2H6MA

An episulfide cation (thiiranium ring) trapped in the active site of hav 3c proteinase inactivated by peptide-based ketone inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
212
structure length
212
Chain Sequence
STLEIAGLVRKNLVQFGVGEKNGSVRWVMNALGVKDDWLLVPSHAYKFEKDYEMMEFYFNRGGTYYSISAGNVVIQSLDVGFQDVVLMKVPTIPKFRDITQHFIKKGDVPRALNRLATLVTTVNGTPMLISEGPLKMEEKATYVHKKNDGTTVDLTVDQAWRGKGEGLPGMCGGALVSSNQSIQNAILGIHVAGGNSILVAKLVTQEMFQNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An episulfide cation (thiiranium ring) trapped in the active site of HAV 3C proteinase inactivated by peptide-based ketone inhibitors.
pubmed doi rcsb
source organism Hepatitis a virus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Picornain 3C
total genus 53
structure length 212
sequence length 212
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00548 Peptidase_C3 3C cysteine protease (picornain 3C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2h6mA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2h6mA02
3S9AA 5E0GA 1O5GH 2VIVA 2QV1A 5EW1H 1TFXA 4I33A 5C1XA 3ATMA 2JETC 5HM9A 2H1UA 1C5SA 2EI7A 1CGIE 3VFEA 1HV7A 3TGIE 1EJNA 1JBUH 1QB6A 4IS5A 3QGJA 1UK3A 2PUQH 1PPZA 1VJAU 1GJ9B 4AORA 3FAOA 4MNYA 3ZZ9A 3MO3A 1YPKH 1FJSA 3ATKA 3RMMH 4X8VH 4AFQA 2JETB 3TVJB 1DFPA 5C2ZA 1AZZA 1Y8TA 2FDAA 1OP2A 5PTPA 3TITA 3GDSA 4Q7YA 2OQ5A 5ESBA 4DG4A 1TRYA 1D4PB 4ZHLU 4JYTA 7KMEH 1K21H 2FPZA 2QXGA 1F5LA 4ZMAH 1ZJDA 3RXMA 1SG8B 1DVAH 1C2GA 2BZAA 2R2WU 4CHAB 1DLEA 3QN7A 1W2KH 3KHVA 3ZZCA 1SGYE 1V2TT 2ZU3A 3KN2A 4X6OA 1GHYH 3F1SB 4X1RU 6CHAC 1BIOA 3QLPH 1BRCE 2JKHA 2WV5A 4ZUHA 1HAVA 2ZCKP 1TGNA 1G32B 1DPOA 3DT0H 2B0FA 2ZDLA 4JK5A 2P16A 2AH4X 4TYDA 4AZ2B 1NRPH 3GOVB 1A3EH 1MKWK 1C1WH 1WYKA 5A09A 1C1QA 2ZHWH 2EI8A 1KDQA 5DP5A 5T3HA 3EYDA 2UWLA 4U01A 1AHTH 3P8GA 1G9IE 1C2EA 2OC1A 2QA9E 2XWBI 4KP0A 1LHFH 2J4IA 3QTOH 1OSSA 1QIXB 3ZV8A 2HWLB 5B6OA 3SUEA 1B7XB 1C5TA 1ANBA 1QGFA 1P06A 1DXWA 1MCTA 1AD8H 2OC7A 1W8BH 4GLYA 2ESTE 2BVXH 2PGBB 4IN2A 5DG6A 1QRXA 2PKSB 1SLVB 1OOKB 4FUDA 2CHAB 1DITH 3BTGE 1O2XA 1NY22 4K1TA 5HXFA 1EASA 2C3SA 2RA0A 4K69A 2ZGCA 2GMTC 4NIYA 2OUAA 1TPSA 1O2JA 3FP8E 2Q1JA 2FI5E 4ABIA 4RN6A 2A5AA 1HAXB 1QL9A 4MG3A 1O2PA 1A46H 1O2TA 1SGDE 1IQGA 2P94A 1LQEA 5FBIA 4I8KA 3MU5A 1ZYOA 1GVLA 1NT1A 1QRZA 1JWTA 1LVOA 2EA3A 3AW0A 2H9TH 3UR6A 3HK6B 3T27A 3U1JB 1AI8H 1ELAA 5LPFA 1ZTKA 2W26A 3RXDA 1GI0A 1O2OA 1OWJA 2BQ6B 3BTDE 5I46H 1C1TA 3KEEA 4AN7A 5C1UA 1TMUH 1S5SA 3LGTA 2IPHA 3U9AH 1RTKA 1H9IE 1SI5H 1HAHH 1QRWA 2OCVB 5HMAA 1TYNA 1AMHA 1YPHE 3TPIZ 4YLQH 4BAKB 3RC5A 1D3QB 5DP4A 4NIWA 1PQ7A 1KXAA 1UK2A 1GJCB 3ZZ8A 1C5UA 3BTKE 3SQHE 2D1JA 2WINI 3K6ZA 1L1NA 2EI6A 3GCHB 2OINA 4B71A 4U2WA 3RXKA 1IQJA 1QA7A 4AGKA 4X6MA 3RMNH 1LVBA 3MI4A 2C90B 1SLUB 2P59A 3ESTA 2D26C 3PMJA 3EQ0H 1AY6H 2ZHEH 1LVMA 1TOCB 2AMDA 4YOIA 5L30H 1F5RA 1SR5C 1VITG 2ZC9H 2XBWA 1W0ZU 2VU8E 1GG6C 1PYTD 1OKXA 4OS1A 1GBBA 1O5AB 1TA2A 5BPEA 5DP9A 1BRBE 3SV8A 1TNGA 3O8CA 3CS0A 3OSYA 1Z7KA 2ASUB 4BANB 1NFUA 2QN5T 3ELAH 3M61U 1BHXF 5A0AE 1MU6B 2GT7A 2ILNA 1P12E 1YBWA 1GMHG 1O2QA 3SV2H 4NWKA 5GIBA 1G30B 3TU7H 3D65E 1C2MA 4NFFA 3D23A 1GJBB 2CMYA 4BTIB 1ACBE 8GCHG 2JH0D 1EOLA 3E0PB 1LKAA 1IQMA 2O8UA 2C93B 2VNTA 2FESH 4FU8A 4A1TA 5A0CA 2RCEA 1QURH 4CH8B 4YZUA 2ZNKH 3GCNA 1B5GH 1G3CA 2NU2E 2A45B 1XXFA 1BRAA 2WYGA 3Q3KA 4AB9A 2GCTB 3HK3B 3PB1E 1V2PT 2R3UA 4NZLA 3UNSA 2G5NA 2FO9A 2ZTXA 4BTTB 1UHBB 5SGAE 2V0BA 4U32A 2YNAA 4B1TA 1C5MD 1DSTA 1FIZA 3RXRA 3ZVDA 1IQHA 1K22H 1QY6A 2WPKS 2FEQH 1WAYB 2GP9B 3P95A 2ANKH 2F3CE 1INCA 1RIWC 5GCHG 1BQYA 1BBRK 4FVDA 3SU4A 4D9QA 3S7KB 1MKXH 2CV3A 1IHSH 2Z6BD 6GCHF 2QGRA 3BG4C 2PWXA 4JMYA 1K1OA 4LZ4B 1ARBA 3A8DA 1CE5A 3H7OA 3MH4A 1TX6A 3A88A 4ABEA 5LPEA 3QTVH 3P17H 3A7WA 1TABE 4Z0KA 1C5QA 1THRH 2FOMB 1TNIA 1EZXC 2YOLA 1BDAA 1C5YB 1QHRB 3LJJA 4WH8A 1VR1H 1AWHB 1L4ZA 3U8TH 4YT6H 2VGCC 1A3BH 2WV4A 1AKSB 2IN2A 1S0RA 1SGPE 4B2CA 2ZKSA 5GCHF 3RMLH 2ZTYA 1G37A 1TMBH 1MBQA 1RFNA 1E0FD 1SVPA 1YC0A 2VB0A 4VGCB 1J9CH 1C1RA 4NA8A 1C5OH 2FS8A 1OX1A 2ZFRH 1GI4A 5AFZH 1ESBA 4X0WU 2XXLA 4KTCA 2Z9JA 1KDQB 3GCTG 1EJAA 2BXTH 3GY8A 4OGXA 4MNVA 6ESTA 4I8LA 4JZIA 4AYVB 3GY4A 3E91A 5G4BA 2HNTE 1ZZZA 1WTGH 2FYQA 1CT4E 1GBLA 2B5TB 3PLPA 1BUIA 2G52A 3UFAA 3RXTA 4A5TS 1MTNC 3PWCA 1GBDA 1BTHH 3UOPA 1BTZA 1JIMA 5JDUB 4UE7H 4YO9A 1EQ9A 5F6MA 1W7XH 3E6PH 3A8CA 2XRCA 3E3TA 1AKSA 2VWOA 1VITF 5DP8A 3LU9B 1C1UH 4WMEA 3SUFA 1UVTH 5EQRA 2BY7X 3ZVCA 4TY6A 5CE1A 1Y3YA 4D7FA 3T28A 4FUEA 1AB9C 3GCTF 2NWNA 2M5TA 2ZTZA 1D9IA 3PROA 1FAXA 2ZECA 2GZ8A 1N8OB 3MU1A 4M7GA 4ISNA 1AWFH 3QUMP 1C5VA 1LPKB 3RXSA 1DX5M 2WPJS 1ZGVA 3DUXH 2I6SA 1PQ5A 4XOJA 1VCPA 3K65B 4NZQA 3TNTA 5F03A 1XXDA 2SGEE 2SNWA 2FI3E 2A2QH 2YNBA 3RU4T 1XUKA 1GVZA 3Q00A 1O3DA 1GGDC 1O2ZA 3UNQA 2G51A 4CRCA 1LHEH 2CHAC 3S7HB 2HNTF 1S82A 1O3LA 1DT2A 1HJ9A 1LO6A 5T6FA 3QZRA 4HGCA 1G3BA 1GJ6A 3SUGA 2UUKB 3A86A 4UONA 1TPOA 5ESTE 2AS9A 5FHTA 5JBCS 1SBWA 2Y5GA 1V2JT 1TONA 1UVUH 3RXPA 2ZGXH 3TH3H 2FWWA 1QL8A 4YESB 1AFEH 1CSOE 1SGEE 3OY6U 5FAHA 3I77A 3L33A 2GZ7A 1A0HB 3SV7A 3BF6H 2BDYA 5EU8A 5JBTA 2Y80A 1ZMNA 2XYAA 3STIA 