1F92A

Urokinase plasminogen activator b chain-uki-1d complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title Crystals of the urokinase type plasminogen activator variant beta(c)-uPAin complex with small molecule inhibitors open the way towards structure-based drug design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 57
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2000-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f92A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f92A01
3M5OA 1UCYK 5PTPA 1TMUH 2VWOA 1GJ7B 2FI4E 2ZA5A 4UEHH 1P10A 3MU0A 4H4FA 1W8BH 9ESTA 5DP4A 1DT2A 1XKBC 4FUIA 4MTBA 1QBVH 1GHYH 4I33A 2A4RA 1CBWB 1H9IE 2QXGA 5DP8A 1TPAE 4MLFB 1BRUP 1XVMA 1KXCA 1N6XA 1ZSJA 2F9VA 3CS0A 1S0RA 3QTOH 1W10U 1QY6A 1LVMA 3SJOA 3PLBA 2TGPZ 3W94A 4AFQA 1THSH 1ZHPA 1HRTH 2KAIB 4NIXA 4XOJA 3BG8A 4E7NA 1B0FA 1SVPA 4AGKA 1GHBG 1QURH 1MD7A 4JZFH 5JB8S 3BTQE 4B2CA 1MCVA 3P92A 2O9QA 2OQUA 3V3MA 1GJDB 4HTCH 1TBRH 4YO9A 1BJUA 5J4SA 2PFEA 2PKAA 1LHFH 2F9PA 1BUIA 3A8CA 1XUKA 2B8OH 1O32A 2W5EA 2XC0A 1OWDA 4NIYA 1C1TA 2ZFQH 1C1MA 1KDQB 1UCYE 1GDQA 3OY6U 1CHOF 1CT2E 1TPOA 5F8ZA 2CHAB 2VWLA 2ZDLA 4ZKNU 4IC6A 3UREA 1P01A 1O3KA 3Q00A 3UFAA 4Y0ZE 5ESTE 2Y5GA 1ZHRA 2FOMB 1MTVA 1A0LA 4XFQA 4X8TH 4MPVA 1BIOA 3E1XB 4FVDA 3E3TA 1NFWA 3QLPH 5C5NA 2GTBA 3SZNA 1P2NA 4FU7A 4FUFA 1NROH 1TQ7B 1IQGA 3BIVH 3K9XB 5FX6A 2A31A 1EP5A 1GJCB 1NRQH 2ZWLH 1TNIA 3BF6H 3IITA 3FVFB 2H6MA 4MPXA 1P12E 2Y81A 4CRGA 1JRTA 2SFAA 1FPHH 1CHOG 1OYTH 2NU1E 2PGQB 1NESE 3GCOA 3LJOA 4BXSA 1HAOH 2BD2A 1BTZA 1FDPA 4UONA 2ZIQH 3BEUA 1TMTH 3T28A 1C5PA 2SGEE 3M3VA 1O2NA 2RA3A 1YPLH 3QUMP 1GVKB 1WTHD 1D3PB 1C2IA 3A7TA 1Y3YA 3B23B 4K1EA 3SNCA 2AFQB 3RXOA 1JBUH 1HGTH 2ULLA 4IN2A 5A8XA 2AGEX 1G36A 1O3CA 1C1QA 1CGIE 4KTSA 3V12A 4YTAA 1V2QT 3U1JB 1UVUH 3CENA 4NA9H 3SW2B 2ZNKH 1VITH 1F5LA 4TY6A 1DM4B 3BTEE 4ZUHA 3GY2A 4DGJA 2OTVA 4AZ2B 3DD2H 4JCNA 5FPTA 3VPKA 1MTNB 2AEIH 3BV9B 4YOJA 2VB0A 2CN0H 1AFQB 5EQRA 1O2HA 1SGRE 5T6GA 4I7YH 1AO5A 2SGPE 1W3CA 2OBQA 1SMFE 1YLCA 1IHSH 2XBWA 1NRPH 4X8UH 5EOKA 1GG6B 1GJ9B 3LGYA 4DCDA 1TE0A 4CBOA 1YP9A 1FN6A 1UCYH 3GYMA 3L6PA 1ZMNA 2GMTC 5ESBA 2C8WB 5DPAA 4UDWH 2QXHA 2O8TA 3LPRA 4MG3A 3F6UH 2J38A 3SJ8A 1G3EA 2FI3E 4GHTA 1UVSH 3O8DA 2D1JA 1FY3A 3T27A 3TIUA 4AYYB 2FS8A 2ZCKP 2STBE 2BD7A 3BSQA 2J9NA 1YPGH 2GX4A 1ESBA 1MTUA 3MH6A 1QRXA 2BLVA 2G5VA 4Y8ZA 4BTTB 4Y8YA 1L1GA 3KQCA 4O3UA 2VIPA 1T8NA 3TNTA 2BDYA 1ZOMA 4FU8A 1K28D 1O3NA 1C2EA 2FM2A 1RTLA 1SGYE 2VNTA 1OWKA 2WPMS 3UNRA 1AKSB 3C1KA 1GBJA 2BQ7B 2ZFTA 4YT7H 1GJ6A 1GI1A 2Y5FA 3PM3A 2WV4A 3T62A 3UQOA 2R0LA 1J15A 1YYY1 1C4Y2 1JMOH 2DE9A 1GJ5H 4BXWA 3M5MA 4JYVH 2PKSC 2GGVB 3STIA 1CT4E 1GL0E 1RGQA 2BX3A 1BJVA 2XC4A 1QQUA 4KTCA 2Y6TA 2VIWA 1BT7A 1TNGA 1S82A 4Z6AH 1GBTA 1KY9A 1EPTA 2HWLB 1DUAA 1ZR0A 1KLJH 3MO3A 4IN1A 2HRVA 3GY4A 5CMXH 1TLDA 1KXFA 1SOTA 1LQDB 8ESTE 1WQVH 1ORFA 1GJ4H 1HIAA 1O31A 1NS3A 1HB0B 3QGJA 3ZV9A 5LPEA 1LQEA 1ETTH 5C1UA 1SPJA 3KHVA 2JH0D 3RXAA 1A4WH 3SNAA 1C5YB 1GVLA 3UNQA 1QA7A 3GICB 2ANWA 1O3DA 1V2JT 1O0DH 3M7TA 2ZKSA 2XNIA 1HAZB 3MU8A 1IQLA 3NCLA 5A8YA 1P05A 2A2XH 1KXAA 3ITIA 1GBHA 3HK6B 1YPEH 3BTKE 1HUTH 1ELVA 1ELTA 1OXGA 3RUOA 2VIOA 5HXFA 2F9BH 3A87A 3PMBB 3A81A 1C5WB 3LJJA 3QWCH 2P59A 1SLWB 1O2SA 1O2RA 1O2ZA 2A5KA 4NZLA 1YPHE 5FPYA 2BD9A 1QA0A 4CRDA 3QDZB 2UUYA 1GGDB 1VCWA 2UWOA 1DXWA 4NCYA 3SUGA 4YLQH 1DE7H 1ZMLA 1HAYB 3SUFA 3MO6A 1CA0C 2ZHWH 1MTNC 1C1SA 3H7TA 1GHZA 2OUAA 1LCYA 1ZTKA 3R3GB 2Q6GA 2BDIA 1A3BH 1OWJA 2JKHA 5EQQA 5CE1A 1IQHA 1Y5AT 1QL7A 4CBNA 4AFUA 4NIWA 1D9IA 1KIGH 3FP8E 1GG6C 2R2MB 2BYAX 1F5RA 5EPNA 1P03A 2OP9A 1CU1A 3SUDA 5DP5A 4OS7A 3LGVA 1BMLA 3BTTE 5JBAS 1AB9B 1FONA 2D8WA 1TBQH 1MD8A 2VH0A 2GT7A 4ISNA 4FXGH 2VIDA 1ZJDA 1IHTH 3SGAE 2FZZA 1AUTC 1MH0A 3B8JA 1P04A 4MNWA 1EJNA 3QO6A 3SQHE 2ZHDA 4I8GA 4GPGA 3SU6A 3F68H 3U8RH 3M7UA 1IQJA 1THRH 3KGPA 5A2MH 5C20A 2BQWB 1MKXK 2OC1A 3URCA 1NFUA 2WYGA 1K1JA 1P8VC 5L30H 1DSTA 4O3TA 4AYVB 3ZZ9A 1QJ7B 1ZPZA 5AHGH 3RXGA 1FMGA 3A89A 1W2KH 3BEIB 3Q3KA 1EASA 1O5GH 3MH4A 2VVVA 5ABWA 1ZRKA 1BA8B 6CHAB 1H4WA 1K1IA 1AY6H 1BRCE 1GBCA 1Z6EA 1O39A 1P06A 1O3IA 3MU5A 2ALPA 3RU4T 1O2XA 1GHXH 1HAVB 3RXFA 3VGCB 1FN8A 2BXUH 4FUBA 2CMYA 1T32A 2ZU4A 4JZDH 4GCHF 1Y3VA 1TGSZ 3N7OA 5EXNA 2VIQA 5TCCA 2BOHB 2IOTA 2ZEBA 2P93A 1C2HA 2YOLA 4WWYA 3SNDA 1FY1A 1NRSH 3QX5H 2FODA 1IQEA 3VB7A 3NZIA 1UHBB 4JZEH 4TWYA 1XXFA 1J9CH 2FOEA 1BTUA 4WY3A 1P0SH 3RU4D 5DKMA 2ZGBH 1Q2WA 4X6MA 1ACBE 2ZDMA 3M37A 2P3FH 1JIRA 2HLCA 4Y8XA 3S9AA 1CQQA 1EPTC 1GHVH 2ASUB 1BZXE 3TGKE 1RRKA 4R0IA 4ABFA 2ZGJA 3ATKA 5JBBS 2J94A 1TQ0B 1P57B 2QC2A 1O2IA 1XX9A 1FAXA 3FZDA 1PPFE 1PQ5A 1J8AA 4GCHG 2FMJA 3SI4H 4ZXYH 5C5OA 1XUJA 1SC8U 2GVFA 1EZSC 2Z3CA 4AFZA 1NRRH 1ZTLA 2BY5X 2CF9H 4K69A 3GCTF 3I78A 2ZFRH 2A1DB 3LU9B 1V2NT 1CT0E 3F1SB 2PTNA 2QY0B 1UK2A 1ZPBA 1AVWA 2WPKS 3V0XA 2IPHA 5JPMH 1CGHA 2LPRA 3AAUA 3M36A 2I6SA 5E2OA 1HNEE 1O3JA 2JH6D 1EXFA 4AGJA 1LPZB 5L2YH 3STJA 3OSYA 2BD5A 1TX7A 4JZ1A 1V2KT 2BY6X 1GDNA 3JZ1B 2ANKH 1HAPH 4ZXXH 4H6SB 4FU9A 4FUJA 1BQYA 5FCRA 1ANCA 1IAUA 