1F92A

Urokinase plasminogen activator b chain-uki-1d complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
247
structure length
247
Chain Sequence
b'IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title Crystals of the urokinase type plasminogen activator variant beta(c)-uPAin complex with small molecule inhibitors open the way towards structure-based drug design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 57
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2000-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f92A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f92A01
3QTOH 1JIMA 3HKIB 4Q7YA 5LGOA 3ZZ6A 1GI9B 3I78A 1O3HA 2HNTF 5DK1A 1A46H 3W95A 4NA8A 1QBOA 1FLEE 3HK6B 2NU1E 4DG4A 1OWKA 4IGDA 1DWEH 4XFQA 4E06H 2ZPRA 1AFQB 1OKXA 1BRUP 2ZGJA 2OBOA 3GY7A 2FWWA 4Y11E 3S0NA 1EOJA 1O2ZA 3PWBA 1NROH 1V3XA 3LH3A 3RDZA 4A1XA 2QYIA 3E16B 4AB8A 3SORA 5DO4H 2XWBI 1P04A 1D4PB 1S5SA 1NM6A 1NFXA 1C2JA 2A7CA 3GY2A 1YPGH 4X8VH 1BTZA 3GDSA 3M35A 2ZP0H 1SQTA 1VITF 2SGPE 5EQQA 1GBLA 1IQGA 1TRNA 5DP6A 1E36B 1TOCB 3A7TA 1GI3A 3U8TH 5LPRA 1YLCA 1LHCH 3ZZAA 1GBBA 2A45B 1KXAA 2V3HH 3MFJA 3K65B 1LHFH 3UQVA 1UK4A 1OWIA 3SUFA 1TPOA 3NXPA 1JRTA 5ABWA 3SU2A 4NA7A 1KY9A 1MMJN 4AGJA 1P06A 2GP9B 1DANH 3WY8A 1ZJDA 1SQAA 1UCYE 3T29A 6GCHG 1O2TA 1ANCA 2GZ7A 1GI5A 1QL8A 4NFFA 3H7TA 1Z8RA 2QY0B 1V2UT 1EB1H 3NK8A 3M61U 3RC4A 2ZFSA 2NU3E 3GDVA 1GMCF 1GHBF 4I7YH 3MYWA 3SUEA 1ZR0A 3O8CA 5EQSA 3M5MA 2BD8A 4CR9A 1O37A 2A2QH 1TNIA 1MKWK 2B9LA 1KIGH 1ZGIA 1SLXB 2F9NA 3QX5H 4X6NA 1A61H 2RA3A 3LOXA 2OC1A 3GY6A 1TRYA 4YM9A 5CE1A 3RXRA 3AW0A 2HVXA 3KNXA 3P17H 1DSTA 2ASUB 5FXLA 1KLIH 1A0LA 3ATLA 2Q6DA 2XC5A 1P2NA 2FOHA 4Q7XA 3T28A 2A2XH 1B5GH 1AWFH 1TGBA 1K2I1 1P0SH 1THPB 2GGVB 1ELTA 2ZHDA 5E0HA 4X1RU 3URCA 1CE5A 1FI8A 1XM1A 2GTBA 1SQOA 1VITG 3A8BA 4J2YB 2OXSA 1SHHB 2O8MA 5C20A 4B71A 3P92A 1TPPA 2G4UA 1G3EA 2ZI2H 1CA0C 4TWWA 1O2YA 5GPIB 4BXWA 3QGNB 1AFQC 1BIOA 2TGTA 3E90B 1V2MT 4LZ1H 1BZXE 1THSH 3EAJA 2AMDA 2BY6X 2SGDE 1MTVA 3U9AH 1HAPH 1N6YA 3LGYA 3EQ0H 1UHBA 2I6SA 1FY5A 5DP7A 4YO9A 1BMAA 1P9SA 3RUOA 1GMCG 3KQBA 3SNBA 3DT0H 2UUFB 1GJDB 2ZDLA 1WCZA 1Z6JH 1RS0A 2QXIA 2P59A 2P8OB 1P2JA 4DURA 1C1QA 2ZGBH 1FMGA 4YOJA 5A8YA 1BRCE 3TNTA 4YLUA 4CREA 1SGDE 4WMDA 1UHBB 1J9CH 3S69A 1YPJH 2UWPA 1UCYK 5A8XA 3DHKH 1TNLA 1C1OA 1TNJA 1FZZA 3CS0A 5EU8A 4TY7A 1J14A 1DS2E 4Y0ZE 3AAUA 1BRAA 4ABDA 1F0SA 3BIUH 1O2GH 1NFWA 4ISNA 4YT7H 5EXNA 2HNTC 2FLBH 4M7GA 1L1NA 2ODQA 1G3DA 2ZGCA 3PWCA 1F92A 3UNRA 4MPUA 3PTBA 4NWKA 2Q6GA 1BUIA 4X1QU 3TGKE 5DP5A 1FDPA 1GHZA 3T25A 1TMUH 2XTTB 3SW2B 7ESTE 1OWHA 3TJNA 1EPTA 1WYKA 5JPMH 1S82A 3I77A 1ZPBA 2PUQH 1A4WH 1O5AB 1VCQA 5DP4A 3DFLA 3UQOA 1D6RA 1VCPA 1YPHE 4ASHA 1ZZZA 5B6OA 1O3OA 4AFZA 3A87A 2ZPSA 1TQ7B 4Y0YE 1PPEE 1A5GH 1BA8B 1AUJA 3E0PB 3FP7E 2FTMA 3NZIA 2GMTB 1HXFH 1O30A 1BTUA 1RRKA 1O2RA 4WH8A 1O3NA 1AB9B 7KMEH 1O2IA 4UFFH 4K60A 1ZMNA 2CMYA 2TPIZ 1CSOE 5JB8S 3LONA 9ESTA 1XXFA 3AW1A 5GJ4B 3RU4D 5EGMA 4D9QA 1MTNB 3UR6A 2EC9H 2ZNKH 3E91A 2QCYA 3QTVH 1V2ST 2Y5FA 3QN7A 3TJOA 1EP5A 1E38B 2ZPQA 2WPJS 2BLVA 1K1JA 3Q3KA 2J2UA 1GJCB 1E37B 1FAKH 1FJSA 3LGTA 1B0FA 3ENSB 1UTMA 1C2EA 4IBLH 4J1YA 3VXFH 1V2KT 5A8ZA 3QWCH 3MU4A 3TJUA 1K1IA 1TGSZ 3M5LA 4JCNA 3KF2A 4LOYH 1XKAC 3RXEA 3TU7H 3RXAA 1HAVA 1TGCA 1ELGA 2FI3E 2J95A 1C1NA 2B8OH 3BTHE 1BBRK 1HLTH 1AZZA 1GDUA 2P8OC 5EQRA 1CBWB 4UFGH 1DXWA 3BEIB 3TK9A 3JZ2B 4CRCA 3VB3A 1DPOA 5G4BA 3T27A 2GKVE 1G2LA 3SU5A 1O32A 4DGJA 3VXEH 3ODFA 5DP9A 1GI0A 1L1JA 2UWOA 2LPRA 3RXMA 3M7TA 2I6QA 1HAVB 4CRFA 3GY8A 4UD9H 4DIHH 4XDEA 4CRGA 1BTWA 3MH4A 2P3TB 5DP8A 2SFAA 2H9HA 1MBMA 4X2WA 2BM2A 1C2FA 2JETB 3MTYA 5LPEA 5AFYH 1UK3A 2PTNA 1Y3YA 1O36A 1H1BA 2OC7A 2AYWA 3BTEE 3RM2H 1O38A 2WYGA 2Y7ZA 4BAHB 2CV3A 1QBNA 2QC2A 4ABBA 4INHA 4OS1A 1DDJA 3E1XB 3K6ZA 1KLJH 3NPSA 4KP0A 1ZHRA 4ZXXH 2BDIA 1L4DA 1NRRH 2R3YA 1C2MA 1TAWA 4GCHG 2A4QA 4K8BA 8ESTE 4I32A 1WQSA 1HAOH 3BG4B 3HGPA 2QXJA 2XBVA 3F68H 2GMTC 2VU8E 2VWLA 1ZTJA 4OS2A 2ZKSA 1AB9C 2FXRA 4YOIA 1O3BA 4D7FA 1MTNC 4MDSA 2F9OA 5HGGA 2C90B 1BOQA 3S9BA 1MTUA 2AS9A 1G32B 4XE4A 2XC0A 3AVZA 3TH2H 2ODYB 1OS8A 3C27B 2OC8A 1GVZA 5TJXA 3M3VA 1HDTH 2ZDKA 1DM4B 1TX7A 1KXBA 3N7OA 3SJ8A 1GBIA 3FP6E 1LMWB 3MNXA 3PYHA 1RGQA 3SU1A 4ISIH 2GT7A 1CGIE 1O5DH 1ARBA 1D6WA 1C5XB 1ID5H 2HWLB 4CR5A 2BVSH 1ZRBA 3PMAB 1C9PA 5A0AE 1HJ8A 5FHTA 2VWNA 1YPKH 3ZZBA 2ZGXH 3BSQA 1HB0B 2BVRH 2Z3DA 2ZEBA 2H9TH 1VITH 3SJ9A 2ALPA 4MNXA 3PM3A 1CBWC 2WPHS 1CGHA 3S7KB 1SVPA 2BDAA 1BBRH 2VIDA 4K1SA 3LGVA 1GBMA 1SGTA 1P11E 1XUGA 2BOHB 2BY7X 2F9BH 4RSPA 2JH5D 4GHQA 5FPSA 1O5BB 5CHAB 2QF0A 2ZTZA 2FO9A 1KTSB 3U8OH 2AEIH 2AIQA 1OX1A 3DD2H 1HJAB 1O3AA 5EODA 1L0ZA 1TNGA 1ETSH 4INLA 4Y6DA 1FQ3A 4U2WA 2QXGA 1NO9H 4KTUA 4AFSA 2ZCHP 3GCNA 1P2MA 3PMBB 3RC6A 1NN6A 2JH0D 5DKMA 2JETC 1P9UA 3PMHB 1BRBE 1O2KA 5EW2H 4FU7A 1GL0E 1O2LA 4AG2A 3P8FA 1QB1A 2VNTA 2A7JA 1LPZB 1IAUA 4TWYA 1Q31A 3ZZDA 1ELBA 1ZRKA 1BTHH 1Y3WA 1HNEE 5LH8A 2R2WU 3LGUA 3D65E 1QQ4A 4FVBA 4ABIA 3ZZ8A 4JK5A 1SOTA 2EI7A 2Y5HA 1GVKB 3BG4C 1TRMA 2ZU2A 2ANYA 4WMEA 1D3TB 1O39A 