1GDQA 3C27B 1H9LB 4DY7B 1VCQA 1CT0E 3ZVBA 3M3SA 1O5DH 1XKBC 2BQWB 2OTVA 2Z3DA 3MO9A 3DFLA 3TH4H 1EP5A 2BXUH 5EODA 1D3PB 4IW4E 1ZMLA 1GBKA 4DJZB 1KIGH 4K1EA 2ANMH 2BD2A 4ZXXH 4Y6DA 4K60A 2P8OB 1SGFA 2BLWA 1W12U 3WY8A 4K1SA 1YYY1 1O5FH 4AB8A 3T62A 2BHGA 2GDEH 2C8XB 1JOUB 3PO1B 3SGAE 3AAVA 3QWCH 2PGQB 1UHBA 3KQEA 1C9PA 3MOCA 1MKXK 1PPGE 5DP6A 1Z6JH 1D3TB 1PPFE 3OY5U 2BD3A 1O3OA 1KLJH 3UPEA 3Q3XA 3M5LA 1BMLA 3W95A 3ZZ7A 2VH6A 2DE8A 1SB1H 3M3VA 1K1JA 4I8HA 2F9NA 4FUBA 3P8FA 3ZZAA 1FY1A 1S0QA 4FUHA 1YPHC 1GBCA 1TNLA 1C5XB 3UR9A 3GISB 5C3NA 1C4V2 3E90B 2WPLS 2PLXA 1O3CA 1HJAB 3A80A 3EDXB 4DIHH 1H8DH 1GI5A 4ZH8A 4WJG2 5EW2H 1A1RA 2XBXA 1IQKA 3GY3A 1KXCA 3A7VA 2TIOA 1GGDB 3SORA 4GUXA 3RXHA 3A7ZA 4MDSA 1ZSKA 2BDBA 3A85A 1Z1JA 3MNSA 3RXIA 4UFGH 3IITA 1EP6A 4CRFA 3SU3A 2B9LA 1V2MT 4GAWA 1PPHE 2ALPA 4DIIH 2XC4A 5C20A 1H9HE 2ANWA 4LZ1H 4IC5A 5E2PA 2ZU2A 1DY8A 3V3MA 5J4SA 3SNAA 4H4FA 1D6RA 1LQDB 1T7CA 3A82A 4WMFA 1AB9B 2AMQA 2QXJA 4B76A 4XBCA 4YOJA 1V2KT 3LH1A 2PTNA 1NZQH 4AFSA 2A5KA 2CGAA 3E1XB 4MPXA 2BOHB 2PV9B 1TQ7B 1T32A 4Y0ZE 1BBRE 2FOCA 1CGHA 1NTPA 5C5OA 2KAIA 3G01A 1HFDA 3NZIA 1XVMA 2GCHF 3URCA 2ZFFH 3V7TA 7GCHG 5GXPA 2BDGA 3HATH 3HPTB 1DS2E 4ZHMU 1NU7B 1O2UA 1BT7A 2AGEX 1MTNB 2G55A 4AFUA 3RU4E 2FODA 1ELGA 2GX4A 2G81E 1K1MA 1QR3E 1HCGA 1GI2A 5GDSH 2BD7A 1A5GH 1ZLRA 1V2VT 1IQNA 1G36A 1F2SE 8KME2 2TGTA 3HKJB 1K28D 3BTFE 2CN0H 1GHVH 1O3NA 2FYRA 3GCHC 3U8OH 3PMAB 1AE8H 5EG4A 5L2YH 3ZVEA 5JYIA 1E38B 1T8NA 1KSNA 1GVKB 2PUXB 4FUFA 4YLUA 1CGJE 1GHZA 1DUAA 3E0NB 3UY9A 4FUJA 3L6PA 1SFIA 1MH0A 3MU4A 5AVDA 4J1YA 2R0LA 7ESTE 2D8WA 2PKAB 2W5EA 3SU2A 3IWMA 3DD2H 1O3AA 2VWMA 3H5CB 1P0SH 3M5MA 4I7YH 1KLTA 2ODPA 3SUDA 1ZRBA 1PYTC 3A7TA 1HAVB 1O3EA 2WPMS 3HGPA 3A7XA 1PJPA 4E06H 3SJ8A 1HAGE 4RKOB 3LGUA 2ZA5A 1XMNB 2BVSH 2Z9IA 3RXAA 1HAYB 1YPEH 2GV7A 4XE4A 3TNSA 1GHWH 3TJVA 1V2LT 2P3TB 3VB7A 4Y7AA 2VIQA 4UFFH 7GCHF 4OS7A 1S84A 1ZHMA 1ZOMA 4IGDA 1J16A 3T5FH 4B2AA 1P03A 3A7YA 4KTUA 4O3TA 3UIRA 1GI6A 2F83A 1Z8IB 5GPIB 2BDHA 5CMXH 1J8AA 3SNDA 1RGQA 5EOKA 4TWWA 5K7RA 1AFQC 1GMDF 1AQ7A 2LPRA 4CRDA 5H4IB 2VIWA 2QF3A 1Y59T 2GDDA 4X1QU 3RXLA 3F6UH 4NSYA 3N7OA 2D2DA 3PWBA 1YCPK 3K6YA 6LPRA 3M36A 2XCFA 2C4FH 4LOYH 1RTFB 2GCTC 1A5IA 2ZG0H 1SHYA 1DWEH 2VVVA 1UTQA 2ZPRA 1Z71A 5AHGH 2ZFTA 5HYOA 2AERH 4IMQA 2ZGJA 1EAIA 1O35A 1LMWB 2CJIA 2J94A 3SGQE 3NCLA 5A0BA 1O37A 1ABJH 2PFEA 5HGGA 1C1VH 1BTWA 2BY6X 4BAMB 1C2JA 3ZZDA 2DE9A 2H9HA 4LK4A 4X2VA 1MAYA 1C5PA 3PMHB 3RXCA 4B2BA 2BD5A 1HXEH 1J15A 1B0EA 4U30A 1O5EH 1NM6A 2JH5D 4NGAH 1K2I1 1BMNH 3LGVA 2NU1E 6CHAB 1P2MA 5EXNA 2W3IA 5DK1A 4X6NA 4H42U 2CF8H 2O8WA 1UTPA 2TPIZ 1BRUP 1SGCA 1V2RT 3FVFB 1FNIA 1FN6A 1TQ0B 1AIXH 1WBGB 3RDZA 1DSUA 2BD9A 1F92A 4K2YA 1NS3A 4MQAA 1C1PA 1LDTT 1HAIH 4THNH 1IQEA 1SQOA 1V2WT 3FZDA 1GJAB 2V3OH 1DXPA 1AVWA 1FY4A 3BN9A 1DDJA 2Z9KA 3M35A 4ESTE 1WUNH 4AYYB 1CA8B 5A8XA 4DURA 3DHKH 1QQ4A 2A7HA 1GDNA 4ABFA 1XUGA 3O8RA 1WOFA 1O5BB 3EE0B 3PTNA 4X2WA 3ZVFA 1GCDA 3NXPA 3AVZA 3U1IB 1MTVA 4BAOB 1G3EA 3PTBA 1W7GH 4HTCH 4ABBA 1FN8A 4B74A 5LH8A 4X8SH 2GVFA 2Q6GA 2QCYA 3EGKH 3RU4D 2XTTB 1HXFH 1LPGB 2XBYA 4FUCA 1EKBB 1GI8B 1HIAA 3SI3H 2WPIS 1TWXB 1ID5H 2ZFPH 1QQUA 4UDWH 4D9RA 3K2UA 1T31A 5T6DA 3PLBA 1GMHF 3GY2A 1FI8A 5FCRA 1A5HA 1S85A 3IG6B 1P2OA 1Q31A 1ELVA 2QIQA 1V2QT 1LHCH 3SGBE 2ZP0H 3ZVGA 1OWEA 1FPHH 3LONA 3HGNA 1YM0A 3F9EA 3P70B 3P8OA 1XUHA 1TGTA 1P02A 1P2IA 2A0QB 4ISLA 3MO6A 2P8OC 4X1SU 5JPMH 2J95A 1ZHRA 1MZAA 1FY3A 4A1VA 1S6HA 1P8VC 2H5CA 4NG9H 5GWZA 4JK6A 1YF4A 5E0HA 2ANYA 1TBZH 1W0YH 3RLWH 4Y11E 1NESE 3MH6A 3PM3A 1VITH 3SI4H 2BZ6H 4ZKRU 1NFYA 4NA9H 4CRAA 2ULLA 5J4QA 3LKWA 3GY7A 2LNCA 2FOHA 4ZHAA 2W3KA 3FFGA 2ZDKA 1AZ8A 2ZEBA 1BBRH 5EXLA 1K1PA 2O8TA 1O3HA 2P95A 1Y5UT 4ABAA 2ZCLP 4ISHH 1TIOA 4ABDA 3A89A 5JB8S 5F8XA 1DANH 3QZQA 3STJA 4X8UH 1A0LA 4GCHG 1B0FA 1OWIA 1QNJA 1YPGH 2CF9H 2ZFQH 3RXQA 2AIQA 4DT7B 3BV9B 1AE5A 2A1DB 1DLKB 4NWLA 3KNXA 1CVWH 3QO6A 3SQEE 2F9PA 1O36A 2FTLE 1AN1E 1EPTA 3KF2A 3MWIU 5FBEA 1CQQA 4WY3A 1TNJA 3E16B 1HUTH 3UWIA 2F9UA 1HAPH 4J2YB 1Z6EA 4FVBA 1O2WA 3MNBA 4TPYA 1P9SA 2ZGHA 4BAQB 1F5KU 1GBIA 3TJNA 1PPBH 3U69H 1P01A 1ZPCA 4Y8XA 1IHTH 5FCKA 1E34B 4X6PA 1EZQA 1K1IA 1UTJA 4O97A 3RXGA 2Y5FA 1KXFA 1GPZA 1NN6A 4MNWA 4JZFH 2TRMA 2H5DA 3L3TA 1N8OC 1O2NA 3RXFA 1UCYH 5EPYA 1EPTC 2Y6TA 1KLIH 1N1LA 1VZQH 4WXIA 1ELCA 1TAWA 4ZKOU 3SV6A 1XUFA 3V0XA 2ZPQA 3BG4B 3SU5A 1RS0A 1AUTC 3F9FA 5K0HA 3KIDU 2KAIB 6GCHG 3UUZA 4Y71A 4ZAEA 1K9OE 2Y7ZA 1QJ7B 1BB0B 2J38A 1FUJA 1YPLH 1O2MA 2BX3A 5GJ4B 4E7NA 4INHA 4INLA 1FY8E 2XCNA 2H6MA 5C5NA 1ZTJA 2EEKA 1LHDH 1HIAB 3QK1A 4Y76A 1ELEE 2A7CA 2Z9LA 3NUMA 4UFDH 2PKSC 1O38A 3AW1A 4E05H 2F9BH 4GCHF 1OP8A 1NRRH 1O2LA 1GJ5H 1UVSH 3GDVA 4SGAE 1LPZB 3ODDA 1ANEA 2ZU5A 3B8JA 4X1PU 1RD3B 3M5NA 3T2NA 1UTKA 4LXBH 1GMCG 3RP2A 5F8ZA 2F9VA 3VXFH 2FI4E 2ALVA 4A92A 2A4OA 1EX3A 1MCVA 1Q3XA 1NROH 2EC9H 3BEIB 3T26A 2FLBH 1P57B 4AGJA 1QBOA 1ZSJA 2BY8X 1H1BA 1NRNH 1ZSLA 5FXLA 2R3YA 2HPQH 4BAHB 1O3FA 4X8TH 1BTUA 1C9TA 1ARCA 3PO1C 2STBE 2SGFE 1ETSH 3RMOH 1HLTH 3TJUA 1TPAE 3BTME 3VB3A 2VIOA 3F68H 9LPRA 5DO4H 1BJVA 1CHGA 2P3UB 4CRGA 2FMJA 2VGCB 4XDEA 1SGRE 3RXEA 