4J2YB

Crystal structure of a plant trypsin inhibitor ecti in complex with bovine trypsin.
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin inhibitor
publication title Crystal Structures of a Plant Trypsin Inhibitor from Enterolobium contortisiliquum (EcTI) and of Its Complex with Bovine Trypsin.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2013-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4j2yB01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4j2yB02
1BJVA 1C1NA 1JOUB 1DLEA 1AVXA 7GCHG 1TLDA 4Y7BA 2FM2A 1H4WA 5EW1H 3K6YA 3MH4A 5G4BA 1QJ7B 4B71A 2JETC 1EB2A 1JMOH 2IJOB 1UTNA 2PFEA 1GWAA 5J4SA 4U30A 1OOKB 2ZGCA 5JBCS 2THFB 1EPTA 1D4PB 4K1TA 1NFXA 1DWCH 3ATIA 1Y5AT 2ANMH 2Y7XA 5EOKA 1RD3B 4NIWA 1YC0A 5L2ZH 2WUCA 1NM6A 1AVWA 1AY6H 1C1QA 3V3MA 2FXRA 1GHZA 1ZMJA 1FN6A 1BBRH 5DP4A 3TLOA 1O3NA 2BZ6H 1FQ3A 2O8UA 3VFEA 2W3IA 2FS8A 3HK3B 3MU1A 3TK5A 4AOQA 4AX9H 1DXWA 1LHCH 2EI8A 4FUHA 1IQEA 5EODA 1CGHA 1FY8E 3E0PB 5HYOA 1HJAB 3ATLA 4MVNA 1GMHF 1ZPBA 2Y5GA 2ZFFH 1SGEE 2PHBA 1QQ4A 3AW0A 1O5EH 4CR5A 4AFZA 3KNXA 1HJAC 1H9IE 1YPKH 1AWFH 3P17H 1EQ9A 3ZZ4A 4BOHA 2W26A 1T8NA 3MNCA 4ESTE 3SI4H 1LTOA 1TA2A 3GY5A 1CGIE 3RP2A 1DLKB 3SORA 1EAUA 2VIVA 1ELVA 1SGNE 1VITF 1VR1H 1AWHB 1RTKA 1TOCB 2BD4A 3UY9A 2UWOA 1UJ1A 1GI8B 3QWCH 2NU3E 3SU1A 2AERH 1AHTH 1C5ZB 3R3GB 1AFEH 1HAGE 3I78A 4AG1A 4Y10E 1QRZA 3A8AA 4ISHH 2GTBA 1V2UT 3ESTA 3S9CA 2P3TB 3VB7A 1IQJA 1PPZA 1N6YA 3A8DA 1SQTA 1CA0B 1QCPA 1A5HA 2QIQA 1BTUA 1P8VC 2R9PA 1UVOA 3T29A 4KTCA 1ZSKA 2PUXB 3RXPA 1DVAH 5CMXH 1UVSH 2PW8H 1SOTA 3PLKA 2BQ6B 2OINA 3NPSA 1G3BA 1CA0C 2UUYA 5TCAA 3A7WA 4HI3A 2R3YA 7LPRA 5FCKA 2F9PA 2WPMS 2PKAB 2J38A 1O2NA 2V3HH 3M7UA 2Y81A 3PROA 4WMDA 2OUAA 1XUGA 2BDCA 1VITH 3BEFB 4BAMB 4O3TA 5BPEA 2F9BH 3MU4A 1FUJA 1PYTC 4TWWA 1XMNB 1IQIA 3TNSA 2FX6A 1GI4A 1MTNB 3BTTE 1QL8A 6ESTA 1CVWH 3MU0A 1NU9A 1O2TA 2G81E 4I33A 5C67A 1ABIH 4DY7B 6GCHG 3PWCA 1IQLA 1RS0A 2AMQA 3FP6E 1O32A 1XUJA 5A0BA 1O3EA 5DP3A 4YT6H 3M37A 1HV7A 4NSYA 4B2CA 3F68H 3FZZA 3M3SA 3ZYDA 1SGIB 1SGRE 3Q77A 5LPRA 2BDBA 1Y5BT 1HIAA 5DP9A 3U1JB 1C1OA 4Q7XA 3JZ1B 2A7HA 1TAWA 1FY4A 3RXSA 2HRVA 1KDQA 2B7DH 4H6TA 1BMLA 1OX1A 1O2ZA 2WPKS 1GDNA 2FLRH 5C1XA 4FUCA 1HAXB 5ESTE 3BTHE 2ULLA 3ZZCA 4GLYA 1XUHA 1XXFA 1Z8IB 2QV1A 4Y0YE 3TVJB 1TMTH 1C4Y2 7GCHF 1YPJH 1UTKA 1ZJKA 2C4FH 1T7CA 3KF2A 5K7RA 4OS1A 1PQ8A 3SV2H 1GCDA 1GI0A 1KTTB 2BD5A 1BTZA 4DVAU 3LONA 1C2EA 1V2NT 1BBRE 3UREA 1EZSC 3CS7A 3K9XB 5A2MH 1OWHA 1PQAA 1ANBA 2NU1E 4DGJA 1O3AA 3ZV8A 2HGTH 1QA0A 5IYTA 1YLDA 3UQVA 1F5RA 1UTMA 1QNJA 1W10U 2VGCB 2WPJS 3FANA 5EQRA 3Q76A 1YCPM 1ZYOA 1O2JA 2TGTA 1E38B 1KXFA 1VGCB 1KXAA 4UE7H 3RXAA 2ODYB 2VIOA 4ISNA 4Z0KA 1N8OC 3SUGA 3C27B 2JH5D 2WPHS 4WVPE 1W3CA 1ZJDA 4YO9A 1JIMA 1SFQB 4AYVB 1TWXB 2UUKB 3RMNH 1ZTJA 3GCHC 3BTME 4I7YH 1QB1A 3SNBA 3RXCA 2PKSC 2WYGA 1SHYA 1KXEA 4X1SU 2FI3E 4INLA 2FOCA 5CHAB 5T6GA 3SJIA 1L4DA 2BVXH 3NK8A 4AFQA 2BQ7B 4D9RA 1OWDA 5JPMH 1FPCH 3A87A 2CMYA 4I8GA 2NU4E 4M7GA 4MQAA 1NS3A 3ZZ5A 5C1YA 3MTYA 1XUFA 1RJXB 2JKHA 3B8JA 3DFLA 3FVFB 1C2JA 1F0UA 1F5LA 1Y3UA 4ISLA 5GJ4B 1F92A 3PLPA 1HB0B 1O34A 1QTFA 1AQ7A 1TNJA 4CR9A 1O3DA 1UK3A 2BDAA 4B74A 1GI2A 1WBGB 2QXJA 1WV7H 3SJKA 1H9LB 1NPMA 3E0NB 4ZH8A 2VVVA 2GKVE 2BLVA 2C8ZB 1ANEA 1ZMLA 1F5KU 1S84A 1V2MT 1YPMH 2PLXA 2H6MA 1G32B 1FPHH 1T8MA 4UDWH 1D3TB 1U6QA 1D3DB 2M5TA 5A0CA 3RXUA 2DUCA 1CU1A 3GOVB 1QHRB 1GI5A 4NCYA 1SLXB 1O2UA 1AFQB 3MWIU 4DIIH 3LGIA 3QUMP 1O2SA 5AHGH 3SUEA 1GHBG 1QQUA 1AUTC 4K60A 4KTSA 1QURH 4NFFA 4ZKOU 4BNRA 3RXIA 4BTUB 2CJIA 1TBZH 1TNIA 2BLOA 1UHBA 1AFQC 4Y8XA 1PQ7A 1V2OT 2Z9JA 3TJVA 1O3HA 5DKMA 2XCFA 1ZPZA 2GDEH 2F9UA 4TPYA 2H9EH 3NCLA 1C2MA 3ODFA 4BXWA 2B0FA 1GJ7B 2Y80A 5EXMA 5FPYA 1C1UH 3U98H 3I29A 4JYUH 1MKXH 1KTSB 1ETTH 1G2MA 2R3UA 4I32A 1C2GA 4X1NU 3EA8A 4KTUA 4AFSA 2BD8A 2AGIX 2BLQA 1SGPE 4X1QU 2HNTF 3D62A 1Y5UT 2ZPQA 2QGRA 1FAXA 4UD9H 2BD7A 1VJ9U 4ZKNU 3OY6U 2GCTB 3LGTA 1OPHB 2ZHEH 1QGFA 4J2YB 3BF6H 2FYRA 4ZKSU 1S85A 4DJZB 1O2QA 4E05H 2EI7A 4Q80A 1K1NA 5DPAA 3A83A 2WPLS 3TK6A 3EE0B 3U9AH 3QK1A 4LXBH 3MYWA 1K1IA 1Y3VA 3E3TA 1EATA 1MKWK 2GV7A 5EXNA 3TJOA 1TOMH 1SHHB 4X2XA 2FODA 2G51A 4E7NA 2QN5T 2R2WU 2FOGA 3LT3A 1YKTA 4THNH 2KAIA 2D8WA 1MBMA 5C5OA 3SGBE 1AU8A 2P8OC 1ETSH 3AASA 1UVTH 1RRKA 3U1IB 1P06A 2LNCA 1ANCA 1AD8H 2XNIA 1MU6B 1GDUA 2XWBI 3NWUA 1BMNH 4MNVA 5E0HA 1BB0B 1MH0A 1G3DA 2RDLA 3ODDA 1LHGH 2TGPZ 3H5CB 1L1NA 1DX5M 3HKIB 4KP0A 1GJAB 4FXGH 4IW4E 2FS9A 2XWAA 1O30A 3M5LA 1A3EH 1SGTA 1GBEA 2XXLA 2VWNA 3UQOA 2F9NA 3FAOA 2Z3DA 3RMOH 1A0JA 1A2CH 3MO9A 3LKWA 4XSKU 2HWLB 3BTEE 3Q3KA 1YYY1 3ZZBA 4ABGA 2R2MB 4RSPA 2Y82A 5SGAE 3RMLH 2Z6BD 1D3QB 1C5MD 1GJ6A 1MAYA 2ZGHA 4MPVA 4AB9A 5I25A 3BSQA 3MHWU 2GT8A 5DO4H 1DUAA 1QJ1B 2Q1JA 4IMQA 1Y3WA 2A5AA 3BTGE 3H7TA 2BDYA 1RFNA 2FOMB 1EAXA 1QR3E 1GI1A 4TY6A 2A5KA 1C1PA 4MDSA 4VGCC 5AF9H 1H8IH 3PO1C 3ZZ8A 1L0ZA 1C2KA 2PGQB 7KMEH 1FI8A 1T8LA 3SU6A 1NU7B 1OXGA 1TPOA 1C5OH 3SQHE 4WY3A 3LIWA 2QF0A 5L6NH 4D9QA 5GCHG 1G3CA 4ZHLU 3MU8A 2JH0D 5EU8A 4B2AA 4DT7B 5JYIA 5TJXA 3QLPH 1WUNH 1J8AA 1DPOA 