4FUCA

Crystal structure of the urokinase
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Urokinase
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
total genus 54
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fucA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fucA01
2BD8A 1GMCG 1QB9A 2XC4A 1EPTC 1SGCA 4Y8XA 5DP7A 1EZUC 1OWHA 1PPZA 4TPIZ 3LJOA 1GMHG 3ITIA 1JOUB 1HGTH 2ZHWH 2C8WB 2A7HA 4GVUA 1BOQA 1XXDA 1OPHB 1CSOE 5G4BA 1NFYA 1KIGH 1UTLM 1GHYH 2LNCA 3E16B 4U30A 5L2YH 5DO4H 1VJAU 1AWHB 1PPCE 3PO1B 1GI2A 3D65E 4NGAH 4WY3A 3GY6A 1PFXC 4BAOB 2BOKA 2AGIX 1QB1A 2ODYB 4MNVA 1DLEA 2ANMH 3LGTA 3TGIE 1S6FA 3OY5U 1EOJA 1ELCA 4SGBE 1IQKA 1L4ZA 1VGCB 2F91A 4U2WA 2HPPH 6ESTA 2XCFA 1AN1E 3K9XB 3UOPA 1O2JA 2SNWA 1C1UH 1GDQA 3V0XA 2BY5X 2A2XH 2ZFRH 4U32A 1UTQA 2Q6GA 1A5HA 4X2XA 2ZF0H 3PTBA 1H1BA 4Y10E 1XKBC 1F5LA 3A83A 4AORA 2W5EA 4CHAC 1TGTA 1W14U 2O8UA 2Z3EA 2H9EH 1Z8GA 1GJ6A 4NSYA 3BTDE 3LPRA 4I33A 3VFEA 5HGGA 1QJ7B 4IGDA 5DKMA 1TMUH 1O3JA 4JZEH 2XTTB 1V2TT 1YLDA 1H4WA 1RJXB 1P12E 3TVJB 3DD2H 2GX4A 3A7WA 5FPSA 2FOAA 3CP7A 3P17H 4RSPA 1OWKA 2A5AA 1ETTH 1AE5A 3TNSA 1S0RA 2EA3A 2FMJA 2Y6TA 1W8BH 2ZG0H 4X1PU 2PR3A 4FVDA 1UHBA 3U1JB 2BYAX 2OBOA 4GUXA 1JXPA 2TGTA 3SHAH 1TA2A 3MNSA 4INHA 1DT2A 2VIQA 2W7SA 1W7GH 2F3CE 4D8NA 2QF0A 5E2OA 1CQQA 2G5NA 2IPHA 4I7YH 4X8UH 3AW1A 1LVBA 3DHKH 4HFPB 4ZH8A 3RXUA 2ODPA 2XBYA 2STAE 1DFPA 1UTKA 5ABWA 1P2KA 2BD9A 1RRKA 2VWMA 2KAIA 1TAWA 1HYLA 2VJ1A 1UHBB 2ZTZA 4R8TB 1C1TA 8GCHG 1GVZA 3D23A 1IHSH 1BCUH 2V3OH 1ZGVA 1D3TB 1MZDA 1XM1A 4NSVA 3RXGA 1HAIH 2P16A 3ZZAA 2ESTE 2FI4E 3LDXH 8ESTE 4FU9A 3SJ9A 1TX8A 1E36B 2BD3A 1P3EA 4YLQH 3OU0A 1EZQA 1EATA 4GHQA 1TNGA 3P92A 1NN6A 2D2DA 3VEQB 1O5EH 2ZPRA 2BHGA 2G5VA 2JH6D 4CRFA 1EB1H 1A5GH 3QTVH 3MU8A 2GD4B 2HWLB 1V2OT 2WUCA 2F9NA 4K1TA 4FU8A 1ZRBA 3GCOA 3PLBA 4O03A 2ZCKP 1GBHA 1Z8JB 1AMHA 3LC3A 1VGCC 1TBZH 2QC2A 4X1NU 3UFAA 3BTEE 1A0JA 1Z71A 1BA8B 1WU1A 3B9FH 3ELAH 3LU9B 4NZLA 1TOMH 2H5CA 4AG1A 1A0LA 5C3NA 1THSH 1UTPA 4UFGH 1SGYE 3SU5A 2J38A 3BTWE 1E35B 3T62A 4INLA 1HV7A 1EJNA 1CU1A 1FIZA 1P04A 1V2NT 1BITA 5T3HA 1VITG 2Y7XA 1PPEE 2EI6A 2ZGXH 2IJOB 3H7OA 4WH8A 4Y0ZE 1YPJH 1JBUH 1C1PA 1GBCA 3NK8A 1SG8B 1BB0B 1GI0A 1S83A 2GZ7A 4XBCA 1UCYH 3ZZ7A 3A7ZA 4JYUH 4UD9H 3RXDA 4K69A 1NZQH 3V7TA 2GZ9A 3BTQE 2NU4E 3M35A 1SPJA 4X2VA 3T5FH 2GCTC 1U6QA 2JH0D 1O2RA 4Z6AH 3MNXA 4Q7ZA 1TPOA 3D62A 3F9FA 1GJAB 1EB2A 1E0FD 1CVWH 1ELTA 4AB9A 1D6WA 2Y81A 1O2PA 2D26C 2FX6A 2FZZA 3TH2H 1LHFH 4I8GA 1GJ8B 2HGTH 4R0IA 1TWXB 3SU2A 3SW2B 2Z9IA 4RKOB 3D49H 2VWLA 5FPTA 1PPFE 3JZ2B 4JYVH 3VXEH 4CR5A 3NZIA 1E34B 3QO6A 1SGTA 3DFLA 3RXAA 3T25A 4Q2KA 1FY5A 1LQDB 5GIBA 2P8OB 2K1QA 1V2KT 1CA0B 4AYYB 1ZHMA 3LGWA 1XVMA 2GP9B 5DP8A 3HGPA 4K2YA 5FXLA 1C5RA 2PKAA 2CF8H 1LCYA 4FUBA 2ZDAH 1AI8H 1RTFB 3CENA 4IN2A 1P2IA 4D9RA 2HNTE 1LVYA 2VGCB 2PTNA 2BXTH 1KLJH 1QNJA 1VZQH 4MPWA 2STBE 1P06A 1ZLRA 3VB3A 1WTGH 2PV9B 1AUJA 1YYY1 4AYVB 1RD3B 2VINA 3TH3H 1KLTA 7LPRA 3T28A 3TNTA 3UR6A 1AQ7A 4MQAA 1C2IA 2SGEE 3BEUA 4WF8A 1C5XB 1XUHA 2G00A 3GCTG 1P2JA 3P95A 5C20A 4ISNA 3O8RA 1C1MA 5DPAA 2TGAA 1O2MA 3LGYA 1IQIA 1JIMA 1D3QB 4FUJA 1SQAA 1NPMA 3BG4B 2FLBH 3PMHB 3U9AH 2G81E 3ZZCA 4IC6A 1F5KU 4WVPE 4I8JA 1TGCA 3F9EA 1O5DH 1W7XH 5FAHA 1V2VT 2NU1E 3E0PB 3RP2A 3RMOH 3A8CA 5C1XA 3KHVA 2ZWLH 1LHEH 2XYAA 1GVLA 1Y5BT 1PQ5A 1TNIA 2XC0A 4B75A 1P02A 3CS7A 2OP9A 9LPRA 2J4IA 1V2QT 2BQWB 3A8AA 1C2FA 1MQ5A 1AFQC 3BEFB 5GWZA 2VIWA 3SGAE 2BDAA 4Y79A 3BTGE 2GGVB 3F1SB 2OQ5A 1GBLA 2FEQH 2CV3A 4KTUA 1GBMA 1C9TA 4KGAA 1O33A 4FUGA 5I25A 1C1VH 1ANBA 2WINI 1P2MA 4Z0KA 3RXHA 5GCHF 2UUFB 4YOJA 4XSKU 1GI6A 4A1TA 3HPTB 1O38A 4MNYA 1OWIA 1UVTH 1IQEA 1TBRH 3EGKH 1O3OA 4IMQA 3PM3A 1C5NH 1LTOA 1XKAC 2ZDKA 2VIDA 1J8AA 2O8TA 2PGBB 1DE7H 3SJKA 3A8DA 1MH0A 3PMBB 5AFZH 1QGFA 2BVXH 1O2YA 1Z1IA 4AFZA 1MU6B 1YP9A 4UFFH 4AOQA 1S85A 1TRNA 1YM0A 1VCQA 2D8WA 4SGAE 3GY2A 2XNIA 1Z1JA 5FBIA 3P8GA 2AIPA 2TGPZ 1YKTA 2BQ7B 4X2WA 1XVOA 3VGCC 5K7RA 1NRRH 5EQSA 1GBTA 4AN7A 1MZAA 2R0LA 3PMJA 1MKWK 1D3PB 8GCHF 1KDQB 2R2WU 4DOQA 1P05A 5FPYA 7GCHG 5J4SA 1TQ0B 2XWAA 1BRUP 1MCVA 5DP6A 4MG3A 4CBOA 1KXAA 1QR3E 2Y82A 5EGMA 1FMGA 2BMGB 2GT7A 5FCKA 5A09A 2ZFPH 2AYWA 1ZMNA 1GBFA 1LVMA 4ZKSU 1TLDA 1DITH 2FTLE 3DA9B 3A7TA 4YOIA 4NIVA 2W3IA 3TU7H 4BAMB 3A81A 3MH5A 3IG6B 2C8XB 2RG3A 2ZPQA 4FUHA 1CGJE 2C90B 3SU3A 5TCCA 4X8VH 1GBJA 1CT2E 1FQ3A 1VCPA 2VVVA 2C8ZB 1GBDA 2GDDA 2I6SA 4XBBA 4B73A 1BT7A 1GJ7B 1FLEE 4FUIA 1V6DA 3SNAA 2ULLA 1GI4A 1O3AA 2P94A 1IQHA 2OC0A 3QTOH 1O2XA 3RDZA 4OS4A 2ZQ1A 2ANYA 2BDGA 4H6SB 3LONA 4Y71A 1BJVA 2RA0A 4J2YB 1PPBH 4K3JA 3GY8A 5A8ZA 1GI7B 1M9UA 5BPEA 1C2GA 4DURA 2BY7X 5E0JA 1FY8E 2ZFQH 4AZ2B 2AH4X 1DWBH 1VJ9U 4CRAA 2A31A 1O2LA 3L33A 2J34A 1LKBA 3SV7A 1ZPBA 4OGYA 4VGCB 2OINA 3E3TA 1TRYA 4TWWA 2OC1A 3Q00A 4ZKOU 5F8XA 3ZZ4A 1J9CH 1C2DA 1FPCH 4WWYA 4LK4A 1QBVH 5EOKA 2Z9LA 3TK5A 1GJ9B 3L6PA 4D9QA 2QAAA 1DUEA 3RUOA 4GPGA 2LPRA 1TPPA 3GYMA 1UCYK 1UK2A 3FFGA 2BDHA 5DGJA 5FX6A 1BMNH 1TNKA 1K28D 4CBNA 4WMDA 4FUCA 1QL9A 1Z6JH 1THRH 5EPYA 2BLVA 