1YGCH 1J17T 2PW8H 4CBNA 4BXSA 3UNRA 2A4RA 1YKTA 1SGIB 2VIDA 2ZWLH 4Q7XA 4Y10E 2FOGA 3MMGA 1T4VH 5EQQA 2WUBA 1ELDE 1A0JA 3UQOA 1EJMA 2FZZA 1QFKH 4DOQA 1OYTH 1QB1A 1OWHA 1GG6B 3AASA 2Z7FE 1KTTB 1FZZA 3GY5A 4MVNA 1AO5A 3LH3A 3D49H 4FXGH 2K1QA 4KELA 1HAZB 4K8BA 1ANCA 2AMPA 2ODQA 1SQTA 1C1SA 2XBVA 1CHOF 3VEQB 1RIWB 2J2UA 3BTWE 3Q3YA 1O2RA 3GYLB 5AFYH 1AVGH 3GDUA 4FUIA 2AFQB 4OGYA 1TMTH 4MPUA 4YOGA 3TH2H 1KXBA 4E7RG 2GZ9A 3MH7A 1UTOA 1O3GA 5CHAC 5HM2A 4KKDA 4CREA 1C4U2 2ZI2H 2BLVA 3BEUA 1MTWA 1GL1A 2V35A 2ZPSA 1ZR0A 3R3GB 1BJUA 1KYNA 1TGSZ 4AOQA 5I25A 1SGFG 1UTLM 1Z8JB 1CBWC 4Y8ZA 5ABWA 1F0TA 2OXSA 2Y81A 2VWLA 1O2YA 1MU8B 1O3PB 1VCWA 1QA0A 1DWBH 5L6NH 4ZXYH 3PLKA 4YTAA 3C1KA 2BYAX 2ZDNA 3EAJA 5TJXA 4CRBA 1GBMA 1PPEE 3PMBB 5IYTA 1ELBA 3PV4A 1FIWA 4Y8YA 1QCPA 5DGJA 2BOKA 5IDKA 2SGDE 1ESAA 2ZDMA 3KL6A 3V13A 1EATA 2BM2A 3W94A 1C2LA 1DE7H 4TWYA 4DGJA 2XNIA 1BHXB 1THSH 3MTYA 2UUJB 2ZFSA 1TA6A 1HBTH 1GCTB 1JMOH 8LPRA 2QF0A 1EXFA 1ABIH 1O39A 4JZEH 4JYUH 3MYWA 1P3EA 1L1JA 2G00A 1P05A 3LOXA 1P10A 1AGJA 3M37A 2G5VA 1TB6H 2VINA 1IOEA 1V2NT 1TRNA 1MQ6A 1YPJH 5TCCA 1H8IH 4Q2KA 3SJKA 3RXOA 2TGAA 2GKVE 3MHWU 1EB2A 4FU7A 1LVYA 3VGCC 1C5NH 3TLOA 1BMAA 1F0SA 1RXPA 2A7JA 3S0NA 3RC4A 1C2KA 4ISOA 1BCUH 1FAKH 1DM4B 4NA7A 1VJ9U 1S83A 3QGNB 3LGYA 3TGJE 1Y5BT 3OTJE 4DW2U 2BY5X 5EQSA 3K9XB 1WU1A 2FOFA 1XVOA 2Z9GA 3OYPA 1O3JA 1V3XA 1A7SA 1XM1A 2XWAA 1D6WA 2PKAA 2Z94A 2ZIQH 1ZMJA 5DP3A 3SO3A 1TX8A 3VB4A 1CA0B 4K3JA 1QL7A 2BD4A 1GI9B 2BQ7B 3A8AA 3TIUA 5CHAB 1T8OA 1BZXE 4R8TB 1P2JA 5A8ZA 3H7TA 4WWYA 3NWUA 4MNXA 1J14A 1GDUA 1P04A 3EA9A 1O3MA 3MNCA 3VXEH 4XBDA 1C1MA 5DPAA 3Q76A 1WV7H 1O34A 2QXIA 5JBBS 1MAXA 1GHAG 3T25A 1HJAC 3V12A 1E36B 2IOTA 3I78A 1DWDH 1ZTLA 2DUCA 4IN1A 3A8BA 2XC5A 4CH2B 1O5CB 1LKBA 1PQ8A 3BTQE 3NK8A 2BTCE 1JIRA 1GBEA 4R0IA 2ZQ2A 4ABJA 3SBKA 2ZHDA 1Q2WA 2HLCA 3GCOA 4X2YA 1GJ8B 3A84A 1T8MA 1WTHD 4Y7BA 4DCDA 1GHBF 1SPJA 2ZU1A 2O9QA 3UOUA 3O8DA 1ETRH 2TBSA 2VH0A 4IC6A 3P92A 5FPYA 1C2HA 1O2HA 1JXPA 1ZRKA 3TJOA 2WUCA 1QJ6B 1AUJA 2J9NA 3R0FA 4I31A 3PYHA 3BTTE 4A6LA 3MU8A 1CO7E 3OX7U 2J34A 1D3DB 1G2LA 3M7QA 4I8GA 1HDTH 2UWOA 2AYWA 2BX4A 3ZZ5A 5A8YA 2GTBA 1NFXA 2STAE 3DFJA 3F9GA 4FU9A 8GCHF 1W10U 5AF9H 3CS7A 2A4QA 1QBVH 1ZHPA 1DUEA 1W14U 3M7TA 1BTPA 1K1NA 1G3DA 3MU0A 4MTBA 1DOJA 4IMZA 4TPIZ 1BTXA 2ZHQH 2IJOB 2O8MA 1UJ1A 3LC5A 4D76A 4OS5A 5LGOA 1GI1A 4A1XA 3LJOA 1O3KA 1UK4A 1V6DA 3UQVA 1F7ZA 1OYQA 3BIVH 2QC2A 1GL0E 3LPRA 2UWPA 3SU0A 1FMGA 1OWDA 5EXMA 2BDAA 2Y5HA 2FOAA 4DVAU 1E35B 2HPPH 5ETXA 1GBTA 3SHCH 4CR5A 1L1GA 1MTUA 4Z6AH 2AGIX 3LT3A 2BMGB 2OP9A 4ISIH 2SFAA 3DA9B 3FP6E 3GYMA 4XBBA 1ZJKA 1O2KA 3ZZBA 2ZU4A 1O0DH 2FXRA 3A87A 5DP7A 4HI3A 1YLDA 1V2UT 4AX9H 1ORFA 2BD8A 4OS2A 3JZ2B 4ABHA 1P9UA 1WQSA 3P6ZB 3B9FH 1EB1H 1MBMA 3VPKA 3E8LA 5FPTA 1BITA 1P3CA 4BTUB 3ODFA 4FUGA 1O30A 1OS8A 1S6FA 1SOTA 1X7AC 1C5LH 1XX9A 2FM2A 2WYJA 3UWJH 4NIVA 3B23B 1GBAA 4YT7H 2BDIA 1N6YA 1EOJA 1OP0A 2A4GA 1BOQA 4CBOA 4GPGA 1P09A 1Y3UA 2OD3B 4Y0YE 1ELFA 2VJ1A 3GICB 3RC6A 2XW9A 9ESTA 1UVOA 1O2GH 1NPMA 2G8TA 3VGCB 1GHBG 2OBQA 3RXJA 3D62A 2NU0E 1XKAC 1THPB 3S9BA 3AAUA 3RM2H 1C4Y2 1MQ5A 1OXGA 1GBFA 1SQAA 3ZV9A 1O31A 2HGTH 1NU9A 1QBNA 1UO6A 1UMAH 2HVXA 2UUYA 3FZZA 1EAXA 1SGQE 2VVCA 3EA7A 1TOMH 4UFEH 3SNCA 3M7UA 4A7IB 1JRTA 1HGTH 1ZPZA 1SLXB 3SU6A 2FTMA 1EUFA 2W7UA 2H2ZA 1TALA 1VGCC 1YP9A 2I6QA 1TNKA 3EA8A 2A31A 3MFJA 1GCTC 1NRSH 2SGQE 2HOBA 4D7GA 2FOEA 2HRVA 2QXHA 5E0JA 1CU1A 4O03A 3RUOA 1PQAA 1G2MA 1OPHB 3LDXH 1MD8A 1MUEB 2GGVB 2PSYA 2SGPE 2TGPZ 1P11E 2CXVA 1WCZA 2VIPA 5F8TA 3NKKA 4GVUA 1F0RA 3O8BA 3KQDA 4I32A 4VGCC 1YLCA 3TK6A 1SFQB 1L0ZA 2O8LA 5FPSA 1HB0B 4MPVA 1ETTH 1HJ8A 3Q77A 1HPGA 3FP7E 4JCNA 1O3IA 3SV9A 4WH6A 3ZVAA 2A5IA 4GSOA 2R9PA 1K1LA 4X1NU 2BLQA 4K8YA 4AG1A 1U6QA 2BY9X 8ESTE 2F91A 1KTSB 1TGCA 3HKIB 2OC0A 3OU0A 4AFZA 4BOHA 2TGDA 1NO9H 2QYIA 3S9CA 5BRRE 4F49A 4CHAC 3LGWA 1FLEE 3BTEE 3RXVA 3ATLA 1UTNA 2FX6A 3MH5A 1QTFA 1UTMA 1GBHA 3KGPA 1WSSH 1L4DA 1Y5AT 3T29A 1SL3A 4UEHH 4HFPB 4QT8C 2QY0B 1F0UA 2C8YB 4AG2A 5E8EH 1TBRH 1NC6A 1GI3A 4K5ZA 5A2MH 3QX5H 2C8ZB 1NRQH 2BB4A 1FONA 4ZROA 1GJ4H 5E2OA 1LTOA 5T6GA 1GI7B 2B8OH 3SN8A 3BIUH 3M3TA 2VWNA 1Z8GA 4INKA 4NSVA 2FS9A 1O32A 1GJDB 1YCPM 1Y3VA 3QDZB 3SW2B 3RXUA 2JH6D 1GMDG 3VB5A 1TLDA 1T8LA 4MPWA 3SNEA 1C5ZB 1DWCH 2G4UA 2ZO3H 3RLYH 1FXYA 4F4OC 3SU1A 2V3HH 3SNBA 4X2XA 1TRMA 2OLGA 1MD7A 4O9VA 2ZHFH 4ABGA 2SGAA 1O3BA 1ELTA 2ZGBH 1GJ7B 1Z1IA 1EZSC 1MTSA 4Y79A 1IQIA 2OQUA 2PHBA 3KCGH 4Q80A 4HZHA 3ITIA 1IAUA 1TBQH 2A2XH 4B73A 4KTSA 1P2QA 3I29A 4JZ1A 2BLOA 4BNRA 2GCHG 4JZDH 1N6XA 2GD4B 1W11U 2A32A 4YM9A 3BSQA 3ATWA 3VB6A 1AVXA 3CENA 3URDA 3A83A 1QB9A 4XFQA 1TNHA 2FLRH 1A4WH 1GBJA 1YPMH 1SGNE 1HAOH 1C1NA 2GV6A 5EPNA 4ASHA 1SLWB 1FDPA 1VGCB 1SHHB 1MMJN 1TE0A 2AIPA 1C5WB 2G4TA 1SC8U 1XUJA 1KXEA 1KY9A 2BDCA 5C1YA 1P2NA 2PR3A 1ZGIA 3U98H 1TGBA 3SJOA 3A81A 1C5RA 1C2DA 3S69A 1H4WA 1ANDA 3M5OA 3UTUH 1AFQB 3BEFB 1UCYE 2P3FH 4OS4A 1DY9A 1YCPH 2B7DH 1UCYK 4WF8A 1C1OA 2C8WB 5L2ZH 1W13U 3BTHE 1NFWA 1AU8A 1CA0C 2F9OA 2RG3A 1EPTB 3UREA 2ZCHP 1LHGH 5FX6A 4KGAA 2HNTC 4BXWA 4IBLH 1DICA 2R0KA 2AEIH 3U8RH 1PFXC 1UVPA 4D8NA 