1BTHH 1ETRH 1AI8H 2A0QB 3MNBA 4OS6A 5GJ4B 2Z9GA 1AWFH 2J4IA 3KN2A 2H9HA 3H5CB 3GCTG 4CH2B 3PYHA 1BCUH 1K1MA 1U6QA 1ELEE 2BZ6H 1HPGA 2BY9X 1V2ST 3K6YA 3S9CA 1GHWH 4ISHH 2XWBI 4KKDA 4Z0KA 2C4FH 3HKIB 4D7FA 4ISIH 2FPZA 1EUFA 3U8OH 5C1YA 3ELAH 5HM2A 1KTTB 4IW4E 1PFXC 2A4QA 1EAWA 2H9TH 4E06H 1C5RA 2P3UB 3A80A 5HYOA 3ZZ5A 1TGTA 4Q7ZA 1VITF 1TRYA 1O2PA 2VH6A 3PMHB 4NA7A 1EAIA 4D7GA 2ILNA 7LPRA 3EYDA 5GIBA 1MKXH 3DFJA 4E05H 1FUJA 1LHGH 1O2TA 2XWAA 4A92A 4BTIB 1TNLA 1C5XB 1QB6A 1S0QA 2FTLE 1O2LA 1H9LB 1UMAH 4FUEA 2GZ8A 1RTFB 1F5KU 3EQ0H 1G37A 2ZDAH 3SORA 4WMDA 2HNTE 1SGEE 1SL3A 3BTME 4GAWA 4AOQA 2HGTH 1GBLA 1PPCE 4ZMAH 3TU7H 4ABGA 1VITG 5FBEA 3U98H 2ALVA 3BTWE 1ABIH 2GMTB 1AWHB 4I8HA 4YOIA 4JMYA 4A6LA 1GBFA 4D9QA 3ZZ7A 1O3PB 1JIMA 3ATLA 3I29A 1N8OC 1P2QA 1N6YA 1E34B 1TA2A 4CR9A 1XM1A 3A88A 1YGCH 3P70B 4AB8A 1NU9A 5TCAA 3VB6A 5JDUB 1T31A 1NY22 3RXBA 4XBBA 3SBKA 2BTCE 2OINA 2VGCC 1XXDA 1NTPA 3NWUA 3SU5A 1JOUB 1ANBA 1MQ5A 4B75A 8LPRA 2ZG0H 2PV9B 2Z7FE 5EGMA 2C8ZB 1O38A 3A8BA 2OBOA 4ZKRU 2PWXA 3TK9A 1VCQA 1UVPA 2NU0E 1HJAC 2GD4B 2GZ9A 3M35A 4DOQA 1G3DA 3LGTA 3BN9A 2ZDNA 1O3GA 2XBVA 1P02A 3D65E 3EE0B 4U32A 4UD9H 2Z9JA 3QK1A 1W12U 2PKSB 2XBXA 1BMAA 1BTWA 1GCTC 1WAYB 2VIVA 4A7IB 1S6FA 1TPPA 2UUFB 3GISB 2GCTC 3UR6A 1ELCA 5T3HA 3NXPA 3K65B 3UOPA 1E38B 2J34A 3C27B 1KSNA 2O8MA 1SSXA 4KTUA 1XUGA 2TRMA 1QFKH 4XE4A 4OGXA 4A1TA 3ODFA 4R8TB 1BBRK 3RXHA 3P8GA 1FY5A 1SGFA 1TNHA 5L6NH 3QGNB 3EAJA 1A5HA 3Q3XA 1SQAA 2W26A 3RMLH 3G01A 3ZVFA 3SU1A 2NU4E 5T6DA 1K22H 1IQNA 1W0YH 3H7OA 2W7SA 1O2OA 3ZZ8A 1C2JA 1P9UA 4NWLA 4NFEA 3RXSA 3KNXA 1TMBH 4UFDH 5A0AE 2VVCA 2VWNA 3HPTB 1KLTA 1QQ4A 4E7RG 3A7VA 2QYIA 1ELDE 5F03A 2OD3B 1L4DA 4JK5A 1EZXC 3KCGH 1FY4A 4O9VA 3DFLA 1SLXB 4VGCB 1WQSA 2VU8E 1K1LA 5HM9A 1GI4A 1DITH 1C5UA 2A4OA 1A5GH 3E91A 1DY9A 1VZQH 4ZHMU 3ENSB 5JBCS 1PYTD 4DJZB 1CA0B 3MNCA 1TGBA 1TAWA 1W11U 1GI9B 3T25A 1P2MA 1AIXH 2J95A 4SGBE 5AFYH 1T7CA 2A7CA 1WTGH 3F9GA 4K5ZA 1DANH 1SLVB 2BDCA 2V3HH 4YM9A 1SGDE 2GP9B 2PHBA 5HGGA 2OC8A 3QZQA 4K8YA 4NFFA 2QN5T 1LVBA 3TPIZ 7GCHF 4TYDA 1Z71A 1B0EA 1NT1A 4I8LA 1Z8GA 1CO7E 2ZGXH 1TFXA 1BMMH 4NA8A 3A82A 1GPZA 4D8NA 4O03A 4XSKU 1DUEA 2AS9A 4NSYA 1F92A 4BAKB 1GJBB 1QRWA 1GI8B 3VXFH 6ESTA 1P3CA 4K8BA 1L1NA 2VINA 3UTUH 1SFIA 1ID5H 3EGKH 1BDAA 4GLYA 2FIRH 2PW8H 4X6PA 1C5QA 2GDDA 1EJAA 5GDSH 3GOVB 1FXYA 3MNSA 7GCHG 2EEKA 1LHDH 3MH7A 2Z6BD 4GUXA 3R0FA 1MQ6A 4CRBA 2ODYB 3L33A 2VJ1A 2ZPQA 1LHCH 1T8OA 1S83A 5AVDA 1AE8H 2Q6DA 2V3OH 1PYTC 4WXIA 4Y11E 1ARBA 3SV2H 3VEQB 3RXKA 3Q3YA 4BAOB 5C1XA 1EQ9A 2Z9IA 4B76A 1AZ8A 2EI7A 3URDA 5AF9H 2CXVA 2A2QH 3ZZBA 4MNYA 3RDZA 1FV9A 1VR1H 1H8DH 2Z94A 1BHXB 4CR5A 2I6QA 1GL1A 1GBAA 2FYRA 2GCHF 1O3HA 1C1WH 2FX4A 1P2OA 3AAVA 1O5DH 1PPGE 1H1BA 4RSPA 1HLTH 4HGCA 1SGCA 2STAE 3BTHE 4MPUA 1M9UA 1NC6A 2XCFA 3NUMA 1MTSA 5AFZH 1YLDA 2R3YA 2IJOB 1EPTB 1GBBA 3ZZCA 1KYNA 1V6DA 1HJ9A 4Y0YE 4IC5A 2FP7B 5T6FA 3GY8A 7ESTE 4X1RU 1HIAB 4B2BA 2ZF0H 3O8BA 4I8JA 1F0UA 4BNRA 3GY7A 1MUEB 2XXLA 1SB1H 2NWNA 3MFJA 1QHRB 2H2ZA 1OPHB 3UQVA 1DLKB 4IMQA 1Z6JH 1AUJA 1HV7A 1WBGB 3BIUH 3UUZA 1RIWB 1S81A 4VGCC 2P95A 4F4OC 1DWEH 2OC0A 4JYUH 3TK6A 1WU1A 5DP6A 1GBIA 2GCHG 1P2JA 1B5GH 1O3MA 4RKOB 3NK8A 1OKXA 2Y5HA 2P8OC 3S9BA 1HJ8A 3S69A 4OS4A 2GKVE 1TX8A 1UK3A 2XYAA 1YPMH 1F2SE 2QF3A 5EW2H 2FXRA 3MH5A 1MZAA 5GWZA 4QT8C 3RMNH 4YT6H 1NO9H 1UTJA 3SGBE 4X8SH 4FUDA 4Q80A 2FOGA 2ZQ2A 1FQ3A 1NRNH 4LXBH 2ZU1A 3T26A 1A2CH 1O2MA 1ELGA 1SGTA 4INKA 2BHGA 4BTUB 4DT7B 2ZGHA 1S5SA 1D6RA 1EATA 1SGNE 1LPGB 2FEQH 3GYLB 1MKWK 2M5TA 3E0PB 1G30B 3F9FA 3RXMA 1GI7B 3P8NA 2W3IA 1ESTA 3LC3A 1C2KA 2FWWA 5F6MA 3A85A 4ABHA 3GDUA 1NU7B 5EPYA 2FO9A 2BD4A 1A0HB 4DY7B 1ZSLA 1O3FA 1Z8JB 1C1OA 1GI0A 3VB3A 5EG4A 3TH4H 4ZHAA 1Z8IB 1UTPA 1TBZH 2BQ6B 2F9OA 1VGCB 3AW1A 2ZP0H 4CRCA 5LGOA 2BXTH 2AMQA 1XKAC 2ZHEH 3PLKA 1YBWA 2RCEA 1SHHB 2EA3A 3EA8A 1HAXB 3LOXA 1W13U 4IS5A 1UJ1A 4SGAE 3P17H 1V2OT 2RG3A 3VXEH 2H5DA 3MU1A 3ZVBA 3SU4A 1XUFA 2UWPA 1E36B 2ZGCA 1AD8H 1P2KA 5FCKA 1MZDA 1ZHMA 1DS2E 2BB4A 5EXMA 2UUJB 2FOCA 3A7WA 1TX6A 1V3XA 1SGFG 2ESTE 1J16A 1MAYA 3NPSA 4K60A 1SBWA 3RP2A 5SGAE 3ESTA 2ZFFH 1ABJH 2ZI2H 1O5EH 3RXLA 5F8XA 4Y10E 1P3EA 2H1UA 2ZQ1A 1C2LA 2AGGX 2BLWA 2H5CA 5DJ7A 2WPIS 1OWEA 3F9EA 1IQKA 1ZRBA 1IQMA 2OXSA 1L1JA 2B9LA 3O8RA 3PMJA 3GDVA 4AB9A 2ANMH 1GMDF 3EDXB 3U1IB 1N8OB 1YCPK 2F9UA 5BRRE 2XW9A 2JH5D 2PUQH 3MYWA 1QL8A 1OP2A 1PQ7A 3UWJH 1Q31A 4BAMB 3K6ZA 3A86A 2EC9H 3E16B 2F9NA 2A4GA 2VGCB 1J17T 1P11E 2G55A 1EAXA 1ESAA 1Z8RA 5IDKA 1X7AC 1KTSB 2B7DH 2LNCA 2ZTZA 2QCYA 1OWHA 4I31A 2AYWA 2Z3EA 2ZTYA 1NZQH 1RIWC 1Y5UT 3UOUA 2FESH 1C9PA 4DIHH 4ASHA 1O5AB 1LDTT 1FZZA 5K7RA 1HJAB 1K1NA 3UNSA 1VJ9U 1MMJN 3CS7A 2QAAA 1GMDG 4OS2A 1O5FH 2G00A 2RA0A 1S84A 4X0WU 2OCVB 1LMWB 4AG1A 1UTLM 1RD3B 3LKWA 1GCTB 1QR3E 1FY8E 3SO3A 4THNH 3PTNA 2GCTB 2VVUA 3RC6A 1HBTH 2CV3A 3MNXA 1A46H 2EI6A 2SGDE 1HXEH 4JYTA 1D6WA 1W7XH 3P6ZB 3P95A 3MOCA 1F0TA 1ELBA 1AFEH 1S85A 3SOSA 1WYKA 2HNTF 2V0BA 3DT0H 4WH8A 5E2PA 1GI5A 4ISOA 5JB9S 2QXIA 3RXEA 1CA8B 1GVZA 1MKWH 1YF4A 5C3NA 1C5ZB 3KQEA 2BVRH 1SR5C 