1DM4B 1EP5A 2GZ8A 6GCHG 1EASA 3M7UA 1NT1A 1YPMH 1CHOG 1ELFA 3SV9A 1K1IA 1AWFH 4GLYA 3BV9B 1BRBE 2DE8A 1L1JA 2Y5GA 2HPQH 5CMXH 1W10U 1DANH 3PMAB 3ZVCA 1G36A 1LPGB 3VB5A 1H8IH 2BD5A 2ZO3H 2CMYA 1NO9H 2FWWA 1Z7KA 1L2EA 1C5QA 1MTSA 4KELA 4RKJB 1KSNA 1FNIA 4HGCA 2TRMA 1AVGH 1DY9A 2A7JA 3BIUH 5ETXA 1HXEH 2Z9GA 2J92A 3SNEA 4BAHB 1MU8B 3BG4C 1YPGH 1W0YH 1O2KA 2ILNA 2FYQA 1G2MA 5LH8A 3GY3A 1XMNB 1V2MT 2BY9X 1EJMA 2WPMS 4ISLA 2GT8A 4AGJA 1B0FA 1SHHB 1O5BB 1YCPH 2FOGA 1ORFA 1AIXH 3TPIZ 3F6UH 2Y5HA 1CGHA 3ZZDA 2ZIQH 3SJ8A 2UWOA 1GMCF 3UUZA 3RMLH 1SLXB 3STJA 2ZZUH 3IWMA 1RIWB 1CO7E 1DSTA 1O39A 3HK6B 1T4VH 5EODA 2OBQA 1GJCB 1SBWA 3PO1C 2GV6A 1F0RA 1HAGE 1V2UT 1Y59T 4I8KA 4NWKA 1TFXA 1OSSA 2FDAA 2SGDE 3LGIA 2TIOA 4MPXA 1ESAA 1S84A 4GSOA 4X1SU 2FO9A 4IN1A 3SHCH 2BOHB 2YNAA 3T2NA 1JMOH 1PQ8A 1EX3A 4DY7B 3SZNA 1ID5H 1O3IA 1O5CB 3E91A 4MNWA 2ZFFH 3TGJE 1EPTB 4DJZB 1OKXA 2VNTA 4X6OA 1QRWA 1O2SA 5H4IB 2PSYA 4UONA 1BBRE 1C2EA 3P70B 2A5IA 4TY7A 5PTPA 1UO6A 3LOXA 3UWJH 3S9CA 1TALA 1UK4A 1VCWA 3IITA 1GHBG 4YM9A 3GCTF 4K1EA 4DT7B 2FOMB 3UY9A 3A7YA 6CHAB 1HB0B 4DIIH 2BTCE 2A4GA 5FCRA 5JBTA 3SJOA 1KTTB 3S7KB 1WSSH 2Z9KA 1NRNH 1GL0E 1J14A 1O2ZA 1S0QA 3QGNB 5AHGH 3O8CA 1P8VC 3SV6A 1K1JA 2R3UA 1C5PA 2FS9A 3ZVAA 6CHAC 1HJAC 4OS6A 4CRCA 2P3TB 1QCPA 1A3BH 1GWAA 4ABAA 1O5GH 1P09A 1TGNA 3LKWA 1MQ6A 2QCYA 1DWEH 2HNTF 2VWOA 3N7OA 1ETSH 2OQUA 1QB6A 1TYNA 2ZFSA 2QXJA 5C5OA 1GG6B 1UVSH 1Y5AT 4AG2A 2J2UA 3I78A 4H4FA 3RXPA 5DP4A 1EZXC 4B2BA 4F49A 1P2NA 1GHVH 1NROH 2ZGCA 4A92A 2BLWA 5JB9S 4NG9H 3ZZ5A 4DG4A 1K22H 1O3FA 1W13U 1ZMLA 1HAVA 3SU1A 1RS0A 4X6NA 1T8OA 1LMWB 1FXYA 1K21H 3JZ1B 1DWCH 2WPJS 2FOEA 1TQ7B 1FUJA 8KME2 3E0NB 1A1RA 1BMMH 5L6NH 1Q31A 3MNBA 5HXFA 3GDSA 4JK6A 1OWJA 1TNJA 1GHAF 5JBCS 1FN6A 3SNDA 1AY6H 1WQSA 5EW1H 3RXCA 1GI8B 2A4OA 3K2UA 4LZ1H 2XBWA 4FXGH 3UOUA 2IOTA 3TK6A 1IQGA 1AKSB 2BZ6H 3I77A 1FONA 3GY5A 2B5TB 4K5ZA 1QURH 1E38B 1UVPA 3RXLA 4LOYH 1F92A 1MTVA 1O3MA 4E05H 1EKBB 2FOCA 2C3SA 3ATMA 5C1UA 1JWTA 1Y3XA 3W95A 1KLIH 1P3CA 1SOTA 2XCNA 3SNCA 3MFJA 3TLOA 4ZMAH 1S6HA 3BTHE 1AU8A 3ZYEA 2ANWA 1S5SA 2FM2A 1C4U2 2QY0B 1SSXA 2ALPA 1MTNB 2O8LA 2UWPA 1ANDA 1F0UA 2ZA5A 1O5FH 1O2TA 3VXFH 3LT3A 4F4OC 1SVPA 2KAIB 4O97A 1MKXK 2G52A 2HNTC 4JCNA 4OGXA 3ZV8A 4K1SA 3SUFA 4WXVA 3A80A 2QA9E 3S7HB 3SU4A 1GI9B 3M5OA 2XWBI 1BBRH 1RTLA 2PUXB 1GBBA 3KEEA 1F0SA 1GDNA 5SGAE 3B8JA 2BDCA 5FX5A 1NRSH 3A85A 1C4V2 1EZSC 1ETRH 1ARBA 2FP7B 4VGCC 2VH0A 1ELAA 3K65B 1ZMJA 2GMTC 3RXEA 1GMDF 4UFEH 1IQNA 1OYQA 3MHWU 1Z6EA 2O8MA 1CT0E 1ELBA 4U01A 1AHTH 4A7IB 1HDTH 2DUCA 2WUBA 4K8YA 1DICA 4MNXA 3UR9A 1TA6A 1C5MD 5EW2H 1C5TA 2BQ6B 1BJUA 3MO3A 4CREA 2PLXA 2W3KA 3AAVA 1MKWH 1EAUA 5HM2A 3FAOA 1GGDC 2F9PA 4AFQA 1CBWC 2D1JA 1GCDA 2ASUB 2FYRA 2CJIA 2PSXA 1ZRKA 2CN0H 3P8NA 3UNRA 5BRRE 1F5RA 2H5DA 5L2ZH 3V13A 1HLTH 2XRCA 1O3NA 2QIQA 2A0QB 4CH8B 1V2RT 3SO3A 4GCHG 3TJUA 1QY6A 1P10A 2CXVA 4ABBA 2BLQA 2ZHFH 4M7GA 3EA9A 5T6FA 1THPB 5K0HA 1GHXH 1RTKA 3UNSA 1T8NA 1GBEA 4UEHH 3FZDA 1P0SH 3ZZ3A 2AGEX 4RN6A 2F9BH 3MNCA 1P57B 3V3MA 1A7SA 1TOCB 2XC5A 4TYDA 3AASA 4IC5A 2QF3A 3R3GB 4NZQA 3ATIA 3SQEE 4TY6A 3QZRA 3ZV9A 3T26A 1K1LA 1SGRE 1C1WH 4CRGA 1MAYA 1O37A 4ZKRU 2BXUH 1YPKH 3BTTE 5DJ7A 2WPIS 3PV4A 8LPRA 1G3BA 1ZSJA 1G30B 1ZTLA 3RXIA 1FDPA 1SMFE 5DG6A 1JRSA 3RXOA 3KQEA 1WUNH 2AFQB 3Q3YA 5FBEA 1K1NA 1GL1A 5CHAC 1QL8A 2NU3E 4BTIB 1LHCH 2H9HA 1RXPA 1EJAA 1IQMA 1BHXF 1BHXB 1GMHF 4IMZA 1RIWC 1L1NA 2RCEA 2A7CA 1CBWB 5JPMH 3Q3KA 4CR9A 2J95A 3MMGA 1SGDE 3DFJA 2G4TA 4X2YA 3O8DA 3NWUA 3CS0A 2DE9A 1TX6A 2VIPA 1DSUA 4H6TA 1WOFA 4A1XA 3EDXB 2PKAB 3SUGA 1GHAG 1QQUA 1GHWH 2QV1A 1PYTD 1G3CA 2BD7A 1OOKB 2QGRA 5LPRA 3UTUH 2ZI2H 3RXVA 1AUTC 1L4DA 4NA7A 1BRCE 1B0EA 5HM9A 1C5YB 1FN8A 1YCPK 1ZTKA 1QJ6B 2GMTB 1EXFA 4DVAU 5E0HA 1Z8IB 1C5SA 1TGBA 1K2I1 1T4UH 1BTZA 4BXSA 1Y3UA 2FESH 4J1YA 2HRVA 3ESTA 2A32A 1ZYOA 4B2CA 3SNBA 5I46H 3ATLA 1FJSA 4WH6A 2OXSA 3AAUA 2ZHDA 1EOLA 1S82A 2ZPSA 3RMNH 3SOSA 4I32A 4JYTA 2BM2A 2THFB 2ZGJA 1QL7A 1NFXA 2XBVA 3A88A 2ZU1A 3S9AA 2NU0E 2OTVA 2OC7A 2PUQH 1V2PT 1BTWA 1NC6A 3TJOA 1MAXA 4HI3A 1EAIA 2PHBA 1TNHA 2SGFE 4DCDA 5JBAS 5C5NA 2FXRA 3SQHE 1K1PA 3AVZA 1ELEE 1TMBH 1DLKB 1P9UA 4WMFA 5LPFA 1ZPZA 2BVSH 2QXGA 3QGJA 1YF4A 2FIRH 4KTSA 4BAQB 4NA9H 3ZVBA 3W94A 3QUMP 1FI8A 5AVDA 3A82A 3Q3XA 5HYOA 3GDVA 4YT6H 7ESTE 3DUXH 4FUFA 1T7CA 4MDSA 3EYDA 5FHTA 4D7FA 2AERH 4E06H 1BZXE 3A89A 2A1DB 3PB1E 1O3DA 2UUJB 4ZKNU 1SGQE 1P2OA 4AFSA 4BTUB 4BNRA 1BMLA 1DXPA 4IW4E 1NFUA 4BXWA 2P59A 3BN9A 5T6GA 4GHTA 2R2MB 1XUJA 2GCTB 2Z9JA 2BZAA 4CRDA 1O2HA 1ZSKA 3HK3B 2A4QA 3ZYDA 3U8TH 1HJ8A 2YNBA 1GBIA 3ZVDA 4YO9A 3F68H 3KCGH 1BIOA 2UWLA 1OP8A 2OCVB 4MTBA 4WMEA 4UFDH 3M7QA 4XE4A 2P3UB 3RXTA 3GICB 3MU1A 3O8BA 4JZDH 2PTCE 4O9VA 4ABFA 3SI4H 5GJ4B 2JKHA 3KIDU 1J16A 2ZDVH 3KL6A 3GCHC 1EP6A 2BX4A 2ZDMA 1YCPM 1HAYB 1H9LB 2EI7A 1O3CA 1D4PB 1GG6C 3MU0A 3UQVA 2P95A 1ZPCA 2IN2A 3VGCB 3ATKA 1W3CA 1ZGIA 1ZTJA 5HMAA 2WV5A 1TB6H 1BRAA 1GJDB 1DOJA 1KTSB 1O32A 2GVFA 3FP8E 1SOZA 1O3EA 3SN8A 1LKAA 2ZEBA 3A84A 4OS5A 3U8OH 1DVAH 1C5UA 1Y5UT 