2Q6FA 1S81A 4MLFB 2WPHS 5DKMA 3SOSA 4H6TA 1FY5A 2OC8A 3CP7A 2UUFB 1E37B 1FQ3A 3LIWA 1RRKA 4JYVH 1Y3WA 1A61H 1CT2E 1HYLA 1WQVH 5LPRA 4UD9H 1M9UA 1GWAA 2J92A 1GMCF 3KQBA 3ZZ3A 2OBOA 1FPCH 2ZQ1A 2FIRH 2GT8A 3TK5A 4OS6A 3JZ1B 1SMFE 1GHXH 1HNEE 2FX4A 3BG8A 3ZZ6A 2FP7B 1MZDA 2ZDVH 2FOBA 3ZZ4A 2GMTB 1L2EA 1W3CA 1V2ST 2BVRH 2R2MB 5DJ7A 3ZYDA 1HRTH 1O2IA 4NFEA 2SNVA 1QJ1B 1OWKA 1T4UH 2Y82A 4NIXA 1SGTA 3SHAH 1IQFA 1O2VA 2V6NA 2ZF0H 5EGMA 2VVUA 4XSKU 4WVPE 1ZPBA 5C67A 4NCYA 1BA8B 7LPRA 2W7SA 2ZDAH 2NU3E 1MKWH 2Y7XA 3NPSA 2Z3CA 1EAWA 1SSXA 3F9HA 3LGIA 1LCYA 5JBAS 4B75A 1GHAF 1JRSA 3TK9A 1O33A 1ESTA 2ZZUH 1V2OT 2QAAA 1XUIA 1EZUC 1RTLA 5JB9S 2HALA 2PTCE 3FANA 3SJ9A 3TGKE 1C2IA 3MNXA 4GHTA 1FV9A 4TY7A 1BMMH 2THFB 1BTYA 5FX5A 3ATIA 4H6SB 3GY6A 1KXDA 1Z8RA 1RJXB 2Z3EA 2XC0A 4O3UA 3ZYEA 3RM0H 4CR9A 1Y3XA 2NU4E 2PSXA 2RDLA 2AGGX 3SZNA 3ENSB 4WMDA 1IQLA 2RA3A 4RKJB 4I8JA 1C2FA 1PPCE 4WXVA 2H9EH 1O2SA 2P93A 3LC3A 3P8NA 3KQCA 3SJIA 1P2KA 1CBWB 4GHQA 4ZKSU 3RXBA 1EAUA 4ZKNU 1TX7A 2ODYB 4PROA 4Q7ZA 5TCAA 2Q6DA 1SOZA 1TPPA 4RSPA 1A2CH 1CHOG 4SGBE
chains in the Genus database with same CATH superfamily
3S9AA 5E0GA 3WWBA 1O5GH 2VIVA 2QV1A 5EW1H 1TFXA 4I33A 5C1XA 3ATMA 2JETC 5HM9A 2H1UA 1C5SA 2EI7A 1CGIE 3VFEA 1HV7A 3TGIE 1EJNA 1JBUH 1QB6A 4IS5A 3QGJA 1UK3A 2PUQH 1PPZA 4P00A 1VJAU 1GJ9B 4AORA 2IPQX 3N7EA 3FAOA 4MNYA 3ZZ9A 3MO3A 1YPKH 1FJSA 3ATKA 3RMMH 4X8VH 4AFQA 2JETB 3TVJB 1DFPA 5C2ZA 1AZZA 1Y8TA 2FDAA 1OP2A 5PTPA 3TITA 3GDSA 4Q7YA 2OQ5A 5ESBA 4DG4A 1TRYA 1D4PB 4ZHLU 4JYTA 7KMEH 1K21H 2FPZA 5HIYA 2QXGA 1F5LA 4ZMAH 1ZJDA 3RXMA 1SG8B 1DVAH 1C2GA 2BZAA 2R2WU 3OFND 4CHAB 1DLEA 3QN7A 1W2KH 3KHVA 3ZZCA 1SGYE 1V2TT 2ZU3A 3KN2A 4X6OA 1GHYH 3F1SB 4X1RU 6CHAC 1BIOA 3QLPH 1BRCE 2JKHA 2WV5A 4ZUHA 1HAVA 2ZCKP 1TGNA 1G32B 1DPOA 3DT0H 2B0FA 2ZDLA 4JK5A 2P16A 2AH4X 4TYDA 4AZ2B 1NRPH 3GOVB 1A3EH 1MKWK 2XNDD 1C1WH 1WYKA 5A09A 1C1QA 2ZHWH 2EI8A 1KDQA 5DP5A 5T3HA 3EYDA 2UWLA 4U01A 1AHTH 3P8GA 1G9IE 1C2EA 2OC1A 2QA9E 2XWBI 4KP0A 1LHFH 2J4IA 3QTOH 1OSSA 1QIXB 3ZV8A 2HWLB 5B6OA 3SUEA 1B7XB 1C5TA 1ANBA 1QGFA 1P06A 1DXWA 1MCTA 1AD8H 4XRNA 2OC7A 1W8BH 4GLYA 2ESTE 2BVXH 2PGBB 4IN2A 5DG6A 1QRXA 2PKSB 1SLVB 1OOKB 4FUDA 2CHAB 1DITH 3BTGE 1O2XA 3SYJA 1NY22 4K1TA 5HXFA 1EASA 2C3SA 2RA0A 4K69A 4TSFD 2ZGCA 2GMTC 4NIYA 2OUAA 1TPSA 1O2JA 3FP8E 2Q1JA 4B6FA 2FI5E 4ABIA 4RN6A 2A5AA 1HAXB 1QL9A 4MG3A 1YWUA 1O2PA 1A46H 1O2TA 1SGDE 1IQGA 2P94A 1LQEA 5FBIA 2WHXA 4I8KA 3MU5A 1ZYOA 1GVLA 1NT1A 1QRZA 1JWTA 1LVOA 2EA3A 3AW0A 2H9TH 3UR6A 3HK6B 3T27A 3U1JB 1AI8H 1ELAA 5LPFA 2J98A 1ZTKA 2W26A 3RXDA 4RT1A 1GI0A 1O2OA 1OWJA 2BQ6B 3BTDE 3F2FA 5I46H 1C1TA 3KEEA 4AN7A 3GS9A 5C1UA 1TMUH 1S5SA 3LGTA 2IPHA 3U9AH 1RTKA 1H9IE 1SI5H 1HAHH 1QRWA 2OCVB 5HMAA 1TYNA 1AMHA 1YPHE 3TPIZ 4YLQH 4BAKB 3RC5A 1D3QB 5DP4A 4NIWA 1PQ7A 1KXAA 1UK2A 1GJCB 3ZZ8A 1C5UA 3BTKE 3SQHE 4I86A 2D1JA 2WINI 3K6ZA 1L1NA 3W1EA 2WZQA 2EI6A 3GCHB 2OINA 4B71A 4U2WA 3RXKA 1IQJA 1QA7A 4AGKA 4X6MA 3RMNH 5CHBA 1LVBA 3MI4A 2C90B 1SLUB 2P59A 3ESTA 2D26C 3PMJA 3EQ0H 1AY6H 2ZHEH 1LVMA 1TOCB 2AMDA 4YOIA 5L30H 1F5RA 1SR5C 1VITG 2ZC9H 2XBWA 1W0ZU 2VU8E 1GG6C 1PYTD 1OKXA 4OS1A 1GBBA 1O5AB 1TA2A 5BPEA 5DP9A 1BRBE 3SV8A 1TNGA 3O8CA 3CS0A 3OSYA 1Z7KA 2ASUB 4BANB 1NFUA 2QN5T 3ELAH 3F2HA 1BHXF 3M61U 1MU6B 5A0AE 2GT7A 2ILNA 1P12E 1YBWA 5GNDA 1GMHG 1O2QA 5EJZA 3SV2H 4NWKA 5GIBA 1G30B 3TU7H 3D65E 1C2MA 4NFFA 3D23A 1GJBB 2CMYA 4BTIB 1ACBE 1YLNA 8GCHG 2JH0D 1EOLA 3E0PB 1LKAA 1IQMA 2O8UA 2C93B 2VNTA 2KCYA 2FESH 4ACBA 4FU8A 4A1TA 5A0CA 2RCEA 2K0QA 1QURH 4CH8B 4YZUA 2ZNKH 1H8HD 3GCNA 1B5GH 1G3CA 2NU2E 2A45B 1XXFA 1BRAA 2WYGA 3Q3KA 4AB9A 2GCTB 3HK3B 3PB1E 1V2PT 2R3UA 4NZLA 3UNSA 2G5NA 2FO9A 2ZTXA 4BTTB 3VG8A 4AC9A 1UHBB 5SGAE 2V0BA 4U32A 2YNAA 4B1TA 2EQNA 1C5MD 1DSTA 1FIZA 2J5UA 3RXRA 3ZVDA 3FOAA 1IQHA 1K22H 1QY6A 2WPKS 2FEQH 1WAYB 2GP9B 3P95A 2ANKH 2F3CE 1INCA 1RIWC 2F4LA 5GCHG 1BQYA 1BBRK 4FVDA 3SU4A 4D9QA 3S7KB 3OTPA 1MKXH 2CV3A 1IHSH 1MABB 2Z6BD 6GCHF 2QGRA 3BG4C 2PWXA 4JMYA 1K1OA 4LZ4B 1ARBA 3A8DA 1CE5A 3H7OA 3MH4A 1TX6A 3A88A 4ABEA 5LPEA 3QTVH 3P17H 3A7WA 1TABE 2JIZD 4Z0KA 1C5QA 1THRH 2FOMB 1TNIA 3FKSD 1EZXC 2YOLA 1BDAA 1C5YB 1QHRB 3LJJA 4WH8A 1VR1H 1AWHB 1L4ZA 3U8TH 4YT6H 2VGCC 1A3BH 2WV4A 1AKSB 2IN2A 1S0RA 1SGPE 2RDEA 4B2CA 2ZKSA 5GCHF 3RMLH 2ZTYA 1G37A 1TMBH 1MBQA 1RFNA 1E0FD 4ZCNA 1SVPA 1YC0A 3N7DA 2VB0A 4VGCB 1J9CH 1C1RA 4NA8A 1C5OH 2FS8A 1OX1A 2ZFRH 1GI4A 5AFZH 1ESBA 4X0WU 2XXLA 4KTCA 2Z9JA 1KDQB 3GCTG 1EJAA 2BXTH 3GY8A 4OGXA 4MNVA 6ESTA 4I8LA 4JZIA 4AYVB 3GY4A 3E91A 5G4BA 2HNTE 1ZZZA 1WTGH 2QF5A 2FYQA 1CT4E 1GBLA 2B5TB 3PLPA 1BUIA 2G52A 3UFAA 3RXTA 4A5TS 1MTNC 2RFKC 3PWCA 1GBDA 1BTHH 3UOPA 1BTZA 1JIMA 5JDUB 4UE7H 3DSGA 4YO9A 1EQ9A 5F6MA 1W7XH 3E6PH 3A8CA 2XRCA 3E3TA 1AKSA 4Z1MD 2VWOA 1VITF 5DP8A 3LU9B 1C1UH 4WMEA 3SUFA 1UVTH 5EQRA 2BY7X 3ZVCA 4TY6A 5CE1A 1Y3YA 4D7FA 3T28A 5C0UA 4FUEA 1AB9C 3GCTF 2NWNA 2M5TA 2ZTZA 1D9IA 3PROA 1FAXA 2ZECA 2GZ8A 4Q63A 1N8OB 3MU1A 4M7GA 4ISNA 1AWFH 3QUMP 1C5VA 1LPKB 3RXSA 1DX5M 2WPJS 1ZGVA 3DUXH 2I6SA 1PQ5A 4XOJA 1VCPA 3K65B 4NZQA 2CK3D 3TNTA 5F03A 1XXDA 2SGEE 2SNWA 2FI3E 2A2QH 2YNBA 3RU4T 1XUKA 