3F9EA 1NFUA 4I8HA 3ATIA 1EJAA 5AF9H 4K5ZA 1T32A 1ANEA 2VVUA 4HZHA 4CHAB 1HAYB 5C3NA 1ZHPA 5A09A 1K1NA 1XUKA 2PW8H 2OCVB 4ABHA 5A0CA 2FI4E 4NIWA 1CHOF 1AKSA 1LQEA 2HOBA 4NSYA 3TIUA 4JZFH 1O3MA 3D62A 3HGNA 1OWDA 1ORFA 1YPMH 1NS3A 4A7IB 4GUXA 4NIYA 3VB6A 3BF6H 1PQAA 2FS9A 1UVPA 1KXEA 5GCHF 1TGTA 1FPHH 5EXLA 1HPGA 1LHDH 2OLGA 1RTFB 1SLVB 1W7GH 3L6PA 1AKSB 2FOMB 3SGBE 3VGCB 5HM9A 1WUNH 1O2WA 1GBJA 3U69H 1BT7A 1DSUA 1MKXH 2LNCA 2IN2A 1QJ7B 1H9LB 5HM2A 3KQCA 2GZ9A 3DFJA 3SQHE 3BG8A 1P2KA 3ZZ3A 2PLXA 3VB4A 2IJOB 2O8LA 1G30B 1G3BA 2GX4A 1T4VH 1IQNA 3MU5A 1A1RA 1FY3A 4YESB 5CHAC 1G36A 1VCWA 1O2XA 2A32A 4Q2KA 1AUTC 5E2OA 5JB9S 1O2HA 2ZHQH 3P8GA 1HJAC 1F5RA 3Q3XA 4XBBA 2Z7FE 1V2PT 1DE7H 2ZU1A 1CA0B 4KTSA 5CMXH 4TPIZ 1B7XB 2A4OA 5F8XA 2P94A 3UTUH 2XBWA 1ZYOA 2BX4A 3STIA 3SGQE 1CVWH 2BD7A 1QCPA 4B2AA 3URDA 2XCFA 2A0QB 5E0JA 2ANKH 1QURH 4E7RG 3A85A 1AI8H 1TA6A 1WU1A 2QIQA 1UMAH 1CHOG 2PSYA 2ZWLH 2AFQB 7LPRA 3FVFB 4CH2B 2EA3A 2FYRA 1SGCA 4NSVA 1S0RA 3VEQB 3UUZA 1Y3XA 4X1PU 4DJZB 1H8DH 2CF8H 4ZHMU 1W14U 3O8BA 4KGAA 3BEUA 1DX5M 3TVJB 2OBQA 5GCHG 3SGAE 1C5YB 1KXDA 3Q77A 1F2SE 2KAIA 4Y71A 2C4FH 1ACBE 4ZH8A 2FI5E 3W94A 5L2YH 1XUFA 5L30H 1LO6A 3QDZB 1LHEH 4U30A 1QIXB 2GV7A 1THRH 2D2DA 2GCHF 4CHAC 1SGIB 1P2QA 4AZ2B 1SB1H 5E0GA 2W3IA 3ITIA 2F91A 2SNWA 4CBOA 1C1RA 1T31A 2ALVA 4UFDH 4HFPB 1WBGB 1GI4A 3V7TA 1QNJA 3FZZA 4JK6A 1KLTA 6LPRA 3EA9A 1DLKB 3RXUA 2R2MB 1YKTA 1FY1A 1W0ZU 3VFEA 1ZSKA 1JXPA 4ZROA 1A0JA 1C4Y2 1C5SA 3TK5A 1TBZH 1EASA 2ZDAH 3B23B 3GISB 2FOAA 1MU8B 1MUEB 1TPAE 3VGCC 1XVOA 2ESTE 1G3CA 1GBKA 3SV7A 2G00A 1BB0B 3G01A 1F0UA 2BQ6B 1RJXB 4AG1A 2BLOA 1WQVH 1AQ7A 1IQLA 4H6SB 3QO6A 1DUAA 4H4FA 4CRBA 1GDNA 3CS7A 1K22H 1PPGE 1FNIA 1ZLRA 4I8LA 2W26A 4DIIH 1O3EA 2Z3CA 3RMNH 2BD5A 2H2ZA 5JBCS 2NU0E 3V0XA 4OS7A 3UWJH 1DICA 2BQWB 3QZQA 1TX8A 1Z1JA 4GLYA 1UTNA 2BTCE 4QT8C 2V0BA 3UPEA 4X6PA 2GV6A 1DWDH 1BTYA 2GCHG 3HKJB 5A2MH 3Q76A 1O3GA 3MHWU 3ZVCA 1NU7B 3A7ZA 3E3TA 1O5CB 2ZFTA 3HATH 1ETRH 3GY3A 4FUJA 1ARCA 1SBWA 5TCAA 1GHBG 1SGEE 2YNBA 2BHGA 3GICB 3R0FA 3ZZ7A 3QUMP 2O8UA 1LVMA 5JYIA 1AIXH 9LPRA 2PV9B 4MQAA 1BBRE 1ZSJA 4FUFA 3T5FH 2C8ZB 1NTPA 1W3CA 3OX7U 4K8YA 2D1JA 1FONA 4H6TA 4ABFA 1Z1IA 3STJA 1GVLA 1XX9A 3M36A 3KEEA 1GHXH 1L2EA 2OQUA 3RMLH 1C5OH 2PKSC 1OYTH 1UTJA 4WF8A 3U1IB 5GIBA 1FY4A 1AZ8A 5EW1H 1UTLM 2XXLA 1GJ5H 4X2VA 3F6UH 3U98H 1ELCA 2Y6TA 1H9HE 2J92A 1LVBA 3ZVGA 1GJBB 1EUFA 3ZZ9A 1ZTLA 4X8SH 1ABJH 2OD3B 1LDTT 4FUCA 4OS5A 1EZXC 1ZMLA 1Y8TA 1TNHA 1SLWB 4IS5A 3RXFA 1C5MD 2ANMH 2AMPA 4AGKA 1DUEA 1F5KU 4DY7B 1QFKH 1V2WT 1YC0A 4LK4A 1EZUC 1IHTH 4A1TA 1O2SA 1DFPA 3A80A 1TE0A 3P6ZB 1YPEH 3BTDE 3QZRA 2GVFA 1PPZA 2XC4A 3MH5A 3AAVA 1QRWA 1UTOA 1JRSA 4H42U 1O0DH 2R0LA 5GXPA 2ULLA 1QGFA 2GD4B 3RXBA 3SJIA 5HYOA 1GG6B 2WUBA 1ZMJA 2V3OH 2BMGB 2C8YB 1TGNA 3AASA 1NPMA 3S9AA 2J34A 5H4IB 2VJ1A 3SV8A 1EPTB 4TPYA 3BEFB 1UVTH 1FIWA 1A3BH 3EDXB 1O2NA 4ZKNU 3RXDA 1PPBH 1C1MA 1Y3VA 4XSKU 3E0NB 1EQ9A 5F6MA 4LXBH 4Y8YA 1BMLA 3SI4H 2JKHA 4JZEH 1DY8A 1HBTH 1BQYA 4O9VA 3SNEA 3TH4H 3EGKH 1C5RA 2F9UA 1LHGH 4GSOA 2H9EH 3F1SB 2Z9JA 5J4QA 2VB0A 3GY5A 3OY5U 4Z0KA 3L33A 1OPHB 2WPLS 3RLWH 1T7CA 1HJ9A 2OTVA 2DUCA 4K1TA 2IOTA 3QK1A 5F8TA 1HAHH 3ATKA 5AHGH 5C1YA 4UEHH 3FZDA 2ZO3H 1C1WH 1P09A 1QL7A 2A31A 2HALA 3UNQA 1CT2E 3ZV8A 2ZFRH 1T8NA 4DCDA 3B9FH 4AB9A 4Y7BA 4BANB 1HYLA 4AFUA 8KME2 2G81E 3KIDU 1AN1E 2FESH 5TCCA 2G5NA 4ZKSU 3T2NA 3DA9B 2XBXA 3SV6A 1TQ0B 1XUHA 1PYTC 2BLQA 1SFQB 2O8WA 4U01A 2AH4X 1PPCE 1RIWC 3RLYH 1DVAH 1SLUB 5IYTA 3SU3A 2ZC9H 3LGWA 1IQHA 2HGTH 1B0EA 2ZHEH 1EP6A 3SO3A 1G9IE 4GHTA 1EAXA 1O2VA 2P3UB 3SV2H 3LPRA 1V2VT 1AU8A 1TALA 2HPPH 2P16A 1JWTA 2J38A 1BCUH 2XWAA 2P93A 2EEKA 4X8TH 2G51A 5I25A 1SGQE 1O31A 3BIVH 2BY9X 4NZQA 1GJ7B 4Y8ZA 2Y7XA 3GOVB 4A5TS 2UUKB 1LTOA 4SGBE 2J94A 2OINA 4WY3A 5HMAA 4D9RA 5DG6A 1AD8H 1NRNH 5FPTA 4GAWA 4BTUB 4MPXA 1AMHA 5C67A 4FVDA 1XMNB 3O8RA 1WSSH 3EA8A 1Q3XA 3E8LA 3NWUA 4ZHLU 1OP8A 1O3KA 2PR3A 2ILNA 1IHSH 2VIQA 1O2PA 1QRXA 1GG6C 1QBVH 2ZTXA 4DT7B 3A7WA 3GYLB 3MMGA 3SHCH 3TK6A 4IN2A 2FOGA 1YYY1 1EPTC 8LPRA 1O3LA 4CRDA 5C1UA 5FBEA 1EAUA 3BTWE 2VVVA 3MO3A 2VWMA 1O2UA 1GI8B 3OU0A 4Q7ZA 1YP9A 2FTLE 2Z94A 5FCKA 1S81A 4WJG2 4Z6AH 4A6LA 2BYAX 2ZCKP 2Y80A 2YNAA 4IC5A 3PB1E 5K7RA 1MQ5A 2J4IA 3BTGE 2QAAA 3K2UA 4OS4A 1SGNE 2C8XB 1XKBC 5F03A 1KDQA 3QGJA 3UIRA 2BDGA 4OGXA 1GJ9B 4HGCA 2GDEH 1WAYB 1V2LT 2H6MA 1O3CA 5E2PA 1OP2A 1GL1A 1W13U 1ZPZA 1WV7H 2ZIQH 1C5UA 1V2QT 3IITA 1C9TA 4YLQH 4U32A 1MKXK 3A81A 4SGAE 2TRMA 3FAOA 3RXVA 1FV9A 1V2JT 2PFEA 1AVXA 2NWNA 1MCVA 1OYQA 3A8AA 3P70B 5AVDA 2QN5T 1Y5AT 3RMMH 5C2ZA 5EPYA 4KELA 1HCGA 5BPEA 3V3MA 4YT6H 2BY8X 1FN8A 3FANA 4ZKOU 2UUYA 3H5CB 1C5WB 1PYTD 2VH0A 2XW9A 3VB5A 1GGDB 4AN7A 1AWHB 1KYNA 1QR3E 3KGPA 3OY6U 2PHBA 1QQUA 4Y8XA 4AORA 1C1SA 4K3JA 3R3GB 3SUGA 1SI5H 2H5CA 4I8JA 1KXCA 1C4V2 3PLBA 3A84A 1A5HA 1V2OT 1VR1H 4ZAEA 1ZSLA 1GMHF 5FPYA 1J8AA 1K1PA 2G55A 2STAE 4MNYA 4FU9A 1O2OA 1ELEE 2PSXA 4IMQA 4K2YA 2BLWA 2BD4A 2UUJB 2B0FA 4UE7H 1QRZA 1ZHMA 2BB4A 2BDBA 3A88A 1ZOMA 1W7XH 3A86A 1T8LA 1W2KH 3V13A 2A5IA 2FOBA 2Z9KA 3M5NA 2PTCE 