X8SH 2VINA 3B23B 1OYQA 2H5DA 4ZROA 1KDQB 4H6TA 1P2KA 1UK2A 5L6NH 8KME2 3TH4H 1AY6H 4FUIA 4WF8A 1QR3E 5C5OA 1SGRE 1D9IA 1ABJH 1TQ0B 1TA2A 2VIPA 1FN8A 4Z0KA 2ZFPH 3O8RA 4ZAEA 1AB9C 1MUEB 4GPGA 3VPKA 4AFZA 1IOEA 1QL7A 3LU9B 4KKDA 1ZR0A 3SNBA 2ZHFH 3ATMA 1LKBA 1DLEA 1QIXB 4UEHH 1VCPA 2WPIS 3QUMP 1GCTC 6GCHF 1SLUB 4UFDH 3VGCB 4AGKA 1EPTC 2JH6D 4FXGH 1ZHRA 1TNIA 1OWEA 1LPKB 1CHOF 1O2QA 2W7UA 1SQOA 4AFSA 4E06H 2V3HH 3EA9A 3AAVA 2BLOA 2JETC 4KTSA 2H9HA 1S0QA 1IHTH 3LC3A 2A4RA 5LPFA 1J17T 1SLVB 1WOFA 1EJNA 2DUCA 1CQQA 3MI4A 1ELCA 5PTPA 4OS4A 3QTOH 1PYTD 1C2HA 4CR9A 1GG6B 1EB2A 2QAAA 1TIOA 3KQDA 2PTCE 1O5EH 4K1SA 4NIWA 2BVSH 4JYTA 2VVCA 3B8JA 1BBRH 3SU5A 1T8OA 3RLWH 4DOQA 1RGQA 3A8BA 2ZG0H 1D3DB 2QIQA 2RDLA 3PO1C 2QXJA 2FOFA 1J14A 1TRMA 4KP0A 2BXTH 1QHRB 1AKSA 3U69H 4IMQA 2FLRH 1DANH 1GJ8B 3IWMA 2PKAA 1GBDA 4ZUHA 1MBMA 3RMNH 2B8OH 2OQUA 5CMXH 1O3AA 4LZ1H 1YPHE 2F9PA 4ABIA 1PQ7A 1Y3XA 2ODQA 3TGJE 1C4V2 1LKAA 2AS9A 3OX7U 1E36B 2OQ5A 3QTVH 3PMJA 3KCGH 3KQBA 3PMBB 1PFXC 1ZTLA 4X2WA 1H8IH 1K22H 2ZDAH 5IYTA 3RU4E 5HMAA 1SBWA 2BQ6B 3UNSA 4YZUA 2ZFSA 3DUXH 1MKWH 2H6MA 3T25A 3TNTA 2ZFRH 1QRWA 1C5UA 3UNRA 3OY6U 3DD2H 4FVDA 3UUZA 1ABIH 3FP8E 1O2IA 2CV3A 1QA7A 1OWKA 3GCHB 4Y0YE 3SORA 4RN6A 3RMMH 5GIBA 5A0BA 1GMHF 1EP6A 5C3NA 4ZXYH 3A80A 3UQOA 2G55A 1CSOE 4ABHA 3L3TA 3BTTE 1O3JA 4JK6A 4FUDA 1NRQH 1A2CH 3SI4H 3ELAH 1OWDA 2GZ8A 1PYTC 1P11E 3GYLB 3ZVFA 3UR9A 1ETSH 1VITG 2F3CE 3T5FH 1QQ4A 3RXTA 1WBGB 3F9EA 3BTWE 3ATKA 1YKTA 3M61U 1GDQA 3TK5A 2J94A 3A83A 2BX4A 4U30A 1C5RA 5SGAE 3V7TA 2CMYA 3MOCA 1GI0A 2EI6A 1P9SA 1HAVB 2XWBI 3ESTA 2V6NA 3MNSA 1XUKA 1PJPA 1GPZA 1QB1A 2ZU3A 3E1XB 5T6DA 4H42U 1UTOA 2ESTE 2NU0E 3TU7H 1ETRH 1MTNC 1G9IE 1C9TA 1NRNH 1C5NH 1W7GH 2FYQA 1Z1JA 1AE8H 5C2ZA 3SHCH 4JYVH 2GX4A 3D65E 1QJ1B 1THRH 2GV6A 3Q77A 2CN0H 4K1EA 5I46H 1B7XB 4TWYA 1XUJA 2FTLE 2BY8X 1GJBB 1HGTH 3A85A 4RKOB 4GCHF 5DG6A 1Z8RA 2ZGBH 4B1TA 4GLYA 4OGXA 1TOCB 4X1SU 1PPGE 4NFFA 1LHEH 5HM9A 1YPGH 1EAWA 1SOZA 2FOEA 1TALA 3LIWA 1OXGA 2FLBH 1W0YH 5JPMH 1TX8A 4OS2A 4CH8B 2NU1E 4NSVA 1XX9A 2STAE 5E0JA 1O2HA 4JZFH 2WPKS 3VB7A 4AYVB 3A7XA 4JZIA 1O2ZA 3PYHA 1K1OA 1Z8JB 1HIAA 1O2PA 1LQDB 1SFIA 2TGDA 1Z1IA 5F8XA 2O9QA 3OTJE 1P09A 1DOJA 4Z6AH 4MDSA 1TMTH 1O2RA 5EOKA 1CHGA 1XM1A 1W11U 1TB6H 1O33A 3BTFE 3LGTA 1P2MA 1TE0A 3BG8A 1CT0E 1BMAA 2C8XB 2DE8A 3I78A 1CA0B 1Y3VA 4MNWA 3A86A 3SU2A 2FOMB 4R8TB 4FUCA 1O2OA 1IQNA 2Q1JA 1SHHB 4YT6H 2C4FH 1O39A 3UWIA 3P17H 2ZU2A 1V2ST 3A87A 2Z9JA 5ESBA 1ORFA 7KMEH 1CGHA 4ISHH 5C67A 4GUXA 1EUFA 3GYMA 3MO3A 4BAQB 2ZDLA 2P8OB 2ZP0H 1XKBC 1O2LA 4D8NA 2BVXH 3RM2H 4DURA 1K1MA 4BAMB 4H4FA 3FZDA 3MU5A 1DY8A 3R3GB 3GY2A 3B9FH 3SU3A 3S0NA 2VVVA 3I77A 3UTUH 3EA7A 1QRZA 5EW2H 1NO9H 4MG3A 1V3XA 5A0CA 3STJA 2TGPZ 1GMDG 2BLVA 4RKJB 5E0HA 4FUBA 1GVLA 2ZDKA 2P93A 3M3TA 3QDZB 2XRCA 2KAIB 3HKIB 1EJAA 1EOLA 1P02A 1C4Y2 3PWBA 1P2OA 3O8DA 1DPOA 2BD9A 2HGTH 2SNWA 3GCTG 1KXDA 2R9PA 1T8MA 2WPJS 2QN5T 1FI8A 5GWZA 3ATLA 3LH3A 1KYNA 1K1PA 2ILNA 2VIVA 5K7RA 1YP9A 2FI5E 5DO4H 1C1TA 3SV2H 4BNRA 1O3HA 3URCA 3HPTB 4NZQA 1ETTH 1Z7KA 3H5CB 1V2TT 4IBLH 1C1QA 5C1UA 5F6MA 2ZPQA 1F92A 2FX6A 4K5ZA 1A5HA 3MMGA 1EKBB 5JBTA 5T3HA 1MAYA 3GY3A 1QY6A 1GDNA 1MCTA 2F9UA 2ZGXH 2WPMS 1C2IA 1XXDA 1O36A 3UIRA 1VZQH 1AB9B 2A4GA 4BAKB 1NRPH 3M36A 3RC4A 3M7UA 2Y6TA 1C2FA 1O37A 1YLDA 1O3DA 4A5TS 8GCHG 2VIQA 2YOLA 1SL3A 1QA0A 1A0HB 1ZGIA 2PR3A 2UUFB 4ZKNU 4AN7A 1IQJA 1GCTB 1OP0A 1G3BA 1EPTB 1XKAC 1ELBA 1GI6A 2UWPA 4K8BA 3K6ZA 1SFQB 4A1TA 1MTSA 2ZHWH 4A92A 2XNIA 4AORA 1P10A 1FUJA 1QBNA 2ZTYA 4WH8A 1O32A 3KNXA 4XDEA 1P8VC 3PTNA 2G51A 2UUYA 2ZTZA 1EZSC 1W2KH 4K8YA 3LDXH 1FY1A 1NRSH 4WMEA 1C1NA 4X0WU 5DP5A 1GHZA 4RSPA 1GBIA 1QURH 1NROH 3PB1E 2XW9A 2QV1A 4AB9A 1ZOMA 2A5KA 2QXIA 1MCVA 1O3OA 1ZMNA 2GDEH 1DT2A 3SNEA 2H1UA 3RMOH 3TH2H 1TQ7B 3NUMA 1GJ9B 3K6YA 1AUTC 1C1MA 5CE1A 2WUCA 3RXGA 3OY5U 2PLXA 4B2CA 2B9LA 2RA0A 2AGEX 4X1QU 2A32A 4IS5A 1SLXB 3RXOA 5C20A 2WPHS 2BOHB 2FWWA 4I32A 4CBNA 2GV7A 2QXHA 1YYY1 1HAXB 1ESTA 3SV9A 5ETXA 4ABJA 2OLGA 1TMUH 1P2NA 1ZRBA 5FPSA 4NIXA 2NU4E 1ZPZA 2ZF0H 4J2YB 4X2YA 1ZSKA 1GJ5H 1JRTA 4KTCA 4DIHH 1KXCA 1XXFA 4U2WA 1S84A 2FESH 3EQ0H 1FONA 1BTWA 1V2WT 4ZHMU 2THFB 2F9OA 1J16A 2AERH 1E38B 1ACBE 1TGTA 1KTTB 1LVOA 2Z9IA 1Y5UT 2R0KA 3NWUA 3TJVA 1IQHA 1THPB 4ZKRU 1GHAG 2OP9A 2ZCKP 1AMHA 3RXUA 1UO6A 3UWJH 1YBWA 3P8GA 1P04A 4NSYA 3UR6A 1AN1E 1IQFA 3RXHA 4E7NA 3LT3A 3FFGA 3M5NA 4LZ4B 2Y80A 