1C5NH 2ZHDA 2BY6X 1LHEH 1W7GH 3P8FA 1C1VH 4TYDA 4YLUA 1V2KT 1P10A 3RXOA 1BRCE 1V2WT 3PM3A 4ASHA 1TONA 3FZDA 2STAE 1MBQA 1NRQH 3T2NA 1YF4A 1BIOA 4ABBA 4AG2A 3A7VA 2F3CE 4DURA 1WYKA 2GDDA 4Z6AH 1ELCA 2G4TA 1GDQA 3RM0H 1SC8U 1GHBF 1GBJA 1SGFA 3ZVEA 6CHAC 1E35B 4YOIA 2ZPRA 1K9OE 1SL3A 1O2GH 4ISIH 1GG6C 1DWEH 3A7ZA 2Z9IA 1P2KA 2FOFA 2H5CA 1DITH 1QJ6B 1TA6A 2BQWB 1DE7H 2SGPE 2ZU3A 3MH5A 1GMCG 2CGAA 3A85A 2ZU5A 1GVLA 4INHA 2GZ7A 3TGKE 4IC5A 1OS8A 1V2JT 4HTCH 1DT2A 2R0LA 1HDTH 3DHKH 2ZGBH 3T5FH 2BOKA 2JH6D 1GGDC 2A32A 1WQVH 8KME2 1XXDA 2O8TA 1TMBH 4NZLA 4WMFA 5HM2A 2SGEE 1PPGE 4TY7A 3SNCA 2A4QA 3QDZB 1B0FA 1HAIH 1YPLH 1GJCB 2PWXA 1W0ZU 1NROH 1C2DA 1S81A 2HNTE 5FXLA 3A7YA 1P2IA 2BDHA 1C5SA 4Y8ZA 2PSYA 2HNTC 4BAOB 3URCA 1MCTA 3PTBA 2ZTXA 1EZXC 3A84A 1IQHA 2GX4A 1FAKH 1INCA 4ABAA 1AO5A 2TIOA 5A8XA 2BXUH 2XBXA 1FY3A 3HGPA 5C20A 3NUMA 4ZXXH 1GI7B 1TRMA 1WAYB 3M5OA 1O3LA 2BD3A 1D6RA 4E7RG 8LPRA 2SNVA 3SI3H 3CP7A 1OKXA 3LJOA 1NRPH 1YP9A 2G55A 1E0FD 1K2I1 5GPIB 1BJUA 1GJBB 2SFAA 1TYNA 3FP7E 4KGAA 3D49H 3GDSA 2GMTB 3KQEA 1FMGA 2BXTH 4R0IA 1C1RA 3UR9A 1E37B 4SGAE 4D76A 1UVPA 1FONA 4D7GA 1ZRKA 1Z1JA 4FVDA 2BYAX 2GMTC 1T8OA 3F9HA 5DK1A 1TQ7B 4NGAH 1V2QT 3LGUA 3RC6A 2PKAA 4K3JA 3RU4T 1GI9B 1MTVA 3RMMH 4XBDA 1BT7A 1CA8B 1O5CB 1ZHRA 4E06H 5B6OA 1GPZA 2XBWA 4R8TB 5HXFA 4FUFA 5JBTA 2H2ZA 4UFGH 2H1UA 4ZMAH 1LQDB 1W14U 2ZDVH 4NWLA 1O36A 2BVSH 1O3IA 1NESE 4AGJA 3OTJE 1GBHA 2FYQA 1GI3A 1BITA 3P8NA 1FZZA 5GCHF 2CHAB 2D2DA 2PTCE 1EAWA 2SGFE 5EG4A 3EA9A 1Z7KA 4CRAA 5JB8S 2OC7A 1KLJH 2I6SA 4JZEH 3VB5A 3GY6A 3HKJB 4X6PA 2CHAC 1S82A 4XBCA 2P3UB 5AFZH 3RXQA 1JXPA 2P16A 3TNTA 4MPWA 1EP6A 2OCVB 4LK4A 3ZZDA 3KGPA 1KY9A 1EASA 4ABJA 1MQ5A 2Z7FE 2RA3A 1TNGA 2FX4A 1P05A 2BTCE 2XC4A 2V35A 1SLUB 1VCQA 1N6XA 1HGTH 2CXVA 2SGDE 4UFDH 1Y59T 1YGCH 1SMFE 2AIQA 1WCZA 3B9FH 4WWYA 4MLFB 4I8LA 4WH6A 3MO6A 3ZVDA 1O3KA 3BTQE 4H4FA 4MNYA 1ELGA 1XM1A 2O8LA 3ZZ9A 1BTWA 2STBE 3K6ZA 4O3UA 2AEIH 4MTBA 2VIDA 2XW9A 1O3OA 4A5TS 4CHAB 1O39A 2ZF0H 1MTNC 4K69A 4DOQA 1LKBA 1O2YA 1CGJE 1ID5H 3NXPA 3SGAE 4X6OA 1HAYB 1HCGA 1GMCF 3VXFH 4CHAC 1TX7A 2ZO3H 3RXEA 4KKDA 2J4IA 1KSNA 1V2ST 1S5SA 1VCWA 5FBIA 1OSSA 2IOTA 1G37A 1YBWA 2A5IA 3V13A 2B8OH 3DFJA 5F8ZA 3UUZA 2XTTB 1SGQE 1EAIA 3BN9A 5C5NA 4LZ1H 2ZQ1A 1ACBE 1LHDH 3S9AA 3SU0A 2PSXA 3SU2A 2G00A 2ZQ2A 1PPFE 2J9NA 3C1KA 3UOPA 2VWMA 3V12A 3TK9A 4MNWA 1ANDA 4OS6A 2OLGA 2CV3A 2G5VA 1BTYA 1C4U2 2YOLA 2VWLA 4O9VA 1NRRH 1UTQA 1S0RA 4XE4A 1GHAG 2TBSA 4CRGA 3RM2H 1DM4B 1BRAA 2GCHG 4UONA 4CH8B 1CSOE 3KQDA 1DSUA 2O9QA 1RTFB 1J16A 1T4VH 1PPBH 3UTUH 2YNBA 5PTPA 4CBNA 2Z94A 1NY22 3EQ0H 4A1VA 3SGQE 2PGBB 1HAZB 3T26A 4U01A 1HFDA 1J17T 1S0QA 3MU5A 4GSOA 2QA9E 2VGCC 1NRNH 1TALA 2ZCLP 2QC2A 1EZUC 1FY1A 1VGCC 1YCPK 1JBUH 3JZ2B 3QTOH 1DXPA 2BOHB 1VZQH 3S69A 3S0NA 1K1LA 3VXEH 3GY2A 1FN8A 2VINA 2C8XB 5DP8A 2A2XH 2VWOA 3IWMA 2P3FH 1O2XA 1P11E 2ZFQH 5E2PA 1DY8A 1CT4E 5I46H 2FO9A 1C5PA 4NZQA 3BEIB 1O31A 3W94A 1A0HB 4AZ2B 4CRDA 4H42U 2ZFSA 1ZHPA 1ZHMA 4ISOA 8GCHG 4QT8C 2CF9H 1D3PB 2BY7X 1VCPA 5CHAC 3T27A 2TGDA 2W7UA 1GL0E 2OC8A 1HAVB 1O2KA 1MTWA 2RG3A 5FHTA 2ZTZA 1SOZA 1Y3YA 1FXYA 3SU5A 1WSSH 1MKWH 3LH3A 1ESAA 2UUJB 2QF3A 1UK4A 1EZQA 3DA9B 3AAVA 1GBCA 5DGJA 3TH2H 1UTJA 1BTXA 4I8HA 2Y5FA 3AAUA 1QFKH 1P03A 5E0GA 2J2UA 4K8YA 1FNIA 3T25A 2DE8A 3LDXH 1C5YB 1UTLM 2ZECA 2R0KA 1O3GA 1Z6JH 2B5TB 4WH8A 2ZKSA 5JBBS 1O2RA 4Y11E 3UOUA 2EC9H 5EPYA 4B75A 1MTSA 1UCYK 4XOJA 2ZP0H 3ATMA 1AB9B 1ETRH 1MD8A 3QO6A 2FTMA 5H4IB 1W8BH 1GBKA 5E0JA 1YM0A 3RU4D 2WYJA 1GBTA 3KCGH 3M7QA 1W7XH 3DT0H 4FUGA 2VIQA 2ZNKH 1AB9C 2F9OA 3PB1E 2IPHA 4WF8A 1XUKA 1Z6EA 1D9IA 2SGAA 1SFIA 1AZZA 1GMDG 1OWIA 2WUBA 1YLCA 2PTNA 3MMGA 4BAQB 3A7XA 1J15A 5GXPA 1SGYE 3UPEA 1C5LH 4A6LA 5A0AE 4IN1A 2K1QA 2ZCHP 1AE5A 3ENSB 3UR6A 3VB4A 1V2LT 1QBNA 5EGMA 1ARBA 6GCHF 1A5GH 2HPQH 4LZ4B 2VVUA 2P59A 2AGEX 1O5AB 2OTVA 3OU0A 3URDA 1NC6A 3MFJA 1SSXA 3UNSA 1BQYA 1IQMA 1MAXA 2NU0E 4ABIA 3RLWH 1PPEE 5LPEA 1LPKB 1ZZZA 4Y79A 1QB6A 1SBWA 2W5EA 1BTHH 1UCYE 1AZ8A 3VB6A 1ZSLA 3LH1A 1B5GH 1FJSA 1Y8TA 1J9CH 1RIWB 3RXTA 2BY8X 5F6MA 2VIWA 4FUJA 2GCTC 3BG8A 2V6NA 2EA3A 4NIXA 3GY4A 1RIWC 2V3OH 3LU9B 1DSTA 1CE5A 2ASUB 2C8YB 4X6NA 3N7OA 4UFEH 3M61U 2A4RA 2ZDKA 3F9EA 3NZIA 1P9UA 1P02A 5HMAA 3SJOA 1Z8GA 3Q00A 1O2VA 4X8SH 3UWIA 1GI6A 1GHXH 4ZHMU 4WXVA 1GHAF 1BCUH 3T62A 1QL9A 2NWNA 2GCHF 3SW2B 4GHQA 1PYTD 2H9HA 4DCDA 1MD7A 3A8BA 4JYVH 1GBFA 1EJAA 1GBDA 1WOFA 3P8OA 2D1JA 3DD2H 1A61H 2ANWA 3HPTB 1BZXE 5J4QA 2OQ5A 2FZZA 2F83A 2GVFA 1V2TT 2BM2A 4WMEA 1P2JA 4GUXA 1EX3A 3RXHA 5FAHA 1TFXA 4HFPB 2FI5E 3QN7A 3LC3A 4I8KA 4MNXA 3PWBA 1ZOMA 2AYWA 3BV9B 4SGBE 3PLBA 1GCTB 2ODPA 1MU8B 4JZDH 4U32A 1F0SA 2AMDA 4PROA 1SQOA 4GPGA 4GHTA 2A1DB 3TGJE 3UIRA 1GCTC 3MNXA 3E6PH 4Y8YA 3ZVAA 2OD3B 4F4OC 1GJ9B 3P6ZB 2A7JA 1DUEA 3SV6A 2WV5A 1ELTA 1C2FA 1A0LA 1UMAH 1MCVA 4JK5A 1DICA 2BY5X 5FX6A 1BMAA 2ILNA 1NZQH 1ZLRA 3PYHA 2NU2E 1V2RT 4INKA 8GCHF 1AN1E 1AGJA 1G36A 1HXFH 2FMJA 3M3TA 3Q3XA 3AW1A 3SJ8A 1C5QA 1O5GH 2ODQA 1LDTT 1ZR0A 3GY8A 1TMUH 2HPPH 3TU7H 1M9UA 1H9HE 4ZUHA 1O2OA 2ZI2H 2P93A 4IC6A 