2GDEH 1DFPA 1V2LT 2FOAA 1KXBA 2QA9E 3TGIE 2BM2A 1OSSA 5IYTA 3DHKH 1VGCC 3TJUA 1QTFA 2BVSH 4TWWA 1LKBA 4X1NU 3RMOH 1QL9A 3WY8A 4GSOA 1RJXB 1GBMA 1EB1H 1QJ1B 2AIPA 1YPKH 3U69H 3QZRA 2GV6A 2C93B 1AVGH 2FYQA 4XDEA 1DOJA 1AE5A 1VCPA 3GCHC 2BD3A 1TRNA 5DP3A 1O3LA 1ZTJA 3NKKA 2FLBH 3ZYDA 3ATWA 1FLEE 1G3CA 1TB6H 3P8FA 2BOKA 2AGIX 1OS8A 4LZ1H 2Y7XA 1C5OH 1EAUA 1ZGIA 1ETSH 5I46H 1ZPCA 3FP7E 1DDJA 3B9FH 2A5IA 1IQIA 1BTXA 1PQAA 4ABEA 2A7HA 4ZHLU 4X1QU 3KQDA 1D4PB 2GV7A 1A7SA 2ODQA 1DXPA 1TOCB 5FXLA 1AN1E 3A83A 1J14A 1C1PA 2PGBB 1P09A 1O3OA 5K0HA 2ZPRA 1ZGVA 2PLXA 2BY7X 1GHAF 5E0GA 2O8WA 2KAIA 5EODA 4NIVA 3M5LA 3EA7A 3RC4A 2XCNA 3FFGA 1ZLRA 1YC0A 1XUHA 1ELFA 2ZO3H 3BG4B 5TJXA 3SNBA 1A1RA 2C8XB 3RLYH 1YCPH 4A1VA 3FAOA 4GVUA 3UR9A 1AHTH 3RXDA 1PPHE 1C2DA 2O8LA 4IMZA 4Y79A 5DGJA 1VJAU 3GDSA 2HALA 1IQFA 1UVOA 2XRCA 4WMFA 2AERH 3SHAH 3T29A 1O2GH 5EXLA 2WUBA 3PB1E 2P3TB 1KDQA 1LVOA 2G81E 3TK5A 1O30A 5E0HA 3FZZA 3T5FH 2BDHA 5FPSA 2ZZUH 2BD8A 1C5LH 1QNJA 2UWLA 2TIOA 6GCHF 5GCHF 1DPOA 1D3TB 1GHAG 2SGAA 3LC5A 3A7ZA 5L2ZH 4ABDA 4RN6A 1V2MT 2PKAB 4X2XA 4XBCA 3E6PH 3D62A 4MDSA 1MAXA 3E0NB 2ZTXA 3ZZ6A 1O2KA 3SQEE 2G4UA 1DWBH 3LGIA 1PPEE 3RXQA 2YNBA 4HI3A 5E0JA 1SOZA 2QF0A 4ZAEA 3ZVCA 1KXEA 3OYPA 1FNIA 1GI2A 4INLA 3O8CA 4NG9H 1MCTA 3GY6A 1YM0A 4ZROA 3SUEA 1XVOA 3VB4A 4BANB 3RU4E 1HAGE 3ATIA 3RXCA 4CHAC 1D3QB 2AMPA 3SJ9A 1ZMJA 5CHAC 3PLPA 1O36A 2V35A 4DVAU 3ZZDA 1HAIH 2R3UA 1GWAA 3CP7A 2GZ7A 6GCHG 3A7XA 5GCHG 2PSXA 1C4V2 1UO6A 3TJVA 3GY3A 4AG2A 4KP0A 3TNSA 1LKAA 4WVPE 3TJNA 5FBIA 2FOHA 3OX7U 1GDUA 1GBDA 1K21H 1O35A 5LPFA 3DUXH 2ZC9H 3IWMA 1FAKH 2ZCLP 1OP0A 1BTPA 1K9OE 1C2FA 1SI5H 2C90B 4B1TA 4LZ4B 1O5BB 2BZAA 1A61H 1Z7KA 9LPRA 1HDTH 1O3EA 2GT8A 2H9EH 1C4U2 2ANYA 3SU3A 1LTOA 1O3BA 3M7QA 3MTYA 2P8OB 2J92A 1ARCA 2ZU2A 2EI8A 2CJIA 5FHTA 5EQSA 1BBRE 1B7XB 3TITA 4I8KA 1C5NH 4K1TA 1O2UA 3RXUA 2JETB 4D9RA 1BRBE 2WPHS 1GJ8B 3EA9A 1AZZA 1TALA 1EZQA 1QBOA 3LDXH 1JXPA 5A8ZA 4X2VA 2QIQA 1RTKA 1OX1A 1GBEA 1Y59T 1C1UH 3SV6A 2WINI 1O2JA 1HFDA 1L2EA 4ABBA 2K1QA 1YPHC 2PR3A 4YLUA 2ZCHP 3TH2H 5C2ZA 6LPRA 3OTJE 1MU6B 2CGAA 2BLOA 4YOGA 2TGAA 1O3AA 1XUIA 2Z9LA 4B2AA 1THPB 2Q6FA 2B5TB 5BPEA 1FIWA 4ESTE 2QXJA 2G4TA 3RM2H 3RXIA 1Y3XA 1MTWA 1TIOA 4INHA 3ZV8A 4LOYH 3A7YA 3RXJA 3DA9B 4K1SA 3M5NA 4UE7H 3BG4C 3MU4A 1ZJKA 2ZHQH 1CBWC 2FDAA 1YKTA 1E35B 4FUCA 1G2MA 1PPZA 2SGQE 3LH1A 3UWIA 4A1XA 1AKSA 1BTYA 1CVWH 2FTMA 3HKJB 4ZH8A 3SI3H 2C8YB 3PMAB 5JYIA 1Z1JA 2F83A 1OWIA 3S7KB 4DG4A 3U9AH 1UTQA 2WPJS 1C9TA 1OYQA 3ODDA 1MU8B 4ABJA 4ZKOU 2A7JA 2RDLA 1GMHF 3LIWA 3BTGE 1S6HA 3PO1B 4Y7BA 4WMEA 1AU8A 2D2DA 1QIXB 5A0CA 5C67A 1DLEA 1INCA 4X8VH 1PQ8A 1K1OA 4FVBA 3AW0A 4CRAA 3QN7A 1Z1IA 3UPEA 4JK6A 1HYLA 3KEEA 2NU2E 1SGIB 1LPKB 1BRAA 4KGAA 3V13A 1RFNA 2G5NA 5DP9A 1A0JA 1O2WA 1QCPA 1RS0A 2CHAC 3BTDE 2C3SA 3LGUA 1G9IE 4NZQA 4RKJB 3T2NA 3RM0H 4U2WA 1C5SA 3SGQE 2HOBA 4OS1A 2F3CE 3PWCA 3RXVA 5I25A 1T4VH 1O5CB 3RMMH 3K2UA 1PJPA 5ETXA 4O97A 2TBSA 1BBRH 4H6TA 1JRSA 1XMNB 1GMHG 4ZKSU 3ZVEA 2Y82A 2TPIZ 3KL6A 1WSSH 1IOEA 1H9HE 1T4UH 4J1YA 4X1PU 2P16A 4MNVA 4I32A 1TABE 3ATMA 4DIIH 1DVAH 3A8AA 4ISLA 1CE5A 4BOHA 4MNXA 1HAHH 1TWXB 2FS9A 4M7GA 1Q3XA 3MI4A 3D23A 4IGDA 1TONA 1SQOA 2Y80A 1ANDA 1V2PT 1PPBH 2R9PA 1WCZA 2VWMA 4X1SU 4HZHA 1CHGA 1QBNA 1ZZZA 4UFGH 4WF8A 2HVXA 2ZU3A 1GBKA 1O33A 2JETC 3L3TA 3LONA 1EOJA 4WXVA 1TNKA 2HPPH 2ZHFH 4AN7A 7KMEH 5DO4H 1Y8TA 1DX5M 2BDBA 3SJKA 1EOLA 3BTFE 3PV4A 1DWDH 4UFFH 3LGWA 4U30A 3ZZAA 3SN8A 4TY7A 4A5TS 1FJSA 4K3JA 2OQ5A 5GXPA 1GCDA 4CRFA 2FX6A 1EKBB 1GI3A 1AFQC 2W3KA 2G52A 1NM6A 5E8EH 1EZUC 3SNEA 4ABAA 2FLRH 2Q1JA 3HGPA 4JZIA 3KQBA 1T8MA 2FOBA 4U01A 4K2YA 4B73A 1C1NA 2BMGB 1EX3A 1W0ZU 1QB9A 1BMNH 1DWCH 2ZPSA 4CREA 1ANEA 4X6NA 1N1LA 2FOFA 5H4IB 1G32B 2ZFPH 1O37A 1V2VT 2BY8X 1H8IH 2BX4A 1HCGA 1W7GH 3JZ2B 4B71A 3A84A 1JWTA 5DG6A 1YCPM 3TJOA 3GCHB 1C2GA 2BVXH 4YZUA 1SGPE 1MBQA 4NSVA 1TPSA 4MPWA 3HATH 1DSUA 1FPCH 2YNAA 1AMHA 2AIQA 3MMGA 1A3EH 1C5TA 1CGJE 1SLUB 2FI5E 1TNJA 1L0ZA 3PO1C 4H42U 1ELAA 1HAVA 1LHEH 4TPIZ 5J4QA 3AASA 4MQAA 3Q77A 1TA6A 3MWIU 2SGFE 3SV8A 3ZZ3A 4HFPB 1SFQB 1EB2A 2Z3DA 3SHCH 4Q7XA 1SGQE 2ZFSA 5B6OA 1UHBA 5A0BA 4Y71A 3KF2A 1DICA 1K1PA 3F9HA 1NPMA 1V2TT 1UTMA 4WH6A 4BAHB 3Q76A 3RLWH 3ZZ4A 3OU0A 2Y7ZA 1ZYOA 1K2I1 3S7HB 3VFEA 2XTTB 3W95A 1SG8B 3VB5A 4XBDA 2Z9KA 4DURA 2HNTC 2P94A 1P9SA 2ZDVH 3TH3H 3SV9A 1Y3WA 5DP7A 3U8TH 1OP8A 2DUCA 3FANA 1Y5BT 3RXPA 1KXDA 3TVJB 2PUXB 3M3SA 4X2WA 2PSYA 1AQ7A 5G4BA 8GCHF 4FUGA 2AMDA 1QJ6B 2UUKB 1DY8A 1YPJH 2WUCA 1FI8A 1UVTH 1RXPA 3HK3B 2ZDKA 5FAHA 1TGCA 2G51A 2ZU5A 3SV7A 3LT3A 4D76A 1C5VA 3V7TA 4Q2KA 1SQTA 4IBLH 1GMCF 2D26C 2BLQA 5HMAA 3GY5A 2TGTA 1O2YA 1QGFA 2QGRA 4DW2U 2BDGA 2TGDA 5EW1H 4X2YA 1BB0B 1TRMA 4GHQA 1GI6A 3HGNA 4X6OA 1O2VA 4NGAH 1MBMA 1QRZA 2ZECA 3I77A 1C2MA 2A5AA 1BITA 1D3DB 3PWBA 2PTCE 2OLGA 5LH8A 1O2QA 2BDAA 4OGYA 4F49A 1W14U 4AX9H 1SHYA 1V2RT 3TLOA 1WUNH 1Y3UA 1GGDC 1TYNA 2R2WU 4NWKA 2V6NA 2W7UA 2NU3E 3RXTA 2SNWA 3SJIA 8GCHG 1G2LA 2A32A 4LK4A 3ZVDA 4YESB 3AVZA 4PROA 1EJMA 3FP6E 1E0FD 1OOKB 4UFEH 1V2UT 1BHXF 1A5IA 3S0NA 1F0SA 4CHAB 3E8LA 3BEFB 1AVXA 1QB1A 3GCNA 2SNVA 1HXFH 5CHAB 3D49H 3P8OA 2XC5A 1GMCG 3LH3A 3ZVAA 2DE8A 2ODPA 4AFSA 2QV1A 2WV5A 2G8TA 3TGJE 2WYJA 1O34A 4TPYA 2CF8H 2F91A 2HPQH 1WV7H 3E90B 4ABIA 1AGJA 3MHWU 2WPLS 3UIRA 1AB9C 2B0FA 3RXRA 1UK4A 5DK1A 1L4ZA 5FX5A 1G3BA 5A09A 1ZSKA 1UTNA 3M61U 3MO9A 1UTOA 1C1RA 1E37B 2AH4X 4WJG2 1LVYA 8KME2 5LPRA 3ZVGA 4MVNA 4CH8B 1TGNA 4Y7AA 3SU0A 3QTVH 2OC7A 1LO6A 2R0KA 1V2WT 1KLIH 2XBYA 1TOMH 3PTBA 2J2UA 5F8TA 2THFB 3RC5A 1CSOE 1GJAB 3KIDU 1NFYA 3A8DA 5GPIB 4B74A 3M3TA 3OY5U 4Y6DA 1NFXA 4Y76A 4Q7YA 1EP6A 1FIZA 2A45B 1C5MD 4KELA 1F7ZA 1BOQA 1WOFA 1T8LA 3UY9A 6CHAC 1GHBF 3IG6B 4BAQB 4AORA 2O8UA 4J2YB 1C1VH 3PROA 3SU2A 1F0RA 3VGCC 1P2IA 4FUHA 1NN6A 2IN2A 1UTKA 3ZYEA 4OS5A 5JBTA 5EU8A