1ZHPA 1G3CA 4FVBA 2SNVA 4NZLA 5ABWA 2EC9H 1UTLM 1SGQE 5J4SA 1BZXE 2Y5FA 3ZVAA 1F5RA 4U01A 4BXSA 1CE5A 2GMTC 1W3CA 2ZGHA 1FXYA 1SGFG 3D49H 4ZH8A 1G37A 1NTPA 1MTNB 2ZZUH 2OCVB 1UTNA 3ZZ6A 2BDYA 3VB3A 1WAYB 2B5TB 5F8ZA 1DFPA 3GDVA 2BY7X 3ATIA 1Y3UA 1YM0A 3ATWA 4CRDA 2O8UA 1JIRA 3SJIA 4BTUB 1RFNA 2I6SA 1BTPA 1C2LA 4ABFA 4HTCH 1AKSB 3ZZ8A 3M3SA 1QTFA 4I8LA 3QK1A 4BANB 2JKHA 1O2NA 1Q2WA 2PKAB 3SZNA 2STBE 3U1IB 4AFUA 4X1PU 1GHVH 3KL6A 2F83A 1AO5A 3NZIA 2ZCLP 2Z6BD 1Z6JH 1SLWB 1ZPCA 2HNTF 2QC2A 2ZU1A 1FIWA 3SI3H 5EXMA 4YM9A 1G2LA 3F68H 1NU7B 2FIRH 2A1DB 4Y71A 1O3KA 2Y7ZA 2WYGA 1TGSZ 1H8DH 3TH3H 1GBEA 1K21H 3AAUA 3I29A 2GZ9A 1E0FD 3A84A 3BTEE 3MHWU 2BDIA 5JB9S 1BTUA 2JH5D 1MD7A 2C93B 2OC1A 5CHAC 1Y3YA 3UFAA 5BRRE 3LONA 3KGPA 3OSYA 1MKWK 1GI5A 4UFGH 2PTNA 3PLPA 1TA6A 2C8YB 2HWLB 1OP8A 2FYRA 1LDTT 1A5IA 2A4QA 4CRFA 4CRCA 2BZAA 2RG3A 1P3EA 1C5TA 1IQLA 5H4IB 1HAIH 1SVPA 3SW2B 4MNYA 1BCUH 1P2IA 2LNCA 5EPNA 1T32A 1HFDA 1CVWH 2VGCC 2HALA 3U8RH 2GT7A 4IC5A 4YT7H 1UMAH 4ZHAA 3V12A 1YPKH 3TJOA 5HM2A 1SQTA 6ESTA 1D3QB 2AGIX 4K2YA 2BTCE 3BN9A 1NZQH 3SQEE 2GCTC 5EODA 1MH0A 2Y5GA 3QN7A 2OBQA 3SV6A 4SGBE 1VCQA 1ARCA 1DSUA 1C5PA 1FV9A 1SMFE 1GCDA 1GVKB 2CGAA 1O2VA 2D1JA 3HATH 3GCTF 3S7KB 4HFPB 1H9IE 3F6UH 3TITA 4MVNA 3A7ZA 3RXMA 2IJOB 8ESTE 2FS8A 4DGJA 3SHAH 2ZPRA 4B73A 1RTFB 1YC0A 1KLJH 1MTUA 2Q6DA 2VWNA 5G4BA 1OX1A 1GGDC 3RXPA 2BLQA 1NU9A 4XFQA 5L30H 3HGNA 1UVUH 2AMPA 1GBFA 2PV9B 1G36A 2GKVE 2PGQB 4WVPE 2GVFA 1TONA 1GWAA 2Z9GA 4INKA 3GY4A 4K60A 3O8CA 1O3LA 3EE0B 1QJ6B 1ARBA 1QRXA 1FIZA 2R0LA 1TNJA 2QF3A 2UWLA 2R2MB 4OS1A 4WMDA 2A2QH 1QL9A 1HNEE 1ZMJA 3GICB 1QL8A 4NIYA 1GHBG 4ABBA 1FY8E 1GVZA 2Z7FE 1V2KT 5J4QA 1O30A 4DVAU 1AZ8A 3LGYA 3SUEA 2ULLA 4R0IA 2DE9A 1L2EA 3EDXB 4B2BA 1HIAB 3GDSA 1O3CA 1UHBA 3ZVEA 3O8BA 4KELA 1V2NT 2SGFE 2BX3A 3SU0A 2ZDVH 2ZQ2A 4YTAA 5LH8A 1TNGA 1C5LH 1OOKB 4CBOA 2PWXA 1O2TA 3ZZCA 2CJIA 4Y79A 5L2YH 2I6QA 3SNAA 1NFWA 3UY9A 1ANCA 3ZZ5A 4D9RA 4H6SB 3GY8A 1M9UA 1FDPA 4XOJA 1GMCF 3JZ1B 1O5AB 1TPAE 2ZFQH 3SUFA 2P94A 4BOHA 1E35B 3MFJA 2FDAA 4JMYA 4OGYA 2VVUA 1FMGA 2ZQ1A 1BITA 3HK3B 2C8WB 2ZIQH 2F9NA 4XE4A 4CHAC 1B0EA 3MO9A 3ZZ4A 2FEQH 1HAGE 1KTSB 7LPRA 3S9BA 3TGKE 2FI3E 1C5XB 2EEKA 1DLKB 2TIOA 2TGAA 3ZYEA 1S6FA 4QT8C 1EATA 4O9VA 3BSQA 1YPJH 2A4OA 1LVMA 2ZCHP 1UVPA 1UTKA 4Q2KA 3SUDA 3W94A 3FP7E 5FPTA 1MTVA 5FHTA 1SGCA 2ODPA 2VNTA 1MAXA 1TBRH 1GJ4H 1D6WA 4ABAA 3LH1A 2O8TA 5DP9A 2V35A 4YO9A 1V2JT 4OS7A 2BDHA 1SHYA 3M5OA 2XC5A 3F9FA 3DHKH 4FU9A 1SSXA 2O8MA 1UTPA 4B76A 4E05H 4LXBH 1F0SA 4UD9H 1DUEA 2A0QB 1AVGH 1GHYH 1YCPK 1VCWA 1EP5A 3QGJA 2G5NA 1HRTH 1V2MT 5GCHG 2IPHA 1A61H 1V2QT 5K0HA 2BZ6H 7ESTE 2ZPSA 4Q7YA 7GCHG 2FZZA 2D2DA 6CHAC 3D62A 1TWXB 2SGAA 4CRAA 3A7VA 1MZDA 1GHAF 1W14U 3VEQB 1MZAA 3RXAA 1P12E 1WYKA 1HPGA 3PLKA 5JBBS 3QO6A 2UWOA 1VGCC 3E6PH 3UQVA 1L1GA 1FY4A 2BHGA 1O35A 2H5CA 2HPPH 3MNBA 1SOTA 1WTGH 3RXBA 1BQYA 2SGEE 3JZ2B 1ELTA 4Q7XA 5EGMA 2IN2A 2Q6GA 5A8XA 1GI9B 2H9TH 5AFZH 3P70B 4ZKSU 1VR1H 2FM2A 3ODDA 2BD8A 3P6ZB 4ISLA 3SGQE 1A7SA 2PSXA 4WMFA 1V2PT 4AZ2B 2AYWA 1O3PB 5TCCA 4YOJA 3BG4C 4NGAH 2PGBB 1HLTH 2GD4B 3DFJA 3S7HB 1V2OT 1TRYA 3MU8A 4WH6A 5JDUB 1KSNA 2GMTB 4A1XA 3KEEA 1CBWC 2G52A 2ZFTA 1LTOA 1GHXH 2ZKSA 1AQ7A 1DICA 4MLFB 3RXEA 4AB8A 2OC0A 1K9OE 2ANKH 4NCYA 5EXLA 3UPEA 1GBCA 1A0JA 1WQVH 2W3IA 1INCA 2Q6FA 1YGCH 2W3KA 5DP3A 3RLYH 2ZO3H 6GCHG 3IG6B 2HNTE 1RXPA 2P95A 1NPMA 5EW1H 3E91A 1SB1H 2VWMA 1HJAC 1A5GH 2C8ZB 1AFEH 3CP7A 3VB6A 3TLOA 4YLUA 1C1VH 1QQUA 2G5VA 3RMLH 1TABE 9ESTA 4Y8XA 4TYDA 1BTHH 6LPRA 1ZSLA 5FX6A 2VB0A 1H1BA 1Y5BT 1TYNA 1O2XA 3CENA 1P57B 1O34A 1P9UA 3BIUH 4X6PA 2W5EA 4VGCC 1JIMA 3VXEH 1YCPH 1K1JA 3ZVBA 1AZZA 1GI4A 2C3SA 3E16B 1Q31A 3FP6E 3RU4T 1K28D 1NT1A 1SGTA 2P3TB 2WUBA 1S83A 3LGVA 3ZZDA 1WTHD 2BDGA 1BOQA 3OU0A 1C1PA 1EZQA 1P3CA 4XBDA 1GBKA 3TK9A 1RRKA 1BJVA 1UTJA 1ZYOA 1ELEE 4Y76A 1HBTH 5CHAB 4GAWA 2XBWA 1O0DH 1OWJA 3LGWA 3E8LA 4LK4A 2BD2A 5FX5A 4FUGA 5LPEA 3U9AH 2V3OH 2RA3A 3TK6A 2IOTA 1JOUB 2JH0D 2V0BA 5FXLA 1HXEH 3P92A 4X8VH 1OKXA 2R3UA 3LJJA 3QLPH 1RIWC 3OYPA 1S0RA 1XUFA 5FBIA 3Q3KA 1V2LT 1ZZZA 4FUFA 2GCHG 3R0FA 3BTGE 4E7RG 2XBYA 2JETB 4IW4E 2VGCB 4ASHA 5DP6A 3F9HA 1UK3A 1C1SA 1OS8A 1OWIA 3SO3A 4D9QA 2BY9X 1ZJDA 5EG4A 1ELGA 2XYAA 2VH6A 2PSYA 2GCTB 3BTME 3DA9B 3KQEA 3KHVA 1HUTH 2OTVA 3BIVH 3S69A 1FPHH 1SI5H 1ZRKA 1C5QA 3PO1B 1O2WA 2AMDA 1LHCH 2BDAA 2A2XH 1EB1H 3A7WA 2A45B 1SGDE 2A5IA 1W12U 