1HAOH 2QXGA 1TGTA 1G3EA 1AI8H 1G2LA 1KLIH 1AE8H 1O37A 3MO3A 4NIVA 5HM9A 4A1TA 1QL7A 1CQQA 3RXDA 3RXGA 3SO3A 3GISB 1GL1A 2OC1A 1C1SA 3O8RA 4B1TA 1LVOA 2AGGX 3EGKH 4B76A 2ZDLA 1TBQH 4X0WU 1O2HA 4DG4A 1QRXA 5K0HA 5DJ7A 2BVRH 2BZAA 3SHCH 2BX4A 4NWKA 4JZIA 5A09A 1HRTH 4K2YA 4MPXA 5F03A 2TPIZ 1GBIA 1N1LA 4ZKRU 4J1YA 1Z1IA 1P2OA 2XBVA 3K2UA 4ABHA 1GMDF 1TBRH 1OWEA 4FU9A 1NFUA 3RXLA 2Q6GA 1O3FA 2Y6TA 2ZDNA 2BB4A 1VJAU 1Q31A 2HVXA 4NA7A 3GY3A 8ESTE 2W7SA 1K22H 2HALA 3ZZ7A 3V7TA 1FIWA 1W12U 1C5WB 3ZZ6A 3SV7A 2QXHA 4FUBA 1CHOG 1GBAA 1HBTH 4ZHAA 1DOJA 1A46H 2OBOA 3RXBA 3S7HB 1JRTA 4CRBA 3UNQA 1YPEH 5AFYH 1ZGVA 1LVMA 1XX9A 3QZQA 3G01A 2ZHQH 1BDAA 1IHSH 4CH2B 3A80A 3SV8A 3QGJA 5C3NA 5F8XA 2ZTYA 1MZAA 1O2PA 2PV9B 1C1TA 3M5MA 1HJ8A 3QTVH 1C5VA 1C1MA 4AORA 3M36A 5GIBA 4Q2KA 4AB8A 4X2WA 1BRBE 1DFPA 4A1XA 2XC0A 3ZVFA 1F7ZA 2BY9X 2FWWA 2VH0A 5GDSH 2AS9A 3ZVCA 5LPFA 3PMHB 1OYTH 1AIXH 2ZFTA 2JETB 1MZDA 5FBEA 4ABEA 3SZNA 3MI4A 3RXMA 1T31A 1JIRA 4B73A 2PUQH 4X8TH 1P2QA 4UEHH 3SJ9A 5BRRE 2V0BA 2VB0A 2LPRA 1G9IE 1P09A 3TJNA 1O3PB 3PV4A 1THSH 3D23A 5JBAS 1ORFA 2C3SA 1GHWH 2J94A 1AKSB 1C5TA 3E8LA 2C8WB 1DY9A 4JCNA 4A7IB 1FY5A 1QB9A 3LJJA 3F9FA 4X8VH 3MOCA 4AFUA 4TWYA 1LVYA 1C9TA 1Q2WA 1L2EA 4CBOA 3GCTG 3LGYA 3RU4E 1GBBA 1C1WH 1HJ9A 1SGDE 2ZU4A 1W13U 2ZIQH 3ATWA 1HNEE 2GD4B 1TGCA 3BTWE 4GCHG 1SLVB 2FOAA 4CRCA 1EJMA 4XBBA 1ZRBA 3LGWA 1QY6A 1KLTA 1SGCA 3M3VA 1DS2E 1CO7E 2ALVA 4FUEA 5EPNA 4XFQA 4ZAEA 1GVZA 5ESBA 5DG6A 1P57B 2Z9KA 3HATH 4OGXA 1SQAA 2FOHA 1KXBA 4AGKA 1TGSZ 1Z71A 4X6MA 1SLWB 2ZU2A 1TX6A 1HAPH 3VB3A 2Q6FA 2XYAA 1D6WA 3BTDE 1NT1A 1UVUH 4MPUA 1EPTB 3H7OA 1A5IA 1TPPA 1AMHA 1CT0E 2WINI 4IS5A 4K5ZA 1P04A 1TPSA 1H8DH 3A8CA 2GZ8A 1EPTC 1O2IA 2Y5HA 1O5DH 1UTPA 2XRCA 3O8DA 3KIDU 3MH6A 3GYMA 1FLEE 1TNKA 5ETXA 4OS7A 3Q3YA 4YOGA 1THRH 3EDXB 2SGQE 4K1SA 1YCPH 3VEQB 1O33A 9LPRA 1Y3XA 1OYQA 2A4GA 1FV9A 1ZSJA 1LPZB 2VIPA 3QGNB 1C2HA 4UFFH 3V0XA 3NKKA 1TNHA 1V6DA 4YTAA 3TGIE 3SUFA 1EJNA 3RXVA 1GJDB 1O2LA 4AN7A 3CENA 2VVCA 5C1UA 2ZC9H 2BMGB 2ZCKP 1TNLA 2OP9A 2VJ1A 1A4WH 1EOJA 1HYLA 2HOBA 2J95A 4IMZA 1JWTA 2FOBA 1EP5A 4CREA 1AUJA 1F2SE 1K1PA 1T4UH 2WPIS 2Z9GA 3L33A 1BBRK 1WQSA 1CHOF 1BA8B 1C9PA 4NIYA 1KYNA 1EB1H 3ATKA 4X1PU 3LC5A 4JK6A 3BTKE 3I77A 2QAAA 2F91A 1KIGH 1HLTH 1Z8RA 4NA9H 1ZPCA 3SU4A 2CF8H 1K1MA 3WY8A 1SR5C 1LMWB 3KQBA 1PPHE 2ESTE 1SGFG 4Y0ZE 3U8TH 4BAKB 4X8UH 2A45B 3L3TA 2Q6DA 5FPTA 2ZU1A 1IAUA 1UCYH 1THPB 2W3KA 4Y71A 1HAVA 1P3EA 3RDZA 2WV4A 3GCNA 4K8BA 2FDAA 5A8YA 4YT7H 1GHYH 1C5XB 2UUFB 1ELDE 3QZRA 1S6HA 3A86A 1Q3XA 3GDVA 1BMMH 2Y7ZA 3UFAA 5CE1A 3S9BA 1NN6A 2F9VA 4FVBA 1G30B 2VNTA 2RA0A 3STJA 1TGNA 3PTNA 4F49A 2QY0B 1BUIA 5IDKA 4LOYH 4Y6DA 3A7TA 2AMPA 4O97A 2SNWA 1GJ5H 1N8OB 1CT2E 3TH3H 1B0EA 2BX3A 2TGAA 3F1SB 1MUEB 4AYYB 4XDEA 2VH6A 2Z3CA 2A31A 3ZVBA 4BAHB 1HIAB 3P92A 3GCHB 3GCTF 4ZROA 2GT7A 3LGVA 1P3CA 4FUIA 2BDIA 3TPIZ 1C2IA 2CN0H 1KDQB 2PKSB 1IQGA 5L2YH 2FPZA 1BHXF 1K1OA 1NTPA 4X2VA 4GCHF 1S6FA 1O35A 1GBLA 2J92A 1O3CA 3OX7U 1PFXC 3UWJH 1O3BA 4YZUA 9ESTA 3O8CA 2ZHFH 4OS5A 4GVUA 1C4V2 1LKAA 1P2NA 1HAHH 5EW2H 4OS4A 1DWDH 4X2YA 3OYPA 2ZGJA 1B7XB 1IOEA 3A81A 3PMBB 3MH7A 1OP2A 3EAJA 1HUTH 3U8OH 2P94A 1EKBB 6LPRA 2G5NA 1A3BH 2Z3EA 3RXJA 2UWLA 3PMAB 4ZXYH 1NFWA 1FIZA 1K28D 3RUOA 3P95A 1GHVH 1S83A 4MG3A 2QCYA 2A0QB 3ZV9A 1UTOA 1C5RA 3T28A 4NSVA 4NA8A 1OWKA 3VPKA 1CHGA 3A89A 2D26C 2G4UA 1WTGH 5ABWA 2HLCA 5FX5A 1RTLA 4K1EA 2O8MA 1EOLA 1ESTA 3P70B 3FFGA 3BTFE 5L30H 5FCRA 4HGCA 1CBWB 5DP6A 1V2PT 2FESH 3EA7A 1IQFA 3M35A 4IN2A 1TRYA 2B9LA 1CBWC 1JRSA 1W2KH 7ESTE 2ZGXH 3OY5U 2OC0A 1DANH 3ELAH 1LHFH 1P0SH 3LOXA 1LCYA 3S7KB 1XVMA 3B23B 1W0YH 3KQCA 3SHAH 2BD9A 2ZFPH 1SG8B 3BIUH 3M7TA 2OBQA 3STIA 4DW2U 2H9TH 4GAWA 5LGOA 2GP9B 3K65B 3IG6B 3SUDA 1A1RA 5AVDA 2XC5A 1E36B 2UWPA 5C2ZA 4H6SB 1YPGH 3W95A 1GJ4H 1GBMA 1ZGIA 5TCCA 5JDUB 4YESB 3SV9A 1TX8A 3MNSA 4FUDA 4NG9H 1TABE 1BTPA 2FLBH 2FIRH 1O0DH 3SNDA 4JYTA 3ZVGA 4CRFA 1HPGA 1IQNA 1ELFA 3KHVA 1K1JA 3AVZA 3DUXH 4BTIB 3SNAA 1DDJA 5FPSA 2I6QA 3VGCB 1QBOA 1DWBH 1IHTH 1PPCE 1PJPA 1QRWA 1SPJA 2P8OB 3SQEE 2EI6A 1V2VT 1UHBB 1MQ6A 3E16B 3OSYA 4WJG2 3VGCC 1NO9H 3GICB 3SU3A 1QBVH 4JZ1A 4D7FA 4KELA 2AIPA 1O3MA 2OQUA 2QYIA 5EQSA 2IN2A 3A88A 2A4OA 1XKBC 1WU1A 4FU8A 2ZA5A 4Y7AA 3E90B 4D8NA 3ZYEA 1FDPA 1MMJN 2O8WA 1OWJA 5HGGA 4B2BA 4BXSA 1OP0A 4IGDA 3D65E 2ZDAH 1TE0A 2TRMA 3PMJA 4X1RU 2BDGA 1QIXB 3O8BA 4HZHA 4JMYA 3BG4B 3U8RH 3FP8E 1OP8A 3A82A 4A92A 4BANB 4ABFA 3BEUA 4WXIA 3P8GA 4I8JA 5T3HA 3BG4C 1F0TA 2FTLE 3IITA 4I31A 1W11U 2BLWA 4RN6A 3ZZAA 3E1XB 3RC5A 2ALPA 3L6PA 3TITA 2GV6A 2G8TA 1GMHG 3TH4H 3RC4A 4YLQH 2AH4X 1TRNA 1XVOA 2QXIA 1SI5H 1L1JA 4Y76A 1ELBA 1AVGH 2DE9A 3ITIA 2J34A 1C5UA 2FEQH 1LO6A 1XUIA 1TPAE 1C2LA 4VGCB 5F8TA 5A8ZA 3HK6B 4RKOB 3GYLB 1SVPA 3PO1B 1BHXB 1P9SA 3LPRA 4OGYA 4Q7ZA 2GZ9A 2KAIB 2OXSA 2ZEBA 1MKXK 4TPIZ 3TIUA 2GGVB 3RXKA 4DIHH 1O5FH 1VITG 1EUFA 2H5DA 2A2QH 1L4ZA 1LPGB 4IBLH 5JB9S 3QX5H 1O5BB 3HGNA 1J14A 2ANYA 2Z9LA 4BTTB 1RGQA 1TIOA 2FP7B 1QA7A 3GY7A 4OS2A 2ZFRH 1ZTKA 4FU7A 2XCNA 5GWZA 1E34B 1PQ5A 3SBKA 3SNEA 1V3XA 5EQQA 2BHGA 3SN8A 1EXFA 1L1GA 3RLYH 3TJUA 1LQEA 2AFQB 5DP5A 1T32A 2C93B 1K21H 2RCEA 3RXFA 1NRSH 3KN2A 4NFEA 1P2MA 1ARCA 1P12E 2ZHWH 1O2WA 2ANKH 1ZTLA 3KL6A 4O03A 1HXEH 1O2MA 1RXPA 2G52A 1A7SA 6CHAB 2ZPSA 1ABJH 2BD2A 4U2WA 1GJ8B 3MNBA 2ZZUH 1O3JA 1TB6H 4Q7YA 3KEEA 2P95A 3F9GA 2EEKA 1GG6B 2PR3A 3M5NA 1UK2A 2XBYA 1ESBA 1KXDA 1X7AC 1KXCA 1BOQA 3GCOA 1NFYA 1BRUP 1IQKA 4RKJB 1UO6A 1AKSA 1TQ0B 1YPHE 5LH8A 2ZWLH 1SB1H 1ELEE 2FI4E 2ZG0H 3F6UH 3RXRA 3BIVH 5T6FA 3GDUA 4ABDA 1GGDB 1YPHC 1TGBA 1F0RA 4JZFH 3ZZ3A 3UNRA 2C90B 2ZDMA 3E91A 5EXLA 1WTHD 5E2OA 3U69H 2VU8E 1XKAC 4YOJA 1O38A 1P01A 2A7CA 5T6DA 1H1BA 4YM9A 1GVKB 3SOSA 2FOEA 5E8EH 1MTUA 1ZMNA 2YNAA 3CS0A 3EYDA 1Z8JB 1ELAA 5DP7A 3R0FA 1LVBA