3TGKE 1H8DH 1BMAA 1A3EH 1PPGE 1Y3YA 2CHAC 3GYLB 3A8BA 1W2KH 1EQ9A 2ZQ2A 4GCHF 3FP7E 2QN5T 1C9PA 3T29A 2A4RA 2FI5E 2R3YA 2BDBA 3Q77A 1W11U 2WV4A 3RLYH 3SUEA 1Y3VA 1F7ZA 4ISIH 1NY22 1ZHPA 1FY1A 1KXBA 1OX1A 1Q2WA 1LO6A 5A0CA 1ESTA 2ZU3A 4BOHA 1GI3A 3RM0H 1OYTH 3C1KA 2BY6X 5AF9H 3BF6H 1TPAE 1GGDB 1ZJDA 2Q6DA 1O2QA 1C5WB 1AKSA 1AB9B 4LXBH 2VVUA 1BQYA 1XUGA 3SUDA 3FVFB 2SFAA 3SBKA 1MD7A 1O2IA 1UTJA 2AMPA 2B8OH 4Y6DA 4KTCA 1H9IE 5DP9A 1BTXA 1K9OE 1TABE 1TE0A 1N8OB 2HLCA 5TCAA 1BTPA 4AB8A 1NU7B 1SLWB 1LHDH 1TRMA 4ISHH 1JRTA 4WJG2 3NCLA 2ZFTA 1A0HB 3U8RH 4OS2A 1DY8A 4NIWA 3U98H 1AVWA 1O2OA 3OYPA 4MPUA 1IAUA 2M5TA 3K6YA 1HAXB 5C1YA 1ANEA 2Y80A 3S9BA 2ZHEH 1QFKH 2VWNA 2NWNA 4GAWA 1ELVA 2BLOA 3A86A 2C93B 4O3UA 1XX9A 2OLGA 4HTCH 1FAKH 2C4FH 2OC8A 2W26A 4QT8C 1SI5H 1YLCA 3A7XA 2G8TA 3F9GA 1NM6A 2ZU2A 5B6OA 2F9OA 3NXPA 2Q6FA 2PFEA 3QN7A 3EQ0H 3E8LA 4PROA 1UMAH 1J15A 2ZDNA 1HUTH 1TPSA 1P9SA 3RXFA 2UUYA 2V6NA 2Z7FE 1CT4E 1GDUA 4UE7H 4X0WU 3U69H 4JZIA 2Y5FA 2O9QA 2BDYA 1SGFG 4BAKB 3LH1A 3QK1A 5A0AE 4AGKA 1C1NA 2XXLA 1OWEA 2G4UA 1XUIA 3VB7A 1FAXA 1YPEH 2B0FA 2F83A 2H9TH 2A45B 1EUFA 3RC6A 3V12A 1AZ8A 1TIOA 1GCTC 2CGAA 3M3VA 4D76A 4E7RG 2HOBA 4I8LA 2VIOA 5CHAB 3ZZ9A 3P6ZB 3SU0A 2Y7ZA 2H2ZA 5A2MH 4FU7A 1ELGA 4BANB 2WPLS 2R0KA 4A6LA 3M3TA 1YPHE 3GCNA 2BD2A 2H6MA 4NFFA 5T6DA 4A1VA 4NCYA 1O2GH 2BY8X 3QWCH 4MLFB 2TBSA 1NTPA 7KMEH 1PQAA 3M5MA 5TJXA 1C2JA 1T8LA 3BTFE 3KF2A 3QX5H 3FP6E 1O2VA 5GCHG 1ABIH 3VB4A 3ODDA 4DIHH 1W12U 3P8OA 1GHZA 1DPOA 1GBAA 4ABJA 1AD8H 4JZFH 2ZGBH 4I31A 1ESBA 4Y7BA 5EU8A 1O2NA 2B9LA 1YGCH 4X8SH 3ZZBA 2XBXA 4TPYA 1QRZA 4LZ4B 3EE0B 2OD3B 5A8XA 1HAZB 3TIUA 1WAYB 4INKA 5JYIA 4YTAA 5JDUB 4ABEA 1FY3A 1P03A 4IBLH 3FZZA 1EAXA 4NIYA 3NKKA 4FUDA 1JIRA 3LH3A 1BUIA 3RC4A 4B74A 1O3LA 2Z6BD 2V35A 1X7AC 1BTYA 1XXFA 1DXWA 1B5GH 4HZHA 1SGNE 3DT0H 2FTMA 1VITF 2AIQA 4ZXXH 1C2HA 3AW0A 4MVNA 3WY8A 1WBGB 2BB4A 1O36A 2G51A 1SB1H 1HAPH 1E37B 1HCGA 3RXJA 1QBNA 2OUAA 1GJBB 4Y76A 3F9HA 3PROA 1O3HA 1ABJH 3UWIA 3ZVEA 1GHBF 2ZCLP 5ESTE 1ZHRA 3L3TA 2EI8A 3M5LA 4X1QU 3GY4A 1HAVB 2GKVE 1MTUA 1HBTH 1BTUA 5GPIB 4ZAEA 3SJIA 3PTNA 3UQOA 4X6PA 1N1LA 1AVXA 2FOBA 1WCZA 1VITH 2Q1JA 3Q76A 3UREA 1PJPA 4NA8A 1F2SE 1G2LA 1G3EA 1CA8B 1DDJA 5EPNA 4KP0A 1HFDA 1O5AB 1OS8A 3H7TA 1FY4A 2ALVA 3KNXA 1SGPE 2F9UA 1N6XA 2Z3CA 4K60A 1AO5A 1PYTC 7GCHF 3EA7A 1QTFA 2ZECA 1DWDH 3NPSA 1KDQA 4Q7YA 4ZROA 1FV9A 3SGBE 1O31A 4XFQA 1O3KA 3LJJA 3RXSA 4X8TH 4A5TS 1O34A 1HJ9A 1O3BA 2ZCHP 3SV2H 1WYKA 2ZDLA 1B7XB 1C2LA 4B2AA 1WV7H 1AFQB 5E2PA 5CE1A 5LPEA 4Q80A 1SGEE 4E7NA 1ZJKA 2PKSC 1C5VA 5GDSH 1ACBE 1L1GA 3RU4D 3M36A 1W0ZU 3LGVA 1GBKA 1MBMA 2A2QH 1OP2A 2JH5D 2RA3A 3GDUA 1UTMA 4O3TA 1O35A 5JBBS 4WXIA 4XDEA 1GI5A 3ODFA 1C1OA 5C2ZA 1VR1H 4CRBA 3UPEA 4BTTB 4K8BA 1NFWA 3QLPH 1G9IE 3H5CB 5L30H 1QHRB 2FX4A 5DP5A 5E0GA 1V2ST 5E8EH 1P2QA 5EQQA 5DP3A 1C5OH 1LQEA 4XOJA 2WPKS 3VPKA 1V3XA 3RU4T 1SGIB 2RDLA 2NU2E 4B76A 3OX7U 2PKSB 1HPGA 4NFEA 6GCHF 1NESE 3GISB 3PLKA 1YBWA 2CF9H 1C1SA 1K1MA 1UTNA 5F03A 4YESB 1O30A 1HAHH 3EAJA 3BSQA 4ABDA 3ZVGA 1AFEH 4Q7XA 4H42U 1HIAB 1N8OC 1KXFA 1XUKA 4D7GA 4DGJA 4ZUHA 2A5KA 1T8MA 5EXMA 3S69A 1GPZA 1OXGA 2F9VA 5IYTA 4AX9H 3LC5A 1SFIA 4NIXA 1C5ZB 3RXQA 2HVXA 1PPHE 3GY7A 4ZHLU 3URDA 1TGSZ 5LGOA 3TJVA 1P11E 4X1RU 1BTHH 1AB9C 1CA0C 2SGPE 1LDTT 2P8OC 3E6PH 3TJNA 2J94A 3MO9A 2VU8E 1H9HE 1O3GA 2ZC9H 1A46H 3U1IB 1F0TA 1G32B 3RMMH 2VVCA 4DW2U 4Y8ZA 1D3DB 3S0NA 1NRPH 3TK9A 3EA8A 1L0ZA 5A0BA 3A7VA 3FANA 5ESBA 1CHOF 1TMTH 2BX3A 1GI1A 1MD8A 2J9NA 4OS7A 1SGFA 3PYHA 4X6MA 1SC8U 2EC9H 4FVBA 2AS9A 2CHAB 1Z8RA 3RXRA 1GJ5H 1LHGH 4IS5A 5EG4A 4Y7AA 3PWCA 1MUEB 4YT7H 1D6RA 1ARCA 1SFQB 1DS2E 1O3PB 1GMDG 5C67A 4ZHMU 3ATWA 1FIWA 3BIVH 1CE5A 3RXMA 4I8HA 3RXKA 1Q3XA 1EAWA 1NU9A 3UNQA 3QDZB 1O2WA 2AGGX 1INCA 2B7DH 4ISOA 1AE8H 1P01A 3GCHB 2JETC 2BDIA 1A5IA 9ESTA 3MWIU 1V2LT 4XBDA 2FLRH 1YC0A 2SGQE 4NWLA 3R0FA 1ZSLA 2TPIZ 1V2WT 4ZHAA 3LGUA 2H1UA 1C1RA 1O2UA 1T31A 5A8YA 4B1TA 2ZNKH 1QIXB 2Z3DA 1RFNA 1NS3A 2VB0A 3QZQA 3MOCA 3URCA 5EXLA 3RM2H 4FUEA 1S81A 2PWXA 3SORA 3SI3H 5F8TA 1KYNA 1KXEA 5F8ZA 1AZZA 1QRXA 2SNVA 4Y11E 4JK5A 3STIA 3BEIB 3KQDA 3MTYA 1KXDA 4YLUA 3VB6A 1PQ7A 1QQ4A 3T27A 2C8YB 5IDKA 5F6MA 3PLPA 1A61H 1GVKB 1SLVB 1CGIE 3HKIB 2HALA 5AFYH 1FPHH 1GCTB 3B23B 4THNH 2GV7A 4YOGA 5GXPA 3OSYA 1IQLA 1YPLH 4UDWH 1MTNC 2ZGHA 1C2MA 2ZU5A 2I6QA 1UCYE 2ZTXA 1C1QA 1TX7A 1SR5C 2O8WA 2ZHQH 3OTJE 1IQFA 1C2KA 4ASHA 2AEIH 3UIRA 1T32A 2YOLA 2BD4A 2ZP0H 2FI3E 4ABIA 2XW9A 2ZU4A 3RLWH 2ZTYA 3C27B 2PW8H 3MU4A 4ABGA 3BG8A 1KXCA 4TWYA 3E90B 1UTOA 2BVRH 2WYJA 1HXFH 1ZOMA 3ZZ6A 3SU6A 3MH7A 1UVOA 1C5LH 3KGPA 3GOVB 3M7TA 4CH2B 2TGDA 1ELDE 1UK3A 1OWDA 3KQCA 3SGQE 2GDEH 5JB8S 1C4Y2 2R9PA 3K6ZA 2FS8A 3TH4H 4Y8YA 1RGQA 3MYWA 1SL3A 1TBQH 3MI4A 3BTKE 1G3DA 1FZZA 1TNLA 4MPVA 2GCHG 4JZ1A 3TITA 1UVUH 1ZR0A 3ENSB 1TONA 1IHTH 1MMJN 3MU5A 2QXIA 3MH6A 3NUMA 2SGAA 6LPRA 2FOFA 1N6YA 4Y0YE 2VH6A 3RXBA 2Z94A 1HAOH 2FODA 1MTWA 2VGCC 1MKXH 3P8FA 1SQOA 3M37A 3ZVFA 4ABHA 4CHAB 2WPHS 1BBRK 1KY9A 3I29A 1LPZB 3BTME 5EXNA 1K1OA 2WYGA 3ZZ8A 1Y8TA 1NRQH 2V3HH 4OS1A 3G01A 4KKDA 2JETB 1ZZZA 2W7UA 3MH4A 5DK1A 1HIAA 1O0DH 1QA7A 2QXHA 3KN2A 3LIWA 2PGQB 3M3SA 2AMQA 1SHYA 1GJ4H 1A4WH 1Y3WA 1WQVH 4ZXYH 2GTBA 2ODQA 1QJ1B 3HATH 2ANKH 3HKJB 1CHGA 4YZUA 3A87A 1EPTA 1QBOA 2FPZA 4B71A 1HJAB 5J4QA 1SQTA 1J17T 3RU4E 1QA0A 2P93A 1HNEE 5EQRA 2UUKB 2VIVA 3MO6A 1UJ1A 1DX5M 1OP0A 2AMDA 1V2JT 2V0BA 2ZKSA 3HGNA 1MBQA 3SV8A 3KQBA 1SLUB 1AGJA 1D9IA 1A2CH 1HRTH 1MCTA 2FOHA 3OY6U 1BDAA 1IQJA 2QYIA 1G37A 3M5NA 1IOEA 1ANCA 1LPKB 2G55A 3E1XB 4ESTE 3RC5A 1DUAA 2EEKA 1XUFA 2GCHF 3PWBA 1YPHC 2P3FH 1WTHD 1LVOA 4AFUA 4JMYA 3M61U