chains in the Genus database with same CATH superfamily
3M5OA 1UCYK 5PTPA 1TMUH 2VWOA 1GJ7B 2FI4E 2ZA5A 4UEHH 1P10A 3MU0A 4H4FA 1W8BH 9ESTA 5DP4A 1DT2A 1XKBC 4FUIA 4MTBA 1QBVH 1GHYH 4I33A 2A4RA 1CBWB 1H9IE 2EY4C 2QXGA 5DP8A 1TPAE 4MLFB 1BRUP 1XVMA 1KXCA 1N6XA 1ZSJA 2F9VA 3CS0A 1S0RA 3QTOH 1W10U 1QY6A 1LVMA 3SJOA 3PLBA 2TGPZ 3W94A 4AFQA 1THSH 1ZHPA 1HRTH 2KAIB 3DSGA 4NIXA 3BG8A 4XOJA 4E7NA 1B0FA 1SVPA 4AGKA 1GHBG 1QURH 1MD7A 4JZFH 5JB8S 3BTQE 4B2CA 1MCVA 3P92A 2HVYB 2J98A 2O9QA 2OQUA 3V3MA 1GJDB 4HTCH 1TBRH 4YO9A 1BJUA 5J4SA 2PFEA 2PKAA 1LHFH 2F9PA 1BUIA 3A8CA 1XUKA 2B8OH 1O32A 2W5EA 2XC0A 2J5UA 1OWDA 4NIYA 1C1TA 2ZFQH 1C1MA 1KDQB 1UCYE 1GDQA 3OY6U 4XRNA 1CHOF 2PP6A 1CT2E 1TPOA 5F8ZA 2CHAB 2VWLA 2ZDLA 4ZKNU 4IC6A 3UREA 1P01A 1O3KA 3Q00A 3UFAA 4Y0ZE 5ESTE 2Y5GA 1ZHRA 2FOMB 1MTVA 1A0LA 4XFQA 4X8TH 4MPVA 1BIOA 3E1XB 4FVDA 3E3TA 1NFWA 3QLPH 5C5NA 2GTBA 3SZNA 1P2NA 4FU7A 4FUFA 1NROH 1TQ7B 1IQGA 3BIVH 3K9XB 5FX6A 2A31A 1EP5A 1GJCB 1NRQH 2ZWLH 1TNIA 3BF6H 3IITA 1FX0B 2H6MA 3FVFB 4MPXA 1P12E 2Y81A 4CRGA 1JRTA 2SFAA 1FPHH 1CHOG 1OYTH 2NU1E 2PGQB 1NESE 3GCOA 3LJOA 4BXSA 1HAOH 2BD2A 1BTZA 1FDPA 4UONA 2ZIQH 3BEUA 1TMTH 3T28A 1C5PA 2SGEE 3M3VA 1O2NA 2RA3A 1YPLH 3QUMP 1GVKB 1WTHD 1D3PB 1C2IA 3A7TA 1Y3YA 3B23B 4K1EA 3SNCA 2AFQB 3MQKC 3RXOA 2KM0A 1JBUH 1HGTH 2ULLA 4IN2A 5A8XA 2AGEX 1G36A 1O3CA 1C1QA 1CGIE 4KTSA 3V12A 4YTAA 1V2QT 3VG8A 3U1JB 1UVUH 3CENA 4NA9H 3SW2B 2ZNKH 3WWBA 1VITH 1F5LA 4TY6A 1DM4B 3BTEE 4ZUHA 3GY2A 4DGJA 2OTVA 4AZ2B 3DD2H 4JCNA 5FPTA 3VPKA 1MTNB 2AEIH 3BV9B 4YOJA 2VB0A 2CN0H 1AFQB 5EQRA 1O2HA 1SGRE 5T6GA 4I7YH 1AO5A 2SGPE 1W3CA 2OBQA 1SMFE 1YLCA 1IHSH 2XBWA 1NRPH 3N7DA 4X8UH 5EOKA 1GG6B 1GJ9B 3LGYA 4DCDA 1TE0A 4CBOA 1YP9A 1FN6A 1UCYH 3GYMA 3L6PA 1ZMNA 2GMTC 5ESBA 2C8WB 5DPAA 4UDWH 2QXHA 2O8TA 3LPRA 4MG3A 3F6UH 2J38A 3SJ8A 1G3EA 2FI3E 4GHTA 3W1EA 1UVSH 3O8DA 2D1JA 1FY3A 3T27A 3TIUA 4AYYB 2FS8A 2ZCKP 2STBE 2BD7A 3BSQA 2J9NA 1YPGH 2GX4A 1ESBA 1MTUA 3MH6A 5HIYA 1QRXA 2BLVA 2G5VA 4Y8ZA 4BTTB 4Y8YA 1L1GA 3KQCA 4O3UA 2VIPA 1T8NA 3TNTA 2BDYA 1ZOMA 4FU8A 3FKSD 1K28D 1O3NA 1C2EA 2FM2A 1RTLA 1SGYE 2VNTA 1OWKA 2WPMS 3UNRA 3F2FA 1AKSB 3C1KA 1GBJA 2BQ7B 2ZFTA 4YT7H 1GJ6A 1GI1A 2Y5FA 3PM3A 2WV4A 3T62A 3UQOA 2R0LA 1J15A 1YYY1 1C4Y2 1JMOH 2WV9A 2DE9A 1W0JD 1GJ5H 4BXWA 3M5MA 4FETA 4JYVH 2PKSC 2GGVB 3STIA 1CT4E 1GL0E 1RGQA 2BX3A 1BJVA 2XC4A 3WW7A 4Q63A 1QQUA 4KTCA 1VKYA 2Y6TA 2VIWA 1BT7A 1TNGA 1S82A 4Z6AH 1GBTA 1KY9A 1EPTA 2HWLB 1DUAA 1ZR0A 1KLJH 3MO3A 4IN1A 2HRVA 3GY4A 5CMXH 1TLDA 1KXFA 1SOTA 1LQDB 8ESTE 1WQVH 1ORFA 1GJ4H 1HIAA 1O31A 1NS3A 1HB0B 3QGJA 3ZV9A 5LPEA 1LQEA 1ETTH 5C1UA 1SPJA 3KHVA 2JH0D 3RXAA 1A4WH 3SNAA 1C5YB 1GVLA 3UNQA 1QA7A 2L74A 3GICB 2ANWA 1O3DA 1V2JT 1O0DH 3M7TA 2ZKSA 2XNIA 1HAZB 3MU8A 1IQLA 2WZQA 3NCLA 5A8YA 1P05A 2A2XH 1KXAA 3ITIA 1GBHA 3HK6B 1YPEH 3BTKE 1HUTH 1ELVA 1ELTA 1OXGA 3RUOA 4I86A 2VIOA 5HXFA 2F9BH 3A87A 3PMBB 3A81A 1C5WB 3LJJA 3QWCH 2P59A 1SLWB 1O2SA 2EQNA 1O2RA 1O2ZA 2A5KA 4NZLA 1YPHE 5FPYA 2BD9A 1QA0A 4CRDA 3QDZB 1YY3A 2UUYA 1QZ8A 1GGDB 1VCWA 2UWOA 1DXWA 4NCYA 3SUGA 4YLQH 1DE7H 1ZMLA 1HAYB 3SUFA 5C94A 3MO6A 1CA0C 2ZHWH 1MTNC 1C1SA 3H7TA 1GHZA 2OUAA 1LCYA 1ZTKA 2KCPA 3R3GB 2Q6GA 2BDIA 1A3BH 1OWJA 2JKHA 5EQQA 5F53A 1WXRA 5CE1A 1IQHA 1Y5AT 1QL7A 2IJD1 4CBNA 4AFUA 4NIWA 1D9IA 1KIGH 3FP8E 1GG6C 2R2MB 2BYAX 1F5RA 5EPNA 3SZEA 4XD7D 1P03A 2OP9A 3GS9A 1CU1A 3SUDA 5DP5A 4OS7A 3LGVA 3KYGA 1BMLA 3BTTE 5JBAS 1AB9B 1FONA 2D8WA 1TBQH 1MD8A 2VH0A 2GT7A 4ISNA 4FXGH 2VIDA 1ZJDA 1IHTH 4RT0A 3SGAE 2FZZA 1AUTC 1MH0A 3B8JA 1P04A 4MNWA 1EJNA 3QO6A 3SQHE 2ZHDA 4I8GA 4GPGA 3SU6A 3F68H 3U8RH 3M7UA 1IQJA 1THRH 3KGPA 5A2MH 5C20A 2BQWB 1MKXK 2OC1A 3URCA 1NFUA 2WYGA 1K1JA 1P8VC 1E1RD 1DSTA 4O3TA 5L30H 2W6JD 4AYVB 3ZZ9A 1QJ7B 1ZPZA 5AHGH 3RXGA 1FMGA 3A89A 1W2KH 3BEIB 3Q3KA 1EASA 1O5GH 3MH4A 2VVVA 5ABWA 1ZRKA 1BA8B 6CHAB 1H4WA 1K1IA 1AY6H 1BRCE 1GBCA 1Z6EA 1O39A 1P06A 3OAAD 1O3IA 3MU5A 2ALPA 3RU4T 1O2XA 2F4LA 1GHXH 1HAVB 2F43B 3RXFA 3VGCB 1FN8A 2BXUH 4FUBA 2CMYA 1SKYE 1T32A 2ZU4A 4JZDH 3OTPA 4GCHF 1Y3VA 1TGSZ 3N7OA 5EXNA 2VIQA 5TCCA 2BOHB 2IOTA 2ZEBA 2P93A 1C2HA 2YOLA 4WWYA 3SNDA 1FY1A 1NRSH 3QX5H 2FODA 1IQEA 3VB7A 3NZIA 1UHBB 4JZEH 4TWYA 1XXFA 1J9CH 3FO8D 2FOEA 1BTUA 4WY3A 1P0SH 3RU4D 5DKMA 2ZGBH 4TT3D 1Q2WA 4X6MA 1ACBE 2ZDMA 3M37A 2HLCA 