1F92A

Urokinase plasminogen activator b chain-uki-1d complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title Crystals of the urokinase type plasminogen activator variant beta(c)-uPAin complex with small molecule inhibitors open the way towards structure-based drug design.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2000-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f92A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f92A01
1D4PB 2Y6TA 1SGRE 1XX9A 1ZR0A 2EC9H 3RXBA 1F0SA 2QXHA 1EOLA 4FVDA 3F9HA 1BITA 1TGBA 2F91A 2PKSB 4WF8A 1PQ8A 1IQJA 4MDSA 3RM2H 3MNBA 1V2TT 3RXPA 3K6YA 1C2KA 1B5GH 2C8ZB 5FX6A 3ZZ9A 2P95A 3SV7A 1C1PA 3RXQA 3S7KB 2QF3A 1J8AA 1DWBH 3GY6A 3GY4A 4JZEH 2QXJA 4TWYA 4UE7H 4DOQA 3M7TA 4GSOA 2H9EH 4D7FA 1FY1A 3LOXA 2BVSH 2ZFPH 2AYWA 1S5SA 5I25A 3SNCA 2GDEH 3QO6A 4NZLA 7ESTE 2W7SA 4AGKA 3T27A 4AG1A 4OS7A 5GDSH 1GCTC 1MTWA 5E8EH 2FP7B 4I8JA 1TMUH 1PPEE 1DOJA 2Z9JA 1XKBC 3DA9B 1OYQA 3NWUA 2Y5GA 4NSVA 1DVAH 4HI3A 5F03A 1C2HA 1HAOH 2F3CE 1O2QA 4Y6DA 4K1TA 5FPSA 1KYNA 5DP4A 4I8KA 2BDHA 2PSYA 2RA3A 3BTHE 5GPIB 5AFYH 4KP0A 2BVXH 4BAKB 3QDZB 1VGCC 2ZKSA 1GI1A 1IQFA 1DFPA 1LPZB 3E16B 2D26C 1NRSH 3SU3A 1DS2E 1AVWA 2V0BA 2OC8A 3HATH 1YM0A 4AFSA 1C4V2 1PYTC 4X2WA 1TLDA 2EI8A 2OINA 1OS8A 1YPEH 1O39A 4LOYH 1BTXA 4I8GA 4BAQB 1AUTC 1MZAA 3RP2A 1MUEB 5A09A 1AO5A 2J9NA 5E0JA 2ZNKH 4I32A 1ABIH 3A83A 1O5FH 2GTBA 4INKA 4KELA 1DWCH 1BMLA 1T4UH 1T8NA 2A31A 1WTHD 1MBQA 4FU7A 2ZDLA 2HNTF 4ABIA 4CRDA 2GZ7A 5CE1A 2XBYA 2DE9A 1LVOA 1GMCG 2GT7A 1V2WT 4XBBA 1P2JA 1O3EA 2V6NA 3JZ2B 4X6NA 3SORA 2G5VA 1O36A 1MMJN 4U01A 3A7YA 2ZHFH 3LH3A 3FAOA 6LPRA 2Y81A 4ZMAH 2BDBA 1K1JA 3UIRA 1FNIA 1YKTA 3VEQB 3H5CB 1Q3XA 4JZDH 1BZXE 1TYNA 4MPVA 2GZ8A 4WJG2 1CA8B 2VIVA 2HLCA 1HNEE 1P2MA 3BTDE 1BCUH 1W3CA 4VGCC 5TCCA 4CHAC 1GHXH 5DK1A 4WMEA 1LKBA 3AAUA 4UFDH 1YP9A 2ZHEH 2FOMB 1TNIA 1CU1A 2A32A 4OS5A 2PKAB 1CQQA 4OS4A 5HM2A 1TPOA 3RMLH 1BTYA 3RXDA 2V3HH 2P93A 4HZHA 3GYMA 4GCHG 1SQTA 7GCHF 2BMGB 1YGCH 3TU7H 1GJBB 2IJOB 3U8OH 4IBLH 5FPTA 3D49H 2BD5A 1GBTA 1BQYA 1FIZA 3RXMA 1E38B 2SNWA 1A3BH 1E35B 1CSOE 1ETRH 1O2TA 1O2OA 1EAUA 9ESTA 2Y5FA 3GDVA 1GBAA 1CHOF 1GVKB 5A0AE 5HXFA 1BHXB 1AB9C 1ZGIA 4IMZA 2XRCA 1BRUP 1MZDA 4O9VA 3T2NA 3BG4C 2BZ6H 1GHVH 1GBDA 3KN2A 3OYPA 3AVZA 2A2XH 1ZJDA 2PR3A 4NA9H 3UNRA 4Z0KA 3LDXH 2BY9X 1AMHA 2GX4A 2IOTA 3ZV9A 2F83A 1C5UA 1P2QA 3ZZ4A 1YC0A 3MWIU 3Q3XA 3RMNH 3OX7U 1CO7E 5C20A 3DFJA 4ISNA 5FPYA 4YT7H 4AB8A 1K9OE 1HBTH 4ABDA 1XUIA 2QXIA 1LKAA 4UONA 3TH4H 2GDDA 4ABEA 1V2MT 3BEIB 1AZZA 2D2DA 2XC4A 2BY7X 3TJNA 1DX5M 1C5LH 1MTVA 1XMNB 1K1IA 1INCA 1LHFH 3SZNA 2AH4X 4JMYA 3ZVCA 1UCYH 4DJZB 4TY6A 3ZZ7A 1F0RA 1YPHC 4UFGH 4GUXA 1GHBF 3VFEA 1EX3A 3OY6U 2H6MA 1EZUC 1MBMA 1JMOH 8GCHG 2STAE 1L4DA 1C5QA 3P70B 2G4TA 1HAXB 1O3IA 2ZCHP 1A61H 1UK2A 3MYWA 1IQLA 1ANCA 1FXYA 4NIXA 3T25A 1GBEA 2VU8E 1G3BA 1QBNA 3EA8A 3UFAA 1A3EH 1SPJA 1QHRB 3MO6A 3TIUA 1LHDH 1N8OC 1Z8GA 2OC1A 8ESTE 1Q31A 5G4BA 3A85A 1W7GH 1D3PB 4B76A 2ZFQH 4A7IB 3SV9A 2QIQA 2ZF0H 2EI7A 1Y3WA 2F9OA 3AASA 2CHAB 3GDUA 1GHWH 3KCGH 2STBE 5DP3A 4X8TH 4KTCA 1PYTD 1OWJA 4X2VA 1BRCE 1S81A 1NM6A 1ZHRA 4F49A 1SQOA 5A8ZA 1V2NT 1SBWA 1VITG 4I31A 3SU4A 1BTHH 3IITA 2IN2A 5JB9S 1HIAA 3B8JA 1EB2A 1C1MA 2RA0A 1EATA 2ZCLP 1GBMA 1IHSH 1KLTA 3EA7A 5EOKA 3EQ0H 2O8MA 1WQSA 1D3TB 1O2XA 2BLOA 3TNSA 2ZDNA 3BTME 4SGBE 4U2WA 1A5GH 1ELAA 3LKWA 1XUGA 2GVFA 4YM9A 4NWKA 1S84A 1DXPA 2PW8H 1RIWB 1YLDA 1FQ3A 4NA7A 4LK4A 1GJ5H 2OUAA 2P94A 5K0HA 1HJAC 1YCPK 3BSQA 2OP9A 1UCYE 1DUEA 1GBCA 2ANYA 1NRRH 3PWCA 3NKKA 1MQ5A 4RSPA 1FY4A 4I33A 1C1NA 1P2IA 6CHAC 1HCGA 5T6FA 1RGQA 1MAXA 1QJ1B 3GCHC 2C8YB 1O2SA 2OXSA 1TWXB 1BOQA 3MNCA 1A1RA 1N1LA 3I29A 1THSH 2AMQA 2J4IA 4INHA 1OWKA 1H8IH 1NESE 3ATLA 2FLRH 2BX4A 1PQ7A 2HWLB 5C67A 3ZVAA 1MKWK 1BTUA 1C5ZB 4H6TA 1L1NA 3O8BA 3L3TA 1E34B 5C1YA 1HLTH 3RXKA 1GVLA 1TQ7B 4Q7ZA 4WMFA 3PWBA 2OC7A 3VB6A 1TB6H 2ZGJA 3SJIA 3RXAA 1TRYA 4ABHA 1SLXB 1P06A 2FI3E 1GMDG 1NO9H 2NU3E 1JIRA 4ZROA 1ELEE 4K1EA 1SGIB 1TIOA 2ZEBA 2J34A 1KY9A 1SLVB 2VH0A 5H4IB 3ZZCA 4X2YA 3H7OA 1X7AC 1UVOA 1SHYA 2J2UA 1GHAG 3UR9A 3KEEA 3AAVA 4K1SA 3RC6A 2CF9H 3E6PH 1GJDB 3A81A 3FANA 4FXGH 4NGAH 3GOVB 1W0YH 2NU0E 1ABJH 4DVAU 2XWAA 1LTOA 1O3KA 1AFQB 1A4WH 3A80A 2XYAA 4WH6A 1FJSA 1DICA 1FPCH 2BDCA 4B74A 2XBWA 1IHTH 3KQDA 1O5EH 3QX5H 4ZHMU 1KDQB 1VJ9U 3VB3A 4BAHB 1YYY1 3PM3A 3STIA 1FI8A 3BN9A 3HGPA 1C1QA 1AD8H 3RXRA 1DITH 1SLWB 5LPEA 1MCTA 2FOFA 1DLEA 1OWIA 1P04A 3N7OA 1FY5A 4CBOA 2VIDA 4NIVA 4U30A 2BY8X 4AOQA 3AW0A 2VGCB 3SI4H 1T8OA 1J9CH 1GBBA 3UREA 1MD8A 1C2IA 2ULLA 1ELVA 3C27B 3ATMA 3UOPA 1CBWB 1PPGE 1G36A 5EXNA 1O2RA 2B7DH 2VIPA 1GDQA 4MNWA 3T26A 4AFUA 1AWFH 3U9AH 5EQSA 1BJVA 4ZKNU 1SFQB 2JETC 3UR6A 3KIDU 3SW2B 2BXUH 1XXFA 3MOCA 2BD2A 2P3UB 1F5LA 2ZC9H 3Q3KA 1IQEA 3F9EA 1K1MA 4JYVH 2NWNA 3A8AA 5K7RA 3IWMA 1KLJH 1Z1IA 4WY3A 1QR3E 2YNBA 2ZCKP 1TRMA 4RKJB 1WBGB 5LGOA 1ZOMA 3PMHB 1EASA 1AFEH 1LQDB 1Y5UT 3RXCA 3S9AA 2GZ9A 1KXCA 2OBOA 1MU8B 3TNTA 3S9CA 1A0HB 3LT3A 4A5TS 2AMDA 3M61U 2Z3CA 4MG3A 1P09A 3V12A 2EI6A 3MU8A 