chains in the Genus database with same CATH superfamily
1BJVA 1C1NA 1JOUB 1DLEA 1AVXA 5HIYA 7GCHG 1TLDA 4Y7BA 2FM2A 1H4WA 5EW1H 3K6YA 3MH4A 5G4BA 1QJ7B 4B71A 2IPQX 2JETC 1EB2A 1JMOH 2IJOB 4RT0A 1UTNA 3F2FA 2PFEA 1GWAA 5J4SA 2WSSD 4U30A 1OOKB 2ZGCA 5JBCS 2THFB 1EPTA 1D4PB 4K1TA 2JIZD 1NFXA 1DWCH 3ATIA 1Y5AT 2ANMH 2Y7XA 5EOKA 1RD3B 4NIWA 1YC0A 5L2ZH 2WUCA 1NM6A 1AVWA 1AY6H 1C1QA 3V3MA 2FXRA 1GHZA 1ZMJA 3N7EA 1FN6A 1BBRH 5DP4A 3TLOA 1O3NA 2BZ6H 1FQ3A 2O8UA 3VFEA 2W3IA 2FS8A 3HK3B 3MU1A 3TK5A 4AOQA 4AX9H 1DXWA 1LHCH 2EI8A 2PP6A 4FUHA 1IQEA 5EODA 1CGHA 1FY8E 3E0PB 5HYOA 1HJAB 3ATLA 4MVNA 1GMHF 1ZPBA 2Y5GA 2ZFFH 1SGEE 2PHBA 1QQ4A 3AW0A 1O5EH 4CR5A 4AFZA 3KNXA 1HJAC 1H9IE 1YPKH 1AWFH 3P17H 1EQ9A 3ZZ4A 4BOHA 2W26A 1T8NA 3MNCA 3SYJA 4ESTE 3SI4H 1LTOA 1TA2A 3GY5A 1CGIE 3RP2A 1DLKB 3SORA 1EAUA 2VIVA 1ELVA 1SGNE 1VITF 1VR1H 1AWHB 1RTKA 1TOCB 2BD4A 3OTPA 3UY9A 2UWOA 1UJ1A 1GI8B 3QWCH 2NU3E 3SU1A 2AERH 1AHTH 1C5ZB 3R3GB 1AFEH 1HAGE 3I78A 4AG1A 4Y10E 1QRZA 3A8AA 4ISHH 2GTBA 1V2UT 3ESTA 4I86A 3S9CA 2P3TB 3VB7A 3OE7D 1IQJA 1PPZA 1N6YA 3A8DA 1SQTA 1CA0B 1QCPA 1A5HA 2QIQA 1BTUA 1P8VC 2R9PA 1UVOA 3T29A 4KTCA 1ZSKA 2PUXB 3RXPA 1DVAH 5CMXH 1UVSH 2PW8H 1SOTA 3PLKA 2BQ6B 2OINA 3NPSA 1G3BA 1CA0C 2UUYA 5TCAA 3A7WA 4HI3A 2R3YA 7LPRA 5FCKA 2F9PA 2YMSB 2WPMS 2PKAB 2J38A 1O2NA 2V3HH 3M7UA 2Y81A 3PROA 4WMDA 2OUAA 1XUGA 2BDCA 1VITH 3BEFB 4BAMB 4O3TA 2YMSC 5BPEA 2F9BH 3MU4A 1FUJA 1PYTC 4TWWA 1XMNB 1IQIA 3TNSA 2FX6A 1GI4A 1MTNB 3BTTE 1QL8A 6ESTA 1CVWH 3MU0A 1NU9A 5C17A 1O2TA 2G81E 4I33A 5C67A 1ABIH 4DY7B 6GCHG 3PWCA 1IQLA 1RS0A 2AMQA 3PRBA 3FP6E 1O32A 1XUJA 5A0BA 1O3EA 5DP3A 4YT6H 3M37A 1HV7A 4NSYA 4B2CA 3F68H 3FZZA 3M3SA 3ZYDA 1SGIB 1SGRE 3Q77A 5LPRA 2BDBA 1Y5BT 1HIAA 5DP9A 3U1JB 3OAAD 1C1OA 4Q7XA 3JZ1B 2A7HA 1TAWA 1FY4A 3RXSA 2HRVA 1KDQA 2B7DH 4H6TA 1BMLA 1OX1A 1O2ZA 3DSOA 2WPKS 1GDNA 2FLRH 5C1XA 4FUCA 2KCPA 1HAXB 5CHBA 5ESTE 3BTHE 2ULLA 3ZZCA 4GLYA 1XUHA 1XXFA 1Z8IB 2QV1A 4Y0YE 3TVJB 1TMTH 1C4Y2 7GCHF 1YPJH 1UTKA 1ZJKA 2C4FH 1T7CA 3KF2A 5K7RA 4OS1A 1PQ8A 3SV2H 1GCDA 1GI0A 1KTTB 2BD5A 1BTZA 4DVAU 3LONA 1C2EA 1V2NT 1BBRE 3UREA 1EZSC 3CS7A 3K9XB 1H8HD 5A2MH 1OWHA 1PQAA 1ANBA 2NU1E 4DGJA 1O3AA 3ZV8A 2HGTH 1QA0A 5IYTA 1YLDA 3UQVA 1F5RA 1UTMA 1QNJA 1W10U 2VGCB 2WPJS 3FANA 5EQRA 3Q76A 1YCPM 1ZYOA 1O2JA 2TGTA 1E38B 1KXFA 1VGCB 1KXAA 4UE7H 3RXAA 2ODYB 2VIOA 4ISNA 4Z0KA 1N8OC 3FOAA 3SUGA 3C27B 2JH5D 2WPHS 4WVPE 1W3CA 1ZJDA 4YO9A 1JIMA 1SFQB 4AYVB 1TWXB 2UUKB 3RMNH 1ZTJA 2XNDD 3GCHC 3BTME 4I7YH 1QB1A 3SNBA 3RXCA 2PKSC 2WYGA 1SHYA 1KXEA 2J98B 4X1SU 2FI3E 4INLA 2FOCA 5CHAB 5T6GA 3SJIA 1L4DA 2BVXH 3NK8A 4AFQA 2BQ7B 4D9RA 1OWDA 5JPMH 1FPCH 3A87A 2CMYA 4I8GA 2NU4E 4M7GA 4MQAA 1NS3A 3ZZ5A 5C1YA 3MTYA 1XUFA 1RJXB 2JKHA 3B8JA 3DFLA 3FVFB 1C2JA 1F0UA 1F5LA 1Y3UA 4ISLA 5KGOA 5GJ4B 1F92A 3PLPA 1HB0B 1O34A 1QTFA 1AQ7A 1TNJA 1QZ8A 4CR9A 1O3DA 1UK3A 2BDAA 2J97A 4B74A 1GI2A 1WBGB 2QXJA 1WV7H 3SJKA 1H9LB 1NPMA 2WHXA 3E0NB 4ZH8A 2VVVA 2GKVE 2BLVA 2C8ZB 3KYFA 1ANEA 1ZMLA 4TT3D 1F5KU 1S84A 1V2MT 1YPMH 2PLXA 2H6MA 1G32B 1FPHH 1T8MA 4UDWH 1D3TB 1U6QA 1D3DB 2M5TA 5A0CA 3RXUA 2DUCA 1CU1A 3GOVB 1QHRB 1GI5A 4NCYA 1SLXB 1O2UA 1AFQB 3MWIU 4DIIH 3LGIA 3QUMP 1O2SA 5AHGH 3SUEA 1GHBG 1QQUA 1AUTC 4K60A 4KTSA 1QURH 4NFFA 4ZKOU 4BNRA 3RXIA 4BTUB 2CJIA 1TBZH 1TNIA 2BLOA 1UHBA 1AFQC 4Y8XA 2IJD1 1PQ7A 1V2OT 2Z9JA 3TJVA 1O3HA 5DKMA 2XCFA 1ZPZA 2GDEH 2F9UA 4TPYA 2H9EH 3NCLA 1C2MA 3ODFA 4BXWA 2B0FA 1GJ7B 4AC9A 2Y80A 5EXMA 5FPYA 1C1UH 3U98H 3I29A 2J5UA 4JYUH 1MKXH 1KTSB 1ETTH 1G2MA 2R3UA 4I32A 1C2GA 4X1NU 3EA8A 4KTUA 4AFSA 2BD8A 2AGIX 2BLQA 1SGPE 4X1QU 2HNTF 3D62A 1Y5UT 2ZPQA 2QGRA 1FAXA 4UD9H 2BD7A 1VJ9U 4ZKNU 3OY6U 2GCTB 3LGTA 1OPHB 2ZHEH 1QGFA 4J2YB 3BF6H 2FYRA 4ZKSU 1S85A 4DJZB 1O2QA 4E05H 2EI7A 4Q80A 1K1NA 5DPAA 3A83A 2KCYA 2WPLS 3TK6A 3EE0B 3U9AH 3QK1A 4LXBH 3MYWA 1K1IA 1Y3VA 3E3TA 1EATA 1MKWK 2GV7A 5EXNA 3TJOA 4Z1MD 5HKKD 1TOMH 2QF5A 1SHHB 4X2XA 2FODA 2G51A 4E7NA 2QN5T 2R2WU 2FOGA 3LT3A 1YKTA 4THNH 2KAIA 2D8WA 1MBMA 5C5OA 3SGBE 1AU8A 2P8OC 1ETSH 3AASA 3DSGA 1UVTH 1RRKA 3U1IB 1P06A 2LNCA 1ANCA 4F55A 1AD8H 2XNIA 1MU6B 1GDUA 2XWBI 3NWUA 4B6FA 1BMNH 4MNVA 5E0HA 1BB0B 2AHME 1MH0A 1G3DA 2RDLA 3ODDA 1LHGH 2TGPZ 3H5CB 1L1NA 1DX5M 3HKIB 4KP0A 1GJAB 4FXGH 4IW4E 2FS9A 2XWAA 1O30A 3M5LA 1A3EH 1SGTA 1GBEA 2XXLA 2VWNA 3UQOA 2F9NA 3FAOA 