1GGDB 1HV7A 1N8OC 1TMBH 3M7QA 1LHGH 1V2RT 3KQCA 1ZTJA 5AFYH 1DS2E 3RXLA 2SGPE 1FNIA 4JYUH 2BY6X 1A3BH 2EA3A 2NU3E 3GY6A 4K69A 2ZC9H 3P8NA 2XC0A 1PPFE 1G32B 5GJ4B 9LPRA 1UK4A 2ANMH 4DG4A 1BMLA 1O3IA 3NPSA 1MQ6A 1C2JA 2AGGX 3ZV9A 3RXIA 1FY3A 3F9GA 3IITA 2A5AA 5EU8A 4K3JA 1D3PB 2YNBA 1JXPA 3V0XA 4MQAA 4AOQA 1BRCE 1E37B 4KGAA 3S9CA 3L33A 1C5ZB 2B7DH 2HLCA 1O2MA 3SGAE 2H9EH 3AASA 5EQRA 3M3VA 1GBMA 3VB5A 3RXRA 1SGNE 1Q3XA 3QGNB 5EPYA 4BXWA 1P01A 2WPLS 4FUJA 1VITF 3TNSA 1SC8U 1VJ9U 1ESBA 1TAWA 1O2YA 4UE7H 1NFUA 1GI1A 2K1QA 2ZU4A 4D7GA 2D8WA 3ZZAA 1YLCA 1LHFH 1QB9A 1DSTA 2ZI2H 3NXPA 2ZECA 1D6RA 1XUIA 1GBTA 2XCNA 4AX9H 4FU7A 2ANWA 1AI8H 3URDA 3MU4A 3U1JB 3HKJB 3WY8A 2GZ7A 2FP7B 1ZPBA 1ELFA 3CS7A 1AWHB 1EPTA 2AEIH 1O5FH 1W0ZU 1GJ6A 4B75A 4BTIB 1OYTH 1LQEA 2BQWB 4XBBA 1W13U 1DVAH 3V3MA 1EAIA 1DM4B 3UOUA 1J15A 1HAYB 5JYIA 2P3UB 2XBXA 5F03A 2GDDA 4B71A 1RS0A 1SR5C 1L1NA 1A1RA 1A3EH 4JZEH 3Q00A 1RTKA 4Y6DA 1TGCA 1N1LA 1O3MA 4WWYA 4ESTE 1IHSH 3U8TH 2XTTB 1QNJA 1LMWB 4MPXA 2J2UA 1HJ9A 5F8TA 1P0SH 1V2VT 5DK1A 3A89A 3ENSB 4HI3A 3ZV8A 5I25A 1BIOA 3AW0A 1TPSA 1AD8H 2H2ZA 4ZXXH 3H7OA 1K2I1 1UCYE 1F0UA 5GDSH 1P2JA 2J95A 1AHTH 5FCKA 5GCHF 3MH5A 5BPEA 2NU2E 4A1VA 7GCHF 2TGTA 5DP7A 3BF6H 4Q7ZA 4Y8YA 1WCZA 3A81A 2Y82A 1WV7H 3T29A 3VB4A 1W8BH 1LO6A 5E0GA 4YOGA 2F91A 1VITH 1C2KA 1TX6A 5A2MH 1LCYA 4GVUA 3E3TA 3RXKA 6CHAB 1SG8B 1DWEH 1O3GA 2OINA 4YLQH 4CR5A 4SGAE 5JBCS 3TJUA 1OPHB 1BT7A 1BTXA 2AH4X 1T4VH 1QBVH 1G3DA 1RTLA 4TPIZ 1SGPE 2F9VA 1AFQC 1BTYA 4F4OC 1XMNB 3GCNA 1L4ZA 1U6QA 1L0ZA 1UHBB 1CU1A 2PKSC 2G8TA 1TPOA 3MH4A 1XVOA 1C2EA 4AFQA 3PV4A 1HAPH 3PLBA 3Q3XA 2PUQH 1K1IA 4GHQA 3LPRA 3RU4D 1O3EA 1SGIB 2FX4A 1UVTH 3SOSA 3ZVDA 2ZHDA 3BG4B 1BRUP 1DITH 1B5GH 3TPIZ 1GMDF 3SU1A 1GJ7B 3P8OA 4NA9H 4NIVA 3SUGA 3PMHB 1CBWB 3GY7A 4FU8A 1GBLA 1EX3A 3M7TA 1QGFA 2BD7A 2Z9KA 1K1NA 1C1UH 3W95A 3RXQA 3PROA 4Y11E
chains in the Genus database with same CATH superfamily
2P16A 3F0OA 2Z3CA 4MPWA 4O97A 1EAXA 3GCOA 2GT8A 3KIDU 4GHTA 4FUEA 1BRBE 1KIGH 1HJAB 3P8FA 3PM3A 3ZYDA 1HAHH 2VJ1A 1F2SE 2AFQB 5C5NA 1BTZA 4TSFD 3BTKE 1FN6A 2UUJB 2YMSD 2ZGCA 4AGJA 1BHXB 1CT2E 2F9BH 2XBVA 2ZEBA 1SGEE 4DT7B 1BRAA 1O2JA 3Q76A 1FLEE 4VGCB 2ALVA 1FPCH 1TBZH 5L2ZH 2OC8A 1FY5A 3SBKA 2TPIZ 4MPVA 3LJOA 2M5TA 1COWD 3BEFB 1AVXA 3LGUA 2ALPA 2G81E 1K1LA 3QWCH 5IDKA 2A7CA 3SJ8A 4GSOA 1V6DA 2QA9E 2Y5HA 1HDTH 4ABEA 4CRBA 4WXVA 5C1YA 3EYDA 2ZGJA 2SGDE 2AMQA 2QXGA 5A8YA 1YPHC 1P2QA 1MBQA 1GJCB 1H4WA 5B6OA 1UTMA 1E79D 8GCHF 2ZWLH 1W7XH 1GL1A 1ZSJA 1YPMH 1O5CB 2PHBA 2ZHEH 1KXBA 2GCHF 1KDQA 1ZHMA 4I8JA 4M9FA 5TJXA 2ZA5A 5F53A 4TY7A 3DSOA 4CRGA 3GISB 1GJDB 1C2DA 1RIWB 4D7FA 3FAOA 4ZHLU 1G2MA 3TVJB 3RC5A 2HOBA 4I7YH 2OXSA 4NA8A 2BD3A 1TNHA 2BVRH 4A7IB 3SV7A 1MKXK 3T27A 1GDUA 2VIWA 4XBCA 1E34B 1MU6B 1Z8GA 4O03A 1SGYE 3RXJA 2J4IA 1CA8B 1LPGB 1C5SA 3LOXA 3S9AA 4I8GA 4MTBA 3SV8A 2O8WA 5GXPA 1BUIA 3ZZ3A 1PPEE 1TGBA 1PPBH 3AW1A 3F0PA 3M5LA 4ISOA 2QGRA 2FMJA 3KQ5A 1THSH 5EQSA 3E0PB 3LKWA 3RXVA 3MO6A 1ID5H 1TRNA 4OS6A 3F1SB 2A7JA 1DWBH 5CHBA 4NG9H 5DP4A 1GBJA 4INHA 3SU4A 1N8OB 1S81A 3U98H 1RJXB 1P06A 2BB4A 2WV9A 3MH7A 1L1JA 3ZZ9A 1FZZA 1ELDE 1AU8A 4WY3A 1Y59T 3CS0A 2OUAA 1MU8B 1B0FA 2Z9LA 1TFXA 3U8OH 1DWCH 4HGCA 4X1NU 4CH2B 4AG1A 1LVYA 1NS3A 2CXVA 2OBOA 2LP6A 1PQAA 3W1EA 1YF4A 1GHWH 1HYLA 1PPZA 1T8LA 4NFEA 5GNDA 1F0TA 2FXRA 1PQ8A 1BA8B 1WUNH 1OSSA 2HRVA 1T4UH 2ANYA 4I8HA 3MYWA 3M37A 1UCYK 1XUGA 4X8UH 4IC6A 2ZDNA 3OTPA 4X6MA 1Z6EA 4TWWA 2BY5X 2ZHQH 3BTDE 1C9PA 1EOJA 3G01A 2ZNKH 1AE5A 4J1YA 3WW7A 1F5LA 4M7GA 5EJLA 1J9CH 1BMMH 1N6XA 1O2GH 5C1XA 2CHAC 2V7QD 3P95A 4I8KA 4ISIH 1A46H 2VU8E 1FQ3A 2Z3DA 4AG2A 4ZMAH 2SGQE 1PPCE 4JK5A 1W0KD 2A31A 2BOKA 1MKXH 2FOAA 4X6OA 3SJOA 3K65B 5AHGH 1EQ9A 3EGKH 3LGIA 1KXEA 2FODA 1KY9A 2KCYA 3A82A 2Y81A 1EASA 4X2XA 4YESB 3C1KA 5AVDA 1ANDA 2BDBA 4X8TH 3SQHE 4BAOB 4TPYA 1IQIA 1EZXC 3K2UA 1NM6A 3A8AA 1DXWA 1AVWA 5HGGA 1BDAA 4ACBA 2WV5A 3UOPA 2GGVB 1O2UA 5HXFA 3DT0H 3RXSA 2A7HA 3RXDA 1MQ5A 3N7OA 3EAJA 4TY6A 3VGCC 1O2KA 3SNCA 5E2PA 2FPZA 1IQEA 4XSKU 3STIA 5EQQA 1Y3WA 1HAVA 1WQSA 4DJZB 1TGNA 4X1RU 3A88A 5JB8S 3M5MA 1IQMA 1S6HA 1C1WH 4Y0ZE 4DT4A 1BBRE 1YCPM 1CHOG 1GG6C 5A0AE 2FOHA 4ISNA 2PW8H 1D4PB 3MH6A 2KR7A 1GI3A 1OP2A 3FANA 1O5GH 3E0NB 1OWHA 2WINI 1DDJA 1NRRH 1LHDH 1XUHA 2FOCA 1UCYH 3PTBA 3GOVB 3QZQA 3TGIE 2ZTXA 2HNTC 5ESTE 4NWLA 3NKKA 5E8EH 1TNKA 2KX4A 1HAOH 1KXFA 5LGOA 1AWFH 3RUOA 3RXCA 4O3UA 