chains in the Genus database with same CATH superfamily
2BD8A 1GMCG 1QB9A 2YMSB 2XC4A 1EPTC 3F3BA 1SGCA 4Y8XA 5DP7A 1EZUC 1OWHA 1PPZA 4TPIZ 3LJOA 1GMHG 3ITIA 1JOUB 1HGTH 2ZHWH 2C8WB 2A7HA 4GVUA 1BOQA 1XXDA 1OPHB 1CSOE 5G4BA 1NFYA 1KIGH 1UTLM 1GHYH 5C0UA 2LNCA 3E16B 4U30A 5L2YH 5DO4H 1VJAU 1AWHB 1PPCE 3PO1B 1GI2A 3D65E 4NGAH 4WY3A 3GY6A 1PFXC 4BAOB 2BOKA 2AGIX 1QB1A 2ODYB 4MNVA 2JJ2D 1DLEA 2ANMH 3LGTA 3TGIE 1S6FA 3OY5U 1EOJA 1ELCA 4SGBE 1IQKA 1L4ZA 1VGCB 2F91A 4U2WA 2HPPH 6ESTA 2XCFA 1AN1E 3K9XB 3UOPA 1O2JA 2SNWA 1C1UH 1GDQA 3V0XA 2BY5X 2A2XH 2ZFRH 4U32A 1UTQA 2Q6GA 1A5HA 4X2XA 2ZF0H 2PP6A 3PTBA 1H1BA 4Y10E 1XKBC 1F5LA 3A83A 4AORA 2W5EA 4CHAC 1TGTA 1W14U 3N99A 2O8UA 2Z3EA 4ASUD 2H9EH 1Z8GA 1GJ6A 4NSYA 3BTDE 3LPRA 4I33A 3VFEA 5HGGA 1QJ7B 4IGDA 5DKMA 1TMUH 1O3JA 4JZEH 2XTTB 1V2TT 1YLDA 1H4WA 1RJXB 1P12E 3TVJB 3DD2H 2GX4A 3A7WA 5FPSA 2FOAA 3CP7A 3P17H 4RSPA 2RFKC 1OWKA 2A5AA 1ETTH 1AE5A 3TNSA 1S0RA 3MQKC 2EA3A 2FMJA 2Y6TA 1W8BH 2ZG0H 4X1PU 2PR3A 4FVDA 1UHBA 4RT1A 3U1JB 2BYAX 2OBOA 4GUXA 1JXPA 2TGTA 3SHAH 1TA2A 3MNSA 4INHA 1DT2A 2VIQA 2W7SA 4YXWD 1W7GH 2F3CE 4D8NA 2QF0A 5E2OA 1CQQA 2G5NA 2IPHA 4I7YH 2WV9A 4X8UH 3AW1A 1LVBA 3DHKH 4HFPB 4ZH8A 3RXUA 2ODPA 2XBYA 2STAE 1DFPA 1UTKA 5ABWA 1P2KA 2BD9A 1MABB 1RRKA 2VWMA 2KAIA 1TAWA 1HYLA 2VJ1A 1UHBB 2ZTZA 3GS9A 4R8TB 1C1TA 8GCHG 1GVZA 3D23A 1IHSH 1BCUH 2V3OH 1ZGVA 1D3TB 1MZDA 1XM1A 4NSVA 3RXGA 1HAIH 2P16A 3ZZAA 2ESTE 2FI4E 3LDXH 8ESTE 4FU9A 3SJ9A 1TX8A 1E36B 2BD3A 1P3EA 4YLQH 3OU0A 1EZQA 1EATA 4GHQA 1TNGA 3P92A 1NN6A 2D2DA 2VBCA 3VEQB 1O5EH 2ZPRA 2BHGA 2G5VA 2JH6D 4CRFA 1EB1H 1A5GH 3QTVH 4HG6A 3F2GA 3MU8A 2GD4B 2HWLB 1V2OT 2WUCA 2F9NA 4K1TA 4FU8A 1ZRBA 3GCOA 3PLBA 4O03A 2ZCKP 2CK3D 1GBHA 2EQNA 1Z8JB 1AMHA 3LC3A 1VGCC 1TBZH 2QC2A 4X1NU 3UFAA 3BTEE 1A0JA 1Z71A 1BA8B 1WU1A 3B9FH 3ELAH 3LU9B 3OFND 4NZLA 1TOMH 2H5CA 4AG1A 1A0LA 5C3NA 1THSH 1UTPA 4UFGH 1SGYE 3SU5A 2J38A 3BTWE 1E35B 3T62A 2J98A 3OAAD 1W0KD 4INLA 1HV7A 1EJNA 1CU1A 1FIZA 1P04A 1V2NT 1BITA 5T3HA 1VITG 2Y7XA 1PPEE 2EI6A 2ZGXH 2OK5A 2IJOB 3H7OA 4WH8A 4Y0ZE 1YPJH 1JBUH 1C1PA 1GBCA 3NK8A 1SG8B 1BB0B 1GI0A 1S83A 2GZ7A 4XBCA 1UCYH 3ZZ7A 3A7ZA 4JYUH 4UD9H 3RXDA 4K69A 1NZQH 3V7TA 2GZ9A 3BTQE 2NU4E 3M35A 4M9FA 1SPJA 4X2VA 3T5FH 2GCTC 1U6QA 2JH0D 1O2RA 3KYGA 3MNXA 4Z6AH 4Q7ZA 1TPOA 3D62A 3F9FA 1GJAB 1EB2A 1E0FD 1CVWH 2WHXA 1ELTA 4AB9A 1D6WA 2Y81A 1O2PA 2D26C 2FX6A 2FZZA 3TH2H 1LHFH 4I8GA 1GJ8B 2HGTH 4R0IA 1TWXB 3SU2A 3SW2B 2Z9IA 4RKOB 3D49H 2VWLA 5FPTA 1PPFE 3JZ2B 4JYVH 3VXEH 4CR5A 2M2AA 3NZIA 1E34B 3QO6A 1SGTA 3DFLA 3RXAA 3T25A 4Q2KA 1FY5A 1LQDB 5GIBA 2P8OB 2K1QA 1V2KT 1CA0B 4AYYB 1ZHMA 3LGWA 1XVMA 2GP9B 5DP8A 3HGPA 4K2YA 5FXLA 1C5RA 2PKAA 2CF8H 1LCYA 4FUBA 2ZDAH 1AI8H 1RTFB 3CENA 4IN2A 1P2IA 4D9RA 2HNTE 1LVYA 2VGCB 2PTNA 2BXTH 1KLJH 1QNJA 1VZQH 4MPWA 2STBE 1P06A 1ZLRA 3VB3A 1WTGH 2PV9B 2V3MA 1AUJA 1YYY1 4AYVB 1RD3B 2VINA 3TH3H 1KLTA 7LPRA 3T28A 3TNTA 3UR6A 2IJD1 5FL7D 1AQ7A 4MQAA 1C2IA 2SGEE 3BEUA 2HLDD 4WF8A 1C5XB 1XUHA 2G00A 3GCTG 1P2JA 3P95A 5C20A 4ISNA 3O8RA 1C1MA 5DPAA 2TGAA 1O2MA 3LGYA 1IQIA 1JIMA 1D3QB 4FUJA 1SQAA 1NPMA 3BG4B 2FLBH 3PMHB 3U9AH 2G81E 3ZZCA 4IC6A 1F5KU 4WVPE 4I8JA 1TGCA 2WSSD 3F9EA 1O5DH 1W7XH 5FAHA 1V2VT 2NU1E 3E0PB 3RP2A 3RMOH 3A8CA 5EJZA 5C1XA 3KHVA 2ZWLH 1LHEH 2XYAA 1GVLA 1Y5BT 1PQ5A 1TNIA 1YWUA 2XC0A 4B75A 1P02A 3CS7A 2OP9A 9LPRA 5C0TA 2J4IA 1V2QT 2BQWB 3A8AA 1C2FA 1MQ5A 1AFQC 3BEFB 5GWZA 2VIWA 3SGAE 2BDAA 4Y79A 3BTGE 2GGVB 3F1SB 2OQ5A 1GBLA 2FEQH 2CV3A 4KTUA 1GBMA 1C9TA 4KGAA 1O33A 4FUGA 5I25A 1C1VH 1ANBA 2WINI 1P2MA 4Z0KA 3RXHA 5GCHF 4ACBA 2UUFB 4YOJA 4XSKU 1GI6A 4A1TA 3HPTB 1O38A 4MNYA 1OWIA 1UVTH 1IQEA 1TBRH 3EGKH 1O3OA 4IMQA 3PM3A 1C5NH 1LTOA 1XKAC 2ZDKA 2O8TA 1J8AA 2PGBB 2VIDA 1DE7H 1NBMD 3SJKA 3A8DA 1MH0A 3PMBB 5AFZH 1QGFA 2BVXH 1O2YA 2L74A 1Z1IA 4AFZA 1MU6B 1YP9A 4UFFH 4AOQA 1S85A 1TRNA 1YM0A 1VCQA 2D8WA 4SGAE 3GY2A 2XNIA 1Z1JA 5FBIA 3P8GA 2AIPA 2TGPZ 1YKTA 2BQ7B 4X2WA 1XVOA 3VGCC 5K7RA 1NRRH 3F0OA 5EQSA 1GBTA 4AN7A 1MZAA 2R0LA 3PMJA 3WW7A 1MKWK 1D3PB 8GCHF 1KDQB 2R2WU 4DOQA 1P05A 5FPYA 7GCHG 5J4SA 3H09A 1TQ0B 2XWAA 1BRUP 1MCVA 5EJLA 5DP6A 4MG3A 4CBOA 1KXAA 1QR3E 2Y82A 2KX4A 5EGMA 1FMGA 2BMGB 2GT7A 5FCKA 5A09A 2ZFPH 2AYWA 1ZMNA 2XOKD 1GBFA 1LVMA 4ZKSU 1TLDA 1DITH 3W1EA 2FTLE 3DA9B 3A7TA 4YOIA 4NIVA 2W3IA 3TU7H 4BAMB 3A81A 3MH5A 3IG6B 2C8XB 2RG3A 2ZPQA 4FUHA 1CGJE 2C90B 5T1VA 3SU3A 5TCCA 4X8VH 1GBJA 1CT2E 1FQ3A 1VCPA 2GDDA 