4MPVA 4WXIA 2TIOA 1ELFA 4B2CA 1V2TT 1NT1A 4JZIA 2FLRH 1W10U 1AHTH 2Q6FA 1DWCH 3ZVBA 3GYMA 1YPLH 4F49A 2WV4A 3DUXH 2ZGHA 4ZHAA 2VIVA 3P8NA 1ANBA 4B1TA 4AX9H 1DLEA 1EXFA 1BJUA 1GJAB 2K1QA 1EX3A 3M7QA 4IC6A 2P95A 4DOQA 3T62A 8GCHF 1W12U 3GCHB 1PFXC 1K21H 1GPZA 2HRVA 1CGJE 5DJ7A 1DXPA 1K9OE 1DY9A 4WXVA 1ANDA 1VJAU 2G4TA 4NGAH 1ELDE 1HIAA 2M5TA 2FP7B 3I29A 3MU1A 4JYTA 3PTNA 1XUIA 3A7XA 3KL6A 4D76A 1O34A 1EB2A 2NU2E 1J15A 2WPIS 1T8OA 1LCYA 1LVOA 3A7YA 1NC6A 4X8UH 2BVXH 2A4GA 3EA7A 2PUXB 3Q3YA 2GCTB 3IWMA 1GMHG 1GI2A 4ABJA 3ATMA 3RXIA 2STBE 4INKA 1AO5A 1MAYA 1HAZB 2ZDMA 2VH6A 3PMJA 1C5NH 1SGYE 3M7UA 5PTPA 1ABIH 3SOSA 1YM0A 4B75A 3KCGH 3PO1C 1GGDC 3GY4A 1JBUH 1F7ZA 1Y5BT 1E35B 1O3DA 1F5LA 4NZLA 1E0FD 1D3PB 3LC5A 2AMQA 1TONA 4ZXYH 1C5QA 2Y5GA 5EXMA 1YGCH 1A3EH 1C5TA 4JZDH 3ZZ5A 1S0QA 1GBFA 2BZAA 3PV4A 2ZFQH 4ABAA 5SGAE 1SGFA 2B7DH 6CHAB 1X7AC 1QTFA 1C2HA 3T26A 2CGAA 3RXJA 4CRAA 4NA9H 1LKAA 1OOKB 1RTKA 1SSXA 2AIPA 1MBQA 1O2QA 8GCHG 3IG6B 3RU4T 1LQDB 4ISHH 2BXTH 4TYDA 1TFXA 2P3FH 2YOLA 4Q80A 1GI6A 1N8OB 2H5DA 5LPFA 1AVGH 4FUBA 2CF9H 1UVSH 3U1JB 3RU4E 2SGQE 1Z8IB 1HAIH 2ZF0H 2FPZA 1W0YH 3JZ1B 1TB6H 2OQ5A 3MU8A 1G2MA 1D9IA 1CHGA 1GHWH 1LPGB 5FCRA 2F83A 2PKSB 3ZVFA 5HXFA 2AGEX 1LVYA 2PGBB 2XNIA 2NU4E 3QLPH 1SGFG 3RXPA 2W3KA 1Z8GA 3SHAH 1H8IH 2VIWA 1QB6A 1UVUH 2Z3EA 4Y79A 5IDKA 1GBCA 3GCHC 4YTAA 1QJ6B 2KAIB 4NFEA 5L2ZH 2WPKS 4BAQB 2RG3A 5AFZH 1O2MA 4NWLA 1OWEA 1C5ZB 1FXYA 4NG9H 1EOLA 4X6MA 1TA2A 4WVPE 1AE5A 1XVMA 1SL3A 2F3CE 3L3TA 1BMNH 2C3SA 1BMMH 2D26C 5ESTE 4FUGA 3LC3A 1MCTA 1NZQH 3MNBA 1V2NT 4BNRA 5JDUB 2GCTC 1OXGA 3OYPA 1UTPA 1IQJA 4D7GA 1C5LH 2Y81A 2Z9IA 4YZUA 4Y10E 3UWIA 1BTPA 2PKAA 1FY8E 4DW2U 3TJVA 3GDUA 2A1DB 5ETXA 2W7SA 1WOFA 3RMOH 1GBAA 2WV5A 4UFEH 1EAIA 1OWJA 1NESE 1HAGE 2HNTE 3RXQA 1MQ6A 2ZDVH 3D23A 1RD3B 2SGEE 4JMYA 1MTSA 2ZU4A 2VIPA 1EZSC 1S84A 3Q00A 7GCHF 2IPHA 2PKAB 3LJJA 3BTFE 1J17T 4FUHA 1Y59T 3TGIE 1C2IA 4CBNA 1UVOA 4JYUH 6CHAC 1ESBA 2O9QA 1E34B 1NFYA 3RXKA 2TGAA 2TGPZ 2F9VA 1D3DB 1BHXF 1HXEH 2VVCA 3A89A 3E6PH 3RXTA 3LIWA 1O33A 1XUJA 2HLCA 4XOJA 2ZFFH 4KKDA 3CP7A 4XBDA 1TYNA 1N8OC 5GDSH 5BRRE 2WUCA 2Z9GA 2XRCA 2FOEA 4B2BA 2FX6A 1FN6A 1IQEA 5F8ZA 1FIZA 3M3TA 2XYAA 3RC5A 3O8DA 4ISLA 1YCPK 1VZQH 1IOEA 1RIWB 1P12E 2TGDA 1K28D 1L1GA 2ZCLP 2Q1JA 3MH7A 5EG4A 1C5PA 4HI3A 1P8VC 2FEQH 2W7UA 3UOPA 4ABEA 1JOUB 1C1VH 1QA7A 2CHAB 1KXFA 2BOKA 1FAXA 1C1UH 2CJIA 4NIXA 2FIRH 2QV1A 2HPQH 1LPKB 1PQ7A 1QL9A 1AE8H 3TNSA 1EJNA 1SC8U 3V12A 2TBSA 1INCA 4A1VA 1GHVH 2G5VA 2BX3A 1GHAF 3MNCA 3ZZ4A 2BXUH 4Y7AA 1ZJKA 2FYQA 1YBWA 3ATWA 3BTME 1CA8B 2ZU3A 2ZFPH 3S7HB 2VGCB 4ZUHA 2JH6D 1GI7B 3F9HA 5I46H 3S9CA 7GCHG 1BHXB 4GPGA 3VPKA 4DVAU 1TIOA 1QA0A 2H1UA 3BV9B 4OS6A 2Z6BD 1DOJA 4R0IA 5J4SA 2QA9E 1NRSH 1FUJA 1O3JA 1NU9A 2SGFE 2ZECA 5T6GA 4AFQA 1YLDA 3MO6A 4MNVA 5C1XA 4FUIA 1FPCH 3SNDA 2F9PA 1SFIA 3LT3A 1N6XA 1Z8JB 2UWLA 1VGCB 2A5AA 3KHVA 3HK3B 1AY6H 1S83A 1MKWH 3OSYA 1GBHA 1M9UA 3HPTB 1GJ6A 2DE8A 2GDDA 1GWAA 4NCYA 2O8TA 2WINI 4K69A 1QJ1B 1J16A 2XCNA 1A5IA 1TMBH 1AFEH 1ESAA 1IQFA 2FM2A 1TBQH 1TWXB 3LKWA 2V6NA 2FS8A 1EJMA 2QGRA 1WTHD 2W5EA 4THNH 3UFAA 1CU1A 2ZQ2A 4JYVH 5K0HA 2AGGX 3MOCA 1VJ9U 3ODDA 1UJ1A 1S6HA 3F9FA 2FODA 1K1LA 2ZTYA 1BJVA 4MPWA 3B8JA 4B74A 4I31A 3RP2A 1GMDF 4X6OA 3M37A 1KTTB 4NIVA 3BTKE 3FP8E 4KTCA 4I33A 3RXLA 2GT8A 2THFB 6ESTA 1IQMA 1SPJA 1P3EA 3FFGA 1GHAG 3GCTF 1DT2A 3EYDA 1GHYH 4D8NA 4GCHF 3LGIA 1SG8B 4YOGA 1ZTKA 3LH1A 2BZ6H 2ZDNA 1S6FA 1Q2WA 4BOHA 4GVUA 4BAMB 1O5GH 1V2RT 1Z7KA 3SU0A 1P2IA 2ZQ1A 4X1SU 2CXVA 3TLOA 1O3FA 1GCDA 1BITA 4WH6A 1YCPH 1CT0E 1PPHE 2BDYA 3SV9A 2BD3A 1GJ8B 2CHAC 4HTCH 3EE0B 1D3QB 1YPHC 1SHYA 3LU9B 5DPAA 1A0HB 4ESTE 2A7HA 4WMFA 1MTWA 1GBEA 1O5EH 3TITA 4AYVB 3NKKA 2VIOA 1LKBA 4PROA 1K1MA 1L4ZA 3SJOA 4O97A 1Y3UA 1O5FH 4BTTB 3A82A 3C1KA 1YCPM 1A2CH 1UCYH 2R3UA 3PLKA 4MLFB 4BAOB 1O2JA 3GCOA 1DWBH 4R8TB 1P02A 4TY6A 4OGYA 2FMJA 2VGCC 1TMTH 2G52A 4O3UA 4WWYA 5ESBA 1PQ8A 2DE9A 1EZQA 1NRPH 1P10A 2WYJA 2BD2A 4FU8A 3SBKA 3ZVEA 2RA0A 2AGIX 2ZG0H 4CH8B 3NCLA 4XBCA 2OP9A 1T8MA 1VGCC 1WTGH 3ZYEA 1O3PB 1MZDA 3ZVAA 1GMDG 3P8OA 4O3TA 2D8WA 4A92A 1C2DA 2QF3A 4ISOA 1AVWA 4BXSA 2ZU5A 3GCTG 3MO9A 4AOQA 1TLDA 3RM0H 5L6NH 4X2YA 3M3SA 1UO6A 2A4RA 3NUMA 4BAKB 4VGCB 1JMOH 4I8GA 4F4OC 4B73A 2G8TA 2Z9LA 4BTIB 2FZZA 1N1LA 2PGQB 1NRQH 3ZVDA 3A8DA 1BTXA 1S85A 5FBIA 1HV7A 1GCTB 2SGAA 1SR5C 4B76A 2ODPA 2WPMS 1HUTH 3TPIZ 4MTBA 4X2XA 4FXGH 4K1EA 3MU0A 1IQIA 2ZHFH 3CENA 2A5KA 3PROA 1XXDA 1P2OA 4Y76A 1C5VA 1GI1A 4ABGA 3A7VA 1QHRB 1SGRE 3UOUA 4I8KA 1P57B 1KDQB 4RKJB 1ZPCA 2FDAA 1GBTA 3A8CA 4FUDA 1JIRA 3SN8A 1MU6B 3F9GA 4E05H 1ESTA 4IW4E 2R0KA 3PO1B 1QY6A 3LDXH 2EI8A 2V35A 5JBAS 1PPFE 1IQKA 2C8WB 2C93B 3A83A 2R9PA 1EKBB 3BN9A 1W11U 2BQ7B 3OTJE 1UTKA 1PJPA 1TOMH 1K1OA 2ZHWH 3SI3H 5C5NA 3SUDA 1C2KA 1RXPA 3ELAH 3PLPA 3KN2A 4IMZA 4X0WU 1EATA 1W8BH 1HRTH 1TX6A 5A0BA 1C1PA 1TABE 1RTLA 2RCEA 3RXGA 3D49H 3ZZCA 2Y82A 1Z71A 2BDCA 1BDAA 1P01A 4MNWA 1GBDA 4X1NU 3RXSA 1C2LA 5GWZA 1U6QA 5C5OA 1O3IA 3MH6A 4UDWH 1NY22 1UK2A 1ELAA 1MH0A 4IN1A 5JBBS 3SJKA 2ZZUH 3H7OA 1HGTH 2VWOA 3BTQE 