1GVZA 3Q00A 1O3DA 1GGDC 1O2ZA 3UNQA 2G51A 4CRCA 1LHEH 2CHAC 3S7HB 2HNTF 1S82A 1O3LA 4OM9A 1DT2A 1HJ9A 1LO6A 5T6FA 3QZRA 4HGCA 1G3BA 1GJ6A 3SUGA 2UUKB 3A86A 4UONA 1TPOA 5ESTE 2AS9A 5FHTA 3N99A 5JBCS 1SBWA 2Y5GA 1V2JT 1TONA 1UVUH 3RXPA 2ZGXH 3TH3H 2FWWA 1QL8A 4YESB 2KCPA 1AFEH 1CSOE 1SGEE 3OY6U 5FAHA 3I77A 3L33A 2GZ7A 4HG6A 1A0HB 3SV7A 3BF6H 2BDYA 5EU8A 5F53A 2Y80A 5JBTA 1ZMNA 2XYAA 3STIA 1GDQA 3C27B 1H9LB 4DY7B 1VCQA 1CT0E 3ZVBA 3M3SA 1O5DH 1XKBC 2BQWB 2OTVA 2Z3DA 3MO9A 3DFLA 3TH4H 1EP5A 2BXUH 5EODA 1D3PB 4IW4E 1ZMLA 1GBKA 4DJZB 1KIGH 4K1EA 2ANMH 2BD2A 4ZXXH 4Y6DA 4K60A 2P8OB 1SGFA 2BLWA 1W12U 3WY8A 4K1SA 1YYY1 1O5FH 4AB8A 3T62A 2BHGA 2GDEH 2C8XB 1JOUB 3PO1B 3SGAE 3AAVA 3QWCH 2PGQB 1UHBA 3KQEA 1C9PA 3MOCA 1MKXK 1PPGE 5DP6A 1Z6JH 1D3TB 1PPFE 3OY5U 2BD3A 1O3OA 1KLJH 3UPEA 3Q3XA 3M5LA 4B6EA 1BMLA 3W95A 3ZZ7A 2VH6A 2DE8A 1SB1H 3M3VA 1K1JA 4I8HA 2F9NA 4FUBA 3P8FA 4FETA 3ZZAA 1FY1A 1S0QA 4FUHA 1YPHC 1GBCA 1TNLA 1C5XB 3UR9A 3GISB 5C3NA 1C4V2 3E90B 2WPLS 2PLXA 1O3CA 1HJAB 3A80A 3EDXB 4DIHH 1H8DH 1GI5A 4ZH8A 4WJG2 5EW2H 1A1RA 2XBXA 1IQKA 3GY3A 1KXCA 3A7VA 2TIOA 1GGDB 3SORA 4GUXA 3KYGA 3RXHA 3A7ZA 4MDSA 1ZSKA 2BDBA 3A85A 1Z1JA 3MNSA 3RXIA 4UFGH 3IITA 1EP6A 4CRFA 3SU3A 2B9LA 1V2MT 4GAWA 1PPHE 2ALPA 4DIIH 2XC4A 5C20A 1H9HE 2ANWA 4LZ1H 4IC5A 5E2PA 2ZU2A 4TT3D 1DY8A 3V3MA 5J4SA 3SNAA 4H4FA 1D6RA 1LQDB 1T7CA 3A82A 4WMFA 1AB9B 2AMQA 2QXJA 4B76A 4XBCA 4YOJA 1V2KT 3LH1A 2V7QD 2PTNA 1NZQH 4AFSA 2A5KA 2OK5A 2CGAA 3E1XB 4MPXA 2BOHB 2PV9B 1TQ7B 1T32A 4Y0ZE 1BBRE 2FOCA 1CGHA 1NTPA 5C5OA 2KAIA 2IJD1 3G01A 1HFDA 3NZIA 1XVMA 2GCHF 3URCA 2ZFFH 3V7TA 7GCHG 5GXPA 2BDGA 3HATH 3HPTB 1DS2E 4ZHMU 1NU7B 1O2UA 3PRBA 1BT7A 2QF4A 2YMSB 2AGEX 1MTNB 2G55A 4AFUA 3RU4E 2FODA 1ELGA 2GX4A 2G81E 1K1MA 1QR3E 1HCGA 1GI2A 5GDSH 2BD7A 1A5GH 1ZLRA 1V2VT 1IQNA 1W0JD 1G36A 1F2SE 8KME2 2TGTA 3HKJB 1K28D 3BTFE 2CN0H 1GHVH 1O3NA 2FYRA 3GCHC 3U8OH 3PMAB 1AE8H 5EG4A 5L2YH 3ZVEA 5JYIA 1E38B 1T8NA 1KSNA 1GVKB 2PUXB 4FUFA 4YLUA 1CGJE 1GHZA 1DUAA 3E0NB 3UY9A 4FUJA 3L6PA 1SFIA 1MH0A 3MU4A 5AVDA 4J1YA 2R0LA 3PRDA 7ESTE 2D8WA 2EY4C 2PKAB 2W5EA 3SU2A 3IWMA 3DD2H 1O3AA 2VWMA 3H5CB 1P0SH 3M5MA 4I7YH 1KLTA 2ODPA 3SUDA 1ZRBA 1PYTC 3A7TA 1HAVB 1O3EA 2WPMS 3HGPA 3A7XA 1PJPA 4E06H 3SJ8A 1HAGE 4RKOB 3LGUA 2ZA5A 1XMNB 2BVSH 2Z9IA 3RXAA 1HAYB 1YPEH 2GV7A 4XE4A 3TNSA 1GHWH 3TJVA 1V2LT 2P3TB 3VB7A 4Y7AA 2VIQA 4UFFH 7GCHF 4OS7A 1S84A 1ZHMA 1ZOMA 4IGDA 3DCLA 1J16A 3T5FH 4B2AA 1P03A 3A7YA 4KTUA 4O3TA 3UIRA 1GI6A 2F83A 1Z8IB 2QE7D 5GPIB 2BDHA 5CMXH 1J8AA 3SNDA 1RGQA 5EOKA 4TWWA 5K7RA 1AFQC 1GMDF 1AQ7A 2LPRA 4CRDA 5H4IB 2VIWA 2QF3A 1Y59T 2GDDA 4X1QU 3RXLA 3F6UH 4NSYA 3N7OA 3KYFA 2D2DA 3PWBA 1YCPK 5C94A 3K6YA 6LPRA 3M36A 2XCFA 2C4FH 4LOYH 1RTFB 2GCTC 1A5IA 2ZG0H 1SHYA 1DWEH 2VVVA 1UTQA 2ZPRA 1Z71A 5AHGH 2ZFTA 5HYOA 2AERH 4IMQA 2ZGJA 1EAIA 1O35A 1LMWB 2CJIA 1EFRD 2J94A 3SGQE 3NCLA 5A0BA 1O37A 1ABJH 2PFEA 5HGGA 1C1VH 2YMSD 1BTWA 2BY6X 4BAMB 1C2JA 3ZZDA 2DE9A 2PP6A 2H9HA 4LK4A 4X2VA 1MAYA 2V3MA 1C5PA 3PMHB 3RXCA 4B2BA 2BD5A 1HXEH 1J15A 1B0EA 4U30A 1O5EH 1NM6A 2JH5D 5EJ1A 4NGAH 1K2I1 1BMNH 3LGVA 2NU1E 6CHAB 1P2MA 1E79D 5EXNA 2W3IA 5DK1A 4X6NA 4H42U 2CF8H 2O8WA 1UTPA 2TPIZ 1BRUP 1SGCA 1V2RT 3FVFB 1FNIA 1FN6A 1TQ0B 1AIXH 1WBGB 3RDZA 1DSUA 2BD9A 1F92A 4K2YA 1NS3A 2KR7A 4MQAA 1C1PA 1LDTT 1HAIH 4THNH 1IQEA 1SQOA 1V2WT 3FZDA 1GJAB 5CDFE 2V3OH 1DXPA 1AVWA 1FY4A 3BN9A 1DDJA 2Z9KA 3M35A 4ESTE 1WUNH 4AYYB 1CA8B 5A8XA 4DURA 3DHKH 1QQ4A 2A7HA 1GDNA 4ABFA 1XUGA 3O8RA 1WOFA 1O5BB 3EE0B 3PTNA 4X2WA 3ZVFA 1GCDA 3NXPA 5HIZA 3AVZA 3U1IB 1MTVA 4BAOB 1G3EA 3PTBA 1W7GH 4HTCH 4ABBA 1FN8A 4B74A 5LH8A 4X8SH 2GVFA 3H09A 2Q6GA 2QCYA 3EGKH 3RU4D 2XTTB 1HXFH 1LPGB 2XBYA 4FUCA 1EKBB 1GI8B 1HIAA 3SI3H 2WPIS 1TWXB 1ID5H 2ZFPH 1QQUA 4UDWH 4D9RA 3K2UA 1T31A 5T6DA 3PLBA 1GMHF 3GY2A 1FI8A 5FCRA 1A5HA 1S85A 3IG6B 1P2OA 1Q31A 1ELVA 2QIQA 1UW7A 1V2QT 1LHCH 3SGBE 2ZP0H 3ZVGA 1OWEA 3UB0A 1FPHH 3LONA 3HGNA 1YM0A 3F9EA 3P70B 3P8OA 2JJ2D 1XUHA 1TGTA 1P02A 1P2IA 2A0QB 4ISLA 3MO6A 2P8OC 4X1SU 5JPMH 2J95A 1ZHRA 1MZAA 1FY3A 3U28C 2KCOA 1S6HA 1P8VC 2H5CA 4NG9H 4A1VA 5GWZA 4JK6A 1YF4A 5E0HA 2ANYA 1TBZH 1W0YH 3RLWH 4M9FA 4Y11E 1NESE 3MH6A 3PM3A 1WDIA 1VITH 3SI4H 2BZ6H 4ZKRU 1NFYA 4NA9H 4CRAA 2ULLA 5J4QA 3LKWA 3GY7A 2LNCA 2FOHA 4ZHAA 2W3KA 3FFGA 2ZDKA 1AZ8A 2ZEBA 1BBRH 5EXLA 4F55A 1K1PA 2O8TA 1O3HA 2P95A 1Y5UT 4ABAA 2HVYB 2ZCLP 4ISHH 1TIOA 4ABDA 3A89A 5JB8S 5F8XA 1DANH 3NRLA 3QZQA 3STJA 4X8UH 1A0LA 4GCHG 1B0FA 2K8IA 3F3BA 1OWIA 1QNJA 1YPGH 2CF9H 2ZFQH 3RXQA 2AIQA 3OE7D 4DT7B 3BV9B 1AE5A 2A1DB 1DLKB 4NWLA 3KNXA 1CVWH 3QO6A 3SQEE 2F9PA 1O36A 2FTLE 1AN1E 1EPTA 3KF2A 3MWIU 5FBEA 1S6LA 1CQQA 4WY3A 5EIYA 1TNJA 3E16B 1HUTH 3UWIA 2F9UA 1HAPH 3SZEA 4J2YB 1Z6EA 4FVBA 1O2WA 3MNBA 4TPYA 1P9SA 2ZGHA 4BAQB 1F5KU 1GBIA 3TJNA 1PPBH 2KZ4A 3U69H 5KEDA 1P01A 1ZPCA 4Y8XA 1IHTH 5FCKA 1E34B 4X6PA 1EZQA 1K1IA 1UTJA 4O97A 3RXGA 2Y5FA 1KXFA 1GPZA 1NN6A 4MNWA 4JZFH 2TRMA 2H5DA 3L3TA 1N8OC 1O2NA 3RXFA 1UCYH 5EPYA 1NBMD 1EPTC 2Y6TA 1KLIH 1N1LA 1VZQH 4WXIA 1ELCA 1TAWA 4ZKOU 3SV6A 1XUFA 3V0XA 1E1RD 2ZPQA 3BG4B 3SU5A 1RS0A 1AUTC 3F9FA 5K0HA 3KIDU 2KAIB 