2TPIZ 3M36A 4LXBH 1ESTA 1H9LB 2BM2A 2R9PA 3NPSA 2QA9E 2ZU3A 3KNXA 2ZU4A 3S0NA 4DURA 1G30B 3KQCA 4AFZA 2V3OH 2WPMS 1TPPA 1YPGH 1QY6A 5LPFA 1DE7H 2BY5X 3FP7E 4MQAA 2RCEA 4A92A 1QNJA 3MMGA 2C8WB 2CF8H 1QQUA 1SC8U 5BRRE 3RXSA 3MHWU 5DG6A 2WPKS 3RXEA 1O3OA 1NFUA 1EOJA 3RMMH 4TY7A 1EJAA 3URDA 1W12U 1UHBB 3MNXA 1P3EA 1C2FA 1S0RA 3ZZBA 2Z9IA 1NFXA 2ZPQA 5BPEA 2KAIA 4ZXXH 1GJ8B 5EXMA 1BRBE 5DP8A 1NZQH 1O35A 4IC6A 1CA0B 3M5OA 1V6DA 1ZPBA 2VH6A 2HNTE 4ZKSU 1OOKB 1UVTH 3QN7A 1QGFA 3BEUA 4INLA 2UUYA 2XC0A 5F8ZA 2A5AA 1CT2E 1WSSH 3Q76A 1ZTJA 1P2NA 2ZIQH 2GD4B 1XVOA 2A7JA 3A86A 3RXIA 1XKAC 5E0GA 3SU1A 1O5BB 4Q7YA 1P9SA 1GBKA 3UPEA 2AGGX 3RU4E 1ZRBA 5E2OA 1PQ5A 3GY3A 1RFNA 5HGGA 1VGCB 1XUJA 5B6OA 2B9LA 4Y0ZE 5GJ4B 2DE8A 1DT2A 2M5TA 1YPHE 2ZTZA 1FN6A 3PO1C 1ELGA 1ESBA 4JK6A 1H8DH 3ZZAA 4MNYA 1MKXK 1ZRKA 3SUEA 2FIRH 1GG6B 5HYOA 1O3CA 1E36B 4X1NU 3L6PA 1TFXA 3LC5A 5AHGH 1UTQA 2ZHDA 2Q6DA 3QGNB 2PKSC 5ESBA 1C2JA 1GMHF 2AGIX 1Z8RA 1YPKH 1SB1H 3RXOA 2XCNA 1EZQA 1TGNA 1WQVH 2PTCE 3UQOA 1THPB 1C1RA 3RXFA 2C93B 1TGCA 2ZHQH 4IMQA 4Y71A 4AB9A 2BY6X 5FBEA 1B0EA 1Z7KA 5GCHF 4MLFB 1F5KU 1AN1E 1HAVB 4K8YA 4FVBA 5A8XA 5EPYA 1ZSKA 1FONA 1H9HE 2P59A 2YOLA 1C5OH 2WV4A 1CT0E 1TNLA 3MH4A 1TX7A 5JYIA 2BDIA 2FTMA 4DW2U 8GCHF 1ZMLA 4X6PA 1YF4A 3A89A 3SGQE 3Q00A 1K1OA 1KLIH 3URCA 1TOMH 2ZTYA 2BB4A 3PMBB 1ARCA 2G5NA 1GVZA 3SU6A 4VGCB 3RC5A 2Q1JA 1OP2A 2C4FH 1O37A 4CR9A 4E06H 1K1LA 1V2ST 1ZZZA 4Q7XA 1PJPA 3U98H 4IN1A 1QB6A 3NUMA 7LPRA 3P8GA 2QYIA 1QBVH 1OX1A 1VZQH 1TX8A 1Z6EA 2BDAA 3LGVA 2AS9A 2BD7A 2PTNA 2QAAA 1W2KH 1GJCB 2WPJS 1EJMA 1NT1A 3SV8A 1NFYA 3TK9A 4I7YH 3DT0H 1P01A 2OTVA 3TJVA 2Y82A 3PV4A 1TALA 4B2BA 1TBQH 4FU9A 1LPGB 5JBCS 2FDAA 1GJ9B 3A8CA 4XDEA 3SUFA 1AB9B 1YPMH 2PUXB 1NRNH 3AW1A 4AGJA 1HUTH 2GMTC 4FUCA 2SGFE 1THRH 3BG4B 2OD3B 4IC5A 3FZDA 2Y7ZA 2LNCA 1D3DB 1O32A 3F1SB 2ZQ2A 4E7RG 2A2QH 5PTPA 2AEIH 1AKSA 3P8NA 1ZSJA 4X8VH 2R0LA 2TGTA 1UTMA 3LGUA 2GCHF 1O2UA 3T5FH 4QT8C 2H9TH 4SGAE 2QN5T 1O3DA 3PLBA 3ZVDA 3A7WA 2XBVA 2ZGBH 2FOCA 1FIWA 5DJ7A 3ODFA 2H9HA 3TJOA 3HKIB 2CXVA 3ODDA 4ABBA 1FZZA 2F9VA 2FWWA 1GL0E 5EW1H 2Z7FE 1O3LA 1G3EA 1K2I1 1O0DH 2F9NA 4FUEA 3F9FA 2JKHA 1GI0A 3ESTA 3RMOH 1WAYB 1LHGH 3B23B 3RXTA 1HRTH 2ZFRH 4CBNA 1K1NA 4NZQA 2VIQA 4YOGA 5FXLA 4XOJA 2QGRA 3DFLA 1LVBA 4JK5A 4ZHAA 1F5RA 5L30H 1C2LA 3RDZA 1W7XH 1MH0A 1EAXA 1O2WA 1WV7H 2A0QB 3Q3YA 3F9GA 2PGBB 1QB1A 2UUJB 4NA8A 3BV9B 4OS6A 1GBFA 2XCFA 3A7ZA 2BLQA 2O8UA 4WXVA 3VXEH 5ABWA 2H1UA 2ZECA 1N8OB 1O2IA 3UTUH 4BAMB 2BDGA 1L1GA 2CGAA 1FY8E 1C9TA 1J15A 3IG6B 1C5XB 2HOBA 1J14A 1ANEA 1B7XB 2ZU5A 5A0BA 2G8TA 3UNSA 4H6SB 4E7NA 3A87A 1TPAE 1ELFA 1SGFG 2BX3A 1Y5AT 2UUKB 3QWCH 1LDTT 1TX6A 1F0UA 2XW9A 3A7XA 1OWHA 2GCTC 2G00A 3RM0H 1A5IA 1V2KT 1AY6H 1P9UA 4WVPE 1BMMH 3NCLA 1AHTH 4NSYA 3ZVEA 4IGDA 3KQEA 1CGHA 3M35A 4MVNA 2FOAA 3GISB 2CJIA 1V3XA 5EGMA 2OCVB 3C1KA 4X8SH 2ODYB 1G3DA 2TRMA 1XXDA 4IS5A 3M5MA 3U8RH 2BHGA 1L0ZA 3M5LA 1HAPH 2A7CA 4FUBA 3RXLA 4X6OA 4Y79A 3SJ8A 3HK6B 4ABGA 2C8XB 2B0FA 3H7TA 4CH8B 2P3TB 4CRCA 2SGQE 2RG3A 2XXLA 1C2GA 1SGNE 1EKBB 3OU0A 4B2CA 1LQEA 4O97A 2JH5D 3M3TA 5CMXH 2FOGA 3LJOA 1SOTA 4YO9A 1RD3B 4GPGA 3GY2A 1GCDA 3LPRA 4AORA 6CHAB 1EPTA 1K1PA 3EDXB 1O30A 3GCHB 1TA6A 4LZ4B 3GCTF 4MPUA 2GT8A 1C5WB 2QC2A 1GI8B 2UUFB 2GV7A 1S85A 1O2KA 3DUXH 3M7QA 6GCHG 3LGIA 1AVGH 1SGDE 1W10U 3ZVFA 1GDUA 1O31A 1ARBA 4NFEA 3SU2A 2O9QA 3RC4A 1FV9A 3D65E 2A5KA 1SQAA 1OSSA 2BOHB 3V13A 3LIWA 7GCHG 1G2LA 3HPTB 4DGJA 2ZWLH 3MNSA 1GJAB 4Y7AA 2BYAX 1C1VH 1PQAA 1QIXB 3MFJA 1IAUA 1HXFH 5T3HA 4XBCA 1S83A 1B0FA 1O3MA 1A5HA 1BUIA 3M37A 2PSXA 3TPIZ 2BD8A 2A1DB 2F9BH 1S6HA 1UHBA 8LPRA 3EYDA 4YLUA 4HFPB 1D6RA 1BTWA 1TBRH 4XSKU 1C2DA 5FCKA 3FVFB 1O3HA 2C90B 4K60A 1A2CH 1NRPH 1FAKH 4FU8A 4NIWA 1C5MD 3PTNA 2J38A 2XNIA 2ZI2H 4YT6H 5FX5A 4FUGA 2QF0A 2QV1A 1TGTA 3MO3A 4HTCH 2OBQA 5DP5A 3M3VA 3MH7A 3TGKE 2WYGA 2QY0B 2VNTA 2W3IA 1TE0A 2BD3A 1GGDC 4XBDA 2FESH 4R0IA 2AFQB 4FUDA 3CP7A 3MH5A 3TGJE 1HPGA 3PMAB 2XWBI 5CHAB 4CREA 1C5NH 1V2QT 1HXEH 1O2MA 3QTVH 4AYVB 3VB7A 3GY7A 2HVXA 2FS9A 1GHBG 1LPKB 2ZGCA 3G01A 4YZUA 1ESAA 3PYHA 2BOKA 1HYLA 3ATKA 1XUHA 4TPIZ 1WYKA 1D9IA 1BB0B 4K3JA 5ESTE 3ELAH 1S0QA 2BD4A 1YLCA 1TA2A 1U6QA 1MQ6A 3SJKA 4FUHA 1SSXA 4ZH8A 2JETB 4CRFA 1H1BA 2ZPSA 3QGJA 4ZAEA 4AFQA 5SGAE 3K9XB 3A88A 1BRAA 2GKVE 2FX4A 1W8BH 3ITIA 3VGCB 1LVMA 5JBBS 1ETSH 1GBHA 4JYUH 1QCPA 5JPMH 4BAOB 2ZU1A 2AERH 1LHCH 2BQWB 3I77A 4Y10E 5DO4H 4D9QA 1V2LT 4K8BA 1UK4A 3MU4A 1LMWB 3LH1A 1W13U 1UTJA 3P92A 3RLWH 1IQHA 1DWEH 5HMAA 4ABJA 1ZJKA 2NU4E 2ZGXH 2ZG0H 3SJOA 1EQ9A 1C5TA 1MTNC 4BXWA 3RUOA 4WWYA 1CT4E 2P16A 2UWPA 3SGBE 4TWWA 2ZU2A 3QZQA 4MNVA 1BA8B 4B75A 2BD9A 2CMYA 1MU6B 1ETTH 2ALVA 3SNEA 5C5OA 1KTTB 3SQEE 1OWEA 2HPQH 3A82A 4BANB 1C5PA 1P10A 3ATWA 2ZTXA 1FLEE 5FAHA 3OY5U 3F6UH 1ELCA 4F4OC 2WPLS 4JCNA 1TNHA 5E0HA 4ISOA 2R3UA 2A4OA 2R2WU 5DKMA 3RXGA 3EGKH 5GWZA 4Y8ZA 1C5RA 4DG4A 3CS0A 5C1UA 2FS8A 2G52A 3OTJE 2O8WA 4FUFA 3TGIE 3P17H 3QK1A 5AFZH 1AE8H 1G2MA 1HIAB 1O2PA 2D8WA 3E8LA 2ZZUH 3BEFB 1DSUA 3E91A 1VITH 4BXSA 3T28A 4J2YB 3B9FH 