3KF2A 2G00A 4Y7BA 5FCRA 2XWAA 4BTTB 1DUAA 3M35A 4Y7AA 1C5VA 3EA8A 3D23A 5DJ7A 1QCPA 4X6NA 1GI8B 2FTMA 1BB0B 1TBQH 1GBAA 2NWNA 1BMNH 1NESE 1YPEH 3RP2A 4UFFH 1HJ8A 1C1RA 1YPLH 1JBUH 2EI7A 1DE7H 2VWLA 4A6LA 1C2GA 1AFQB 2TRMA 1P03A 2OD3B 2QF0A 2BLWA 3VFEA 2PKSB 1C5WB 2LPRA 4DCDA 1T8NA 4UDWH 1P05A 1F7ZA 3RC6A 2BXUH 1UVSH 3SU6A 4U32A 1L4DA 1FAXA 3GY5A 2Y7XA 1CT4E 2QCYA 2QY0B 1GL0E 1W10U 2Z94A 1O38A 1ESAA 3GCHC 3TJNA 2VH0A 4RI0A 1CGJE 1NY22 1TX7A 4PROA 5EJZA 1T7CA 5HYOA 2SFAA 1HXFH 2UUKB 1UTQA 4THNH 5DPAA 2BYAX 4IN2A 3SGBE 4AC9A 4I86A 1NC6A 1GMHG 1NFXA 1K0HA 5FAHA 3QZRA 3MTYA 2VIOA 2EY4C 4NWKA 5T6FA 8LPRA 3GDUA 1C1OA 1AIXH 2TBSA 1O3FA 3FZZA 4FUHA 3AVZA 3NCLA 3A8CA 3TIUA 1GMCG 4CREA 5TCAA 3ZZ7A 1MD8A 1A4WH 1IAUA 1N6YA 3RXFA 1GI7B 2G4UA 4WXIA 4Q4LA 1HB0B 4I31A 1SQRA 1C5OH 2XCFA 1C2MA 2ZFFH 2W26A 1GHBF 3ZVCA 1XVMA 1FAKH 2KAIA 1PPHE 4LOYH 3PMAB 1S82A 3BTQE 4MNXA 1O3NA 2EI8A 4UONA 2GTBA 4ZKOU 4YOIA 1Y8TA 2ZU5A 1E1QD 1O31A 3BTHE 2P59A 5LPRA 2L6OA 1CGIE 2PUXB 1NN6A 2R2WU 1G3EA 2FOBA 2J92A 2BMGB 2RCEA 2ASUB 5B6LA 1KXAA 5DP8A 1X7AC 4GCHG 3NK8A 2XNDD 1MMJN 1A0LA 1RD3B 1EXFA 1ANEA 1HAZB 2QYIA 2QF5A 3HK6B 1EAUA 3PV2A 1UJ1A 2D26C 4DY7B 3A8DA 4IN1A 4WJG2 3MNCA 5A09A 1O5DH 1SGFA 2AIQA 3H09A 4HZHA 4BAHB 1JRSA 2ODYB 1WSSH 3PWCA 5DKMA 3MU0A 3UREA 3A7TA 1AGJA 1EJMA 2B0FA 4JCNA 4F49A 1ZGVA 4MNVA 4MPUA 1EZUC 1C5YB 4B2AA 2QE7D 2KZ4A 2J38A 1S85A 5DGJA 3V13A 3ZVGA 2Z3EA 4O3TA 2YNAA 1DXPA 3SJKA 5JBAS 1F5KU 4K1TA 3ZZBA 1HCGA 1IQGA 1LVBA 4ABGA 1DWDH 3Q3YA 1GBBA 1FJSA 3E90B 1KLTA 3LC5A 1E1RD 1PQ5A 2W6JD 4DW2U 3SJ9A 2WV4A 1VJAU 1CA0C 3BEUA 4RT0A 2HVXA 4INLA 2BM2A 4CHAB 2BD4A 3L6PA 1Z8IB 5FPYA 1DY9A 1H9LB 3EE7A 1SPJA 2BDCA 4AYYB 3SN8A 1ZMLA 2O8LA 1QB6A 2CF9H 2HPQH 2J9NA 2ZDMA 4Y8ZA 3DFLA 1F0RA 2XXLA 4KTUA 2BQ7B 2RFKC 1TOMH 1MTWA 4P00A 1KLIH 2WYJA 3MWIU 3MU1A 1LPZB 1BJUA 1T31A 1AUJA 3KN2A 3UNQA 1QFKH 4UFEH 1C5MD 4D76A 4DIIH 2P8OC 1Z71A 1ANBA 2C90B 4Z1MD 1Y5AT 2VWOA 3MNXA 3ODFA 3T62A 2CF8H 1QBOA 1J8AA 1SQAA 5EXNA 4OS5A 1C4U2 3H7TA 1S5SA 2AIPA 1GJAB 5GPIB 1V2UT 2OC7A 5A8ZA 1ELVA 4I33A 1O5BB 2FS9A 1QJ7B 3ITIA 1DX5M 1BBRK 4IMZA 1H9HE 1JWTA 1O2SA 1TLDA 2J34A 4B74A 3SNDA 1NFYA 1G30B 1ZJKA 1O3BA 2XC4A 1WU1A 3RDZA 4ABDA 1CO7E 1D3TB 1TNLA 5FBEA 3T2NA 2VIDA 3HGPA 2FOGA 4IGDA 3N7DA 3FVFB 3T26A 2PFEA 2PP6A 3C27B 4NA7A 2FI4E 1GBHA 1BHXF 2WZQA 4X2VA 1ELAA 5AF9H 2CHAB 4JZDH 3K9XB 1IQKA 4JZ1A 5T6GA 2P3FH 1JMOH 2BD5A 3T28A 2GP9B 2G4TA 4Y10E 3RM0H 3VXFH 1VGCB 1ZTKA 2W7SA 2R3YA 1ZLRA 2FO9A 5E2OA 3BEIB 1GI2A 3BV9B 3QX5H 1TPPA 4Q80A 3A7YA 1UVOA 4X8SH 2VINA 3B23B 1OYQA 2H5DA 4ZROA 1KDQB 4H6TA 1P2KA 1UK2A 5L6NH 8KME2 3TH4H 1AY6H 4FUIA 4WF8A 1QR3E 5C5OA 1SGRE 2KCOA 1D9IA 1ABJH 1TQ0B 1TA2A 2VIPA 1FN8A 4Z0KA 2ZFPH 3O8RA 4ZAEA 1AB9C 1MUEB 4GPGA 3VPKA 4AFZA 1IOEA 1QL7A 3LU9B 4KKDA 1ZR0A 3SNBA 2ZHFH 3ATMA 1LKBA 1DLEA 1QIXB 4UEHH 1VCPA 2KCPA 2WPIS 3QUMP 1GCTC 6GCHF 1SLUB 4UFDH 3VGCB 4AGKA 1EPTC 2JH6D 4FXGH 1ZHRA 1TNIA 1OWEA 1LPKB 1CHOF 1O2QA 2W7UA 1SQOA 4AFSA 4E06H 2V3HH 3EA9A 3AAVA 2BLOA 5DN6D 2JETC 4KTSA 2H9HA 1S0QA 1IHTH 3LC3A 2A4RA 5LPFA 1J17T 1SLVB 1WOFA 1EJNA 2DUCA 1CQQA 3MI4A 1ELCA 5PTPA 4OS4A 3QTOH 1PYTD 1C2HA 4CR9A 1GG6B 1EB2A 2QAAA 5CDFE 1TIOA 3KQDA 2PTCE 1O5EH 4K1SA 4NIWA 2BVSH 4JYTA 2VVCA 5KGOA 3B8JA 1BBRH 3SU5A 1T8OA 3RLWH 4DOQA 5C94A 1RGQA 3A8BA 2ZG0H 1D3DB 2QIQA 2RDLA 3PO1C 2QXJA 2FOFA 1J14A 5C0TA 3PRDA 1TRMA 1YWUA 4KP0A 2BXTH 1QHRB 1EFRD 1AKSA 2J5UA 3U69H 4F48B 4IMQA 2FLRH 3ZIAD 1DANH 1SKYE 1GJ8B 5DSFA 3IWMA 2PKAA 1GBDA 4ZUHA 1MBMA 3RMNH 2B8OH 2OQUA 5CMXH 1O3AA 4LZ1H 1YPHE 4B6FA 2F9PA 4ABIA 1PQ7A 1Y3XA 2ODQA 3TGJE 1C4V2 1LKAA 4YXWD 2AS9A 3OX7U 1E36B 2OQ5A 3QTVH 3PMJA 3KCGH 3KQBA 3PMBB 1PFXC 1ZTLA 4X2WA 1H8IH 1K22H 2ZDAH 2HVYB 5IYTA 3RU4E 5HMAA 1SBWA 2BQ6B 3UNSA 4YZUA 2ZFSA 3DUXH 1MKWH 2H6MA 3T25A 3TNTA 2QF4A 2ZFRH 1QRWA 1C5UA 3UNRA 3OY6U 3DD2H 4OM9A 4FVDA 3UUZA 1ABIH 3FP8E 1O2IA 2CV3A 1QA7A 1OWKA 3GCHB 4Y0YE 3SORA 4RN6A 3RMMH 5GIBA 5A0BA 1GMHF 1EP6A 5C3NA 4ZXYH 3A80A 3UQOA 2G55A 1CSOE 4ABHA 3L3TA 3BTTE 1O3JA 4JK6A 4FUDA 1NRQH 1A2CH 3SI4H 3ELAH 1OWDA 2GZ8A 1PYTC 1P11E 3GYLB 3ZVFA 3UR9A 1ETSH 1VITG 2F3CE 3T5FH 1QQ4A 3RXTA 1WBGB 3F9EA 2YMSC 3BTWE 3ATKA 1YKTA 3M61U 1GDQA 3TK5A 2J94A 3A83A 2BX4A 4U30A 1C5RA 5SGAE 3V7TA 2CMYA 3MOCA 1GI0A 2EI6A 1P9SA 1HAVB 2XWBI 3ESTA 2V6NA 3MNSA 1XUKA 1PJPA 1GPZA 1QB1A 2ZU3A 3E1XB 5T6DA 4H42U 1UTOA 2ESTE 3AK5A 2NU0E 3TU7H 1ETRH 1MTNC 1G9IE 