5FX6A 1MD7A 1KSNA 1UTQA 5JBTA 3TGJE 1P03A 1Z6EA 2AERH 3RXHA 3M5OA 3KQDA 1TPSA 1TBRH 2EI6A 2CN0H 3TH3H 3ESTA 3SU6A 1T4UH 4MVNA 3SU4A 2GZ8A 3UNSA 4VGCC 3VB7A 1V6DA 1AGJA 2BD9A 3ZYDA 1C1TA 1A7SA 1SGPE 1C4U2 2B5TB 4RN6A 3UR9A 4MG3A 1GCTC 3SNAA 3K6YA 2XBYA 4O03A 3RXCA 2OC0A 5T6FA 2FOCA 1C2GA 4JZ1A 2ANWA 4ZMAH 5DGJA 1OSSA 3SQEE 3UY9A 5T3HA 4ZKRU 4LZ4B 1YF4A 2QXHA 3UREA 1CT4E 2FOFA 1QB9A 1GJ4H 5FAHA 2BDHA 1SOZA 1DITH 5E8EH 3KQEA 1H4WA 1G37A 3MNSA 1ZGVA 1TNKA 1F0RA 1PQ5A 4E7NA 2FX4A 3SNCA 1OP0A 1ELVA 3ZV9A 3SZNA 1HIAB 5FX5A 3MWIU 1SMFE 2BY5X 2J9NA 4UONA 3BTTE 3LJOA 3P95A 3U8RH 2RDLA 1MZAA 5EOKA 1CQQA 2PWXA 4FUEA 6GCHF 1GDQA 1HFDA 5DP3A 5T6DA 1Y5UT 2OUAA 1MD8A 3RXOA 1P05A 3MI4A 1RFNA 4AYYB 1O35A 1EAWA 1CO7E 4RKOB 5EPNA 1H9IE 1MAXA 3K9XB 2VINA 1F0TA 1HAXB 2SNVA 2ZA5A 1P3CA 1ETTH
chains in the Genus database with same CATH superfamily
3QTOH 1JIMA 3HKIB 4Q7YA 5LGOA 3ZZ6A 1GI9B 3I78A 1O3HA 2HNTF 5DK1A 1A46H 3W95A 4NA8A 1QBOA 1FLEE 3FKSD 3HK6B 2NU1E 4DG4A 1OWKA 4IGDA 4ZCNA 1DWEH 4XFQA 4E06H 2ZPRA 1AFQB 1BMFD 1OKXA 1BRUP 2ZGJA 2OBOA 3GY7A 2FWWA 4Y11E 3S0NA 1EOJA 1O2ZA 5KEDA 3PWBA 5HIZA 1NROH 1V3XA 3LH3A 3RDZA 4A1XA 2QYIA 3E16B 4AB8A 3SORA 5DO4H 2XWBI 3SYJA 1P04A 1D4PB 1S5SA 1NM6A 1NFXA 1C2JA 2A7CA 3GY2A 1YPGH 4X8VH 1BTZA 3GDSA 3M35A 2ZP0H 1SQTA 1VITF 2SGPE 2XNDD 5EQQA 1GBLA 1IQGA 1TRNA 5DP6A 1E36B 1TOCB 3A7TA 1GI3A 3U8TH 5LPRA 1YLCA 2LELA 1LHCH 2K8IA 1GBBA 2A45B 1KXAA 3ZZAA 2V3HH 2EY4C 3K65B 1LHFH 3MFJA 3UQVA 1UK4A 1OWIA 3SUFA 1TPOA 3NXPA 1JRTA 5ABWA 3SU2A 4NA7A 1KY9A 1MMJN 4AGJA 1P06A 2GP9B 1DANH 3WY8A 1ZJDA 1SQAA 1UCYE 3SZEA 3T29A 6GCHG 1O2TA 1ANCA 2GZ7A 1GI5A 1QL8A 4NFFA 3H7TA 1Z8RA 2QY0B 1V2UT 1EB1H 3NK8A 3M61U 3RC4A 2ZFSA 2NU3E 3GDVA 1GMCF 1GHBF 2J97A 4I7YH 3MYWA 3SUEA 1ZR0A 4I86A 3O8CA 5EQSA 3OEHD 2KFWA 3M5MA 2BD8A 4CR9A 1O37A 2A2QH 1TNIA 1MKWK 2B9LA 1KIGH 1ZGIA 1SLXB 2F9NA 3QX5H 4X6NA 1A61H 2RA3A 3LOXA 2OC1A 3GY6A 3ZIAD 1TRYA 4YM9A 5CE1A 3RXRA 3AW0A 2HVXA 3KNXA 3P17H 1DSTA 2ASUB 3OAAD 5FXLA 1KLIH 1A0LA 3ATLA 2Q6DA 2XC5A 1P2NA 2FOHA 4Q7XA 3T28A 2A2XH 1B5GH 1AWFH 1TGBA 1K2I1 1P0SH 1THPB 2GGVB 1ELTA 2ZHDA 5E0HA 4X1RU 3URCA 1CE5A 1FI8A 1XM1A 2GTBA 1SQOA 1VITG 3A8BA 4J2YB 2OXSA 1SHHB 2O8MA 5C20A 4B71A 3P92A 1TPPA 2G4UA 1G3EA 2ZI2H 1CA0C 4TWWA 1O2YA 5GPIB 4BXWA 3QGNB 1AFQC 1BIOA 3CNRA 2TGTA 3E90B 1V2MT 4LZ1H 1BZXE 1THSH 3EAJA 2AMDA 5FL7D 2BY6X 2SGDE 1MTVA 3U9AH 1HAPH 1N6YA 3LGYA 3EQ0H 1UHBA 2I6SA 1FY5A 5DP7A 4YO9A 1BMAA 1P9SA 1COWD 3F2HA 3RUOA 4HG6A 1GMCG 3KQBA 3SNBA 1VKYA 3DT0H 2UUFB 1GJDB 2ZDLA 1WCZA 1Z6JH 1RS0A 2QXIA 2P59A 2P8OB 1P2JA 4DURA 1C1QA 2ZGBH 1FMGA 4YOJA 5A8YA 1BRCE 3TNTA 1MABB 4YLUA 4CREA 1SGDE 4WMDA 1UHBB 1J9CH 3S69A 1YPJH 1W0JD 2UWPA 1UCYK 5A8XA 3DHKH 1TNLA 1C1OA 1TNJA 1FZZA 3CS0A 5EU8A 4TY7A 1J14A 1DS2E 4Y0ZE 3AAUA 1BRAA 4ABDA 1F0SA 3BIUH 1O2GH 1NFWA 4ISNA 4YT7H 5EXNA 2HNTC 2FLBH 4M7GA 1L1NA 2ODQA 1G3DA 2ZGCA 3PWCA 1F92A 3UNRA 4MPUA 3PTBA 4NWKA 2Q6GA 1BUIA 4X1QU 2KCPA 5DP5A 3TGKE 1FDPA 1GHZA 3T25A 5EJ1A 1TMUH 2XTTB 2KCAA 3SW2B 7ESTE 1OWHA 3TJNA 1EPTA 2RDEA 3AK5A 1WYKA 5JPMH 1S82A 3I77A 1ZPBA 2PUQH 1A4WH 2KX4A 1O5AB 1VCQA 5DP4A 3DFLA 3UQOA 1D6RA 1VCPA 1YPHE 4ASHA 1ZZZA 5B6OA 1O3OA 4AFZA 3A87A 2ZPSA 1TQ7B 4FOUC 4Y0YE 1PPEE 1A5GH 1BA8B 1AUJA 3E0PB 3FP7E 2FTMA 3NZIA 2GMTB 1HXFH 1O30A 2YMSB 1BTUA 1RRKA 1O2RA 4WH8A 1O3NA 1AB9B 7KMEH 1O2IA 4UFFH 4K60A 1ZMNA 2CMYA 2TPIZ 1CSOE 5JB8S 3LONA 9ESTA 1XXFA 3AW1A 5GJ4B 3RU4D 5EGMA 4D9QA 1MTNB 3UR6A 2EC9H 2ZNKH 3E91A 2QCYA 3QTVH 1V2ST 2Y5FA 3QN7A 3TJOA 1EP5A 1E38B 2ZPQA 2WPJS 2BLVA 1K1JA 3Q3KA 2J2UA 1GJCB 1E37B 1FAKH 1FJSA 3LGTA 1B0FA 3ENSB 1UTMA 1C2EA 4IBLH 4J1YA 4P02A 1V2KT 3VXFH 5A8ZA 3QWCH 3MU4A 3TJUA 1K1IA 1TGSZ 3M5LA 4JCNA 2KM0A 3KF2A 4LOYH 1XKAC 3RXEA 3TU7H 3RXAA 1HAVA 1TGCA 1ELGA 2FI3E 2J95A 1C1NA 2B8OH 1H8HD 3BTHE 1BBRK 1HLTH 1AZZA 1GDUA 2P8OC 3F2FA 5EQRA 1CBWB 4UFGH 1DXWA 3BEIB 3TK9A 3JZ2B 4CRCA 3VB3A 1DPOA 5G4BA 3T27A 2GKVE 2W6ID 1G2LA 3SU5A 1O32A 4RI0A 2QF4A 4DGJA 3VXEH 3ODFA 5DP9A 1GI0A 1L1JA 2UWOA 2LPRA 3RXMA 3M7TA 2I6QA 1HAVB 4CRFA 3GY8A 4UD9H 4DIHH 4XDEA 4CRGA 1BTWA 3MH4A 2P3TB 5DP8A 2SFAA 2H9HA 1MBMA 4X2WA 2BM2A 1C2FA 2JETB 2WPDD 3MTYA 5LPEA 5AFYH 1UK3A 2PTNA 1Y3YA 4FETA 1O36A 1H1BA 2OC7A 2AYWA 3BTEE 3RM2H 1O38A 2WYGA 2Y7ZA 4BAHB 2CV3A 1QBNA 2QC2A 4ABBA 4INHA 4OS1A 1DDJA 3E1XB 4ACAA 2K0QA 3K6ZA 1KLJH 3NPSA 4KP0A 1ZHRA 4ZXXH 2BDIA 1L4DA 1NRRH 1SKYE 2R3YA 1C2MA 1TAWA 4GCHG 2A4QA 4K8BA 8ESTE 4I32A 1WQSA 1HAOH 3BG4B 3HGPA 2QXJA 2XBVA 3F68H 2GMTC 2YMSC 2VU8E 2VWLA 1ZTJA 4OS2A 2ZKSA 1AB9C 2FXRA 4YOIA 5EJZA 1O3BA 4D7FA 1MTNC 4MDSA 2F9OA 5HGGA 2C90B 1BOQA 3S9BA 1MTUA 2AS9A 1G32B 4XE4A 2XC0A 3AVZA 3TH2H 2ODYB 1OS8A 3C27B 2OC8A 1GVZA 5TJXA 4OM9A 3M3VA 1HDTH 2ZDKA 1WDIA 1DM4B 1TX7A 1KXBA 3N7OA 3SJ8A 1GBIA 3FP6E 1LMWB 3MNXA 3PYHA 1RGQA 3KQ5A 2KCOA 3SU1A 4ISIH 2GT7A 1CGIE 1O5DH 1ARBA 1D6WA 1C5XB 1ID5H 2HWLB 4CR5A 2BVSH 1ZRBA 3PMAB 1C9PA 5KECA 5A0AE 1HJ8A 5FHTA 2VWNA 1YPKH 3ZZBA 2ZGXH 3BSQA 1HB0B 2BVRH 2Z3DA 2ZEBA 2H9TH 1VITH 3EE7A 3SJ9A 2ALPA 4MNXA 3PM3A 1CBWC 2WPHS 1CGHA 3S7KB 1SVPA 2BDAA 1BBRH 2VIDA 