1YCPM 1L1JA 4CRBA 5TCAA 3M3SA 2VJ1A 1SHHB 2TGDA 1TBZH 4NCYA 1OP8A 2GV6A 2ZGHA 4MNXA 4R8TB 3GICB 1C2EA 5FCRA 2OLGA 3QTOH 1CVWH 2P8OC 3MU0A 4TPYA 4Y0YE 1AGJA 3GCOA 4B71A 1O3NA 1GMCF 1ZMJA 3LGYA 1GWAA 2G51A 1MAYA 1HAZB 1KXBA 1XUFA 3VPKA 2ZFFH 3S9BA 1GI3A 1Y3VA 1SGFA 3NK8A 4X8UH 2SGEE 2VIWA 1G37A 4ZUHA 2ZA5A 1O3GA 1YCPH 3VB4A 2BZAA 1BMAA 3PROA 3PB1E 1BMNH 3M7UA 4B73A 1EPTC 2FI4E 1M9UA 2PKAA 1Z8JB 5DP6A 4XFQA 3NXPA 1ZYOA 5LH8A 3DHKH 1DLKB 1AUJA 1JRSA 1C4U2 4MPXA 1EB1H 1C9PA 2ANMH 2GGVB 2OQUA 1JXPA 3FFGA 4ISHH 4OS1A 4GAWA 4X2XA 1QJ7B 1UVSH 4A1VA 2VVVA 1MKWH 3PO1B 3CS7A 1PPBH 5C1XA 3SU5A 2HGTH 1GCTB 4K2YA 2WV5A 1GBLA 1O2GH 3A7TA 1A7SA 1HGTH 2HRVA 2ZO3H 1O5GH 4GCHF 2VWLA 2Z6BD 3MO9A 1FN8A 1SMFE 2CN0H 1H4WA 1SGYE 1DM4B 4OGYA 3E3TA 1T7CA 2HPPH 2P3FH 4UEHH 1O2NA 4WXIA 1PPCE 1UO6A 3UUZA 1E0FD 2OQ5A 2THFB 1HFDA 1P3CA 2SNVA 1GHYH 1ZLRA 2ZDKA 1AVXA 1UK3A 2FPZA 1NS3A 1T32A 3K6ZA 1TNGA 3BIUH 5EPNA 3ZZDA 1VJAU 3V3MA 1JOUB 1O5AB 3GYLB 1GBIA 3P95A 5FBIA 5LPRA 2FLBH 4ISLA 1O3FA 3D23A 3F68H 4X1QU 3RU4T 4AG2A 1UCYK 3RXJA 1QTFA 1RTLA 3WY8A 3KHVA 4ZXYH 1CA0C 2Z9LA 1EAWA 2A4GA 3BTWE 4O3TA 2TGPZ 1W14U 5F8TA 2B8OH 2Z3EA 1AZ8A 1HJ9A 1MTUA 1C1SA 3RXVA 1JIMA 1P11E 2AMPA 2HALA 3EE0B 1IQMA 1UTNA 2EA3A 3L33A 2R3YA 1TABE 1C5VA 2A45B 3GY8A 3ZZ8A 4ABAA 2TBSA 2O8TA 1O2HA 1KTSB 1NROH 4AYYB 3SNAA 1QA7A 1C1TA 3V7TA 4LZ1H 1TNJA 4Q80A 3SV6A 1VCWA 1HV7A 1GBJA 3SN8A 3O8RA 4X1SU 2VWMA 3UWJH 4JZIA 1C1OA 1OPHB 1CHGA 3SUDA 1IQGA 1IQKA 3O8CA 1O2JA 3E0PB 3QLPH 1DY8A 2Y5HA 5IDKA 2SGDE 1SGTA 3TK5A 1GI2A 1TOCB 2YNAA 1GG6C 5HM9A 4H42U 2NU2E 4CHAB 4BNRA 1QBOA 2FOHA 1ZHMA 1VR1H 2FOBA 1BBRH 4JZ1A 1S6FA 2GMTB 1O34A 1SOZA 3PLPA 1PFXC 1SI5H 4WMDA 5DPAA 1ZGVA 2J92A 1O5DH 1YPLH 2BTCE 2FZZA 4X1RU 5EW2H 2B5TB 2BQ6B 5A0CA 2C3SA 3BTQE 4IN2A 3P6ZB 2QXGA 4KTUA 4M7GA 5JBTA 1QRWA 1F2SE 5IYTA 1TMTH 3TJUA 4D8NA 1VITF 1Y8TA 1DANH 2XBXA 4D9RA 4IW4E 1BHXF 1P03A 3K65B 1EZSC 2D1JA 1LHEH 1KSNA 3U69H 1V2VT 1KIGH 1ANDA 2I6QA 4CRGA 3GCNA 3STJA 2SGPE 1QRXA 2VVUA 1UJ1A 4O03A 1T4VH 1ZSLA 1UVPA 2ZDVH 4E05H 2XC5A 4XE4A 5JDUB 3BTFE 1OP0A 3RXUA 3SUGA 9LPRA 1O2YA 1JWTA 4JYTA 6GCHF 3R3GB 1D3QB 1EJNA 1F0TA 1GI5A 1DSTA 2WUBA 3JZ1B 1MD7A 1UTPA 1BT7A 2GP9B 5L2ZH 2AIPA 1T31A 1EAIA 1SGQE 2W26A 4DCDA 2KAIB 5J4QA 3O8DA 2FYRA 4GHTA 1RRKA 1Y5BT 2BDYA 4GVUA 3ZV8A 4ZKOU 1IQIA 5C5NA 4CRAA 3FP8E 1AI8H 3ZVBA 2BLVA 1XVMA 1AE5A 1PPFE 4U32A 2UWLA 4DT7B 1DPOA 1NFWA 1Y59T 4Z6AH 2FXRA 3ZZ3A 4NIYA 1P2OA 1ANBA 1K22H 4RKOB 4FUIA 1WU1A 3GDSA 1EXFA 1BBRE 1EP5A 2TIOA 1GL1A 4Q2KA 1SR5C 2Z3DA 2F9PA 1G3CA 2HNTC 2ZFTA 2VWNA 2GCTB 1YPJH 4D7GA 1GMDF 4A6LA 2OC0A 1VCQA 3UWIA 2QCYA 1GI4A 1KXEA 1Z1JA 4NFFA 2R0KA 4I8LA 1EZXC 1GMHG 1HJ8A 2G81E 5I46H 3ZZ6A 2ANWA 2ZQ1A 3PTBA 1DDJA 1GHAF 1HAGE 1GDNA 1KDQA 4ISIH 1C2MA 1AIXH 1IQNA 2PFEA 1HB0B 3SBKA 2H5CA 2WINI 3D62A 2FX6A 2W7UA 5GCHG 1S82A 1MKXH 3EA9A 5GIBA 4BOHA 4K69A 4CH2B 2BLWA 1FMGA 4Y8XA 4YLQH 4A1XA 5J4SA 3A7VA 1T8MA 3TLOA 1C4Y2 1W11U 2PGQB 1EP6A 1RXPA 5L2YH 1OYTH 1Y3YA 2V35A 5F8XA 2JH6D 2WPIS 3MTYA 3MI4A 1Y3UA 3BTGE 2G4UA 1GJ6A 3SNBA 1G32B 8KME2 2Z9GA 4JZFH 1A46H 1P2KA 2F9UA 1OXGA 1NTPA 4ASHA 3M5NA 1V2JT 2VB0A 4KGAA 1PPHE 4PROA 1GHZA 1QB9A 1ELDE 2PV9B 2WYJA 3R0FA 1VCPA 1ACBE 2WPHS 2ODPA 1NPMA 2R2MB 1Q2WA 1T8LA 1A0LA 1HJAB 2PWXA 4YTAA 4ZHLU 4WH8A 3QUMP 1SG8B 5AF9H 1ELBA 1OWDA 2ZDMA 1ZTKA 3FP6E 1HAHH 4AZ2B 2A4RA 2ZFSA 1N6YA 1GI7B 4ESTE 1SFIA 1RTFB 2G55A 2VINA 5DP7A 3ZYDA 1K28D 1MCVA 2ASUB 3ZVGA 1TRNA 1L2EA 1O38A 3W94A 3DD2H 1HAYB 1Z8IB 2BXTH 2PHBA 4UFFH 1ZMNA 3A8DA 3KGPA 1ID5H 1UTOA 4BTTB 1TQ0B 2FYQA 3LC3A 1TPSA 3BF6H 4D76A 2ESTE 2UWOA 2O8LA 3Q77A 1NC6A 1SLUB 1AU8A 1WCZA 3UNQA 5GXPA 4MTBA 2CHAC 1QL8A 1H9IE 3FZZA 3U1IB 1QJ6B 2SFAA 1TMBH 1CGJE 5EODA 2W3KA 3SQHE 3TK6A 2GCHG 4BTUB 3LU9B 2Y7XA 2FOEA 2J94A 1GJ7B 3SHCH 1DUAA 1P12E 1FY3A 1ZPCA 3A8BA 1BTPA 5L6NH 2ZHWH 2VVCA 1ELTA 1WUNH 1XUKA 1ZPZA 2W5EA 1PPZA 1CHOG 2Z9KA 1GGDB 4DIIH 2ZPRA 4GHQA 1V2PT 4MPWA 1LCYA 1TNKA 1AKSB 1YBWA 1IOEA 3V0XA 4J1YA 4OS2A 3I78A 5F6MA 2FO9A 3NZIA 1F92A 3GY5A 1C5SA 3RLYH 4Y76A 5ETXA 4I8HA 2I6SA 1RIWC 1EUFA 1QA0A 1GI6A 3KF2A 4Y11E 3SU0A 4B1TA 1KXDA 3U8TH 3LONA 4B2AA 2CV3A 1XM1A 3EAJA 2BVRH 2Y80A 4UDWH 3CENA 3TITA 1GI9B 4KKDA 1ZTLA 1P0SH 1NU9A 3SJ9A 3PLKA 2A5IA 2WUCA 4CR5A 3HKJB 3BTKE 3TVJB 1HDTH 2K1QA 5AVDA 3SNDA 3MU1A 1P02A 1QURH 4KTSA 2AGEX 3VB5A 2SGAA 2IPHA 2Q6FA 5DP9A 4DIHH 3KQBA 3HGNA 4DY7B 1JRTA 1GJ4H 4X1PU 1O2ZA 1K21H 5EU8A 3SV2H 1MTSA 4NWLA 4Y7BA 3BIVH 1J17T 1RS0A 1O3AA 1MTNB 4BTIB 3W95A 3S69A 1UVUH 3A84A 4OGXA 2ODQA 1O3JA 1G9IE 1KXAA 3SGAE 3E0NB 1KXFA 2ZP0H 3TH2H 2Z94A 2J95A 2VWOA 2NU1E 2H5DA 2PUQH 3T29A 2FI5E 1NN6A 1FUJA 3P8FA 4GLYA 4YESB 1SGCA 3KL6A 1WTGH 5FHTA 3ZYEA 1A0JA 3RU4D 3PMJA 4X6MA 1Z71A 1LVYA 4THNH 4YOIA 4O3UA 1FAXA 1SVPA 4NG9H 2FODA 5CHAC 2DUCA 1AFQC 2ALPA 5E2PA 1HAVA 5TJXA 1FDPA 1DWDH 4UFEH 4UD9H 1Y3XA 1NRQH 3BTTE 3E90B 2FTLE 3VXFH 3K2UA 1SGPE 1O3BA 5T6DA 3RXHA 1QFKH 2BQ7B 2P8OB 4K5ZA 1C5YB 3SOSA 1ZHPA 1DXWA 5EQRA 1O2LA 4X0WU 4A1TA 1Z6JH 3GCTG 1P05A 5JBAS 6ESTA 1D6WA 3P8OA 2PLXA 4AN7A 5C3NA 3SI3H 3BTEE 3VGCC 1UMAH 2VGCC 1BBRK 1GPZA 3TH3H 3SHAH 1F7ZA 4AX9H 1QL7A 4YOJA 1BJUA 1EPTB 1E37B 2ZDAH 2JH0D 3UOUA 3LJJA 4ABFA 1TGSZ 1P57B 2FM2A 1CBWC 1O33A 2TGAA 1C1WH 1FPHH 1V2RT 1TAWA 5C2ZA 3QZRA 1W0ZU 2A4QA 3UY9A 3ENSB 1RJXB 1O2VA 2ILNA 1C1UH 1QRZA 1AQ7A 4FUJA 1SL3A 7KMEH 3MH6A 1ORFA 1OKXA 1SGEE 1O3PB 3ZZ5A 3OSYA 1BDAA 1CE5A 1UTKA 2LPRA 4HGCA 2VIOA 2AIQA 1AWHB 2H2ZA 2Q6GA 1V2UT 3T62A 2FMJA 2EEKA 4H4FA 2RDLA 1J16A 3MU5A 1QQ4A 1BTZA 1CGIE 1V2OT 2ANKH 3SO3A 3UQVA 3U1JB 5A8YA 1P8VC 5JB8S 1UTLM 4TYDA 1NU7B 2FEQH 5DGJA 5EQQA 5A2MH 2XTTB 1DY9A 1JBUH 4Y8YA 3ATIA 1HAIH 1QL9A 3E1XB 1RTKA 5EXLA 4ZKRU 1BIOA 3LGTA 5EG4A 3BG8A 1WOFA 1L4ZA 1TONA 1LO6A 1O5CB 3LGWA 3S7HB 3HK3B 1N6XA 5T6GA 1NY22 2A7HA 4RN6A