2C8ZB 1GBDA 2VVVA 2I6SA 4XBBA 4B73A 1BT7A 1GJ7B 1FLEE 4FUIA 1V6DA 3VG8A 3SNAA 2ULLA 3PV2A 1GI4A 1O3AA 2P94A 1IQHA 2OC0A 3QTOH 1O2XA 3RDZA 4OS4A 2ZQ1A 2ANYA 2BDGA 4H6SB 3LONA 4Y71A 1BJVA 2RA0A 4J2YB 1PPBH 4K3JA 3GY8A 5A8ZA 5KECA 1GI7B 1M9UA 5BPEA 1C2GA 4DURA 2BY7X 5E0JA 1FY8E 2ZFQH 4AZ2B 2AH4X 1DWBH 1VJ9U 4CRAA 2A31A 3DSGA 1O2LA 3L33A 2J34A 1LKBA 3SV7A 1ZPBA 4OGYA 4VGCB 2OINA 3E3TA 1TRYA 3PRDA 4TWWA 2OC1A 3Q00A 3UB0A 4ZKOU 5F8XA 3ZZ4A 1J9CH 1C2DA 1FPCH 4WWYA 4LK4A 1QBVH 5EOKA 2Z9LA 3TK5A 1GJ9B 3L6PA 4D9QA 2QAAA 1DUEA 3RUOA 4GPGA 2LPRA 1TPPA 3GYMA 1UCYK 1UK2A 3FFGA 2BDHA 5DGJA 5FX6A 1BMNH 1TNKA 1K28D 4CBNA 4WMDA 4FUCA 1QL9A 1Z6JH 1THRH 5EPYA 2BLVA 1DM4B 1EP5A 2GZ8A 6GCHG 1EASA 3M7UA 1NT1A 1YPMH 1CHOG 1ELFA 3SV9A 1K1IA 1AWFH 4GLYA 3BV9B 1BRBE 2DE8A 1L1JA 2Y5GA 1WXRA 2HPQH 5CMXH 1W10U 1DANH 3PMAB 3ZVCA 1G36A 1LPGB 3VB5A 1H8IH 2BD5A 2ZO3H 2CMYA 1NO9H 2FWWA 3SYJA 1Z7KA 1L2EA 1C5QA 1MTSA 4KELA 4RKJB 1KSNA 1FNIA 4HGCA 2JIZD 2TRMA 1AVGH 1DY9A 2A7JA 3BIUH 5ETXA 3WWBA 1HXEH 2Z9GA 2J92A 3SNEA 5EJ1A 4BAHB 1MU8B 3BG4C 1YPGH 1W0YH 1O2KA 2ILNA 2FYQA 3NRLA 1G2MA 5LH8A 3GY3A 1XMNB 1V2MT 2BY9X 1EJMA 2WPMS 4ISLA 2GT8A 4AGJA 1B0FA 1SHHB 1O5BB 1YCPH 2FOGA 1ORFA 1AIXH 3TPIZ 3F6UH 2Y5HA 1CGHA 1S6LA 3DSOA 2ZIQH 3SJ8A 2UWOA 3ZZDA 1GMCF 3SZEA 3RMLH 3UUZA 1SLXB 3STJA 2ZZUH 3IWMA 1RIWB 1CO7E 1DSTA 1O39A 3HK6B 1T4VH 5EODA 2OBQA 1GJCB 1SBWA 3PO1C 2GV6A 1F0RA 1HAGE 1V2UT 1Y59T 4I8KA 4NWKA 1TFXA 1OSSA 2FDAA 2SGDE 3LGIA 2TIOA 4MPXA 1ESAA 1S84A 4GSOA 4X1SU 2FO9A 4IN1A 3SHCH 2BOHB 2YNAA 3T2NA 1JMOH 1PQ8A 1EX3A 2EY4C 4DY7B 3SZNA 1ID5H 1O3IA 1O5CB 3E91A 4MNWA 2ZFFH 3TGJE 1EPTB 4DJZB 1OKXA 2VNTA 4X6OA 1QRWA 1O2SA 5H4IB 2PSYA 4UONA 1BBRE 5KEDA 1C2EA 3P70B 2A5IA 4TY7A 5PTPA 1UO6A 3LOXA 3UWJH 3S9CA 1TALA 1UK4A 1VCWA 3IITA 1GHBG 4YM9A 3GCTF 4K1EA 4DT7B 2FOMB 3UY9A 3A7YA 6CHAB 5KGOA 1HB0B 4DIIH 2BTCE 2A4GA 5FCRA 2L6OA 2QF4A 5JBTA 3SJOA 1KTTB 2KCYA 3S7KB 1WSSH 2Z9KA 2GJGA 1NRNH 1GL0E 1J14A 1O2ZA 1S0QA 3QGNB 5AHGH 3O8CA 1P8VC 3SV6A 1K1JA 1QZ8A 2LELA 2KCPA 2R3UA 1C5PA 2FS9A 3ZVAA 6CHAC 1HJAC 4OS6A 4CRCA 2P3TB 1QCPA 1A3BH 1GWAA 3N7EA 4ABAA 1O5GH 1P09A 1TGNA 3LKWA 1MQ6A 2QCYA 5GNDA 1DWEH 2HNTF 2VWOA 3N7OA 1ETSH 2OQUA 1QB6A 1TYNA 2ZFSA 2QXJA 1VKYA 5C5OA 1GG6B 4ACAA 1UVSH 1Y5AT 4AG2A 2J2UA 3I78A 4H4FA 3RXPA 5DP4A 1EZXC 4B2BA 4F49A 1P2NA 1GHVH 1NROH 2ZGCA 4A92A 2BLWA 5JB9S 4NG9H 3ZZ5A 4DG4A 1K22H 1O3FA 1W13U 1ZMLA 1HAVA 2KR7A 3SU1A 1RS0A 4X6NA 1T8OA 1E1QD 1LMWB 1FXYA 1K21H 3JZ1B 1DWCH 2WPJS 2FOEA 1TQ7B 1FUJA 8KME2 3E0NB 1A1RA 1BMMH 4RT0A 5L6NH 1Q31A 3MNBA 5HXFA 1NBME 3GDSA 4JK6A 1OWJA 1TNJA 1GHAF 5JBCS 1FN6A 3SNDA 1AY6H 1WQSA 5EW1H 3RXCA 1GI8B 2A4OA 2KZ4A 3K2UA 4LZ1H 2XBWA 4FXGH 3UOUA 3DCLA 2IOTA 3TK6A 1IQGA 1AKSB 2BZ6H 3I77A 4OM9A 1FONA 3GY5A 2B5TB 4K5ZA 1QURH 1E38B 1UVPA 3RXLA 4LOYH 1F92A 1MTVA 1O3MA 4E05H 1EKBB 2FOCA 2C3SA 1SKYE 3ATMA 5C1UA 1JWTA 1Y3XA 3W95A 1KLIH 1P3CA 1SOTA 2XCNA 3SNCA 3MFJA 4B6EA 3TLOA 4ZMAH 1S6HA 3BTHE 1AU8A 3ZYEA 2ANWA 1S5SA 2FM2A 1C4U2 2QY0B 1SSXA 2ALPA 1MTNB 4P00A 2O8LA 2UWPA 1ANDA 1F0UA 2ZA5A 1O5FH 1O2TA 3VXFH 3LT3A 4F4OC 1SVPA 2KAIB 4O97A 1MKXK 2G52A 2HNTC 2J98B 4JCNA 4OGXA 3ZV8A 4K1SA 3SUFA 4WXVA 3A80A 2QA9E 3S7HB 3SU4A 1GI9B 3UAIC 3M5OA 2XWBI 1BBRH 1RTLA 2PUXB 1GBBA 3KEEA 1F0SA 1GDNA 5SGAE 3B8JA 2BDCA 5FX5A 1NRSH 3A85A 1C4V2 1EZSC 1ETRH 1ARBA 2FP7B 5CDFE 4VGCC 2VH0A 1ELAA 3K65B 1ZMJA 2GMTC 3RXEA 1GMDF 4UFEH 1IQNA 1OYQA 3MHWU 1Z6EA 2O8MA 1CT0E 1ELBA 4U01A 1AHTH 4A7IB 1HDTH 2DUCA 4TSFD 2WUBA 4K8YA 1DICA 4MNXA 3UR9A 1TA6A 1C5MD 5EW2H 1C5TA 2BQ6B 1BJUA 3MO3A 4CREA 2PLXA 2W3KA 3AAVA 1MKWH 1EAUA 4Z1MD 5HM2A 3FAOA 1GGDC 4F55A 3FKSD 2F9PA 4AFQA 1CBWC 2D1JA 1GCDA 2ASUB 2FYRA 2CJIA 2PSXA 1ZRKA 2CN0H 3P8NA 3UNRA 5BRRE 1F5RA 3U28C 2H5DA 5L2ZH 3V13A 1HLTH 2XRCA 1O3NA 2QIQA 2A0QB 2JJ1D 4CH8B 1V2RT 3SO3A 4GCHG 3TJUA 1QY6A 1P10A 2CXVA 1YLNA 4ABBA 2BLQA 2ZHFH 4M7GA 4DT4A 3EA9A 3KYFA 5T6FA 1THPB 5K0HA 1GHXH 1RTKA 3UNSA 1T8NA 1GBEA 4UEHH 3FZDA 1P0SH 3ZZ3A 2AGEX 4RN6A 2F9BH 3MNCA 1P57B 3V3MA 1A7SA 1TOCB 3FN8A 2XC5A 4TYDA 3AASA 4IC5A 2QF3A 3R3GB 4NZQA 3ATIA 3SQEE 4TY6A 3QZRA 3ZV9A 3T26A 1K1LA 1SGRE 1C1WH 4CRGA 1MAYA 1O37A 2KM0A 4ZKRU 2BXUH 1YPKH 3BTTE 3ZIAD 5DJ7A 2WPIS 3PV4A 8LPRA 1G3BA 1ZSJA 1G30B 1ZTLA 3RXIA 1FDPA 1SMFE 5DG6A 1JRSA 3RXOA 3KQEA 1WUNH 2AFQB 3Q3YA 5FBEA 1K1NA 1GL1A 5CHAC 3WWFA 1QL8A 2NU3E 4BTIB 1LHCH 2H9HA 1RXPA 1EJAA 1IQMA 1BHXF 1BHXB 1GMHF 4IMZA 1RIWC 1L1NA 2RCEA 2A7CA 1CBWB 5DSFA 5JPMH 3Q3KA 4CR9A 2J95A 3MMGA 1SGDE 3DFJA 2G4TA 4X2YA 3O8DA 3NWUA 3CS0A 2DE9A 1TX6A 2VIPA 1DSUA 4H6TA 1WOFA 4A1XA 3EDXB 2PKAB 3SUGA 1GHAG 1QQUA 1GHWH 2QV1A 1PYTD 1G3CA 2BD7A 1OOKB 2QGRA 5LPRA 3UTUH 2ZI2H 3RXVA 1AUTC 1L4DA 4NA7A 1BRCE 1B0EA 5HM9A 1C5YB 1FN8A 1YCPK 1ZTKA 1QJ6B 2GMTB 1EXFA 4DVAU 5E0HA 1Z8IB 1C5SA 1TGBA 1K2I1 5F53A 1T4UH 1BTZA 4BXSA 1Y3UA 2FESH 4J1YA 2HRVA 3ESTA 2A32A 1ZYOA 4B2CA 3SNBA 5I46H 3ATLA 1FJSA 4WH6A 2OXSA 3AAUA 2ZHDA 1EOLA 1S82A 2ZPSA 3RMNH 3SOSA 4I32A 4JYTA 2BM2A 2THFB 2ZGJA 2J97A 1QL7A 1NFXA 2XBVA 3A88A 3KQ5A 1WDIA 2ZU1A 3S9AA 