6GCHG 3UUZA 4Y71A 4ZAEA 1K9OE 4DT4A 2Y7ZA 1QJ7B 1BB0B 2J38A 1FUJA 1YPLH 1O2MA 2BX3A 5GJ4B 4E7NA 4INHA 4INLA 1FY8E 2XCNA 2H6MA 5C5NA 1ZTJA 2EEKA 1LHDH 1HIAB 3QK1A 4Y76A 1ELEE 2A7CA 2Z9LA 3NUMA 4UFDH 2PKSC 1O38A 3AW1A 4E05H 2F9BH 4GCHF 1OP8A 1NRRH 1O2LA 1GJ5H 1UVSH 3GDVA 4SGAE 1LPZB 3ODDA 5KECA 5T1VA 1ANEA 2ZU5A 3B8JA 4X1PU 1RD3B 3M5NA 3T2NA 1UTKA 4LXBH 1GMCG 3RP2A 5F8ZA 2F9VA 3VXFH 2FI4E 2ALVA 4A92A 1H8ED 1EX3A 2A4OA 1MCVA 1Q3XA 1NROH 2EC9H 3BEIB 3T26A 2FLBH 1P57B 4AGJA 1QBOA 1ZSJA 2BY8X 1H1BA 1NRNH 1ZSLA 5FXLA 2R3YA 2HPQH 4BAHB 2WPDD 1O3FA 4X8TH 1BTUA 1C9TA 1ARCA 3PO1C 2STBE 2SGFE 1ETSH 3RMOH 1HLTH 3TJUA 1TPAE 3BTME 3VB3A 2VIOA 3F68H 9LPRA 5DO4H 1BJVA 1CHGA 2P3UB 4CRGA 2FMJA 2VGCB 4XDEA 1SGRE 3RXEA 1YGCH 1J17T 2PW8H 4CBNA 4BXSA 3UNRA 2A4RA 1YKTA 1SGIB 2VIDA 2ZWLH 4Q7XA 4Y10E 2FOGA 3MMGA 1T4VH 5EQQA 2WUBA 1ELDE 1A0JA 3UQOA 1EJMA 2FZZA 1QFKH 4DOQA 1OYTH 1QB1A 1KMHB 4FOUC 1OWHA 1GG6B 3AASA 2Z7FE 1KTTB 1FZZA 3GY5A 4MVNA 1AO5A 3LH3A 3D49H 4FXGH 2K1QA 1W0KD 4KELA 1HAZB 4K8BA 1ANCA 2AMPA 2ODQA 1SQTA 1C1SA 2XBVA 1CHOF 3VEQB 1RIWB 2J2UA 3BTWE 3Q3YA 1O2RA 3GYLB 5AFYH 1AVGH 3GDUA 4FUIA 2AFQB 4OGYA 1TMTH 4MPUA 4YOGA 3TH2H 1KXBA 4E7RG 2GZ9A 3MH7A 1UTOA 1O3GA 5CHAC 5HM2A 4KKDA 4CREA 1C4U2 2ZI2H 2BLVA 3BEUA 1MTWA 5FL7D 1GL1A 2V35A 2ZPSA 1ZR0A 3R3GB 1BJUA 1KYNA 1TGSZ 4AOQA 5I25A 1SGFG 1UTLM 1Z8JB 1CBWC 4Y8ZA 4YXWD 5ABWA 1F0TA 2OXSA 2Y81A 2VWLA 1O2YA 1MU8B 1O3PB 1VCWA 1QA0A 1DWBH 5L6NH 4ZXYH 3PLKA 2KX4A 4YTAA 3C1KA 2BYAX 2ZDNA 3EAJA 5TJXA 4CRBA 1GBMA 1PPEE 3PMBB 5IYTA 1ELBA 3PV4A 1FIWA 4Y8YA 1QCPA 5DGJA 2BOKA 5IDKA 2SGDE 1ESAA 2ZDMA 3KL6A 3V13A 1EATA 2BM2A 3W94A 1C2LA 1DE7H 4TWYA 4DGJA 2XNIA 1BHXB 1THSH 3MTYA 2UUJB 2ZFSA 1TA6A 1HBTH 1GCTB 1JMOH 8LPRA 2QF0A 1EXFA 1ABIH 1O39A 4JZEH 4JYUH 3MYWA 1P3EA 1L1JA 2G00A 2GJGA 1P05A 3LOXA 1P10A 1AGJA 3M37A 2G5VA 1TB6H 2VINA 1IOEA 1V2NT 1TRNA 1MQ6A 1YPJH 5TCCA 1H8IH 4Q2KA 3F2GA 3SJKA 3RXOA 2TGAA 2GKVE 3MHWU 1EB2A 4FU7A 1LVYA 3VGCC 5DN6D 1C5NH 3TLOA 1BMAA 1F0SA 1RXPA 2YMSC 2A7JA 3S0NA 3CNRA 3RC4A 1C2KA 4ISOA 1BCUH 5C17A 1FAKH 1DM4B 4NA7A 1VJ9U 1S83A 3QGNB 3LGYA 3TGJE 1Y5BT 3OTJE 4DW2U 3OAAD 2BY5X 5EQSA 3K9XB 1WU1A 2FOFA 1XVOA 2Z9GA 3OYPA 1O3JA 1V3XA 2JJ1D 1A7SA 1XM1A 2XWAA 1D6WA 2PKAA 2Z94A 2ZIQH 1ZMJA 5DP3A 3SO3A 1TX8A 3VB4A 1CA0B 3PV5A 1QL7A 4K3JA 2BD4A 1GI9B 2BQ7B 3A8AA 3TIUA 5CHAB 1T8OA 1BZXE 4R8TB 1P2JA 5A8ZA 3H7TA 4WWYA 3NWUA 2J97A 4MNXA 1J14A 1GDUA 1P04A 3EA9A 1O3MA 3MNCA 3VXEH 4XBDA 1C1MA 5DPAA 3Q76A 1WV7H 1O34A 2QXIA 5JBBS 1MAXA 1GHAG 3T25A 1HJAC 3V12A 1WXRA 1E36B 2IOTA 3I78A 1DWDH 1ZTLA 2DUCA 4IN1A 3A8BA 2XC5A 5EJLA 4CH2B 1O5CB 1LKBA 1PQ8A 3BTQE 3NK8A 2BTCE 1JIRA 1GBEA 4R0IA 2ZQ2A 2WSSD 4ABJA 3SBKA 2ZHDA 1Q2WA 2HLCA 3GCOA 4X2YA 1GJ8B 3A84A 1T8MA 1WTHD 4Y7BA 4DCDA 1GHBF 1SPJA 2ZU1A 2O9QA 3UOUA 3O8DA 1ETRH 2TBSA 2VH0A 1YY3A 2LELA 4IC6A 3P92A 5FPYA 1C2HA 1O2HA 1JXPA 1ZRKA 3TJOA 1QJ6B 2WUCA 1AUJA 2J9NA 3R0FA 4I31A 3PYHA 3BTTE 5DSFA 4A6LA 3MU8A 1CO7E 3OX7U 2J34A 1D3DB 1G2LA 3M7QA 4I8GA 1HDTH 2UWOA 2AYWA 2BX4A 3ZZ5A 5A8YA 2GTBA 1NFXA 2STAE 3DFJA 3F9GA 4FU9A 2J98B 8GCHF 1W10U 5AF9H 3CS7A 2A4QA 1QBVH 1ZHPA 1DUEA 1W14U 3M7TA 1BTPA 1K1NA 1G3DA 3MU0A 4MTBA 1DOJA 4IMZA 4TPIZ 1BTXA 2ZHQH 2IJOB 2O8MA 1UJ1A 3LC5A 4D76A 4OS5A 2L6OA 5LGOA 1GI1A 4A1XA 3LJOA 1O3KA 1UK4A 4ASUD 1V6DA 3UQVA 1F7ZA 1OYQA 3BIVH 2QC2A 1GL0E 3LPRA 2UWPA 3SU0A 1FMGA 1OWDA 5EXMA 2BDAA 2Y5HA 2FOAA 4DVAU 1E35B 1COWD 2HPPH 5ETXA 3FN8A 1SQRA 1GBTA 3SHCH 4CR5A 1L1GA 1MTUA 4Z6AH 2AGIX 3LT3A 2BMGB 2OP9A 4ISIH 2SFAA 3DA9B 3FP6E 3GYMA 4XBBA 1ZJKA 1O2KA 3ZZBA 2ZU4A 1O0DH 2FXRA 3A87A 5DP7A 4HI3A 1YLDA 2M2AA 1V2UT 4AX9H 1ORFA 2BD8A 3AK5A 4OS2A 3JZ2B 4ABHA 1P9UA 1WQSA 3P6ZB 3B9FH 1EB1H 1MBMA 3VPKA 3E8LA 3DSPA 4XD7D 5FPTA 1BITA 1P3CA 4BTUB 3ODFA 4FUGA 1O30A 1OS8A 1S6FA 1SOTA 1X7AC 1C5LH 1XX9A 2FM2A 2WYJA 3UWJH 4NIVA 3B23B 1GBAA 4YT7H 2BDIA 1N6YA 1EOJA 1OP0A 2A4GA 1BOQA 4CBOA 4GPGA 1P09A 1Y3UA 2OD3B 4Y0YE 1ELFA 2VJ1A 3GICB 3RC6A 2XW9A 9ESTA 3MQKC 1UVOA 1O2GH 1NPMA 2G8TA 3VGCB 2JDID 1GHBG 2OBQA 3RXJA 3D62A 2NU0E 1XKAC 1THPB 3S9BA 3AAUA 3RM2H 1C4Y2 1MQ5A 1OXGA 1GBFA 1SQAA 3ZV9A 1O31A 2HGTH 1NU9A 1QBNA 1UO6A 1UMAH 2HVXA 2UUYA 3FZZA 1EAXA 1SGQE 2VVCA 3EA7A 1TOMH 4UFEH 3SNCA 3M7UA 4A7IB 1JRTA 1HGTH 1ZPZA 1SLXB 3SU6A 2FTMA 1EUFA 2W7UA 2H2ZA 1NBME 1TALA 1VGCC 1YP9A 2I6QA 1TNKA 3EA8A 2A31A 3MFJA 1GCTC 1NRSH 2SGQE 2HOBA 4D7GA 2FOEA 1SKYE 2HRVA 2QXHA 5E0JA 1CU1A 4O03A 3RUOA 1PQAA 1G2MA 1OPHB 3LDXH 1MD8A 1MUEB 2GGVB 2PSYA 4Q4LA 2SGPE 2TGPZ 2W6ID 1P11E 2CXVA 1WCZA 2VIPA 5F8TA 3NKKA 4GVUA 1F0RA 3O8BA 3KQDA 4I32A 4VGCC 1YLCA 3TK6A 1SFQB 1L0ZA 3F0OA 2O8LA 5FPSA 1HB0B 4ACAA 3KQ5A 4MPVA 1ETTH 2F43B 1HJ8A 3Q77A 1HPGA 3FP7E 4JCNA 1O3IA 3SV9A 4WH6A 3ZVAA 2A5IA 4GSOA 2R9PA 1K1LA 4X1NU 3OEED 5B6LA 2BLQA 4K8YA 4AG1A 1U6QA 2BY9X 8ESTE 2F91A 1KTSB 1TGCA 3HKIB 2OC0A 3OU0A 4AFZA 1FX0B 4BOHA 2TGDA 1NO9H 2QYIA 3S9CA 5BRRE 4F49A 2LP6A 4CHAC 3LGWA 1FLEE 3BTEE 3RXVA 3ATLA 1BMFD 1UTNA 2FX6A 3MH5A 1QTFA 1UTMA 1GBHA 3KGPA 1WSSH 1L4DA 1Y5AT 3T29A 1SL3A 4UEHH 4HFPB 1OHHD 2QY0B 1F0UA 2C8YB 4QT8C 4AG2A 5E8EH 1TBRH 1NC6A 1GI3A 4K5ZA 5A2MH 3QX5H 2C8ZB 1NRQH 2BB4A 