chains in the Genus database with same CATH superfamily
1D4PB 2Y6TA 1SGRE 1XX9A 1ZR0A 2EC9H 3RXBA 1F0SA 2QXHA 1EOLA 4FVDA 3F9HA 1BITA 1TGBA 2F91A 2PKSB 4WF8A 1PQ8A 1IQJA 4MDSA 3RM2H 3MNBA 1V2TT 3RXPA 3K6YA 1C2KA 1B5GH 2C8ZB 5FX6A 3ZZ9A 2P95A 3SV7A 1C1PA 3RXQA 3S7KB 2QF3A 1J8AA 4M9FA 1DWBH 3GY6A 3GY4A 4JZEH 2QXJA 4TWYA 4UE7H 4DOQA 3M7TA 2JJ2D 4GSOA 3GS9A 2H9EH 4D7FA 1FY1A 3LOXA 2BVSH 4ZCNA 2ZFPH 2AYWA 1S5SA 5I25A 3SNCA 2GDEH 3QO6A 4NZLA 7ESTE 2W7SA 4AGKA 3T27A 4AG1A 4OS7A 5GDSH 1GCTC 1MTWA 5E8EH 2FP7B 4I8JA 1TMUH 1PPEE 1DOJA 2Z9JA 1XKBC 3DA9B 1OYQA 3NWUA 2Y5GA 4NSVA 1DVAH 4HI3A 5F03A 1C2HA 1HAOH 2F3CE 1O2QA 4Y6DA 4K1TA 5FPSA 1KYNA 5DP4A 4I8KA 2BDHA 2PSYA 2RA3A 3BTHE 5GPIB 5AFYH 4KP0A 2BVXH 4BAKB 3QDZB 1VGCC 2ZKSA 1GI1A 1IQFA 1DFPA 1LPZB 3E16B 3OFND 2D26C 1NRSH 3SU3A 1DS2E 1AVWA 2V0BA 2OC8A 3HATH 1YM0A 4AFSA 1C4V2 1PYTC 4X2WA 1TLDA 2EI8A 2OINA 1OS8A 1YPEH 1O39A 4LOYH 1BTXA 4I8GA 4BAQB 4OM9A 1AUTC 1MZAA 3RP2A 1MUEB 5A09A 1AO5A 2J9NA 5E0JA 2ZNKH 4I32A 1ABIH 3A83A 1O5FH 5KECA 2GTBA 4INKA 4KELA 1DWCH 1BMLA 1T4UH 1T8NA 2A31A 1WTHD 1MBQA 4FU7A 2ZDLA 2HNTF 4ABIA 4CRDA 2GZ7A 5CE1A 2XBYA 2DE9A 1LVOA 1GMCG 2GT7A 1V2WT 4XBBA 1P2JA 1O3EA 2V6NA 3JZ2B 4X6NA 3SORA 2G5VA 1O36A 1MMJN 4U01A 3A7YA 2ZHFH 3LH3A 3FAOA 6LPRA 2Y81A 4ZMAH 2BDBA 3OAAD 1K1JA 3UIRA 2RFKC 1FNIA 1YKTA 3VEQB 3H5CB 1Q3XA 4JZDH 1BZXE 1TYNA 4MPVA 2GZ8A 4WJG2 1CA8B 2VIVA 2HLCA 1HNEE 1P2MA 3BTDE 1BCUH 1W3CA 2XOKD 4VGCC 5TCCA 4CHAC 1GHXH 1WDIA 5DK1A 4WMEA 1LKBA 3AAUA 4UFDH 1YP9A 2ZHEH 2FOMB 1TNIA 1CU1A 2A32A 4OS5A 2PKAB 1CQQA 4OS4A 5HM2A 1TPOA 3RMLH 1BTYA 3RXDA 2V3HH 2P93A 4HZHA 3GYMA 4GCHG 1SQTA 7GCHF 2BMGB 1YGCH 3TU7H 1GJBB 2IJOB 2W6JD 3U8OH 4IBLH 5FPTA 3D49H 2BD5A 1GBTA 1BQYA 1FIZA 3RXMA 1E38B 2SNWA 1A3BH 1E35B 1CSOE 1ETRH 1O2TA 1O2OA 1EAUA 3PRDA 9ESTA 2Y5FA 3GDVA 1GBAA 1CHOF 1GVKB 5A0AE 1WXRA 5HXFA 1BHXB 1AB9C 1ZGIA 4IMZA 2XRCA 1BRUP 1MZDA 4O9VA 3T2NA 3BG4C 2BZ6H 1GHVH 1GBDA 3KN2A 3OYPA 3AVZA 2A2XH 1ZJDA 2PR3A 4NA9H 3UNRA 4Z0KA 3LDXH 2BY9X 1AMHA 2GX4A 2IOTA 5GNDA 3SYJA 3ZV9A 2F83A 1C5UA 3KYFA 1P2QA 3ZZ4A 1YC0A 3MWIU 3Q3XA 3RMNH 3OX7U 1CO7E 5C20A 3DFJA 4ISNA 5FPYA 4YT7H 4AB8A 1K9OE 1HBTH 4ABDA 2JIZD 1XUIA 2QXIA 3F2GA 2JJ1D 1LKAA 4UONA 3TH4H 2GDDA 4B6EA 4ABEA 1V2MT 3BEIB 1AZZA 2D2DA 2XC4A 2BY7X 3TJNA 1DX5M 1C5LH 1MTVA 1XMNB 1K1IA 1INCA 1LHFH 3SZNA 2AH4X 4JMYA 3ZVCA 1UCYH 4DJZB 2F4LA 4TY6A 3ZZ7A 1F0RA 1YPHC 4UFGH 2EQNA 4GUXA 1GHBF 3VFEA 2WZQA 1EX3A 3OY6U 2H6MA 1EZUC 1MBMA 1JMOH 8GCHG 2STAE 1L4DA 1C5QA 3P70B 2G4TA 1HAXB 1O3IA 2ZCHP 1A61H 1UK2A 3MYWA 1IQLA 1ANCA 1FXYA 4NIXA 3T25A 1GBEA 2VU8E 1G3BA 1QBNA 3EA8A 3UFAA 1A3EH 1SPJA 1QHRB 3MO6A 3TIUA 1LHDH 1N8OC 1Z8GA 2OC1A 4XD7D 8ESTE 1Q31A 5G4BA 3A85A 1W7GH 1D3PB 4B76A 2ZFQH 4A7IB 3SV9A 2QIQA 2ZF0H 2EI7A 1Y3WA 2F9OA 1BMFD 2CHAB 3AASA 1GHWH 3GDUA 3KCGH 2STBE 5DP3A 5IK2D 4X8TH 4KTCA 1PYTD 1OWJA 4X2VA 1BRCE 1S81A 1NM6A 1ZHRA 1OHHD 4F49A 1SQOA 5A8ZA 1V2NT 1SBWA 1VITG 4I31A 3SU4A 1BTHH 3IITA 2IN2A 5JB9S 1HIAA 3B8JA 1EB2A 1C1MA 2RA0A 1EATA 2ZCLP 1GBMA 1IHSH 1KLTA 3EA7A 5EOKA 3EQ0H 5CDFE 2O8MA 1WQSA 1D3TB 1O2XA 2BLOA 3TNSA 2ZDNA 3BTME 4SGBE 2PP6A 4U2WA 1A5GH 1ELAA 3LKWA 1XUGA 2GVFA 4YM9A 4NWKA 1S84A 1DXPA 2PW8H 1RIWB 1YLDA 1FQ3A 4NA7A 4LK4A 1GJ5H 2OUAA 2P94A 5K0HA 1HJAC 1YCPK 3BSQA 2OP9A 1UCYE 1DUEA 1GBCA 2ANYA 1NRRH 3PWCA 3NKKA 1MQ5A 4RSPA 1FY4A 4I33A 1C1NA 1P2IA 6CHAC 1HCGA 5T6FA 1RGQA 1MAXA 1QJ1B 3GCHC 2C8YB 1O2SA 2OXSA 1TWXB 1BOQA 3MNCA 1A1RA 1N1LA 3I29A 2J4IA 1THSH 2AMQA 4INHA 1OWKA 1H8IH 1NESE 3ATLA 3OTPA 2FLRH 2BX4A 1PQ7A 3UAIC 2HWLB 5C67A 3ZVAA 1MKWK 1BTUA 1C5ZB 4H6TA 1L1NA 3O8BA 3L3TA 1E34B 5C1YA 1HLTH 3RXKA 1GVLA 1TQ7B 4Q7ZA 4WMFA 3PWBA 2OC7A 3VB6A 1TB6H 2ZGJA 3SJIA 3RXAA 1TRYA 4ABHA 1SLXB 1P06A 2FI3E 1GMDG 1NO9H 2NU3E 1JIRA 4ZROA 1ELEE 4K1EA 1SGIB 1TIOA 2ZEBA 2J34A 1KY9A 1SLVB 2VH0A 5H4IB 3ZZCA 4X2YA 3H7OA 1X7AC 1UVOA 1SHYA 2J2UA 1GHAG 3UR9A 3KEEA 3AAVA 4K1SA 3RC6A 2CF9H 3E6PH 1GJDB 3A81A 3FANA 4FXGH 4NGAH 3GOVB 1W0YH 2NU0E 1ABJH 4DVAU 2XWAA 1LTOA 1O3KA 1AFQB 1A4WH 3A80A 2XYAA 4WH6A 1FJSA 1DICA 1FPCH 2BDCA 4B74A 2XBWA 1IHTH 3KQDA 2IJD1 1O5EH 3QX5H 4ZHMU 1KDQB 1VJ9U 3VB3A 4BAHB 5CHBA 1YYY1 3PM3A 3STIA 1FI8A 3BN9A 3HGPA 1C1QA 1AD8H 3N99A 3RXRA 1DITH 1SLWB 5LPEA 1MCTA 2FOFA 1DLEA 1OWIA 1P04A 1K0HA 3N7OA 1FY5A 4CBOA 2VIDA 4NIVA 4U30A 2BY8X 1QZ8A 4AOQA 3ZIAD 3AW0A 