1JIRA 2P3FH 2HLDD 4Y8XA 3S9AA 1CQQA 1EPTC 1GHVH 2ASUB 1BZXE 3TGKE 1RRKA 4R0IA 4ABFA 2ZGJA 3ATKA 5JBBS 2J94A 1TQ0B 1P57B 2QC2A 1O2IA 1XX9A 1FAXA 3FZDA 1PPFE 1PQ5A 1J8AA 4GCHG 2FMJA 3SI4H 2LELA 4ZXYH 1EFRD 5C5OA 1XUJA 1SC8U 3PV5A 2GVFA 1EZSC 2YMSD 2Z3CA 2CK3D 4AFZA 1NRRH 1ZTLA 2BY5X 2CF9H 4K69A 3GCTF 3I78A 2ZFRH 2A1DB 3LU9B 1V2NT 1CT0E 3F1SB 2PTNA 2QY0B 3FOAA 1UK2A 1ZPBA 1AVWA 2WPKS 3V0XA 2IPHA 5JPMH 1CGHA 2LPRA 3AAUA 3M36A 2I6SA 5E2OA 1HNEE 1O3JA 2JH6D 1EXFA 4AGJA 1E79D 1LPZB 5L2YH 3STJA 3OSYA 2BD5A 1TX7A 4JZ1A 1V2KT 3KQ5A 3SYJA 2BY6X 1GDNA 3JZ1B 2ANKH 1HAPH 4ZXXH 4H6SB 4FU9A 4FUJA 1BQYA 5FCRA 1ANCA 1IAUA 1BTHH 1ETRH 1AI8H 2A0QB 3MNBA 4OS6A 5GJ4B 2Z9GA 1AWFH 2J4IA 2V3MA 3KN2A 2H9HA 3H5CB 3GCTG 4CH2B 3PYHA 1BCUH 1K1MA 1U6QA 1ELEE 2BZ6H 1HPGA 2BY9X 2IPQX 1V2ST 3K6YA 3S9CA 1GHWH 4ISHH 2XWBI 4KKDA 4Z0KA 2C4FH 3HKIB 4D7FA 4ISIH 2FPZA 1EUFA 3U8OH 5C1YA 3ELAH 5HM2A 1KTTB 4IW4E 1PFXC 2A4QA 1EAWA 2H9TH 2JIZD 4E06H 1C5RA 2P3UB 3A80A 5HYOA 3ZZ5A 4ASUD 1TGTA 4Q7ZA 1VITF 1TRYA 1O2PA 2VH6A 3PMHB 4NA7A 1EAIA 4D7GA 2ILNA 7LPRA 3EYDA 5GIBA 1MKXH 3DFJA 4E05H 1FUJA 1LHGH 1O2TA 2XWAA 4A92A 4BTIB 1TNLA 1C5XB 1QB6A 1S0QA 2FTLE 1O2LA 1H9LB 1UMAH 3UB0A 4FUEA 2GZ8A 1RTFB 1F5KU 3EQ0H 1G37A 2ZDAH 3SORA 4WMDA 2HNTE 1SGEE 1SL3A 3BTME 4GAWA 4AOQA 2WHXA 2HGTH 1GBLA 1PPCE 4ZMAH 3TU7H 4ABGA 1VITG 5FBEA 3U98H 2ALVA 3BTWE 1ABIH 2GMTB 1AWHB 3OEED 4I8HA 4YOIA 4JMYA 4A6LA 1GBFA 4D9QA 3ZZ7A 1O3PB 1JIMA 3ATLA 4RI0A 3I29A 1N8OC 1P2QA 1N6YA 5HIZA 5KEDA 1E34B 1TA2A 4CR9A 1XM1A 2KCYA 3A88A 1YGCH 3P70B 4AB8A 1NU9A 5TCAA 3VB6A 5JDUB 1T31A 1NY22 3RXBA 4XBBA 3SBKA 2BTCE 3DCLA 2GJGA 2OINA 2VGCC 1XXDA 1NTPA 3NRLA 3NWUA 3SU5A 1JOUB 1ANBA 1MQ5A 2JDID 2QF5A 4B75A 8LPRA 2ZG0H 2PV9B 1WDIA 2Z7FE 1S6LA 5EGMA 2C8ZB 1O38A 3A8BA 2OBOA 4ZKRU 2PWXA 3TK9A 1VCQA 1UVPA 4ZCNA 2NU0E 1HJAC 2GD4B 2GZ9A 3M35A 4DOQA 1G3DA 3LGTA 3BN9A 2J98B 2ZDNA 1O3GA 2XBVA 1P02A 3D65E 3EE0B 4U32A 4UD9H 2Z9JA 2W6ID 3QK1A 1W12U 2PKSB 2XBXA 1BMAA 2JJ2D 1BTWA 1GCTC 1WAYB 2VIVA 4A7IB 1S6FA 1TPPA 2UUFB 3GISB 2GCTC 3UR6A 1ELCA 5T3HA 3NXPA 3K65B 3UOPA 1E38B 2J34A 4YXWD 3C27B 1KSNA 2O8MA 1SSXA 4KTUA 1XUGA 2TRMA 1QFKH 4XE4A 4OGXA 4A1TA 3ODFA 4R8TB 1BBRK 3RXHA 3P8GA 1FY5A 1SGFA 1TNHA 2KR7A 5L6NH 1YLNA 3QGNB 3EAJA 1A5HA 3Q3XA 1SQAA 2W26A 3RMLH 3G01A 2M2AA 3ZVFA 3SU1A 2NU4E 5T6DA 1K22H 1IQNA 1W0YH 3H7OA 2W7SA 1O2OA 3ZZ8A 1C2JA 1P9UA 4NWLA 4NFEA 3RXSA 3KNXA 1TMBH 4UFDH 5A0AE 2VVCA 2VWNA 3HPTB 1KLTA 1QQ4A 4E7RG 3A7VA 1NBME 1ELDE 2QYIA 5F03A 2OD3B 1L4DA 4JK5A 1EZXC 3KCGH 1FY4A 4O9VA 3DFLA 1SLXB 4VGCB 1WQSA 2VU8E 1K1LA 5HM9A 1GI4A 1DITH 2L6OA 1C5UA 2A4OA 1A5GH 3E91A 1DY9A 1VZQH 4ZHMU 3ENSB 5JBCS 5KECA 1PYTD 4DJZB 1CA0B 3MNCA 1TGBA 1TAWA 1W11U 1GI9B 3T25A 1P2MA 1AIXH 2J95A 4SGBE 5AFYH 1T7CA 2A7CA 1WTGH 3F9GA 4K5ZA 1DANH 1SLVB 2BDCA 2V3HH 4YM9A 1SGDE 2GP9B 2PHBA 5HGGA 2OC8A 3QZQA 4K8YA 4NFFA 2QN5T 1LVBA 3TPIZ 3PV2A 7GCHF 4TYDA 1Z71A 1B0EA 1NT1A 4I8LA 1Z8GA 1CO7E 2ZGXH 1TFXA 1BMMH 4NA8A 3A82A 1GPZA 4D8NA 4O03A 4XSKU 1DUEA 2AS9A 4NSYA 1F92A 5T1VA 4BAKB 1GJBB 1QRWA 1GI8B 3VXFH 6ESTA 1P3CA 4K8BA 4TSFD 1L1NA 2VINA 3F2GA 3UTUH 1SFIA 1ID5H 3EGKH 1BDAA 4GLYA 2FIRH 2PW8H 2KCOA 4X6PA 1C5QA 2GDDA 1EJAA 5GDSH 3GOVB 1FXYA 3MNSA 7GCHG 2EEKA 1LHDH 3MH7A 2Z6BD 4GUXA 3R0FA 1MQ6A 4CRBA 2ODYB 3L33A 2VJ1A 2ZPQA 1LHCH 1T8OA 1S83A 5AVDA 1AE8H 2Q6DA 2V3OH 1PYTC 2V7QD 4WXIA 1ARBA 4Y11E 3SV2H 3VEQB 3RXKA 3Q3YA 4BAOB 5C1XA 1EQ9A 2Z9IA 4B76A 1AZ8A 2EI7A 3URDA 1COWD 5AF9H 2CXVA 2A2QH 3ZZBA 4MNYA 3RDZA 1FV9A 1VR1H 1H8DH 2Z94A 1BHXB 4CR5A 2I6QA 1GL1A 1GBAA 2FYRA 2GCHF 1O3HA 1C1WH 2FX4A 1P2OA 3AAVA 1O5DH 1PPGE 1H1BA 4RSPA 1HLTH 4HGCA 1SGCA 2STAE 3BTHE 4MPUA 1M9UA 1NC6A 2XCFA 3NUMA 1MTSA 5AFZH 1YLDA 2R3YA 2IJOB 1EPTB 4P02A 1GBBA 3ZZCA 1KYNA 1V6DA 2KCAA 1HJ9A 4Y0YE 4IC5A 2FP7B 5T6FA 3GY8A 7ESTE 4X1RU 1HIAB 4B2BA 2ZF0H 3O8BA 4I8JA 3UAIC 1F0UA 4BNRA 3GY7A 1MUEB 2XXLA 1SB1H 2NWNA 3MFJA 1QHRB 2H2ZA 1OPHB 3UQVA 1DLKB 4IMQA 1Z6JH 1AUJA 1HV7A 1WBGB 3BIUH 3UUZA 5HKKD 1RIWB 1S81A 4VGCC 2P95A 4F4OC 1DWEH 2OC0A 4JYUH 3TK6A 1WU1A 5DP6A 1GBIA 2GCHG 1P2JA 1B5GH 1O3MA 4RKOB 3NK8A 1OKXA 2Y5HA 2P8OC 3S9BA 1HJ8A 3S69A 4OS4A 2GKVE 1TX8A 1UK3A 2XYAA 1YPMH 1F2SE 2QF3A 5EW2H 2FXRA 3MH5A 1MZAA 5GWZA 4QT8C 3RMNH 4YT6H 1NO9H 1UTJA 3SGBE 4X8SH 4FUDA 4Q80A 3PRDA 2FOGA 5B6LA 2ZQ2A 1FQ3A 1NRNH 1E1QD 4LXBH 2ZU1A 3T26A 1A2CH 1O2MA 1ELGA 1SGTA 4INKA 2BHGA 4BTUB 4DT7B 2ZGHA 1S5SA 1D6RA 1EATA 1SGNE 1LPGB 2FEQH 3GYLB 1MKWK 2M5TA 3E0PB 1G30B 3F9FA 3RXMA 1GI7B 3P8NA 2W3IA 1ESTA 3LC3A 1C2KA 2FWWA 2OK5A 5F6MA 3A85A 4ABHA 3GDUA 2RFKC 1NU7B 5EPYA 2FO9A 2BD4A 1A0HB 4DY7B 1ZSLA 1O3FA 1Z8JB 1C1OA 1GI0A 4OM9A 3VB3A 5EG4A 3TH4H 4ZHAA 1Z8IB 1UTPA 1TBZH 2BQ6B 2F9OA 1VGCB 3AW1A 2ZP0H 4CRCA 5LGOA 2BXTH 2AMQA 1XKAC 2ZHEH 3PLKA 1YBWA 2RCEA 1SHHB 2EA3A 3EA8A 1HAXB 3LOXA 1W13U 4IS5A 1UJ1A 4SGAE 3P17H 1V2OT 2RG3A 3VXEH 2H5DA 3MU1A 3ZVBA 3SU4A 1XUFA 2UWPA 1E36B 2ZGCA 1AD8H 1P2KA 5FCKA 1MZDA 2YMSB 1ZHMA 1DS2E 5KGOA 2BB4A 5EXMA 2UUJB 2FOCA 3A7WA 1TX6A 3F0PA 1V3XA 1SGFG 2ESTE 1J16A 1MAYA 3NPSA 4K60A 1SBWA 1SQRA 3RP2A 5SGAE 