2NU0E 2OTVA 2OC7A 2PUQH 1V2PT 1BTWA 1NC6A 3TJOA 1MAXA 4HI3A 5HIZA 1EAIA 2PHBA 1TNHA 2SGFE 4DCDA 5JBAS 5C5NA 2FXRA 3SQHE 1K1PA 3AVZA 1ELEE 1TMBH 1DLKB 1P9UA 3F0PA 4WMFA 5LPFA 1ZPZA 2BVSH 2QXGA 3QGJA 1YF4A 1H8ED 2FIRH 4KTSA 4BAQB 4NA9H 3ZVBA 3W94A 3QUMP 1FI8A 5AVDA 3A82A 3Q3XA 5HYOA 3GDVA 4YT6H 7ESTE 3DUXH 4FUFA 1T7CA 4MDSA 3EYDA 5FHTA 4D7FA 2AERH 3OEED 4E06H 1BZXE 3A89A 2A1DB 3PB1E 1O3DA 2UUJB 4ZKNU 1SGQE 1P2OA 4AFSA 4BTUB 4BNRA 1BMLA 1DXPA 4IW4E 1NFUA 4BXWA 2P59A 3BN9A 1EFRD 5T6GA 4GHTA 3FO8D 2R2MB 1XUJA 2GCTB 2Z9JA 2BZAA 4CRDA 1O2HA 1ZSKA 3HK3B 2A4QA 3ZYDA 3U8TH 1COWD 1HJ8A 2YNBA 1GBIA 3ZVDA 4YO9A 3F68H 3KCGH 1BIOA 2UWLA 1OP8A 2OCVB 4MTBA 4WMEA 4UFDH 3M7QA 4XE4A 2P3UB 3RXTA 3GICB 3MU1A 3O8BA 4JZDH 2PTCE 4O9VA 4ABFA 3SI4H 5GJ4B 2JKHA 3KIDU 1J16A 2ZDVH 3KL6A 3GCHC 1EP6A 2BX4A 2ZDMA 1YCPM 1HAYB 1H9LB 2EI7A 1O3CA 1GG6C 1D4PB 3MU0A 3UQVA 2P95A 1ZPCA 2IN2A 3VGCB 3ATKA 1W3CA 1ZGIA 1ZTJA 5CHBA 5HMAA 2WV5A 1TB6H 1BRAA 1GJDB 1DOJA 1KTSB 1O32A 2GVFA 3FP8E 3OE7D 1SOZA 1O3EA 3SN8A 1LKAA 2ZEBA 3A84A 4OS5A 3U8OH 1DVAH 1YY3A 1C5UA 1Y5UT 3TGKE 1H8DH 1BMAA 1A3EH 1PPGE 1Y3YA 2CHAC 3GYLB 3A8BA 1W2KH 1EQ9A 2ZQ2A 4GCHF 3FP7E 2QN5T 1C9PA 3T29A 2A4RA 2FI5E 2R3YA 2BDBA 3Q77A 1W11U 2WV4A 3RLYH 3SUEA 1Y3VA 4RI0A 1F7ZA 4ISIH 1NY22 2KFWA 1ZHPA 1FY1A 1KXBA 1OX1A 1Q2WA 1LO6A 5A0CA 1ESTA 2ZU3A 4BOHA 1GI3A 3RM0H 1OYTH 3C1KA 2BY6X 5AF9H 3BF6H 1TPAE 1GGDB 1ZJDA 2Q6DA 1O2QA 1C5WB 3OTPA 1AKSA 1AB9B 3AK5A 4LXBH 2VVUA 1BQYA 1XUGA 3SUDA 3FVFB 2SFAA 2W6ID 3SBKA 1MD7A 1O2IA 1UTJA 2AMPA 2B8OH 3F2HA 4Y6DA 4KTCA 1H9IE 5DP9A 1BTXA 1K9OE 1TABE 1TE0A 1N8OB 2HLCA 3N7DA 5TCAA 1BTPA 4AB8A 1NU7B 1SLWB 1LHDH 1TRMA 4ISHH 1JRTA 4WJG2 3NCLA 2ZFTA 1A0HB 3U8RH 4OS2A 1DY8A 4NIWA 3U98H 1AVWA 1O2OA 3OYPA 1BMFD 4MPUA 1IAUA 2M5TA 3K6YA 1HAXB 5C1YA 1ANEA 2Y80A 3S9BA 2ZHEH 1QFKH 2VWNA 2NWNA 4GAWA 1ELVA 2BLOA 3A86A 2C93B 4O3UA 4Q4LA 1XX9A 2OLGA 4HTCH 1FAKH 2C4FH 2OC8A 2W26A 4QT8C 1SI5H 2JDID 1YLCA 2KCAA 2G8TA 3A7XA 3F9GA 1NM6A 2ZU2A 5B6OA 2F9OA 3NXPA 2Q6FA 2PFEA 3QN7A 3EQ0H 3E8LA 3EE7A 4PROA 1UMAH 1J15A 5HKKD 2ZDNA 1HUTH 1TPSA 1P9SA 3RXFA 2UUYA 4XD7D 2V6NA 2Z7FE 1CT4E 1GDUA 4UE7H 4X0WU 3U69H 4JZIA 2Y5FA 2O9QA 2BDYA 1SGFG 4BAKB 3LH1A 3QK1A 1W0JD 5A0AE 4AGKA 1C1NA 2XXLA 1OWEA 2G4UA 1XUIA 3VB7A 1FAXA 1YPEH 2B0FA 2F83A 2H9TH 2A45B 1EUFA 3RC6A 3V12A 1AZ8A 1TIOA 1GCTC 2CGAA 3M3VA 4D76A 4E7RG 2HOBA 4I8LA 2VIOA 5CHAB 3ZZ9A 3P6ZB 3SU0A 2Y7ZA 2H2ZA 5A2MH 4FU7A 1ELGA 4BANB 2WPLS 2R0KA 4A6LA 3M3TA 1YPHE 3GCNA 2BD2A 2H6MA 4NFFA 5T6DA 4A1VA 4NCYA 1O2GH 2BY8X 3QWCH 4MLFB 2TBSA 1NTPA 7KMEH 1PQAA 3M5MA 5TJXA 4I86A 1C2JA 1T8LA 3BTFE 3KF2A 3QX5H 3FP6E 3DSPA 1O2VA 5GCHG 1ABIH 3VB4A 3ODDA 4DIHH 1W12U 3P8OA 1GHZA 1DPOA 2HVYB 1GBAA 2RDEA 1AD8H 4JZFH 2ZGBH 4I31A 1ESBA 4Y7BA 5EU8A 4ABJA 1O2NA 2B9LA 1YGCH 2QF5A 4X8SH 3ZZBA 2F4LA 2XBXA 3FOAA 4TPYA 1QRZA 4LZ4B 3EE0B 2OD3B 5A8XA 1HAZB 3TIUA 1WAYB 4INKA 5JYIA 4YTAA 5JDUB 2AHME 4ABEA 1FY3A 1P03A 4IBLH 3FZZA 1EAXA 4NIYA 3NKKA 4FUDA 1JIRA 3LH3A 1BUIA 3RC4A 4B74A 1O3LA 2Z6BD 2V35A 1X7AC 1BTYA 1XXFA 1DXWA 1B5GH 3PV5A 4HZHA 1SGNE 3DT0H 2FTMA 5C94A 1VITF 3CNRA 2AIQA 4ZXXH 1C2HA 3AW0A 4MVNA 4B6FA 3WY8A 1WBGB 2BB4A 1O36A 2G51A 1SB1H 1HAPH 1E37B 1HCGA 3RXJA 1QBNA 2OUAA 1GJBB 4Y76A 3OEHD 3F9HA 3PROA 1O3HA 1ABJH 3UWIA 3ZVEA 1GHBF 2ZCLP 5ESTE 1ZHRA 3L3TA 2EI8A 3M5LA 4X1QU 3GY4A 1HAVB 2GKVE 1MTUA 1HBTH 4F48B 1BTUA 5GPIB 4ZAEA 3SJIA 3PTNA 3UQOA 4X6PA 1N1LA 1AVXA 2FOBA 1WCZA 1VITH 2Q1JA 3Q76A 3UREA 1PJPA 4NA8A 1F2SE 1K0HA 1G2LA 1G3EA 1CA8B 1DDJA 2WPDD 5EPNA 4KP0A 1HFDA 1O5AB 1OS8A 3H7TA 1FY4A 2ALVA 3KNXA 1SGPE 2F9UA 1N6XA 2Z3CA 4K60A 1AO5A 1PYTC 7GCHF 3EA7A 1E1RD 1QTFA 2ZECA 1DWDH 3NPSA 1KDQA 4Q7YA 4ZROA 1FV9A 3SGBE 1O31A 4XFQA 1O3KA 3LJJA 3RXSA 4X8TH 4A5TS 5IK2D 1O34A 1HJ9A 1O3BA 2ZCHP 3SV2H 1WYKA 2ZDLA 1B7XB 1C2LA 4B2AA 1WV7H 1AFQB 5E2PA 5CE1A 5LPEA 4Q80A 1SGEE 4E7NA 1ZJKA 2PKSC 1C5VA 5GDSH 1ACBE 1L1GA 3RU4D 3M36A 1W0ZU 4XRNA 3LGVA 1GBKA 1MBMA 2A2QH 1OP2A 2JH5D 2RA3A 3GDUA 1UTMA 4O3TA 1O35A 5JBBS 4WXIA 4XDEA 1GI5A 3ODFA 1C1OA 5C2ZA 1VR1H 2QE7D 4CRBA 3UPEA 4BTTB 4K8BA 1NFWA 3QLPH 1G9IE 3H5CB 5L30H 1QHRB 2FX4A 5DP5A 5E0GA 1V2ST 5E8EH 1P2QA 5EQQA 5DP3A 1C5OH 1LQEA 4XOJA 2WPKS 5B6LA 2F43B 3VPKA 1V3XA 4Q63A 3RU4T 1SGIB 2RDLA 2NU2E 4FOUC 3OX7U 4B76A 2PKSB 1HPGA 4NFEA 6GCHF 1NESE 3GISB 3PLKA 1YBWA 2CF9H 1C1SA 1K1MA 1UTNA 5F03A 4YESB 1O30A 1HAHH 3EAJA 3BSQA 4ABDA 3ZVGA 1AFEH 4Q7XA 4H42U 1HIAB 1N8OC 1KXFA 1XUKA 2KCOA 4D7GA 4DGJA 4ZUHA 2A5KA 1T8MA 5EXMA 4P02A 3S69A 1GPZA 1OXGA 2F9VA 5IYTA 4AX9H 3LC5A 1SFIA 4NIXA 1C5ZB 3RXQA 2HVXA 1PPHE 3GY7A 4ZHLU 3URDA 1TGSZ 5LGOA 3TJVA 1P11E 2YMSC 4X1RU 1BTHH 1AB9C 1CA0C 2SGPE 1LDTT 2P8OC 3E6PH 3TJNA 2J94A 3MO9A 2VU8E 1H9HE 1O3GA 2ZC9H 1A46H 3U1IB 1F0TA 1G32B 3RMMH 2WZQA 2VVCA 4DW2U 4Y8ZA 1D3DB 3S0NA 2IPQX 1NRPH 3TK9A 3EA8A 1L0ZA 5A0BA 3A7VA 3FANA 2LP6A 5ESBA 1CHOF 1TMTH 2BX3A 1GI1A 1MD8A 2J9NA 1SQRA 4OS7A 1SGFA 3PYHA 4X6MA 1SC8U 2EC9H 4FVBA 2AS9A 2CHAB 1Z8RA 3RXRA 1GJ5H 1LHGH 4IS5A 5EG4A 4Y7AA 3PWCA 1MUEB 4YT7H 1D6RA 1ARCA 1SFQB 1DS2E 