1FONA 4ZROA 1GJ4H 2XOKD 5E2OA 5IK2D 1LTOA 5T6GA 1GI7B 2B8OH 3SN8A 3BIUH 3M3TA 2VWNA 1Z8GA 4INKA 4NSVA 2FS9A 1O32A 1QZ8A 2WV9A 1GJDB 1YCPM 1Y3VA 3QDZB 3SW2B 3DSOA 3RXUA 2JH6D 1GMDG 3VB5A 1TLDA 1T8LA 4MPWA 1K0HA 3SNEA 1C5ZB 1DWCH 2G4UA 2ZO3H 3RLYH 1FXYA 4F4OC 3SU1A 2V3HH 3SNBA 4X2XA 1TRMA 2OLGA 1MD7A 4O9VA 2ZHFH 4ABGA 2SGAA 1O3BA 1ELTA 1E1QD 2ZGBH 1GJ7B 1Z1IA 1EZSC 1MTSA 4Y79A 1IQIA 2OQUA 2PHBA 3KCGH 4Q80A 4HZHA 3UAIC 3ITIA 3EE7A 1IAUA 1TBQH 2A2XH 4B73A 2W6JD 4KTSA 1P2QA 3I29A 4JZ1A 2BLOA 4BNRA 5KGOA 2GCHG 4JZDH 1N6XA 2GD4B 1W11U 2A32A 4YM9A 3BSQA 3ATWA 3VB6A 2VBCA 1AVXA 3CENA 3URDA 3A83A 1QB9A 4XFQA 4P02A 1TNHA 2HLDD 2FLRH 1A4WH 1GBJA 1YPMH 1SGNE 1HAOH 1C1NA 2GV6A 5EPNA 4ASHA 1SLWB 1FDPA 1VGCB 1SHHB 3WWFA 1MMJN 1TE0A 2AIPA 1C5WB 2G4TA 1SC8U 1XUJA 1KXEA 1KY9A 2BDCA 5C1YA 1P2NA 2PR3A 1ZGIA 3U98H 1TGBA 3SJOA 3A81A 1C5RA 1C2DA 3S69A 5C0TA 1H4WA 1ANDA 3M5OA 3PV2A 1AFQB 3BEFB 3UTUH 1UCYE 3WW7A 2P3FH 4OS4A 1DY9A 1YCPH 2B7DH 2AHME 1UCYK 4WF8A 1C1OA 2C8WB 5L2ZH 1W13U 3BTHE 1NFWA 1VKYA 1AU8A 1CA0C 2F9OA 2RG3A 1EPTB 3UREA 2ZCHP 2KCAA 1LHGH 5FX6A 4KGAA 2HNTC 4BXWA 4IBLH 1DICA 2R0KA 3F0PA 4F48B 2AEIH 3U8RH 1PFXC 1UVPA 4D8NA 2Q6FA 1S81A 4MLFB 2WPHS 5DKMA 3SOSA 4H6TA 1FY5A 2OC8A 4RI0A 2KM0A 3CP7A 5HKKD 2UUFB 1E37B 2KFWA 1FQ3A 3LIWA 1RRKA 4JYVH 1Y3WA 1A61H 1CT2E 1HYLA 1WQVH 5LPRA 4UD9H 1M9UA 1GWAA 2J92A 1GMCF 3KQBA 3ZZ3A 2OBOA 1FPCH 2ZQ1A 2FIRH 2GT8A 3TK5A 4OS6A 3JZ1B 1SMFE 1GHXH 2L74A 1HNEE 2FX4A 3BG8A 3ZZ6A 2FP7B 1MZDA 2ZDVH 2FOBA 3ZZ4A 2GMTB 1L2EA 1W3CA 1V2ST 2BVRH 2R2MB 5DJ7A 3ZYDA 1HRTH 1O2IA 4NFEA 2SNVA 1QJ1B 1OWKA 1T4UH 2Y82A 4NIXA 1SGTA 3ZIAD 3SHAH 1IQFA 1O2VA 2V6NA 2ZF0H 5EGMA 2VVUA 4XSKU 4WVPE 1ZPBA 5C67A 4NCYA 1BA8B 3OEHD 7LPRA 2W7SA 2ZDAH 2NU3E 1MKWH 2Y7XA 3NPSA 2Z3CA 1EAWA 1SSXA 3F9HA 3LGIA 1LCYA 5JBAS 4B75A 1GHAF 1JRSA 3TK9A 1O33A 1ESTA 2ZZUH 1V2OT 2QAAA 1XUIA 1EZUC 1RTLA 5JB9S 2HALA 2PTCE 3FANA 3SJ9A 3TGKE 1C2IA 3MNXA 4GHTA 1FV9A 4TY7A 1BMMH 2THFB 1BTYA 5FX5A 3ATIA 3FO8D 4H6SB 3GY6A 1KXDA 1Z8RA 1RJXB 2Z3EA 2XC0A 4O3UA 3ZYEA 3RM0H 4CR9A 1Y3XA 2NU4E 2PSXA 2RDLA 2AGGX 3SZNA 3ENSB 4WMDA 1IQLA 2RA3A 4RKJB 4I8JA 1C2FA 1PPCE 4WXVA 2H9EH 1O2SA 2P93A 3LC3A 3P8NA 3KQCA 3SJIA 1P2KA 1CBWB 4GHQA 4ZKSU 3RXBA 1EAUA 4ZKNU 1TX7A 2ODYB 4PROA 4Q7ZA 5TCAA 2Q6DA 1SOZA 4RT0A 1TPPA 4RSPA 1A2CH 1CHOG 4SGBE
chains in the Genus database with same CATH topology
3S9AA 5E0GA 1O5GH 2VIVA 2QV1A 5EW1H 1TFXA 4I33A 5C1XA 3ATMA 2JETC 5HM9A 2H1UA 1C5SA 2EI7A 1CGIE 3VFEA 1HV7A 3TGIE 1EJNA 1JBUH 1QB6A 4IS5A 3QGJA 1UK3A 2PUQH 1PPZA 1VJAU 1GJ9B 4AORA 3FAOA 4MNYA 3ZZ9A 3MO3A 1YPKH 1FJSA 3ATKA 3RMMH 4X8VH 4AFQA 2JETB 3TVJB 1DFPA 5C2ZA 1AZZA 1Y8TA 2FDAA 1OP2A 5PTPA 3TITA 3GDSA 4Q7YA 2OQ5A 5ESBA 4DG4A 1TRYA 1D4PB 4ZHLU 4JYTA 7KMEH 1K21H 2FPZA 2QXGA 1F5LA 4ZMAH 1ZJDA 3RXMA 1SG8B 1DVAH 1C2GA 2BZAA 2R2WU 4CHAB 1DLEA 3QN7A 1W2KH 3KHVA 3ZZCA 1SGYE 1V2TT 2ZU3A 3KN2A 4X6OA 1GHYH 3F1SB 4X1RU 6CHAC 1BIOA 3QLPH 1BRCE 2JKHA 2WV5A 4ZUHA 1HAVA 2ZCKP 1TGNA 1G32B 1DPOA 3DT0H 2B0FA 2ZDLA 4JK5A 2P16A 2AH4X 4TYDA 4AZ2B 1NRPH 3GOVB 1A3EH 1MKWK 1C1WH 1WYKA 5A09A 1C1QA 2ZHWH 2EI8A 1KDQA 5DP5A 5T3HA 3EYDA 2UWLA 4U01A 1AHTH 3P8GA 1G9IE 1C2EA 2OC1A 2QA9E 2XWBI 4KP0A 1LHFH 2J4IA 3QTOH 1OSSA 1QIXB 3ZV8A 2HWLB 5B6OA 3SUEA 1B7XB 1C5TA 1ANBA 1QGFA 1P06A 1DXWA 1MCTA 1AD8H 2OC7A 1W8BH 4GLYA 2ESTE 2BVXH 2PGBB 4IN2A 5DG6A 1QRXA 2PKSB 1SLVB 1OOKB 4FUDA 2CHAB 1DITH 3BTGE 1O2XA 1NY22 4K1TA 5HXFA 1EASA 2C3SA 2RA0A 4K69A 2ZGCA 2GMTC 4NIYA 2OUAA 1TPSA 1O2JA 3FP8E 2Q1JA 2FI5E 4ABIA 4RN6A 2A5AA 1HAXB 1QL9A 4MG3A 1O2PA 1A46H 1O2TA 1SGDE 1IQGA 2P94A 1LQEA 5FBIA 4I8KA 3MU5A 1ZYOA 1GVLA 1NT1A 1QRZA 1JWTA 1LVOA 2EA3A 3AW0A 2H9TH 3UR6A 3HK6B 3T27A 3U1JB 1AI8H 1ELAA 5LPFA 1ZTKA 2W26A 3RXDA 1GI0A 1O2OA 1OWJA 2BQ6B 3BTDE 5I46H 1C1TA 3KEEA 4AN7A 5C1UA 1TMUH 1S5SA 3LGTA 2IPHA 3U9AH 1RTKA 1H9IE 1SI5H 1HAHH 1QRWA 2OCVB 5HMAA 1TYNA 1AMHA 1YPHE 3TPIZ 4YLQH 4BAKB 3RC5A 1D3QB 5DP4A 4NIWA 1PQ7A 1KXAA 1UK2A 1GJCB 3ZZ8A 1C5UA 3BTKE 3SQHE 2D1JA 2WINI 3K6ZA 1L1NA 2EI6A 3GCHB 2OINA 4B71A 4U2WA 3RXKA 1IQJA 1QA7A 4AGKA 4X6MA 3RMNH 1LVBA 3MI4A 2C90B 1SLUB 2P59A 3ESTA 2D26C 3PMJA 3EQ0H 1AY6H 2ZHEH 1LVMA 1TOCB 2AMDA 4YOIA 5L30H 1F5RA 1SR5C 1VITG 2ZC9H 2XBWA 1W0ZU 2VU8E 1GG6C 1PYTD 1OKXA 4OS1A 1GBBA 1O5AB 1TA2A 5BPEA 5DP9A 1BRBE 3SV8A 1TNGA 3O8CA 3CS0A 3OSYA 1Z7KA 2ASUB 4BANB 1NFUA 2QN5T 3ELAH 3M61U 1BHXF 5A0AE 1MU6B 2GT7A 2ILNA 1P12E 1YBWA 1GMHG 1O2QA 3SV2H 4NWKA 5GIBA 1G30B 3TU7H 3D65E 1C2MA 4NFFA 3D23A 1GJBB 2CMYA 4BTIB 1ACBE 8GCHG 2JH0D 1EOLA 3E0PB 1LKAA 1IQMA 2O8UA 2C93B 2VNTA 2FESH 4FU8A 4A1TA 5A0CA 2RCEA 1QURH 4CH8B 4YZUA 2ZNKH 3GCNA 1B5GH 1G3CA 2NU2E 2A45B 1XXFA 1BRAA 2WYGA 3Q3KA 4AB9A 2GCTB 3HK3B 3PB1E 1V2PT 2R3UA 4NZLA 3UNSA 2G5NA 2FO9A 2ZTXA 4BTTB 1UHBB 5SGAE 2V0BA 4U32A 2YNAA 4B1TA 1C5MD 1DSTA 1FIZA 3RXRA 3ZVDA 1IQHA 1K22H 1QY6A 2WPKS 2FEQH 1WAYB 2GP9B 3P95A 2ANKH 2F3CE 1INCA 1RIWC 5GCHG 1BQYA 1BBRK 4FVDA 3SU4A 4D9QA 3S7KB 1MKXH 2CV3A 1IHSH 2Z6BD 6GCHF 2QGRA 3BG4C 2PWXA 4JMYA 1K1OA 4LZ4B 1ARBA 3A8DA 1CE5A 3H7OA 3MH4A 1TX6A 3A88A 4ABEA 5LPEA 3QTVH 3P17H 3A7WA 1TABE 4Z0KA 1C5QA 1THRH 2FOMB 