3ESTA 2ZFFH 1ABJH 2ZI2H 1O5EH 3RXLA 5F8XA 4Y10E 1P3EA 2H1UA 2ZQ1A 2RDEA 1C2LA 2AGGX 2BLWA 2H5CA 5DJ7A 2WPIS 1OWEA 3F9EA 1IQKA 1ZRBA 1IQMA 2OXSA 1L1JA 2B9LA 3O8RA 3PMJA 3GDVA 4AB9A 2ANMH 1GMDF 3EDXB 3U1IB 1N8OB 1YCPK 2F9UA 5BRRE 2XW9A 2JH5D 2PUQH 3MYWA 1QL8A 1OP2A 1PQ7A 3UWJH 3DSOA 1Q31A 4BAMB 3K6ZA 3A86A 2EC9H 3E16B 2F9NA 2A4GA 2VGCB 1J17T 1P11E 2G55A 1EAXA 1ESAA 1Z8RA 5IDKA 1X7AC 1KTSB 2B7DH 2LNCA 2ZTZA 2QCYA 1OWHA 4I31A 2AYWA 1H8ED 2Z3EA 2ZTYA 1NZQH 1RIWC 1Y5UT 3UOUA 2FESH 1C9PA 4DIHH 4ASHA 1O5AB 1LDTT 1FZZA 5K7RA 1HJAB 1K1NA 3UNSA 1VJ9U 1MMJN 3CS7A 2QAAA 1GMDG 4OS2A 1NBMD 1O5FH 2G00A 2RA0A 4F48B 1S84A 4X0WU 2OCVB 1LMWB 4AG1A 1UTLM 1RD3B 3LKWA 1GCTB 1QR3E 1FY8E 5DSFA 3SO3A 4THNH 3PTNA 2GCTB 2VVUA 3RC6A 1HBTH 2CV3A 3MNXA 1A46H 2EI6A 2SGDE 1HXEH 4JYTA 1D6WA 1W7XH 3P6ZB 3P95A 3MOCA 1F0TA 1ELBA 1AFEH 1S85A 3SOSA 1WYKA 2HNTF 2V0BA 3DT0H 4WH8A 5E2PA 1GI5A 4ISOA 5JB9S 2QXIA 3RXEA 1CA8B 1GVZA 1MKWH 1YF4A 5C3NA 1C5ZB 3KQEA 2BVRH 1SR5C 2GDEH 1DFPA 1V2LT 2FOAA 1KXBA 2QA9E 3TGIE 2BM2A 1OSSA 5IYTA 3DHKH 1VGCC 3TJUA 1QTFA 2BVSH 4TWWA 1LKBA 4X1NU 3RMOH 1QL9A 3WY8A 4GSOA 1RJXB 1GBMA 1EB1H 5EJ1A 4M9FA 1QJ1B 2AIPA 1YPKH 3U69H 3QZRA 2GV6A 2C93B 1AVGH 2FYQA 3PRBA 4XDEA 1DOJA 1AE5A 1VCPA 3GCHC 2BD3A 1TRNA 5DP3A 1O3LA 1ZTJA 3NKKA 2FLBH 3ZYDA 2YMSC 3ATWA 3CNRA 1FLEE 1G3CA 1OHHD 1TB6H 2K0QA 3AK5A 3P8FA 2BOKA 2AGIX 5DN6D 1OS8A 4LZ1H 2Y7XA 1C5OH 1EAUA 1ZGIA 1ETSH 5I46H 1ZPCA 3FP7E 3FN8A 1DDJA 3B9FH 2A5IA 1IQIA 1BTXA 1PQAA 4ABEA 2A7HA 4ZHLU 4X1QU 3KQDA 1D4PB 2GV7A 1A7SA 2ODQA 1DXPA 1TOCB 5FXLA 1AN1E 3A83A 1J14A 1C1PA 2PGBB 1P09A 1O3OA 5K0HA 2ZPRA 1ZGVA 2PLXA 2BY7X 1GHAF 5E0GA 2O8WA 2KAIA 5EODA 4NIVA 3M5LA 3EA7A 3RC4A 2XCNA 3FFGA 1ZLRA 1YC0A 1XUHA 1ELFA 2ZO3H 3BG4B 5TJXA 3SNBA 1A1RA 2C8XB 3RLYH 3ZIAD 1YCPH 4A1VA 3FAOA 4GVUA 3U28C 3UR9A 1AHTH 3RXDA 1PPHE 1C2DA 2LP6A 2O8LA 4IMZA 4Y79A 5DGJA 1VJAU 3GDSA 2HALA 1IQFA 1UVOA 2XRCA 4WMFA 2AERH 3SHAH 3T29A 1O2GH 5EXLA 4B6FA 2K8IA 2WUBA 3PB1E 2P3TB 1KDQA 1LVOA 2G81E 3TK5A 1O30A 5E0HA 3F0OA 3FZZA 3T5FH 2BDHA 5FPSA 2ZZUH 2BD8A 1C5LH 1QNJA 2UWLA 2TIOA 6GCHF 5GCHF 1DPOA 1D3TB 1GHAG 2SGAA 3LC5A 3A7ZA 5L2ZH 1K0HA 4ABDA 4RN6A 1V2MT 2PKAB 4X2XA 4XBCA 3E6PH 3D62A 4MDSA 1MAXA 3E0NB 4ACAA 2ZTXA 3ZZ6A 1O2KA 3SQEE 2G4UA 1DWBH 3LGIA 1W0KD 1PPEE 3RXQA 2YNBA 4HI3A 5E0JA 1SOZA 2QF0A 4ZAEA 3ZVCA 1KXEA 3OYPA 1FNIA 1GI2A 4INLA 3O8CA 4NG9H 1MCTA 3GY6A 1YM0A 4ZROA 3SUEA 1XVOA 3VB4A 4BANB 4P00A 3OFND 3RU4E 1HAGE 3ATIA 3RXCA 4CHAC 1D3QB 2AMPA 3SJ9A 1ZMJA 2WSSD 5CHAC 3PLPA 1O36A 2V35A 4DVAU 3ZZDA 1HAIH 2R3UA 1GWAA 3CP7A 2GZ7A 6GCHG 3A7XA 5GCHG 2PSXA 1C4V2 1UO6A 3TJVA 3GY3A 4AG2A 4KP0A 3TNSA 1LKAA 4WVPE 3TJNA 5FBIA 2FOHA 3OE7D 3OX7U 1GDUA 1GBDA 1K21H 1O35A 5LPFA 3DUXH 2ZC9H 3IWMA 1FAKH 2ZCLP 1OP0A 1BTPA 1K9OE 1C2FA 1SI5H 2C90B 4B1TA 3EE7A 4LZ4B 1O5BB 2BZAA 1A61H 1Z7KA 9LPRA 1HDTH 1O3EA 2GT8A 2H9EH 1C4U2 2ANYA 3SU3A 1LTOA 1O3BA 3M7QA 3MTYA 2P8OB 2JJ1D 2J92A 1ARCA 2ZU2A 2EI8A 2CJIA 5FHTA 5EQSA 1BBRE 1B7XB 3TITA 4I8KA 1C5NH 4K1TA 1O2UA 5EJLA 5GNDA 2JETB 3RXUA 1BRBE 4D9RA 2WPHS 1GJ8B 3EA9A 1AZZA 1TALA 1EZQA 1QBOA 3LDXH 1JXPA 5A8ZA 2QE7D 4X2VA 2QIQA 1RTKA 1OX1A 1GBEA 1Y59T 1C1UH 3SV6A 2WINI 1O2JA 1HFDA 1L2EA 4ABBA 2K1QA 1YPHC 2PR3A 4YLUA 1BMFD 2ZCHP 3TH2H 5C2ZA 6LPRA 2QF4A 3OTJE 1MU6B 2CGAA 2BLOA 4YOGA 2TGAA 1O3AA 2XNDD 1XUIA 2Z9LA 4B2AA 1THPB 2Q6FA 2B5TB 5BPEA 1FIWA 4ESTE 2QXJA 5C0UA 2G4TA 3RM2H 3RXIA 1Y3XA 1MTWA 1TIOA 4INHA 3ZV8A 4LOYH 5CHBA 3A7YA 3RXJA 3DA9B 4K1SA 3M5NA 4UE7H 3BG4C 3MU4A 1ZJKA 2ZHQH 1CBWC 1YWUA 2FDAA 1YKTA 1E35B 4AC9A 2AHME 5EJZA 4FUCA 1G2MA 1PPZA 2SGQE 3LH1A 3UWIA 4A1XA 1AKSA 1BTYA 1CVWH 2FTMA 3HKJB 4ZH8A 3SI3H 2C8YB 3PMAB 5JYIA 1Z1JA 2F83A 1OWIA 3S7KB 4DG4A 3U9AH 1UTQA 2WPJS 1C9TA 1OYQA 3ODDA 1MU8B 4ABJA 4ZKOU 2A7JA 2RDLA 1GMHF 3LIWA 3BTGE 1S6HA 3PO1B 4Y7BA 4WMEA 1AU8A 2D2DA 1QIXB 5A0CA 5C67A 1DLEA 1INCA 4X8VH 1PQ8A 1K1OA 4FVBA 3AW0A 4CRAA 3QN7A 1Z1IA 3UPEA 4JK6A 1HYLA 3KEEA 2NU2E 1SGIB 1LPKB 1BRAA 4KGAA 3V13A 1RFNA 2G5NA 5DP9A 1A0JA 1O2WA 1QCPA 1RS0A 2CHAC 3BTDE 2C3SA 3LGUA 1G9IE 4NZQA 4RKJB 3T2NA 3RM0H 4U2WA 1C5SA 4ACBA 3SGQE 2HOBA 4OS1A 2F3CE 3PWCA 3RXVA 5I25A 1T4VH 1O5CB 3N7EA 3RMMH 3K2UA 1PJPA 5ETXA 1KMHB 4O97A 2TBSA 1BBRH 4H6TA 1JRSA 1XMNB 1GMHG 4ZKSU 3ZVEA 2Y82A 2TPIZ 3KL6A 5C17A 1WSSH 1IOEA 1H9HE 1T4UH 4J1YA 4X1PU 2P16A 4MNVA 4I32A 1TABE 3ATMA 4DIIH 1DVAH 3A8AA 4ISLA 1CE5A 4BOHA 4MNXA 1HAHH 1TWXB 2FS9A 4M7GA 1Q3XA 3MI4A 3D23A 4IGDA 1TONA 1SQOA 2Y80A 1ANDA 1V2PT 1PPBH 2R9PA 1WCZA 2VWMA 4X1SU 4HZHA 1CHGA 1QBNA 1ZZZA 4UFGH 4WF8A 5C0TA 2HVXA 2ZU3A 1GBKA 1O33A 2JETC 3L3TA 3LONA 1EOJA 4WXVA 1TNKA 2HPPH 2ZHFH 4AN7A 7KMEH 5DO4H 1Y8TA 1DX5M 2BDBA 3SJKA 1EOLA 3BTFE 3PV4A 1DWDH 4UFFH 3LGWA 4U30A 3ZZAA 4Q4LA 4TY7A 3SN8A 4A5TS 1FJSA 4K3JA 2OQ5A 5GXPA 1GCDA 4CRFA 4DT4A 2FX6A 1EKBB 1GI3A 1AFQC 2W3KA 3KYFA 2G52A 1NM6A 5E8EH 1EZUC 3SNEA 4ABAA 2FLRH 2Q1JA 3HGPA 4JZIA 3KQBA 3H09A 1T8MA 2FOBA 4U01A 4K2YA 4B73A 1C1NA 5IK2D 2BMGB 1EX3A 1W0ZU 1QB9A 1BMNH 1DWCH 2KZ4A 2ZPSA 1MABB 4CREA 1ANEA 2J97A 4X6NA 1N1LA 2FOFA 5H4IB 1G32B 2ZFPH 1O37A 