1O3PB 3PRBA 1GMDG 5C67A 4ZHMU 3ATWA 1FX0B 1FIWA 2K0QA 3BIVH 1CE5A 3RXMA 4I8HA 3RXKA 1Q3XA 1EAWA 1NU9A 3UNQA 3QDZB 1O2WA 2AGGX 1INCA 2B7DH 4ISOA 1AE8H 1P01A 3GCHB 2JETC 2BDIA 1A5IA 9ESTA 3MWIU 1V2LT 2W6JD 4XBDA 2FLRH 1YC0A 2SGQE 4NWLA 3R0FA 1ZSLA 2TPIZ 1V2WT 4ZHAA 2K8IA 3LGUA 2H1UA 1C1RA 1O2UA 1T31A 5A8YA 4B1TA 2ZNKH 1QIXB 2Z3DA 1RFNA 1NS3A 2VB0A 3QZQA 3MOCA 3URCA 5EXLA 3RM2H 4FUEA 1S81A 2PWXA 3SORA 3SI3H 5F8TA 1KYNA 1KXEA 5F8ZA 1AZZA 1QRXA 2SNVA 4Y11E 4JK5A 3STIA 3BEIB 3KQDA 3MTYA 1KXDA 1KMHB 4YLUA 3VB6A 1PQ7A 1QQ4A 3T27A 2C8YB 5IDKA 5F6MA 3PLPA 1A61H 1GVKB 1SLVB 1CGIE 3HKIB 2HALA 5AFYH 1FPHH 1GCTB 3B23B 4THNH 2GV7A 4YOGA 5GXPA 3OSYA 1IQLA 1YPLH 4UDWH 1MTNC 2ZGHA 1C2MA 2ZU5A 2I6QA 1UCYE 2ZTXA 1C1QA 1TX7A 1SR5C 2O8WA 2ZHQH 3OTJE 1IQFA 1C2KA 4ASHA 2AEIH 2V7QD 3UIRA 1T32A 2YOLA 2J5UA 2BD4A 3F2FA 2ZP0H 1E79D 2FI3E 4ABIA 2XW9A 2ZU4A 3RLWH 2ZTYA 3C27B 2PW8H 3MU4A 4ABGA 3BG8A 4FETA 1KXCA 4TWYA 3E90B 1UTOA 2YMSD 2BVRH 2WYJA 1HXFH 1ZOMA 3ZZ6A 3SU6A 3MH7A 1UVOA 1C5LH 3KGPA 3GOVB 3M7TA 4CH2B 2TGDA 1ELDE 1UK3A 1OWDA 3KQCA 3SGQE 2GDEH 5JB8S 1C4Y2 2R9PA 3K6ZA 2FS8A 3TH4H 4Y8YA 1RGQA 3MYWA 1SL3A 1TBQH 3MI4A 3BTKE 1G3DA 1FZZA 1TNLA 4MPVA 2GCHG 4JZ1A 3TITA 1UVUH 1ZR0A 3ENSB 1TONA 1IHTH 1MMJN 3MU5A 2QXIA 3MH6A 3NUMA 2SGAA 6LPRA 2FOFA 1N6YA 4Y0YE 2VH6A 3RXBA 2Z94A 1HAOH 2XNDD 2FODA 1H8HD 1MTWA 2VGCC 1MKXH 3P8FA 1SQOA 3M37A 3ZVFA 4ABHA 4CHAB 2WPHS 1BBRK 1KY9A 3I29A 1LPZB 3BTME 5EXNA 1K1OA 2WYGA 3ZZ8A 1Y8TA 1NRQH 2V3HH 4OS1A 3G01A 4KKDA 2JETB 1ZZZA 2W7UA 3MH4A 5DK1A 1HIAA 1O0DH 2QXHA 1QA7A 3KN2A 3LIWA 1UW7A 2PGQB 3M3SA 2AMQA 1SHYA 1GJ4H 1A4WH 1Y3WA 1WQVH 4ZXYH 2GTBA 2ODQA 1QJ1B 3HATH 2ANKH 3HKJB 1CHGA 4YZUA 3A87A 1EPTA 4TT3D 4AC9A 1QBOA 2FPZA 4B71A 1HJAB 5J4QA 1SQTA 1J17T 3RU4E 1QA0A 2P93A 1HNEE 1OHHD 5EQRA 2UUKB 2VIVA 3MO6A 1UJ1A 1DX5M 1OP0A 2AMDA 1V2JT 2V0BA 5EIYA 2ZKSA 3HGNA 1MBQA 3SV8A 3KQBA 5DN6D 1SLUB 1AGJA 4ZCNA 1D9IA 1A2CH 1HRTH 1MCTA 2FOHA 3OY6U 1BDAA 1IQJA 2QYIA 1G37A 3M5NA 1IOEA 1ANCA 1LPKB 2G55A 3E1XB 4ESTE 3RC5A 1DUAA 2EEKA 1XUFA 5C17A 2GCHF 3PWBA 1YPHC 2P3FH 1WTHD 5HIYA 1LVOA 4AFUA 4JMYA 3M61U
chains in the Genus database with same CATH topology
2BD8A 1GMCG 1QB9A 2XC4A 1EPTC 1SGCA 4Y8XA 5DP7A 1EZUC 1OWHA 1PPZA 4TPIZ 3LJOA 1GMHG 3ITIA 1JOUB 1HGTH 2ZHWH 2C8WB 2A7HA 4GVUA 1BOQA 1XXDA 1OPHB 1CSOE 5G4BA 1NFYA 1KIGH 1UTLM 1GHYH 2LNCA 3E16B 4U30A 5L2YH 5DO4H 1VJAU 1AWHB 1PPCE 3PO1B 1GI2A 3D65E 4NGAH 4WY3A 3GY6A 1PFXC 4BAOB 2BOKA 2AGIX 1QB1A 2ODYB 4MNVA 1DLEA 2ANMH 3LGTA 3TGIE 1S6FA 3OY5U 1EOJA 1ELCA 4SGBE 1IQKA 1L4ZA 1VGCB 2F91A 4U2WA 2HPPH 6ESTA 2XCFA 1AN1E 3K9XB 3UOPA 1O2JA 2SNWA 1C1UH 1GDQA 3V0XA 2BY5X 2A2XH 2ZFRH 4U32A 1UTQA 2Q6GA 1A5HA 4X2XA 2ZF0H 3PTBA 1H1BA 4Y10E 1XKBC 1F5LA 3A83A 4AORA 2W5EA 4CHAC 1TGTA 1W14U 2O8UA 2Z3EA 2H9EH 1Z8GA 1GJ6A 4NSYA 3BTDE 3LPRA 4I33A 3VFEA 5HGGA 1QJ7B 4IGDA 5DKMA 1TMUH 1O3JA 4JZEH 2XTTB 1V2TT 1YLDA 1H4WA 1RJXB 1P12E 3TVJB 3DD2H 2GX4A 3A7WA 5FPSA 2FOAA 3CP7A 3P17H 4RSPA 1OWKA 2A5AA 1ETTH 1AE5A 3TNSA 1S0RA 2EA3A 2FMJA 2Y6TA 1W8BH 2ZG0H 4X1PU 2PR3A 4FVDA 1UHBA 3U1JB 2BYAX 2OBOA 4GUXA 1JXPA 2TGTA 3SHAH 1TA2A 3MNSA 4INHA 1DT2A 2VIQA 2W7SA 1W7GH 2F3CE 4D8NA 2QF0A 5E2OA 1CQQA 2G5NA 2IPHA 4I7YH 4X8UH 3AW1A 1LVBA 3DHKH 4HFPB 4ZH8A 3RXUA 2ODPA 2XBYA 2STAE 1DFPA 1UTKA 5ABWA 1P2KA 2BD9A 1RRKA 2VWMA 2KAIA 1TAWA 1HYLA 2VJ1A 1UHBB 2ZTZA 4R8TB 1C1TA 8GCHG 1GVZA 3D23A 1IHSH 1BCUH 2V3OH 1ZGVA 1D3TB 1MZDA 1XM1A 4NSVA 3RXGA 1HAIH 2P16A 3ZZAA 2ESTE 2FI4E 3LDXH 8ESTE 4FU9A 3SJ9A 1TX8A 1E36B 2BD3A 1P3EA 4YLQH 3OU0A 1EZQA 1EATA 4GHQA 1TNGA 3P92A 1NN6A 2D2DA 3VEQB 1O5EH 2ZPRA 2BHGA 2G5VA 2JH6D 4CRFA 1EB1H 1A5GH 3QTVH 3MU8A 2GD4B 2HWLB 1V2OT 2WUCA 2F9NA 4K1TA 4FU8A 1ZRBA 3GCOA 3PLBA 4O03A 2ZCKP 1GBHA 1Z8JB 1AMHA 3LC3A 1VGCC 1TBZH 2QC2A 4X1NU 3UFAA 3BTEE 1A0JA 1Z71A 1BA8B 1WU1A 3B9FH 3ELAH 3LU9B 4NZLA 1TOMH 2H5CA 4AG1A 1A0LA 5C3NA 1THSH 1UTPA 4UFGH 1SGYE 3SU5A 2J38A 3BTWE 1E35B 3T62A 4INLA 1HV7A 1EJNA 1CU1A 1FIZA 1P04A 1V2NT 1BITA 5T3HA 1VITG 2Y7XA 1PPEE 2EI6A 2ZGXH 2IJOB 3H7OA 4WH8A 4Y0ZE 1YPJH 1JBUH 1C1PA 1GBCA 3NK8A 1SG8B 1BB0B 1GI0A 1S83A 2GZ7A 4XBCA 1UCYH 3ZZ7A 3A7ZA 4JYUH 4UD9H 3RXDA 4K69A 1NZQH 3V7TA 2GZ9A 3BTQE 2NU4E 3M35A 1SPJA 4X2VA 3T5FH 2GCTC 1U6QA 2JH0D 1O2RA 4Z6AH 3MNXA 4Q7ZA 1TPOA 3D62A 3F9FA 1GJAB 1EB2A 1E0FD 1CVWH 1ELTA 4AB9A 1D6WA 2Y81A 1O2PA 2D26C 2FX6A 2FZZA 3TH2H 1LHFH 4I8GA 1GJ8B 2HGTH 4R0IA 1TWXB 3SU2A 3SW2B 2Z9IA 4RKOB 3D49H 2VWLA 5FPTA 1PPFE 3JZ2B 4JYVH 3VXEH 4CR5A 3NZIA 1E34B 3QO6A 1SGTA 3DFLA 3RXAA 3T25A 4Q2KA 1FY5A 1LQDB 5GIBA 2P8OB 2K1QA 1V2KT 1CA0B 4AYYB 1ZHMA 3LGWA 1XVMA 2GP9B 5DP8A 3HGPA 4K2YA 5FXLA 1C5RA 2PKAA 2CF8H 1LCYA 4FUBA 2ZDAH 1AI8H 1RTFB 3CENA 4IN2A 1P2IA 4D9RA 2HNTE 1LVYA 2VGCB 2PTNA 2BXTH 1KLJH 1QNJA 1VZQH 4MPWA 2STBE 1P06A 1ZLRA 3VB3A 1WTGH 2PV9B 1AUJA 1YYY1 4AYVB 1RD3B 2VINA 3TH3H 1KLTA 7LPRA 3T28A 3TNTA 3UR6A 1AQ7A 4MQAA 1C2IA 2SGEE 3BEUA 4WF8A 1C5XB 1XUHA 2G00A 3GCTG 1P2JA 3P95A 5C20A 4ISNA 3O8RA 1C1MA 5DPAA 2TGAA 1O2MA 3LGYA 1IQIA 1JIMA 1D3QB 4FUJA 1SQAA 1NPMA 