2VGCB 3SI4H 1T8OA 1J9CH 1GBBA 3UREA 1MD8A 1C2IA 2ULLA 1ELVA 3C27B 4ACBA 3ATMA 3UOPA 1CBWB 1PPGE 1G36A 5EXNA 1O2RA 2B7DH 2VIPA 1GDQA 4MNWA 3T26A 4AFUA 1AWFH 3U9AH 5EQSA 1BJVA 4ZKNU 1SFQB 2JETC 3UR6A 3KIDU 3SW2B 2BXUH 1XXFA 3MOCA 2BD2A 2P3UB 1F5LA 2ZC9H 3Q3KA 1IQEA 3F9EA 1K1MA 4JYVH 2NWNA 3A8AA 3DSPA 5K7RA 3IWMA 1KLJH 1Z1IA 4WY3A 1QR3E 2YNBA 2ZCKP 1TRMA 4RKJB 1WBGB 5LGOA 5C94A 1ZOMA 3PMHB 1EASA 1AFEH 1LQDB 1Y5UT 3RXCA 3S9AA 2GZ9A 1KXCA 2OBOA 1MU8B 3TNTA 3S9CA 1A0HB 3LT3A 4A5TS 2AMDA 3M61U 2Z3CA 4MG3A 1P09A 3V12A 2EI6A 3MU8A 2TPIZ 3M36A 4LXBH 1ESTA 1H9LB 2BM2A 2R9PA 3NPSA 2QA9E 2ZU3A 3KNXA 2ZU4A 3S0NA 4DURA 1G30B 3KQCA 4AFZA 2V3OH 2WPMS 2KCOA 1TPPA 1YPGH 1QY6A 5LPFA 1DE7H 2BY5X 3FP7E 4MQAA 2RCEA 4A92A 1QNJA 3MMGA 2C8WB 2CF8H 1KMHB 1QQUA 1SC8U 5BRRE 3RXSA 3MHWU 5DG6A 2WPKS 3RXEA 1O3OA 1NFUA 4P00A 1EOJA 3RMMH 4TY7A 1EJAA 3URDA 1W12U 1UHBB 3MNXA 1P3EA 1C2FA 1S0RA 3ZZBA 2Z9IA 1NFXA 2ZPQA 3UB0A 5BPEA 2KAIA 4ZXXH 1GJ8B 5EXMA 1BRBE 5DP8A 1NZQH 1O35A 4IC6A 1CA0B 3M5OA 4FOUC 1V6DA 1ZPBA 2VH6A 2HNTE 3WW7A 4ZKSU 1OOKB 1UVTH 3QN7A 1QGFA 3BEUA 4INLA 2UUYA 2XC0A 5F8ZA 2A5AA 1CT2E 1WSSH 3Q76A 1ZTJA 1P2NA 2ZIQH 2GD4B 5EIYA 1XVOA 2A7JA 3A86A 3RXIA 1XKAC 5E0GA 3SU1A 1O5BB 4Q7YA 1P9SA 1GBKA 3UPEA 2AGGX 3RU4E 1ZRBA 5E2OA 1PQ5A 3GY3A 1RFNA 5HGGA 1VGCB 1XUJA 5B6OA 2B9LA 4Y0ZE 5GJ4B 2DE8A 1DT2A 2M5TA 1YPHE 2ZTZA 1FN6A 3F2FA 3PO1C 1ELGA 1ESBA 4JK6A 1H8DH 3ZZAA 4MNYA 1MKXK 1ZRKA 3SUEA 2K0QA 2FIRH 1GG6B 5HYOA 1O3CA 1E36B 4X1NU 3L6PA 1TFXA 3LC5A 5AHGH 1UTQA 2ZHDA 2QF4A 2Q6DA 3QGNB 2PKSC 5ESBA 1C2JA 1GMHF 2AGIX 1Z8RA 1YPKH 1SB1H 2QF5A 3RXOA 2XCNA 5EJZA 1EZQA 1TGNA 3PRBA 1WQVH 2PTCE 3OE7D 3UQOA 1THPB 1C1RA 3RXFA 2JDID 2C93B 1TGCA 2ZHQH 3NRLA 4IMQA 3MQKC 4Y71A 4AB9A 2BY6X 5FBEA 1B0EA 1Z7KA 5GCHF 4MLFB 1F5KU 4AC9A 1AN1E 1HAVB 4K8YA 4FVBA 5A8XA 5EPYA 1ZSKA 5DN6D 1FONA 1H9HE 2P59A 2YOLA 1C5OH 2WV4A 1CT0E 1TNLA 3MH4A 1TX7A 5JYIA 2BDIA 2FTMA 4DW2U 8GCHF 1ZMLA 4X6PA 1YF4A 3A89A 3SGQE 3Q00A 1K1OA 1KLIH 3URCA 1TOMH 2ZTYA 2BB4A 3PMBB 1ARCA 2KM0A 2G5NA 1GVZA 3SU6A 4VGCB 3RC5A 2Q1JA 1OP2A 2C4FH 1O37A 4CR9A 4E06H 1K1LA 2YMSC 1SKYE 1V2ST 1ZZZA 4Q7XA 1PJPA 3U98H 4IN1A 4Q63A 4RT0A 2WV9A 1QB6A 3PV5A 3NUMA 7LPRA 3P8GA 2QYIA 1W0KD 1QBVH 1OX1A 1VZQH 1TX8A 1Z6EA 2BDAA 5HIYA 3LGVA 2AS9A 2BD7A 2PTNA 2QAAA 1W2KH 1GJCB 2WPJS 1EJMA 1NT1A 3SV8A 1NFYA 3TK9A 4I7YH 2J98A 3DT0H 1P01A 2OTVA 3TJVA 2Y82A 3PV4A 1TALA 4B2BA 1TBQH 4FU9A 1LPGB 5JBCS 2FDAA 1GJ9B 3A8CA 4XDEA 3SUFA 1AB9B 1YPMH 2PUXB 1NRNH 3AW1A 4AGJA 1HUTH 2GMTC 4FUCA 2SGFE 1THRH 3BG4B 2OD3B 3OEHD 4IC5A 3FZDA 2Y7ZA 2LNCA 1D3DB 1O32A 3F1SB 2ZQ2A 4E7RG 2A2QH 5PTPA 2AEIH 1AKSA 3P8NA 1ZSJA 4X8VH 2R0LA 2TGTA 1UTMA 3LGUA 2GCHF 1O2UA 4TT3D 3T5FH 2KFWA 4QT8C 2H9TH 4SGAE 2QN5T 1O3DA 3PLBA 3ZVDA 3A7WA 2XBVA 2ZGBH 2FOCA 1FIWA 5DJ7A 3ODFA 2H9HA 3TJOA 3HKIB 1UW7A 2CXVA 3ODDA 4ABBA 1FZZA 2F9VA 2FWWA 1GL0E 5EW1H 2Z7FE 1O3LA 1G3EA 1K2I1 1O0DH 2F9NA 4FUEA 3F9FA 2JKHA 1GI0A 3ESTA 3RMOH 1WAYB 1LHGH 3B23B 3RXTA 1HRTH 2ZFRH 3FO8D 4CBNA 1K1NA 4NZQA 2J5UA 2HVYB 3KYGA 2VIQA 4YOGA 5FXLA 4XOJA 2QGRA 3DFLA 1LVBA 4JK5A 4ZHAA 1F5RA 5L30H 1C2LA 3RDZA 5C0UA 1W7XH 1MH0A 1EAXA 1O2WA 1WV7H 2A0QB 3Q3YA 3F9GA 2PGBB 1QB1A 2UUJB 4NA8A 3BV9B 4OS6A 1GBFA 2XCFA 3A7ZA 2BLQA 2O8UA 4WXVA 3VXEH 5ABWA 2H1UA 2ZECA 1N8OB 1O2IA 3UTUH 4BAMB 1YWUA 2BDGA 1L1GA 2CGAA 1FY8E 1C9TA 4ACAA 1J15A 3IG6B 1C5XB 2HOBA 1J14A 1ANEA 3CNRA 1B7XB 2ZU5A 5A0BA 2G8TA 3UNSA 4H6SB 4E7NA 3A87A 1TPAE 1ELFA 1SGFG 2BX3A 1Y5AT 2UUKB 3QWCH 1LDTT 1TX6A 1F0UA 2XW9A 3A7XA 1OWHA 3VG8A 2GCTC 2G00A 3RM0H 1A5IA 1V2KT 1AY6H 1P9UA 4WVPE 1BMMH 3NCLA 1AHTH 4NSYA 3ZVEA 4IGDA 3KQEA 1CGHA 3M35A 4MVNA 2FOAA 3GISB 2CJIA 1V3XA 5EGMA 2OCVB 3C1KA 4X8SH 2ODYB 2LP6A 1G3DA 2TRMA 1XXDA 4IS5A 3M5MA 3U8RH 2BHGA 1L0ZA 3M5LA 1HAPH 2A7CA 4FUBA 3RXLA 4X6OA 4Y79A 3SJ8A 3HK6B 4ABGA 2C8XB 2B0FA 3H7TA 4CH8B 2P3TB 4CRCA 2SGQE 4TSFD 2RG3A 2XXLA 1C2GA 1SGNE 1EKBB 3OU0A 2VBCA 4B2CA 1LQEA 4O97A 2JH5D 3M3TA 5CMXH 2FOGA 3LJOA 1SOTA 4YO9A 1RD3B 4GPGA 3GY2A 1GCDA 2KX4A 3LPRA 4AORA 1E1QD 6CHAB 1EPTA 1K1PA 3EDXB 1O30A 3GCHB 5KEDA 1TA6A 4LZ4B 3GCTF 4MPUA 5C0TA 2GT8A 1C5WB 2QC2A 1GI8B 2UUFB 2GV7A 1S85A 1O2KA 3DUXH 2YMSD 3M7QA 6GCHG 3LGIA 1AVGH 1SGDE 1W10U 3ZVFA 1GDUA 1O31A 1ARBA 4NFEA 3SU2A 2O9QA 3RC4A 1FV9A 3N7EA 3D65E 2A5KA 1SQAA 1OSSA 2BOHB 3V13A 1E1RD 3LIWA 7GCHG 1G2LA 4Q4LA 3HPTB 4DGJA 2ZWLH 3MNSA 1GJAB 4Y7AA 3WWFA 5B6LA 2BYAX 1C1VH 1PQAA 1QIXB 3MFJA 1IAUA 1HXFH 5T3HA 4XBCA 1S83A 1B0FA 1O3MA 1A5HA 1BUIA 3M37A 2PSXA 3TPIZ 2BD8A 2A1DB 2F9BH 1S6HA 1UHBA 8LPRA 3EYDA 4YLUA 4HFPB 1D6RA 1BTWA 1TBRH 4XSKU 1C2DA 5FCKA 3FVFB 1O3HA 2C90B 4K60A 1A2CH 1NRPH 1FAKH 4FU8A 4NIWA 1C5MD 3PTNA 2J38A 2XNIA 2ZI2H 4YT6H 5FX5A 4FUGA 1H8HD 2QF0A 2QV1A 1TGTA 3MO3A 4HTCH 2OBQA 5DP5A 3M3VA 3MH7A 3TGKE 2WYGA 2QY0B 2VNTA 2W3IA 1TE0A 2BD3A 1GGDC 4XBDA 2FESH 4R0IA 2AFQB 4FUDA 3CP7A 3MH5A 3TGJE 1HPGA 3PMAB 2WHXA 2XWBI 5T1VA 5CHAB 4CREA 1C5NH 1V2QT 1HXEH 1O2MA 3QTVH 4AYVB 2KR7A 3VB7A 3W1EA 3GY7A 2HVXA 2FS9A 1GHBG 1LPKB 2IPQX 2ZGCA 3G01A 4YZUA 1ESAA 3PYHA 2BOKA 2LELA 1HYLA 