2Z3DA 3RMOH 1A0JA 1A2CH 2LP6A 3MO9A 3LKWA 4XSKU 2HWLB 3BTEE 3Q3KA 1YYY1 3ZZBA 4ABGA 2R2MB 4RSPA 2Y82A 5SGAE 3RMLH 2Z6BD 1D3QB 1C5MD 1GJ6A 1MAYA 2ZGHA 4MPVA 4AB9A 5I25A 3BSQA 3MHWU 2GT8A 5DO4H 1DUAA 1QJ1B 2Q1JA 4IMQA 1Y3WA 2A5AA 4DT4A 2CK3D 3BTGE 3H7TA 2BDYA 1RFNA 2FOMB 1EAXA 1QR3E 1GI1A 4TY6A 2A5KA 1C1PA 4MDSA 4VGCC 5AF9H 1YY3A 1H8IH 3PO1C 3ZZ8A 1L0ZA 1C2KA 2PGQB 7KMEH 1FI8A 1T8LA 3SU6A 1NU7B 1OXGA 1TPOA 1C5OH 3SQHE 4WY3A 3LIWA 2QF0A 5L6NH 4D9QA 5GCHG 1G3CA 4HG6A 4ZHLU 3MU8A 2JH0D 5EU8A 4B2AA 4DT7B 5JYIA 5TJXA 3QLPH 1WUNH 1J8AA 1DPOA 1C5NH 2ZHDA 2BY6X 4Q63A 1LHEH 1W7GH 3P8FA 1C1VH 4TYDA 4YLUA 1V2KT 1P10A 3RXOA 1BRCE 1V2WT 3PM3A 4ASHA 1TONA 3FZDA 2STAE 1MBQA 1NRQH 3T2NA 1YF4A 1BIOA 4ABBA 4AG2A 3A7VA 2F3CE 4DURA 1WYKA 2GDDA 3FO8D 4Z6AH 1ELCA 2G4TA 1GDQA 3RM0H 1SC8U 1GHBF 1GBJA 1SGFA 3ZVEA 6CHAC 1E35B 4YOIA 2ZPRA 1K9OE 1SL3A 1O2GH 4ISIH 1GG6C 1DWEH 3A7ZA 2Z9IA 1P2KA 2FOFA 2H5CA 1DITH 1QJ6B 3OFND 3WWFA 1TA6A 2BQWB 1DE7H 2SGPE 2ZU3A 3MH5A 1GMCG 2CGAA 3A85A 2JDID 2ZU5A 1GVLA 4INHA 2GZ7A 3TGKE 5DSFA 4IC5A 5C0UA 1OS8A 1V2JT 4HTCH 1DT2A 2R0LA 1HDTH 3DHKH 2ZGBH 3T5FH 2BOKA 2JH6D 1GGDC 2A32A 1WQVH 8KME2 1XXDA 2O8TA 1TMBH 2F43B 4NZLA 4WMFA 5HM2A 2SGEE 1PPGE 4TY7A 3SNCA 2A4QA 3QDZB 1B0FA 1HAIH 1YPLH 1GJCB 2PWXA 1W0ZU 1NROH 1C2DA 1S81A 2HNTE 5FXLA 3A7YA 1P2IA 2BDHA 3WWBA 3U28C 1C5SA 4Y8ZA 2PSYA 2HNTC 1COWD 4BAOB 3URCA 1MCTA 3N7DA 3PTBA 2ZTXA 1EZXC 3A84A 1IQHA 2GX4A 1FAKH 1INCA 4ABAA 1AO5A 2TIOA 5A8XA 2BXUH 2XBXA 1FY3A 3HGPA 5C20A 3NUMA 4ZXXH 1GI7B 1TRMA 1WAYB 3M5OA 1O3LA 2BD3A 1D6RA 4E7RG 8LPRA 2SNVA 3SI3H 3CP7A 1OKXA 3LJOA 1NRPH 1YP9A 2RDEA 2G55A 1E0FD 1K2I1 5GPIB 1BJUA 1GJBB 2SFAA 1TYNA 3FP7E 4KGAA 3D49H 3GDSA 1BMFD 2GMTB 3KQEA 1FMGA 2BXTH 4R0IA 1C1RA 3UR9A 1E37B 4SGAE 4D76A 1UVPA 1FONA 4D7GA 1ZRKA 4P00A 1Z1JA 4FVDA 2BYAX 2GMTC 1T8OA 3F9HA 5DK1A 1TQ7B 4NGAH 1V2QT 3LGUA 3RC6A 2PKAA 4K3JA 3RU4T 1GI9B 1MTVA 3RMMH 4XBDA 1BT7A 1CA8B 1O5CB 1ZHRA 4E06H 5B6OA 1GPZA 2XBWA 4R8TB 5HXFA 4FUFA 5JBTA 2H2ZA 4UFGH 2H1UA 4ZMAH 1LQDB 1W14U 2ZDVH 4NWLA 1O36A 2BVSH 1O3IA 4ASUD 2W6ID 1NESE 1MABB 5C94A 5GNDA 4AGJA 3DCLA 3OTJE 1GBHA 2FYQA 1GI3A 1BITA 3P8NA 1FZZA 5GCHF 2CHAB 2D2DA 2PTCE 1EAWA 2SGFE 5EG4A 3EA9A 1Z7KA 4CRAA 4F48B 5JB8S 2OC7A 1KLJH 2I6SA 4JZEH 3SZEA 3VB5A 3GY6A 3HKJB 4X6PA 2CHAC 1WDIA 1S82A 4XBCA 2P3UB 5AFZH 4TSFD 3RXQA 1JXPA 2P16A 3TNTA 4MPWA 1EP6A 2OCVB 4LK4A 3ZZDA 3KGPA 1KY9A 1EASA 4ABJA 1MQ5A 2Z7FE 2RA3A 1TNGA 2FX4A 1P05A 2BTCE 2XC4A 2V35A 3FN8A 1SLUB 1VCQA 1N6XA 1HGTH 2CXVA 2SGDE 4UFDH 1Y59T 1YGCH 1SMFE 2AIQA 1WCZA 3B9FH 4WWYA 4MLFB 3ZIAD 4I8LA 4WH6A 3MO6A 3ZVDA 1O3KA 3BTQE 4H4FA 4MNYA 1ELGA 1XM1A 2O8LA 3ZZ9A 1BTWA 2STBE 3K6ZA 4O3UA 2KCOA 2AEIH 4MTBA 2VIDA 2XW9A 1O3OA 4A5TS 4CHAB 1O39A 2ZF0H 1MTNC 4K69A 4DOQA 4RI0A 1LKBA 1O2YA 1CGJE 1ID5H 3NXPA 1W0KD 3SGAE 4X6OA 1HAYB 1HCGA 3UB0A 1GMCF 3VXFH 4CHAC 1TX7A 2ZO3H 3RXEA 4KKDA 2J4IA 1KSNA 1V2ST 1S5SA 1VCWA 1NBMD 5FBIA 1OSSA 1EFRD 2IOTA 1G37A 1YBWA 2A5IA 3V13A 2B8OH 3DFJA 5F8ZA 3UUZA 2XTTB 1SGQE 1EAIA 4FOUC 3BN9A 5C5NA 4LZ1H 3DSPA 2ZQ1A 1ACBE 1LHDH 4P02A 3S9AA 3SU0A 2PSXA 3SU2A 2G00A 2ZQ2A 2J9NA 1PPFE 3C1KA 2J98A 3UOPA 2VWMA 3V12A 2KFWA 3TK9A 4MNWA 1ANDA 1S6LA 4OS6A 2OLGA 2CV3A 2G5VA 1BTYA 1C4U2 2YOLA 2VWLA 4O9VA 1NRRH 1UTQA 1S0RA 4XE4A 1GHAG 2TBSA 4RT1A 4CRGA 3RM2H 1DM4B 1BRAA 2GCHG 4UONA 4CH8B 1CSOE 3KQDA 1DSUA 2O9QA 1RTFB 1J16A 1T4VH 1PPBH 3UTUH 2YNBA 5PTPA 4CBNA 2Z94A 1NY22 3EQ0H 4A1VA 3SGQE 2PGBB 1HAZB 3T26A 4U01A 1HFDA 1SKYE 1J17T 1S0QA 3MU5A 4GSOA 2QA9E 2VGCC 1NRNH 3N99A 1TALA 2ZCLP 3FKSD 2QC2A 1EZUC 1FY1A 1VGCC 1YCPK 1JBUH 3JZ2B 3QTOH 1DXPA 2BOHB 1VZQH 3S69A 3S0NA 1K1LA 3VXEH 3GY2A 1FN8A 2VINA 2F4LA 2C8XB 5DP8A 2A2XH 2VWOA 3IWMA 2P3FH 1O2XA 1P11E 2ZFQH 5E2PA 1DY8A 1CT4E 5I46H 2FO9A 1C5PA 4NZQA 3BEIB 1O31A 3W94A 1A0HB 4AZ2B 4CRDA 4H42U 2ZFSA 1ZHPA 1ZHMA 4ISOA 8GCHG 4QT8C 2CF9H 1D3PB 2BY7X 1VCPA 5CHAC 3T27A 2TGDA 2W7UA 3WW7A 1GL0E 2OC8A 1HAVB 1O2KA 1MTWA 2RG3A 5FHTA 2ZTZA 1SOZA 1Y3YA 1UW7A 1FXYA 3SU5A 1WSSH 1MKWH 3LH3A 1ESAA 2UUJB 2QF3A 1UK4A 1EZQA 3DA9B 3AAVA 1GBCA 5DGJA 3TH2H 1UTJA 1BTXA 1H8ED 4I8HA 2Y5FA 1E79D 3AAUA 1QFKH 1P03A 5E0GA 2J2UA 4K8YA 1FNIA 3T25A 2DE8A 3LDXH 1C5YB 1UTLM 2ZECA 2R0KA 1O3GA 1Z6JH 2B5TB 4WH8A 2ZKSA 5JBBS 3F2GA 1O2RA 4Y11E 3UOUA 2EC9H 5EPYA 4B75A 1MTSA 4XD7D 1UCYK 4XOJA 2ZP0H 3ATMA 1AB9B 1ETRH 1MD8A 3QO6A 2FTMA 5H4IB 1W8BH 1GBKA 5E0JA 1YM0A 3NRLA 3RU4D 2WYJA 1GBTA 3KCGH 3M7QA 1W7XH 3DT0H 4FUGA 2VIQA 2ZNKH 1AB9C 2F9OA 3PB1E 2IPHA 4WF8A 1XUKA 1Z6EA 1D9IA 2SGAA 1SFIA 1AZZA 1GMDG 1OWIA 2WUBA 1YLCA 2PTNA 3MMGA 4BAQB 3A7XA 5C0TA 1J15A 4FETA 5GXPA 1SGYE 3UPEA 1C5LH 4A6LA 5A0AE 4IN1A 2K1QA 2ZCHP 1AE5A 3ENSB 3UR6A 3VB4A 1V2LT 1QBNA 5EGMA 1ARBA 6GCHF 1A5GH 2HPQH 4LZ4B 2VVUA 2P59A 2AGEX 1O5AB 2OTVA 3OU0A 3URDA 1NC6A 3MFJA 1SSXA 3UNSA 1BQYA 1IQMA 4B6EA 1MAXA 2NU0E 4ABIA 3RLWH 1PPEE 5LPEA 1LPKB 1ZZZA 4Y79A 1QB6A 1SBWA 3UAIC 2W5EA 1BTHH 2EQNA 1UCYE 1AZ8A 3VB6A 1ZSLA 3LH1A 1B5GH 1FJSA 1Y8TA 1J9CH 1RIWB 3RXTA 2BY8X 5F6MA 2VIWA 4FUJA 2GCTC 3BG8A 2V6NA 2QE7D 2EA3A 3PV5A 4NIXA 3GY4A 1RIWC 