4K1SA 3LGVA 1GBMA 1SGTA 1P11E 1XUGA 2BOHB 5C17A 2BY7X 2F9BH 4RSPA 2JH5D 4GHQA 5FPSA 1O5BB 5CHAB 2QF0A 2ZTZA 2FO9A 1KTSB 3U8OH 2AEIH 2AIQA 1OX1A 3DD2H 1HJAB 1O3AA 5EODA 1L0ZA 1TNGA 1ETSH 4INLA 3NRLA 4Y6DA 1FQ3A 4U2WA 2QXGA 1NO9H 4KTUA 4AFSA 2ZCHP 3GCNA 1P2MA 3PMBB 3RC6A 1NN6A 2JH0D 5DKMA 2JETC 1P9UA 3PMHB 1BRBE 1O2KA 5EW2H 1QZ8A 4FU7A 1GL0E 1O2LA 4AG2A 3P8FA 1QB1A 2VNTA 2A7JA 1LPZB 1IAUA 4TWYA 2F4LA 1Q31A 3ZZDA 1ELBA 1ZRKA 1BTHH 2WSSD 1Y3WA 1HNEE 5LH8A 2R2WU 3LGUA 3D65E 1QQ4A 4FVBA 1E1RD 4ABIA 3ZZ8A 4JK5A 1SOTA 2EI7A 2Y5HA 1GVKB 3BG4C 1TRMA 2ZU2A 2ANYA 4WMEA 1D3TB 1O39A 3F9EA 1NFUA 4I8HA 3ATIA 1EJAA 5AF9H 4K5ZA 1T32A 1ANEA 2VVUA 4HZHA 4CHAB 1HAYB 5C3NA 1ZHPA 4Z1MD 5A09A 1K1NA 1XUKA 2YMSD 2PW8H 2OCVB 4ABHA 5A0CA 2FI4E 4NIWA 1CHOF 1AKSA 1LQEA 2HOBA 2AHME 4NSYA 3TIUA 4JZFH 1O3MA 3D62A 3HGNA 1OWDA 1ORFA 1YPMH 1NS3A 4A7IB 4GUXA 4NIYA 3VB6A 3BF6H 1PQAA 2FS9A 1UVPA 1KXEA 5GCHF 1TGTA 1FPHH 5EXLA 3H09A 1HPGA 1LHDH 2OLGA 1RTFB 1SLVB 1W7GH 3L6PA 4P00A 1AKSB 2FOMB 3SGBE 3VGCB 5HM9A 1WUNH 1O2WA 1GBJA 3U69H 1BT7A 1DSUA 1MKXH 2LNCA 2IN2A 1QJ7B 1H9LB 5HM2A 3KQCA 2GZ9A 3DFJA 3SQHE 3BG8A 1P2KA 5C0UA 3ZZ3A 2PLXA 3VB4A 2IJOB 2O8LA 1G30B 1G3BA 2GX4A 1T4VH 1IQNA 3MU5A 1A1RA 1FY3A 4YESB 5CHAC 1G36A 1VCWA 4B6FA 1O2XA 2A32A 4Q2KA 1AUTC 5E2OA 5JB9S 1O2HA 2ZHQH 3P8GA 1HJAC 1F5RA 3Q3XA 4XBBA 2Z7FE 1V2PT 1DE7H 2ZU1A 1CA0B 4KTSA 5CMXH 4TPIZ 1B7XB 2A4OA 5F8XA 2P94A 3UTUH 2XBWA 1ZYOA 2BX4A 3STIA 3SGQE 1CVWH 2BD7A 1QCPA 4B2AA 3URDA 2XCFA 2A0QB 5E0JA 2ANKH 1QURH 4E7RG 3A85A 1AI8H 1TA6A 1WU1A 2QIQA 1UMAH 1CHOG 2PSYA 2ZWLH 2AFQB 7LPRA 3FVFB 4CH2B 2EA3A 2FYRA 3FO8D 1SGCA 4NSVA 1S0RA 3VEQB 3UUZA 1Y3XA 4X1PU 4DJZB 1H8DH 2CF8H 4ZHMU 1W14U 3O8BA 4KGAA 3BEUA 1DX5M 3TVJB 2OBQA 5GCHG 3SGAE 1C5YB 1KXDA 3Q77A 1F2SE 2KAIA 4Y71A 2C4FH 1ACBE 4ZH8A 2FI5E 3W94A 5L2YH 1XUFA 5L30H 1LO6A 3QDZB 1LHEH 4U30A 1QIXB 2GV7A 1THRH 2D2DA 2GCHF 4CHAC 1SGIB 1P2QA 4AZ2B 1SB1H 3OTPA 5E0GA 2W3IA 3ITIA 2F91A 2SNWA 4CBOA 1C1RA 1T31A 2ALVA 4UFDH 4HFPB 1WBGB 1GI4A 3V7TA 1QNJA 3FZZA 4JK6A 1KLTA 4TSFD 6LPRA 5EJLA 3EA9A 1DLKB 1S6LA 3RXUA 2R2MB 1YKTA 1FY1A 2RFKC 1W0ZU 3VFEA 1ZSKA 1JXPA 4ZROA 1A0JA 1C4Y2 1C5SA 3TK5A 1TBZH 1EASA 2ZDAH 3B23B 3GISB 2FOAA 1MU8B 1MUEB 1TPAE 3VGCC 1XVOA 5CDFE 2ESTE 1G3CA 1GBKA 3SV7A 2G00A 1BB0B 3G01A 1F0UA 2BQ6B 1RJXB 4AG1A 2BLOA 1WQVH 1AQ7A 1IQLA 4H6SB 3PV5A 3QO6A 1DUAA 4H4FA 4CRBA 1GDNA 5KGOA 1NBMD 3CS7A 1K22H 1PPGE 1FNIA 5GNDA 1ZLRA 4I8LA 2W26A 4DIIH 1O3EA 2Z3CA 3RMNH 2BD5A 2H2ZA 5JBCS 2NU0E 3V0XA 4OS7A 3UWJH 1DICA 2BQWB 3QZQA 1TX8A 1Z1JA 4GLYA 1UTNA 2BTCE 4QT8C 2V0BA 3UPEA 4X6PA 2GV6A 1DWDH 1BTYA 2GCHG 3HKJB 5A2MH 3Q76A 1O3GA 3MHWU 3ZVCA 1W0KD 1NU7B 3A7ZA 3E3TA 1O5CB 2ZFTA 3HATH 1ETRH 3GY3A 4FUJA 1ARCA 1YY3A 1SBWA 5TCAA 1GHBG 1SGEE 2YNBA 2BHGA 3GICB 3R0FA 3ZZ7A 3QUMP 2O8UA 1LVMA 5JYIA 1AIXH 9LPRA 2PV9B 4MQAA 1BBRE 1ZSJA 4FUFA 3T5FH 2C8ZB 1NTPA 1W3CA 3OX7U 4K8YA 2D1JA 1FONA 4H6TA 4ABFA 1Z1IA 3STJA 1GVLA 1XX9A 3M36A 3KEEA 1GHXH 1L2EA 2OQUA 3RMLH 1C5OH 2PKSC 1OYTH 1UTJA 4WF8A 3U1IB 5GIBA 1FY4A 1AZ8A 5EW1H 1UTLM 2XXLA 1GJ5H 4X2VA 3F6UH 3U98H 1ELCA 2Y6TA 1H9HE 2J92A 1LVBA 1KMHB 3ZVGA 1GJBB 1EUFA 3ZZ9A 1ZTLA 4X8SH 1ABJH 2OD3B 1LDTT 4FUCA 4OS5A 1EZXC 1ZMLA 1Y8TA 1TNHA 1SLWB 4IS5A 3RXFA 1C5MD 2ANMH 2AMPA 4AGKA 1DUEA 1F5KU 4AC9A 4DY7B 1QFKH 1V2WT 1YC0A 4LK4A 1EZUC 1IHTH 4A1TA 3WWBA 1O2SA 1DFPA 3A80A 1TE0A 3P6ZB 1YPEH 3BTDE 3QZRA 2GVFA 3WWFA 1PPZA 2XC4A 2HVYB 2XOKD 3MH5A 3AAVA 5CHBA 1QRWA 1UTOA 1JRSA 4H42U 1O0DH 2R0LA 5GXPA 1FX0B 1QGFA 2GD4B 2ULLA 3RXBA 3SJIA 5HYOA 1GG6B 2WUBA 1ZMJA 2V3OH 2BMGB 2C8YB 1TGNA 3AASA 1NPMA 3S9AA 2J34A 5H4IB 2VJ1A 3SV8A 1EPTB 4TPYA 3BEFB 2JJ1D 1UVTH 1FIWA 1A3BH 3EDXB 1O2NA 4ZKNU 3RXDA 1PPBH 1C1MA 1Y3VA 4XSKU 3E0NB 1EQ9A 5F6MA 4LXBH 4Y8YA 1BMLA 3SI4H 2JKHA 4JZEH 1DY8A 1HBTH 1BQYA 4O9VA 3SNEA 3TH4H 3EGKH 1C5RA 2F9UA 1LHGH 4GSOA 2H9EH 3F1SB 2Z9JA 5J4QA 2VB0A 3GY5A 3OY5U 4Z0KA 3L33A 1OPHB 2WPLS 3RLWH 1T7CA 2W6JD 1HJ9A 2OTVA 2DUCA 2JDID 4K1TA 2IOTA 3QK1A 5F8TA 1HAHH 3ATKA 5AHGH 5C1YA 4UEHH 3FZDA 2ZO3H 1C1WH 1P09A 1QL7A 2A31A 2HALA 3UNQA 1CT2E 3ZV8A 2ZFRH 1T8NA 4DCDA 2J98A 3B9FH 4AB9A 4Y7BA 4BANB 1HYLA 2WZQA 4AFUA 8KME2 2G81E 3KIDU 1AN1E 2FESH 1K0HA 5TCCA 3N99A 2G5NA 4ZKSU 3T2NA 3DA9B 2XBXA 3SV6A 1TQ0B 1XUHA 1PYTC 2BLQA 3DSOA 1SFQB 2O8WA 4U01A 2AH4X 1PPCE 1RIWC 3RLYH 1DVAH 1SLUB 4RT0A 5IYTA 3SU3A 2ZC9H 3LGWA 1IQHA 2HGTH 1B0EA 2ZHEH 1EP6A 3SO3A 1G9IE 4GHTA 1EAXA 1O2VA 2P3UB 3SV2H 3LPRA 1V2VT 2QE7D 1AU8A 1TALA 2HPPH 2P16A 1JWTA 2J38A 1BCUH 2XWAA 2P93A 4ASUD 2EEKA 4X8TH 2G51A 5I25A 1SGQE 1O31A 3BIVH 2BY9X 4NZQA 1GJ7B 4Y8ZA 2Y7XA 3GOVB 4A5TS 2UUKB 1LTOA 4SGBE 2J94A 2OINA 4WY3A 5HMAA 4D9RA 5DG6A 1AD8H 1NRNH 5FPTA 4GAWA 4BTUB 4MPXA 1AMHA 5C67A 4FVDA 1XMNB 3O8RA 1WSSH 3EA8A 1Q3XA 3E8LA 3NWUA 4ZHLU 1OP8A 1O3KA 2PR3A 2ILNA 1IHSH 2VIQA 4M9FA 1O2PA 1QRXA 1GG6C 1QBVH 2ZTXA 4DT7B 3A7WA 3GYLB 3MMGA 3SHCH 3TK6A 4IN2A 2FOGA 1YYY1 1EPTC 8LPRA 2EQNA 1O3LA 4CRDA 5C1UA 5FBEA 2KZ4A 1EAUA 3BTWE 2VVVA 3MO3A 2VWMA 1O2UA 1GI8B 3OU0A 4Q7ZA 1YP9A 2FTLE 2Z94A 5FCKA 1S81A 4WJG2 4Z6AH 4A6LA 2BYAX 2ZCKP 