1C9TA 1NRNH 1C5NH 1W7GH 2FYQA 1Z1JA 3DSPA 1AE8H 5C2ZA 3SHCH 2IPQX 4JYVH 2GX4A 3D65E 1QJ1B 1THRH 2GV6A 3Q77A 2CN0H 4K1EA 5I46H 1B7XB 4TWYA 1XUJA 2FTLE 2BY8X 1GJBB 1HGTH 3A85A 4RKOB 4GCHF 5DG6A 1Z8RA 2ZGBH 3F2HA 4B1TA 4GLYA 4OGXA 1TOCB 4X1SU 1PPGE 4NFFA 1LHEH 5HM9A 1YPGH 2CK3D 1EAWA 1SOZA 2FOEA 1TALA 2KFWA 3LIWA 1OXGA 2FLBH 1W0YH 5JPMH 1TX8A 4OS2A 4CH8B 2NU1E 4NSVA 1XX9A 2STAE 5E0JA 1O2HA 4JZFH 2WPKS 3VB7A 4AYVB 3A7XA 1UW7A 4JZIA 1O2ZA 3PYHA 1K1OA 1Z8JB 1HIAA 1O2PA 1LQDB 1SFIA 2TGDA 1Z1IA 5F8XA 2O9QA 3OTJE 1P09A 1DOJA 4Z6AH 4MDSA 1TMTH 1O2RA 5EOKA 1CHGA 1XM1A 1W11U 1TB6H 1O33A 3BTFE 3LGTA 1P2MA 1TE0A 3UAIC 3BG8A 1CT0E 1BMAA 2C8XB 2M2AA 2DE8A 3I78A 1CA0B 1Y3VA 4MNWA 1BMFD 3A86A 3SU2A 2FOMB 4R8TB 4FUCA 1O2OA 2KCAA 1IQNA 2Q1JA 1SHHB 4YT6H 2C4FH 1O39A 3UWIA 3F2GA 2EQNA 3P17H 2ZU2A 1V2ST 3A87A 2Z9JA 5ESBA 1ORFA 7KMEH 1CGHA 4ISHH 5C67A 4GUXA 1EUFA 3GYMA 3MO3A 4BAQB 2ZDLA 2P8OB 2ZP0H 1XKBC 1O2LA 2V3MA 4D8NA 2BVXH 3RM2H 4DURA 1K1MA 4BAMB 4H4FA 3FZDA 3MU5A 1DY8A 3R3GB 3GY2A 3B9FH 3SU3A 3S0NA 2VVVA 3I77A 3UTUH 3EA7A 1QRZA 5EW2H 1NO9H 4MG3A 1V3XA 5A0CA 2IJD1 3STJA 2TGPZ 1GMDG 2BLVA 4RKJB 5E0HA 3PRBA 4FUBA 1GVLA 2ZDKA 2P93A 3M3TA 3QDZB 2XRCA 2KAIB 3HKIB 1EJAA 1EOLA 1P02A 1C4Y2 3PWBA 1P2OA 3O8DA 3NRLA 1DPOA 2BD9A 2HGTH 2SNWA 3GCTG 1KXDA 2R9PA 1T8MA 2WPJS 1OHHD 2QN5T 1FI8A 5GWZA 3ATLA 3LH3A 1KYNA 1K1PA 2ILNA 1WXRA 4FETA 1S6LA 2VIVA 5K7RA 1YP9A 2FI5E 5DO4H 1C1TA 1WDIA 3SV2H 4BNRA 1O3HA 3URCA 3HPTB 4NZQA 1ETTH 1Z7KA 3H5CB 1V2TT 4IBLH 1C1QA 5C1UA 5F6MA 2ZPQA 2AHME 1F92A 2FX6A 4K5ZA 1A5HA 3MMGA 1EKBB 5JBTA 5T3HA 1MAYA 3GY3A 3WWFA 1QY6A 1GDNA 1MCTA 2F9UA 2ZGXH 2WPMS 1C2IA 1XXDA 1YY3A 1O36A 3FKSD 3UIRA 1VZQH 1AB9B 2A4GA 4BAKB 1NRPH 3M36A 5HIZA 3RC4A 3M7UA 2Y6TA 1C2FA 1O37A 1YLDA 1O3DA 4A5TS 5EIYA 8GCHG 2VIQA 2YOLA 1SL3A 1QA0A 1A0HB 1ZGIA 2PR3A 2UUFB 4ZKNU 4AN7A 1IQJA 1GCTB 1OP0A 1G3BA 1EPTB 1XKAC 1ELBA 1GI6A 2UWPA 4K8BA 3K6ZA 1SFQB 4A1TA 1MTSA 2ZHWH 4A92A 2XNIA 4AORA 4FOUC 1P10A 1FUJA 1QBNA 2ZTYA 4WH8A 1O32A 4Q63A 3KNXA 4XDEA 1P8VC 3PTNA 5HIYA 2G51A 2UUYA 2ZTZA 1EZSC 1W2KH 4K8YA 3LDXH 1FY1A 3DSGA 1NRSH 4WMEA 1C1NA 4X0WU 5DP5A 1GHZA 4RSPA 1GBIA 1QURH 1NROH 3PB1E 1NBMD 2XW9A 2QV1A 4AB9A 1ZOMA 2A5KA 2QXIA 1MCVA 1O3OA 1ZMNA 2GDEH 1DT2A 3SNEA 2H1UA 3RMOH 3TH2H 1TQ7B 3NUMA 1GJ9B 3K6YA 1AUTC 1C1MA 5CE1A 2WUCA 3RXGA 3OY5U 2PLXA 4B2CA 2B9LA 2RA0A 2AGEX 4X1QU 2A32A 2J98B 4IS5A 1SLXB 3RXOA 5C20A 2WPHS 2BOHB 3OE7D 2FWWA 4I32A 4CBNA 2GV7A 2QXHA 1YYY1 1HAXB 1ESTA 3SV9A 5ETXA 4ABJA 2OLGA 1TMUH 1P2NA 1ZRBA 5FPSA 4NIXA 2NU4E 1ZPZA 2ZF0H 4J2YB 4X2YA 1ZSKA 1GJ5H 1JRTA 4KTCA 4DIHH 1KXCA 1XXFA 3CNRA 4U2WA 1S84A 2FESH 3EQ0H 1FONA 1BTWA 1V2WT 4ZHMU 2THFB 2F9OA 1J16A 2AERH 1E38B 1ACBE 1TGTA 2HLDD 1KTTB 1LVOA 2Z9IA 1Y5UT 2R0KA 3NWUA 2K0QA 3TJVA 1IQHA 1THPB 4ZKRU 1GHAG 2OP9A 4ACAA 2ZCKP 1AMHA 3RXUA 1UO6A 2JJ1D 4RT1A 3UWJH 1YBWA 3P8GA 1P04A 4NSYA 3UR6A 1AN1E 1IQFA 2W6ID 3RXHA 4E7NA 3LT3A 3FFGA 2YMSB 3M5NA 4LZ4B 2Y80A 1ZHPA 1G3CA 4FVBA 2SNVA 4NZLA 3U28C 5ABWA 2EC9H 1UTLM 1SGQE 5J4SA 1BZXE 2Y5FA 3ZVAA 1F5RA 4U01A 4BXSA 1CE5A 2GMTC 3OEHD 1W3CA 2ZGHA 1FXYA 1SGFG 3D49H 4TT3D 4ZH8A 1G37A 1NTPA 1MTNB 2ZZUH 2OCVB 1UTNA 3ZZ6A 5HKKD 2BDYA 3VB3A 1WAYB 2B5TB 5F8ZA 1DFPA 3GDVA 2BY7X 3ATIA 1Y3UA 1YM0A 3ATWA 4CRDA 2O8UA 1JIRA 3SJIA 5KEDA 4BTUB 1RFNA 2I6SA 1BTPA 3FN8A 1H8HD 1C2LA 4ABFA 4HTCH 1AKSB 3ZZ8A 3M3SA 1QTFA 4I8LA 3QK1A 4BANB 2JKHA 1O2NA 1Q2WA 2PKAB 3SZNA 2STBE 3U1IB 4AFUA 4X1PU 1GHVH 3KL6A 2F83A 1AO5A 3NZIA 2ZCLP 2Z6BD 1Z6JH 1SLWB 1ZPCA 2HNTF 2QC2A 2VBCA 2ZU1A 1FIWA 3SI3H 3SYJA 5EXMA 4YM9A 1G2LA 3F68H 1NU7B 2FIRH 2A1DB 4Y71A 1O3KA 2Y7ZA 2WYGA 1TGSZ 1H8DH 3TH3H 1GBEA 1K21H 3AAUA 3I29A 2GZ9A 1E0FD 3A84A 3BTEE 3MHWU 2BDIA 5JB9S 1BTUA 3F2FA 2JH5D 1MD7A 2C93B 2OC1A 5CHAC 1Y3YA 5C0UA 3UFAA 5BRRE 3LONA 3KGPA 3OSYA 1MKWK 1GI5A 4UFGH 2PTNA 3PLPA 1TA6A 2C8YB 2HWLB 1OP8A 2FYRA 1LDTT 1A5IA 2A4QA 4CRFA 4CRCA 2BZAA 2WSSD 2RG3A 1P3EA 1C5TA 1IQLA 5H4IB 1HAIH 1SVPA 3SW2B 4MNYA 1BCUH 1P2IA 2LNCA 5EPNA 1T32A 1HFDA 1CVWH 2VGCC 2HALA 3F3BA 3U8RH 2GT7A 4IC5A 4YT7H 1UMAH 4ZHAA 3V12A 1YPKH 3TJOA 5HM2A 1SQTA 6ESTA 1D3QB 2AGIX 4K2YA 2BTCE 3BN9A 1FX0B 1NZQH 3SQEE 2GCTC 5EODA 1MH0A 2Y5GA 3QN7A 2OBQA 3SV6A 4SGBE 1VCQA 1ARCA 1DSUA 1C5PA 1FV9A 1SMFE 1GCDA 1GVKB 2CGAA 1O2VA 2D1JA 3HATH 3GCTF 3S7KB 4HFPB 4XRNA 1H9IE 3F6UH 3TITA 4MVNA 3A7ZA 3RXMA 2IJOB 8ESTE 2FS8A 4DGJA 3SHAH 2ZPRA 4B73A 1RTFB 1YC0A 1KLJH 1MTUA 