3ATKA 1XUHA 4TPIZ 1WYKA 1D9IA 1BB0B 4K3JA 5ESTE 3ELAH 1S0QA 2BD4A 4Z1MD 1YLCA 1TA2A 1U6QA 1MQ6A 3SJKA 4FUHA 1SSXA 4ZH8A 2JETB 4CRFA 1H1BA 2ZPSA 3QGJA 4ZAEA 4AFQA 5SGAE 3K9XB 3A88A 1BRAA 2GKVE 2FX4A 1W8BH 3ITIA 3VGCB 1LVMA 5JBBS 1ETSH 1GBHA 4JYUH 1QCPA 5JPMH 4BAOB 2ZU1A 2AERH 1LHCH 2BQWB 3I77A 4Y10E 5DO4H 4D9QA 1V2LT 4K8BA 1UK4A 3MU4A 1LMWB 3FKSD 3LH1A 1W13U 1UTJA 3P92A 3RLWH 1IQHA 1DWEH 5HMAA 4ABJA 1ZJKA 2NU4E 2ZGXH 2ZG0H 3SJOA 1EQ9A 1C5TA 1MTNC 4BXWA 3RUOA 4WWYA 1CT4E 2P16A 2UWPA 3SGBE 4TWWA 2ZU2A 3QZQA 4MNVA 1BA8B 4B75A 2BD9A 2CMYA 1MU6B 1ETTH 4FETA 2ALVA 3SNEA 5C5OA 1KTTB 3SQEE 1OWEA 3KQ5A 2HPQH 3A82A 4BANB 1C5PA 1P10A 3ATWA 2ZTXA 1FLEE 5FAHA 3OY5U 3F6UH 1ELCA 4F4OC 2WPLS 4JCNA 1TNHA 5E0HA 4ISOA 2R3UA 2A4OA 2R2WU 5DKMA 3RXGA 3EGKH 5GWZA 4Y8ZA 1C5RA 4DG4A 3CS0A 5C1UA 2FS8A 2G52A 3OTJE 2O8WA 4FUFA 3TGIE 3P17H 3QK1A 5AFZH 1AE8H 1G2MA 1HIAB 1O2PA 2D8WA 3E8LA 2ZZUH 3BEFB 1DSUA 2J97A 3E91A 1VITH 4BXSA 3T28A 4J2YB 3B9FH 1YCPM 1L1JA 4CRBA 5TCAA 3M3SA 2VJ1A 1SHHB 2TGDA 1TBZH 4NCYA 1OP8A 2GV6A 2ZGHA 3FOAA 4MNXA 3GICB 4R8TB 1C2EA 5FCRA 2OLGA 4HG6A 3QTOH 1CVWH 2P8OC 3DCLA 3DSGA 3MU0A 2W6ID 4TPYA 4Y0YE 1AGJA 3GCOA 4B71A 1O3NA 1GMCF 1ZMJA 3LGYA 1GWAA 2G51A 1MAYA 1HAZB 1KXBA 1XUFA 3VPKA 2ZFFH 3FN8A 3S9BA 1GI3A 1Y3VA 1SGFA 3NK8A 4X8UH 2SGEE 2VIWA 1G37A 4ZUHA 2ZA5A 1O3GA 1YCPH 3VB4A 2BZAA 1BMAA 3PROA 3PB1E 1BMNH 3M7UA 4B73A 1EPTC 2FI4E 1M9UA 2PKAA 1Z8JB 5DP6A 4XFQA 3NXPA 1ZYOA 5LH8A 3DHKH 4I86A 1DLKB 1AUJA 1H8ED 1C4U2 1JRSA 4MPXA 1EB1H 1C9PA 2OK5A 2K8IA 2ANMH 2GGVB 2OQUA 1JXPA 3FFGA 4ISHH 4OS1A 4GAWA 4X2XA 1QJ7B 1UVSH 4A1VA 2VVVA 1MKWH 3PO1B 3CS7A 1PPBH 3N7DA 5C1XA 3SU5A 2HGTH 1GCTB 4K2YA 2WV5A 1GBLA 1O2GH 3A7TA 1A7SA 3F3BA 3SZEA 1HGTH 2HRVA 2ZO3H 1FX0B 1O5GH 4GCHF 2VWLA 3AK5A 2Z6BD 3MO9A 1FN8A 1SMFE 2CN0H 1H4WA 1SGYE 1DM4B 4OGYA 3E3TA 1T7CA 2HPPH 2P3FH 4UEHH 1O2NA 4WXIA 1PPCE 1UO6A 3UUZA 1E0FD 2OQ5A 2THFB 1HFDA 1P3CA 2SNVA 1GHYH 1ZLRA 2ZDKA 1AVXA 1NBMD 1UK3A 2FPZA 1NS3A 1T32A 3K6ZA 1TNGA 3BIUH 5EPNA 3ZZDA 1VJAU 3V3MA 1JOUB 1O5AB 3GYLB 1GBIA 3P95A 5FBIA 5LPRA 2FLBH 4ISLA 1O3FA 3D23A 3F68H 4X1QU 3RU4T 4AG2A 1UCYK 3RXJA 1QTFA 1RTLA 3WY8A 3KHVA 4ZXYH 1CA0C 2Z9LA 2KZ4A 1EAWA 2A4GA 3BTWE 4O3TA 1E79D 4B6FA 2TGPZ 1W14U 5F8TA 2B8OH 2Z3EA 1AZ8A 1HJ9A 1MTUA 1C1SA 3RXVA 1JIMA 3PV2A 1P11E 2AMPA 2HALA 3EE0B 1IQMA 1UTNA 2EA3A 3L33A 2R3YA 1TABE 1C5VA 2A45B 3GY8A 3ZZ8A 4ABAA 2TBSA 2O8TA 1O2HA 1KTSB 1NROH 4AYYB 3SNAA 2YMSB 5FL7D 1QA7A 1C1TA 3V7TA 4LZ1H 1TNJA 4Q80A 3SV6A 2L74A 1VCWA 1HV7A 1GBJA 3SN8A 3O8RA 4X1SU 2VWMA 3UWJH 2WPDD 4JZIA 1C1OA 1OPHB 1CHGA 2F43B 1IQGA 1IQKA 3SUDA 3O8CA 1O2JA 3E0PB 3QLPH 1DY8A 2Y5HA 5IDKA 2RDEA 2SGDE 1SGTA 3TK5A 1GI2A 1TOCB 5F53A 2YNAA 1GG6C 5HM9A 4H42U 2NU2E 4CHAB 4BNRA 1QBOA 2FOHA 1ZHMA 1W0JD 1VR1H 2FOBA 2V7QD 1BBRH 4JZ1A 1S6FA 2GMTB 1O34A 1SOZA 4F55A 3PLPA 1PFXC 1SI5H 3F0PA 4WMDA 5DPAA 1ZGVA 2J92A 1O5DH 1YPLH 2BTCE 2FZZA 4X1RU 5KGOA 5EW2H 2HLDD 2B5TB 2BQ6B 5A0CA 2C3SA 3BTQE 4IN2A 3P6ZB 2QXGA 4KTUA 4M7GA 5JBTA 1QRWA 1F2SE 5IYTA 1TMTH 3TJUA 4D8NA 1VITF 1Y8TA 1DANH 2XBXA 4D9RA 4IW4E 1BHXF 1P03A 3K65B 1EZSC 2D1JA 1LHEH 1KSNA 3U69H 1V2VT 1KIGH 1ANDA 2I6QA 4CRGA 3GCNA 3STJA 2SGPE 1QRXA 2VVUA 1UJ1A 4O03A 1T4VH 5HKKD 1ZSLA 1UVPA 2ZDVH 4E05H 2XC5A 4XE4A 5JDUB 3BTFE 1OP0A 3RXUA 3SUGA 9LPRA 1O2YA 1JWTA 4JYTA 6GCHF 3R3GB 1D3QB 1EJNA 1F0TA 1GI5A 1DSTA 2WUBA 3JZ1B 1MD7A 3H09A 1UTPA 1BT7A 2GP9B 5L2ZH 2AIPA 1T31A 1EAIA 1YY3A 1SGQE 1NBME 2W26A 4DCDA 2KAIB 2V3MA 3O8DA 5J4QA 1MABB 2FYRA 4GHTA 1RRKA 1Y5BT 2BDYA 4GVUA 3ZV8A 4ZKOU 1IQIA 5C5NA 4CRAA 3FP8E 1AI8H 3DSOA 2BLVA 1XVMA 3ZVBA 1AE5A 1PPFE 4U32A 2UWLA 4DT7B 1DPOA 1NFWA 1Y59T 2L6OA 4Z6AH 2FXRA 3ZZ3A 4NIYA 1P2OA 1ANBA 1K22H 4RKOB 2AHME 4FUIA 1WU1A 3GDSA 1EXFA 1BBRE 1EP5A 2TIOA 1GL1A 4Q2KA 1SR5C 2Z3DA 2F9PA 1G3CA 2HNTC 2ZFTA 2VWNA 2GCTB 1YPJH 4D7GA 1GMDF 4A6LA 2OC0A 1VCQA 2KCPA 1YLNA 2QCYA 3UWIA 1GI4A 1KXEA 1Z1JA 4NFFA 2R0KA 4I8LA 1EZXC 1GMHG 1HJ8A 2G81E 5I46H 3ZZ6A 2ANWA 2ZQ1A 3PTBA 1DDJA 1GHAF 1HAGE 1GDNA 1KDQA 4ISIH 1C2MA 1AIXH 1IQNA 2PFEA 1HB0B 3SBKA 2H5CA 2WINI 3D62A 2FX6A 2W7UA 5GCHG 1S82A 1MKXH 3EA9A 5GIBA 4BOHA 4K69A 4CH2B 2BLWA 1FMGA 4Y8XA 4YLQH 4A1XA 5J4SA 3A7VA 1T8MA 2KCYA 3TLOA 1C4Y2 1W11U 2PGQB 1EP6A 1RXPA 5L2YH 1OYTH 1Y3YA 2V35A 5F8XA 1COWD 2JH6D 2WPIS 3MTYA 3MI4A 1Y3UA 3BTGE 2G4UA 1GJ6A 3SNBA 1G32B 8KME2 2Z9GA 4JZFH 1A46H 1P2KA 2F9UA 1OXGA 1NTPA 4ASHA 4YXWD 3M5NA 1V2JT 2VB0A 4KGAA 1PPHE 4PROA 1GHZA 1QB9A 1ELDE 2PV9B 2WYJA 3R0FA 1VCPA 1ACBE 2WPHS 2ODPA 1NPMA 2R2MB 1Q2WA 1T8LA 1A0LA 1HJAB 2PWXA 4YTAA 4ZHLU 4WH8A 3QUMP 1SG8B 5AF9H 1ELBA 4RT1A 1OWDA 2ZDMA 1ZTKA 4RI0A 3FP6E 1HAHH 4AZ2B 2A4RA 2ZFSA 1N6YA 1GI7B 4XRNA 4ESTE 2WSSD 1SFIA 1RTFB 2G55A 2VINA 5DP7A 3ZYDA 1K28D 1MCVA 2ASUB 3ZVGA 1TRNA 1L2EA 1O38A 3W94A 3DD2H 1HAYB 1Z8IB 2BXTH 2PHBA 4UFFH 1ZMNA 3A8DA 3KGPA 2M2AA 1ID5H 1UTOA 4BTTB 1TQ0B 2FYQA 3LC3A 1TPSA 3BF6H 4D76A 2ESTE 2UWOA 2O8LA 3Q77A 1NC6A 4ASUD 1SLUB 1AU8A 1WCZA 3UNQA 5GXPA 4MTBA 2CHAC 1QL8A 1H9IE 3FZZA 3U1IB 1QJ6B 2SFAA 1TMBH 2J98B 1CGJE 5EODA 2W3KA 3SQHE 3TK6A 2GCHG 