2Y80A 2YNAA 3KYGA 4IC5A 3PB1E 5K7RA 1MQ5A 2J4IA 3BTGE 2QAAA 3DSGA 3K2UA 4OS4A 1SGNE 2C8XB 1XKBC 5F03A 1KDQA 3QGJA 3UIRA 2BDGA 4OGXA 1GJ9B 4HGCA 2GDEH 1WAYB 1V2LT 2H6MA 1O3CA 5E2PA 1OP2A 1GL1A 1W13U 1ZPZA 1WV7H 2ZIQH 1C5UA 1V2QT 3IITA 1C9TA 4YLQH 4U32A 1MKXK 3A81A 4SGAE 2TRMA 3FAOA 3RXVA 1FV9A 1V2JT 2PFEA 1AVXA 2NWNA 1MCVA 1OYQA 2JIZD 3A8AA 3P70B 5AVDA 2QN5T 1Y5AT 3RMMH 5C2ZA 2V3MA 5EPYA 4KELA 1HCGA 5BPEA 3V3MA 4YT6H 3PRBA 2BY8X 1FN8A 3FANA 4ZKOU 2UUYA 3H5CB 1C5WB 1PYTD 2IPQX 2VH0A 2XW9A 3VB5A 1GGDB 4AN7A 1AWHB 1KYNA 1QR3E 3KGPA 3MQKC 3OY6U 2PHBA 1QQUA 4Y8XA 5B6LA 4AORA 1C1SA 4K3JA 3R3GB 3SUGA 1SI5H 2VBCA 2H5CA 1UW7A 4I8JA 1KXCA 1C4V2 3PLBA 3A84A 1A5HA 1V2OT 1VR1H 4ZAEA 1ZSLA 1GMHF 5FPYA 1J8AA 1K1PA 2G55A 2STAE 4MNYA 4FU9A 1O2OA 1ELEE 2PSXA 4IMQA 4K2YA 2BLWA 2BD4A 2UUJB 2B0FA 4UE7H 1QRZA 1ZHMA 2BB4A 2BDBA 3A88A 1ZOMA 1W7XH 3A86A 1T8LA 1W2KH 3V13A 2A5IA 2FOBA 2Z9KA 3M5NA 2PTCE 4MPVA 4WXIA 2TIOA 1ELFA 4B2CA 1V2TT 1NT1A 4JZIA 2FLRH 1W10U 1AHTH 2Q6FA 1DWCH 3ZVBA 3GYMA 1YPLH 4F49A 2WV4A 3DUXH 2ZGHA 4ZHAA 2VIVA 3P8NA 1ANBA 4B1TA 4AX9H 1DLEA 1EXFA 1BJUA 5EIYA 1GJAB 2K1QA 1EX3A 3FOAA 3M7QA 4IC6A 2P95A 4DOQA 1WXRA 3T62A 8GCHF 1W12U 3GCHB 1PFXC 1K21H 1GPZA 2HRVA 1CGJE 2QF5A 5DJ7A 1DXPA 1K9OE 3DSPA 1DY9A 4WXVA 1ANDA 1VJAU 2G4TA 4NGAH 1ELDE 1HIAA 2M5TA 3PRDA 2FP7B 3I29A 3MU1A 4JYTA 3F0OA 3PTNA 1XUIA 3A7XA 3KL6A 4D76A 1O34A 2CK3D 1EB2A 2NU2E 1J15A 2WPIS 1T8OA 1LCYA 1LVOA 3A7YA 1NC6A 4X8UH 2BVXH 2A4GA 3EA7A 2PUXB 3Q3YA 2GCTB 3IWMA 1GMHG 1GI2A 4ABJA 3ATMA 3RXIA 2STBE 4INKA 1AO5A 1MAYA 1HAZB 2ZDMA 2VH6A 3PMJA 1C5NH 1SGYE 3M7UA 5PTPA 1ABIH 3SOSA 1YM0A 2WV9A 4B75A 3KCGH 3PO1C 1GGDC 3GY4A 1JBUH 1F7ZA 1Y5BT 1E35B 1O3DA 1F5LA 4NZLA 4B6EA 1E0FD 1EFRD 1D3PB 3LC5A 2AMQA 1TONA 3F3BA 4ZXYH 1C5QA 2Y5GA 5EXMA 1YGCH 1A3EH 1C5TA 4JZDH 3ZZ5A 1S0QA 1GBFA 2LP6A 2BZAA 3PV4A 2ZFQH 4ABAA 5SGAE 1SGFA 2B7DH 6CHAB 1X7AC 1QTFA 1C2HA 3T26A 2CGAA 3RXJA 4CRAA 5IK2D 4NA9H 1LKAA 1OOKB 1RTKA 1SSXA 2AIPA 1MBQA 1O2QA 8GCHG 3IG6B 3RU4T 1LQDB 4ISHH 2HLDD 2BXTH 4TYDA 1TFXA 2P3FH 2YOLA 4Q80A 1GI6A 1N8OB 2H5DA 5LPFA 1AVGH 4FUBA 2CF9H 1UVSH 3U1JB 3RU4E 2SGQE 1Z8IB 1HAIH 2ZF0H 2FPZA 1W0YH 3JZ1B 1TB6H 2OQ5A 3MU8A 1G2MA 1D9IA 1CHGA 1GHWH 5DN6D 1LPGB 5FCRA 2F83A 2PKSB 3KYFA 3ZVFA 5HXFA 2AGEX 1LVYA 2PGBB 2XNIA 2NU4E 3QLPH 1SGFG 3RXPA 2W3KA 1Z8GA 3SHAH 1H8IH 2VIWA 1QB6A 1UVUH 2Z3EA 4Y79A 5IDKA 1GBCA 3GCHC 4YTAA 1QJ6B 2KAIB 4NFEA 5L2ZH 2WPKS 4BAQB 2RG3A 5AFZH 1O2MA 3DCLA 1OWEA 1C5ZB 4NWLA 1FXYA 4NG9H 1EOLA 4X6MA 1TA2A 2IJD1 3PV2A 4WVPE 1AE5A 1XVMA 1SL3A 2F3CE 3L3TA 5C0TA 1BMNH 2C3SA 1BMMH 2D26C 5ESTE 4FUGA 3LC3A 1MCTA 1NZQH 3MNBA 1V2NT 4BNRA 5JDUB 2GCTC 1OXGA 2L6OA 3OYPA 1UTPA 1IQJA 4D7GA 1C5LH 2Y81A 2Z9IA 4YZUA 4Y10E 3UWIA 1BTPA 2PKAA 1FY8E 4DW2U 3TJVA 3GDUA 2A1DB 5ETXA 2W7SA 1WOFA 3RMOH 1GBAA 2WV5A 4UFEH 1EAIA 1OWJA 1NESE 1HAGE 2HNTE 3RXQA 1MQ6A 2ZDVH 3D23A 1RD3B 2SGEE 4JMYA 1MTSA 2ZU4A 2VIPA 1EZSC 1S84A 3Q00A 2KR7A 7GCHF 2IPHA 2PKAB 3LJJA 3BTFE 1J17T 4FUHA 1Y59T 2KCYA 3TGIE 1C2IA 2WHXA 1UVOA 4JYUH 4CBNA 6CHAC 1ESBA 2OK5A 2O9QA 1E34B 1NFYA 3RXKA 2TGAA 2TGPZ 2F9VA 1D3DB 3OEED 1BHXF 1HXEH 2VVCA 3A89A 3N7EA 3E6PH 3RXTA 3LIWA 4RT1A 1O33A 1XUJA 2HLCA 3FN8A 4XOJA 4F48B 2ZFFH 4KKDA 3CP7A 4XBDA 1TYNA 1N8OC 4XD7D 2L74A 5GDSH 5BRRE 2WUCA 2Z9GA 2XRCA 2FOEA 4B2BA 2FX6A 2F43B 1FN6A 1IQEA 5F8ZA 1FIZA 3M3TA 2XYAA 3RC5A 3O8DA 4ISLA 1YCPK 1VZQH 1IOEA 1RIWB 1P12E 2TGDA 1K28D 1L1GA 2ZCLP 2Q1JA 3MH7A 5EG4A 1C5PA 4HI3A 1P8VC 2FEQH 2W7UA 3UOPA 4ABEA 3N7DA 1JOUB 1C1VH 1QA7A 2CHAB 1KXFA 2BOKA 1FAXA 1C1UH 2CJIA 4NIXA 2FIRH 2QV1A 2HPQH 5DSFA 1LPKB 1PQ7A 1QL9A 1AE8H 3TNSA 1EJNA 1SC8U 3V12A 2TBSA 1INCA 4A1VA 1GHVH 2G5VA 2BX3A 1GHAF 3MNCA 1OHHD 3ZZ4A 2BXUH 4Y7AA 1ZJKA 2FYQA 1YBWA 3ATWA 3BTME 1CA8B 2ZU3A 2ZFPH 3S7HB 2VGCB 4ZUHA 2JH6D 1GI7B 3F9HA 5I46H 3S9CA 7GCHG 1BHXB 4GPGA 3VPKA 4DVAU 1TIOA 1QA0A 2H1UA 3BV9B 4OS6A 2Z6BD 1DOJA 4R0IA 5J4SA 2JJ2D 2QA9E 1NRSH 1FUJA 1O3JA 1NU9A 2SGFE 2ZECA 5T6GA 4AFQA 1YLDA 3MO6A 4DT4A 4MNVA 5C1XA 4FUIA 1FPCH 3SNDA 2F9PA 1SFIA 3LT3A 1N6XA 1Z8JB 2UWLA 1VGCB 2A5AA 3KHVA 3HK3B 1AY6H 1S83A 1MKWH 3OSYA 1GBHA 1M9UA 3HPTB 1GJ6A 2DE8A 2GDDA 2M2AA 1GWAA 4NCYA 2O8TA 2WINI 4K69A 1QJ1B 1J16A 2XCNA 1A5IA 1TMBH 1AFEH 1ESAA 1IQFA 2FM2A 1TBQH 1TWXB 3UAIC 3LKWA 2V6NA 2FS8A 1EJMA 2QGRA 1WTHD 2W5EA 4THNH 3UFAA 1CU1A 2ZQ2A 1E79D 4JYVH 5K0HA 2AGGX 3MOCA 1VJ9U 3ODDA 1UJ1A 3F0PA 1S6HA 3F9FA 2FODA 1K1LA 2ZTYA 1BJVA 4MPWA 3B8JA 4B74A 4I31A 1SQRA 3RP2A 1GMDF 4X6OA 3M37A 1KTTB 4NIVA 3BTKE 3FP8E 4KTCA 4I33A 3RXLA 2GT8A 2THFB 2GJGA 6ESTA 1IQMA 1SPJA 1P3EA 3FFGA 1GHAG 3GCTF 1DT2A 3EYDA 1GHYH 4D8NA 4GCHF 3LGIA 1SG8B 4YOGA 1ZTKA 3LH1A 2BZ6H 2ZDNA 1S6FA 3OFND 1Q2WA 4BOHA 4GVUA 4BAMB 1O5GH 1V2RT 1Z7KA 3SU0A 1P2IA 2ZQ1A 4X1SU 2CXVA 3TLOA 1O3FA 1GCDA 1BITA 4WH6A 1YCPH 1CT0E 1PPHE 2BDYA 3WW7A 2J98B 3SV9A 2BD3A 1GJ8B 2CHAC 4HTCH 3EE0B 4Q63A 1D3QB 1YPHC 1SHYA 3LU9B 5DPAA 1A0HB 4ESTE 2A7HA 4WMFA 1MTWA 1GBEA 1O5EH 3TITA 4AYVB 3NKKA 2VIOA 1LKBA 4PROA 1K1MA 1L4ZA 3SJOA 4O97A 1Y3UA 1O5FH 4BTTB 3A82A 3C1KA 1YCPM 1A2CH 1UCYH 2R3UA 3PLKA 4MLFB 