The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
53
|
sequence length |
212
|
structure length |
212
|
Chain Sequence |
STLEIAGLVRKNLVQFGVGEKNGSVRWVMNALGVKDDWLLVPSHAYKFEKDYEMMEFYFNRGGTYYSISAGNVVIQSLDVGFQDVVLMKVPTIPKFRDITQHFIKKGDVPRALNRLATLVTTVNGTPMLISEGPLKMEEKATYVHKKNDGTTVDLTVDQAWRGKGEGLPGMCGGALVSSNQSIQNAILGIHVAGGNSILVAKLVTQEMFQNI
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
Picornain 3C
|
publication title |
An episulfide cation (thiiranium ring) trapped in the active site of HAV 3C proteinase inactivated by peptide-based ketone inhibitors.
pubmed doi rcsb |
source organism |
Hepatitis a virus
|
molecule tags |
Hydrolase/hydrolase inhibitor
|
total genus |
53
|
structure length |
212
|
sequence length |
212
|
ec nomenclature |
ec
2.7.7.48: RNA-directed RNA polymerase. |
pdb deposition date | 2006-05-31 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00548 | Peptidase_C3 | 3C cysteine protease (picornain 3C) |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Barrel | Thrombin, subunit H | Trypsin-like serine proteases | ||
Mainly Beta | Beta Barrel | Thrombin, subunit H | Trypsin-like serine proteases |