1TNIA 1EZXC 2YOLA 1BDAA 1C5YB 1QHRB 3LJJA 4WH8A 1VR1H 1AWHB 1L4ZA 3U8TH 4YT6H 2VGCC 1A3BH 2WV4A 1AKSB 2IN2A 1S0RA 1SGPE 4B2CA 2ZKSA 5GCHF 3RMLH 2ZTYA 1G37A 1TMBH 1MBQA 1RFNA 1E0FD 1SVPA 1YC0A 2VB0A 4VGCB 1J9CH 1C1RA 4NA8A 1C5OH 2FS8A 1OX1A 2ZFRH 1GI4A 5AFZH 1ESBA 4X0WU 2XXLA 4KTCA 2Z9JA 1KDQB 3GCTG 1EJAA 2BXTH 3GY8A 4OGXA 4MNVA 6ESTA 4I8LA 4JZIA 4AYVB 3GY4A 3E91A 5G4BA 2HNTE 1ZZZA 1WTGH 2FYQA 1CT4E 1GBLA 2B5TB 3PLPA 1BUIA 2G52A 3UFAA 3RXTA 4A5TS 1MTNC 3PWCA 1GBDA 1BTHH 3UOPA 1BTZA 1JIMA 5JDUB 4UE7H 4YO9A 1EQ9A 5F6MA 1W7XH 3E6PH 3A8CA 2XRCA 3E3TA 1AKSA 2VWOA 1VITF 5DP8A 3LU9B 1C1UH 4WMEA 3SUFA 1UVTH 5EQRA 2BY7X 3ZVCA 4TY6A 5CE1A 1Y3YA 4D7FA 3T28A 4FUEA 1AB9C 3GCTF 2NWNA 2M5TA 2ZTZA 1D9IA 3PROA 1FAXA 2ZECA 2GZ8A 1N8OB 3MU1A 4M7GA 4ISNA 1AWFH 3QUMP 1C5VA 1LPKB 3RXSA 1DX5M 2WPJS 1ZGVA 3DUXH 2I6SA 1PQ5A 4XOJA 1VCPA 3K65B 4NZQA 3TNTA 5F03A 1XXDA 2SGEE 2SNWA 2FI3E 2A2QH 2YNBA 3RU4T 1XUKA 1GVZA 3Q00A 1O3DA 1GGDC 1O2ZA 3UNQA 2G51A 4CRCA 1LHEH 2CHAC 3S7HB 2HNTF 1S82A 1O3LA 1DT2A 1HJ9A 1LO6A 5T6FA 3QZRA 4HGCA 1G3BA 1GJ6A 3SUGA 2UUKB 3A86A 4UONA 1TPOA 5ESTE 2AS9A 5FHTA 5JBCS 1SBWA 2Y5GA 1V2JT 1TONA 1UVUH 3RXPA 2ZGXH 3TH3H 2FWWA 1QL8A 4YESB 1AFEH 1CSOE 1SGEE 3OY6U 5FAHA 3I77A 3L33A 2GZ7A 1A0HB 3SV7A 3BF6H 2BDYA 5EU8A 5JBTA 2Y80A 1ZMNA 2XYAA 3STIA 1GDQA 3C27B 1H9LB 4DY7B 1VCQA 1CT0E 3ZVBA 3M3SA 1O5DH 1XKBC 2BQWB 2OTVA 2Z3DA 3MO9A 3DFLA 3TH4H 1EP5A 2BXUH 5EODA 1D3PB 4IW4E 1ZMLA 1GBKA 4DJZB 1KIGH 4K1EA 2ANMH 2BD2A 4ZXXH 4Y6DA 4K60A 2P8OB 1SGFA 2BLWA 1W12U 3WY8A 4K1SA 1YYY1 1O5FH 4AB8A 3T62A 2BHGA 2GDEH 2C8XB 1JOUB 3PO1B 3SGAE 3AAVA 3QWCH 2PGQB 1UHBA 3KQEA 1C9PA 3MOCA 1MKXK 1PPGE 5DP6A 1Z6JH 1D3TB 1PPFE 3OY5U 2BD3A 1O3OA 1KLJH 3UPEA 3Q3XA 3M5LA 1BMLA 3W95A 3ZZ7A 2VH6A 2DE8A 1SB1H 3M3VA 1K1JA 4I8HA 2F9NA 4FUBA 3P8FA 3ZZAA 1FY1A 1S0QA 4FUHA 1YPHC 1GBCA 1TNLA 1C5XB 3UR9A 3GISB 5C3NA 1C4V2 3E90B 2WPLS 2PLXA 1O3CA 1HJAB 3A80A 3EDXB 4DIHH 1H8DH 1GI5A 4ZH8A 4WJG2 5EW2H 1A1RA 2XBXA 1IQKA 3GY3A 1KXCA 3A7VA 2TIOA 1GGDB 3SORA 4GUXA 3RXHA 3A7ZA 4MDSA 1ZSKA 2BDBA 3A85A 1Z1JA 3MNSA 3RXIA 4UFGH 3IITA 1EP6A 4CRFA 3SU3A 2B9LA 1V2MT 4GAWA 1PPHE 2ALPA 4DIIH 2XC4A 5C20A 1H9HE 2ANWA 4LZ1H 4IC5A 5E2PA 2ZU2A 1DY8A 3V3MA 5J4SA 3SNAA 4H4FA 1D6RA 1LQDB 1T7CA 3A82A 4WMFA 1AB9B 2AMQA 2QXJA 4B76A 4XBCA 4YOJA 1V2KT 3LH1A 2PTNA 1NZQH 4AFSA 2A5KA 2CGAA 3E1XB 4MPXA 2BOHB 2PV9B 1TQ7B 1T32A 4Y0ZE 1BBRE 2FOCA 1CGHA 1NTPA 5C5OA 2KAIA 3G01A 1HFDA 3NZIA 1XVMA 2GCHF 3URCA 2ZFFH 3V7TA 7GCHG 5GXPA 2BDGA 3HATH 3HPTB 1DS2E 4ZHMU 1NU7B 1O2UA 1BT7A 2AGEX 1MTNB 2G55A 4AFUA 3RU4E 2FODA 1ELGA 2GX4A 2G81E 1K1MA 1QR3E 1HCGA 1GI2A 5GDSH 2BD7A 1A5GH 1ZLRA 1V2VT 1IQNA 1G36A 1F2SE 8KME2 2TGTA 3HKJB 1K28D 3BTFE 2CN0H 1GHVH 1O3NA 2FYRA 3GCHC 3U8OH 3PMAB 1AE8H 5EG4A 5L2YH 3ZVEA 5JYIA 1E38B 1T8NA 1KSNA 1GVKB 2PUXB 4FUFA 4YLUA 1CGJE 1GHZA 1DUAA 3E0NB 3UY9A 4FUJA 3L6PA 1SFIA 1MH0A 3MU4A 5AVDA 4J1YA 2R0LA 7ESTE 2D8WA 2PKAB 2W5EA 3SU2A 3IWMA 3DD2H 1O3AA 2VWMA 3H5CB 1P0SH 3M5MA 4I7YH 1KLTA 2ODPA 3SUDA 1ZRBA 1PYTC 3A7TA 1HAVB 1O3EA 2WPMS 3HGPA 3A7XA 1PJPA 4E06H 3SJ8A 1HAGE 4RKOB 3LGUA 2ZA5A 1XMNB 2BVSH 2Z9IA 3RXAA 1HAYB 1YPEH 2GV7A 4XE4A 3TNSA 1GHWH 3TJVA 1V2LT 2P3TB 3VB7A 4Y7AA 2VIQA 4UFFH 7GCHF 4OS7A 1S84A 1ZHMA 1ZOMA 4IGDA 1J16A 3T5FH 4B2AA 1P03A 3A7YA 4KTUA 4O3TA 3UIRA 1GI6A 2F83A 1Z8IB 5GPIB 2BDHA 5CMXH 1J8AA 3SNDA 1RGQA 5EOKA 4TWWA 5K7RA 1AFQC 1GMDF 1AQ7A 2LPRA 4CRDA 5H4IB 2VIWA 2QF3A 1Y59T 2GDDA 4X1QU 3RXLA 3F6UH 4NSYA 3N7OA 2D2DA 3PWBA 1YCPK 3K6YA 6LPRA 3M36A 2XCFA 2C4FH 4LOYH 1RTFB 2GCTC 1A5IA 2ZG0H 1SHYA 1DWEH 2VVVA 1UTQA 2ZPRA 1Z71A 5AHGH 2ZFTA 5HYOA 2AERH 4IMQA 2ZGJA 1EAIA 1O35A 1LMWB 2CJIA 2J94A 3SGQE 3NCLA 5A0BA 1O37A 1ABJH 2PFEA 5HGGA 1C1VH 1BTWA 2BY6X 4BAMB 1C2JA 3ZZDA 2DE9A 2H9HA 4LK4A 4X2VA 1MAYA 1C5PA 3PMHB 3RXCA 4B2BA 2BD5A 1HXEH 1J15A 1B0EA 4U30A 1O5EH 1NM6A 2JH5D 4NGAH 1K2I1 1BMNH 3LGVA 2NU1E 6CHAB 1P2MA 5EXNA 2W3IA 5DK1A 4X6NA 4H42U 2CF8H 2O8WA 1UTPA 2TPIZ 1BRUP 1SGCA 1V2RT 3FVFB 1FNIA 1FN6A 1TQ0B 1AIXH 1WBGB 3RDZA 1DSUA 2BD9A 1F92A 4K2YA 1NS3A 4MQAA 1C1PA 1LDTT 1HAIH 4THNH 1IQEA 1SQOA 1V2WT 3FZDA 1GJAB 2V3OH 1DXPA 1AVWA 1FY4A 3BN9A 1DDJA 2Z9KA 3M35A 4ESTE 1WUNH 4AYYB 1CA8B 5A8XA 4DURA 3DHKH 1QQ4A 2A7HA 1GDNA 4ABFA 1XUGA 3O8RA 1WOFA 1O5BB 3EE0B 3PTNA 4X2WA 3ZVFA 1GCDA 3NXPA 3AVZA 3U1IB 1MTVA 4BAOB 1G3EA 3PTBA 1W7GH 4HTCH 4ABBA 1FN8A 4B74A 5LH8A 4X8SH 2GVFA 2Q6GA 2QCYA 3EGKH 3RU4D 2XTTB 1HXFH 1LPGB 2XBYA 4FUCA 1EKBB 1GI8B 1HIAA 3SI3H 2WPIS 1TWXB 1ID5H 2ZFPH 1QQUA 4UDWH 4D9RA 3K2UA 1T31A 5T6DA 3PLBA 1GMHF 3GY2A 1FI8A 5FCRA 1A5HA 1S85A 3IG6B 1P2OA 1Q31A 1ELVA 2QIQA 1V2QT 1LHCH 3SGBE 2ZP0H 3ZVGA 1OWEA 1FPHH 3LONA 3HGNA 1YM0A 3F9EA 3P70B 3P8OA 1XUHA 1TGTA 1P02A 1P2IA 2A0QB 4ISLA 3MO6A 2P8OC 4X1SU 5JPMH 2J95A 1ZHRA 1MZAA 1FY3A 4A1VA 1S6HA 1P8VC 2H5CA 4NG9H 5GWZA 4JK6A 1YF4A 5E0HA 2ANYA 1TBZH 1W0YH 3RLWH 4Y11E 1NESE 3MH6A 3PM3A 1VITH 3SI4H 2BZ6H 4ZKRU 1NFYA 4NA9H 4CRAA 2ULLA 5J4QA 3LKWA 3GY7A 2LNCA 2FOHA 4ZHAA 2W3KA 3FFGA 2ZDKA 1AZ8A 2ZEBA 1BBRH 5EXLA 1K1PA 2O8TA 1O3HA 2P95A 1Y5UT 4ABAA 2ZCLP 4ISHH 1TIOA 4ABDA 3A89A 5JB8S 5F8XA 1DANH 3QZQA 3STJA 4X8UH 1A0LA