4BAOB 1O2JA 3GCOA 1DWBH 4R8TB 1P02A 4TY6A 4OGYA 2FMJA 2VGCC 1TMTH 2G52A 4XRNA 4O3UA 4WWYA 5ESBA 1PQ8A 2DE9A 1EZQA 1NRPH 1P10A 2WYJA 2BD2A 1YWUA 4FU8A 3SBKA 3ZVEA 2V7QD 2RA0A 2AGIX 2ZG0H 4CH8B 3NCLA 4XBCA 2OP9A 1T8MA 1VGCC 1WTGH 3ZYEA 1O3PB 1MZDA 3ZVAA 1GMDG 3P8OA 4O3TA 2D8WA 4A92A 1C2DA 2QF3A 4ISOA 3VG8A 1AVWA 4BXSA 2ZU5A 3GCTG 3MO9A 4AOQA 1TLDA 3RM0H 5L6NH 4X2YA 3M3SA 1UO6A 2PP6A 2A4RA 3NUMA 4BAKB 4VGCB 1JMOH 4I8GA 4F4OC 4B73A 3OE7D 2G8TA 2Z9LA 4BTIB 2FZZA 1N1LA 2PGQB 1NRQH 3ZVDA 3A8DA 1BTXA 1S85A 5FBIA 1HV7A 1GCTB 2SGAA 1SR5C 5T1VA 4B76A 2ODPA 2WPMS 1HUTH 3TPIZ 4MTBA 4X2XA 4FXGH 4K1EA 3MU0A 1IQIA 2ZHFH 3CENA 2A5KA 3PROA 1XXDA 1P2OA 4Y76A 1C5VA 1GI1A 4ABGA 3A7VA 1QHRB 1SGRE 1YLNA 3UOUA 4I8KA 1P57B 1KDQB 4RKJB 1ZPCA 2FDAA 1GBTA 3A8CA 4FUDA 1JIRA 3GS9A 3SN8A 1MU6B 3F9GA 4E05H 1ESTA 4IW4E 2R0KA 3PO1B 1QY6A 3LDXH 2EI8A 2V35A 5JBAS 1PPFE 1IQKA 2C8WB 2C93B 3A83A 2R9PA 1EKBB 3BN9A 1W11U 2BQ7B 3OTJE 1UTKA 1PJPA 1TOMH 1K1OA 2ZHWH 3SI3H 5C5NA 3SUDA 1C2KA 1RXPA 3ELAH 3PLPA 3KN2A 4IMZA 4X0WU 1EATA 1W8BH 1HRTH 1TX6A 5A0BA 1C1PA 1TABE 1H8ED 1RTLA 2RCEA 3RXGA 4F55A 3D49H 3ZZCA 2Y82A 5HKKD 1Z71A 2BDCA 1BDAA 1P01A 4MNWA 1GBDA 4X1NU 5HIYA 3RXSA 1C2LA 5GWZA 1U6QA 5C5OA 1NBME 1O3IA 3MH6A 4UDWH 1NY22 1UK2A 4YXWD 1ELAA 1MH0A 4IN1A 5JBBS 3SJKA 2ZZUH 3H7OA 1HGTH 4TT3D 2VWOA 3BTQE 5FX6A 1MD7A 1KSNA 1UTQA 5JBTA 3TGJE 1P03A 1Z6EA 2AERH 3RXHA 3M5OA 3KQDA 1TPSA 1TBRH 2EI6A 2CN0H 4Q4LA 2J5UA 3TH3H 3ESTA 3SU6A 1T4UH 4MVNA 3U28C 3SU4A 2GZ8A 3UNSA 4VGCC 3VB7A 1V6DA 1AGJA 2BD9A 3ZYDA 1C1TA 1A7SA 1SGPE 1C4U2 2B5TB 4RN6A 3UR9A 4MG3A 1GCTC 3SNAA 3K6YA 2XBYA 1E1QD 4O03A 3RXCA 2OC0A 5T6FA 2FOCA 1C2GA 4JZ1A 2ANWA 4ZMAH 5DGJA 1OSSA 3SQEE 3UY9A 3F2GA 5T3HA 4ZKRU 4LZ4B 1YF4A 2QXHA 3UREA 1CT4E 2FOFA 1QB9A 1GJ4H 5FAHA 2BDHA 4ACBA 1SOZA 1DITH 5E8EH 3KQEA 1H4WA 1G37A 3MNSA 1ZGVA 1TNKA 1F0RA 1PQ5A 4E7NA 2FX4A 3SNCA 1OP0A 1ELVA 3ZV9A 3SZNA 1HIAB 5FX5A 5C94A 3MWIU 1SMFE 2BY5X 2J9NA 4UONA 3BTTE 3LJOA 3P95A 3U8RH 2RDLA 1MZAA 5EOKA 1CQQA 2PWXA 4FUEA 6GCHF 1GDQA 1HFDA 5DP3A 5T6DA 1Y5UT 2OUAA 1MD8A 3RXOA 1P05A 3MI4A 1RFNA 4AYYB 3W1EA 1O35A 1EAWA 1CO7E 4RKOB 5EPNA 1H9IE 1MAXA 3K9XB 2VINA 1F0TA 1HAXB 2SNVA 2ZA5A 5F53A 3UB0A 1P3CA 1ETTH
chains in the Genus database with same CATH topology
3QTOH 1JIMA 3HKIB 4Q7YA 5LGOA 3ZZ6A 1GI9B 3I78A 1O3HA 2HNTF 5DK1A 1A46H 3W95A 4NA8A 1QBOA 1FLEE 3HK6B 2NU1E 4DG4A 1OWKA 4IGDA 1DWEH 4XFQA 4E06H 2ZPRA 1AFQB 1OKXA 1BRUP 2ZGJA 2OBOA 3GY7A 2FWWA 4Y11E 3S0NA 1EOJA 1O2ZA 3PWBA 1NROH 1V3XA 3LH3A 3RDZA 4A1XA 2QYIA 3E16B 4AB8A 3SORA 5DO4H 2XWBI 1P04A 1D4PB 1S5SA 1NM6A 1NFXA 1C2JA 2A7CA 3GY2A 1YPGH 4X8VH 1BTZA 3GDSA 3M35A 2ZP0H 1SQTA 1VITF 2SGPE 5EQQA 1GBLA 1IQGA 1TRNA 5DP6A 1E36B 1TOCB 3A7TA 1GI3A 3U8TH 5LPRA 1YLCA 1LHCH 3ZZAA 1GBBA 2A45B 1KXAA 2V3HH 3MFJA 3K65B 1LHFH 3UQVA 1UK4A 1OWIA 3SUFA 1TPOA 3NXPA 1JRTA 5ABWA 3SU2A 4NA7A 1KY9A 1MMJN 4AGJA 1P06A 2GP9B 1DANH 3WY8A 1ZJDA 1SQAA 1UCYE 3T29A 6GCHG 1O2TA 1ANCA 2GZ7A 1GI5A 1QL8A 4NFFA 3H7TA 1Z8RA 2QY0B 1V2UT 1EB1H 3NK8A 3M61U 3RC4A 2ZFSA 2NU3E 3GDVA 1GMCF 1GHBF 4I7YH 3MYWA 3SUEA 1ZR0A 3O8CA 5EQSA 3M5MA 2BD8A 4CR9A 1O37A 2A2QH 1TNIA 1MKWK 2B9LA 1KIGH 1ZGIA 1SLXB 2F9NA 3QX5H 4X6NA 1A61H 2RA3A 3LOXA 2OC1A 3GY6A 1TRYA 4YM9A 5CE1A 3RXRA 3AW0A 2HVXA 3KNXA 3P17H 1DSTA 2ASUB 5FXLA 1KLIH 1A0LA 3ATLA 2Q6DA 2XC5A 1P2NA 2FOHA 4Q7XA 3T28A 2A2XH 1B5GH 1AWFH 1TGBA 1K2I1 1P0SH 1THPB 2GGVB 1ELTA 2ZHDA 5E0HA 4X1RU 3URCA 1CE5A 1FI8A 1XM1A 2GTBA 1SQOA 1VITG 3A8BA 4J2YB 2OXSA 1SHHB 2O8MA 5C20A 4B71A 3P92A 1TPPA 2G4UA 1G3EA 2ZI2H 1CA0C 4TWWA 1O2YA 5GPIB 4BXWA 3QGNB 1AFQC 1BIOA 2TGTA 3E90B 1V2MT 4LZ1H 1BZXE 1THSH 3EAJA 2AMDA 2BY6X 2SGDE 1MTVA 3U9AH 1HAPH 1N6YA 3LGYA 3EQ0H 1UHBA 2I6SA 1FY5A 5DP7A 4YO9A 1BMAA 1P9SA 3RUOA 1GMCG 3KQBA 3SNBA 3DT0H 2UUFB 1GJDB 2ZDLA 1WCZA 1Z6JH 1RS0A 2QXIA 2P59A 2P8OB 1P2JA 4DURA 1C1QA 2ZGBH 1FMGA 4YOJA 5A8YA 1BRCE 3TNTA 4YLUA 4CREA 1SGDE 4WMDA 1UHBB 1J9CH 3S69A 1YPJH 2UWPA 1UCYK 5A8XA 3DHKH 1TNLA 1C1OA 1TNJA 1FZZA 3CS0A 5EU8A 4TY7A 1J14A 1DS2E 4Y0ZE 3AAUA 1BRAA 4ABDA 1F0SA 3BIUH 1O2GH 1NFWA 4ISNA 4YT7H 5EXNA 2HNTC 2FLBH 4M7GA 1L1NA 2ODQA 1G3DA 2ZGCA 3PWCA 1F92A 3UNRA 4MPUA 3PTBA 4NWKA 2Q6GA 1BUIA 4X1QU 3TGKE 5DP5A 1FDPA 1GHZA 3T25A 1TMUH 2XTTB 3SW2B 7ESTE 1OWHA 3TJNA 1EPTA 1WYKA 5JPMH 1S82A 3I77A 1ZPBA 2PUQH 1A4WH 1O5AB 1VCQA 5DP4A 3DFLA 3UQOA 1D6RA 1VCPA 1YPHE 4ASHA 1ZZZA 5B6OA 1O3OA 4AFZA 3A87A 2ZPSA 1TQ7B 4Y0YE 1PPEE 1A5GH 1BA8B 1AUJA 3E0PB 3FP7E 2FTMA 3NZIA 2GMTB 1HXFH 1O30A 1BTUA 1RRKA 1O2RA 4WH8A 1O3NA 1AB9B 7KMEH 1O2IA 4UFFH 4K60A 1ZMNA 2CMYA 2TPIZ 1CSOE 5JB8S 3LONA 9ESTA 1XXFA 3AW1A 5GJ4B 3RU4D 5EGMA 4D9QA 1MTNB 3UR6A 2EC9H 2ZNKH 3E91A 2QCYA 3QTVH 1V2ST 2Y5FA 3QN7A 3TJOA 1EP5A 1E38B 2ZPQA 2WPJS 2BLVA 1K1JA 3Q3KA 2J2UA 1GJCB 1E37B 1FAKH 1FJSA 3LGTA 1B0FA 3ENSB 1UTMA 1C2EA 4IBLH 4J1YA 3VXFH 1V2KT 5A8ZA 3QWCH 3MU4A 3TJUA 1K1IA 1TGSZ 3M5LA 4JCNA 3KF2A 4LOYH 1XKAC 3RXEA 3TU7H 3RXAA 1HAVA 1TGCA 1ELGA 2FI3E 2J95A 1C1NA 2B8OH 3BTHE 1BBRK 1HLTH 1AZZA 1GDUA 2P8OC 5EQRA 1CBWB 4UFGH 1DXWA 3BEIB 3TK9A 3JZ2B 4CRCA 3VB3A 