1V2VT 2BY8X 1H8IH 2BX4A 1HCGA 1W7GH 3JZ2B 4B71A 3A84A 1JWTA 5DG6A 1YCPM 3TJOA 3GCHB 1C2GA 2BVXH 4YZUA 1SGPE 1MBQA 4NSVA 1TPSA 4MPWA 3HATH 1DSUA 1FPCH 2YNAA 1AMHA 2AIQA 3MMGA 1A3EH 1C5TA 1CGJE 1SLUB 2FI5E 1TNJA 1L0ZA 3PO1C 4H42U 2VBCA 1ELAA 1HAVA 1LHEH 4TPIZ 5J4QA 3AASA 4MQAA 3Q77A 1TA6A 3MWIU 2SGFE 3SV8A 3ZZ3A 4HFPB 1SFQB 1EB2A 2Z3DA 3SHCH 4Q7XA 2XOKD 1SGQE 2ZFSA 5B6OA 1UHBA 2WPDD 5A0BA 4Y71A 3KF2A 1DICA 1K1PA 3F9HA 3OEHD 1NPMA 1V2TT 1UTMA 4WH6A 4BAHB 3Q76A 3RLWH 3DSPA 3ZZ4A 3OU0A 2Y7ZA 1ZYOA 1K2I1 3S7HB 3VFEA 2XTTB 3W95A 1SG8B 3VB5A 4XBDA 2Z9KA 4F55A 4DURA 2HNTC 2P94A 1P9SA 2ZDVH 3TH3H 3SV9A 1Y3WA 5DP7A 3U8TH 1OP8A 2DUCA 3FANA 1Y5BT 3RXPA 1KXDA 3TVJB 2PUXB 3M3SA 4X2WA 2PSYA 1AQ7A 5G4BA 8GCHF 4FUGA 2AMDA 1QJ6B 2UUKB 1DY8A 4B6EA 1YPJH 2WUCA 1FI8A 1UVTH 1RXPA 3HK3B 2ZDKA 4RT1A 5FAHA 1TGCA 2G51A 3F2HA 2ZU5A 3SV7A 3LT3A 4D76A 1C5VA 3V7TA 4Q2KA 1SQTA 4IBLH 1GMCF 2D26C 2BLQA 5HMAA 3GY5A 2TGTA 1O2YA 1QGFA 2QGRA 4DW2U 2BDGA 2TGDA 5EW1H 4X2YA 1BB0B 1TRMA 4GHQA 1H8HD 1GI6A 3HGNA 4X6OA 1O2VA 4NGAH 1MBMA 1QRZA 2ZECA 3I77A 1C2MA 2A5AA 1BITA 1D3DB 3PWBA 2PTCE 2OLGA 5LH8A 1O2QA 2BDAA 4OGYA 4F49A 1W14U 4AX9H 1SHYA 1V2RT 3TLOA 1WUNH 1Y3UA 1GGDC 1TYNA 2R2WU 4NWKA 2V6NA 2W7UA 2NU3E 3RXTA 2SNWA 3SJIA 8GCHG 1G2LA 2A32A 4LK4A 3ZVDA 4YESB 2KX4A 3AVZA 4PROA 1EJMA 3FP6E 1E0FD 4Z1MD 1OOKB 4UFEH 1V2UT 1BHXF 2KFWA 1A5IA 3S0NA 1F0SA 4CHAB 3E8LA 3BEFB 1AVXA 1QB1A 3GCNA 2SNVA 1HXFH 5CHAB 3D49H 3P8OA 2XC5A 1GMCG 3LH3A 3ZVAA 2DE8A 2ODPA 4AFSA 2QV1A 2WV5A 2G8TA 3TGJE 2WYJA 1O34A 4TPYA 2CF8H 2F91A 2HPQH 1WV7H 3E90B 4ABIA 1AGJA 3MHWU 2WPLS 3UIRA 1AB9C 2B0FA 3RXRA 1UK4A 5FL7D 5DK1A 1L4ZA 5FX5A 1G3BA 5A09A 1ZSKA 1UTNA 3M61U 3MO9A 1UTOA 3WWFA 1C1RA 1E37B 1UW7A 2AH4X 3N99A 4WJG2 1LVYA 8KME2 5LPRA 3ZVGA 4MVNA 4CH8B 1TGNA 4Y7AA 3SU0A 3QTVH 2OC7A 5CDFE 1LO6A 2R0KA 1V2WT 1KLIH 2XBYA 1TOMH 3PTBA 2J2UA 5F8TA 2THFB 3RC5A 1CSOE 1GJAB 3KIDU 1NFYA 3A8DA 4FOUC 5GPIB 4B74A 3M3TA 3OY5U 4Y6DA 1NFXA 4Y76A 4Q7YA 1EP6A 1FIZA 2A45B 1C5MD 3F3BA 4KELA 1F7ZA 1BOQA 1WOFA 1T8LA 3UY9A 6CHAC 1GHBF 3IG6B 4BAQB 5EIYA 4AORA 2O8UA 4J2YB 1C1VH 3PROA 3SU2A 1F0RA 3VGCC 1P2IA 4FUHA 1NN6A 2IN2A 1UTKA 3ZYEA 4OS5A 5JBTA 5EU8A 4HG6A
chains in the Genus database with same CATH topology
3M5OA 1UCYK 5PTPA 1TMUH 2VWOA 1GJ7B 2FI4E 2ZA5A 4UEHH 1P10A 3MU0A 4H4FA 1W8BH 9ESTA 5DP4A 1DT2A 1XKBC 4FUIA 4MTBA 1QBVH 1GHYH 4I33A 2A4RA 1CBWB 1H9IE 2QXGA 5DP8A 1TPAE 4MLFB 1BRUP 1XVMA 1KXCA 1N6XA 1ZSJA 2F9VA 3CS0A 1S0RA 3QTOH 1W10U 1QY6A 1LVMA 3SJOA 3PLBA 2TGPZ 3W94A 4AFQA 1THSH 1ZHPA 1HRTH 2KAIB 4NIXA 4XOJA 3BG8A 4E7NA 1B0FA 1SVPA 4AGKA 1GHBG 1QURH 1MD7A 4JZFH 5JB8S 3BTQE 4B2CA 1MCVA 3P92A 2O9QA 2OQUA 3V3MA 1GJDB 4HTCH 1TBRH 4YO9A 1BJUA 5J4SA 2PFEA 2PKAA 1LHFH 2F9PA 1BUIA 3A8CA 1XUKA 2B8OH 1O32A 2W5EA 2XC0A 1OWDA 4NIYA 1C1TA 2ZFQH 1C1MA 1KDQB 1UCYE 1GDQA 3OY6U 1CHOF 1CT2E 1TPOA 5F8ZA 2CHAB 2VWLA 2ZDLA 4ZKNU 4IC6A 3UREA 1P01A 1O3KA 3Q00A 3UFAA 4Y0ZE 5ESTE 2Y5GA 1ZHRA 2FOMB 1MTVA 1A0LA 4XFQA 4X8TH 4MPVA 1BIOA 3E1XB 4FVDA 3E3TA 1NFWA 3QLPH 5C5NA 2GTBA 3SZNA 1P2NA 4FU7A 4FUFA 1NROH 1TQ7B 1IQGA 3BIVH 3K9XB 5FX6A 2A31A 1EP5A 1GJCB 1NRQH 2ZWLH 1TNIA 3BF6H 3IITA 3FVFB 2H6MA 4MPXA 1P12E 2Y81A 4CRGA 1JRTA 2SFAA 1FPHH 1CHOG 1OYTH 2NU1E 2PGQB 1NESE 3GCOA 3LJOA 4BXSA 1HAOH 2BD2A 1BTZA 1FDPA 4UONA 2ZIQH 3BEUA 1TMTH 3T28A 1C5PA 2SGEE 3M3VA 1O2NA 2RA3A 1YPLH 3QUMP 1GVKB 1WTHD 1D3PB 1C2IA 3A7TA 1Y3YA 3B23B 4K1EA 3SNCA 2AFQB 3RXOA 1JBUH 1HGTH 2ULLA 4IN2A 5A8XA 2AGEX 1G36A 1O3CA 1C1QA 1CGIE 4KTSA 3V12A 4YTAA 1V2QT 3U1JB 1UVUH 3CENA 4NA9H 3SW2B 2ZNKH 1VITH 1F5LA 4TY6A 1DM4B 3BTEE 4ZUHA 3GY2A 4DGJA 2OTVA 4AZ2B 3DD2H 4JCNA 5FPTA 3VPKA 1MTNB 2AEIH 3BV9B 4YOJA 2VB0A 2CN0H 1AFQB 5EQRA 1O2HA 1SGRE 5T6GA 4I7YH 1AO5A 2SGPE 1W3CA 2OBQA 1SMFE 1YLCA 1IHSH 2XBWA 1NRPH 4X8UH 5EOKA 1GG6B 1GJ9B 3LGYA 4DCDA 1TE0A 4CBOA 1YP9A 1FN6A 1UCYH 3GYMA 3L6PA 1ZMNA 2GMTC 5ESBA 2C8WB 5DPAA 4UDWH 2QXHA 2O8TA 3LPRA 4MG3A 3F6UH 2J38A 3SJ8A 1G3EA 2FI3E 4GHTA 1UVSH 3O8DA 2D1JA 1FY3A 3T27A 3TIUA 4AYYB 2FS8A 2ZCKP 2STBE 2BD7A 3BSQA 2J9NA 1YPGH 2GX4A 1ESBA 1MTUA 3MH6A 1QRXA 2BLVA 2G5VA 4Y8ZA 4BTTB 4Y8YA 1L1GA 3KQCA 4O3UA 2VIPA 1T8NA 3TNTA 2BDYA 1ZOMA 4FU8A 1K28D 1O3NA 1C2EA 2FM2A 1RTLA 1SGYE 2VNTA 1OWKA 2WPMS 3UNRA 1AKSB 3C1KA 1GBJA 2BQ7B 2ZFTA 4YT7H 1GJ6A 1GI1A 2Y5FA 3PM3A 2WV4A 3T62A 3UQOA 2R0LA 1J15A 1YYY1 1C4Y2 1JMOH 2DE9A 1GJ5H 4BXWA 3M5MA 4JYVH 2PKSC 2GGVB 3STIA 1CT4E 1GL0E 1RGQA 2BX3A 1BJVA 2XC4A 1QQUA 4KTCA 2Y6TA 2VIWA 1BT7A 1TNGA 1S82A 4Z6AH 1GBTA 1KY9A 1EPTA 2HWLB 1DUAA 1ZR0A 1KLJH 3MO3A 4IN1A 2HRVA 3GY4A 5CMXH 1TLDA 1KXFA 1SOTA 1LQDB 8ESTE 1WQVH 1ORFA 1GJ4H 1HIAA 1O31A 1NS3A 1HB0B 3QGJA 3ZV9A 5LPEA 1LQEA 1ETTH 5C1UA 1SPJA 3KHVA 2JH0D 3RXAA 1A4WH 3SNAA 1C5YB 1GVLA 3UNQA 1QA7A 3GICB 2ANWA 1O3DA 1V2JT 1O0DH 3M7TA 2ZKSA 2XNIA 1HAZB 3MU8A 1IQLA 3NCLA 5A8YA 1P05A 2A2XH 1KXAA 3ITIA 1GBHA 3HK6B 1YPEH 3BTKE 1HUTH 1ELVA 1ELTA 1OXGA 3RUOA 2VIOA 5HXFA 2F9BH 3A87A 3PMBB 3A81A 1C5WB 3LJJA 3QWCH 2P59A 1SLWB 1O2SA 1O2RA 1O2ZA 2A5KA 4NZLA 1YPHE 5FPYA 2BD9A 1QA0A 4CRDA 3QDZB 2UUYA 