2V3OH 3LU9B 1DSTA 1CE5A 2ASUB 2KCAA 2C8YB 4X6NA 3N7OA 4UFEH 3M61U 2A4RA 2ZDKA 3F9EA 3NZIA 1P9UA 1P02A 5HMAA 3F0PA 3SJOA 1Z8GA 3Q00A 1O2VA 4X8SH 3UWIA 1GI6A 1GHXH 4ZHMU 4WXVA 1GHAF 1BCUH 3T62A 1QL9A 2NWNA 2YMSD 2GCHF 3SW2B 4GHQA 1PYTD 2H9HA 4DCDA 1MD7A 3A8BA 4JYVH 2V7QD 1GBFA 1EJAA 1GBDA 1WOFA 3P8OA 2D1JA 3DD2H 1A61H 2ANWA 3HPTB 1BZXE 5J4QA 2OQ5A 2FZZA 2F83A 2GVFA 1V2TT 2BM2A 4WMEA 1P2JA 4GUXA 1EX3A 3RXHA 5FAHA 1TFXA 4HFPB 2FI5E 3QN7A 3LC3A 4I8KA 4YXWD 4MNXA 3PWBA 1ZOMA 2AYWA 3BV9B 4SGBE 2W6JD 3PLBA 1GCTB 2ODPA 1MU8B 2KM0A 4JZDH 4U32A 1F0SA 2AMDA 4PROA 1SQOA 4GPGA 4GHTA 2A1DB 3TGJE 2K0QA 3UIRA 1GCTC 3MNXA 3E6PH 4Y8YA 3ZVAA 2OD3B 4F4OC 1GJ9B 3P6ZB 2A7JA 1DUEA 3SV6A 2WV5A 1ELTA 1C2FA 1A0LA 1UMAH 1MCVA 4JK5A 1DICA 3MQKC 2BY5X 5FX6A 2QF4A 3F2HA 1BMAA 2ILNA 1NZQH 1ZLRA 3PYHA 2NU2E 1V2RT 4INKA 8GCHF 1AN1E 1AGJA 1G36A 1HXFH 2FMJA 3M3TA 3Q3XA 3AW1A 3SJ8A 1C5QA 1O5GH 2ODQA 1LDTT 1ZR0A 3GY8A 1TMUH 2HPPH 3TU7H 1M9UA 2KZ4A 1H9HE 4ZUHA 1O2OA 2ZI2H 2P93A 4IC6A 1HAOH 2QXGA 1TGTA 3GS9A 1G3EA 1K0HA 1AI8H 1G2LA 1KLIH 1AE8H 1O37A 3MO3A 4NIVA 4OM9A 5HM9A 4A1TA 1QL7A 1CQQA 3RXDA 3RXGA 3SO3A 3GISB 1GL1A 2OC1A 1C1SA 2XOKD 1NBME 2KR7A 3O8RA 4B1TA 1LVOA 2AGGX 3EGKH 4B76A 2ZDLA 1TBQH 4X0WU 1O2HA 1YWUA 4DG4A 1QRXA 5K0HA 3CNRA 3VG8A 5DJ7A 2BVRH 2BZAA 3SHCH 2BX4A 4NWKA 4JZIA 5A09A 1HRTH 4K2YA 4MPXA 5F03A 2TPIZ 1GBIA 1N1LA 4ZKRU 4J1YA 1Z1IA 1P2OA 2XBVA 3K2UA 4ABHA 1GMDF 1TBRH 1OWEA 4FU9A 1NFUA 3RXLA 2Q6GA 1O3FA 2Y6TA 1YLNA 2ZDNA 2BB4A 1VJAU 1Q31A 2HVXA 3PV2A 4NA7A 3GY3A 8ESTE 2W7SA 1K22H 1SQRA 2HALA 3ZZ7A 3V7TA 1FIWA 1W12U 1C5WB 3ZZ6A 3SV7A 2QXHA 4FUBA 1CHOG 1GBAA 1HBTH 4ZHAA 1DOJA 1A46H 2OBOA 3RXBA 3S7HB 1JRTA 4CRBA 3UNQA 1YPEH 5AFYH 1ZGVA 1LVMA 1XX9A 3AK5A 3QZQA 3G01A 2ZHQH 1BDAA 1IHSH 4CH2B 3A80A 3SV8A 3QGJA 5C3NA 5F8XA 2ZTYA 1MZAA 1O2PA 2PV9B 1C1TA 3M5MA 2VBCA 1HJ8A 3QTVH 1C5VA 1C1MA 4AORA 3M36A 5GIBA 4Q2KA 4AB8A 4X2WA 1BRBE 5B6LA 1DFPA 4A1XA 2XC0A 3ZVFA 1F7ZA 2BY9X 2FWWA 2VH0A 5GDSH 2AS9A 3ZVCA 5LPFA 3PMHB 1OYTH 1AIXH 2ZFTA 5FL7D 2JETB 1MZDA 5FBEA 4ABEA 3SZNA 3MI4A 3RXMA 1T31A 1JIRA 4B73A 2PUQH 4X8TH 1P2QA 4UEHH 3SJ9A 5BRRE 2V0BA 2VB0A 2LPRA 1G9IE 1P09A 3TJNA 1O3PB 3PV4A 2LELA 1THSH 3D23A 5JBAS 1ORFA 2C3SA 1GHWH 2J94A 1AKSB 1C5TA 1FX0B 3E8LA 2C8WB 3H09A 1DY9A 4JCNA 4A7IB 1FY5A 1QB9A 3LJJA 3F9FA 4X8VH 3MOCA 4AFUA 4TWYA 1LVYA 1C9TA 1Q2WA 1L2EA 4CBOA 3GCTG 3LGYA 3RU4E 1GBBA 1C1WH 1HJ9A 1SGDE 2ZU4A 1W13U 2ZIQH 3ATWA 1HNEE 2GD4B 1OHHD 1TGCA 3BTWE 4GCHG 1SLVB 2FOAA 4CRCA 1EJMA 4XBBA 1ZRBA 3LGWA 1QY6A 5DN6D 1KLTA 1SGCA 3M3VA 1DS2E 1CO7E 2ALVA 4FUEA 5EPNA 4XFQA 4ZAEA 5CDFE 1GVZA 5ESBA 5DG6A 1P57B 2Z9KA 3HATH 4OGXA 1SQAA 2FOHA 1KXBA 4AGKA 1TGSZ 1Z71A 4X6MA 1SLWB 2ZU2A 1TX6A 1HAPH 3VB3A 2Q6FA 2XYAA 1D6WA 3BTDE 2L74A 1NT1A 1UVUH 4MPUA 1EPTB 3H7OA 1A5IA 5IK2D 1TPPA 1AMHA 1CT0E 2WINI 4IS5A 4K5ZA 1P04A 1TPSA 1H8DH 3A8CA 2GZ8A 1EPTC 1O2IA 2Y5HA 1O5DH 1UTPA 2XRCA 3O8DA 1E1RD 3KIDU 5KECA 3MH6A 3GYMA 1FLEE 1TNKA 5ETXA 4OS7A 3Q3YA 4YOGA 1THRH 3EDXB 2SGQE 4K1SA 1YCPH 3VEQB 1O33A 9LPRA 1Y3XA 1OYQA 2A4GA 1FV9A 1ZSJA 1LPZB 2VIPA 3QGNB 1VKYA 1C2HA 4UFFH 3V0XA 3NKKA 1TNHA 1V6DA 4YTAA 3TGIE 3SUFA 1EJNA 3RXVA 1GJDB 1O2LA 4AN7A 3CENA 2VVCA 5C1UA 2EY4C 2ZC9H 2BMGB 2ZCKP 1TNLA 2OP9A 2VJ1A 1A4WH 1EOJA 1HYLA 2HOBA 2J95A 4IMZA 1JWTA 2FOBA 1EP5A 4CREA 1AUJA 1F2SE 1K1PA 1T4UH 2WPIS 2Z9GA 3L33A 1BBRK 1WQSA 1CHOF 1BA8B 1C9PA 4NIYA 1KYNA 1EB1H 2L6OA 3ATKA 4X1PU 3LC5A 4JK6A 3BTKE 3I77A 2QAAA 2F91A 1KIGH 1HLTH 1Z8RA 4NA9H 1ZPCA 3SU4A 2CF8H 1K1MA 3WY8A 1SR5C 1LMWB 3KQBA 1PPHE 3OEED 2ESTE 1SGFG 4Y0ZE 3U8TH 1W0JD 4BAKB 4X8UH 2A45B 3L3TA 2Q6DA 5FPTA 2ZU1A 1IAUA 1UCYH 1THPB 2W3KA 4Y71A 1HAVA 1P3EA 3RDZA 2WV4A 3GCNA 4K8BA 2FDAA 5A8YA 4YT7H 1GHYH 1C5XB 2UUFB 1ELDE 3QZRA 4Q4LA 1S6HA 3A86A 1Q3XA 3GDVA 1BMMH 2Y7ZA 3UFAA 5CE1A 3S9BA 1NN6A 2F9VA 4FVBA 1G30B 2VNTA 2RA0A 3STJA 1TGNA 2K8IA 3PTNA 4F49A 2QY0B 1BUIA 2KX4A 5IDKA 4LOYH 4Y6DA 3A7TA 2AMPA 4O97A 2SNWA 1GJ5H 1N8OB 1CT2E 3TH3H 1B0EA 2BX3A 2TGAA 3F1SB 1MUEB 4AYYB 4XDEA 2VH6A 2Z3CA 2A31A 3ZVBA 4BAHB 1HIAB 3P92A 3GCHB 2OK5A 3GCTF 4ZROA 2HVYB 2GT7A 4ZCNA 3LGVA 1P3CA 4FUIA 2BDIA 3TPIZ 1C2IA 2CN0H 1KDQB 2PKSB 1IQGA 2HLDD 5L2YH 2FPZA 2V3MA 1BHXF 1K1OA 1NTPA 4X2VA 4GCHF 1S6FA 1O35A 1GBLA 2J92A 1O3CA 3OX7U 1PFXC 3UWJH 5EJ1A 1O3BA 4YZUA 9ESTA 3O8CA 2ZHFH 4OS5A 4GVUA 1C4V2 1LKAA 1P2NA 1HAHH 5EW2H 4OS4A 1DWDH 4X2YA 3OYPA 2ZGJA 1B7XB 1IOEA 3A81A 3PMBB 3MH7A 1OP2A 3EAJA 1HUTH 3U8OH 2P94A 1EKBB 6LPRA 2G5NA 1A3BH 2Z3EA 3RXJA 2UWLA 3PMAB 4ZXYH 1NFWA 1FIZA 1K28D 3RUOA 3P95A 1GHVH 1S83A 4MG3A 2QCYA 2A0QB 3ZV9A 1UTOA 1C5RA 3T28A 4NSVA 4NA8A 1OWKA 2WZQA 3VPKA 1CHGA 3A89A 2D26C 2G4UA 1WTGH 3W1EA 5ABWA 2HLCA 5FX5A 1RTLA 4K1EA 2O8MA 1EOLA 1ESTA 3P70B 3FFGA 3BTFE 5L30H 5FCRA 4HGCA 1CBWB 5DP6A 1V2PT 2FESH 3EA7A 1IQFA 3M35A 4IN2A 1TRYA 2B9LA 1CBWC 1JRSA 1W2KH 7ESTE 2ZGXH 3OY5U 2OC0A 1DANH 3ELAH 1LHFH 1P0SH 3LOXA 1LCYA 3S7KB 5KEDA 1XVMA 3B23B 1W0YH 3KQCA 3SHAH 2BD9A 2ZFPH 1SG8B 3BIUH 3M7TA 2OBQA 3STIA 4DW2U 2H9TH 4GAWA 5T1VA 5LGOA 2GP9B 3K65B 3IG6B 3SUDA 4ACAA 1A1RA 3F0OA 