1DPOA 5G4BA 3T27A 2GKVE 1G2LA 3SU5A 1O32A 4DGJA 3VXEH 3ODFA 5DP9A 1GI0A 1L1JA 2UWOA 2LPRA 3RXMA 3M7TA 2I6QA 1HAVB 4CRFA 3GY8A 4UD9H 4DIHH 4XDEA 4CRGA 1BTWA 3MH4A 2P3TB 5DP8A 2SFAA 2H9HA 1MBMA 4X2WA 2BM2A 1C2FA 2JETB 3MTYA 5LPEA 5AFYH 1UK3A 2PTNA 1Y3YA 1O36A 1H1BA 2OC7A 2AYWA 3BTEE 3RM2H 1O38A 2WYGA 2Y7ZA 4BAHB 2CV3A 1QBNA 2QC2A 4ABBA 4INHA 4OS1A 1DDJA 3E1XB 3K6ZA 1KLJH 3NPSA 4KP0A 1ZHRA 4ZXXH 2BDIA 1L4DA 1NRRH 2R3YA 1C2MA 1TAWA 4GCHG 2A4QA 4K8BA 8ESTE 4I32A 1WQSA 1HAOH 3BG4B 3HGPA 2QXJA 2XBVA 3F68H 2GMTC 2VU8E 2VWLA 1ZTJA 4OS2A 2ZKSA 1AB9C 2FXRA 4YOIA 1O3BA 4D7FA 1MTNC 4MDSA 2F9OA 5HGGA 2C90B 1BOQA 3S9BA 1MTUA 2AS9A 1G32B 4XE4A 2XC0A 3AVZA 3TH2H 2ODYB 1OS8A 3C27B 2OC8A 1GVZA 5TJXA 3M3VA 1HDTH 2ZDKA 1DM4B 1TX7A 1KXBA 3N7OA 3SJ8A 1GBIA 3FP6E 1LMWB 3MNXA 3PYHA 1RGQA 3SU1A 4ISIH 2GT7A 1CGIE 1O5DH 1ARBA 1D6WA 1C5XB 1ID5H 2HWLB 4CR5A 2BVSH 1ZRBA 3PMAB 1C9PA 5A0AE 1HJ8A 5FHTA 2VWNA 1YPKH 3ZZBA 2ZGXH 3BSQA 1HB0B 2BVRH 2Z3DA 2ZEBA 2H9TH 1VITH 3SJ9A 2ALPA 4MNXA 3PM3A 1CBWC 2WPHS 1CGHA 3S7KB 1SVPA 2BDAA 1BBRH 2VIDA 4K1SA 3LGVA 1GBMA 1SGTA 1P11E 1XUGA 2BOHB 2BY7X 2F9BH 4RSPA 2JH5D 4GHQA 5FPSA 1O5BB 5CHAB 2QF0A 2ZTZA 2FO9A 1KTSB 3U8OH 2AEIH 2AIQA 1OX1A 3DD2H 1HJAB 1O3AA 5EODA 1L0ZA 1TNGA 1ETSH 4INLA 4Y6DA 1FQ3A 4U2WA 2QXGA 1NO9H 4KTUA 4AFSA 2ZCHP 3GCNA 1P2MA 3PMBB 3RC6A 1NN6A 2JH0D 5DKMA 2JETC 1P9UA 3PMHB 1BRBE 1O2KA 5EW2H 4FU7A 1GL0E 1O2LA 4AG2A 3P8FA 1QB1A 2VNTA 2A7JA 1LPZB 1IAUA 4TWYA 1Q31A 3ZZDA 1ELBA 1ZRKA 1BTHH 1Y3WA 1HNEE 5LH8A 2R2WU 3LGUA 3D65E 1QQ4A 4FVBA 4ABIA 3ZZ8A 4JK5A 1SOTA 2EI7A 2Y5HA 1GVKB 3BG4C 1TRMA 2ZU2A 2ANYA 4WMEA 1D3TB 1O39A 3F9EA 1NFUA 4I8HA 3ATIA 1EJAA 5AF9H 4K5ZA 1T32A 1ANEA 2VVUA 4HZHA 4CHAB 1HAYB 5C3NA 1ZHPA 5A09A 1K1NA 1XUKA 2PW8H 2OCVB 4ABHA 5A0CA 2FI4E 4NIWA 1CHOF 1AKSA 1LQEA 2HOBA 4NSYA 3TIUA 4JZFH 1O3MA 3D62A 3HGNA 1OWDA 1ORFA 1YPMH 1NS3A 4A7IB 4GUXA 4NIYA 3VB6A 3BF6H 1PQAA 2FS9A 1UVPA 1KXEA 5GCHF 1TGTA 1FPHH 5EXLA 1HPGA 1LHDH 2OLGA 1RTFB 1SLVB 1W7GH 3L6PA 1AKSB 2FOMB 3SGBE 3VGCB 5HM9A 1WUNH 1O2WA 1GBJA 3U69H 1BT7A 1DSUA 1MKXH 2LNCA 2IN2A 1QJ7B 1H9LB 5HM2A 3KQCA 2GZ9A 3DFJA 3SQHE 3BG8A 1P2KA 3ZZ3A 2PLXA 3VB4A 2IJOB 2O8LA 1G30B 1G3BA 2GX4A 1T4VH 1IQNA 3MU5A 1A1RA 1FY3A 4YESB 5CHAC 1G36A 1VCWA 1O2XA 2A32A 4Q2KA 1AUTC 5E2OA 5JB9S 1O2HA 2ZHQH 3P8GA 1HJAC 1F5RA 3Q3XA 4XBBA 2Z7FE 1V2PT 1DE7H 2ZU1A 1CA0B 4KTSA 5CMXH 4TPIZ 1B7XB 2A4OA 5F8XA 2P94A 3UTUH 2XBWA 1ZYOA 2BX4A 3STIA 3SGQE 1CVWH 2BD7A 1QCPA 4B2AA 3URDA 2XCFA 2A0QB 5E0JA 2ANKH 1QURH 4E7RG 3A85A 1AI8H 1TA6A 1WU1A 2QIQA 1UMAH 1CHOG 2PSYA 2ZWLH 2AFQB 7LPRA 3FVFB 4CH2B 2EA3A 2FYRA 1SGCA 4NSVA 1S0RA 3VEQB 3UUZA 1Y3XA 4X1PU 4DJZB 1H8DH 2CF8H 4ZHMU 1W14U 3O8BA 4KGAA 3BEUA 1DX5M 3TVJB 2OBQA 5GCHG 3SGAE 1C5YB 1KXDA 3Q77A 1F2SE 2KAIA 4Y71A 2C4FH 1ACBE 4ZH8A 2FI5E 3W94A 5L2YH 1XUFA 5L30H 1LO6A 3QDZB 1LHEH 4U30A 1QIXB 2GV7A 1THRH 2D2DA 2GCHF 4CHAC 1SGIB 1P2QA 4AZ2B 1SB1H 5E0GA 2W3IA 3ITIA 2F91A 2SNWA 4CBOA 1C1RA 1T31A 2ALVA 4UFDH 4HFPB 1WBGB 1GI4A 3V7TA 1QNJA 3FZZA 4JK6A 1KLTA 6LPRA 3EA9A 1DLKB 3RXUA 2R2MB 1YKTA 1FY1A 1W0ZU 3VFEA 1ZSKA 1JXPA 4ZROA 1A0JA 1C4Y2 1C5SA 3TK5A 1TBZH 1EASA 2ZDAH 3B23B 3GISB 2FOAA 1MU8B 1MUEB 1TPAE 3VGCC 1XVOA 2ESTE 1G3CA 1GBKA 3SV7A 2G00A 1BB0B 3G01A 1F0UA 2BQ6B 1RJXB 4AG1A 2BLOA 1WQVH 1AQ7A 1IQLA 4H6SB 3QO6A 1DUAA 4H4FA 4CRBA 1GDNA 3CS7A 1K22H 1PPGE 1FNIA 1ZLRA 4I8LA 2W26A 4DIIH 1O3EA 2Z3CA 3RMNH 2BD5A 2H2ZA 5JBCS 2NU0E 3V0XA 4OS7A 3UWJH 1DICA 2BQWB 3QZQA 1TX8A 1Z1JA 4GLYA 1UTNA 2BTCE 4QT8C 2V0BA 3UPEA 4X6PA 2GV6A 1DWDH 1BTYA 2GCHG 3HKJB 5A2MH 3Q76A 1O3GA 3MHWU 3ZVCA 1NU7B 3A7ZA 3E3TA 1O5CB 2ZFTA 3HATH 1ETRH 3GY3A 4FUJA 1ARCA 1SBWA 5TCAA 1GHBG 1SGEE 2YNBA 2BHGA 3GICB 3R0FA 3ZZ7A 3QUMP 2O8UA 1LVMA 5JYIA 1AIXH 9LPRA 2PV9B 4MQAA 1BBRE 1ZSJA 4FUFA 3T5FH 2C8ZB 1NTPA 1W3CA 3OX7U 4K8YA 2D1JA 1FONA 4H6TA 4ABFA 1Z1IA 3STJA 1GVLA 1XX9A 3M36A 3KEEA 1GHXH 1L2EA 2OQUA 3RMLH 1C5OH 2PKSC 1OYTH 1UTJA 4WF8A 3U1IB 5GIBA 1FY4A 1AZ8A 5EW1H 1UTLM 2XXLA 1GJ5H 4X2VA 3F6UH 3U98H 1ELCA 2Y6TA 1H9HE 2J92A 1LVBA 3ZVGA 1GJBB 1EUFA 3ZZ9A 1ZTLA 4X8SH 1ABJH 2OD3B 1LDTT 4FUCA 4OS5A 1EZXC 1ZMLA 1Y8TA 1TNHA 1SLWB 4IS5A 3RXFA 1C5MD 2ANMH 2AMPA 4AGKA 1DUEA 1F5KU 4DY7B 1QFKH 1V2WT 1YC0A 4LK4A 1EZUC 1IHTH 4A1TA 1O2SA 1DFPA 3A80A 1TE0A 3P6ZB 1YPEH 3BTDE 3QZRA 2GVFA 1PPZA 2XC4A 3MH5A 3AAVA 1QRWA 1UTOA 1JRSA 4H42U 1O0DH 2R0LA 5GXPA 2ULLA 1QGFA 2GD4B 3RXBA 3SJIA 5HYOA 1GG6B 2WUBA 1ZMJA 2V3OH 2BMGB 2C8YB 1TGNA 3AASA 1NPMA 3S9AA 2J34A 5H4IB 2VJ1A 3SV8A 1EPTB 4TPYA 3BEFB 1UVTH 1FIWA 1A3BH 3EDXB 1O2NA 4ZKNU 3RXDA 1PPBH 1C1MA 1Y3VA 4XSKU 3E0NB 1EQ9A 5F6MA 4LXBH 4Y8YA 1BMLA 3SI4H 2JKHA 4JZEH 1DY8A 1HBTH 1BQYA 4O9VA 3SNEA 3TH4H 3EGKH 1C5RA 2F9UA 1LHGH 4GSOA 2H9EH 3F1SB 2Z9JA 5J4QA 2VB0A 3GY5A 3OY5U 4Z0KA 3L33A 1OPHB 2WPLS 3RLWH 1T7CA 1HJ9A 2OTVA 2DUCA 4K1TA 2IOTA 3QK1A 5F8TA 1HAHH 3ATKA 5AHGH 5C1YA 4UEHH 3FZDA 2ZO3H 1C1WH 1P09A 1QL7A 2A31A 2HALA 3UNQA 1CT2E 3ZV8A 2ZFRH 1T8NA 4DCDA 3B9FH 4AB9A 4Y7BA 4BANB 1HYLA 4AFUA 8KME2 2G81E 3KIDU 1AN1E 2FESH 5TCCA 2G5NA 4ZKSU 3T2NA 3DA9B 2XBXA 3SV6A 1TQ0B 1XUHA 1PYTC