1GGDB 1VCWA 2UWOA 1DXWA 4NCYA 3SUGA 4YLQH 1DE7H 1ZMLA 1HAYB 3SUFA 3MO6A 1CA0C 2ZHWH 1MTNC 1C1SA 3H7TA 1GHZA 2OUAA 1LCYA 1ZTKA 3R3GB 2Q6GA 2BDIA 1A3BH 1OWJA 2JKHA 5EQQA 5CE1A 1IQHA 1Y5AT 1QL7A 4CBNA 4AFUA 4NIWA 1D9IA 1KIGH 3FP8E 1GG6C 2R2MB 2BYAX 1F5RA 5EPNA 1P03A 2OP9A 1CU1A 3SUDA 5DP5A 4OS7A 3LGVA 1BMLA 3BTTE 5JBAS 1AB9B 1FONA 2D8WA 1TBQH 1MD8A 2VH0A 2GT7A 4ISNA 4FXGH 2VIDA 1ZJDA 1IHTH 3SGAE 2FZZA 1AUTC 1MH0A 3B8JA 1P04A 4MNWA 1EJNA 3QO6A 3SQHE 2ZHDA 4I8GA 4GPGA 3SU6A 3F68H 3U8RH 3M7UA 1IQJA 1THRH 3KGPA 5A2MH 5C20A 2BQWB 1MKXK 2OC1A 3URCA 1NFUA 2WYGA 1K1JA 1P8VC 5L30H 1DSTA 4O3TA 4AYVB 3ZZ9A 1QJ7B 1ZPZA 5AHGH 3RXGA 1FMGA 3A89A 1W2KH 3BEIB 3Q3KA 1EASA 1O5GH 3MH4A 2VVVA 5ABWA 1ZRKA 1BA8B 6CHAB 1H4WA 1K1IA 1AY6H 1BRCE 1GBCA 1Z6EA 1O39A 1P06A 1O3IA 3MU5A 2ALPA 3RU4T 1O2XA 1GHXH 1HAVB 3RXFA 3VGCB 1FN8A 2BXUH 4FUBA 2CMYA 1T32A 2ZU4A 4JZDH 4GCHF 1Y3VA 1TGSZ 3N7OA 5EXNA 2VIQA 5TCCA 2BOHB 2IOTA 2ZEBA 2P93A 1C2HA 2YOLA 4WWYA 3SNDA 1FY1A 1NRSH 3QX5H 2FODA 1IQEA 3VB7A 3NZIA 1UHBB 4JZEH 4TWYA 1XXFA 1J9CH 2FOEA 1BTUA 4WY3A 1P0SH 3RU4D 5DKMA 2ZGBH 1Q2WA 4X6MA 1ACBE 2ZDMA 3M37A 2P3FH 1JIRA 2HLCA 4Y8XA 3S9AA 1CQQA 1EPTC 1GHVH 2ASUB 1BZXE 3TGKE 1RRKA 4R0IA 4ABFA 2ZGJA 3ATKA 5JBBS 2J94A 1TQ0B 1P57B 2QC2A 1O2IA 1XX9A 1FAXA 3FZDA 1PPFE 1PQ5A 1J8AA 4GCHG 2FMJA 3SI4H 4ZXYH 5C5OA 1XUJA 1SC8U 2GVFA 1EZSC 2Z3CA 4AFZA 1NRRH 1ZTLA 2BY5X 2CF9H 4K69A 3GCTF 3I78A 2ZFRH 2A1DB 3LU9B 1V2NT 1CT0E 3F1SB 2PTNA 2QY0B 1UK2A 1ZPBA 1AVWA 2WPKS 3V0XA 2IPHA 5JPMH 1CGHA 2LPRA 3AAUA 3M36A 2I6SA 5E2OA 1HNEE 1O3JA 2JH6D 1EXFA 4AGJA 1LPZB 5L2YH 3STJA 3OSYA 2BD5A 1TX7A 4JZ1A 1V2KT 2BY6X 1GDNA 3JZ1B 2ANKH 1HAPH 4ZXXH 4H6SB 4FU9A 4FUJA 1BQYA 5FCRA 1ANCA 1IAUA 1BTHH 1ETRH 1AI8H 2A0QB 3MNBA 4OS6A 5GJ4B 2Z9GA 1AWFH 2J4IA 3KN2A 2H9HA 3H5CB 3GCTG 4CH2B 3PYHA 1BCUH 1K1MA 1U6QA 1ELEE 2BZ6H 1HPGA 2BY9X 1V2ST 3K6YA 3S9CA 1GHWH 4ISHH 2XWBI 4KKDA 4Z0KA 2C4FH 3HKIB 4D7FA 4ISIH 2FPZA 1EUFA 3U8OH 5C1YA 3ELAH 5HM2A 1KTTB 4IW4E 1PFXC 2A4QA 1EAWA 2H9TH 4E06H 1C5RA 2P3UB 3A80A 5HYOA 3ZZ5A 1TGTA 4Q7ZA 1VITF 1TRYA 1O2PA 2VH6A 3PMHB 4NA7A 1EAIA 4D7GA 2ILNA 7LPRA 3EYDA 5GIBA 1MKXH 3DFJA 4E05H 1FUJA 1LHGH 1O2TA 2XWAA 4A92A 4BTIB 1TNLA 1C5XB 1QB6A 1S0QA 2FTLE 1O2LA 1H9LB 1UMAH 4FUEA 2GZ8A 1RTFB 1F5KU 3EQ0H 1G37A 2ZDAH 3SORA 4WMDA 2HNTE 1SGEE 1SL3A 3BTME 4GAWA 4AOQA 2HGTH 1GBLA 1PPCE 4ZMAH 3TU7H 4ABGA 1VITG 5FBEA 3U98H 2ALVA 3BTWE 1ABIH 2GMTB 1AWHB 4I8HA 4YOIA 4JMYA 4A6LA 1GBFA 4D9QA 3ZZ7A 1O3PB 1JIMA 3ATLA 3I29A 1N8OC 1P2QA 1N6YA 1E34B 1TA2A 4CR9A 1XM1A 3A88A 1YGCH 3P70B 4AB8A 1NU9A 5TCAA 3VB6A 5JDUB 1T31A 1NY22 3RXBA 4XBBA 3SBKA 2BTCE 2OINA 2VGCC 1XXDA 1NTPA 3NWUA 3SU5A 1JOUB 1ANBA 1MQ5A 4B75A 8LPRA 2ZG0H 2PV9B 2Z7FE 5EGMA 2C8ZB 1O38A 3A8BA 2OBOA 4ZKRU 2PWXA 3TK9A 1VCQA 1UVPA 2NU0E 1HJAC 2GD4B 2GZ9A 3M35A 4DOQA 1G3DA 3LGTA 3BN9A 2ZDNA 1O3GA 2XBVA 1P02A 3D65E 3EE0B 4U32A 4UD9H 2Z9JA 3QK1A 1W12U 2PKSB 2XBXA 1BMAA 1BTWA 1GCTC 1WAYB 2VIVA 4A7IB 1S6FA 1TPPA 2UUFB 3GISB 2GCTC 3UR6A 1ELCA 5T3HA 3NXPA 3K65B 3UOPA 1E38B 2J34A 3C27B 1KSNA 2O8MA 1SSXA 4KTUA 1XUGA 2TRMA 1QFKH 4XE4A 4OGXA 4A1TA 3ODFA 4R8TB 1BBRK 3RXHA 3P8GA 1FY5A 1SGFA 1TNHA 5L6NH 3QGNB 3EAJA 1A5HA 3Q3XA 1SQAA 2W26A 3RMLH 3G01A 3ZVFA 3SU1A 2NU4E 5T6DA 1K22H 1IQNA 1W0YH 3H7OA 2W7SA 1O2OA 3ZZ8A 1C2JA 1P9UA 4NWLA 4NFEA 3RXSA 3KNXA 1TMBH 4UFDH 5A0AE 2VVCA 2VWNA 3HPTB 1KLTA 1QQ4A 4E7RG 3A7VA 2QYIA 1ELDE 5F03A 2OD3B 1L4DA 4JK5A 1EZXC 3KCGH 1FY4A 4O9VA 3DFLA 1SLXB 4VGCB 1WQSA 2VU8E 1K1LA 5HM9A 1GI4A 1DITH 1C5UA 2A4OA 1A5GH 3E91A 1DY9A 1VZQH 4ZHMU 3ENSB 5JBCS 1PYTD 4DJZB 1CA0B 3MNCA 1TGBA 1TAWA 1W11U 1GI9B 3T25A 1P2MA 1AIXH 2J95A 4SGBE 5AFYH 1T7CA 2A7CA 1WTGH 3F9GA 4K5ZA 1DANH 1SLVB 2BDCA 2V3HH 4YM9A 1SGDE 2GP9B 2PHBA 5HGGA 2OC8A 3QZQA 4K8YA 4NFFA 2QN5T 1LVBA 3TPIZ 7GCHF 4TYDA 1Z71A 1B0EA 1NT1A 4I8LA 1Z8GA 1CO7E 2ZGXH 1TFXA 1BMMH 4NA8A 3A82A 1GPZA 4D8NA 4O03A 4XSKU 1DUEA 2AS9A 4NSYA 1F92A 4BAKB 1GJBB 1QRWA 1GI8B 3VXFH 6ESTA 1P3CA 4K8BA 1L1NA 2VINA 3UTUH 1SFIA 1ID5H 3EGKH 1BDAA 4GLYA 2FIRH 2PW8H 4X6PA 1C5QA 2GDDA 1EJAA 5GDSH 3GOVB 1FXYA 3MNSA 7GCHG 2EEKA 1LHDH 3MH7A 2Z6BD 4GUXA 3R0FA 1MQ6A 4CRBA 2ODYB 3L33A 2VJ1A 2ZPQA 1LHCH 1T8OA 1S83A 5AVDA 1AE8H 2Q6DA 2V3OH 1PYTC 4WXIA 4Y11E 1ARBA 3SV2H 3VEQB 3RXKA 3Q3YA 4BAOB 5C1XA 1EQ9A 2Z9IA 4B76A 1AZ8A 2EI7A 3URDA 5AF9H 2CXVA 2A2QH 3ZZBA 4MNYA 3RDZA 1FV9A 1VR1H 1H8DH 2Z94A 1BHXB 4CR5A 2I6QA 1GL1A 1GBAA 2FYRA 2GCHF 1O3HA 1C1WH 2FX4A 1P2OA 3AAVA 1O5DH 1PPGE 1H1BA 4RSPA 1HLTH 4HGCA 1SGCA 2STAE 3BTHE 4MPUA 1M9UA 1NC6A 2XCFA 3NUMA 1MTSA 5AFZH 1YLDA 2R3YA 2IJOB 1EPTB 1GBBA 3ZZCA 1KYNA 1V6DA 1HJ9A 4Y0YE 4IC5A 2FP7B 5T6FA 3GY8A 7ESTE 4X1RU 1HIAB 4B2BA 2ZF0H 3O8BA 4I8JA 1F0UA 4BNRA 3GY7A 1MUEB 2XXLA 1SB1H 2NWNA 3MFJA 1QHRB 2H2ZA 1OPHB 3UQVA 1DLKB 4IMQA 1Z6JH 1AUJA 1HV7A 1WBGB 3BIUH 3UUZA 1RIWB 1S81A 4VGCC 2P95A 4F4OC 1DWEH 2OC0A 4JYUH 3TK6A 1WU1A 5DP6A 1GBIA 2GCHG 1P2JA 1B5GH 1O3MA 4RKOB 3NK8A 1OKXA 2Y5HA 2P8OC 3S9BA 1HJ8A 3S69A 4OS4A 2GKVE 1TX8A 1UK3A 2XYAA 1YPMH 1F2SE 2QF3A 5EW2H 2FXRA 3MH5A 1MZAA 5GWZA 4QT8C 3RMNH 4YT6H