5AVDA 2M2AA 2XC5A 1E36B 2UWPA 5C2ZA 5F53A 4H6SB 1YPGH 3W95A 1GJ4H 1WXRA 1GBMA 1ZGIA 5TCCA 5JDUB 4YESB 3SV9A 1TX8A 3MNSA 4FUDA 4NG9H 1TABE 1BTPA 3OEHD 2FLBH 2FIRH 3F3BA 1O0DH 3SNDA 4JYTA 3ZVGA 2JJ2D 4CRFA 1HPGA 1IQNA 1ELFA 3KHVA 1K1JA 3AVZA 3DUXH 4BTIB 3SNAA 1DDJA 5FPSA 2I6QA 3VGCB 1QBOA 1DWBH 1IHTH 1PPCE 5EJLA 1PJPA 1QRWA 1SPJA 2P8OB 3SQEE 2EI6A 1V2VT 1UHBB 1MQ6A 3E16B 3OSYA 4WJG2 3VGCC 1NO9H 3GICB 3SU3A 1QBVH 4JZ1A 5EIYA 4D7FA 4KELA 2AIPA 1O3MA 2OQUA 2QYIA 5EQSA 2IN2A 3A88A 2A4OA 1KMHB 1XKBC 1WU1A 4FU8A 2ZA5A 4Y7AA 3E90B 4D8NA 3ZYEA 1FDPA 1MMJN 2O8WA 1OWJA 5HGGA 4B2BA 4BXSA 1OP0A 4IGDA 3D65E 2ZDAH 1TE0A 2TRMA 3PMJA 4X1RU 2BDGA 1QIXB 3O8BA 4HZHA 5HIZA 4JMYA 3BG4B 3U8RH 3FP8E 1OP8A 3A82A 4A92A 4BANB 4ABFA 3BEUA 4WXIA 3P8GA 4I8JA 5T3HA 3BG4C 1F0TA 2FTLE 3IITA 4I31A 1W11U 2BLWA 4RN6A 3ZZAA 3E1XB 3RC5A 2ALPA 3L6PA 3TITA 2GV6A 2G8TA 1GMHG 3TH4H 2GJGA 3RC4A 4YLQH 2AH4X 1TRNA 1XVOA 2QXIA 1SI5H 1L1JA 3KYGA 4Y76A 1ELBA 1AVGH 2DE9A 3ITIA 2J34A 1C5UA 2FEQH 1LO6A 1XUIA 1TPAE 1C2LA 4VGCB 5F8TA 5A8ZA 3HK6B 4RKOB 3GYLB 1SVPA 3PO1B 1BHXB 1P9SA 3LPRA 4OGYA 4Q7ZA 2GZ9A 2KAIB 2OXSA 2ZEBA 1MKXK 4XRNA 4TPIZ 3TIUA 2GGVB 3RXKA 4DIHH 1O5FH 1VITG 1EUFA 2H5DA 2A2QH 1L4ZA 1LPGB 4IBLH 5JB9S 3QX5H 1O5BB 3HGNA 1J14A 2ANYA 2Z9LA 4BTTB 3EE7A 1RGQA 1TIOA 2FP7B 1QA7A 2RFKC 3GY7A 4OS2A 2ZFRH 1ZTKA 4FU7A 2XCNA 5GWZA 1E34B 1PQ5A 3KQ5A 3SBKA 3SNEA 1V3XA 5EQQA 2BHGA 3SN8A 1EXFA 1L1GA 2WV9A 3RLYH 3TJUA 1LQEA 2AFQB 5DP5A 1T32A 2C93B 1K21H 2RCEA 3RXFA 1NRSH 3KN2A 4NFEA 1P2MA 1ARCA 1P12E 2ZHWH 1O2WA 2ANKH 1ZTLA 3KL6A 4O03A 2JJ1D 1HXEH 1O2MA 1RXPA 2G52A 1A7SA 6CHAB 2ZPSA 1ABJH 2BD2A 4U2WA 1GJ8B 3MNBA 2ZZUH 1O3JA 1TB6H 4Q7YA 3KEEA 2P95A 3F9GA 2EEKA 1GG6B 2PR3A 3M5NA 1UK2A 2XBYA 2WPDD 1ESBA 1KXDA 1X7AC 1KXCA 1BOQA 3GCOA 3PRDA 1NFYA 1BRUP 1IQKA 4RKJB 1UO6A 4M9FA 1E1QD 1AKSA 1TQ0B 1YPHE 5LH8A 5EJZA 2ZWLH 1SB1H 1ELEE 2FI4E 2ZG0H 3F6UH 3RXRA 3BIVH 5T6FA 3GDUA 4ACBA 4ABDA 1GGDB 1YPHC 1TGBA 1F0RA 4JZFH 3ZZ3A 3UNRA 2C90B 2ZDMA 3E91A 5EXLA 1WTHD 5E2OA 3U69H 2VU8E 1XKAC 4YOJA 1O38A 1P01A 2A7CA 5T6DA 1H1BA 4YM9A 1GVKB 3SOSA 2FOEA 5E8EH 1MTUA 1ZMNA 2YNAA 3CS0A 3EYDA 1Z8JB 1ELAA 5DP7A 3R0FA 1LVBA
chains in the Genus database with same CATH topology
1BJVA 1C1NA 1JOUB 1DLEA 1AVXA 7GCHG 1TLDA 4Y7BA 2FM2A 1H4WA 5EW1H 3K6YA 3MH4A 5G4BA 1QJ7B 4B71A 2JETC 1EB2A 1JMOH 2IJOB 1UTNA 2PFEA 1GWAA 5J4SA 4U30A 1OOKB 2ZGCA 5JBCS 2THFB 1EPTA 1D4PB 4K1TA 1NFXA 1DWCH 3ATIA 1Y5AT 2ANMH 2Y7XA 5EOKA 1RD3B 4NIWA 1YC0A 5L2ZH 2WUCA 1NM6A 1AVWA 1AY6H 1C1QA 3V3MA 2FXRA 1GHZA 1ZMJA 1FN6A 1BBRH 5DP4A 3TLOA 1O3NA 2BZ6H 1FQ3A 2O8UA 3VFEA 2W3IA 2FS8A 3HK3B 3MU1A 3TK5A 4AOQA 4AX9H 1DXWA 1LHCH 2EI8A 4FUHA 1IQEA 5EODA 1CGHA 1FY8E 3E0PB 5HYOA 1HJAB 3ATLA 4MVNA 1GMHF 1ZPBA 2Y5GA 2ZFFH 1SGEE 2PHBA 1QQ4A 3AW0A 1O5EH 4CR5A 4AFZA 3KNXA 1HJAC 1H9IE 1YPKH 1AWFH 3P17H 1EQ9A 3ZZ4A 4BOHA 2W26A 1T8NA 3MNCA 4ESTE 3SI4H 1LTOA 1TA2A 3GY5A 1CGIE 3RP2A 1DLKB 3SORA 1EAUA 2VIVA 1ELVA 1SGNE 1VITF 1VR1H 1AWHB 1RTKA 1TOCB 2BD4A 3UY9A 2UWOA 1UJ1A 1GI8B 3QWCH 2NU3E 3SU1A 2AERH 1AHTH 1C5ZB 3R3GB 1AFEH 1HAGE 3I78A 4AG1A 4Y10E 1QRZA 3A8AA 4ISHH 2GTBA 1V2UT 3ESTA 3S9CA 2P3TB 3VB7A 1IQJA 1PPZA 1N6YA 3A8DA 1SQTA 1CA0B 1QCPA 1A5HA 2QIQA 1BTUA 1P8VC 2R9PA 1UVOA 3T29A 4KTCA 1ZSKA 2PUXB 3RXPA 1DVAH 5CMXH 1UVSH 2PW8H 1SOTA 3PLKA 2BQ6B 2OINA 3NPSA 1G3BA 1CA0C 2UUYA 5TCAA 3A7WA 4HI3A 2R3YA 7LPRA 5FCKA 2F9PA 2WPMS 2PKAB 2J38A 1O2NA 2V3HH 3M7UA 2Y81A 3PROA 4WMDA 2OUAA 1XUGA 2BDCA 1VITH 3BEFB 4BAMB 4O3TA 5BPEA 2F9BH 3MU4A 1FUJA 1PYTC 4TWWA 1XMNB 1IQIA 3TNSA 2FX6A 1GI4A 1MTNB 3BTTE 1QL8A 6ESTA 1CVWH 3MU0A 1NU9A 1O2TA 2G81E 4I33A 5C67A 1ABIH 4DY7B 6GCHG 3PWCA 1IQLA 1RS0A 2AMQA 3FP6E 1O32A 1XUJA 5A0BA 1O3EA 5DP3A 4YT6H 3M37A 1HV7A 4NSYA 4B2CA 3F68H 3FZZA 3M3SA 3ZYDA 1SGIB 1SGRE 3Q77A 5LPRA 2BDBA 1Y5BT 1HIAA 5DP9A 3U1JB 1C1OA 4Q7XA 3JZ1B 2A7HA 1TAWA 1FY4A 3RXSA 2HRVA 1KDQA 2B7DH 4H6TA 1BMLA 1OX1A 1O2ZA 2WPKS 1GDNA 2FLRH 5C1XA 4FUCA 1HAXB 5ESTE 3BTHE 2ULLA 3ZZCA 4GLYA 1XUHA 1XXFA 1Z8IB 2QV1A 4Y0YE 3TVJB 1TMTH 1C4Y2 7GCHF 1YPJH 1UTKA 1ZJKA 2C4FH 1T7CA 3KF2A 5K7RA 4OS1A 1PQ8A 3SV2H 1GCDA 1GI0A 1KTTB 2BD5A 1BTZA 4DVAU 3LONA 1C2EA 1V2NT 1BBRE 3UREA 1EZSC 3CS7A 3K9XB 5A2MH 1OWHA 1PQAA 1ANBA 2NU1E 4DGJA 1O3AA 3ZV8A 2HGTH 1QA0A 5IYTA 1YLDA 3UQVA 1F5RA 1UTMA 1QNJA 1W10U 2VGCB 2WPJS 3FANA 5EQRA 3Q76A 1YCPM 1ZYOA 1O2JA 2TGTA 1E38B 1KXFA 1VGCB 1KXAA 4UE7H 3RXAA 2ODYB 2VIOA 4ISNA 4Z0KA 1N8OC 3SUGA 3C27B 2JH5D 2WPHS 4WVPE 1W3CA 1ZJDA 4YO9A 1JIMA 1SFQB 4AYVB 1TWXB 2UUKB 3RMNH 1ZTJA 3GCHC 3BTME 4I7YH 1QB1A 3SNBA 3RXCA 2PKSC 2WYGA 1SHYA 1KXEA 4X1SU 2FI3E 4INLA 2FOCA 5CHAB 5T6GA 3SJIA 1L4DA 2BVXH 3NK8A 4AFQA 2BQ7B 4D9RA 1OWDA 5JPMH 1FPCH 3A87A 2CMYA 4I8GA 2NU4E 4M7GA 4MQAA 1NS3A 3ZZ5A 5C1YA 3MTYA 1XUFA 1RJXB 2JKHA 3B8JA 3DFLA 3FVFB 1C2JA 1F0UA 1F5LA 1Y3UA 4ISLA 5GJ4B 1F92A 3PLPA 1HB0B 1O34A 1QTFA 1AQ7A 1TNJA 4CR9A 1O3DA 1UK3A 2BDAA 4B74A 1GI2A 1WBGB 2QXJA 1WV7H 3SJKA 1H9LB 1NPMA 3E0NB 4ZH8A 2VVVA 2GKVE 2BLVA 2C8ZB 1ANEA 1ZMLA 1F5KU 1S84A 1V2MT 1YPMH 2PLXA 2H6MA 1G32B 1FPHH 1T8MA 