3BG4B 2FLBH 3PMHB 3U9AH 2G81E 3ZZCA 4IC6A 1F5KU 4WVPE 4I8JA 1TGCA 3F9EA 1O5DH 1W7XH 5FAHA 1V2VT 2NU1E 3E0PB 3RP2A 3RMOH 3A8CA 5C1XA 3KHVA 2ZWLH 1LHEH 2XYAA 1GVLA 1Y5BT 1PQ5A 1TNIA 2XC0A 4B75A 1P02A 3CS7A 2OP9A 9LPRA 2J4IA 1V2QT 2BQWB 3A8AA 1C2FA 1MQ5A 1AFQC 3BEFB 5GWZA 2VIWA 3SGAE 2BDAA 4Y79A 3BTGE 2GGVB 3F1SB 2OQ5A 1GBLA 2FEQH 2CV3A 4KTUA 1GBMA 1C9TA 4KGAA 1O33A 4FUGA 5I25A 1C1VH 1ANBA 2WINI 1P2MA 4Z0KA 3RXHA 5GCHF 2UUFB 4YOJA 4XSKU 1GI6A 4A1TA 3HPTB 1O38A 4MNYA 1OWIA 1UVTH 1IQEA 1TBRH 3EGKH 1O3OA 4IMQA 3PM3A 1C5NH 1LTOA 1XKAC 2ZDKA 2VIDA 1J8AA 2O8TA 2PGBB 1DE7H 3SJKA 3A8DA 1MH0A 3PMBB 5AFZH 1QGFA 2BVXH 1O2YA 1Z1IA 4AFZA 1MU6B 1YP9A 4UFFH 4AOQA 1S85A 1TRNA 1YM0A 1VCQA 2D8WA 4SGAE 3GY2A 2XNIA 1Z1JA 5FBIA 3P8GA 2AIPA 2TGPZ 1YKTA 2BQ7B 4X2WA 1XVOA 3VGCC 5K7RA 1NRRH 5EQSA 1GBTA 4AN7A 1MZAA 2R0LA 3PMJA 1MKWK 1D3PB 8GCHF 1KDQB 2R2WU 4DOQA 1P05A 5FPYA 7GCHG 5J4SA 1TQ0B 2XWAA 1BRUP 1MCVA 5DP6A 4MG3A 4CBOA 1KXAA 1QR3E 2Y82A 5EGMA 1FMGA 2BMGB 2GT7A 5FCKA 5A09A 2ZFPH 2AYWA 1ZMNA 1GBFA 1LVMA 4ZKSU 1TLDA 1DITH 2FTLE 3DA9B 3A7TA 4YOIA 4NIVA 2W3IA 3TU7H 4BAMB 3A81A 3MH5A 3IG6B 2C8XB 2RG3A 2ZPQA 4FUHA 1CGJE 2C90B 3SU3A 5TCCA 4X8VH 1GBJA 1CT2E 1FQ3A 1VCPA 2VVVA 2C8ZB 1GBDA 2GDDA 2I6SA 4XBBA 4B73A 1BT7A 1GJ7B 1FLEE 4FUIA 1V6DA 3SNAA 2ULLA 1GI4A 1O3AA 2P94A 1IQHA 2OC0A 3QTOH 1O2XA 3RDZA 4OS4A 2ZQ1A 2ANYA 2BDGA 4H6SB 3LONA 4Y71A 1BJVA 2RA0A 4J2YB 1PPBH 4K3JA 3GY8A 5A8ZA 1GI7B 1M9UA 5BPEA 1C2GA 4DURA 2BY7X 5E0JA 1FY8E 2ZFQH 4AZ2B 2AH4X 1DWBH 1VJ9U 4CRAA 2A31A 1O2LA 3L33A 2J34A 1LKBA 3SV7A 1ZPBA 4OGYA 4VGCB 2OINA 3E3TA 1TRYA 4TWWA 2OC1A 3Q00A 4ZKOU 5F8XA 3ZZ4A 1J9CH 1C2DA 1FPCH 4WWYA 4LK4A 1QBVH 5EOKA 2Z9LA 3TK5A 1GJ9B 3L6PA 4D9QA 2QAAA 1DUEA 3RUOA 4GPGA 2LPRA 1TPPA 3GYMA 1UCYK 1UK2A 3FFGA 2BDHA 5DGJA 5FX6A 1BMNH 1TNKA 1K28D 4CBNA 4WMDA 4FUCA 1QL9A 1Z6JH 1THRH 5EPYA 2BLVA 1DM4B 1EP5A 2GZ8A 6GCHG 1EASA 3M7UA 1NT1A 1YPMH 1CHOG 1ELFA 3SV9A 1K1IA 1AWFH 4GLYA 3BV9B 1BRBE 2DE8A 1L1JA 2Y5GA 2HPQH 5CMXH 1W10U 1DANH 3PMAB 3ZVCA 1G36A 1LPGB 3VB5A 1H8IH 2BD5A 2ZO3H 2CMYA 1NO9H 2FWWA 1Z7KA 1L2EA 1C5QA 1MTSA 4KELA 4RKJB 1KSNA 1FNIA 4HGCA 2TRMA 1AVGH 1DY9A 2A7JA 3BIUH 5ETXA 1HXEH 2Z9GA 2J92A 3SNEA 4BAHB 1MU8B 3BG4C 1YPGH 1W0YH 1O2KA 2ILNA 2FYQA 1G2MA 5LH8A 3GY3A 1XMNB 1V2MT 2BY9X 1EJMA 2WPMS 4ISLA 2GT8A 4AGJA 1B0FA 1SHHB 1O5BB 1YCPH 2FOGA 1ORFA 1AIXH 3TPIZ 3F6UH 2Y5HA 1CGHA 3ZZDA 2ZIQH 3SJ8A 2UWOA 1GMCF 3UUZA 3RMLH 1SLXB 3STJA 2ZZUH 3IWMA 1RIWB 1CO7E 1DSTA 1O39A 3HK6B 1T4VH 5EODA 2OBQA 1GJCB 1SBWA 3PO1C 2GV6A 1F0RA 1HAGE 1V2UT 1Y59T 4I8KA 4NWKA 1TFXA 1OSSA 2FDAA 2SGDE 3LGIA 2TIOA 4MPXA 1ESAA 1S84A 4GSOA 4X1SU 2FO9A 4IN1A 3SHCH 2BOHB 2YNAA 3T2NA 1JMOH 1PQ8A 1EX3A 4DY7B 3SZNA 1ID5H 1O3IA 1O5CB 3E91A 4MNWA 2ZFFH 3TGJE 1EPTB 4DJZB 1OKXA 2VNTA 4X6OA 1QRWA 1O2SA 5H4IB 2PSYA 4UONA 1BBRE 1C2EA 3P70B 2A5IA 4TY7A 5PTPA 1UO6A 3LOXA 3UWJH 3S9CA 1TALA 1UK4A 1VCWA 3IITA 1GHBG 4YM9A 3GCTF 4K1EA 4DT7B 2FOMB 3UY9A 3A7YA 6CHAB 1HB0B 4DIIH 2BTCE 2A4GA 5FCRA 5JBTA 3SJOA 1KTTB 3S7KB 1WSSH 2Z9KA 1NRNH 1GL0E 1J14A 1O2ZA 1S0QA 3QGNB 5AHGH 3O8CA 1P8VC 3SV6A 1K1JA 2R3UA 1C5PA 2FS9A 3ZVAA 6CHAC 1HJAC 4OS6A 4CRCA 2P3TB 1QCPA 1A3BH 1GWAA 4ABAA 1O5GH 1P09A 1TGNA 3LKWA 1MQ6A 2QCYA 1DWEH 2HNTF 2VWOA 3N7OA 1ETSH 2OQUA 1QB6A 1TYNA 2ZFSA 2QXJA 5C5OA 1GG6B 1UVSH 1Y5AT 4AG2A 2J2UA 3I78A 4H4FA 3RXPA 5DP4A 1EZXC 4B2BA 4F49A 1P2NA 1GHVH 1NROH 2ZGCA 4A92A 2BLWA 5JB9S 4NG9H 3ZZ5A 4DG4A 1K22H 1O3FA 1W13U 1ZMLA 1HAVA 3SU1A 1RS0A 4X6NA 1T8OA 1LMWB 1FXYA 1K21H 3JZ1B 1DWCH 2WPJS 2FOEA 1TQ7B 1FUJA 8KME2 3E0NB 1A1RA 1BMMH 5L6NH 1Q31A 3MNBA 5HXFA 3GDSA 4JK6A 1OWJA 1TNJA 1GHAF 5JBCS 1FN6A 3SNDA 1AY6H 1WQSA 5EW1H 3RXCA 1GI8B 2A4OA 3K2UA 4LZ1H 2XBWA 4FXGH 3UOUA 2IOTA 3TK6A 1IQGA 1AKSB 2BZ6H 3I77A 1FONA 3GY5A 2B5TB 4K5ZA 1QURH 1E38B 1UVPA 3RXLA 4LOYH 1F92A 1MTVA 1O3MA 4E05H 1EKBB 2FOCA 2C3SA 3ATMA 5C1UA 1JWTA 1Y3XA 3W95A 1KLIH 1P3CA 1SOTA 2XCNA 3SNCA 3MFJA 3TLOA 4ZMAH 1S6HA 3BTHE 1AU8A 3ZYEA 2ANWA 1S5SA 2FM2A 1C4U2 2QY0B 1SSXA 2ALPA 1MTNB 2O8LA 2UWPA 1ANDA 1F0UA 2ZA5A 1O5FH 1O2TA 3VXFH 3LT3A 4F4OC 1SVPA 2KAIB 4O97A 1MKXK 2G52A 2HNTC 4JCNA 4OGXA 3ZV8A 4K1SA 3SUFA 4WXVA 3A80A 2QA9E 3S7HB 3SU4A 1GI9B 3M5OA 2XWBI 1BBRH 1RTLA 2PUXB 1GBBA 3KEEA 1F0SA 1GDNA 5SGAE 3B8JA 2BDCA 5FX5A 1NRSH 3A85A 1C4V2 1EZSC 1ETRH 1ARBA 2FP7B 4VGCC 2VH0A 1ELAA 3K65B 1ZMJA 2GMTC 3RXEA 1GMDF 4UFEH 1IQNA 1OYQA 3MHWU 1Z6EA 2O8MA 1CT0E 1ELBA 4U01A 1AHTH 4A7IB 1HDTH 2DUCA 2WUBA 4K8YA 1DICA 4MNXA 3UR9A 1TA6A 1C5MD 5EW2H 1C5TA 2BQ6B 1BJUA 3MO3A 4CREA 2PLXA 2W3KA 3AAVA 1MKWH 1EAUA 5HM2A 3FAOA 1GGDC 2F9PA 4AFQA 1CBWC 2D1JA 1GCDA 2ASUB 2FYRA 2CJIA 2PSXA 1ZRKA 2CN0H 3P8NA 3UNRA 5BRRE 1F5RA 2H5DA 5L2ZH 3V13A 1HLTH 2XRCA 1O3NA 2QIQA 2A0QB 4CH8B 1V2RT 3SO3A 4GCHG 3TJUA 1QY6A 1P10A 2CXVA 4ABBA 2BLQA 2ZHFH 4M7GA 3EA9A 5T6FA 1THPB 5K0HA 1GHXH 1RTKA 3UNSA 1T8NA 1GBEA 4UEHH 3FZDA 1P0SH 3ZZ3A 2AGEX 4RN6A 2F9BH 3MNCA 1P57B 3V3MA 1A7SA 1TOCB 2XC5A 4TYDA 3AASA 4IC5A 2QF3A 3R3GB 4NZQA 3ATIA 3SQEE 4TY6A 3QZRA 3ZV9A 3T26A 1K1LA 1SGRE 1C1WH 4CRG<