4BTUB 3LU9B 2Y7XA 2FOEA 2J94A 1GJ7B 3SHCH 1DUAA 1P12E 1FY3A 1ZPCA 3A8BA 1BTPA 5L6NH 2ZHWH 2VVCA 1ELTA 1WUNH 1XUKA 1ZPZA 2W5EA 1PPZA 1CHOG 2Z9KA 1GGDB 4DIIH 2ZPRA 4GHQA 1V2PT 4P02A 4MPWA 1LCYA 1TNKA 1AKSB 1VKYA 1YBWA 1IOEA 3V0XA 4J1YA 4OS2A 3I78A 2CK3D 2FO9A 5F6MA 3NZIA 1F92A 3GY5A 1C5SA 2KCAA 3RLYH 4Y76A 5ETXA 4I8HA 2I6SA 1RIWC 1EUFA 1QA0A 1GI6A 3KF2A 4Y11E 3SU0A 4B1TA 1KXDA 5EJLA 4F48B 3U8TH 3LONA 4B2AA 2CV3A 1XM1A 3EAJA 2BVRH 2Y80A 4UDWH 3CENA 3TITA 1GI9B 4KKDA 1ZTLA 1P0SH 1NU9A 3SJ9A 3PLKA 2A5IA 2WUCA 5DSFA 4CR5A 3HKJB 3BTKE 3TVJB 2XNDD 1HDTH 2K1QA 5AVDA 3SNDA 3MU1A 1P02A 1QURH 4KTSA 2AGEX 3VB5A 2SGAA 2IPHA 2Q6FA 5DP9A 3EE7A 4DIHH 3KQBA 3HGNA 2GJGA 4DY7B 1JRTA 1GJ4H 4X1PU 1O2ZA 1K21H 5EU8A 3SV2H 1MTSA 4NWLA 4Y7BA 3BIVH 1J17T 1RS0A 1O3AA 1MTNB 4BTIB 3W95A 4DT4A 1SQRA 3S69A 1UVUH 3A84A 2QE7D 4OGXA 2ODQA 1O3JA 1G9IE 1KXAA 3SGAE 3E0NB 1KXFA 2ZP0H 3TH2H 2Z94A 2J95A 2VWOA 2NU1E 2H5DA 2PUQH 3T29A 2FI5E 1NN6A 1FUJA 3P8FA 4GLYA 4YESB 1SGCA 3KL6A 1WTGH 5FHTA 3ZYEA 1A0JA 3RU4D 3PMJA 3U28C 4X6MA 1Z71A 1LVYA 4THNH 4YOIA 4O3UA 1FAXA 1SVPA 4NG9H 2FODA 5CHAC 2DUCA 1AFQC 5HIZA 2ALPA 5E2PA 1HAVA 5TJXA 1FDPA 1DWDH 4UFEH 4UD9H 1Y3XA 1NRQH 3BTTE 3E90B 2FTLE 3VXFH 3K2UA 1SGPE 1O3BA 3OEED 5T6DA 3RXHA 1QFKH 2BQ7B 2P8OB 4K5ZA 1C5YB 3SOSA 1ZHPA 1DXWA 5EQRA 1O2LA 4X0WU 1EFRD 4A1TA 1Z6JH 3GCTG 1P05A 5JBAS 6ESTA 1D6WA 3P8OA 2PLXA 4AN7A 5C3NA 3SI3H 3BTEE 3VGCC 1UMAH 2VGCC 1BBRK 1GPZA 3F2HA 3TH3H 3F0OA 3SHAH 1F7ZA 4AX9H 1QL7A 4YOJA 1BJUA 1EPTB 1S6LA 1E37B 2ZDAH 2JH0D 3UOUA 3LJJA 4ABFA 2EY4C 1TGSZ 1P57B 2FM2A 1CBWC 1O33A 2TGAA 1C1WH 1FPHH 1V2RT 1TAWA 5C2ZA 3QZRA 1W0ZU 2A4QA 5EJ1A 3UY9A 3ENSB 1RJXB 1O2VA 3WWBA 2ILNA 1C1UH 1QRZA 1AQ7A 4FUJA 1SL3A 7KMEH 3MH6A 1ORFA 1OKXA 1SGEE 1O3PB 3ZZ5A 3OSYA 1BDAA 1CE5A 1UTKA 2LPRA 4HGCA 2VIOA 2AIQA 1AWHB 2H2ZA 2Q6GA 1V2UT 3T62A 2FMJA 2EEKA 5C17A 4H4FA 2RDLA 1J16A 3MU5A 1QQ4A 1BTZA 1CGIE 1V2OT 2ANKH 3SO3A 3UQVA 3U1JB 5A8YA 1P8VC 5JB8S 1UTLM 4TYDA 1NU7B 2FEQH 5DGJA 5EQQA 5A2MH 2XTTB 1DY9A 1JBUH 4Y8YA 3ATIA 1HAIH 1QL9A 3E1XB 1RTKA 5EXLA 4ZKRU 1BIOA 3LGTA 5EG4A 3BG8A 1WOFA 1L4ZA 1TONA 1LO6A 1O5CB 3LGWA 3S7HB 3HK3B 1N6XA 5T6GA 1NY22 2A7HA 4RN6A
chains in the Genus database with same CATH topology
1D4PB 2Y6TA 1SGRE 1XX9A 1ZR0A 2EC9H 3RXBA 1F0SA 2QXHA 1EOLA 4FVDA 3F9HA 1BITA 1TGBA 2F91A 2PKSB 4WF8A 1PQ8A 1IQJA 4MDSA 3RM2H 3MNBA 1V2TT 3RXPA 3K6YA 1C2KA 1B5GH 2C8ZB 5FX6A 3ZZ9A 2P95A 3SV7A 1C1PA 3RXQA 3S7KB 2QF3A 1J8AA 1DWBH 3GY6A 3GY4A 4JZEH 2QXJA 4TWYA 4UE7H 4DOQA 3M7TA 4GSOA 2H9EH 4D7FA 1FY1A 3LOXA 2BVSH 2ZFPH 2AYWA 1S5SA 5I25A 3SNCA 2GDEH 3QO6A 4NZLA 7ESTE 2W7SA 4AGKA 3T27A 4AG1A 4OS7A 5GDSH 1GCTC 1MTWA 5E8EH 2FP7B 4I8JA 1TMUH 1PPEE 1DOJA 2Z9JA 1XKBC 3DA9B 1OYQA 3NWUA 2Y5GA 4NSVA 1DVAH 4HI3A 5F03A 1C2HA 1HAOH 2F3CE 1O2QA 4Y6DA 4K1TA 5FPSA 1KYNA 5DP4A 4I8KA 2BDHA 2PSYA 2RA3A 3BTHE 5GPIB 5AFYH 4KP0A 2BVXH 4BAKB 3QDZB 1VGCC 2ZKSA 1GI1A 1IQFA 1DFPA 1LPZB 3E16B 2D26C 1NRSH 3SU3A 1DS2E 1AVWA 2V0BA 2OC8A 3HATH 1YM0A 4AFSA 1C4V2 1PYTC 4X2WA 1TLDA 2EI8A 2OINA 1OS8A 1YPEH 1O39A 4LOYH 1BTXA 4I8GA 4BAQB 1AUTC 1MZAA 3RP2A 1MUEB 5A09A 1AO5A 2J9NA 5E0JA 2ZNKH 4I32A 1ABIH 3A83A 1O5FH 2GTBA 4INKA 4KELA 1DWCH 1BMLA 1T4UH 1T8NA 2A31A 1WTHD 1MBQA 4FU7A 2ZDLA 2HNTF 4ABIA 4CRDA 2GZ7A 5CE1A 2XBYA 2DE9A 1LVOA 1GMCG 2GT7A 1V2WT 4XBBA 1P2JA 1O3EA 2V6NA 3JZ2B 4X6NA 3SORA 2G5VA 1O36A 1MMJN 4U01A 3A7YA 2ZHFH 3LH3A 3FAOA 6LPRA 2Y81A 4ZMAH 2BDBA 1K1JA 3UIRA 1FNIA 1YKTA 3VEQB 3H5CB 1Q3XA 4JZDH 1BZXE 1TYNA 4MPVA 2GZ8A 4WJG2 1CA8B 2VIVA 2HLCA 1HNEE 1P2MA 3BTDE 1BCUH 1W3CA 4VGCC 5TCCA 4CHAC 1GHXH 5DK1A 4WMEA 1LKBA 3AAUA 4UFDH 1YP9A 2ZHEH 2FOMB 1TNIA 1CU1A 2A32A 4OS5A 2PKAB 1CQQA 4OS4A 5HM2A 1TPOA 3RMLH 1BTYA 3RXDA 2V3HH 2P93A 4HZHA 3GYMA 4GCHG 1SQTA 7GCHF 2BMGB 1YGCH 3TU7H 1GJBB 2IJOB 3U8OH 4IBLH 5FPTA 3D49H 2BD5A 1GBTA 1BQYA 1FIZA 3RXMA 1E38B 2SNWA 1A3BH 1E35B 1CSOE 1ETRH 1O2TA 1O2OA 1EAUA 9ESTA 2Y5FA 3GDVA 1GBAA 1CHOF 1GVKB 5A0AE 5HXFA 1BHXB 1AB9C 1ZGIA 4IMZA 2XRCA 1BRUP 1MZDA 4O9VA 3T2NA 3BG4C 2BZ6H 1GHVH 1GBDA 3KN2A 3OYPA 3AVZA 2A2XH 1ZJDA 2PR3A 4NA9H 3UNRA 4Z0KA 3LDXH 2BY9X 1AMHA 2GX4A 2IOTA 3ZV9A 2F83A 1C5UA 1P2QA 3ZZ4A 1YC0A 3MWIU 3Q3XA 3RMNH 3OX7U 1CO7E 5C20A 3DFJA 4ISNA 5FPYA 4YT7H 4AB8A 1K9OE 1HBTH 4ABDA 1XUIA 2QXIA 1LKAA 4UONA 3TH4H 2GDDA 4ABEA 1V2MT 3BEIB 1AZZA 2D2DA 2XC4A 2BY7X 3TJNA 1DX5M 1C5LH 1MTVA 1XMNB 1K1IA 1INCA 1LHFH 3SZNA 2AH4X 4JMYA 3ZVCA 1UCYH 4DJZB 4TY6A 3ZZ7A 1F0RA 1YPHC 4UFGH 4GUXA 1GHBF 3VFEA 1EX3A 3OY6U 2H6MA 1EZUC 1MBMA 1JMOH 8GCHG 2STAE 1L4DA 1C5QA 3P70B 2G4TA 1HAXB 1O3IA 2ZCHP 1A61H 1UK2A 3MYWA 1IQLA 1ANCA 1FXYA 4NIXA 3T25A 1GBEA 2VU8E 1G3BA 1QBNA 3EA8A 3UFAA 1A3EH 1SPJA 1QHRB 3MO6A 3TIUA 1LHDH 1N8OC 1Z8GA 2OC1A 8ESTE 1Q31A 5G4BA 3A85A 1W7GH 1D3PB 4B76A 2ZFQH 4A7IB 3SV9A 2QIQA 2ZF0H 2EI7A 1Y3WA 2F9OA 3AASA 2CHAB 3GDUA 1GHWH 3KCGH 2STBE 5DP3A 4X8TH 4KTCA 1PYTD 1OWJA 4X2VA 1BRCE 1S81A 1NM6A 1ZHRA 4F49A 1SQOA 5A8ZA 1V2NT 1SBWA 1VITG 4I31A 3SU4A 1BTHH 3IITA 2IN2A 5JB9S 1HIAA 3B8JA 1EB2A 1C1MA 2RA0A 1EATA 2ZCLP 1GBMA 1IHSH 1KLTA 