4UDWH 1D3TB 1U6QA 1D3DB 2M5TA 5A0CA 3RXUA 2DUCA 1CU1A 3GOVB 1QHRB 1GI5A 4NCYA 1SLXB 1O2UA 1AFQB 3MWIU 4DIIH 3LGIA 3QUMP 1O2SA 5AHGH 3SUEA 1GHBG 1QQUA 1AUTC 4K60A 4KTSA 1QURH 4NFFA 4ZKOU 4BNRA 3RXIA 4BTUB 2CJIA 1TBZH 1TNIA 2BLOA 1UHBA 1AFQC 4Y8XA 1PQ7A 1V2OT 2Z9JA 3TJVA 1O3HA 5DKMA 2XCFA 1ZPZA 2GDEH 2F9UA 4TPYA 2H9EH 3NCLA 1C2MA 3ODFA 4BXWA 2B0FA 1GJ7B 2Y80A 5EXMA 5FPYA 1C1UH 3U98H 3I29A 4JYUH 1MKXH 1KTSB 1ETTH 1G2MA 2R3UA 4I32A 1C2GA 4X1NU 3EA8A 4KTUA 4AFSA 2BD8A 2AGIX 2BLQA 1SGPE 4X1QU 2HNTF 3D62A 1Y5UT 2ZPQA 2QGRA 1FAXA 4UD9H 2BD7A 1VJ9U 4ZKNU 3OY6U 2GCTB 3LGTA 1OPHB 2ZHEH 1QGFA 4J2YB 3BF6H 2FYRA 4ZKSU 1S85A 4DJZB 1O2QA 4E05H 2EI7A 4Q80A 1K1NA 5DPAA 3A83A 2WPLS 3TK6A 3EE0B 3U9AH 3QK1A 4LXBH 3MYWA 1K1IA 1Y3VA 3E3TA 1EATA 1MKWK 2GV7A 5EXNA 3TJOA 1TOMH 1SHHB 4X2XA 2FODA 2G51A 4E7NA 2QN5T 2R2WU 2FOGA 3LT3A 1YKTA 4THNH 2KAIA 2D8WA 1MBMA 5C5OA 3SGBE 1AU8A 2P8OC 1ETSH 3AASA 1UVTH 1RRKA 3U1IB 1P06A 2LNCA 1ANCA 1AD8H 2XNIA 1MU6B 1GDUA 2XWBI 3NWUA 1BMNH 4MNVA 5E0HA 1BB0B 1MH0A 1G3DA 2RDLA 3ODDA 1LHGH 2TGPZ 3H5CB 1L1NA 1DX5M 3HKIB 4KP0A 1GJAB 4FXGH 4IW4E 2FS9A 2XWAA 1O30A 3M5LA 1A3EH 1SGTA 1GBEA 2XXLA 2VWNA 3UQOA 2F9NA 3FAOA 2Z3DA 3RMOH 1A0JA 1A2CH 3MO9A 3LKWA 4XSKU 2HWLB 3BTEE 3Q3KA 1YYY1 3ZZBA 4ABGA 2R2MB 4RSPA 2Y82A 5SGAE 3RMLH 2Z6BD 1D3QB 1C5MD 1GJ6A 1MAYA 2ZGHA 4MPVA 4AB9A 5I25A 3BSQA 3MHWU 2GT8A 5DO4H 1DUAA 1QJ1B 2Q1JA 4IMQA 1Y3WA 2A5AA 3BTGE 3H7TA 2BDYA 1RFNA 2FOMB 1EAXA 1QR3E 1GI1A 4TY6A 2A5KA 1C1PA 4MDSA 4VGCC 5AF9H 1H8IH 3PO1C 3ZZ8A 1L0ZA 1C2KA 2PGQB 7KMEH 1FI8A 1T8LA 3SU6A 1NU7B 1OXGA 1TPOA 1C5OH 3SQHE 4WY3A 3LIWA 2QF0A 5L6NH 4D9QA 5GCHG 1G3CA 4ZHLU 3MU8A 2JH0D 5EU8A 4B2AA 4DT7B 5JYIA 5TJXA 3QLPH 1WUNH 1J8AA 1DPOA 1C5NH 2ZHDA 2BY6X 1LHEH 1W7GH 3P8FA 1C1VH 4TYDA 4YLUA 1V2KT 1P10A 3RXOA 1BRCE 1V2WT 3PM3A 4ASHA 1TONA 3FZDA 2STAE 1MBQA 1NRQH 3T2NA 1YF4A 1BIOA 4ABBA 4AG2A 3A7VA 2F3CE 4DURA 1WYKA 2GDDA 4Z6AH 1ELCA 2G4TA 1GDQA 3RM0H 1SC8U 1GHBF 1GBJA 1SGFA 3ZVEA 6CHAC 1E35B 4YOIA 2ZPRA 1K9OE 1SL3A 1O2GH 4ISIH 1GG6C 1DWEH 3A7ZA 2Z9IA 1P2KA 2FOFA 2H5CA 1DITH 1QJ6B 1TA6A 2BQWB 1DE7H 2SGPE 2ZU3A 3MH5A 1GMCG 2CGAA 3A85A 2ZU5A 1GVLA 4INHA 2GZ7A 3TGKE 4IC5A 1OS8A 1V2JT 4HTCH 1DT2A 2R0LA 1HDTH 3DHKH 2ZGBH 3T5FH 2BOKA 2JH6D 1GGDC 2A32A 1WQVH 8KME2 1XXDA 2O8TA 1TMBH 4NZLA 4WMFA 5HM2A 2SGEE 1PPGE 4TY7A 3SNCA 2A4QA 3QDZB 1B0FA 1HAIH 1YPLH 1GJCB 2PWXA 1W0ZU 1NROH 1C2DA 1S81A 2HNTE 5FXLA 3A7YA 1P2IA 2BDHA 1C5SA 4Y8ZA 2PSYA 2HNTC 4BAOB 3URCA 1MCTA 3PTBA 2ZTXA 1EZXC 3A84A 1IQHA 2GX4A 1FAKH 1INCA 4ABAA 1AO5A 2TIOA 5A8XA 2BXUH 2XBXA 1FY3A 3HGPA 5C20A 3NUMA 4ZXXH 1GI7B 1TRMA 1WAYB 3M5OA 1O3LA 2BD3A 1D6RA 4E7RG 8LPRA 2SNVA 3SI3H 3CP7A 1OKXA 3LJOA 1NRPH 1YP9A 2G55A 1E0FD 1K2I1 5GPIB 1BJUA 1GJBB 2SFAA 1TYNA 3FP7E 4KGAA 3D49H 3GDSA 2GMTB 3KQEA 1FMGA 2BXTH 4R0IA 1C1RA 3UR9A 1E37B 4SGAE 4D76A 1UVPA 1FONA 4D7GA 1ZRKA 1Z1JA 4FVDA 2BYAX 2GMTC 1T8OA 3F9HA 5DK1A 1TQ7B 4NGAH 1V2QT 3LGUA 3RC6A 2PKAA 4K3JA 3RU4T 1GI9B 1MTVA 3RMMH 4XBDA 1BT7A 1CA8B 1O5CB 1ZHRA 4E06H 5B6OA 1GPZA 2XBWA 4R8TB 5HXFA 4FUFA 5JBTA 2H2ZA 4UFGH 2H1UA 4ZMAH 1LQDB 1W14U 2ZDVH 4NWLA 1O36A 2BVSH 1O3IA 1NESE 4AGJA 3OTJE 1GBHA 2FYQA 1GI3A 1BITA 3P8NA 1FZZA 5GCHF 2CHAB 2D2DA 2PTCE 1EAWA 2SGFE 5EG4A 3EA9A 1Z7KA 4CRAA 5JB8S 2OC7A 1KLJH 2I6SA 4JZEH 3VB5A 3GY6A 3HKJB 4X6PA 2CHAC 1S82A 4XBCA 2P3UB 5AFZH 3RXQA 1JXPA 2P16A 3TNTA 4MPWA 1EP6A 2OCVB 4LK4A 3ZZDA 3KGPA 1KY9A 1EASA 4ABJA 1MQ5A 2Z7FE 2RA3A 1TNGA 2FX4A 1P05A 2BTCE 2XC4A 2V35A 1SLUB 1VCQA 1N6XA 1HGTH 2CXVA 2SGDE 4UFDH 1Y59T 1YGCH 1SMFE 2AIQA 1WCZA 3B9FH 4WWYA 4MLFB 4I8LA 4WH6A 3MO6A 3ZVDA 1O3KA 3BTQE 4H4FA 4MNYA 1ELGA 1XM1A 2O8LA 3ZZ9A 1BTWA 2STBE 3K6ZA 4O3UA 2AEIH 4MTBA 2VIDA 2XW9A 1O3OA 4A5TS 4CHAB 1O39A 2ZF0H 1MTNC 4K69A 4DOQA 1LKBA 1O2YA 1CGJE 1ID5H 3NXPA 3SGAE 4X6OA 1HAYB 1HCGA 1GMCF 3VXFH 4CHAC 1TX7A 2ZO3H 3RXEA 4KKDA 2J4IA 1KSNA 1V2ST 1S5SA 1VCWA 5FBIA 1OSSA 2IOTA 1G37A 1YBWA 2A5IA 3V13A 2B8OH 3DFJA 5F8ZA 3UUZA 2XTTB 1SGQE 1EAIA 3BN9A 5C5NA 4LZ1H 2ZQ1A 1ACBE 1LHDH 3S9AA 3SU0A 2PSXA 3SU2A 2G00A 2ZQ2A 1PPFE 2J9NA 3C1KA 3UOPA 2VWMA 3V12A 3TK9A 4MNWA 1ANDA 4OS6A 2OLGA 2CV3A 2G5VA 1BTYA 1C4U2 2YOLA 2VWLA 4O9VA 1NRRH 1UTQA 1S0RA 4XE4A 1GHAG 2TBSA 4CRGA 3RM2H 1DM4B 1BRAA 2GCHG 4UONA 4CH8B 1CSOE 3KQDA 1DSUA 2O9QA 1RTFB 1J16A 1T4VH 1PPBH 3UTUH 2YNBA 5PTPA 4CBNA 2Z94A 1NY22 3EQ0H 4A1VA 3SGQE 2PGBB 1HAZB 3T26A 4U01A 1HFDA 1J17T 1S0QA 3MU5A 4GSOA 2QA9E 2VGCC 1NRNH 1TALA 2ZCLP 2QC2A 1EZUC 1FY1A 1VGCC 1YCPK 1JBUH 3JZ2B 3QTOH 1DXPA 2BOHB 1VZQH 3S69A 3S0NA 1K1LA 3VXEH 3GY2A 1FN8A 2VINA 2C8XB 5DP8A 2A2XH 2VWOA 3IWMA 2P3FH 1O2XA 1P11E 2ZFQH 5E2PA 1DY8A 1CT4E 5I46H 2FO9A 1C5PA 4NZQA 3BEIB 1O31A 3W94A 1A0HB 4AZ2B 4CRDA 4H42U 2ZFSA 1ZHPA 1ZHMA 4ISOA 8GCHG 4QT8C 2CF9H 1D3PB 2BY7X 1VCPA 5CHAC 3T27A 2TGDA 2W7UA 1GL0E 2OC8A 1HAVB 1O2KA 1MTWA 2RG3A 5FHTA 2ZTZA 1SOZA 1Y3YA 1FXYA 3SU5A 1WSSH 1MKWH 3LH3A 1ESAA 2UUJB 2QF3A 1UK4A 1EZQA 3DA9B 3AAVA 1GBCA 5DGJA 3TH2H 1UTJA 1BTXA 4I8HA 2Y5FA 3AAUA 1QFKH 1P03A 5E0GA 2J2UA 4K8YA 1FNIA 3T25A 2DE8A 3LDXH 1C5YB 1UTLM 2ZECA 2R0KA