2Q6DA 2VWNA 5G4BA 1OX1A 1GGDC 3RXPA 2BLQA 1NU9A 4XFQA 5L30H 3HGNA 1UVUH 2AMPA 1GBFA 2PV9B 1G36A 2GKVE 2PGQB 4WVPE 2GVFA 1TONA 1GWAA 2Z9GA 4INKA 3GY4A 4K60A 3O8CA 1O3LA 3EE0B 1QJ6B 1ARBA 2LELA 3WWBA 1QRXA 1FIZA 2R0LA 1TNJA 2QF3A 2UWLA 2R2MB 4OS1A 4WMDA 2A2QH 1QL9A 1HNEE 1ZMJA 3GICB 1QL8A 4NIYA 1GHBG 4ABBA 1FY8E 1GVZA 3KYFA 2Z7FE 1V2KT 5J4QA 1O30A 4DVAU 1AZ8A 3LGYA 3SUEA 2ULLA 4R0IA 2DE9A 1L2EA 3EDXB 3KYGA 4B2BA 1HIAB 3GDSA 1O3CA 1UHBA 3ZVEA 3O8BA 4KELA 1V2NT 2SGFE 2BX3A 3SU0A 2ZDVH 2ZQ2A 4YTAA 5LH8A 1TNGA 1C5LH 1OOKB 4ASUD 4CBOA 2PWXA 1O2TA 3ZZCA 2CJIA 4Y79A 5L2YH 2I6QA 3SNAA 1NFWA 3UY9A 1ANCA 3ZZ5A 4D9RA 4H6SB 3GY8A 1M9UA 1FDPA 4XOJA 1GMCF 3JZ1B 1O5AB 1TPAE 2ZFQH 3SUFA 2P94A 4BOHA 1E35B 3MFJA 2OK5A 2FDAA 4JMYA 4OGYA 2VVUA 1FMGA 2ZQ1A 1BITA 3HK3B 2C8WB 2ZIQH 2F9NA 4XE4A 4CHAC 1B0EA 3MO9A 3ZZ4A 2FEQH 1HAGE 4P02A 1KTSB 7LPRA 3S9BA 3TGKE 2FI3E 1C5XB 2EEKA 1DLKB 2TIOA 2TGAA 3ZYEA 1S6FA 4QT8C 1EATA 4O9VA 3BSQA 1YPJH 2A4OA 1LVMA 2ZCHP 1UVPA 1UTKA 4Q2KA 3SUDA 3W94A 3FP7E 5FPTA 1MTVA 5FHTA 1SGCA 2ODPA 2VNTA 1MAXA 1TBRH 1GJ4H 1D6WA 4ABAA 3LH1A 2O8TA 5DP9A 2V35A 4YO9A 1V2JT 3UB0A 4OS7A 2BDHA 1SHYA 3M5OA 2XC5A 3F9FA 3DHKH 4XD7D 4FU9A 1SSXA 2O8MA 1UTPA 2JJ2D 4B76A 4E05H 5KECA 4LXBH 1F0SA 4UD9H 1DUEA 2A0QB 1AVGH 1GHYH 1YCPK 1VCWA 1EP5A 3QGJA 2G5NA 1HRTH 1V2MT 5GCHG 2IPHA 1A61H 1V2QT 5K0HA 2BZ6H 7ESTE 2ZPSA 4Q7YA 7GCHG 2FZZA 2D2DA 6CHAC 3D62A 1TWXB 2SGAA 4CRAA 3A7VA 1MZDA 1GHAF 1W14U 3VEQB 1MZAA 3RXAA 1P12E 1WYKA 1HPGA 3PLKA 5JBBS 3QO6A 2UWOA 1VGCC 1YLNA 1H8ED 3E6PH 3UQVA 1L1GA 1FY4A 2BHGA 1O35A 2H5CA 2HPPH 3MNBA 1SOTA 1WTGH 3RXBA 1BQYA 2SGEE 3JZ2B 1ELTA 1QZ8A 4Q7XA 5EGMA 2IN2A 2Q6GA 5A8XA 1GI9B 2H9TH 5AFZH 3P70B 4ZKSU 1VR1H 2FM2A 3ODDA 2BD8A 3P6ZB 4ISLA 3SGQE 1A7SA 2PSXA 4WMFA 1V2PT 4AZ2B 2AYWA 1O3PB 5TCCA 2K8IA 4YOJA 3BG4C 4NGAH 2PGBB 1HLTH 2GD4B 3DFJA 3S7HB 1V2OT 1TRYA 3MU8A 4WH6A 5JDUB 1KSNA 5FL7D 2GMTB 4A1XA 3KEEA 1CBWC 2G52A 2ZFTA 1LTOA 1GHXH 2ZKSA 1AQ7A 1DICA 4MLFB 3RXEA 4AB8A 2OC0A 1K9OE 2ANKH 4NCYA 5EXLA 3UPEA 2JDID 1GBCA 1A0JA 1WQVH 2W3IA 1INCA 2Q6FA 1YGCH 2W3KA 5DP3A 3RLYH 2ZO3H 6GCHG 3IG6B 2HNTE 1RXPA 2P95A 1NPMA 5EW1H 3E91A 1SB1H 2VWMA 1HJAC 1A5GH 2C8ZB 1AFEH 3CP7A 3VB6A 3TLOA 2L74A 1C1VH 1QQUA 2G5VA 4YLUA 3RMLH 1TABE 9ESTA 4Y8XA 4TYDA 1BTHH 6LPRA 1ZSLA 5FX6A 2VB0A 1H1BA 1Y5BT 1TYNA 1O2XA 3CENA 1P57B 1O34A 1P9UA 3BIUH 4X6PA 1W0JD 2W5EA 4VGCC 1JIMA 3VXEH 1YCPH 1K1JA 3ZVBA 1AZZA 1GI4A 2C3SA 3E16B 1Q31A 3FP6E 3RU4T 1K28D 1NT1A 1SGTA 2P3TB 2WUBA 1S83A 3LGVA 3ZZDA 1WTHD 2BDGA 1BOQA 2WHXA 3OU0A 1C1PA 1EZQA 1P3CA 4XBDA 1GBKA 3TK9A 1RRKA 1BJVA 1UTJA 1ZYOA 1ELEE 4Y76A 1HBTH 5CHAB 4GAWA 2XBWA 1O0DH 1OWJA 3LGWA 3E8LA 4LK4A 2BD2A 5FX5A 4FUGA 5LPEA 3U9AH 2V3OH 3OAAD 2RA3A 3TK6A 2IOTA 1JOUB 2JH0D 2V0BA 5FXLA 1HXEH 3P92A 4X8VH 1OKXA 2R3UA 3LJJA 3QLPH 1RIWC 3OYPA 1S0RA 1XUFA 5FBIA 3Q3KA 1V2LT 1ZZZA 4FUFA 4F55A 2GCHG 3R0FA 3BTGE 4E7RG 2XBYA 2WPDD 2JETB 4IW4E 2VGCB 4ASHA 5DP6A 3F9HA 1UK3A 1C1SA 1OS8A 1OWIA 3SO3A 4D9QA 2BY9X 1ZJDA 2F4LA 5EG4A 1ELGA 2XYAA 2VH6A 2PSYA 2GCTB 3BTME 3DA9B 3KQEA 3KHVA 1HUTH 3VG8A 2OTVA 3BIVH 3S69A 1FPHH 1SI5H 1ZRKA 1C5QA 3PO1B 1O2WA 2AMDA 1LHCH 2BDAA 2A2XH 1EB1H 3A7WA 2A45B 1SGDE 2A5IA 1W12U 3OFND 1GGDB 1HV7A 1N8OC 1TMBH 3M7QA 1LHGH 1V2RT 3KQCA 1ZTJA 5AFYH 1DS2E 3RXLA 2SGPE 1FNIA 4JYUH 2BY6X 1A3BH 2EA3A 2NU3E 3GY6A 4K69A 2ZC9H 3P8NA 2XC0A 1PPFE 5EJ1A 1G32B 5GJ4B 2RDEA 9LPRA 1UK4A 2J97A 2ANMH 4DG4A 1BMLA 1O3IA 3NPSA 1MQ6A 1C2JA 2AGGX 3PV5A 3ZV9A 3RXIA 1FY3A 3F9GA 2GJGA 3IITA 2A5AA 5EU8A 4K3JA 1D3PB 2YNBA 1JXPA 3V0XA 4MQAA 4AOQA 1BRCE 1E37B 4KGAA 3S9CA 3L33A 1C5ZB 2B7DH 2HLCA 1O2MA 3SGAE 2H9EH 3AASA 5EQRA 3M3VA 1GBMA 3VB5A 2KM0A 3RXRA 1SGNE 1Q3XA 2XOKD 3QGNB 5EPYA 4BXWA 1P01A 2WPLS 4FUJA 1VITF 3TNSA 1SC8U 1VJ9U 3N7EA 1ESBA 1TAWA 1O2YA 4UE7H 1NFUA 1GI1A 2K1QA 2ZU4A 4D7GA 2D8WA 3ZZAA 1YLCA 1LHFH 1QB9A 1DSTA 2ZI2H 3NXPA 2ZECA 1D6RA 1XUIA 1GBTA 2F43B 2XCNA 4AX9H 4FU7A 2ANWA 1AI8H 3URDA 3MU4A 3U1JB 3HKJB 3WY8A 2GZ7A 2FP7B 1ZPBA 1ELFA 3CS7A 1AWHB 1EPTA 2AEIH 1O5FH 1W0ZU 1NBME 1GJ6A 3N99A 4B75A 4BTIB 1OYTH 1LQEA 2BQWB 4XBBA 1W13U 3OEED 1DVAH 4ZCNA 3V3MA 1EAIA 1DM4B 3SZEA 3UOUA 1J15A 1HAYB 5JYIA 2P3UB 2XBXA 5F03A 2GDDA 4B71A 1RS0A 1SR5C 1L1NA 1A1RA 1A3EH 4JZEH 3Q00A 1RTKA 4HG6A 4B6EA 4Y6DA 1TGCA 1N1LA 5IK2D 1O3MA 4WWYA 4ESTE 1IHSH 3U8TH 2XTTB 1QNJA 1LMWB 4MPXA 2J2UA 1HJ9A 5F8TA 1P0SH 1V2VT 5DK1A 3A89A 3ENSB 4HI3A 3ZV8A 