3EA7A 5EOKA 3EQ0H 2O8MA 1WQSA 1D3TB 1O2XA 2BLOA 3TNSA 2ZDNA 3BTME 4SGBE 4U2WA 1A5GH 1ELAA 3LKWA 1XUGA 2GVFA 4YM9A 4NWKA 1S84A 1DXPA 2PW8H 1RIWB 1YLDA 1FQ3A 4NA7A 4LK4A 1GJ5H 2OUAA 2P94A 5K0HA 1HJAC 1YCPK 3BSQA 2OP9A 1UCYE 1DUEA 1GBCA 2ANYA 1NRRH 3PWCA 3NKKA 1MQ5A 4RSPA 1FY4A 4I33A 1C1NA 1P2IA 6CHAC 1HCGA 5T6FA 1RGQA 1MAXA 1QJ1B 3GCHC 2C8YB 1O2SA 2OXSA 1TWXB 1BOQA 3MNCA 1A1RA 1N1LA 3I29A 1THSH 2AMQA 2J4IA 4INHA 1OWKA 1H8IH 1NESE 3ATLA 2FLRH 2BX4A 1PQ7A 2HWLB 5C67A 3ZVAA 1MKWK 1BTUA 1C5ZB 4H6TA 1L1NA 3O8BA 3L3TA 1E34B 5C1YA 1HLTH 3RXKA 1GVLA 1TQ7B 4Q7ZA 4WMFA 3PWBA 2OC7A 3VB6A 1TB6H 2ZGJA 3SJIA 3RXAA 1TRYA 4ABHA 1SLXB 1P06A 2FI3E 1GMDG 1NO9H 2NU3E 1JIRA 4ZROA 1ELEE 4K1EA 1SGIB 1TIOA 2ZEBA 2J34A 1KY9A 1SLVB 2VH0A 5H4IB 3ZZCA 4X2YA 3H7OA 1X7AC 1UVOA 1SHYA 2J2UA 1GHAG 3UR9A 3KEEA 3AAVA 4K1SA 3RC6A 2CF9H 3E6PH 1GJDB 3A81A 3FANA 4FXGH 4NGAH 3GOVB 1W0YH 2NU0E 1ABJH 4DVAU 2XWAA 1LTOA 1O3KA 1AFQB 1A4WH 3A80A 2XYAA 4WH6A 1FJSA 1DICA 1FPCH 2BDCA 4B74A 2XBWA 1IHTH 3KQDA 1O5EH 3QX5H 4ZHMU 1KDQB 1VJ9U 3VB3A 4BAHB 1YYY1 3PM3A 3STIA 1FI8A 3BN9A 3HGPA 1C1QA 1AD8H 3RXRA 1DITH 1SLWB 5LPEA 1MCTA 2FOFA 1DLEA 1OWIA 1P04A 3N7OA 1FY5A 4CBOA 2VIDA 4NIVA 4U30A 2BY8X 4AOQA 3AW0A 2VGCB 3SI4H 1T8OA 1J9CH 1GBBA 3UREA 1MD8A 1C2IA 2ULLA 1ELVA 3C27B 3ATMA 3UOPA 1CBWB 1PPGE 1G36A 5EXNA 1O2RA 2B7DH 2VIPA 1GDQA 4MNWA 3T26A 4AFUA 1AWFH 3U9AH 5EQSA 1BJVA 4ZKNU 1SFQB 2JETC 3UR6A 3KIDU 3SW2B 2BXUH 1XXFA 3MOCA 2BD2A 2P3UB 1F5LA 2ZC9H 3Q3KA 1IQEA 3F9EA 1K1MA 4JYVH 2NWNA 3A8AA 5K7RA 3IWMA 1KLJH 1Z1IA 4WY3A 1QR3E 2YNBA 2ZCKP 1TRMA 4RKJB 1WBGB 5LGOA 1ZOMA 3PMHB 1EASA 1AFEH 1LQDB 1Y5UT 3RXCA 3S9AA 2GZ9A 1KXCA 2OBOA 1MU8B 3TNTA 3S9CA 1A0HB 3LT3A 4A5TS 2AMDA 3M61U 2Z3CA 4MG3A 1P09A 3V12A 2EI6A 3MU8A 2TPIZ 3M36A 4LXBH 1ESTA 1H9LB 2BM2A 2R9PA 3NPSA 2QA9E 2ZU3A 3KNXA 2ZU4A 3S0NA 4DURA 1G30B 3KQCA 4AFZA 2V3OH 2WPMS 1TPPA 1YPGH 1QY6A 5LPFA 1DE7H 2BY5X 3FP7E 4MQAA 2RCEA 4A92A 1QNJA 3MMGA 2C8WB 2CF8H 1QQUA 1SC8U 5BRRE 3RXSA 3MHWU 5DG6A 2WPKS 3RXEA 1O3OA 1NFUA 1EOJA 3RMMH 4TY7A 1EJAA 3URDA 1W12U 1UHBB 3MNXA 1P3EA 1C2FA 1S0RA 3ZZBA 2Z9IA 1NFXA 2ZPQA 5BPEA 2KAIA 4ZXXH 1GJ8B 5EXMA 1BRBE 5DP8A 1NZQH 1O35A 4IC6A 1CA0B 3M5OA 1V6DA 1ZPBA 2VH6A 2HNTE 4ZKSU 1OOKB 1UVTH 3QN7A 1QGFA 3BEUA 4INLA 2UUYA 2XC0A 5F8ZA 2A5AA 1CT2E 1WSSH 3Q76A 1ZTJA 1P2NA 2ZIQH 2GD4B 1XVOA 2A7JA 3A86A 3RXIA 1XKAC 5E0GA 3SU1A 1O5BB 4Q7YA 1P9SA 1GBKA 3UPEA 2AGGX 3RU4E 1ZRBA 5E2OA 1PQ5A 3GY3A 1RFNA 5HGGA 1VGCB 1XUJA 5B6OA 2B9LA 4Y0ZE 5GJ4B 2DE8A 1DT2A 2M5TA 1YPHE 2ZTZA 1FN6A 3PO1C 1ELGA 1ESBA 4JK6A 1H8DH 3ZZAA 4MNYA 1MKXK 1ZRKA 3SUEA 2FIRH 1GG6B 5HYOA 1O3CA 1E36B 4X1NU 3L6PA 1TFXA 3LC5A 5AHGH 1UTQA 2ZHDA 2Q6DA 3QGNB 2PKSC 5ESBA 1C2JA 1GMHF 2AGIX 1Z8RA 1YPKH 1SB1H 3RXOA 2XCNA 1EZQA 1TGNA 1WQVH 2PTCE 3UQOA 1THPB 1C1RA 3RXFA 2C93B 1TGCA 2ZHQH 4IMQA 4Y71A 4AB9A 2BY6X 5FBEA 1B0EA 1Z7KA 5GCHF 4MLFB 1F5KU 1AN1E 1HAVB 4K8YA 4FVBA 5A8XA 5EPYA 1ZSKA 1FONA 1H9HE 2P59A 2YOLA 1C5OH 2WV4A 1CT0E 1TNLA 3MH4A 1TX7A 5JYIA 2BDIA 2FTMA 4DW2U 8GCHF 1ZMLA 4X6PA 1YF4A 3A89A 3SGQE 3Q00A 1K1OA 1KLIH 3URCA 1TOMH 2ZTYA 2BB4A 3PMBB 1ARCA 2G5NA 1GVZA 3SU6A 4VGCB 3RC5A 2Q1JA 1OP2A 2C4FH 1O37A 4CR9A 4E06H 1K1LA 1V2ST 1ZZZA 4Q7XA 1PJPA 3U98H 4IN1A 1QB6A 3NUMA 7LPRA 3P8GA 2QYIA 1QBVH 1OX1A 1VZQH 1TX8A 1Z6EA 2BDAA 3LGVA 2AS9A 2BD7A 2PTNA 2QAAA 1W2KH 1GJCB 2WPJS 1EJMA 1NT1A 3SV8A 1NFYA 3TK9A 4I7YH 3DT0H 1P01A 2OTVA 3TJVA 2Y82A 3PV4A 1TALA 4B2BA 1TBQH 4FU9A 1LPGB 5JBCS 2FDAA 1GJ9B 3A8CA 4XDEA 3SUFA 1AB9B 1YPMH 2PUXB 1NRNH 3AW1A 4AGJA 1HUTH 2GMTC 4FUCA 2SGFE 1THRH 3BG4B 2OD3B 4IC5A 3FZDA 2Y7ZA 2LNCA 1D3DB 1O32A 3F1SB 2ZQ2A 4E7RG 2A2QH 5PTPA 2AEIH 1AKSA 3P8NA 1ZSJA 4X8VH 2R0LA 2TGTA 1UTMA 3LGUA 2GCHF 1O2UA 3T5FH 4QT8C 2H9TH 4SGAE 2QN5T 1O3DA 3PLBA 3ZVDA 3A7WA 2XBVA 2ZGBH 2FOCA 1FIWA 5DJ7A 3ODFA 2H9HA 3TJOA 3HKIB 2CXVA 3ODDA 4ABBA 1FZZA 2F9VA 2FWWA 1GL0E 5EW1H 2Z7FE 1O3LA 1G3EA 1K2I1 1O0DH 2F9NA 4FUEA 3F9FA 2JKHA 1GI0A 3ESTA 3RMOH 1WAYB 1LHGH 3B23B 3RXTA 1HRTH 2ZFRH 4CBNA 1K1NA 4NZQA 2VIQA 4YOGA 5FXLA 4XOJA 2QGRA 3DFLA 1LVBA 4JK5A 4ZHAA 1F5RA 5L30H 1C2LA 3RDZA 1W7XH 1MH0A 1EAXA 1O2WA 1WV7H 2A0QB 3Q3YA 3F9GA 2PGBB 1QB1A 2UUJB 4NA8A 3BV9B 4OS6A 1GBFA 2XCFA 3A7ZA 2BLQA 2O8UA 4WXVA 3VXEH 5ABWA 2H1UA 2ZECA 1N8OB 1O2IA 3UTUH 4BAMB 2BDGA 1L1GA 2CGAA 1FY8E 1C9TA 1J15A 3IG6B 1C5XB 2HOBA 1J14A 1ANEA 1B7XB 2ZU5A 5A0BA 2G8TA 3UNSA 4H6SB 4E7NA 3A87A 1TPAE 1ELFA 1SGFG 2BX3A 1Y5AT 2UUKB 3QWCH 1LDTT 1TX6A 1F0UA 2XW9A 3A7XA 1OWHA 2GCTC 2G00A 3RM0H 1A5IA 1V2KT 1AY6H 1P9UA 4WVPE 1BMMH 3NCLA 1AHTH 4NSYA 3ZVEA 4IGDA 3KQEA 1CGHA 3M35A 4MVNA 2FOAA 3GISB 2CJIA 1V3XA 5EGMA 2OCVB 3C1KA 4X8SH 2ODYB 1G3DA 2TRMA 1XXDA 4IS5A 3M5MA 3U8RH 2BHGA 1L0ZA 3M5LA 1HAPH 2A7CA 4FUBA 3RXLA 4X6OA 4Y79A 3SJ8A 3HK6B 4ABGA 2C8XB 2B0FA 3H7TA 4CH8B 2P3TB 4CRCA 2SGQE 2RG3A 2XXLA 1C2GA 1SGNE 1EKBB 3OU0A 4B2CA 1LQEA 4O97A 2JH5D 3M3TA 5CMXH 2FOGA 3LJOA 1SOTA 4YO9A 1RD3B 4GPGA 3GY2A 1GCDA 3LPRA 4AORA 6CHAB 1EPTA 1K1PA 3EDXB 1O30A 3GCHB 1TA6A 4LZ4B 3GCTF 4MPUA 2GT8A 1C5WB 2QC2A 1GI8B 2UUFB 2GV7A 1S85A 1O2KA