5I25A 1BIOA 3AW0A 1TPSA 1AD8H 2H2ZA 4ZXXH 3H7OA 1K2I1 1UCYE 1F0UA 5GDSH 3FO8D 1P2JA 2J95A 1AHTH 5FCKA 5GCHF 3MH5A 5BPEA 2NU2E 4A1VA 1KMHB 7GCHF 2TGTA 5DP7A 3BF6H 2J98A 4Q7ZA 4Y8YA 1WCZA 5C17A 3A81A 2Y82A 1WV7H 3T29A 3VB4A 1W8BH 1LO6A 5E0GA 4YOGA 2F91A 1VITH 1C2KA 1TX6A 5A2MH 1LCYA 4GVUA 3E3TA 3RXKA 6CHAB 1SG8B 1DWEH 1O3GA 2OINA 4YLQH 4CR5A 4SGAE 5JBCS 3TJUA 1OPHB 1BT7A 1BTXA 2AH4X 1T4VH 1QBVH 1G3DA 1RTLA 4TPIZ 1SGPE 2F9VA 1AFQC 1BTYA 4F4OC 1XMNB 3GCNA 1L4ZA 1U6QA 1L0ZA 3FOAA 3GS9A 1UHBB 1CU1A 2PKSC 2G8TA 1TPOA 3MH4A 1XVOA 1C2EA 4AFQA 3PV4A 1HAPH 3PLBA 3Q3XA 2PUQH 1K1IA 4GHQA 3LPRA 3RU4D 1O3EA 1SGIB 5T1VA 2FX4A 1UVTH 3SOSA 3ZVDA 2ZHDA 3BG4B 1BRUP 3MQKC 1DITH 1B5GH 3TPIZ 1GMDF 3SU1A 1GJ7B 3P8OA 4NA9H 4NIVA 3SUGA 3PMHB 1VKYA 1CBWB 1MABB 3GY7A 4FU8A 1GBLA 2JIZD 1EX3A 3M7TA 1QGFA 2BD7A 2Z9KA 1K1NA 1C1UH 3W95A 3DCLA 3RXQA 3PROA 4Y11E
chains in the Genus database with same CATH topology
2P16A 2Z3CA 4MPWA 4O97A 1EAXA 3GCOA 2GT8A 3KIDU 4GHTA 4FUEA 1BRBE 1KIGH 1HJAB 3P8FA 3PM3A 3ZYDA 1HAHH 2VJ1A 1F2SE 2AFQB 5C5NA 1BTZA 3BTKE 1FN6A 2UUJB 2ZGCA 4AGJA 1BHXB 1CT2E 2F9BH 2XBVA 2ZEBA 1SGEE 4DT7B 1BRAA 1O2JA 3Q76A 1FLEE 4VGCB 2ALVA 1FPCH 1TBZH 5L2ZH 2OC8A 1FY5A 3SBKA 2TPIZ 4MPVA 3LJOA 2M5TA 3BEFB 1AVXA 3LGUA 2ALPA 2G81E 1K1LA 3QWCH 5IDKA 2A7CA 3SJ8A 4GSOA 1V6DA 2QA9E 2Y5HA 1HDTH 4ABEA 4CRBA 4WXVA 5C1YA 3EYDA 2ZGJA 2SGDE 2AMQA 2QXGA 5A8YA 1YPHC 1P2QA 1MBQA 1GJCB 1H4WA 5B6OA 1UTMA 8GCHF 2ZWLH 1W7XH 1GL1A 1ZSJA 1YPMH 1O5CB 2PHBA 2ZHEH 1KXBA 2GCHF 1KDQA 1ZHMA 4I8JA 5TJXA 2ZA5A 4TY7A 4CRGA 3GISB 1GJDB 1C2DA 1RIWB 4D7FA 3FAOA 4ZHLU 1G2MA 3TVJB 3RC5A 2HOBA 4I7YH 2OXSA 4NA8A 2BD3A 1TNHA 2BVRH 4A7IB 3SV7A 1MKXK 3T27A 1GDUA 2VIWA 4XBCA 1E34B 1MU6B 1Z8GA 4O03A 1SGYE 3RXJA 2J4IA 1CA8B 1LPGB 1C5SA 3LOXA 3S9AA 4I8GA 4MTBA 3SV8A 2O8WA 5GXPA 1BUIA 3ZZ3A 1PPEE 1TGBA 1PPBH 3AW1A 3M5LA 4ISOA 2QGRA 2FMJA 1THSH 5EQSA 3E0PB 3LKWA 3RXVA 3MO6A 1ID5H 1TRNA 4OS6A 3F1SB 2A7JA 1DWBH 4NG9H 5DP4A 1GBJA 4INHA 3SU4A 1N8OB 1S81A 3U98H 1RJXB 1P06A 2BB4A 3MH7A 1L1JA 3ZZ9A 1FZZA 1ELDE 1AU8A 4WY3A 1Y59T 3CS0A 2OUAA 1MU8B 1B0FA 2Z9LA 1TFXA 3U8OH 1DWCH 4HGCA 4X1NU 4CH2B 4AG1A 1LVYA 1NS3A 2CXVA 2OBOA 1PQAA 1YF4A 1GHWH 1HYLA 1PPZA 1T8LA 4NFEA 1F0TA 2FXRA 1PQ8A 1BA8B 1WUNH 1OSSA 2HRVA 1T4UH 2ANYA 4I8HA 3MYWA 3M37A 1UCYK 1XUGA 4X8UH 4IC6A 2ZDNA 4X6MA 1Z6EA 4TWWA 2BY5X 2ZHQH 3BTDE 1C9PA 1EOJA 3G01A 2ZNKH 1AE5A 4J1YA 1F5LA 4M7GA 1J9CH 1BMMH 1N6XA 1O2GH 5C1XA 2CHAC 3P95A 4I8KA 4ISIH 1A46H 2VU8E 1FQ3A 2Z3DA 4AG2A 4ZMAH 2SGQE 1PPCE 4JK5A 2A31A 2BOKA 1MKXH 2FOAA 4X6OA 3SJOA 3K65B 5AHGH 1EQ9A 3EGKH 3LGIA 1KXEA 2FODA 1KY9A 3A82A 2Y81A 1EASA 4X2XA 4YESB 3C1KA 5AVDA 1ANDA 2BDBA 4X8TH 3SQHE 4BAOB 4TPYA 1IQIA 1EZXC 3K2UA 1NM6A 3A8AA 1DXWA 1AVWA 5HGGA 1BDAA 2WV5A 3UOPA 2GGVB 1O2UA 5HXFA 3DT0H 3RXSA 2A7HA 3RXDA 1MQ5A 3N7OA 3EAJA 4TY6A 3VGCC 1O2KA 3SNCA 5E2PA 2FPZA 1IQEA 4XSKU 3STIA 5EQQA 1Y3WA 1HAVA 1WQSA 4DJZB 1TGNA 4X1RU 3A88A 5JB8S 3M5MA 1IQMA 1S6HA 1C1WH 4Y0ZE 1BBRE 1YCPM 1CHOG 1GG6C 5A0AE 2FOHA 4ISNA 2PW8H 1D4PB 3MH6A 1GI3A 1OP2A 3FANA 1O5GH 3E0NB 1OWHA 2WINI 1DDJA 1NRRH 1LHDH 1XUHA 2FOCA 1UCYH 3PTBA 3GOVB 3QZQA 3TGIE 2ZTXA 2HNTC 5ESTE 4NWLA 3NKKA 5E8EH 1TNKA 1HAOH 1KXFA 5LGOA 1AWFH 3RUOA 3RXCA 4O3UA 3KF2A 2G00A 4Y7BA 5FCRA 2XWAA 4BTTB 1DUAA 3M35A 4Y7AA 1C5VA 3EA8A 3D23A 5DJ7A 1QCPA 4X6NA 1GI8B 2FTMA 1BB0B 1TBQH 1GBAA 2NWNA 1BMNH 1NESE 1YPEH 3RP2A 4UFFH 1HJ8A 1C1RA 1YPLH 1JBUH 2EI7A 1DE7H 2VWLA 4A6LA 1C2GA 1AFQB 2TRMA 1P03A 2OD3B 2QF0A 2BLWA 3VFEA 2PKSB 1C5WB 2LPRA 4DCDA 1T8NA 4UDWH 1P05A 1F7ZA 3RC6A 2BXUH 1UVSH 3SU6A 4U32A 1L4DA 1FAXA 3GY5A 2Y7XA 1CT4E 2QCYA 2QY0B 1GL0E 1W10U 2Z94A 1O38A 1ESAA 3GCHC 3TJNA 2VH0A 1CGJE 1NY22 1TX7A 4PROA 1T7CA 5HYOA 2SFAA 1HXFH 2UUKB 1UTQA 4THNH 5DPAA 2BYAX 4IN2A 3SGBE 1NC6A 1GMHG 1NFXA 5FAHA 3QZRA 3MTYA 2VIOA 4NWKA 5T6FA 8LPRA 3GDUA 1C1OA 1AIXH 2TBSA 1O3FA 3FZZA 4FUHA 3AVZA 3NCLA 3A8CA 3TIUA 1GMCG 4CREA 5TCAA 3ZZ7A 1MD8A 1A4WH 1IAUA 1N6YA 3RXFA 1GI7B 2G4UA 4WXIA 1HB0B 4I31A 1C5OH 2XCFA 1C2MA 2ZFFH 2W26A 1GHBF 3ZVCA 1XVMA 1FAKH 2KAIA 1PPHE 4LOYH 3PMAB 1S82A 3BTQE 4MNXA 1O3NA 2EI8A 4UONA 2GTBA 4ZKOU 4YOIA 1Y8TA 2ZU5A 1O31A 3BTHE 2P59A 5LPRA 1CGIE 2PUXB 1NN6A 2R2WU 1G3EA 2FOBA 2J92A 2BMGB 2RCEA 2ASUB 1KXAA 5DP8A 1X7AC 4GCHG 3NK8A 1MMJN 1A0LA 1RD3B 1EXFA 1ANEA 1HAZB 2QYIA 3HK6B 1EAUA 1UJ1A 2D26C 4DY7B 3A8DA 4IN1A 4WJG2 3MNCA 5A09A 1O5DH 1SGFA 2AIQA 4HZHA 4BAHB 1JRSA 2ODYB 1WSSH 3PWCA 5DKMA 3MU0A 3UREA 3A7TA 1AGJA 1EJMA 2B0FA 4JCNA 4F49A 1ZGVA 4MNVA 4MPUA 1EZUC 1C5YB 4B2AA 2J38A 1S85A 5DGJA 3V13A 3ZVGA 2Z3EA 4O3TA 2YNAA 1DXPA 3SJKA 5JBAS 1F5KU 4K1TA 3ZZBA 1HCGA 1IQGA 1LVBA 4ABGA 1DWDH 3Q3YA 1GBBA 1FJSA 3E90B 1KLTA 3LC5A 1PQ5A 4DW2U 3SJ9A 2WV4A 1VJAU 1CA0C 3BEUA 4CHAB 2HVXA 4INLA 2BM2A 2BD4A 3L6PA 1Z8IB 5FPYA 1DY9A 1H9LB 1SPJA 2BDCA 4AYYB 3SN8A 1ZMLA 2O8LA 1QB6A 2CF9H 2HPQH 2J9NA 2ZDMA 4Y8ZA 3DFLA 1F0RA 2XXLA 4KTUA 2BQ7B 1TOMH 1MTWA 1KLIH 2WYJA 3MWIU 3MU1A 1LPZB 1BJUA 1T31A 1AUJA 3KN2A 3UNQA 1QFKH 4UFEH 1C5MD 4D76A 4DIIH 2P8OC 1Z71A 1ANBA 2C90B 1Y5AT 2VWOA 3MNXA 3ODFA 3T62A 2CF8H 1QBOA 1J8AA 1SQAA 5EXNA 4OS5A 1C4U2 3H7TA 1S5SA 2AIPA 1GJAB 5GPIB 1V2UT 2OC7A 5A8ZA 1ELVA 4I33A 1O5BB 2FS9A 1QJ7B 3ITIA 1DX5M 1BBRK 4IMZA 1H9HE 1JWTA 1O2SA 1TLDA 2J34A 4B74A 3SNDA 1NFYA 1G30B 1ZJKA 1O3BA 2XC4A 1WU1A 3RDZA 4ABDA 1CO7E 1D3TB 1TNLA 5FBEA 3T2NA 2VIDA 3HGPA 2FOGA 4IGDA 3FVFB 3T26A 2PFEA 3C27B 4NA7A 2FI4E 1GBHA 1BHXF 4X2VA 1ELAA 5AF9H 2CHAB 4JZDH 3K9XB 1IQKA 4JZ1A 5T6GA 2P3FH 1JMOH 2BD5A 3T28A 2GP9B 2G4TA 4Y10E 3RM0H 3VXFH 1VGCB 1ZTKA 2W7SA 2R3YA 1ZLRA 2FO9A 5E2OA 3BEIB 1GI2A 3BV9B 3QX5H 1TPPA 4Q80A 3A7YA 1UVOA 4X8SH 2VINA 3B23B 1OYQA 2H5DA 4ZROA 1KDQB 4H6TA 1P2KA 1UK2A 5L6NH 8KME2 3TH4H 1AY6H 4FUIA 4WF8A 1QR3E 5C5OA 1SGRE 1D9IA 1ABJH 1TQ0B 1TA2A 2VIPA 1FN8A 4Z0KA 2ZFPH 3O8RA 4ZAEA 1AB9C 1MUEB 4GPGA 3VPKA 4AFZA 1IOEA 1QL7A 3LU9B 4KKDA 1ZR0A 3SNBA 2ZHFH 3ATMA 1LKBA 1DLEA 1QIXB 4UEHH 1VCPA 2WPIS 3QUMP 1GCTC 6GCHF 1SLUB 4UFDH 3VGCB 4AGKA 1EPTC 2JH6D 4FXGH 1ZHRA 1TNIA 1OWEA 1LPKB 1CHOF 1O2QA 2W7UA 1SQOA 4AFSA 4E06H 2V3HH 3EA9A 3AAVA 2BLOA 2JETC 4KTSA 2H9HA 1S0QA 1IHTH 3LC3A 2A4RA 5LPFA 1J17T 1SLVB 1WOFA 1EJNA 2DUCA 1CQQA 3MI4A 1ELCA 5PTPA 4OS4A 3QTOH 1PYTD 1C2HA 4CR9A 1GG6B 1EB2A 2QAAA 1TIOA 3KQDA 2PTCE 1O5EH 4K1SA 4NIWA 2BVSH 4JYTA 2VVCA 3B8JA 1BBRH 3SU5A 1T8OA 3RLWH 4DOQA 1RGQA 3A8BA 2ZG0H 1D3DB 2QIQA 2RDLA 3PO1C 2QXJA 2FOFA 1J14A 1TRMA 4KP0A 2BXTH 1QHRB 1AKSA 3U69H 4IMQA 2FLRH 1DANH 1GJ8B 3IWMA 2PKAA 1GBDA 4ZUHA 1MBMA 3RMNH 2B8OH 2OQUA 5CMXH 1O3AA 4LZ1H 1YPHE 2F9PA 4ABIA 1PQ7A 1Y3XA 2ODQA 3TGJE 1C4V2 1LKAA 2AS9A 3OX7U 1E36B 2OQ5A 3QTVH 3PMJA 3KCGH 3KQBA 3PMBB 1PFXC 1ZTLA 4X2WA 1H8IH 1K22H 2ZDAH 5IYTA 3RU4E 5HMAA 1SBWA 2BQ6B 3UNSA 4YZUA 2ZFSA 3DUXH 1MKWH 2H6MA 3T25A 3TNTA 2ZFRH 1QRWA 1C5UA 3UNRA 3OY6U 3DD2H 4FVDA 3UUZA 1ABIH 3FP8E 1O2IA 2CV3A 1QA7A 1OWKA 3GCHB 4Y0YE 3SORA 4RN6A 3RMMH 5GIBA 5A0BA 1GMHF 1EP6A 5C3NA 4ZXYH 3A80A 3UQOA 2G55A 1CSOE 4ABHA 3L3TA 3BTTE 1O3JA 4JK6A 4FUDA 1NRQH 1A2CH 3SI4H 3ELAH 1OWDA 2GZ8A 1PYTC 1P11E 3GYLB 3ZVFA 3UR9A 1ETSH 1VITG 2F3CE 3T5FH 1QQ4A 3RXTA 1WBGB 3F9EA 3BTWE 3ATKA 1YKTA 3M61U 1GDQA 3TK5A 2J94A 3A83A 2BX4A 4U30A 1C5RA 5SGAE 3V7TA 2CMYA 3MOCA 1GI0A 2EI6A 1P9SA 1HAVB 2XWBI 3ESTA 2V6NA 3MNSA 1XUKA 1PJPA 1GPZA 1QB1A 2ZU3A 3E1XB 5T6DA 4H42U 1UTOA 2ESTE 2NU0E 3TU7H 1ETRH 1MTNC 1G9IE 1C9TA 1NRNH 1C5NH 1W7GH 2FYQA 1Z1JA 1AE8H 5C2ZA 3SHCH 4JYVH 2GX4A 3D65E 1QJ1B 1THRH 2GV6A 3Q77A 2CN0H 4K1EA 5I46H 1B7XB 4TWYA 1XUJA 2FTLE 2BY8X 1GJBB 1HGTH 3A85A 4RKOB 4GCHF 5DG6A 1Z8RA 2ZGBH 4B1TA 4GLYA 4OGXA 1TOCB 4X1SU 1PPGE 4NFFA 1LHEH 5HM9A 1YPGH 1EAWA 1SOZA 2FOEA 1TALA 3LIWA 1OXGA 2FLBH 1W0YH 5JPMH 1TX8A 4OS2A 4CH8B 2NU1E 4NSVA 1XX9A 2STAE 5E0JA 1O2HA 4JZFH 2WPKS 3VB7A 4AYVB 3A7XA 4JZIA 1O2ZA 3PYHA 1K1OA 1Z8JB 1HIAA 1O2PA 1LQDB 1SFIA 2TGDA 1Z1IA 5F8XA 2O9QA 3OTJE 1P09A 1DOJA 4Z6AH 4MDSA 1TMTH 1O2RA 5EOKA 1CHGA 1XM1A 1W11U 1TB6H 1O33A 3BTFE 3LGTA 1P2MA 1TE0A 3BG8A 1CT0E 1BMAA 2C8XB 2DE8A 3I78A 1CA0B 1Y3VA 4MNWA 3A86A 3SU2A 2FOMB 4R8TB 4FUCA 1O2OA 1IQNA 2Q1JA 1SHHB 4YT6H 2C4FH 1O39A 3UWIA 3P17H 2ZU2A 1V2ST 3A87A 2Z9JA 5ESBA 1ORFA 7KMEH 1CGHA 4ISHH 5C67A 4GUXA 1EUFA 3GYMA 3MO3A 4BAQB 2ZDLA 2P8OB 2ZP0H 1XKBC 1O2LA 4D8NA 2BVXH 3RM2H 4DURA 1K1MA 4BAMB 4H4FA 3FZDA 3MU5A 1DY8A 3R3GB 3GY2A 3B9FH 3SU3A 3S0NA 2VVVA 3I77A 3UTUH 3EA7A 1QRZA 5EW2H 1NO9H 4MG3A 1V3XA 5A0CA 3STJA 2TGPZ 1GMDG 2BLVA 4RKJB 5E0HA 4FUBA 1GVLA 2ZDKA 2P93A 3M3TA 3QDZB 2XRCA 2KAIB 3HKIB 1EJAA 1EOLA 1P02A 1C4Y2 3PWBA 1P2OA 3O8DA 1DPOA 2BD9A 2HGTH 2SNWA 3GCTG 1KXDA 2R9PA 1T8MA 2WPJS 2QN5T 1FI8A 5GWZA 3ATLA 3LH3A 1KYNA 1K1PA 2ILNA 2VIVA 5K7RA 1YP9A 2FI5E 5DO4H 1C1TA 3SV2H 4BNRA 1O3HA 3URCA 3HPTB 4NZQA 1ETTH 1Z7KA 3H5CB 1V2TT 4IBLH 1C1QA 5C1UA 5F6MA 2ZPQA 1F92A 2FX6A 4K5ZA 1A5HA 3MMGA 1EKBB 5JBTA 5T3HA 1MAYA 3GY3A 1QY6A 1GDNA